2JK8A

Type iv secretion system effector protein bepa complexed with a pyrophosphate moiety
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
291
structure length
291
Chain Sequence
EIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCSHDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMPEMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHPFREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDISNPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYIIGNIDHLPPEQLKILKPGDKITFTAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fic Domain Catalyzed Adenylylation: Insight Provided by the Structural Analysis of the Type Iv Secretion System Effector Bepa.
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Cell adhesion
molecule keywords PUTATIVE CELL FILAMENTATION PROTEIN (BEPA PROTEIN)
total genus 90
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 2jk8A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2jk8A02
1LTLA 1V9PA 5C44G 3EIVA 4JG2A 3I4NH 1YI2A 1SROA 3HOXG 1PH9A 2UUBL 1KAWA 1YNXA 2C35B 2UU9Q 2R93H 3UDIA 1K83H 2R7ZG 5IP7G 4AQYL 3PCOB 2F52A 1JMCA 4LF9L 4LFBL 3HOXH 4IFDJ 5GAGC 1TWAH 2NVYH 2YTYA 2YV5A 5IYBH 2K5HA 2G03A 5FLMG 1E24A 2VZAA 5IP7H 4YY3L 1Q7YC 1CKMA 2PQAA 1UEBA 1QVGA 3CC4A 4LF8Q 5IYDH 3RN2A 2NZHA 3WWVA 1E22A 3T1HL 1Y1WG 1XMOL 4GNXB 4A3MH 1PH5A 4GN5A 5JFZA 3CCVA 2E5LQ 5IYBG 3HKSA 1N33L 4IOCA 3CUCA 1OXSC 4C3HH 4X2EA 4JOIA 5IT9c 2YU9H 3FKIG 1WFQA 4J15A 4B3ML 2VL6A 4GLVB 1SMXA 3CCEA 3J7A5 1SLJA 4GNXC 1B8AA 1YJ9A 4A93G 3CC2A 3DLLA 1S72A 3I55A 2IT1A 3M7NA 3KOJA 2HIXA 1KHIA 4IPHA 2VNUD 1PH1A 2IY5B 3J81i 2MO0A 3M4PA 4DV5Q 1VS0A 2IHEA 4AH6A 3S1RH 2D0PA 4UPAA 4A3KH 5DLQE 4N67A 4KHPL 2UUCQ 4XTCS 2VUMG 2VQFQ 2RF4A 5C0XJ 4B3TL 3J81j 4ALPA 2PI2E 3K7AH 3UDXA 4LF4Q 1V1QA 2LXKA 3SN9A 4TVAB 2JK8A 2NN6I 4DR7L 1E7ZA 4A3KG 5C3EG 4NXNL 2UUBQ 1VQ6A 2UU9L 1XJVA 2YYZA 3S1MH 2WAQG 4X62L 1IZ6A 2OWOA 4A3GG 2UUCL 1G6PA 4B3TQ 2R7FA 5EAYA 2NVXH 5IYCH 5LMNQ 1CKNA 4LF4L 4POGA 2H5XA 3PGZA 4R4CA 1QZGA 2ATWA 5AJ3L 4JYAQ 3HOVH 4A3GH 1PYSB 1XPOA 1MJCA 1S3OA 4PZ6A 1L1OB 2OTLA 2K50A 1YITA 1FJGL 1WCMH 2VS1A 2LXJA 1K3RA 1B70B 5IY0A 4YCWA 2E5LL 1P8LA 2Y0SG 4HIDA 3CF5A 4LFAL 3HOVG 1TWCH 2XGTA 4X2CA 2CCZA 2OTJA 4A3FG 4UP9A 3ER0A 3A74A 1RL2A 2ALYB 3HOUH 4JOIC 1YJWA 4JV5L 3U58A 4R4QA 2WB1G 3HOYG 1K9MC 4XI8A 1JJCB 4POFA 1O7IA 5GAHC 4DV1L 2Q2UA 2E2IH 4DR3Q 3H3VH 1CSPA 2K75A 5CKLA 3ZCBA 4DV4L 3I4MG 1MKHA 1QUQB 1OTCA 3OW2A 3S2DH 2JA8H 5M3MG 1X56A 1VQHA 2UXCQ 3G71A 3S24A 1W2BA 1K8AC 3AYHB 3OYYA 1CUKA 2RHQB 4JV5Q 1K73C 1LYLA 1W3SA 3KFUA 4B3RQ 3D0FA 4UY8C 1U5KA 4DV1Q 1IXRA 2F6SA 3RR5A 4JI5Q 1ASYA 1N9WA 1IBLL 4DV4Q 1C9OA 4ITRA 1T9HA 1VQCA 1LUZA 4DKAC 4X64Q 3CMAA 1Q82C 1HNXQ 3PV0A 4JCVE 2HHHQ 4LF5Q 5CMTA 5C4JH 2CKZB 1SN8A 4L5TA 4NXMQ 3LETA 4GNXA 4X2DA 5LMNL 3S14H 1LM0A 4A3IH 4LF7Q 4DUYL 1PH6A 4X65Q 2E8GA 3J80i 1XNQL 2A19A 2UXDL 5E7NA 2K5NA 3RLNA 1E1TA 1UE1A 4KHZA 1KL9A 5FJ8H 1WOCA 3EBEA 4QIWE 5IYCG 3PIOA 1CKOA 4DNIA 3FHWA 1PH8A 1NY4A 1HNXL 1HNZQ 2HHHL 1JB7A 4LF5L 4OX9Q 3HOWG 3ICEA 4A3DH 3BU2A 3GO5A 1WYDA 4MTNA 1TXYA 1NBWA 3Q8DA 2B3GA 4LFAQ 4EQ5A 1KQSA 2ASBA 1Q12A 5FJ8G 3M85A 2ZM6Q 3GTOH 1N32L 4U0UA 2I5HA 3G48A 2JQOA 2WAQE 2XTIA 4DV6Q 4GOPC 1K8GA 4LF7L 4BA2I 1C7YA 3HFZB 1N8RC 1HR0Q 2UXDQ 4Y52H 2V1CC 3GTMH 4YWMA 3VDYA 4K0KL 4A3JG 3GTPH 1VQOA 2ZTEA 1KC8C 2JA6G 3H0GH 1A63A 5K36G 4PZ7A 3GTLH 3S17H 4GS3A 2RHSB 4WJ4A 1L2FA 3S2HH 2N78A 4MNOA 1XPUA 3PUZA 2Q2IA 3KDFB 2EQSA 2A1AA 3ULLA 2D0OA 2JA6H 2Y0SE 2JA8G 5M3MH 2R93G 5IP9H 3GD7A 5LMUL 1VQAA 1PFSA 3AQQA 2AWNA 5HY6A 2OQ0A 2NVTH 3PO3G 1R9TH 2GVBA 1IBLQ 3ULPA 3J80c 1SE8A 4DR5Q 2JJQA 4GOPB 1CKNB 1G51A 3I4NG 1HNWQ 4A75A 1PV4A 1VQBA 3F2BA 3TS0A 2JA5G 4U0ZA 1X65A 4LF8L 2BA1A 3PIPA 4DR1L 1VQ5A 2F4VL 2GN5A 1XMOQ 4B3SL 2D62A 3FP9A 3UDFA 1QVCA 3PSIA 4YHHQ 1EQQA 1N33Q 4DUZL 5IWAQ 3ZJYC 1BBWA 1KRSA 2JEBI 1EIFA 4C3IH 3STBD 5GAEC 1YHQA 1M1KC 4A3BG 4HIOA 2DGYA 4RMFA 1VQ8A 4JC0A 3DM3A 4X66Q 2E2JH 4B3MQ 4IOAA 4UP7A 4X6AH 4LF6Q 4P75A 3JAMi 1XNRQ 2OQKA 4IFDI 5C4XG 2BA0A 5ELNA 4A3BH 2GVAA 2LSSA 4DV6L 4BY1G 2B63H 4A3DG 2I5MX 3KF8B 4A3LH 4YHHL 1Y1VH 1EWIA 4A3EG 4DUZQ 3CMEA 2I0QA 2BH2A 4IFDG 2DUDA 4DV3L 1N36L 4DR6L 2A8VA 1IBML 4M16A 2AKWB 4A3LG 1GD7A 3IRBA 4A76A 4GKKL 1GVPA 1N34Q 2ES2A 4GOPA 4L5QA 1J5EQ 5HGQA 2JE6I 1Q81C 3H0GG 5M5YH 2VW9A 3BJUA 1OXVA 1NE3A 2QA4A 5LMUQ 4QQBX 2RCNA 2PMZE 4BBRG 3UDGA 4GLAC 4P72A 3PF5A 4BBSH 4DR6Q 3N3UA 1CSQA 1GO3E 4NPSA 3BZCA 4FDBA 5JFFA 5H1SE 3S16H 4DR4L 1I94L 1TWGH 4GKKQ 3PO3H 2JA7H 1VQ7A 5AJ3Q 1HZAA 1N34L 1M90C 1QUQA 2IX1A 4DR1Q 4GLXA 2F3IA 4NB3A 4IPGA 1AE3A 4OXPA 5GQOA 1VQEA 2KCMA 2QEXA 1Z47A 4AQYQ 5J3BA 3GTQH 4A3CH 2EXDA 4BY7H 5FLMH 4DR4Q 2QGQA 5IYDG 2VQEQ 3W5OA 2AWOA 4YWKA 1HZBA 1HZ9A 2B29A 3K0XA 1VQIA 4A3MG 1VQPA 1WCMG 1XPRA 4JBWA 2ZJPA 1Y14B 3G4SA 3PUVA 3T1HQ 4P73A 1PA6A 3K81C 2EIFA 2HQLA 3CCRA 4QL5A 1VQLA 4U07A 4U04A 4GN4B 2ID0A 1BKBA 3TQYA 4A4IA 5FLXc 1VQDA 1EFWA 4DV3Q 4YCVA 4YCUA 1N36Q 2MQHA 1VQMA 4BY1H 2UXCL 5IE8A 4GKJQ 3KDFA 2UUAL 1EIYB 3I4OA 1Y1VG 3KF6A 5GROA 3A5ZB 1G291 1J5EL 5JEAG 3AFQA 1EYGA 1X55A 3K7UC 1PH3A 4JI5L 5JJLA 3TEHB 1H95A 3NBHB 1A0IA 2YTXA 4OWXB 4HJ9A 4JBMA 4AYBE 4NXML 2UUAQ 4DV5L 4JBJA 2BH8A 1I94Q 4JI1Q 1YHBA 4OONA 4BXXG 2YTVA 4RG1A 4DUYQ 3BZKA 3M9BA 2JEAI 4DR7Q 3AEVA 1XNQQ 2N49A 4BBSG 1B7YB 4IO9A 1VQ9A 1KXLA 4AIMA 1XTDA 5M5XH 1NJIC 3L2PA 4DV7Q 1D7QA 1UWVA 3SHGA 3PUWA 4X62Q 1VQKA 4OX9L 1U0LA 1YZ6A 2KBNA 4NXNQ 1OXXK 5BR8L 1Q46A 5C44H 1NMFA 4XIGS 3U50C 4JI4L 1VQNA 4R4IA 4JI1L 4A3CG 4WJ3M 3M4OH 1HJPA 1TWHH 3HOZG 3HKZE 1AE2A 3HOWH 1BVSA 1FJGQ 1ASZA 4P74A 3CCSA 1WI5A 1P16A 1L1OC 5M3FH 3A5UA 4JYAL 4LUVA 3E0EA 4L5SA 3CP0A 1YIJA 2K14A 3NENA 3CQZH 4GN3B 3CC7A 1Q8KA 5JEAJ 4DAMA 1QZHA 3TS2A 1SRUA 1YEZA 1PH4A 3UE1A 1Y1WH 3GTGH 4OO1G 2KHJA 3CW2C 2R6GA 3KLWA 2AMCB 4HJAA 2JA9A 2Z0SA 1JJGA 1WJJA 4QY7A 1X3EA 3ULJA 2CWPA 3H15A 3S6AA 3FKIH 4H02A 5ELOA 4YY3Q 4O0AA 4DR5L 4DR2Q 1PHJA 5JJKA 1C0AA 4KLKA 1FVIA 3ZC7A 3M4QA 3HOUG 4OO1I 4DR3L 3RN5A 3ERSX 3KYHC 3HOYH 4JI3Q 3PUYA 4IJLA 3L7ZC 1K0RA 3MXNB 5JJIA 2MFIA 2KHIA 2K4KA 1EQRA 1OXTA 2IX0A 3ZLMA 4JI8Q 4LFCL 4DPGA 5M5WH 3E9IA 3I4MH 5IWAL 3KJOA 1Q1EA 1VQJA 1V43A 1YJNA 3S1QH 1A8VA 4DV7L 4DR2L 1SR3A 2I5LX 2N8NA 4X66L 2ZTDA 1X54A 3L0OA 2NN6G 2K5VA 4EX5A 4JI0Q 3TRZA 4A3IG 4LF6L 1XNRL 3PO2G 5C3EH 4LNQA 4JI4Q 1JT8A 2ZTCA 4R4OA 3RNUA 3D31A 4PMWA 3I2ZA 3I7FA 4LFCQ 2KENA 2CQOA 4KI0A 4AYBG 3CXCA 3PO2H 4R4TA 4U0SA 1GM5A 2NVQH 1AH9A 1TWFH 4X65L 3K80C 1EOVA 3RLFA 1FL0A 3HOZH 2AHOB 3B6YA 5C0XI 1FGUA 3GTKH 1UE7A 1MJEA 2ZM6L 4JI2Q 3AFPA 3CCUA 4IJHA 5M3FG 1HNZL 1D8LA 1S40A 3S15H 4A3EH 1JE5A 1HH2P 4LWCA 2WP8J 1IL2A 2MNAA 4YWLA 2Z6KA 4OWWB 3LGJA 3H3VI 2HIVA 3A0JA 1MIUA 2CFMA 1VQFA 1Z9FA 2K52A 4PZ8A 1PH7A 4K0KQ 1E3PA 4JI7Q 3W1GA 5C0XG 3TREA 4A3FH 4DV0Q 4Y7NH 1HR0L 3EN2A 3I56A 4PY3A 2IHFA 3NEMA 4MZ9A 5IP9G 1PYBA 1SFOH 1KRTA 3CAMA 2Q2TA 4JI3L 2R7DA 2FXQA 1IYJB 4HIMA 1A62A 3K8AA 1UE6A 4P71A 4JI8L 4BBRH 4A3JH 4DV2Q 1PH2A 4JI6Q 3CCLA 4C3JH 2VY3A 5GADC 1I6HH 3CCJA 4JI7L 1YVCA 3CCMA 1XMQQ 3S1NH 3F2DA 1QVFA 1HNWL 3U4VA 4LUOA 2VQEL 3F1ZA 4JI0L 3STBC 3CPWA 1NMGA 1HR0W 3RZOH 2WB1E 1J6QA 3KJPA 3F8TA 1VQGA 4PG3A 1Q86C 3RZDH 1X3GA 3CCQA 2UXBQ 1X6OA 2F4VQ 2HT1A 4LUZA 1OXUA 1EUJA 4BY7G 3J81c 2Q2HA 4DV2L 4HIKA 4JI6L 1UE5A 4IPDA 4O2DA 1I3QH 4BA1I 1L0WA 2KCTA 4TQUS 3M3YH 3OTOQ 3T1YQ 4GKJL 3UE0A 4B3SQ 3G6EA 2JA5H 4B3RL 5CGLA 2B63G 1PVOA 1YHAA 4JBKA 1I50H 4JI2L 3RLOA 4LFBQ 4DK3C 1X9NA 4L5RC 1IBKL 3PUXA 2MO1A 4X64L 2UXBL 1KD1C 4HJ7A 1VQ4A 2WFWA 1RIPA 1Q1BA 2ZJRA 2NZOA 3F2CA 2ZJQA 2N3SA 1HZCA 2L15A 3GTJH 3OTOL 3T1YL 1GKHA 1BBUA 4DV0L 4UP8A 5C4XH 3JC66 1IBMQ 1I5FA 3NELA 4IPCA 1E1OA 1KIXA 5JJ7A 2R92G 3MEFA 4A93H 1YBYA 4HJ8A 1L1OA 1X3FA 2E2HH 4C2MH 4R1JA 3CPFA 1IBKQ 2PQAB 3GDEA 3SGIA 2PI2A 4LU4A 4LW1A 3CD6A 4DK6C 4HJ5A 3E9HA 1JJ2A 2R92H 3JAMc 4QJFA 3U4ZA 1N32Q 3SE5A 4OWTB 1NTGA 2VUMH 5LMNW 5BR8Q 1XMQL 2JA7G 3J7ZC 4BXXH 3KF6B 5JJ6A 2PNHA 3HKZG 1DGSA 4WGJA 4KHPQ 2OCEA 4LF9Q 4ME3A 2CWAA 4QGUA 2VQFL 3PF4A 3W1BA 5EU0A 1VCIA 4DAYB 2Z6KC 4APVA 2R7ZH
chains in the Genus database with same CATH superfamily
3I4NH 5C44G 1R4QB 4JG2A 1KAWA 2EYOA 4HCSA 3C3LA 2R93H 1K83H 5EPKA 1JMCA 3HOXH 4IFDJ 5GAGC 1SYEA 5D3IB 2NYZD 2K5HA 3TMEA 1E24A 1UEBA 5IYDH 1E22A 1Y1WG 4A3MH 1I4RA 5I4DA 3CCVA 2R7ZB 2Z8LA 3CUCA 2NTTA 1OXSC 5BN5A 4C3HH 5K5PA 4JOIA 4DK0A 3FKIG 1WFQA 4J15A 3CCEA 1SMXA 3HOYB 3J7A5 4GNXC 1JORA 4A93G 4S3SA 3I4MB 3ONAB 3K6OA 1KHIA 2MO0A 1LTRD 4HTHA 4IUNA 4UPAA 2UUCQ 4XTCS 2F0OA 5C0XJ 3A56A 3J81j 2PI2E 3SN9A 5I2XA 4DR7L 2DNCA 4NP5A 4DXFA 4A3KG 3P1HA 1NR2A 4NXNL 1EZ6A 1VQ6A 2Z9HA 1Y8NB 3S1MH 1C4QA 3S1QB 4ULLA 5FKAC 1YNNC 3AU7A 2XNAC 4UDUC 2DY8A 1ESFA 5LMNQ 1XX8A 2H5XA 3PGZA 4R4CA 4KD3A 4JYAQ 2KCNA 2OTLA 1MJCA 2K50A 1WCMH 5DAUA 3CQZB 2WIIB 1B4OA 1P8LA 2E2DC 4X3TA 4QCLA 3NBHA 4B08A 1CHPD 1KTKA 1T5XD 3A7LA 4XQJA 1EZ8A 2ALYB 3S15B 2RDGA 2WB1G 4A3JB 4QUCA 5GAHC 4DR3Q 5CV7A 5CKLA 2GA4B 3I4MG 1OTCA 3QO2A 1K8MA 3A8IE 2K32A 3OW7A 1W2BA 1K8AC 3MWYW 2A6EC 1ML0D 3KFUA 4OL7A 2PZTA 3D0FA 1IXRA 2F6SA 1C9OA 3C1EA 4F87A 3M4OB 4LF5Q 4KY7A 3PV0A 5JOBA 1J9OA 2NTSA 2KHSA 2XIWA 4NXMQ 3KBGA 3WOEA 5KIXA 1HCZA 1LM0A 4ZUIA 4DUYL 1PH6A 4X65Q 1BCPB 4RGNA 3V96A 2K5NA 1E1TA 1UE1A 1STEA 1WOCA 5IYCG 4DNIA 1HNXL 3ICEA 1TXYA 1NBWA 1Q12A 5FJ8G 4K2LA 3G48A 1HXYD 1IL8A 1CQFA 2I5HA 2WAQE 4DV6Q 1C48A 1LABA 5DM63 2X6LA 3NHHA 2A73B 2KECA 5CGKA 4K0KL 2F0QA 1EU3A 3GTPH 2FMMA 1VQOA 4UAIA 1KC8C 3H0GB 3K59A 2RHSB 2BOSA 3S2HH 5IGFA 2IPKD 3NE5B 3PUZA 1XPUA 3D4RA 2A1AA 3ULLA 4BBRB 2Y0SE 2JA8G 4DFAA 1VQAA 4L63B 2NUDA 5ELDA 3MXUA 2OQ0A 3PQIA 1WTOA 