2JK8A

Type iv secretion system effector protein bepa complexed with a pyrophosphate moiety
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
291
structure length
291
Chain Sequence
EIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCSHDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMPEMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHPFREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDISNPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYIIGNIDHLPPEQLKILKPGDKITFTAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE CELL FILAMENTATION PROTEIN (BEPA PROTEIN)
publication title Fic Domain Catalyzed Adenylylation: Insight Provided by the Structural Analysis of the Type Iv Secretion System Effector Bepa.
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Cell adhesion
total genus 90
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 2jk8A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2jk8A02
2JA5H 3JAMc 4A3DG 2K50A 2QEXA 2CQOA 4LFCL 2KCTA 5IYCH 1Y1WH 4X2EA 1VQIA 1J5EL 3I55A 3HOZG 1E3PA 3B6YA 4GLXA 4JYAL 3KDFB 4AQYL 4ME3A 3KFUA 2E2HH 1MKHA 3I2ZA 3GTMH 4GKKQ 1PH9A 5FJ8H 4LF8L 1OXUA 2YU9H 4QL5A 2F6SA 2KHIA 4JI3L 1JMCA 5IYCG 1VCIA 4GN5A 4DV7Q 1Y1WG 1K73C 4GOPB 1X9NA 1KC8C 2JA9A 1JT8A 5IYDG 3F2DA 5IT9c 1N34Q 4QJFA 2EXDA 1P16A 2R92H 2HHHL 1JE5A 2KCMA 4ALPA 1L0WA 1XNRQ 5M3MG 4B3TQ 1CKNA 3M4PA 3T1HQ 4POGA 3J7A5 3HOUG 4YWMA 1UWVA 2UUCL 3U4ZA 4A76A 5HY6A 5LMNQ 1IBMQ 3S2DH 2R92G 1CKMA 2D62A 4OX9L 1EOVA 1LM0A 3HKSA 1VQAA 3CAMA 3UE0A 4JBJA 4OWXB 1L1OA 1YVCA 4A3MH 1VQ9A 5JFZA 2JA6G 3HOVH 1YEZA 1VQKA 4IPHA 1PVOA 2Q2UA 1LTLA 2IY5B 5GAGC 3J7ZC 2Z0SA 1QVCA 1JJGA 2WP8J 4P72A 2ZJPA 1YHQA 1TXYA 