2OEOA 2NVTH 1R9TH 4FXGC 3OMGA 1B9NA 3Q24A 3NTHA 1SE8A 4GOPB 2EYFA 1CKNB 3QB3A 1HA6A 3I91A 4PQXA 3F2BA 2JA5G 3T4AC 1X65A 2Q8RE 3PIPA 4DR1L 2F4VL 1MI2A 2D62A 3UDFA 3PSIA 3QJYA 1EQQA 4DUZL 2JEBI 1BCPC 4C3IH 1EIFA 3M3YB 4KY6A 3H09A 1XNRQ 1JB3A 3GV6A 1CZGA 3I4LA 3J81L 5C4XG 4IALA 5ELNA 4GZYC 2LY7A 2A5HA 4YHHL 1Y1VH 2BH2A 2OXPA 2IJ0A 1PLFA 1TS5A 1E2WA 2A8VA 1IBML 4M16A 2EY1A 3IRBA 3A7AB 4GKKL 3EROA 1STAA 4GOPA 4K6DA 5HGQA 1KNAA 1Q81C 4G4KA 5FOBB 4HAEA 3BJUA 1NE3A 3QWNA 5LMUQ 2XWJB 4XDXA 3UDGA 1ESRA 4GLAC 4BBSH 1CSQA 1GO3E 3BZCA 1QNKA 3ERQA 1I94L 1TWGH 5FO7B 2JA7H 1HZAA 1QUQA 2IX1A 1O7LA 3KLSA 2NVXB 1AE3A 4OXPA 4AQYQ 4BY7H 4RFBA 3FMCA 5FLMH 3JAME 5IYDG 3IKJA 3W5OA 1GUGA 1HZ9A 2EJFC 4Q0FA 1XPRA 4JBWA 1GUOA 4J8QA 4P73A 3K81C 4K5XA 2EIFA 2E2HB 4U04A 4GN4B 2ID0A 1MSGA 4K14A 4YCUA 2ZXOA 4DNRB 2H4OA 3I4OA 1Y1VG 2EY5A 1EQTA 3Q22A 4FF3A 1G291 1EYGA 2NWGA 4BBSB 5JJLA 2RCFA 4JI5L 1LTGD 4EQOA 4A93B 3FRPB 1NCVA 4HJ9A 4AYBE 3SK4A 4JBJA 2BH8A 4K2KA 4OONA 4CHTB 3X3NA 1GXDC 4DUYQ 3AEVA 2B2UA 2N49A 4KD4A 1FD7D 3P75A 2WAQB 4ZQ3A 4KN7C 1H9RA 5M5XH 3SHGA 2JP1A 2E74C 3NTIA 1HTLD 3U50C 1YNJC 4R4IA 4JI1L 1BF4A 4WJ3M 1AE2A 1FJGQ 1WI5A 1P16A 2H1EA 4NW2A 1Q90A 3NENA 3TS2A 4ME5A 1SRUA 1PH4A 2PMZB 1WVLA 2WB1B 2FJ2A 5D65A 3W3AA 4EGVA 4HJAA 1X3EA 2EPBA 2XRSD 3SHLA 3ULJA 3H15A 3A8JE 3FKIH 3K58A 3HS0C 3SXHA 4WFN3 1ET6A 2O4XA 2Z1CA 1QE6A 3J7AV 3KYHC 3NWSA 4IJLA 3PO2B 1PXUA 1K0RA 2MFIA 4JI8Q 1EQRA 2IX0A 3BYYB 4FO2A 5M5WH 3IFDA 2F0UA 1Q1EA 1V43A 4DV7L 1I3QB 1SR3A 2I5LX 2N8NA 1TS4A 3QG1A 3L0OA 3TRZA 4KY5A 2AUKA 4F7XA 3D4WA 2E2IB 1B3AA 1JT8A 1F9RA 2ZTCA 3D31A 4PMWA 4H0LC 2KENA 4XQQA 5M9OA 4U0SA 1SYBA 2NVQH 1WTHA 3VYRA 3GTJB 1QWYA 1QB5D 2VXWA 5CC4A 1FGUA 2NZ1D 1JC7A 2ENBA 1HNZL 1BNZA 1QNUA 1A15A 1HH2P 3ITPA 4YWLA 3A55A 2WINB 2XN9C 1MIUA 2RBMA 1SMYD 1SE3A 3W1GA 1HR0L 3X3MA 4RCNA 2IHFA 4O42A 5IP9G 1UNSA 2J7ZA 3CAMA 2Q2TA 1E2VA 5HURA 3K5OA 4G57A 4BBRH 1UE6A 3E5SA 1STHA 3EQLC 4C3JH 3R8BA 4H13C 3CCMA 1I6HB 4L6TB 4X3KA 3F1ZA 3STBC 3CU7A 1VQGA 5EBDA 3RZDH 1X6OA 4LUZA 1O80A 2VB2X 4O2DA 1I3QH 2K05A 1I6VC 1XTCD 3I3CA 4TQUS 3M3YH 3MVVA 4GKJL 5LL6X 4HMJA 1WTXA 2K5DA 5CGLA 1PVOA 4CGYB 4KKUA 4JI2L 3RLOA 4X64L 1KD1C 1Q1BA 3W2DA 3F2CA 4RGOS 3RZOB 2PPBC 3MXPA 4H7BA 1EU4A 2L15A 3GTJH 1V1OA 4U68A 4DV0L 5C4XH 4A3DB 1KIXA 2G9DA 2I46A 2F0IA 5JJ7A 4TRDA 3SK5A 3HKZB 4K5VA 3D8GA 1X3FA 3OHXC 5J22A 1IBKQ 2PI2A 4LU4A 3CD6A 1A3TA 2A6HC 1DYQA 3E9HA 5E1FA 1JJ2A 2R92H 1DOMA 3SE5A 4YIJA 2VUMH 5BR8Q 2JA7G 3J7ZC 5DM73 5EKIA 4BXXH 5JJ6A 1VMPA 3SVMA 1DGSA 2OCEA 4ME3A 3MXGA 2VQFL 3OMCA 1VCIA 1PTOH 3BVZA 4X3SA 3G6JB 4C1NK 3EIVA 3BDLA 1YI2A 3A54A 4RHRA 3HOXG 1PH9A 5CV6A 1NUCA 2C35B 2K7VA 2UU9Q 2R7ZG 5IP7G 1D5XC 3PCOB 2R93B 4LFBL 1LTTD 1XWEA 4HEDA 1TWAH 2NVYH 2YV5A 5C4ZA 2VZAA 3TN2A 5IP7H 4YY3L 2CQAA 1Q7YC 2PQAA 2NZHA 5DEHA 3NQIA 3T1HL 2E75C 1FGBD 1KLUD 4GNXB 1LV9A 2E5LQ 4IOCA 1ZYRC 2FINB 1JOKA 4RAUC 2K1BA 5IT9c 4QUFA 1F9PA 1SNCA 2NUCA 4B3ML 2VUMB 1SLJA 1B8AA 1CTMA 3DLLA 4B9WA 4C3HG 3I55A 2IT1A 3M7NA 5HGTA 3KOJA 2HIXA 4IPHA 1PFNA 2QDLA 1PDQA 4DV5Q 2IHEA 4AH6A 4ILWA 1R4PB 2D0PA 4N67A 2RF4A 1KDBA 4I7AA 3UDXA 4LF4Q 1MBYA 2N55A 1K28A 4C3HB 1LTBD 2M00A 2UUBQ 3S16B 2YYZA 4CDDC 4X62L 2F0PA 1IZ6A 3T13A 1V1PB 5CV5A 1IHZA 4LF4L 1B9MA 1CKNA 2A74C 2PQEA 1S3OA 1TU2B 1F2ZA 1EYAA 1AN8A 1B70B 2LXJA 5IY0A 1S5CD 4HIDA 3CF5A 3PIP3 4LFAL 3HOVG 1U4MA 3K5LA 4FF1A 2JSOA 3VR5A 1XYIA 5CBAE 3A74A 3HOUH 1YJWA 4R4QA 2HUGA 3T16A 3QIAA 4POFA 1O7IA 4DV1L 1TQOA 1I4QA 1O7ZA 2K75A 2Y0SB 4DV4L 1MKHA 1PMRA 5FK9C 2JA8H 3GTMB 3SEBA 2UXCQ 5FO9B 3G71A 4QMGA 5KYLA 2A6ED 2RHQB 4WORA 1LYLA 2I07B 2K33A 1U5KA 4DV1Q 3BG3A 1IBLL 4DV4Q 4DKAC 4Q5VA 1HNXQ 4X64Q 4N8X1 5CMTA 5C4JH 1A6XA 1DM0B 2A69C 4L5TA 2HDMA 2NN6H 4GNXA 4X2DA 5LMNL 1JE4A 2B2VC 3A8KE 4LF7Q 2E8GA 3M7GA 4KHZA 3PIOA 3EBEA 2HHHL 3HOWG 4X3UA 3BU2A 4DNTB 2ASBA 3SK6A 2ZM6Q 3HGBA 2F0SA 4GOPC 2JQOA 4LF7L 1C7YA 3HFZB 4IUQA 5IGCA 4Y52H 2V1CC 3GTMH 4ODGA 4V0BA 4A3JG 1PRTC 5L37A 2C5CA 1PYWD 2L5TA 3GTLH 2B8GA 4WJ4A 2LS01 1L2FA 1W6KA 4IUPA 2Q8IB 2JA6H 1QCBD 5M3MH 2GVBA 1ONLA 2JJQA 4O1NA 1HNWQ 4OHJA 1VQBA 1OO9B 2F0MA 1CQVA 2ZT9C 3FP9A 4CJ0B 4YHHQ 1UUPA 3ZJYC 1BBWA 1YHQA 4N8FA 1M1KC 3MAQA 2F03A 3BDOA 3I4NB 4A3BG 4IOAA 3RMHA 4J6HA 4P75A 1MD2D 5EKLA 2B2VA 5G3LD 4A3DG 4BY1G 5JVH3 3BVMA 2I5MX 1NH1A 4A3LH 1GOZA 4IFDG 4A3EG 3CMEA 3GTKB 1Y1VB 4DV3L 1N36L 1VDZA 5BN3A 4OGQC 1STGA 5ELFA 1YNJD 4CKCA 1GD7A 2WACA 4A76A 2R92B 4C2MB 3EA6A 1GUWA 1J5EQ 2JE6I 5M5YH 1K83B 3Q6SA 2VW9A 1OXVA 2RCNA 4BBRG 1E0BA 3PF5A 2K04A 1F77A 4FDBA 4NPSA 1W6JA 1TIID 1WTRA 1VQ7A 2SDFA 2KOLA 2F3IA 3GTQH 4A3CH 3L9AX 1V8QA 5NUCA 2EXDA 2F0KA 4IUVA 2VQEQ 3HRZC 2AWOA 1D1IA 2IWHA 3K0XA 3NUCA 4HSVA 2WKCA 2EZVA 1Y1WB 1ICWA 3PUVA 1TWGB 1PA6A 3CCRA 1PZKD 3TQYA 4BY1B 5FLXc 1LACA 4YCVA 4WRDA 2MQHA 4KJNA 1KDCA 2UXCL 3NK9A 3KF6A 1TY0A 3AFQA 3K7UC 1PH3A 1U9RA 3TEHB 3TSSA 3EVQA 2YTXA 5E4WC 4NXML 1D6EC 2KQ3A 4JI1Q 4BXXG 2YTVA 3OOCA 5C3EB 3BZKA 3M9BA 2JEAI 4DR7Q 3GP7A 5T1GA 2K01A 5J1ZA 4IO9A 1VQ9A 1KXLA 2JN4A 1XTDA 2ICEC 5IT9E 1DD2A 3IFTA 1RF2D 1HA5A 1YZ6A 4DAVA 1Q46A 5C44H 4XIGS 2QW7A 2F0HA 4QIWB 3M4OH 3HKZE 5IGEA 2SNMA 1BVSA 2L0CA 4M1UB 3CCSA 5M3FH 3A5UA 4JYAL 2KEEA 3CP0A 2F0EA 4GN3B 3CC7A 5M5XB 1QZHA 1YEZA 5IGDA 4CJ1B 1Y1WH 3KBXA 2R6GA 1EFID 4U673 2Z0SA 1JJGA 1WJJA 3J81E 2CWPA 2A69D 4A3KB 1HUMA 4KMUC 3ZC7A 3HOUG 4OO1I 3NWTA 1UEAB 3ERSX 4PV1C 3HOYH 2B2WC 4JI3Q 1FNUA 3L7ZC 3ND8A 2RDFA 5IIFA 3MXNB 5JJIA 2QCPX 4B9XA 3I4MH 4LFCL 3IL8A 4ZLTF 5M5WB 5COYA 2NUNA 4RGMA 3K57A 1X54A 5FLXE 2NN6G 4A3IG 1XNRL 3NP8A 5C3EH 4LNQA 1WTVA 3RNUA 1R9TB 1EOTA 2XRQD 3I7FA 4LFCQ 1TT2A 5KRUA 3GTPB 4AYBG 3CXCA 3PO2H 4R4TA 4XXEA 1AH9A 1TWCB 1HFNA 2R61A 1EOVA 3D6WA 1FL0A 4R9WA 2F0VA 1MJEA 2RSOA 1S40A 4A3EH 1JE5A 1GUTA 2F4IA 4LWCA 2WP8J 2NVTB 3H3VI 2Z6KA 2HIVA 2K52A 1VQFA 1Z9FA 3E3XA 1PH7A 1Y69U 4K0KQ 4JI7Q 1SE4A 3MXNA 2LFNA 1G8ZD 3TREA 1TS3A 3EN2A 4PY3A 3R3OA 3CRLC 2R7DA 2FXQA 4JI8L 4A3JH 5TSSA 3PO3B 3CCLA 5ELEA 4JI7L 1YVCA 3SK8A 1XMQQ 3MA2B 3H3VC 3CPWA 2AQ1B 3WDNA 1HR0W 1J6QA 3F8TA 2F4VQ 5A2QE 1H9SB 1OXUA 1EUJA 3CRKC 2Q2HA 1RD9D 2EDGA 2XSCA 1L0WA 5C6AA 2JA5B 5ELCA 4PMBA 3T1YQ 3KUPA 2HCIA 1I4GA 3UE0A 3G6EA 4B3RL 1IYUA 1SNPA 1SYDA 4C3JB 1YHAA 4JBKA 4DK3C 4NDXA 1X9NA 1IBKL 2D9UA 5ISRA 4BY7B 1EWCA 2FHTA 1RIPA 3NTKA 1GHJA 2NZOA 1BXTA 5J39A 2A68C 1HZCA 2N3SA 2VB3X 3T1YL 1GKHA 2QF7A 3NELA 2R92G 2K03A 3MEFA 4HJ8A 5JJZA 1JOQA 2WKDA 4DN4M 4A3EB 1L1OA 2E2HH 4C2MH 2PQAB 1PRTB 4EQNA 3SGIA 4LW1A 2IL8A 4DK6C 4HJ5A 4QJFA 1N32Q 3OIPA 5K36H 4OWTB 4C1NI 1NTGA 5I2YA 3DWQA 3KF6B 4CKEA 2PNHA 4WGJA 3TP6A 1DZ1A 4KHPQ 4WJWA 3PF4A 3MEHA 4CBVA 2Z6KC 3TZUA 1LTLA 1FNWA 3TP7A 3K7AB 1YNXA 1G2SA 4PMCA 3UDIA 1LO5D 2F52A 2RQXA 4RCOA 1DXMA 1LT5D 4IURA 4I7ZC 5IYBH 2G03A 3NXWA 3CC4A 1XMOL 1DOLA 5JFZA 4GN5A 2HDLA 3DMUA 2MP1A 1TR5A 1A2TA 4ZAIA 5F2DA 5KNDA 5EQ0A 2VL6A 4GLVB 2DJFC 5A35A 1PRTF 3S1RB 2VNUD 3NPPA 1PH1A 1IW7C 3H94A 2IY5B 4MHEA 5CV9A 5C4HA 2LMCB 3K0YA 1F9QA 1I4XA 1ICFB 3FKIB 5DLQE 4E6IA 4KJOA 3K7AH 3OPOA 1E7ZA 1SJHD 5CR3A 1J8IA 4K8JA 5DNFA 3LX0A 3D4DA 4FP5D 1XJVA 1VMCA 3HOZB 3R93A 1QJOA 2EYHA 4OELB 1SSOA 1HQMC 2R7FA 1TVXA 5EAYA 2NVXH 5IYCH 1QZGA 5AJ3L 4A3GH 1PYSB 3FVQA 1L1OB 2CH4A 4R8IA 1H9JA 2VS1A 4CDEC 4A3IB 1K3RA 2E5LL 1UAPA 1S4ZA 2XGTA 2OTJA 5EPLA 4A3FG 1RKNA 1RL2A 1S5ED 4JOIC 1VF5C 3U58A 3HOYG 4RKLA 1BBXC 1JJCB 2Q2UA 1TWHB 2DY7A 2E2IH 3VA7A 2EYMA 3S2DH 3S14B 1X56A 4IQZA 2F0WA 5I9OA 2JA8B 3LWUA 2AQ3B 2O5IC 3AYHB 1CUKA 1F2YA 1H9MA 2KEDA 2NBFA 1K73C 4G7OC 1CFMA 1TKWB 1YNND 4B3RQ 4UY8C 5EPJA 4BS9A 3AB9A 3RR5A 1T9HA 1LUZA 2HHHQ 3KLSX 1ZYRD 1ILQA 3HOWB 2L12A 1K0SA 3LETA 5JPMC 3DWAA 2F1MA 4A3IH 3RZDB 3J80i 1XNQL 5FLXL 1A2UA 2A19A 1CA5A 3RLNA 1B3QA 3NQTA 5FJ8H 1KL9A 1PH8A 3MFGA 1NY4A 1ZXTA 1SNMA 1JB7A 4MIUA 4OX9Q 5CMDA 2L11A 4CDCC 3GO5A 1WYDA 4MTNA 3VR4A 2B3GA 4EQ5A 1BCPD 3GTOH 1N32L 5JPNC 2G5DA 1K8GA 2FFKB 1BCPF 1N8RC 4OO1H 1STYA 4YWMA 3VDYA 2HD3A 2B63B 1A63A 4PZ7A 4GS3A 3I70A 1LTSD 4JPBW 1PZJD 4MNOA 3KDFB 2EQSA 2D0OA 2SEBD 2L4NA 3S9WA 3AQQA 2AWNA 3PO3G 3J80c 4DR5Q 3I4NG 4A3BB 1DOKA 3URYA 1PV4A 3P7JA 4CKBA 1AZQA 3C46A 2CH4W 4ZUJA 1SFOB 2GN5A 2RDHA 2EYLA 1XMOQ 4B3SL 3GTLB 1QVCA 5IWAQ 1KRSA 3STBD 4HIOA 1BDOA 2E2JH 3DM3A 4X66Q 4B3MQ 1VF7A 1ENCA 4X6AH 4XQNA 1GUNA 2AUJD 4LF6Q 1FYCA 1ILPA 4IZ8A 2GVAA 4DV6L 1X3QA 2B63H 1X32A 4XYOA 1Z7TA 3FPPA 3KF8B 3V2TA 3UI2A 3TZDA 2DUDA 2ICIA 3K5NA 4DR6L 3J80L 1WD0A 5BN4A 1LT3D 4JVZA 4L5QA 2QDBA 3GQBA 1I4PA 2F3WA 4QQBX 1BOSA 4DR6Q 4P72A 3N3UA 4DR4L 4C3JG 4PNYA 1XXGA 3TP5A 3N6RA 4TSSA 3F2UA 1MGSA 3OSOA 1M90C 4DR1Q 1EIHA 2E2JB 2TMPA 2PO4A 2QEXA 1VQEA 1BR9A 1Z47A 5J3BA 3Q23A 4DR4Q 1SXTA 4YWKA 5IT9L 2B29A 4A3MG 1VQPA 2ZJPA 1Y14B 3G4SA 2X69A 5CV8A 4U07A 2MJ8A 4OEMB 1C8CA 2EY2A 2OT2A 4DV3Q 1N36Q 3CHBD 4BY1H 5IE8A 1GHKA 3KDFA 1S5BD 3I8ZA 1EIYB 5GROA 5CV4A 1PTOC 1QOHA 1U4LA 1H95A 3GV3A 5CORA 3HP3A 1EIGA 4XYQA 3NBHB 2D2CC 1A0IA 2V4DA 5EBCA 1KAAA 4OWXB 4JBMA 2UUAQ 1I94Q 3OWFA 1XNQQ 3C2PA 2A68D 1B7YB 1LT4D 1F2MA 4AIMA 1M8AA 3O13A 3L2PA 4DV7Q 1D7QA 1B50A 4OX9L 2KBNA 4NXNQ 1OXXK 1NMFA 3L3OC 4ID6A 4JI4L 1G91A 2EE1A 3BYTB 2O5JC 3HOZG 4A3GB 5C4JB 1ASZA 2B2WA 1L1OC 2DN8A 4MN3A 4LUVA 4L5SA 2KVMA 5JEAJ 4DAMA 2PZWA 2NVYB 3GTGH 3CW2C 4EVOA 2F0LA 4K5WA 4QY7A 3BDCA 5ELOA 1PHJA 4DR5L 5JJKA 5EGTA 2F3VA 1C0AA 1FVIA 1K3BC 3M4QA 4DR3L 3RN5A 3MTSA 4H44C 2MPMA 3PUYA 4HN7A 2KHIA 2K4KA 2J4XA 3SR1A 3E9IA 2EYJA 3ND9A 1YJNA 1VQJA 1HQRD 1WTWA 3S1QH 1A8VA 1KNEA 4DR2L 1JOOA 1KABA 2ZTDA 4JI0Q 2JA6B 4NMZA 2EJGC 1I50B 1ZKOA 1CM9A 3FPUB 3I2ZA 4A3FB 1T5EA 2RVLA 4XT3B 3LNNA 1GM5A 1CK1A 1JCKB 1TWFH 4X65L 3K80C 3RLFA 2RSNA 5A2QL 1QG7A 4ZCKA 1GUSA 3TP8A 2ZM6L 4JI2Q 4IN3A 2K5WA 4F8MA 3S15H 5M3FG 1EY0A 1D8LA 5M3MB 1IL2A 2MNAA 1Z6HA 4OWWB 2MGSA 4PZ8A 1STBA 1E3PA 3VYSA 5C0XG 4IUTA 3EFXD 4Y7NH 1PRTD 2P5ZX 5KGUA 5C5MA 1KRTA 4JI3L 3HOUB 1IYJB 3K8AA 1PH2A 4RWSC 4BWGB 3BS1A 5GADC 3CCJA 1HHVA 2B8FA 1V1PA 5IGBA 3S1NH 1QVFA 1SDFA 1EQVA 4KTAA 4LUOA 3TDQA 3U4VA 5C3WA 2VQEL 1IKMA 1NMGA 1LTAD 1EL0A 3KJPA 1Q86C 2UXBQ 1PFBA 4C3IG 3J81c 4DV2L 4JI6L 4FF2A 1UE5A 3H91A 4IPDA 3AMUA 3C1FA 1WTPA 1KLGD 3HEJA 3OTOQ 2ZXPA 2JA5H 1Y8PB 2Z6BA 1JICA 1I50H 2F0GA 5M5YB 4FXDA 2UXBL 1LLRD 1ENAA 3QR8A 1VQ4A 2WFWA 1Q3LA 4L8JA 3SDZA 1FNVA 2E76C 1WTQA 3I73A 3OTOL 1IBMQ 1BBUA 5LL6S 4A93H 1TY2A 1YBYA 3P20A 3VYUA 4R1JA 1O78A 4OIJA 5JAVA 3JAMc 2CW0C 2YU9B 3DXJC 4Y7NB 3TBIB 5LMNW 3HOXB 1LT6D 3MHBA 1CI3M 2BCOA 2B2UC 3VA5A 4DAYB 4ZRZA 1SYGA 3DEOA 3U9SA 3VYTA 2R7ZH 1V9PA 1D5MC 4TKOB 1SROA 2PNRC 2UUBL 2IX3A 4FVMA 2RA4A 4AQYL 4HCEA 4LF9L 2R3ZA 2YTYA 5C44B 5FLMG 3KLRA 3DM1A 1QVGA 1CKMA 4IUUA 3I72A 4LF8Q 1HFGA 3RN2A 3WWVA 1KDAA 1PH5A 2F0DA 3QOLA 5IYBG 1EY9A 3HKSA 1N33L 3R2TA 4X2EA 2YU9H 1SMYC 3G7LA 5C5LA 2JXMB 1A3UA 1YJ9A 3CC2A 5KYIA 3VR2A 1S72A 2KUMA 2LKVA 2O2LD 1IYVA 2PYKA 3ZYYX 1S5DD 3J81i 3M4PA 3S1RH 1VS0A 4FYDA 1EEFD 2PW5A 1JWUD 4G7HC 4A3KH 4KHPL 2VUMG 2VQFQ 3DWPA 4B3TL 4ALPA 1WCMB 1V1QA 2LXKA 4I65A 4TVAB 2JK8A 2NN6I 3VR6A 4C56C 5FO8B 1JQYD 2Q8TA 4JK1C 5C3EG 3T51B 1Q8IA 2UU9L 2WAQG 4CDFC 2OWOA 4A3GG 2UUCL 1G6PA 4B3TQ 3KF8A 3N52A 3J7YW 4POGA 2R93G 2ATWA 3GTQB 1SJED 4RA8A 3HOVH 1XPOA 4PZ6A 1YITA 1FJGL 3WOFA 4UHVA 4YCWA 2Y0SG 2K28A 3SE0A 1DJRD 4RGTA 1TWCH 1I4HA 3KK7A 1HUNA 4X2CA 2CCZA 1BUVT 5C0XH 4UP9A 3ER0A 3S17B 5D14A 1WD1A 4JV5L 4NKLA 1K9MC 4XI8A 3H3VH 1CSPA 1F9SA 3CKIB 3ZCBA 3D3RA 1QUQB 3OW2A 3DHQA 1SYFA 2RKSA 1QILA 5M3MG 4DK1A 2B39A 1VQHA 3S24A 3OYYA 2DNEA 4JV5Q 2IW3A 1LTID 1W3SA 4ZYSA 5I6YA 5KNCA 3JAML 1RDPD 4FF4A 4JI5Q 1ASYA 1N9WA 2OF1A 1Q82C 4ITRA 2B2YC 1VQCA 3HZXA 3CMAA 4JCVE 2CKZB 1SN8A 2F0FA 1MSHA 3S14H 3S2DB 2PCFB 4N9TA 2UXDL 5E7NA 4QIWE 4RKBA 2DJGC 1CKOA 1HNZQ 3FHWA 3S2HB 4LF5L 4J1MA 4A3DH 1SNDA 5C4XB 1HPCA 1EY4A 4LFAQ 3E0JA 3Q8DA 2X6GA 1KQSA 2BE5D 3M85A 5ELBA 1DONA 4U0UA 3HOVB 2XTIA 4BA2I 4N9PA 3PMFA 5M3FB 1HR0Q 1EWHA 3MFYA 2UXDQ 2F0TA 5CYUA 1EYDA 1SBBB 2ZTEA 2JA6G 3H0GH 2NVQB 1A3VA 2KJXA 5K36G 3S17H 1B1ZA 2N78A 4DA2A 4FNFA 2Q2IA 3V05A 4F88A 5IP9H 3GD7A 3J80E 5LMUL 1PFSA 3DEPA 5HY6A 1IBLQ 2XVSA 3ULPA 2QKIC 1G51A 2SNSA 4A75A 4G7ZC 3TS0A 4U0ZA 4LF8L 2BA1A 1EY7A 1VQ5A 4DAPA 3J7AF 1TWAB 2L9HA 1HRJA 3LWEA 2B2TC 4C3IB 1N33Q 2SOBA 2BE5C 5GAEC 2B2YA 1CA6A 2DGYA 4RMFA 1VQ8A 4JC0A 4UP7A 1AW7A 3JAMi 2OQKA 4IFDI 2BA0A 3R2IA 1E2ZA 4A3BH 2LSSA 5EJWA 2NB0A 4ZKBB 2C9OA 2EVBA 1L0XB 2M9VA 1EWIA 1SNOA 4DUZQ 2I0QA 4LAAA 1IW7D 1H9KA 5KEEA 1RCVD 5JEAH 5CBEE 2AKWB 3I90A 4A3LG 1GJXA 1GVPA 1N34Q 2ES2A 1RJTA 3MZ5A 2QILA 3H0GG 1G2TA 3RD4A 1HTPA 2QA4A 2PMZE 3M4YA 1M4VA 3Q0AA 1O7YA 5H1SE 5JFFA 1S5FD 3S16H 4KN4C 2JA7B 4GKKQ 3PO3H 1EEID 5AJ3Q 1N34L 2K5QA 3FDTA 2MUYA 4GLXA 4NB3A 4IPGA 5GQOA 2KCMA 1RHPA 5IGGA 5KNBA 5E3FA 2HCCA 2AQ2B 3VR3A 4P2CB 2QGQA 3DUZA 5IOCA 1HZBA 1CZWA 1VQIA 4EQPA 2XWBB 3PIO3 1Y8OB 1WCMG 4JW0A 1SE2A 5EKKA 5IODA 3NBIA 3T1HQ 1DCZA 2HQLA 1VQLA 4QL5A 2EOTA 4QB4A 1PFMA 5E4XA 2KA7A 1BKBA 4A4IA 1ENFA 1VQDA 1EFWA 1VQMA 5C3XA 4GKJQ 2UUAL 4IFDH 1NNXA 1PTOD 3A5ZB 4DGZA 1SEBD 4CJ2C 4QF4A 1J5EL 2L55A 5JEAG 4RH6A 1X55A 4ZKCB 3T53B 2N88A 4KK7A 1F2LA 4KV6A 1H9SA 1U4RA 4DV5L 2CHBD 1YHBA 4RG1A 4BBSG 2G9HD 2L1BA 4M8AA 2MHVA 1NJIC 1UWVA 3PUWA 3D6CA 4X62Q 1VQKA 1U0LA 5BR8L 3S1MB 3MC0B 2Z4HA 1TS2A 1VQNA 4ABNA 4A3CG 1ET9A 4AYBB 1HJPA 1TWHH 3BZDB 1EYCA 3HOWH 1PZID 4P74A 4MTKA 4K6LA 2K6AA 5LHY1 3E0EA 1YIJA 2K14A 2B2TA 3CQZH 4HMIA 1Q8KA 1NR4A 3UE1A 4OO1G 1NSNS 2QEJC 2KHJA 3KLWA 1EY5A 2AMCB 1EY6A 2TSSA 2JA9A 2Z4IA 4DF7A 3GTOB 3S6AA 4H02A 4DR2Q 4YY3Q 4O0AA 4KLKA 4XT1B 1MHWC 2PW7A 1BO0A 4FXKC 1B53A 3OWEB 1JR0D 1RTOA 1JWMD 3H6MA 1CHQD 5D3DA 1OXTA 3ZLMA 2CVRA 4DPGA 5IWAL 3KJOA 3GTGB 4X66L 4EX5A 2K5VA 4Z9CB 4LF6L 3PO2G 2HQEA 3BVGA 4JI4Q 2EY6A 4R4OA 2J0TD 2CQOA 4KI0A 1K8OA 2EYPA 4DAYA 4DXGA 3K5MA 3HOZH 1RODA 2AHOB 3B6YA 5C0XI 1D1KA 3GTKH 1UE7A 2F0NA 3AFPA 3E6ZX 4IJHA 3CCUA 1II3A 4R8NA 4HSPA 1U4PA 3LGJA 3A0JA 2CFMA 1AEXA 1FR3A 1STNA 2M2LA 1PTOF 1RTNA 1EY8A 4LK1C 2PZUA 4A3FH 4DV0Q 1AFPA 5AFWA 3I56A 3NEMA 4MZ9A 1SFOH 1PYBA 1TWFB 4DU9A 4HIMA 1A62A 2BDOA 4P71A 1CT1D 1AZPA 3IAYA 4DV2Q 4JI6Q 2KCCA 2VY3A 1I6HH 5G3LF 1NAPA 3F2DA 1JWSD 2FMCA 1HNWL 4RHSA 4JI0L 3S1NB 3RUZA 3RZOH 2WB1E 1D5ZC 4PG3A 1X3GA 3CCQA 2D5DA 2HT1A 5T1IA 4BY7G 2BDNA 4HIKA 2JYOA 5JVG3 1SYCA 4BA1I 4OIKA 2KCTA 3NSWA 3QOJA 4B3SQ 3HG9A 3OIQA 2B63G 4KKSA 4LFBQ 1G6ZA 4L5RC 3PUXA 2MO1A 4LMQD 4HJ7A 4V190 4KKTA 2ZJRA 3EJIA 2ZJQA 2F0JA 1SNQA 1ZEQX 1SAPA 4UP8A 3JC66 1IKLA 1I5FA 1PTOB 1E1OA 4HR7B 4IPCA 5I6WA 4KHVA 1L0YB 3CPFA 4A3MB 5I9PA 3GDEA 2EJMA 2A6HD 2CW0D 3U9OA 1X3PA 4LJZC 1B44D 3T56B 3U4ZA 1B2TA 3FEWX 1D2BA 1XMQL 3HKZG 4ZK9B 2WV6D 2ZXRA 1AP0A 2EXZA 1BQQT 4K8IA 4LF9Q 2CWAA 4QGUA 3W1BA 5EU0A 4APVA
chains in the Genus database with same CATH topology
1LTLA 1V9PA 5C44G 3EIVA 4JG2A 3I4NH 1YI2A 1SROA 3HOXG 1PH9A 2UUBL 1KAWA 1YNXA 2C35B 2UU9Q 2R93H 3UDIA 1K83H 2R7ZG 5IP7G 4AQYL 3PCOB 2F52A 1JMCA 4LF9L 4LFBL 3HOXH 4IFDJ 5GAGC 1TWAH 2NVYH 2YTYA 2YV5A 5IYBH 2K5HA 2G03A 5FLMG 1E24A 2VZAA 5IP7H 4YY3L 1Q7YC 1CKMA 2PQAA 1UEBA 1QVGA 3CC4A 4LF8Q 5IYDH 3RN2A 2NZHA 3WWVA 1E22A 3T1HL 1Y1WG 1XMOL 4GNXB 4A3MH 1PH5A 4GN5A 5JFZA 3CCVA 2E5LQ 5IYBG 3HKSA 1N33L 4IOCA 3CUCA 1OXSC 4C3HH 4X2EA 4JOIA 5IT9c 2YU9H 3FKIG 1WFQA 4J15A 4B3ML 2VL6A 4GLVB 1SMXA 3CCEA 3J7A5 1SLJA 4GNXC 1B8AA 1YJ9A 4A93G 3CC2A 3DLLA 1S72A 3I55A 2IT1A 3M7NA 3KOJA 2HIXA 1KHIA 4IPHA 2VNUD 1PH1A 2IY5B 3J81i 2MO0A 3M4PA 4DV5Q 1VS0A 2IHEA 4AH6A 3S1RH 2D0PA 4UPAA 4A3KH 5DLQE 4N67A 4KHPL 2UUCQ 4XTCS 2VUMG 2VQFQ 2RF4A 5C0XJ 4B3TL 3J81j 4ALPA 2PI2E 3K7AH 3UDXA 4LF4Q 1V1QA 2LXKA 3SN9A 4TVAB 2JK8A 2NN6I 4DR7L 1E7ZA 4A3KG 5C3EG 4NXNL 2UUBQ 1VQ6A 2UU9L 1XJVA 2YYZA 3S1MH 2WAQG 4X62L 1IZ6A 2OWOA 4A3GG 2UUCL 1G6PA 4B3TQ 2R7FA 5EAYA 2NVXH 5IYCH 5LMNQ 1CKNA 4LF4L 4POGA 2H5XA 3PGZA 4R4CA 1QZGA 2ATWA 5AJ3L 4JYAQ 3HOVH 4A3GH 1PYSB 1XPOA 1MJCA 1S3OA 4PZ6A 1L1OB 2OTLA 2K50A 1YITA 1FJGL 1WCMH 2VS1A 2LXJA 1K3RA 1B70B 5IY0A 4YCWA 2E5LL 1P8LA 2Y0SG 4HIDA 3CF5A 4LFAL 3HOVG 1TWCH 2XGTA 4X2CA 2CCZA 2OTJA 4A3FG 4UP9A 3ER0A 3A74A 1RL2A 2ALYB 3HOUH 4JOIC 1YJWA 4JV5L 3U58A 4R4QA 2WB1G 3HOYG 1K9MC 4XI8A 1JJCB 4POFA 1O7IA 5GAHC 4DV1L 2Q2UA 2E2IH 4DR3Q 3H3VH 1CSPA 2K75A 5CKLA 3ZCBA 4DV4L 3I4MG 1MKHA 1QUQB 1OTCA 3OW2A 3S2DH 2JA8H 5M3MG 1X56A 1VQHA 2UXCQ 3G71A 3S24A 1W2BA 1K8AC 3AYHB 3OYYA 1CUKA 2RHQB 4JV5Q 1K73C 1LYLA 1W3SA 3KFUA 4B3RQ 3D0FA 4UY8C 1U5KA 4DV1Q 1IXRA 2F6SA 3RR5A 4JI5Q 1ASYA 1N9WA 1IBLL 4DV4Q 1C9OA 4ITRA 1T9HA 1VQCA 1LUZA 4DKAC 4X64Q 3CMAA 1Q82C 1HNXQ 3PV0A 4JCVE 2HHHQ 4LF5Q 5CMTA 5C4JH 2CKZB 1SN8A 4L5TA 4NXMQ 3LETA 4GNXA 4X2DA 5LMNL 3S14H 1LM0A 4A3IH 4LF7Q 4DUYL 1PH6A 4X65Q 2E8GA 3J80i 1XNQL 2A19A 2UXDL 5E7NA 2K5NA 3RLNA 1E1TA 1UE1A 4KHZA 1KL9A 5FJ8H 1WOCA 3EBEA 4QIWE 5IYCG 3PIOA 1CKOA 4DNIA 3FHWA 1PH8A 1NY4A 1HNXL 1HNZQ 2HHHL 1JB7A 4LF5L 4OX9Q 3HOWG 3ICEA 4A3DH 3BU2A 3GO5A 1WYDA 4MTNA 1TXYA 1NBWA 3Q8DA 2B3GA 4LFAQ 4EQ5A 1KQSA 2ASBA 1Q12A 5FJ8G 3M85A 2ZM6Q 3GTOH 1N32L 4U0UA 2I5HA 3G48A 2JQOA 2WAQE 2XTIA 4DV6Q 4GOPC 1K8GA 4LF7L 4BA2I 1C7YA 3HFZB 1N8RC 1HR0Q 2UXDQ 4Y52H 2V1CC 3GTMH 4YWMA 3VDYA 4K0KL 4A3JG 3GTPH 1VQOA 2ZTEA 1KC8C 2JA6G 3H0GH 1A63A 5K36G 4PZ7A 3GTLH 3S17H 4GS3A 2RHSB 4WJ4A 1L2FA 3S2HH 2N78A 4MNOA 1XPUA 3PUZA 2Q2IA 3KDFB 2EQSA 2A1AA 3ULLA 2D0OA 2JA6H 2Y0SE 2JA8G 5M3MH 2R93G 5IP9H 3GD7A 5LMUL 1VQAA 1PFSA 3AQQA 2AWNA 5HY6A 2OQ0A 2NVTH 3PO3G 1R9TH 2GVBA 1IBLQ 3ULPA 3J80c 1SE8A 4DR5Q 2JJQA 4GOPB 1CKNB 1G51A 3I4NG 1HNWQ 4A75A 1PV4A 1VQBA 3F2BA 3TS0A 2JA5G 4U0ZA 1X65A 4LF8L 2BA1A 3PIPA 4DR1L 1VQ5A 2F4VL 2GN5A 1XMOQ 4B3SL 2D62A 3FP9A 3UDFA 1QVCA 3PSIA 4YHHQ 1EQQA 1N33Q 4DUZL 5IWAQ 3ZJYC 1BBWA 1KRSA 2JEBI 1EIFA 4C3IH 3STBD 5GAEC 1YHQA 1M1KC 4A3BG 4HIOA 2DGYA 4RMFA 1VQ8A 4JC0A 3DM3A 4X66Q 2E2JH 4B3MQ 4IOAA 4UP7A 4X6AH 4LF6Q 4P75A 3JAMi 1XNRQ 2OQKA 4IFDI 5C4XG 2BA0A 5ELNA 4A3BH 2GVAA 2LSSA 4DV6L 4BY1G 2B63H 4A3DG 2I5MX 3KF8B 4A3LH 4YHHL 1Y1VH 1EWIA 4A3EG 4DUZQ 3CMEA 2I0QA 2BH2A 4IFDG 2DUDA 4DV3L 1N36L 4DR6L 2A8VA 1IBML 4M16A 2AKWB 4A3LG 1GD7A 3IRBA 4A76A 4GKKL 1GVPA 1N34Q 2ES2A 4GOPA 4L5QA 1J5EQ 5HGQA 2JE6I 1Q81C 3H0GG 5M5YH 2VW9A 3BJUA 1OXVA 1NE3A 2QA4A 5LMUQ 4QQBX 2RCNA 2PMZE 4BBRG 3UDGA 4GLAC 4P72A 3PF5A 4BBSH 4DR6Q 3N3UA 1CSQA 1GO3E 4NPSA 3BZCA 4FDBA 5JFFA 5H1SE 3S16H 4DR4L 1I94L 1TWGH 4GKKQ 3PO3H 2JA7H 1VQ7A 5AJ3Q 1HZAA 1N34L 1M90C 1QUQA 2IX1A 4DR1Q 4GLXA 2F3IA 4NB3A 4IPGA 1AE3A 4OXPA 5GQOA 1VQEA 2KCMA 2QEXA 1Z47A 4AQYQ 5J3BA 3GTQH 4A3CH 2EXDA 4BY7H 5FLMH 4DR4Q 2QGQA 5IYDG 2VQEQ 3W5OA 2AWOA 4YWKA 1HZBA 1HZ9A 2B29A 3K0XA 1VQIA 4A3MG 1VQPA 1WCMG 1XPRA 4JBWA 2ZJPA 1Y14B 3G4SA 3PUVA 3T1HQ 4P73A 1PA6A 3K81C 2EIFA 2HQLA 3CCRA 4QL5A 1VQLA 4U07A 4U04A 4GN4B 2ID0A 1BKBA 3TQYA 4A4IA 5FLXc 1VQDA 1EFWA 4DV3Q 4YCVA 4YCUA 1N36Q 2MQHA 1VQMA 4BY1H 2UXCL 5IE8A 4GKJQ 3KDFA 2UUAL 1EIYB 3I4OA 1Y1VG 3KF6A 5GROA 3A5ZB 1G291 1J5EL 5JEAG 3AFQA 1EYGA 1X55A 3K7UC 1PH3A 4JI5L 5JJLA 3TEHB 1H95A 3NBHB 1A0IA 2YTXA 4OWXB 4HJ9A 4JBMA 4AYBE 4NXML 2UUAQ 4DV5L 4JBJA 2BH8A 1I94Q 4JI1Q 1YHBA 4OONA 4BXXG 2YTVA 4RG1A 4DUYQ 3BZKA 3M9BA 2JEAI 4DR7Q 3AEVA 1XNQQ 2N49A 4BBSG 1B7YB 4IO9A 1VQ9A 1KXLA 4AIMA 1XTDA 5M5XH 1NJIC 3L2PA 4DV7Q 1D7QA 1UWVA 3SHGA 3PUWA 4X62Q 1VQKA 4OX9L 1U0LA 1YZ6A 2KBNA 4NXNQ 1OXXK 5BR8L 1Q46A 5C44H 1NMFA 4XIGS 3U50C 4JI4L 1VQNA 4R4IA 4JI1L 4A3CG 4WJ3M 3M4OH 1HJPA 