5C3EG 1N8RC 4LW1A 1N33Q 3HOVG 3EN2A 1BBWA 3PUZA 1CKNB 3AYHB 2OCEA 3UDXA 3I4MH 2NZOA 4LF9Q 4L5SA 3S2HH 2ZJQA 3M85A 4JV5L 2K4KA 4YY3L 3ULPA 4QGUA 4DV3L 3FKIG 1L1OB 2OWOA 3RN2A 5EU0A 4DNIA 4JI0L 4JI4Q 1S40A 3GTKH 3U58A 2VQEL 3PO2H 3ZJYC 4JI6Q 3PO3H 3I4MG 4UP9A 3TEHB 1C9OA 4J15A 3J81i 4HJ9A 1YJNA 1R9TH 5JJIA 1KD1C 4IO9A 5AJ3L 1QZGA 1WCMG 3RLOA 3CP0A 2HIVA 2NVQH 3J81c 3CCLA 4OONA 2YTYA 1M1KC 4LF7L 3S15H 3SHGA 4LUVA 4B3RL 3AFPA 4X65L 4DV2L 1WI5A 2EIFA 4OXPA 4X64L 1EQQA 1XNQL 1BBUA 4B3MQ 1YI2A 4DUZQ 1Q81C 3RZOH 4P75A 1KXLA 4C3JH 2ZTDA 1AE2A 1Z9FA 1IBKQ 1HZBA 1T9HA 1IL2A 2OQ0A 4K0KQ 4X6AH 1SR3A 1AE3A 1X56A 4X62L 4IPGA 4X2DA 2MO0A 2AMCB 1G51A 1KL9A 1XPRA 4LF4Q 4IFDJ 3HKZG 4A93H 3J81j 2RF4A 1K8GA 2UU9Q 4WJ4A 5JEAG 3HOXH 3CC7A 3GTOH 3S16H 5JJLA 1A0IA 3HOYH 2UUBL 1CKOA 1Y1VH 4DUYQ 4DR4L 2Q2IA 2UXBL 1L2FA 4A3KG 1PH7A 1EUJA 4A3IG 1PH6A 2YV5A 1VQ6A 1VQBA 5GROA 1FVIA 4U04A 1SRUA 2K5VA 3GO5A 2PQAB 3RR5A 2AWOA 4DV0Q 1E1OA 1ASZA 4A93G 2YTVA 3LGJA 3ULJA 3KLWA 1DGSA 2ZJRA 4YHHQ 5LMUQ 1VQ5A 4Y7NH 2NZHA 3CPFA 1SE8A 1JJCB 3H3VH 4BBRH 1HNWL 3KYHC 2ASBA 1I50H 1IBLQ 3D31A 2AWNA 4B3SL 2ZM6Q 2ATWA 4JI5L 1N36L 4LFBL 1NTGA 1VQFA 5IP7H 1YBYA 2I0QA 2K52A 1JB7A 4DR3Q 3TREA 2ES2A 4DV4L 5IY0A 4HJAA 1O7IA 5C0XJ 3KF6A 1Q82C 2JQOA 1N32Q 1KRTA 4DR2Q 4P71A 3HOWH 2E2JH 4P74A 4POFA 3CCVA 2NVTH 2MFIA 5C4JH 1X3GA 4LFCQ 5C44G 1J5EQ 1OXTA 4MZ9A 3PF4A 2ZTCA 4DR1L 4JYAQ 3STBC 4A3BH 3S1QH 4AQYQ 2RHQB 4JI7L 1PYBA 2PI2E 1UEBA 5FLMG 3CCMA 1PYSB 4PG3A 1BVSA 4LF8Q 2PI2A 4X2CA 1VQ7A 2R7ZG 4JI3Q 1PA6A 2UXDL 3BZCA 2N49A 4C2MH 5ELNA 3E0EA 1V1QA 1NJIC 2CKZB 4GLVB 1YIJA 1IZ6A 5M5YH 2HHHQ 3A5UA 1GKHA 4DK3C 4LF6L 1Q86C 3JC66 1Z47A 4IPDA 1WFQA 4O0AA 4UP7A 3UDIA 3KOJA 4A4IA 