1TWHH 3HOZG 3HKZE 1AE2A 3HOWH 1BVSA 1FJGQ 1ASZA 4P74A 3CCSA 1WI5A 1P16A 1L1OC 5M3FH 3A5UA 4JYAL 4LUVA 3E0EA 4L5SA 3CP0A 1YIJA 2K14A 3NENA 3CQZH 4GN3B 3CC7A 1Q8KA 5JEAJ 4DAMA 1QZHA 3TS2A 1SRUA 1YEZA 1PH4A 3UE1A 1Y1WH 3GTGH 4OO1G 2KHJA 3CW2C 2R6GA 3KLWA 2AMCB 4HJAA 2JA9A 2Z0SA 1JJGA 1WJJA 4QY7A 1X3EA 3ULJA 2CWPA 3H15A 3S6AA 3FKIH 4H02A 5ELOA 4YY3Q 4O0AA 4DR5L 4DR2Q 1PHJA 5JJKA 1C0AA 4KLKA 1FVIA 3ZC7A 3M4QA 3HOUG 4OO1I 4DR3L 3RN5A 3ERSX 3KYHC 3HOYH 4JI3Q 3PUYA 4IJLA 3L7ZC 1K0RA 3MXNB 5JJIA 2MFIA 2KHIA 2K4KA 1EQRA 1OXTA 2IX0A 3ZLMA 4JI8Q 4LFCL 4DPGA 5M5WH 3E9IA 3I4MH 5IWAL 3KJOA 1Q1EA 1VQJA 1V43A 1YJNA 3S1QH 1A8VA 4DV7L 4DR2L 1SR3A 2I5LX 2N8NA 4X66L 2ZTDA 1X54A 3L0OA 2NN6G 2K5VA 4EX5A 4JI0Q 3TRZA 4A3IG 4LF6L 1XNRL 3PO2G 5C3EH 4LNQA 4JI4Q 1JT8A 2ZTCA 4R4OA 3RNUA 3D31A 4PMWA 3I2ZA 3I7FA 4LFCQ 2KENA 2CQOA 4KI0A 4AYBG 3CXCA 3PO2H 4R4TA 4U0SA 1GM5A 2NVQH 1AH9A 1TWFH 4X65L 3K80C 1EOVA 3RLFA 1FL0A 3HOZH 2AHOB 3B6YA 5C0XI 1FGUA 3GTKH 1UE7A 1MJEA 2ZM6L 4JI2Q 3AFPA 3CCUA 4IJHA 5M3FG 1HNZL 1D8LA 1S40A 3S15H 4A3EH 1JE5A 1HH2P 4LWCA 2WP8J 1IL2A 2MNAA 4YWLA 2Z6KA 4OWWB 3LGJA 3H3VI 2HIVA 3A0JA 1MIUA 2CFMA 1VQFA 1Z9FA 2K52A 4PZ8A 1PH7A 4K0KQ 1E3PA 4JI7Q 3W1GA 5C0XG 3TREA 4A3FH 4DV0Q 4Y7NH 1HR0L 3EN2A 3I56A 4PY3A 2IHFA 3NEMA 4MZ9A 5IP9G 1PYBA 1SFOH 1KRTA 3CAMA 2Q2TA 4JI3L 2R7DA 2FXQA 1IYJB 4HIMA 1A62A 3K8AA 1UE6A 4P71A 4JI8L 4BBRH 4A3JH 4DV2Q 1PH2A 4JI6Q 3CCLA 4C3JH 2VY3A 5GADC 1I6HH 3CCJA 4JI7L 1YVCA 3CCMA 1XMQQ 3S1NH 3F2DA 1QVFA 1HNWL 3U4VA 4LUOA 2VQEL 3F1ZA 4JI0L 3STBC 3CPWA 1NMGA 1HR0W 3RZOH 2WB1E 1J6QA 3KJPA 3F8TA 1VQGA 4PG3A 1Q86C 3RZDH 1X3GA 3CCQA 2UXBQ 1X6OA 2F4VQ 2HT1A 4LUZA 1OXUA 1EUJA 4BY7G 3J81c 2Q2HA 4DV2L 4HIKA 4JI6L 1UE5A 4IPDA 4O2DA 1I3QH 4BA1I 1L0WA 2KCTA 4TQUS 3M3YH 3OTOQ 3T1YQ 4GKJL 3UE0A 4B3SQ 3G6EA 2JA5H 4B3RL 5CGLA 2B63G 1PVOA 1YHAA 4JBKA 1I50H 4JI2L 3RLOA 4LFBQ 4DK3C 1X9NA 4L5RC 1IBKL 3PUXA 2MO1A 4X64L 2UXBL 1KD1C 4HJ7A 1VQ4A 2WFWA 1RIPA 1Q1BA 2ZJRA 2NZOA 3F2CA 2ZJQA 2N3SA 1HZCA 2L15A 3GTJH 3OTOL 3T1YL 1GKHA 1BBUA 4DV0L 4UP8A 5C4XH 3JC66 1IBMQ 1I5FA 3NELA 4IPCA 1E1OA 1KIXA 5JJ7A 2R92G 3MEFA 4A93H 1YBYA 4HJ8A 1L1OA 1X3FA 2E2HH 4C2MH 4R1JA 3CPFA 1IBKQ 2PQAB 3GDEA 3SGIA 2PI2A 4LU4A 4LW1A 3CD6A 4DK6C 4HJ5A 3E9HA 1JJ2A 2R92H 3JAMc 4QJFA 3U4ZA 1N32Q 3SE5A 4OWTB 1NTGA 2VUMH 5LMNW 5BR8Q 1XMQL 2JA7G 3J7ZC 4BXXH 3KF6B 5JJ6A 2PNHA 3HKZG 1DGSA 4WGJA 4KHPQ 2OCEA 4LF9Q 4ME3A 2CWAA 4QGUA 2VQFL 3PF4A 3W1BA 5EU0A 1VCIA 4DAYB 2Z6KC 4APVA 2R7ZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTL A;  1V9P A;  5C44 G;  3EIV A;  4JG2 A;  3I4N H;  1YI2 A;  1SRO A;  3HOX G;  1PH9 A;  2UUB L;  1KAW A;  1YNX A;  2C35 B;  2UU9 Q;  2R93 H;  3UDI A;  1K83 H;  2R7Z G;  5IP7 G;  4AQY L;  3PCO B;  2F52 A;  1JMC A;  4LF9 L;  4LFB L;  3HOX H;  4IFD J;  5GAG C;  1TWA H;  2NVY H;  2YTY A;  2YV5 A;  5IYB H;  2K5H A;  2G03 A;  5FLM G;  1E24 A;  2VZA A;  5IP7 H;  4YY3 L;  1Q7Y C;  1CKM A;  2PQA A;  1UEB A;  1QVG A;  3CC4 A;  4LF8 Q;  5IYD H;  3RN2 A;  2NZH A;  3WWV A;  1E22 A;  3T1H L;  1Y1W G;  1XMO L;  4GNX B;  4A3M H;  1PH5 A;  4GN5 A;  5JFZ A;  3CCV A;  2E5L Q;  5IYB G;  3HKS A;  1N33 L;  4IOC A;  3CUC A;  1OXS C;  4C3H H;  4X2E A;  4JOI A;  5IT9 c;  2YU9 H;  3FKI G;  1WFQ A;  4J15 A;  4B3M L;  2VL6 A;  4GLV B;  1SMX A;  3CCE A;  3J7A 5;  1SLJ A;  4GNX C;  1B8A A;  1YJ9 A;  4A93 G;  3CC2 A;  3DLL A;  1S72 A;  3I55 A;  2IT1 A;  3M7N A;  3KOJ A;  2HIX A;  1KHI A;  4IPH A;  2VNU D;  1PH1 A;  2IY5 B;  3J81 i;  2MO0 A;  3M4P A;  4DV5 Q;  1VS0 A;  2IHE A;  4AH6 A;  3S1R H;  2D0P A;  4UPA A;  4A3K H;  5DLQ E;  4N67 A;  4KHP L;  2UUC Q;  4XTC S;  2VUM G;  2VQF Q;  2RF4 A;  5C0X J;  4B3T L;  3J81 j;  4ALP A;  2PI2 E;  3K7A H;  3UDX A;  4LF4 Q;  1V1Q A;  2LXK A;  3SN9 A;  4TVA B;  2JK8 A;  2NN6 I;  4DR7 L;  1E7Z A;  4A3K G;  5C3E G;  4NXN L;  2UUB Q;  1VQ6 A;  2UU9 L;  1XJV A;  2YYZ A;  3S1M H;  2WAQ G;  4X62 L;  1IZ6 A;  2OWO A;  4A3G G;  2UUC L;  1G6P A;  4B3T Q;  2R7F A;  5EAY A;  2NVX H;  5IYC H;  5LMN Q;  1CKN A;  4LF4 L;  4POG A;  2H5X A;  3PGZ A;  4R4C A;  1QZG A;  2ATW A;  5AJ3 L;  4JYA Q;  3HOV H;  4A3G H;  1PYS B;  1XPO A;  1MJC A;  1S3O A;  4PZ6 A;  1L1O B;  2OTL A;  2K50 A;  1YIT A;  1FJG L;  1WCM H;  2VS1 A;  2LXJ A;  1K3R A;  1B70 B;  5IY0 A;  4YCW A;  2E5L L;  1P8L A;  2Y0S G;  4HID A;  3CF5 A;  4LFA L;  3HOV G;  1TWC H;  2XGT A;  4X2C A;  2CCZ A;  2OTJ A;  4A3F G;  4UP9 A;  3ER0 A;  3A74 A;  1RL2 A;  2ALY B;  3HOU H;  4JOI C;  1YJW A;  4JV5 L;  3U58 A;  4R4Q A;  2WB1 G;  3HOY G;  1K9M C;  4XI8 A;  1JJC B;  4POF A;  1O7I A;  5GAH C;  4DV1 L;  2Q2U A;  2E2I H;  4DR3 Q;  3H3V H;  1CSP A;  2K75 A;  5CKL A;  3ZCB A;  4DV4 L;  3I4M G;  1MKH A;  1QUQ B;  1OTC A;  3OW2 A;  3S2D H;  2JA8 H;  5M3M G;  1X56 A;  1VQH A;  2UXC Q;  3G71 A;  3S24 A;  1W2B A;  1K8A C;  3AYH B;  3OYY A;  1CUK A;  2RHQ B;  4JV5 Q;  1K73 C;  1LYL A;  1W3S A;  3KFU A;  4B3R Q;  3D0F A;  4UY8 C;  1U5K A;  4DV1 Q;  1IXR A;  2F6S A;  3RR5 A;  4JI5 Q;  1ASY A;  1N9W A;  1IBL L;  4DV4 Q;  1C9O A;  4ITR A;  1T9H A;  1VQC A;  1LUZ A;  4DKA C;  4X64 Q;  3CMA A;  1Q82 C;  1HNX Q;  3PV0 A;  4JCV E;  2HHH Q;  4LF5 Q;  5CMT A;  5C4J H;  2CKZ B;  1SN8 A;  4L5T A;  4NXM Q;  3LET A;  4GNX A;  4X2D A;  5LMN L;  3S14 H;  1LM0 A;  4A3I H;  4LF7 Q;  4DUY L;  1PH6 A;  4X65 Q;  2E8G A;  3J80 i;  1XNQ L;  2A19 A;  2UXD L;  5E7N A;  2K5N A;  3RLN A;  1E1T A;  1UE1 A;  4KHZ A;  1KL9 A;  5FJ8 H;  1WOC A;  3EBE A;  4QIW E;  5IYC G;  3PIO A;  1CKO A;  4DNI A;  3FHW A;  1PH8 A;  1NY4 A;  1HNX L;  1HNZ Q;  2HHH L;  1JB7 A;  4LF5 L;  4OX9 Q;  3HOW G;  3ICE A;  4A3D H;  3BU2 A;  3GO5 A;  1WYD A;  4MTN A;  1TXY A;  1NBW A;  3Q8D A;  2B3G A;  4LFA Q;  4EQ5 A;  1KQS A;  2ASB A;  1Q12 A;  5FJ8 G;  3M85 A;  2ZM6 Q;  3GTO H;  1N32 L;  4U0U A;  2I5H A;  3G48 A;  2JQO A;  2WAQ E;  2XTI A;  4DV6 Q;  4GOP C;  1K8G A;  4LF7 L;  4BA2 I;  1C7Y A;  3HFZ B;  1N8R C;  1HR0 Q;  2UXD Q;  4Y52 H;  2V1C C;  3GTM H;  4YWM A;  3VDY A;  4K0K L;  4A3J G;  3GTP H;  1VQO A;  2ZTE A;  1KC8 C;  2JA6 G;  3H0G H;  1A63 A;  5K36 G;  4PZ7 A;  3GTL H;  3S17 H;  4GS3 A;  2RHS B;  4WJ4 A;  1L2F A;  3S2H H;  2N78 A;  4MNO A;  1XPU A;  3PUZ A;  2Q2I A;  3KDF B;  2EQS A;  2A1A A;  3ULL A;  2D0O A;  2JA6 H;  2Y0S E;  2JA8 G;  5M3M H;  2R93 G;  5IP9 H;  3GD7 A;  5LMU L;  1VQA A;  1PFS A;  3AQQ A;  2AWN A;  5HY6 A;  2OQ0 A;  2NVT H;  3PO3 G;  1R9T H;  2GVB A;  1IBL Q;  3ULP A;  3J80 c;  1SE8 A;  4DR5 Q;  2JJQ A;  4GOP B;  1CKN B;  1G51 A;  3I4N G;  1HNW Q;  4A75 A;  1PV4 A;  1VQB A;  3F2B A;  3TS0 A;  2JA5 G;  4U0Z A;  1X65 A;  4LF8 L;  2BA1 A;  3PIP A;  4DR1 L;  1VQ5 A;  2F4V L;  2GN5 A;  1XMO Q;  4B3S L;  2D62 A;  3FP9 A;  3UDF A;  1QVC A;  3PSI A;  4YHH Q;  1EQQ A;  1N33 Q;  4DUZ L;  5IWA Q;  3ZJY C;  1BBW A;  1KRS A;  2JEB I;  1EIF A;  4C3I H;  3STB D;  5GAE C;  1YHQ A;  1M1K C;  4A3B G;  4HIO A;  2DGY A;  4RMF A;  1VQ8 A;  4JC0 A;  3DM3 A;  4X66 Q;  2E2J H;  4B3M Q;  4IOA A;  4UP7 A;  4X6A H;  4LF6 Q;  4P75 A;  3JAM i;  1XNR Q;  2OQK A;  4IFD I;  5C4X G;  2BA0 A;  5ELN A;  4A3B H;  2GVA A;  2LSS A;  4DV6 L;  4BY1 G;  2B63 H;  4A3D G;  2I5M X;  3KF8 B;  4A3L H;  4YHH L;  1Y1V H;  1EWI A;  4A3E G;  4DUZ Q;  3CME A;  2I0Q A;  2BH2 A;  4IFD G;  2DUD A;  4DV3 L;  1N36 L;  4DR6 L;  2A8V A;  1IBM L;  4M16 A;  2AKW B;  4A3L G;  1GD7 A;  3IRB A;  4A76 A;  4GKK L;  1GVP A;  1N34 Q;  2ES2 A;  4GOP A;  4L5Q A;  1J5E Q;  5HGQ A;  2JE6 I;  1Q81 C;  3H0G G;  5M5Y H;  2VW9 A;  3BJU A;  1OXV A;  1NE3 A;  2QA4 A;  5LMU Q;  4QQB X;  2RCN A;  2PMZ E;  4BBR G;  3UDG A;  4GLA C;  4P72 A;  3PF5 A;  4BBS H;  4DR6 Q;  3N3U A;  1CSQ A;  1GO3 E;  4NPS A;  3BZC A;  4FDB A;  5JFF A;  5H1S E;  3S16 H;  4DR4 L;  1I94 L;  1TWG H;  4GKK Q;  3PO3 H;  2JA7 H;  1VQ7 A;  5AJ3 Q;  1HZA A;  1N34 L;  1M90 C;  1QUQ A;  2IX1 A;  4DR1 Q;  4GLX A;  2F3I A;  4NB3 A;  4IPG A;  1AE3 A;  4OXP A;  5GQO A;  1VQE A;  2KCM A;  2QEX A;  1Z47 A;  4AQY Q;  5J3B A;  3GTQ H;  4A3C H;  2EXD A;  4BY7 H;  5FLM H;  4DR4 Q;  2QGQ A;  5IYD G;  2VQE Q;  3W5O A;  2AWO A;  4YWK A;  1HZB A;  1HZ9 A;  2B29 A;  3K0X A;  1VQI A;  4A3M G;  1VQP A;  1WCM G;  1XPR A;  4JBW A;  2ZJP A;  1Y14 B;  3G4S A;  3PUV A;  3T1H Q;  4P73 A;  1PA6 A;  3K81 C;  2EIF A;  2HQL A;  3CCR A;  4QL5 A;  1VQL A;  4U07 A;  4U04 A;  4GN4 B;  2ID0 A;  1BKB A;  3TQY A;  4A4I A;  5FLX c;  1VQD A;  1EFW A;  4DV3 Q;  4YCV A;  4YCU A;  1N36 Q;  2MQH A;  1VQM A;  4BY1 H;  2UXC L;  5IE8 A;  4GKJ Q;  3KDF A;  2UUA L;  1EIY B;  3I4O A;  1Y1V G;  3KF6 A;  5GRO A;  3A5Z B;  1G29 1;  1J5E L;  5JEA G;  3AFQ A;  1EYG A;  1X55 A;  3K7U C;  1PH3 A;  4JI5 L;  5JJL A;  3TEH B;  1H95 A;  3NBH B;  1A0I A;  2YTX A;  4OWX B;  4HJ9 A;  4JBM A;  4AYB E;  4NXM L;  2UUA Q;  4DV5 L;  4JBJ A;  2BH8 A;  1I94 Q;  4JI1 Q;  1YHB A;  4OON A;  4BXX G;  2YTV A;  4RG1 A;  4DUY Q;  3BZK A;  3M9B A;  2JEA I;  4DR7 Q;  3AEV A;  1XNQ Q;  2N49 A;  4BBS G;  1B7Y B;  4IO9 A;  1VQ9 A;  1KXL A;  4AIM A;  1XTD A;  5M5X H;  1NJI C;  3L2P A;  4DV7 Q;  1D7Q A;  1UWV A;  3SHG A;  3PUW A;  4X62 Q;  1VQK A;  4OX9 L;  1U0L A;  1YZ6 A;  2KBN A;  4NXN Q;  1OXX K;  5BR8 L;  1Q46 A;  5C44 H;  1NMF A;  4XIG S;  3U50 C;  4JI4 L;  1VQN A;  4R4I A;  4JI1 L;  4A3C G;  4WJ3 M;  3M4O H;  1HJP A;  1TWH H;  3HOZ G;  3HKZ E;  1AE2 A;  3HOW H;  1BVS A;  1FJG Q;  1ASZ A;  4P74 A;  3CCS A;  1WI5 A;  1P16 A;  1L1O C;  5M3F H;  3A5U A;  4JYA L;  4LUV A;  3E0E A;  4L5S A;  3CP0 A;  1YIJ A;  2K14 A;  3NEN A;  3CQZ H;  4GN3 B;  3CC7 A;  1Q8K A;  5JEA J;  4DAM A;  1QZH A;  3TS2 A;  1SRU A;  1YEZ A;  1PH4 A;  3UE1 A;  1Y1W H;  3GTG H;  4OO1 G;  2KHJ A;  3CW2 C;  2R6G A;  3KLW A;  2AMC B;  4HJA A;  2JA9 A;  2Z0S A;  1JJG A;  1WJJ A;  4QY7 A;  1X3E A;  3ULJ A;  2CWP A;  3H15 A;  3S6A A;  3FKI H;  4H02 A;  5ELO A;  4YY3 Q;  4O0A A;  4DR5 L;  4DR2 Q;  1PHJ A;  5JJK A;  1C0A A;  4KLK A;  1FVI A;  3ZC7 A;  3M4Q A;  3HOU G;  4OO1 I;  4DR3 L;  3RN5 A;  3ERS X;  3KYH C;  3HOY H;  4JI3 Q;  3PUY A;  4IJL A;  3L7Z C;  1K0R A;  3MXN B;  5JJI A;  2MFI A;  2KHI A;  2K4K A;  1EQR A;  1OXT A;  2IX0 A;  3ZLM A;  4JI8 Q;  4LFC L;  4DPG A;  5M5W H;  3E9I A;  3I4M H;  5IWA L;  3KJO A;  1Q1E A;  1VQJ A;  1V43 A;  1YJN A;  3S1Q H;  1A8V A;  4DV7 L;  4DR2 L;  1SR3 A;  2I5L X;  2N8N A;  4X66 L;  2ZTD A;  1X54 A;  3L0O A;  2NN6 G;  2K5V A;  4EX5 A;  4JI0 Q;  3TRZ A;  4A3I G;  4LF6 L;  1XNR L;  3PO2 G;  5C3E H;  4LNQ A;  4JI4 Q;  1JT8 A;  2ZTC A;  4R4O A;  3RNU A;  3D31 A;  4PMW A;  3I2Z A;  3I7F A;  4LFC Q;  2KEN A;  2CQO A;  4KI0 A;  4AYB G;  3CXC A;  3PO2 H;  4R4T A;  4U0S A;  1GM5 A;  2NVQ H;  1AH9 A;  1TWF H;  4X65 L;  3K80 C;  1EOV A;  3RLF A;  1FL0 A;  3HOZ H;  2AHO B;  3B6Y A;  5C0X I;  1FGU A;  3GTK H;  1UE7 A;  1MJE A;  2ZM6 L;  4JI2 Q;  3AFP A;  3CCU A;  4IJH A;  5M3F G;  1HNZ L;  1D8L A;  1S40 A;  3S15 H;  4A3E H;  1JE5 A;  1HH2 P;  4LWC A;  2WP8 J;  1IL2 A;  2MNA A;  4YWL A;  2Z6K A;  4OWW B;  3LGJ A;  3H3V I;  2HIV A;  3A0J A;  1MIU A;  2CFM A;  1VQF A;  1Z9F A;  2K52 A;  4PZ8 A;  1PH7 A;  4K0K Q;  1E3P A;  4JI7 Q;  3W1G A;  5C0X G;  3TRE A;  4A3F H;  4DV0 Q;  4Y7N H;  1HR0 L;  3EN2 A;  3I56 A;  4PY3 A;  2IHF A;  3NEM A;  4MZ9 A;  5IP9 G;  1PYB A;  1SFO H;  1KRT A;  3CAM A;  2Q2T A;  4JI3 L;  2R7D A;  2FXQ A;  1IYJ B;  4HIM A;  1A62 A;  3K8A A;  1UE6 A;  4P71 A;  4JI8 L;  4BBR H;  4A3J H;  4DV2 Q;  1PH2 A;  4JI6 Q;  3CCL A;  4C3J H;  2VY3 A;  5GAD C;  1I6H H;  3CCJ A;  4JI7 L;  1YVC A;  3CCM A;  1XMQ Q;  3S1N H;  3F2D A;  1QVF A;  1HNW L;  3U4V A;  4LUO A;  2VQE L;  3F1Z A;  4JI0 L;  3STB C;  3CPW A;  1NMG A;  1HR0 W;  3RZO H;  2WB1 E;  1J6Q A;  3KJP A;  3F8T A;  1VQG A;  4PG3 A;  1Q86 C;  3RZD H;  1X3G A;  3CCQ A;  2UXB Q;  1X6O A;  2F4V Q;  2HT1 A;  4LUZ A;  1OXU A;  1EUJ A;  4BY7 G;  3J81 c;  2Q2H A;  4DV2 L;  4HIK A;  4JI6 L;  1UE5 A;  4IPD A;  4O2D A;  1I3Q H;  4BA1 I;  1L0W A;  2KCT A;  4TQU S;  3M3Y H;  3OTO Q;  3T1Y Q;  4GKJ L;  3UE0 A;  4B3S Q;  3G6E A;  2JA5 H;  4B3R L;  5CGL A;  2B63 G;  1PVO A;  1YHA A;  4JBK A;  1I50 H;  4JI2 L;  3RLO A;  4LFB Q;  4DK3 C;  1X9N A;  4L5R C;  1IBK L;  3PUX A;  2MO1 A;  4X64 L;  2UXB L;  1KD1 C;  4HJ7 A;  1VQ4 A;  2WFW A;  1RIP A;  1Q1B A;  2ZJR A;  2NZO A;  3F2C A;  2ZJQ A;  2N3S A;  1HZC A;  2L15 A;  3GTJ H;  3OTO L;  3T1Y L;  1GKH A;  1BBU A;  4DV0 L;  4UP8 A;  5C4X H;  3JC6 6;  1IBM Q;  1I5F A;  3NEL A;  4IPC A;  1E1O A;  1KIX A;  5JJ7 A;  2R92 G;  3MEF A;  4A93 H;  1YBY A;  4HJ8 A;  1L1O A;  1X3F A;  2E2H H;  4C2M H;  4R1J A;  3CPF A;  1IBK Q;  2PQA B;  3GDE A;  3SGI A;  2PI2 A;  4LU4 A;  4LW1 A;  3CD6 A;  4DK6 C;  4HJ5 A;  3E9H A;  1JJ2 A;  2R92 H;  3JAM c;  4QJF A;  3U4Z A;  1N32 Q;  3SE5 A;  4OWT B;  1NTG A;  2VUM H;  5LMN W;  5BR8 Q;  1XMQ L;  2JA7 G;  3J7Z C;  4BXX H;  3KF6 B;  5JJ6 A;  2PNH A;  3HKZ G;  1DGS A;  4WGJ A;  4KHP Q;  2OCE A;  4LF9 Q;  4ME3 A;  2CWA A;  4QGU A;  2VQF L;  3PF4 A;  3W1B A;  5EU0 A;  1VCI A;  4DAY B;  2Z6K C;  4APV A;  2R7Z H; 
#chains in the Genus database with same CATH topology
 3I4N H;  5C44 G;  1R4Q B;  4JG2 A;  1KAW A;  2EYO A;  4HCS A;  3C3L A;  2R93 H;  1K83 H;  5EPK A;  1JMC A;  3HOX H;  4IFD J;  5GAG C;  1SYE A;  5D3I B;  2NYZ D;  2K5H A;  3TME A;  1E24 A;  1UEB A;  5IYD H;  1E22 A;  1Y1W G;  4A3M H;  1I4R A;  5I4D A;  3CCV A;  2R7Z B;  2Z8L A;  3CUC A;  2NTT A;  1OXS C;  5BN5 A;  4C3H H;  5K5P A;  4JOI A;  4DK0 A;  3FKI G;  1WFQ A;  4J15 A;  3CCE A;  1SMX A;  3HOY B;  3J7A 5;  4GNX C;  1JOR A;  4A93 G;  4S3S A;  3I4M B;  3ONA B;  3K6O A;  1KHI A;  2MO0 A;  1LTR D;  4HTH A;  4IUN A;  4UPA A;  2UUC Q;  4XTC S;  2F0O A;  5C0X J;  3A56 A;  3J81 j;  2PI2 E;  3SN9 A;  5I2X A;  4DR7 L;  2DNC A;  4NP5 A;  4DXF A;  4A3K G;  3P1H A;  1NR2 A;  4NXN L;  1EZ6 A;  1VQ6 A;  2Z9H A;  1Y8N B;  3S1M H;  1C4Q A;  3S1Q B;  4ULL A;  5FKA C;  1YNN C;  3AU7 A;  2XNA C;  4UDU C;  2DY8 A;  1ESF A;  5LMN Q;  1XX8 A;  2H5X A;  3PGZ A;  4R4C A;  4KD3 A;  4JYA Q;  2KCN A;  2OTL A;  1MJC A;  2K50 A;  1WCM H;  5DAU A;  3CQZ B;  2WII B;  1B4O A;  1P8L A;  2E2D C;  4X3T A;  4QCL A;  3NBH A;  4B08 A;  1CHP D;  1KTK A;  1T5X D;  3A7L A;  4XQJ A;  1EZ8 A;  2ALY B;  3S15 B;  2RDG A;  2WB1 G;  4A3J B;  4QUC A;  5GAH C;  4DR3 Q;  5CV7 A;  5CKL A;  2GA4 B;  3I4M G;  1OTC A;  3QO2 A;  1K8M A;  3A8I E;  2K32 A;  3OW7 A;  1W2B A;  1K8A C;  3MWY W;  2A6E C;  1ML0 D;  3KFU A;  4OL7 A;  2PZT A;  3D0F A;  1IXR A;  2F6S A;  1C9O A;  3C1E A;  4F87 A;  3M4O B;  4LF5 Q;  4KY7 A;  3PV0 A;  5JOB A;  1J9O A;  2NTS A;  2KHS A;  2XIW A;  4NXM Q;  3KBG A;  3WOE A;  5KIX A;  1HCZ A;  1LM0 A;  4ZUI A;  4DUY L;  1PH6 A;  4X65 Q;  1BCP B;  4RGN A;  3V96 A;  2K5N A;  1E1T A;  1UE1 A;  1STE A;  1WOC A;  5IYC G;  4DNI A;  1HNX L;  3ICE A;  1TXY A;  1NBW A;  1Q12 A;  5FJ8 G;  4K2L A;  3G48 A;  1HXY D;  1IL8 A;  1CQF A;  2I5H A;  2WAQ E;  4DV6 Q;  1C48 A;  1LAB A;  5DM6 3;  2X6L A;  3NHH A;  2A73 B;  2KEC A;  5CGK A;  4K0K L;  2F0Q A;  1EU3 A;  3GTP H;  2FMM A;  1VQO A;  4UAI A;  1KC8 C;  3H0G B;  3K59 A;  2RHS B;  2BOS A;  3S2H H;  5IGF A;  2IPK D;  3NE5 B;  3PUZ A;  1XPU A;  3D4R A;  2A1A A;  3ULL A;  4BBR B;  2Y0S E;  2JA8 G;  4DFA A;  1VQA A;  4L63 B;  2NUD A;  5ELD A;  3MXU A;  2OQ0 A;  3PQI A;  1WTO A;  2OEO A;  2NVT H;  1R9T H;  4FXG C;  3OMG A;  1B9N A;  3Q24 A;  3NTH A;  1SE8 A;  4GOP B;  2EYF A;  1CKN B;  3QB3 A;  1HA6 A;  3I91 A;  4PQX A;  3F2B A;  2JA5 G;  3T4A C;  1X65 A;  2Q8R E;  3PIP A;  4DR1 L;  2F4V L;  1MI2 A;  2D62 A;  3UDF A;  3PSI A;  3QJY A;  1EQQ A;  4DUZ L;  2JEB I;  1BCP C;  4C3I H;  1EIF A;  3M3Y B;  4KY6 A;  3H09 A;  1XNR Q;  1JB3 A;  3GV6 A;  1CZG A;  3I4L A;  3J81 L;  5C4X G;  4IAL A;  5ELN A;  4GZY C;  2LY7 A;  2A5H A;  4YHH L;  1Y1V H;  2BH2 A;  2OXP A;  2IJ0 A;  1PLF A;  1TS5 A;  1E2W A;  2A8V A;  1IBM L;  4M16 A;  2EY1 A;  3IRB A;  3A7A B;  4GKK L;  3ERO A;  1STA A;  4GOP A;  4K6D A;  5HGQ A;  1KNA A;  1Q81 C;  4G4K A;  5FOB B;  4HAE A;  3BJU A;  1NE3 A;  3QWN A;  5LMU Q;  2XWJ B;  4XDX A;  3UDG A;  1ESR A;  4GLA C;  4BBS H;  1CSQ A;  1GO3 E;  3BZC A;  1QNK A;  3ERQ A;  1I94 L;  1TWG H;  5FO7 B;  2JA7 H;  1HZA A;  1QUQ A;  2IX1 A;  1O7L A;  3KLS A;  2NVX B;  1AE3 A;  4OXP A;  4AQY Q;  4BY7 H;  4RFB A;  3FMC A;  5FLM H;  3JAM E;  5IYD G;  3IKJ A;  3W5O A;  1GUG A;  1HZ9 A;  2EJF C;  4Q0F A;  1XPR A;  4JBW A;  1GUO A;  4J8Q A;  4P73 A;  3K81 C;  4K5X A;  2EIF A;  2E2H B;  4U04 A;  4GN4 B;  2ID0 A;  1MSG A;  4K14 A;  4YCU A;  2ZXO A;  4DNR B;  2H4O A;  3I4O A;  1Y1V G;  2EY5 A;  1EQT A;  3Q22 A;  4FF3 A;  1G29 1;  1EYG A;  2NWG A;  4BBS B;  5JJL A;  2RCF A;  4JI5 L;  1LTG D;  4EQO A;  4A93 B;  3FRP B;  1NCV A;  4HJ9 A;  4AYB E;  3SK4 A;  4JBJ A;  2BH8 A;  4K2K A;  4OON A;  4CHT B;  3X3N A;  1GXD C;  4DUY Q;  3AEV A;  2B2U A;  2N49 A;  4KD4 A;  1FD7 D;  3P75 A;  2WAQ B;  4ZQ3 A;  4KN7 C;  1H9R A;  5M5X H;  3SHG A;  2JP1 A;  2E74 C;  3NTI A;  1HTL D;  3U50 C;  1YNJ C;  4R4I A;  4JI1 L;  1BF4 A;  4WJ3 M;  1AE2 A;  1FJG Q;  1WI5 A;  1P16 A;  2H1E A;  4NW2 A;  1Q90 A;  3NEN A;  3TS2 A;  4ME5 A;  1SRU A;  1PH4 A;  2PMZ B;  1WVL A;  2WB1 B;  2FJ2 A;  5D65 A;  3W3A A;  4EGV A;  4HJA A;  1X3E A;  2EPB A;  2XRS D;  3SHL A;  3ULJ A;  3H15 A;  3A8J E;  3FKI H;  3K58 A;  3HS0 C;  3SXH A;  4WFN 3;  1ET6 A;  2O4X A;  2Z1C A;  1QE6 A;  3J7A V;  3KYH C;  3NWS A;  4IJL A;  3PO2 B;  1PXU A;  1K0R A;  2MFI A;  4JI8 Q;  1EQR A;  2IX0 A;  3BYY B;  4FO2 A;  5M5W H;  3IFD A;  2F0U A;  1Q1E A;  1V43 A;  4DV7 L;  1I3Q B;  1SR3 A;  2I5L X;  2N8N A;  1TS4 A;  3QG1 A;  3L0O A;  3TRZ A;  4KY5 A;  2AUK A;  4F7X A;  3D4W A;  2E2I B;  1B3A A;  1JT8 A;  1F9R A;  2ZTC A;  3D31 A;  4PMW A;  4H0L C;  2KEN A;  4XQQ A;  5M9O A;  4U0S A;  1SYB A;  2NVQ H;  1WTH A;  3VYR A;  3GTJ B;  1QWY A;  1QB5 D;  2VXW A;  5CC4 A;  1FGU A;  2NZ1 D;  1JC7 A;  2ENB A;  1HNZ L;  1BNZ A;  1QNU A;  1A15 A;  1HH2 P;  3ITP A;  4YWL A;  3A55 A;  2WIN B;  2XN9 C;  1MIU A;  2RBM A;  1SMY D;  1SE3 A;  3W1G A;  1HR0 L;  3X3M A;  4RCN A;  2IHF A;  4O42 A;  5IP9 G;  1UNS A;  2J7Z A;  3CAM A;  2Q2T A;  1E2V A;  5HUR A;  3K5O A;  4G57 A;  4BBR H;  1UE6 A;  3E5S A;  1STH A;  3EQL C;  4C3J H;  3R8B A;  4H13 C;  3CCM A;  1I6H B;  4L6T B;  4X3K A;  3F1Z A;  3STB C;  3CU7 A;  1VQG A;  5EBD A;  3RZD H;  1X6O A;  4LUZ A;  1O80 A;  2VB2 X;  4O2D A;  1I3Q H;  2K05 A;  1I6V C;  1XTC D;  3I3C A;  4TQU S;  3M3Y H;  3MVV A;  4GKJ L;  5LL6 X;  4HMJ A;  1WTX A;  2K5D A;  5CGL A;  1PVO A;  4CGY B;  4KKU A;  4JI2 L;  3RLO A;  4X64 L;  1KD1 C;  1Q1B A;  3W2D A;  3F2C A;  4RGO S;  3RZO B;  2PPB C;  3MXP A;  4H7B A;  1EU4 A;  2L15 A;  3GTJ H;  1V1O A;  4U68 A;  4DV0 L;  5C4X H;  4A3D B;  1KIX A;  2G9D A;  2I46 A;  2F0I A;  5JJ7 A;  4TRD A;  3SK5 A;  3HKZ B;  4K5V A;  3D8G A;  1X3F A;  3OHX C;  5J22 A;  1IBK Q;  2PI2 A;  4LU4 A;  3CD6 A;  1A3T A;  2A6H C;  1DYQ A;  3E9H A;  5E1F A;  1JJ2 A;  2R92 H;  1DOM A;  3SE5 A;  4YIJ A;  2VUM H;  5BR8 Q;  2JA7 G;  3J7Z C;  5DM7 3;  5EKI A;  