1SFOH 2RCNA 3IRBA 2LXKA 4A3JG 2UUCQ 2GVAA 1SMXA 3NELA 4KLKA 1YHAA 4JI1L 2IX1A 2JA5G 1W3SA 4OX9Q 2B3GA 4DK6C 4JBMA 1MJEA 4A3EH 4NXML 2JJQA 2C35B 1EFWA 3PUYA 4AYBG 3CCSA 2K5HA 3F8TA 4AYBE 1K9MC 1HZ9A 5FJ8G 1S72A 3H0GH 2V1CC 4JI8L 3GTLH 5GADC 4DV1L 3A0JA 3S1NH 4X66L 2VS1A 1GD7A 4A3EG 1X65A 1Y14B 5ELOA 3GTQH 3BZKA 1XMQL 5IP9H 2GVBA 4O2DA 4DAMA 3NEMA 3PSIA 3W1BA 3BU2A 3T1YQ 3RLFA 1U0LA 2IHEA 4DV6L 1FL0A 1WOCA 4JV5Q 1VQJA 2ID0A 4PZ8A 1HZAA 4YY3Q 4DV3Q 1HNZL 1MIUA 3L7ZC 2OQKA 4BA2I 2HQLA 4JI0Q 1HJPA 4BA1I 3I56A 3CQZH 2WAQG 3K0XA 2VQEQ 5IWAL 2Y0SG 2WAQE 4APVA 2Y0SE 4A3MG 2A19A 2K14A 3A5ZB 3PCOB 4BY1H 1JJ2A 4R4TA 5AJ3Q 2NVXH 5CGLA 2HT1A 4IFDI 3N3UA 4JBWA 3G71A 1VQEA 4IJHA 4LFAL 2KENA 1VQMA 4WJ3M 4JC0A 1EIYB 3I4OA 2UXCL 1TWCH 5BR8Q 4B3RQ 1PHJA 4X65Q 4DV2Q 4X64Q 5LMNW 1A62A 3S6AA 4GNXC 1XNQQ 2VUMH 4EX5A 2DGYA 4RG1A 1C7YA 1P8LA 4KI0A 1E24A 2XGTA 1K0RA 1PH8A 1GO3E 1TWAH 2UUAL 4X62Q 4GKJL 3K7AH 4C3IH 4B3TL 1PH1A 4N67A 4R4IA 4UPAA 1MJCA 2UUBQ 4ITRA 1UE7A 5LMNL 4OWWB 1QVFA 2JA7H 4PY3A 3PO3G 3PO2G 4DR4Q 4IFDG 4LU4A 2PQAA 2R93H 3CCJA 3S24A 3CUCA 4IJLA 1FJGL 4BXXH 1VQCA 1K3RA 2VL6A 3MEFA 4BY7H 2OTJA 2VQFL 1EYGA 2N78A 1TWFH 3G48A 3CW2C 1VQDA 3SGIA 5C0XI 5M5WH 4A3CH 3GD7A 3U50C 3Q8DA 1KIXA 5GQOA 4A3FH 4U0ZA 4JI2Q 1HR0W 3UDFA 3NENA 1HNXL 1HNWQ 2K75A 3HFZB 1B7YB 1I5FA 1NMGA 2RHSB 3TS0A 4BY7G 4AIMA 2CWPA 4B3SQ 3K8AA 1N36Q 4DR5L 4JI5Q 4LFBQ 3PGZA 4H02A 4PZ6A 5E7NA 2A8VA 3HOXG 3H3VI 1A63A 3SN9A 4A3FG 3HOYG 5CMTA 1Y1VG 4DV4Q 3D0FA 2R7DA 3M4QA 3UE1A 3OTOL 1K83H 3K7UC 4HJ8A 4A3LH 1Q1EA 4L5TA 4MTNA 1NMFA 3F1ZA 1HR0L 3CC4A 5M3FH 1WJJA 5C0XG 3I4NH 2BA0A 3WWVA 1RIPA 2R7FA 5IYBH 1NY4A 4HJ5A 2I5LX 1HH2P 2KBNA 3ERSX 5C4XH 1ASYA 4DR7L 3LETA 4DR1Q 