4BXX H;  5JJ6 A;  1VMP A;  3SVM A;  1DGS A;  2OCE A;  4ME3 A;  3MXG A;  2VQF L;  3OMC A;  1VCI A;  1PTO H;  3BVZ A;  4X3S A;  3G6J B;  4C1N K;  3EIV A;  3BDL A;  1YI2 A;  3A54 A;  4RHR A;  3HOX G;  1PH9 A;  5CV6 A;  1NUC A;  2C35 B;  2K7V A;  2UU9 Q;  2R7Z G;  5IP7 G;  1D5X C;  3PCO B;  2R93 B;  4LFB L;  1LTT D;  1XWE A;  4HED A;  1TWA H;  2NVY H;  2YV5 A;  5C4Z A;  2VZA A;  3TN2 A;  5IP7 H;  4YY3 L;  2CQA A;  1Q7Y C;  2PQA A;  2NZH A;  5DEH A;  3NQI A;  3T1H L;  2E75 C;  1FGB D;  1KLU D;  4GNX B;  1LV9 A;  2E5L Q;  4IOC A;  1ZYR C;  2FIN B;  1JOK A;  4RAU C;  2K1B A;  5IT9 c;  4QUF A;  1F9P A;  1SNC A;  2NUC A;  4B3M L;  2VUM B;  1SLJ A;  1B8A A;  1CTM A;  3DLL A;  4B9W A;  4C3H G;  3I55 A;  2IT1 A;  3M7N A;  5HGT A;  3KOJ A;  2HIX A;  4IPH A;  1PFN A;  2QDL A;  1PDQ A;  4DV5 Q;  2IHE A;  4AH6 A;  4ILW A;  1R4P B;  2D0P A;  4N67 A;  2RF4 A;  1KDB A;  4I7A A;  3UDX A;  4LF4 Q;  1MBY A;  2N55 A;  1K28 A;  4C3H B;  1LTB D;  2M00 A;  2UUB Q;  3S16 B;  2YYZ A;  4CDD C;  4X62 L;  2F0P A;  1IZ6 A;  3T13 A;  1V1P B;  5CV5 A;  1IHZ A;  4LF4 L;  1B9M A;  1CKN A;  2A74 C;  2PQE A;  1S3O A;  1TU2 B;  1F2Z A;  1EYA A;  1AN8 A;  1B70 B;  2LXJ A;  5IY0 A;  1S5C D;  4HID A;  3CF5 A;  3PIP 3;  4LFA L;  3HOV G;  1U4M A;  3K5L A;  4FF1 A;  2JSO A;  3VR5 A;  1XYI A;  5CBA E;  3A74 A;  3HOU H;  1YJW A;  4R4Q A;  2HUG A;  3T16 A;  3QIA A;  4POF A;  1O7I A;  4DV1 L;  1TQO A;  1I4Q A;  1O7Z A;  2K75 A;  2Y0S B;  4DV4 L;  1MKH A;  1PMR A;  5FK9 C;  2JA8 H;  3GTM B;  3SEB A;  2UXC Q;  5FO9 B;  3G71 A;  4QMG A;  5KYL A;  2A6E D;  2RHQ B;  4WOR A;  1LYL A;  2I07 B;  2K33 A;  1U5K A;  4DV1 Q;  3BG3 A;  1IBL L;  4DV4 Q;  4DKA C;  4Q5V A;  1HNX Q;  4X64 Q;  4N8X 1;  5CMT A;  5C4J H;  1A6X A;  1DM0 B;  2A69 C;  4L5T A;  2HDM A;  2NN6 H;  4GNX A;  4X2D A;  5LMN L;  1JE4 A;  2B2V C;  3A8K E;  4LF7 Q;  2E8G A;  3M7G A;  4KHZ A;  3PIO A;  3EBE A;  2HHH L;  3HOW G;  4X3U A;  3BU2 A;  4DNT B;  2ASB A;  3SK6 A;  2ZM6 Q;  3HGB A;  2F0S A;  4GOP C;  2JQO A;  4LF7 L;  1C7Y A;  3HFZ B;  4IUQ A;  5IGC A;  4Y52 H;  2V1C C;  3GTM H;  4ODG A;  4V0B A;  4A3J G;  1PRT C;  5L37 A;  2C5C A;  1PYW D;  2L5T A;  3GTL H;  2B8G A;  4WJ4 A;  2LS0 1;  1L2F A;  1W6K A;  4IUP A;  2Q8I B;  2JA6 H;  1QCB D;  5M3M H;  2GVB A;  1ONL A;  2JJQ A;  4O1N A;  1HNW Q;  4OHJ A;  1VQB A;  1OO9 B;  2F0M A;  1CQV A;  2ZT9 C;  3FP9 A;  4CJ0 B;  4YHH Q;  1UUP A;  3ZJY C;  1BBW A;  1YHQ A;  4N8F A;  1M1K C;  3MAQ A;  2F03 A;  3BDO A;  3I4N B;  4A3B G;  4IOA A;  3RMH A;  4J6H A;  4P75 A;  1MD2 D;  5EKL A;  2B2V A;  5G3L D;  4A3D G;  4BY1 G;  5JVH 3;  3BVM A;  2I5M X;  1NH1 A;  4A3L H;  1GOZ A;  4IFD G;  4A3E G;  3CME A;  3GTK B;  1Y1V B;  4DV3 L;  1N36 L;  1VDZ A;  5BN3 A;  4OGQ C;  1STG A;  5ELF A;  1YNJ D;  4CKC A;  1GD7 A;  2WAC A;  4A76 A;  2R92 B;  4C2M B;  3EA6 A;  1GUW A;  1J5E Q;  2JE6 I;  5M5Y H;  1K83 B;  3Q6S A;  2VW9 A;  1OXV A;  2RCN A;  4BBR G;  1E0B A;  3PF5 A;  2K04 A;  1F77 A;  4FDB A;  4NPS A;  1W6J A;  1TII D;  1WTR A;  1VQ7 A;  2SDF A;  2KOL A;  2F3I A;  3GTQ H;  4A3C H;  3L9A X;  1V8Q A;  5NUC A;  2EXD A;  2F0K A;  4IUV A;  2VQE Q;  3HRZ C;  2AWO A;  1D1I A;  2IWH A;  3K0X A;  3NUC A;  4HSV A;  2WKC A;  2EZV A;  1Y1W B;  1ICW A;  3PUV A;  1TWG B;  1PA6 A;  3CCR A;  1PZK D;  3TQY A;  4BY1 B;  5FLX c;  1LAC A;  4YCV A;  4WRD A;  2MQH A;  4KJN A;  1KDC A;  2UXC L;  3NK9 A;  3KF6 A;  1TY0 A;  3AFQ A;  3K7U C;  1PH3 A;  1U9R A;  3TEH B;  3TSS A;  3EVQ A;  2YTX A;  5E4W C;  4NXM L;  1D6E C;  2KQ3 A;  4JI1 Q;  4BXX G;  2YTV A;  3OOC A;  5C3E B;  3BZK A;  3M9B A;  2JEA I;  4DR7 Q;  3GP7 A;  5T1G A;  2K01 A;  5J1Z A;  4IO9 A;  1VQ9 A;  1KXL A;  2JN4 A;  1XTD A;  2ICE C;  5IT9 E;  1DD2 A;  3IFT A;  1RF2 D;  1HA5 A;  1YZ6 A;  4DAV A;  1Q46 A;  5C44 H;  4XIG S;  2QW7 A;  2F0H A;  4QIW B;  3M4O H;  3HKZ E;  5IGE A;  2SNM A;  1BVS A;  2L0C A;  4M1U B;  3CCS A;  5M3F H;  3A5U A;  4JYA L;  2KEE A;  3CP0 A;  2F0E A;  4GN3 B;  3CC7 A;  5M5X B;  1QZH A;  1YEZ A;  5IGD A;  4CJ1 B;  1Y1W H;  3KBX A;  2R6G A;  1EFI D;  4U67 3;  2Z0S A;  1JJG A;  1WJJ A;  3J81 E;  2CWP A;  2A69 D;  4A3K B;  1HUM A;  4KMU C;  3ZC7 A;  3HOU G;  4OO1 I;  3NWT A;  1UEA B;  3ERS X;  4PV1 C;  3HOY H;  2B2W C;  4JI3 Q;  1FNU A;  3L7Z C;  3ND8 A;  2RDF A;  5IIF A;  3MXN B;  5JJI A;  2QCP X;  4B9X A;  3I4M H;  4LFC L;  3IL8 A;  4ZLT F;  5M5W B;  5COY A;  2NUN A;  4RGM A;  3K57 A;  1X54 A;  5FLX E;  2NN6 G;  4A3I G;  1XNR L;  3NP8 A;  5C3E H;  4LNQ A;  1WTV A;  3RNU A;  1R9T B;  1EOT A;  2XRQ D;  3I7F A;  4LFC Q;  1TT2 A;  5KRU A;  3GTP B;  4AYB G;  3CXC A;  3PO2 H;  4R4T A;  4XXE A;  1AH9 A;  1TWC B;  1HFN A;  2R61 A;  1EOV A;  3D6W A;  1FL0 A;  4R9W A;  2F0V A;  1MJE A;  2RSO A;  1S40 A;  4A3E H;  1JE5 A;  1GUT A;  2F4I A;  4LWC A;  2WP8 J;  2NVT B;  3H3V I;  2Z6K A;  2HIV A;  2K52 A;  1VQF A;  1Z9F A;  3E3X A;  1PH7 A;  1Y69 U;  4K0K Q;  4JI7 Q;  1SE4 A;  3MXN A;  2LFN A;  1G8Z D;  3TRE A;  1TS3 A;  3EN2 A;  4PY3 A;  3R3O A;  3CRL C;  2R7D A;  2FXQ A;  4JI8 L;  4A3J H;  5TSS A;  3PO3 B;  3CCL A;  5ELE A;  4JI7 L;  1YVC A;  3SK8 A;  1XMQ Q;  3MA2 B;  3H3V C;  3CPW A;  2AQ1 B;  3WDN A;  1HR0 W;  1J6Q A;  3F8T A;  2F4V Q;  5A2Q E;  1H9S B;  1OXU A;  1EUJ A;  3CRK C;  2Q2H A;  1RD9 D;  2EDG A;  2XSC A;  1L0W A;  5C6A A;  2JA5 B;  5ELC A;  4PMB A;  3T1Y Q;  3KUP A;  2HCI A;  1I4G A;  3UE0 A;  3G6E A;  4B3R L;  1IYU A;  1SNP A;  1SYD A;  4C3J B;  1YHA A;  4JBK A;  4DK3 C;  4NDX A;  1X9N A;  1IBK L;  2D9U A;  5ISR A;  4BY7 B;  1EWC A;  2FHT A;  1RIP A;  3NTK A;  1GHJ A;  2NZO A;  1BXT A;  5J39 A;  2A68 C;  1HZC A;  2N3S A;  2VB3 X;  3T1Y L;  1GKH A;  2QF7 A;  3NEL A;  2R92 G;  2K03 A;  3MEF A;  4HJ8 A;  5JJZ A;  1JOQ A;  2WKD A;  4DN4 M;  4A3E B;  1L1O A;  2E2H H;  4C2M H;  2PQA B;  1PRT B;  4EQN A;  3SGI A;  4LW1 A;  2IL8 A;  4DK6 C;  4HJ5 A;  4QJF A;  1N32 Q;  3OIP A;  5K36 H;  4OWT B;  4C1N I;  1NTG A;  5I2Y A;  3DWQ A;  3KF6 B;  4CKE A;  2PNH A;  4WGJ A;  3TP6 A;  1DZ1 A;  4KHP Q;  4WJW A;  3PF4 A;  3MEH A;  4CBV A;  2Z6K C;  3TZU A;  1LTL A;  1FNW A;  3TP7 A;  3K7A B;  1YNX A;  1G2S A;  4PMC A;  3UDI A;  1LO5 D;  2F52 A;  2RQX A;  4RCO A;  1DXM A;  1LT5 D;  4IUR A;  4I7Z C;  5IYB H;  2G03 A;  3NXW A;  3CC4 A;  1XMO L;  1DOL A;  5JFZ A;  4GN5 A;  2HDL A;  3DMU A;  2MP1 A;  1TR5 A;  1A2T A;  4ZAI A;  5F2D A;  5KND A;  5EQ0 A;  2VL6 A;  4GLV B;  2DJF C;  5A35 A;  1PRT F;  3S1R B;  2VNU D;  3NPP A;  1PH1 A;  1IW7 C;  3H94 A;  2IY5 B;  4MHE A;  5CV9 A;  5C4H A;  2LMC B;  3K0Y A;  1F9Q A;  1I4X A;  1ICF B;  3FKI B;  5DLQ E;  4E6I A;  4KJO A;  3K7A H;  3OPO A;  1E7Z A;  1SJH D;  5CR3 A;  1J8I A;  4K8J A;  5DNF A;  3LX0 A;  3D4D A;  4FP5 D;  1XJV A;  1VMC A;  3HOZ B;  3R93 A;  1QJO A;  2EYH A;  4OEL B;  1SSO A;  1HQM C;  2R7F A;  1TVX A;  5EAY A;  2NVX H;  5IYC H;  1QZG A;  5AJ3 L;  4A3G H;  1PYS B;  3FVQ A;  1L1O B;  2CH4 A;  4R8I A;  1H9J A;  2VS1 A;  4CDE C;  4A3I B;  1K3R A;  2E5L L;  1UAP A;  1S4Z A;  2XGT A;  2OTJ A;  5EPL A;  4A3F G;  1RKN A;  1RL2 A;  1S5E D;  4JOI C;  1VF5 C;  3U58 A;  3HOY G;  4RKL A;  1BBX C;  1JJC B;  2Q2U A;  1TWH B;  2DY7 A;  2E2I H;  3VA7 A;  2EYM A;  3S2D H;  3S14 B;  1X56 A;  4IQZ A;  2F0W A;  5I9O A;  2JA8 B;  3LWU A;  2AQ3 B;  2O5I C;  3AYH B;  1CUK A;  1F2Y A;  1H9M A;  2KED A;  2NBF A;  1K73 C;  4G7O C;  1CFM A;  1TKW B;  1YNN D;  4B3R Q;  4UY8 C;  5EPJ A;  4BS9 A;  3AB9 A;  3RR5 A;  1T9H A;  1LUZ A;  2HHH Q;  3KLS X;  1ZYR D;  1ILQ A;  3HOW B;  2L12 A;  1K0S A;  3LET A;  5JPM C;  3DWA A;  2F1M A;  4A3I H;  3RZD B;  3J80 i;  1XNQ L;  5FLX L;  1A2U A;  2A19 A;  1CA5 A;  3RLN A;  1B3Q A;  3NQT A;  5FJ8 H;  1KL9 A;  1PH8 A;  3MFG A;  1NY4 A;  1ZXT A;  1SNM A;  1JB7 A;  4MIU A;  4OX9 Q;  5CMD A;  2L11 A;  4CDC C;  3GO5 A;  1WYD A;  4MTN A;  3VR4 A;  2B3G A;  4EQ5 A;  1BCP D;  3GTO H;  1N32 L;  5JPN C;  2G5D A;  1K8G A;  2FFK B;  1BCP F;  1N8R C;  4OO1 H;  1STY A;  4YWM A;  3VDY A;  2HD3 A;  2B63 B;  1A63 A;  4PZ7 A;  4GS3 A;  3I70 A;  1LTS D;  4JPB W;  1PZJ D;  4MNO A;  3KDF B;  2EQS A;  2D0O A;  2SEB D;  2L4N A;  3S9W A;  3AQQ A;  2AWN A;  3PO3 G;  3J80 c;  4DR5 Q;  3I4N G;  4A3B B;  1DOK A;  3URY A;  1PV4 A;  3P7J A;  4CKB A;  1AZQ A;  3C46 A;  2CH4 W;  4ZUJ A;  1SFO B;  2GN5 A;  2RDH A;  2EYL A;  1XMO Q;  4B3S L;  3GTL B;  1QVC A;  5IWA Q;  1KRS A;  3STB D;  4HIO A;  1BDO A;  2E2J H;  3DM3 A;  4X66 Q;  4B3M Q;  1VF7 A;  1ENC A;  4X6A H;  4XQN A;  1GUN A;  2AUJ D;  4LF6 Q;  1FYC A;  1ILP A;  4IZ8 A;  2GVA A;  4DV6 L;  1X3Q A;  2B63 H;  1X32 A;  4XYO A;  1Z7T A;  3FPP A;  3KF8 B;  3V2T A;  3UI2 A;  3TZD A;  2DUD A;  2ICI A;  3K5N A;  4DR6 L;  3J80 L;  1WD0 A;  5BN4 A;  1LT3 D;  4JVZ A;  4L5Q A;  2QDB A;  3GQB A;  1I4P A;  2F3W A;  4QQB X;  1BOS A;  4DR6 Q;  4P72 A;  3N3U A;  4DR4 L;  4C3J G;  4PNY A;  1XXG A;  3TP5 A;  3N6R A;  4TSS A;  3F2U A;  1MGS A;  3OSO A;  1M90 C;  4DR1 Q;  1EIH A;  2E2J B;  2TMP A;  2PO4 A;  2QEX A;  1VQE A;  1BR9 A;  1Z47 A;  5J3B A;  3Q23 A;  4DR4 Q;  1SXT A;  4YWK A;  5IT9 L;  2B29 A;  4A3M G;  1VQP A;  2ZJP A;  1Y14 B;  3G4S A;  2X69 A;  5CV8 A;  4U07 A;  2MJ8 A;  4OEM B;  1C8C A;  2EY2 A;  2OT2 A;  4DV3 Q;  1N36 Q;  3CHB D;  4BY1 H;  5IE8 A;  1GHK A;  3KDF A;  1S5B D;  3I8Z A;  1EIY B;  5GRO A;  5CV4 A;  1PTO C;  1QOH A;  1U4L A;  1H95 A;  3GV3 A;  5COR A;  3HP3 A;  1EIG A;  4XYQ A;  3NBH B;  2D2C C;  1A0I A;  2V4D A;  5EBC A;  1KAA A;  4OWX B;  4JBM A;  2UUA Q;  1I94 