3PUWA 1VS0A 3H15A 4OWTB 3F2BA 4R1JA 3KJPA 3SE5A 5CKLA 1EQRA 2MO1A 3OW2A 4A3GH 4JBKA 1XMOL 2VZAA 4BBRG 1CUKA 2NN6I 1WYDA 1X6OA 1PV4A 4U07A 1M90C 2UXDQ 2ALYB 4QQBX 4DR6L 4OO1I 1I94L 3CMAA 3CPWA 5GAEC 5IP7G 4YCUA 1D8LA 1EWIA 4HIOA 1YNXA 1HZCA 4U0SA 4LUOA 3STBD 3CMEA 4LF6Q 4BBSH 2F52A 2AHOB 2D0OA 2JE6I 3AEVA 1KQSA 1YJ9A 1J6QA 2B29A 3OYYA 3HOWG 1A8VA 2AKWB 3VDYA 3NBHB 4C3HH 2Q2TA 1IYJB 2Z6KC 4LF5L 4JI1Q 1KHIA 1YZ6A 2D0PA 2NN6G 1KAWA 4NXMQ 4KHPL 3RZDH 4EQ5A 4A3BG 3CCUA 4UP8A 5K36G 2VNUD 1Q8KA 3U4VA 1W2BA 4NXNL 3PV0A 4JI8Q 3ULLA 1G6PA 1N9WA 2PNHA 2PMZE 4DV1Q 2E5LL 4X66Q 1AH9A 1NE3A 3F2CA 1KRSA 4GNXA 1XMQQ 4WGJA 2E8GA 2LXJA 1SN8A 4A3DH 2N8NA 4DV6Q 1PFSA 1Q1BA 4DPGA 1SLJA 1YHBA 1HNZQ 3HOZH 1C0AA 2H5XA 4DV5L 4Y52H 2HIXA 1E1TA 2GN5A 3EIVA 2A1AA 4QIWE 2JA8H 2MQHA 1VQOA 1LYLA 1OXSC 1QUQA 2WB1G 1G291 5IWAQ 4UY8C 1V43A 1YJWA 2WB1E 4U0UA 2F4VL 2G03A 5DLQE 4P73A 5IYDH 4IOAA 1VQGA 1BKBA 1FGUA 4GNXB 2JA8G 4LFAQ 2I5MX 3K80C 3H0GG 2UXCQ 5M3MH 3E9HA 1OTCA 4JG2A 4GS3A 3HOUH 1SROA 4IOCA 5IP9G 3ZLMA 3T1HL 4TQUS 4LUZA 1OXVA 1QUQB 2Q2HA 2JA6H 2UUAQ 4GKJQ 2JEAI 1H95A 1QZHA 1YITA 1UE6A 3DLLA 3S1RH 3S1MH 3EBEA 4GKKL 4YCVA 1B8AA 4LF7Q 1OXXK 1Q12A 5H1SE 1NBWA 2BH8A 5C3EH 4YWKA 4DV7L 2N3SA 4BY1G 3UDGA 1GM5A 4QY7A 1FJGQ 1N34L 2JK8A 4XI8A 1V9PA 4KHZA 2YTXA 4YCWA 2FXQA 2VQFQ 1IXRA 2R6GA 3CCQA 4IPCA 3CCRA 3M4OH 4GOPC 1XNRL 1EIFA 1UE1A 3FKIH 3MXNB 4JOIC 4XIGS 3S17H 2QGQA 2VUMG 2CCZA 4XTCS 2BA1A 1IBML 2UXBQ 1XPUA 3CXCA 1HNXQ 3M9BA 3K81C 3T1YL 3TRZA 3PIPA 2VY3A 3M7NA 1RL2A 1WCMH 3PUVA 3GTPH 4DR5Q 4NB3A 4R4QA 3I7FA 1X55A 2IT1A 2JA7G 1GVPA 3BJUA 3G6EA 3OTOQ 3G4SA 2CWAA 3J80i 1N33L 1VQPA 4HIMA 1HR0Q 1VQNA 2R93G 2OTLA 3PF5A 2DUDA 1E22A 5JJ6A 3TS2A 4BXXG 5GAHC 4JCVE 2LSSA 3J80c 4LF9L 1PH5A 3CD6A 2Z6KA 2XTIA 4R4OA 4TVAB 4DR7Q 4YWLA 1VQ8A 1X3EA 1I6HH 5BR8L 4DKAC 2JEBI 1D7QA 4A3CG 2EQSA 3AFQA 4JI4L 4RMFA 4HJ7A 2QA4A 1XMOQ 4JI6L 5HGQA 4A3KH 1PH3A 1L1OC 1S3OA 4A3IH 5M5XH 1Q46A 3GDEA 1U5KA 1Q7YC 4DR6Q 1I94Q 2YYZA 2CFMA 2IHFA 3TQYA 3HKZE 3CC2A 2KHJA 3FHWA 3RN5A 1E7ZA 2B63H 4A3LG 1TWGH 3GTGH 4JI7Q 4B3ML 1XTDA 5M3FG 4DUZL 3I4NG 3ZCBA 1X54A 4FDBA 3GTJH 3L0OA 5IYBG 4LF5Q 1IBKL 2WFWA 1K8AC 4L5RC 4K0KL 5C4XG 5JEAJ 1XJVA 3W1GA 4LWCA 1PH4A 4LF4L 2B63G 4KHPQ 5JFFA 3CCEA 3KF8B 5J3BA 2UU9L 2MNAA 1TWHH 5FLXc 1VQ4A 1PH2A 4A3GG 4JI2L 1X3FA 4DUYL 4NXNQ 1XPOA 4DAYB 4HIDA 3E9IA 4L5QA 2E5LQ 3L2PA 2VW9A 4DV0L 2I5HA 2K5NA 2IX0A 2ZTEA 1CSPA 1B70B 3AQQA 4GLAC 4BBSG 5C44H 5LMUL 4MNOA 4YHHL 2BH2A 2F3IA 4DV5Q 3DM3A 2E2IH 4OO1G 2NVYH 1CSQA 1LUZA 5IE8A 5EAYA 5FLMH 1UE5A 4A75A 3ICEA 4GN3B 4R4CA 5JJKA 2R7ZH 1IBLL 3PIOA 3KDFA 1VQHA 3PUXA 2ZM6L 3CF5A 4LNQA 2F4VQ 2L15A 4PMWA 3KJOA 4PZ7A 3ZC7A 1QVGA 5JJ7A 4DR3L 1VQLA 4M16A 1I3QH 4HIKA 3RNUA 1N32L 3RLNA 4GOPA 4DR2L 3JAMi 3FP9A 4JOIA 3S14H 3KF6B 3M3YH 4NPSA 3A74A 4AH6A 4A3JH 3ER0A 3W5OA 4GN4B
chains in the Genus database with same CATH superfamily
2JA5H 2EVBA 4LFCL 1Y1WH 1VQIA 3HOZG 4C3HB 1E3PA 4GLXA 3I2ZA 3GTMH 1OXUA 3TZUA 2YU9H 1STHA 4JI3L 2E2IB 4QF4A 2E76C 1VCIA 5IYCG 4GN5A 4MIUA 5IYDG 2A5HA 4ALPA 1S5CD 1L0WA 3EFXD 2F0NA 4CJ0B 2B39A 1AZQA 1HXYD 3H3VC 2A69C 3FDTA 4KD3A 2R61A 4A76A 5HY6A 5DAUA 5LMNQ 2R92G 1SE2A 4HMJA 1EOVA 4OX9L 1VQ9A 3CAMA 3UE0A 3GV3A 2F0IA 1K3BC 1L1OA 4JBJA 3J7YW 3K5NA 1YEZA 2IY5B 2NWGA 1DONA 1JJGA 3TDQA 4P72A 4AYBB 1QWYA 4NP5A 4LW1A 1LTGD 2AUKA 1BBWA 3AYHB 2OCEA 3UDXA 2QDLA 4BWGB 4LF9Q 2JN4A 3NBIA 3HOUB 3ZYYX 4DGZA 1GUOA 3BS1A 4DV3L 4H7BA 2OWOA 4JI0L 4RCOA 2VQEL 3I4MG 4UP9A 1GOZA 4HJ9A 5JJIA 4I7ZC 1QZGA 1DOLA 1RDPD 3CP0A 3S2DB 4KKUA 1ZEQX 3D8GA 4K8IA 3HOVB 1WI5A 2EIFA 3RZOH 1Q81C 4C3JH 1Z9FA 3H94A 1R4PB 1IBKQ 1BNZA 3R3OA 1X56A 3JAME 4IFDJ 1ENCA 3W3AA 5JEAG 1A0IA 3QR8A 4A3IG 3T56B 2YV5A 1ESFA 3GTKB 2WKDA 3GO5A 3RR5A 1IW7C 1EIGA 2XRQD 3LGJA 4KD4A 1R9TB 4HCSA 5LMUQ 5A2QE 2NVQB 1EEFD 5C3WA 4KKSA 4B3SL 2SDFA 4H0LC 4JI5L 1N36L 2K52A 1JB7A 3KLRA 1IKLA 1IYUA 2JQOA 2F0GA 1KRTA 4P71A 3HOWH 3GTOB 3N52A 4P74A 3CCVA 3HOYB 2GA4B 2NVTH 4ZUIA 1GXDC 1DM0B 2NN6H 2A6HC 3PF4A 4DR1L 4A3BH 2X69A 2RHQB 2AQ1B 5K36H 1A3VA 1T5EA 1EYCA 4PG3A 2PI2A 4X2CA 3U9OA 2MPMA 1KLUD 2KUMA 5IGGA 2IJ0A 1I50B 3A5UA 1CM9A 3N6RA 2UUCQ 3NELA 1W3SA 3HGBA 4A3EH 2E2JB 1EFWA 4AYBG 3CCSA 4K5WA 2K5HA 3F8TA 4AYBE 2M00A 1PYWD 3OHXC 3H0GH 3GTLH 5GADC 5DM73 3S1NH 5ELOA 5IP9H 2GVBA 1RODA 2PMZB 2Z1CA 3W1BA 4ZYSA 4NMZA 3ND9A 4DV6L 1FL0A 5CYUA 4C2MB 1MIUA 2OQKA 1HJPA 4BA1I 4XT3B 2EYOA 4U68A 5J39A 2A19A 3DM1A 1Q8IA 4FF3A 2FMMA 2NVXH 2K01A 1SAPA 2YU9B 5KGUA 3G71A 4LFAL 1VQEA 4KY7A 4B3RQ 5ELDA 1A2TA 4X65Q 4DV2Q 1A62A 1EIHA 4EX5A 1E2ZA 4KI0A 2XGTA 1TWAH 2UUAL 4IALA 3KLSA 3D4WA 3GTQB 2LKVA 1FD7D 1T5XD 1QNKA 2EOTA 1PMRA 4G57A 1MJCA 2UUBQ 4ITRA 3VR4A 1WD0A 4DR4Q 2L1BA 4K8JA 1BF4A 3CCJA 2B2UA 3S24A 3CUCA 3CQZB 4BXXH 4EQPA 2VL6A 3SK5A 1EYGA 2K1BA 2N78A 4BY1B 5FLXL 1G6ZA 4A3CH 4RGOS 5IOCA 1VMCA 3NENA 1HNWQ 5C5LA 3TS0A 3ERQA 5IGDA 2VUMB 2QF7A 1IHZA 1FNUA 3K8AA 2FJ2A 3TBIB 5E7NA 4A3FG 3HOYG 5CMTA 3LNNA 4DV4Q 4F87A 2R7DA 3QJYA 5E1FA 4C3IB 4KMUC 3CKIB 4RGNA 5BN3A 3CC4A 2KEEA 2JA7B 5IYBH 1HH2P 5C4XH 1WTHA 4RHRA 5CV8A 3PUWA 2IWHA 1VS0A 3H15A 3PQIA 4OWTB 3VYUA 3KJPA 1STBA 1EQRA 2MO1A 1Y8NB 4A3GH 3NSWA 4BBRG 4P2CB 