Q;  3OWF A;  1XNQ Q;  3C2P A;  2A68 D;  1B7Y B;  1LT4 D;  1F2M A;  4AIM A;  1M8A A;  3O13 A;  3L2P A;  4DV7 Q;  1D7Q A;  1B50 A;  4OX9 L;  2KBN A;  4NXN Q;  1OXX K;  1NMF A;  3L3O C;  4ID6 A;  4JI4 L;  1G91 A;  2EE1 A;  3BYT B;  2O5J C;  3HOZ G;  4A3G B;  5C4J B;  1ASZ A;  2B2W A;  1L1O C;  2DN8 A;  4MN3 A;  4LUV A;  4L5S A;  2KVM A;  5JEA J;  4DAM A;  2PZW A;  2NVY B;  3GTG H;  3CW2 C;  4EVO A;  2F0L A;  4K5W A;  4QY7 A;  3BDC A;  5ELO A;  1PHJ A;  4DR5 L;  5JJK A;  5EGT A;  2F3V A;  1C0A A;  1FVI A;  1K3B C;  3M4Q A;  4DR3 L;  3RN5 A;  3MTS A;  4H44 C;  2MPM A;  3PUY A;  4HN7 A;  2KHI A;  2K4K A;  2J4X A;  3SR1 A;  3E9I A;  2EYJ A;  3ND9 A;  1YJN A;  1VQJ A;  1HQR D;  1WTW A;  3S1Q H;  1A8V A;  1KNE A;  4DR2 L;  1JOO A;  1KAB A;  2ZTD A;  4JI0 Q;  2JA6 B;  4NMZ A;  2EJG C;  1I50 B;  1ZKO A;  1CM9 A;  3FPU B;  3I2Z A;  4A3F B;  1T5E A;  2RVL A;  4XT3 B;  3LNN A;  1GM5 A;  1CK1 A;  1JCK B;  1TWF H;  4X65 L;  3K80 C;  3RLF A;  2RSN A;  5A2Q L;  1QG7 A;  4ZCK A;  1GUS A;  3TP8 A;  2ZM6 L;  4JI2 Q;  4IN3 A;  2K5W A;  4F8M A;  3S15 H;  5M3F G;  1EY0 A;  1D8L A;  5M3M B;  1IL2 A;  2MNA A;  1Z6H A;  4OWW B;  2MGS A;  4PZ8 A;  1STB A;  1E3P A;  3VYS A;  5C0X G;  4IUT A;  3EFX D;  4Y7N H;  1PRT D;  2P5Z X;  5KGU A;  5C5M A;  1KRT A;  4JI3 L;  3HOU B;  1IYJ B;  3K8A A;  1PH2 A;  4RWS C;  4BWG B;  3BS1 A;  5GAD C;  3CCJ A;  1HHV A;  2B8F A;  1V1P A;  5IGB A;  3S1N H;  1QVF A;  1SDF A;  1EQV A;  4KTA A;  4LUO A;  3TDQ A;  3U4V A;  5C3W A;  2VQE L;  1IKM A;  1NMG A;  1LTA D;  1EL0 A;  3KJP A;  1Q86 C;  2UXB Q;  1PFB A;  4C3I G;  3J81 c;  4DV2 L;  4JI6 L;  4FF2 A;  1UE5 A;  3H91 A;  4IPD A;  3AMU A;  3C1F A;  1WTP A;  1KLG D;  3HEJ A;  3OTO Q;  2ZXP A;  2JA5 H;  1Y8P B;  2Z6B A;  1JIC A;  1I50 H;  2F0G A;  5M5Y B;  4FXD A;  2UXB L;  1LLR D;  1ENA A;  3QR8 A;  1VQ4 A;  2WFW A;  1Q3L A;  4L8J A;  3SDZ A;  1FNV A;  2E76 C;  1WTQ A;  3I73 A;  3OTO L;  1IBM Q;  1BBU A;  5LL6 S;  4A93 H;  1TY2 A;  1YBY A;  3P20 A;  3VYU A;  4R1J A;  1O78 A;  4OIJ A;  5JAV A;  3JAM c;  2CW0 C;  2YU9 B;  3DXJ C;  4Y7N B;  3TBI B;  5LMN W;  3HOX B;  1LT6 D;  3MHB A;  1CI3 M;  2BCO A;  2B2U C;  3VA5 A;  4DAY B;  4ZRZ A;  1SYG A;  3DEO A;  3U9S A;  3VYT A;  2R7Z H;  1V9P A;  1D5M C;  4TKO B;  1SRO A;  2PNR C;  2UUB L;  2IX3 A;  4FVM A;  2RA4 A;  4AQY L;  4HCE A;  4LF9 L;  2R3Z A;  2YTY A;  5C44 B;  5FLM G;  3KLR A;  3DM1 A;  1QVG A;  1CKM A;  4IUU A;  3I72 A;  4LF8 Q;  1HFG A;  3RN2 A;  3WWV A;  1KDA A;  1PH5 A;  2F0D A;  3QOL A;  5IYB G;  1EY9 A;  3HKS A;  1N33 L;  3R2T A;  4X2E A;  2YU9 H;  1SMY C;  3G7L A;  5C5L A;  2JXM B;  1A3U A;  1YJ9 A;  3CC2 A;  5KYI A;  3VR2 A;  1S72 A;  2KUM A;  2LKV A;  2O2L D;  1IYV A;  2PYK A;  3ZYY X;  1S5D D;  3J81 i;  3M4P A;  3S1R H;  1VS0 A;  4FYD A;  1EEF D;  2PW5 A;  1JWU D;  4G7H C;  4A3K H;  4KHP L;  2VUM G;  2VQF Q;  3DWP A;  4B3T L;  4ALP A;  1WCM B;  1V1Q A;  2LXK A;  4I65 A;  4TVA B;  2JK8 A;  2NN6 I;  3VR6 A;  4C56 C;  5FO8 B;  1JQY D;  2Q8T A;  4JK1 C;  5C3E G;  3T51 B;  1Q8I A;  2UU9 L;  2WAQ G;  4CDF C;  2OWO A;  4A3G G;  2UUC L;  1G6P A;  4B3T Q;  3KF8 A;  3N52 A;  3J7Y W;  4POG A;  2R93 G;  2ATW A;  3GTQ B;  1SJE D;  4RA8 A;  3HOV H;  1XPO A;  4PZ6 A;  1YIT A;  1FJG L;  3WOF A;  4UHV A;  4YCW A;  2Y0S G;  2K28 A;  3SE0 A;  1DJR D;  4RGT A;  1TWC H;  1I4H A;  3KK7 A;  1HUN A;  4X2C A;  2CCZ A;  1BUV T;  5C0X H;  4UP9 A;  3ER0 A;  3S17 B;  5D14 A;  1WD1 A;  4JV5 L;  4NKL A;  1K9M C;  4XI8 A;  3H3V H;  1CSP A;  1F9S A;  3CKI B;  3ZCB A;  3D3R A;  1QUQ B;  3OW2 A;  3DHQ A;  1SYF A;  2RKS A;  1QIL A;  5M3M G;  4DK1 A;  2B39 A;  1VQH A;  3S24 A;  3OYY A;  2DNE A;  4JV5 Q;  2IW3 A;  1LTI D;  1W3S A;  4ZYS A;  5I6Y A;  5KNC A;  3JAM L;  1RDP D;  4FF4 A;  4JI5 Q;  1ASY A;  1N9W A;  2OF1 A;  1Q82 C;  4ITR A;  2B2Y C;  1VQC A;  3HZX A;  3CMA A;  4JCV E;  2CKZ B;  1SN8 A;  2F0F A;  1MSH A;  3S14 H;  3S2D B;  2PCF B;  4N9T A;  2UXD L;  5E7N A;  4QIW E;  4RKB A;  2DJG C;  1CKO A;  1HNZ Q;  3FHW A;  3S2H B;  4LF5 L;  4J1M A;  4A3D H;  1SND A;  5C4X B;  1HPC A;  1EY4 A;  4LFA Q;  3E0J A;  3Q8D A;  2X6G A;  1KQS A;  2BE5 D;  3M85 A;  5ELB A;  1DON A;  4U0U A;  3HOV B;  2XTI A;  4BA2 I;  4N9P A;  3PMF A;  5M3F B;  1HR0 Q;  1EWH A;  3MFY A;  2UXD Q;  2F0T A;  5CYU A;  1EYD A;  1SBB B;  2ZTE A;  2JA6 G;  3H0G H;  2NVQ B;  1A3V A;  2KJX A;  5K36 G;  3S17 H;  1B1Z A;  2N78 A;  4DA2 A;  4FNF A;  2Q2I A;  3V05 A;  4F88 A;  5IP9 H;  3GD7 A;  3J80 E;  5LMU L;  1PFS A;  3DEP A;  5HY6 A;  1IBL Q;  2XVS A;  3ULP A;  2QKI C;  1G51 A;  2SNS A;  4A75 A;  4G7Z C;  3TS0 A;  4U0Z A;  4LF8 L;  2BA1 A;  1EY7 A;  1VQ5 A;  4DAP A;  3J7A F;  1TWA B;  2L9H A;  1HRJ A;  3LWE A;  2B2T C;  4C3I B;  1N33 Q;  2SOB A;  2BE5 C;  5GAE C;  2B2Y A;  1CA6 A;  2DGY A;  4RMF A;  1VQ8 A;  4JC0 A;  4UP7 A;  1AW7 A;  3JAM i;  2OQK A;  4IFD I;  2BA0 A;  3R2I A;  1E2Z A;  4A3B H;  2LSS A;  5EJW A;  2NB0 A;  4ZKB B;  2C9O A;  2EVB A;  1L0X B;  2M9V A;  1EWI A;  1SNO A;  4DUZ Q;  2I0Q A;  4LAA A;  1IW7 D;  1H9K A;  5KEE A;  1RCV D;  5JEA H;  5CBE E;  2AKW B;  3I90 A;  4A3L G;  1GJX A;  1GVP A;  1N34 Q;  2ES2 A;  1RJT A;  3MZ5 A;  2QIL A;  3H0G G;  1G2T A;  3RD4 A;  1HTP A;  2QA4 A;  2PMZ E;  3M4Y A;  1M4V A;  3Q0A A;  1O7Y A;  5H1S E;  5JFF A;  1S5F D;  3S16 H;  4KN4 C;  2JA7 B;  4GKK Q;  3PO3 H;  1EEI D;  5AJ3 Q;  1N34 L;  2K5Q A;  3FDT A;  2MUY A;  4GLX A;  4NB3 A;  4IPG A;  5GQO A;  2KCM A;  1RHP A;  5IGG A;  5KNB A;  5E3F A;  2HCC A;  2AQ2 B;  3VR3 A;  4P2C B;  2QGQ A;  3DUZ A;  5IOC A;  1HZB A;  1CZW A;  1VQI A;  4EQP A;  2XWB B;  3PIO 3;  1Y8O B;  1WCM G;  4JW0 A;  1SE2 A;  5EKK A;  5IOD A;  3NBI A;  3T1H Q;  1DCZ A;  2HQL A;  1VQL A;  4QL5 A;  2EOT A;  4QB4 A;  1PFM A;  5E4X A;  2KA7 A;  1BKB A;  4A4I A;  1ENF A;  1VQD A;  1EFW A;  1VQM A;  5C3X A;  4GKJ Q;  2UUA L;  4IFD H;  1NNX A;  1PTO D;  3A5Z B;  4DGZ A;  1SEB D;  4CJ2 C;  4QF4 A;  1J5E L;  2L55 A;  5JEA G;  4RH6 A;  1X55 A;  4ZKC B;  3T53 B;  2N88 A;  4KK7 A;  1F2L A;  4KV6 A;  1H9S A;  1U4R A;  4DV5 L;  2CHB D;  1YHB A;  4RG1 A;  4BBS G;  2G9H D;  2L1B A;  4M8A A;  2MHV A;  1NJI C;  1UWV A;  3PUW A;  3D6C A;  4X62 Q;  1VQK A;  1U0L A;  5BR8 L;  3S1M B;  3MC0 B;  2Z4H A;  1TS2 A;  1VQN A;  4ABN A;  4A3C G;  1ET9 A;  4AYB B;  1HJP A;  1TWH H;  3BZD B;  1EYC A;  3HOW H;  1PZI D;  4P74 A;  4MTK A;  4K6L A;  2K6A A;  5LHY 1;  3E0E A;  1YIJ A;  2K14 A;  2B2T A;  3CQZ H;  4HMI A;  1Q8K A;  1NR4 A;  3UE1 A;  4OO1 G;  1NSN S;  2QEJ C;  2KHJ A;  3KLW A;  1EY5 A;  2AMC B;  1EY6 A;  2TSS A;  2JA9 A;  2Z4I A;  4DF7 A;  3GTO B;  3S6A A;  4H02 A;  4DR2 Q;  4YY3 Q;  4O0A A;  4KLK A;  4XT1 B;  1MHW C;  2PW7 A;  1BO0 A;  4FXK C;  1B53 A;  3OWE B;  1JR0 D;  1RTO A;  1JWM D;  3H6M A;  1CHQ D;  5D3D A;  1OXT A;  3ZLM A;  2CVR A;  4DPG A;  5IWA L;  3KJO A;  3GTG B;  4X66 L;  4EX5 A;  2K5V A;  4Z9C B;  4LF6 L;  3PO2 G;  2HQE A;  3BVG A;  4JI4 Q;  2EY6 A;  4R4O A;  2J0T D;  2CQO A;  4KI0 A;  1K8O A;  2EYP A;  4DAY A;  4DXG A;  3K5M A;  3HOZ H;  1ROD A;  2AHO B;  3B6Y A;  5C0X I;  1D1K A;  3GTK H;  1UE7 A;  2F0N A;  3AFP A;  3E6Z X;  4IJH A;  3CCU A;  1II3 A;  4R8N A;  4HSP A;  1U4P A;  3LGJ A;  3A0J A;  2CFM A;  1AEX A;  1FR3 A;  1STN A;  2M2L A;  1PTO F;  1RTN A;  1EY8 A;  4LK1 C;  2PZU A;  4A3F H;  4DV0 Q;  1AFP A;  5AFW A;  3I56 A;  3NEM A;  4MZ9 A;  1SFO H;  1PYB A;  1TWF B;  4DU9 A;  4HIM A;  1A62 A;  2BDO A;  4P71 A;  1CT1 D;  1AZP A;  3IAY A;  4DV2 Q;  4JI6 Q;  2KCC A;  2VY3 A;  1I6H H;  5G3L F;  1NAP A;  3F2D A;  1JWS D;  2FMC A;  1HNW L;  4RHS A;  4JI0 L;  3S1N B;  3RUZ A;  3RZO H;  2WB1 E;  1D5Z C;  4PG3 A;  1X3G A;  3CCQ A;  2D5D A;  2HT1 A;  5T1I A;  4BY7 G;  2BDN A;  4HIK A;  2JYO A;  5JVG 3;  1SYC A;  4BA1 I;  4OIK A;  2KCT A;  3NSW A;  3QOJ A;  4B3S Q;  3HG9 A;  3OIQ A;  2B63 G;  4KKS A;  4LFB Q;  1G6Z A;  4L5R C;  3PUX A;  2MO1 A;  4LMQ D;  4HJ7 A;  4V19 0;  4KKT A;  2ZJR A;  3EJI A;  2ZJQ A;  2F0J A;  1SNQ A;  1ZEQ X;  1SAP A;  4UP8 A;  3JC6 6;  1IKL A;  1I5F A;  1PTO B;  1E1O A;  4HR7 B;  4IPC A;  5I6W A;  4KHV A;  1L0Y B;  3CPF A;  4A3M B;  5I9P A;  3GDE A;  2EJM A;  2A6H D;  2CW0 D;  3U9O A;  1X3P A;  4LJZ C;  1B44 D;  3T56 B;  3U4Z A;  1B2T A;  3FEW X;  1D2B A;  1XMQ L;  3HKZ G;  4ZK9 B;  2WV6 D;  2ZXR A;  1AP0 A;  2EXZ A;  1BQQ T;  4K8I A;  4LF9 Q;  2CWA A;  4QGU A;  3W1B A;  5EU0 A;  4APV A; 
#chains in the Genus database with same CATH homology