1X6OA 1JICA 1PV4A 1UAPA 4GZYC 4QQBX 1EWCA 4DR6L 1I94L 3CMAA 1PLFA 5GAEC 4X3KA 1LT3D 2K28A 4LUOA 4BBSH 2F0HA 4K6DA 2ZXRA 2F52A 3F2UA 1YJ9A 1J6QA 2B29A 3OYYA 4OO1H 3NBHB 2XSCA 3M4YA 2Q2TA 2Q8RE 1MSHA 1ZYRD 5EKIA 5CR3A 5EKKA 5M3FB 3RZDH 5E4XA 2DNEA 4NXNL 4OIKA 1NUCA 3PV0A 4EVOA 3K6OA 4JI8Q 1G6PA 2PNHA 2PMZE 4GNXA 1XMQQ 4IUVA 2B8GA 4CGYB 2LXJA 2N8NA 1U4PA 2A73B 4DXGA 3HOWB 3HOZH 5I6WA 1SLJA 2X6GA 2IX3A 4Y52H 1V1PA 1E1TA 2GN5A 2HIXA 2A1AA 4QIWE 2JA8H 2MQHA 1SXTA 3L9AX 3A56A 3DMUA 1V43A 4UY8C 4QCLA 2F4VL 2G03A 5DLQE 5FO8B 2EYJA 4P73A 1NCVA 5IYDH 4IOAA 1VQGA 5EPJA 4ZAIA 1ICWA 1B9MA 5LL6X 4DAVA 3OMGA 4HSVA 1KTKA 4WORA 1BDOA 1CQVA 2EJMA 1SYFA 1WTQA 2KQ3A 2IPKD 2KECA 2Q2HA 1H95A 2ZT9C 4K6LA 3J81L 1QZHA 1UE6A 3Q0AA 1HUMA 1NBWA 3NK9A 1GUWA 3HP3A 3P75A 4YWKA 4BY1G 1SYGA 3GTLB 2JK8A 4XI8A 4KHZA 2EZVA 1JQYD 1JOOA 2QCPX 2A6ED 4EQNA 2DY7A 1BO0A 2QGQA 2F0OA 2VUMG 4QUCA 4FF2A 4XTCS 1XPUA 5M3MB 1HNXQ 2CQAA 2VY3A 4TKOB 5KNBA 4C3IG 1RL2A 3GTPH 3MXGA 4DR5Q 2JA6B 2IT1A 2JA7G 3S1MB 1VQNA 3TS2A 2LSSA 4LF9L 3DWQA 1PH5A 3VR5A 2JP1A 1MSGA 1X3EA 5BR8L 1I4RA 2QEJC 4DKAC 1D7QA 4TSSA 2EQSA 3IFTA 5JEAH 3NTKA 2KVMA 2QA4A 2EY1A 3R93A 5EJWA 3M4OB 2WIIB 1L1OC 4A3IH 1SJHD 1O78A 1SNPA 2K5WA 2DY8A 2IW3A 1BCPB 1EEID 4EQOA 3RN5A 1E7ZA 4HEDA 5JPNC 1TWGH 5M3FG 4FDBA 5L37A 4LF5Q 1IBKL 5CV5A 2D2CC 4B9WA 2B63G 4KHPQ 5T1IA 3KF8B 4C56C 3NTIA 3WDNA 4QMGA 1PH2A 1X3FA 3K5MA 1I6HB 3NTHA 1A3TA 4N9TA 2VW9A 4ID6A 3NWSA 1CSPA 4A3KB 5M5XB 5LMUL 1B4OA 3T13A 5KNCA 3S9WA 2E2IH 4CKBA 5D14A 5C4XB 1F9RA 4C1NK 1ESRA 3KDFA 4K5XA 3CF5A 4LNQA 4A3GB 2EY5A 1EY5A 1QNUA 5JJ7A 1KDAA 1SDFA 1RD9D 4GOPA 3JAMi 1TU2B 3OW7A 2E2DC 5ELEA 4ME3A 1K28A 3W5OA 3MWYW 4N8FA 5KIXA 2K50A 3I55A 4HR7B 