 1LTL A;  1V9P A;  5C44 G;  3EIV A;  4JG2 A;  3I4N H;  1YI2 A;  1SRO A;  3HOX G;  1PH9 A;  2UUB L;  1KAW A;  1YNX A;  2C35 B;  2UU9 Q;  2R93 H;  3UDI A;  1K83 H;  2R7Z G;  5IP7 G;  4AQY L;  3PCO B;  2F52 A;  1JMC A;  4LF9 L;  4LFB L;  3HOX H;  4IFD J;  5GAG C;  1TWA H;  2NVY H;  2YTY A;  2YV5 A;  5IYB H;  2K5H A;  2G03 A;  5FLM G;  1E24 A;  2VZA A;  5IP7 H;  4YY3 L;  1Q7Y C;  1CKM A;  2PQA A;  1UEB A;  1QVG A;  3CC4 A;  4LF8 Q;  5IYD H;  3RN2 A;  2NZH A;  3WWV A;  1E22 A;  3T1H L;  1Y1W G;  1XMO L;  4GNX B;  4A3M H;  1PH5 A;  4GN5 A;  5JFZ A;  3CCV A;  2E5L Q;  5IYB G;  3HKS A;  1N33 L;  4IOC A;  3CUC A;  1OXS C;  4C3H H;  4X2E A;  4JOI A;  5IT9 c;  2YU9 H;  3FKI G;  1WFQ A;  4J15 A;  4B3M L;  2VL6 A;  4GLV B;  1SMX A;  3CCE A;  3J7A 5;  1SLJ A;  4GNX C;  1B8A A;  1YJ9 A;  4A93 G;  3CC2 A;  3DLL A;  1S72 A;  3I55 A;  2IT1 A;  3M7N A;  3KOJ A;  2HIX A;  1KHI A;  4IPH A;  2VNU D;  1PH1 A;  2IY5 B;  3J81 i;  2MO0 A;  3M4P A;  4DV5 Q;  1VS0 A;  2IHE A;  4AH6 A;  3S1R H;  2D0P A;  4UPA A;  4A3K H;  5DLQ E;  4N67 A;  4KHP L;  2UUC Q;  4XTC S;  2VUM G;  2VQF Q;  2RF4 A;  5C0X J;  4B3T L;  3J81 j;  4ALP A;  2PI2 E;  3K7A H;  3UDX A;  4LF4 Q;  1V1Q A;  2LXK A;  3SN9 A;  4TVA B;  2JK8 A;  2NN6 I;  4DR7 L;  1E7Z A;  4A3K G;  5C3E G;  4NXN L;  2UUB Q;  1VQ6 A;  2UU9 L;  1XJV A;  2YYZ A;  3S1M H;  2WAQ G;  4X62 L;  1IZ6 A;  2OWO A;  4A3G G;  2UUC L;  1G6P A;  4B3T Q;  2R7F A;  5EAY A;  2NVX H;  5IYC H;  5LMN Q;  1CKN A;  4LF4 L;  4POG A;  2H5X A;  3PGZ A;  4R4C A;  1QZG A;  2ATW A;  5AJ3 L;  4JYA Q;  3HOV H;  4A3G H;  1PYS B;  1XPO A;  1MJC A;  1S3O A;  4PZ6 A;  1L1O B;  2OTL A;  2K50 A;  1YIT A;  1FJG L;  1WCM H;  2VS1 A;  2LXJ A;  1K3R A;  1B70 B;  5IY0 A;  4YCW A;  2E5L L;  1P8L A;  2Y0S G;  4HID A;  3CF5 A;  4LFA L;  3HOV G;  1TWC H;  2XGT A;  4X2C A;  2CCZ A;  2OTJ A;  4A3F G;  4UP9 A;  3ER0 A;  3A74 A;  1RL2 A;  2ALY B;  3HOU H;  4JOI C;  1YJW A;  4JV5 L;  3U58 A;  4R4Q A;  2WB1 G;  3HOY G;  1K9M C;  4XI8 A;  1JJC B;  4POF A;  1O7I A;  5GAH C;  4DV1 L;  2Q2U A;  2E2I H;  4DR3 Q;  3H3V H;  1CSP A;  2K75 A;  5CKL A;  3ZCB A;  4DV4 L;  3I4M G;  1MKH A;  1QUQ B;  1OTC A;  3OW2 A;  3S2D H;  2JA8 H;  5M3M G;  1X56 A;  1VQH A;  2UXC Q;  3G71 A;  3S24 A;  1W2B A;  1K8A C;  3AYH B;  3OYY A;  1CUK A;  2RHQ B;  4JV5 Q;  1K73 C;  1LYL A;  1W3S A;  3KFU A;  4B3R Q;  3D0F A;  4UY8 C;  1U5K A;  4DV1 Q;  1IXR A;  2F6S A;  3RR5 A;  4JI5 Q;  1ASY A;  1N9W A;  1IBL L;  4DV4 Q;  1C9O A;  4ITR A;  1T9H A;  1VQC A;  1LUZ A;  4DKA C;  4X64 Q;  3CMA A;  1Q82 C;  1HNX Q;  3PV0 A;  4JCV E;  2HHH Q;  4LF5 Q;  5CMT A;  5C4J H;  2CKZ B;  1SN8 A;  4L5T A;  4NXM Q;  3LET A;  4GNX A;  4X2D A;  5LMN L;  3S14 H;  1LM0 A;  4A3I H;  4LF7 Q;  4DUY L;  1PH6 A;  4X65 Q;  2E8G A;  3J80 i;  1XNQ L;  2A19 A;  2UXD L;  5E7N A;  2K5N A;  3RLN A;  1E1T A;  1UE1 A;  4KHZ A;  1KL9 A;  5FJ8 H;  1WOC A;  3EBE A;  4QIW E;  5IYC G;  3PIO A;  1CKO A;  4DNI A;  3FHW A;  1PH8 A;  1NY4 A;  1HNX L;  1HNZ Q;  2HHH L;  1JB7 A;  4LF5 L;  4OX9 Q;  3HOW G;  3ICE A;  4A3D H;  3BU2 A;  3GO5 A;  1WYD A;  4MTN A;  1TXY A;  1NBW A;  3Q8D A;  2B3G A;  4LFA Q;  4EQ5 A;  1KQS A;  2ASB A;  1Q12 A;  5FJ8 G;  3M85 A;  2ZM6 Q;  3GTO H;  1N32 L;  4U0U A;  2I5H A;  3G48 A;  2JQO A;  2WAQ E;  2XTI A;  4DV6 Q;  4GOP C;  1K8G A;  4LF7 L;  4BA2 I;  1C7Y A;  3HFZ B;  1N8R C;  1HR0 Q;  2UXD Q;  4Y52 H;  2V1C C;  3GTM H;  4YWM A;  3VDY A;  4K0K L;  4A3J G;  3GTP H;  1VQO A;  2ZTE A;  1KC8 C;  2JA6 G;  3H0G H;  1A63 A;  5K36 G;  4PZ7 A;  3GTL H;  3S17 H;  4GS3 A;  2RHS B;  4WJ4 A;  1L2F A;  3S2H H;  2N78 A;  4MNO A;  1XPU A;  3PUZ A;  2Q2I A;  3KDF B;  2EQS A;  2A1A A;  3ULL A;  2D0O A;  2JA6 H;  2Y0S E;  2JA8 G;  5M3M H;  2R93 G;  5IP9 H;  3GD7 A;  5LMU L;  1VQA A;  1PFS A;  3AQQ A;  2AWN A;  5HY6 A;  2OQ0 A;  2NVT H;  3PO3 G;  1R9T H;  2GVB A;  1IBL Q;  3ULP A;  3J80 c;  1SE8 A;  4DR5 Q;  2JJQ A;  4GOP B;  1CKN B;  1G51 A;  3I4N G;  1HNW Q;  4A75 A;  1PV4 A;  1VQB A;  3F2B A;  3TS0 A;  2JA5 G;  4U0Z A;  1X65 A;  4LF8 L;  2BA1 A;  3PIP A;  4DR1 L;  1VQ5 A;  2F4V L;  2GN5 A;  1XMO Q;  4B3S L;  2D62 A;  3FP9 A;  3UDF A;  1QVC A;  3PSI A;  4YHH Q;  1EQQ A;  1N33 Q;  4DUZ L;  5IWA Q;  3ZJY C;  1BBW A;  1KRS A;  2JEB I;  1EIF A;  4C3I H;  3STB D;  5GAE C;  1YHQ A;  1M1K C;  4A3B G;  4HIO A;  2DGY A;  4RMF A;  1VQ8 A;  4JC0 A;  3DM3 A;  4X66 Q;  2E2J H;  4B3M Q;  4IOA A;  4UP7 A;  4X6A H;  4LF6 Q;  4P75 A;  3JAM i;  1XNR Q;  2OQK A;  4IFD I;  5C4X G;  2BA0 A;  5ELN A;  4A3B H;  2GVA A;  2LSS A;  4DV6 L;  4BY1 G;  2B63 H;  4A3D G;  2I5M X;  3KF8 B;  4A3L H;  4YHH L;  1Y1V H;  1EWI A;  4A3E G;  4DUZ Q;  3CME A;  2I0Q A;  2BH2 A;  4IFD G;  2DUD A;  4DV3 L;  1N36 L;  4DR6 L;  2A8V A;  1IBM L;  4M16 A;  2AKW B;  4A3L G;  1GD7 A;  3IRB A;  4A76 A;  4GKK L;  1GVP A;  1N34 Q;  2ES2 A;  4GOP A;  4L5Q A;  1J5E Q;  5HGQ A;  2JE6 I;  1Q81 C;  3H0G G;  5M5Y H;  2VW9 A;  3BJU A;  1OXV A;  1NE3 A;  2QA4 A;  5LMU Q;  4QQB X;  2RCN A;  2PMZ E;  4BBR G;  3UDG A;  4GLA C;  4P72 A;  3PF5 A;  4BBS H;  4DR6 Q;  3N3U A;  1CSQ A;  1GO3 E;  4NPS A;  3BZC A;  4FDB A;  5JFF A;  5H1S E;  3S16 H;  4DR4 L;  1I94 L;  1TWG H;  4GKK Q;  3PO3 H;  2JA7 H;  1VQ7 A;  5AJ3 Q;  1HZA A;  1N34 L;  1M90 C;  1QUQ A;  2IX1 A;  4DR1 Q;  4GLX A;  2F3I A;  4NB3 A;  4IPG A;  1AE3 A;  4OXP A;  5GQO A;  1VQE A;  2KCM A;  2QEX A;  1Z47 A;  4AQY Q;  5J3B A;  3GTQ H;  4A3C H;  2EXD A;  4BY7 H;  5FLM H;  4DR4 Q;  2QGQ A;  5IYD G;  2VQE Q;  3W5O A;  2AWO A;  4YWK A;  1HZB A;  1HZ9 A;  2B29 A;  3K0X A;  1VQI A;  4A3M G;  1VQP A;  1WCM G;  1XPR A;  4JBW A;  2ZJP A;  1Y14 B;  3G4S A;  3PUV A;  3T1H Q;  4P73 A;  1PA6 A;  3K81 C;  2EIF A;  2HQL A;  3CCR A;  4QL5 A;  1VQL A;  4U07 A;  4U04 A;  4GN4 B;  2ID0 A;  1BKB A;  3TQY A;  4A4I A;  5FLX c;  1VQD A;  1EFW A;  4DV3 Q;  4YCV A;  4YCU A;  1N36 Q;  2MQH A;  1VQM A;  4BY1 H;  2UXC L;  5IE8 A;  4GKJ Q;  3KDF A;  2UUA L;  1EIY B;  3I4O A;  1Y1V G;  3KF6 A;  5GRO A;  3A5Z B;  1G29 1;  1J5E L;  5JEA G;  3AFQ A;  1EYG A;  1X55 A;  3K7U C;  1PH3 A;  4JI5 L;  5JJL A;  3TEH B;  1H95 A;  3NBH B;  1A0I A;  2YTX A;  4OWX B;  4HJ9 A;  4JBM A;  4AYB E;  4NXM L;  2UUA Q;  4DV5 L;  4JBJ A;  2BH8 A;  1I94 Q;  4JI1 Q;  1YHB A;  4OON A;  4BXX G;  2YTV A;  4RG1 A;  4DUY Q;  3BZK A;  3M9B A;  2JEA I;  4DR7 Q;  3AEV A;  1XNQ Q;  2N49 A;  4BBS G;  1B7Y B;  4IO9 A;  1VQ9 A;  1KXL A;  4AIM A;  1XTD A;  5M5X H;  1NJI C;  3L2P A;  4DV7 Q;  1D7Q A;  1UWV A;  3SHG A;  3PUW A;  4X62 Q;  1VQK A;  4OX9 L;  1U0L A;  1YZ6 A;  2KBN A;  4NXN Q;  1OXX K;  5BR8 L;  1Q46 A;  5C44 H;  1NMF A;  4XIG S;  3U50 C;  4JI4 L;  1VQN A;  4R4I A;  4JI1 L;  4A3C G;  4WJ3 M;  3M4O H;  1HJP A;  1TWH H;  3HOZ G;  3HKZ E;  1AE2 A;  3HOW H;  1BVS A;  1FJG Q;  1ASZ A;  4P74 A;  3CCS A;  1WI5 A;  1P16 A;  1L1O C;  5M3F H;  3A5U A;  4JYA L;  4LUV A;  3E0E A;  4L5S A;  3CP0 A;  1YIJ A;  2K14 A;  3NEN A;  3CQZ H;  4GN3 B;  3CC7 A;  1Q8K A;  5JEA J;  4DAM A;  1QZH A;  3TS2 A;  1SRU A;  1YEZ A;  1PH4 A;  3UE1 A;  1Y1W H;  3GTG H;  4OO1 G;  2KHJ A;  3CW2 C;  2R6G A;  3KLW A;  2AMC B;  4HJA A;  2JA9 A;  2Z0S A;  1JJG A;  1WJJ A;  4QY7 A;  1X3E A;  3ULJ A;  2CWP A;  3H15 A;  3S6A A;  3FKI H;  4H02 A;  5ELO A;  4YY3 Q;  4O0A A;  4DR5 L;  4DR2 Q;  1PHJ A;  5JJK A;  1C0A A;  4KLK A;  1FVI A;  3ZC7 A;  3M4Q A;  3HOU G;  4OO1 I;  4DR3 L;  3RN5 A;  3ERS X;  3KYH C;  3HOY H;  4JI3 Q;  3PUY A;  4IJL A;  3L7Z C;  1K0R A;  3MXN B;  5JJI A;  2MFI A;  2KHI A;  2K4K A;  1EQR A;  1OXT A;  2IX0 A;  3ZLM A;  4JI8 Q;  4LFC L;  4DPG A;  5M5W H;  3E9I A;  3I4M H;  5IWA L;  3KJO A;  1Q1E A;  1VQJ A;  1V43 A;  1YJN A;  3S1Q H;  1A8V A;  4DV7 L;  4DR2 L;  1SR3 A;  2I5L X;  2N8N A;  4X66 L;  2ZTD A;  1X54 A;  3L0O A;  2NN6 G;  2K5V A;  4EX5 A;  4JI0 Q;  3TRZ A;  4A3I G;  4LF6 L;  1XNR L;  3PO2 G;  5C3E H;  4LNQ A;  4JI4 Q;  1JT8 A;  2ZTC A;  4R4O A;  3RNU A;  3D31 A;  4PMW A;  3I2Z A;  3I7F A;  4LFC Q;  2KEN A;  2CQO A;  4KI0 A;  4AYB G;  3CXC A;  3PO2 H;  4R4T A;  4U0S A;  1GM5 A;  2NVQ H;  1AH9 A;  1TWF H;  4X65 L;  3K80 C;  1EOV A;  3RLF A;  1FL0 A;  3HOZ H;  2AHO B;  3B6Y A;  5C0X I;  1FGU A;  3GTK H;  1UE7 A;  1MJE A;  2ZM6 L;  4JI2 Q;  3AFP A;  3CCU A;  4IJH A;  5M3F G;  1HNZ L;  1D8L A;  1S40 A;  3S15 H;  4A3E H;  1JE5 A;  1HH2 P;  4LWC A;  2WP8 J;  1IL2 A;  2MNA A;  4YWL A;  2Z6K A;  4OWW B;  3LGJ A;  3H3V I;  2HIV A;  3A0J A;  1MIU A;  2CFM A;  1VQF A;  1Z9F A;  2K52 A;  4PZ8 A;  1PH7 A;  4K0K Q;  1E3P A;  4JI7 Q;  3W1G A;  5C0X G;  3TRE A;  4A3F H;  4DV0 Q;  4Y7N H;  1HR0 L;  3EN2 A;  3I56 A;  4PY3 A;  2IHF A;  3NEM A;  4MZ9 A;  5IP9 G;  1PYB A;  1SFO H;  1KRT A;  3CAM A;  2Q2T A;  4JI3 L;  2R7D A;  2FXQ A;  1IYJ B;  4HIM A;  1A62 A;  3K8A A;  1UE6 A;  4P71 A;  4JI8 L;  4BBR H;  4A3J H;  4DV2 Q;  1PH2 A;  4JI6 Q;  3CCL A;  4C3J H;  2VY3 A;  5GAD C;  1I6H H;  3CCJ A;  4JI7 L;  1YVC A;  3CCM A;  1XMQ Q;  3S1N H;  3F2D A;  1QVF A;  1HNW L;  3U4V A;  4LUO A;  2VQE L;  3F1Z A;  4JI0 L;  3STB C;  3CPW A;  1NMG A;  1HR0 W;  3RZO H;  2WB1 E;  1J6Q A;  3KJP A;  3F8T A;  1VQG A;  4PG3 A;  1Q86 C;  3RZD H;  1X3G A;  3CCQ A;  2UXB Q;  1X6O A;  2F4V Q;  2HT1 A;  4LUZ A;  1OXU A;  1EUJ A;  4BY7 G;  3J81 c;  2Q2H A;  4DV2 L;  4HIK A;  4JI6 L;  1UE5 A;  4IPD A;  4O2D A;  1I3Q H;  4BA1 I;  1L0W A;  2KCT A;  4TQU S;  3M3Y H;  3OTO Q;  3T1Y Q;  4GKJ L;  3UE0 A;  4B3S Q;  3G6E A;  2JA5 H;  4B3R L;  5CGL A;  2B63 G;  1PVO A;  1YHA A;  4JBK A;  1I50 H;  4JI2 L;  3RLO A;  4LFB Q;  4DK3 C;  1X9N A;  4L5R C;  1IBK L;  3PUX A;  2MO1 A;  4X64 L;  2UXB L;  1KD1 C;  4HJ7 A;  1VQ4 A;  2WFW A;  1RIP A;  1Q1B A;  2ZJR A;  2NZO A;  3F2C A;  2ZJQ A;  2N3S A;  1HZC A;  2L15 A;  3GTJ H;  3OTO L;  3T1Y L;  1GKH A;  1BBU A;  4DV0 L;  4UP8 A;  5C4X H;  3JC6 6;  1IBM Q;  1I5F A;  3NEL A;  4IPC A;  1E1O A;  1KIX A;  5JJ7 A;  2R92 G;  3MEF A;  4A93 H;  1YBY A;  4HJ8 A;  1L1O A;  1X3F A;  2E2H H;  4C2M H;  4R1J A;  3CPF A;  1IBK Q;  2PQA B;  3GDE A;  3SGI A;  2PI2 A;  4LU4 A;  4LW1 A;  3CD6 A;  4DK6 C;  4HJ5 A;  3E9H A;  1JJ2 A;  2R92 H;  3JAM c;  4QJF A;  3U4Z A;  1N32 Q;  3SE5 A;  4OWT B;  1NTG A;  2VUM H;  5LMN W;  5BR8 Q;  1XMQ L;  2JA7 G;  3J7Z C;  4BXX H;  3KF6 B;  5JJ6 A;  2PNH A;  3HKZ G;  1DGS A;  4WGJ A;  4KHP Q;  2OCE A;  4LF9 Q;  4ME3 A;  2CWA A;  4QGU A;  2VQF L;  3PF4 A;  3W1B A;  5EU0 A;  1VCI A;  4DAY B;  2Z6K C;  4APV A;  2R7Z H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...