2EXZA 3TP8A 1MKHA 2XNAC 1CHPD 4QL5A 2KHIA 1K73C 4DV7Q 2F0UA 2BDNA 5IT9c 2PYKA 2EJGC 4QJFA 2VXWA 2KCMA 1RTNA 4XYOA 5M3MG 3HS0C 4CDFC 1EZ8A 2UUCL 3A8IE 3U4ZA 3IL8A 3S2DH 4KKTA 3HKSA 4OWXB 2JA6G 2H1EA 5EGTA 3MAQA 3HOVH 5JFZA 3S14B 3M3YB 4A3JB 2Q2UA 1JOKA 3ND8A 3J7ZC 5FLXE 1PTOB 2ZJPA 4MN3A 1TXYA 1SE3A 4YIJA 3EN2A 3PUZA 1CKNB 4CJ1B 3M85A 1SJED 4QGUA 2R92B 4DNIA 5CV4A 3GTKH 4NW2A 4JI6Q 5FO9B 3SK8A 3TEHB 1YJNA 1R9TH 3K59A 1S5FD 2WAQB 2NVQH 2HIVA 1QE6A 1LACA 2K33A 2K5QA 4B3RL 3AFPA 4X65L 4DV2L 1ILQA 1EQQA 1BBUA 4B3MQ 1IL2A 1T9HA 2O4XA 4K0KQ 1SR3A 1I4HA 3GV6A 4X2DA 2IL8A 4IPGA 3I4MB 2Z8LA 1EY4A 3J81j 2UU9Q 1AEXA 1B3AA 3CC7A 3GTOH 4FNFA 3HOYH 2UUBL 1CKOA 4DUYQ 4DR4L 4MTKA 1L2FA 4A3KG 1PH7A 1PH6A 2HD3A 1VQ6A 2X6LA 4QUFA 5GROA 4ZKBB 3P20A 1F2LA 1E1OA 3PO3B 4A93G 5CGKA 3KLWA 5I6YA 3EVQA 3CPFA 1GJXA 1JJCB 4BBRH 1HNWL 1I50H 3PIO3 1IBLQ 4FXKC 1B9NA 5LL6S 2ZM6Q 3E3XA 4DR3Q 3TREA 4DV4L 5IY0A 1O7IA 1LTTD 2XRSD 3C1EA 2B2UC 2B2YC 4DR2Q 2E2JH 2MFIA 2PW5A 5AFWA 5CBAE 4L63B 4IN3A 4JYAQ 1KDBA 1KLGD 4JI7L 1J9OA 1PYBA 2PI2E 1UEBA 1PYSB 3KK7A 4WJWA 1VQ7A 1YNND 2R7ZG 1PA6A 5HURA 4C2MH 5DNFA 5ELNA 2RA4A 2CKZB 4GLVB 2I46A 2HHHQ 4IPDA 1WFQA 3DWAA 4UP7A 3J81E 4KJOA 2Z4IA 3TP5A 2LXKA 4A3JG 4XT1B 2TSSA 1ML0D 1MJEA 4JBMA 2C35B 4RA8A 3HRZC 3PUYA 1SSOA 5CMDA 4IUPA 1VF7A 5FJ8G 1S72A 4JI8L 3DEOA 3S1QB 3I70A 1Y14B 3GTQH 3H09A 1XMQL 4DAMA 1LTBD 3NEMA 3PSIA 4XXEA 3BU2A 3RLFA 1U0LA 2HUGA 1EQVA 2IHEA 3MXPA 4JV5Q 4PZ8A 2ID0A 4YY3Q 5BN5A 5KYIA 5M5YB 1EWHA 3CQZH 5I9OA 1KNEA 2WAQG 3K0XA 2DNCA 2WAQE 1V8QA 1EY6A 2K14A 2K32A 3PCOB 4BY1H 3J80L 1JJ2A 3NPPA 3SK6A 2LY7A 2B2WA 4OEMB 3I4OA 1EIYB 5BR8Q 3VR3A 5LMNW 3S6AA 4GNXC 2VUMH 2F1MA 4RG1A 1C7YA 2J4XA 1E24A 1K0RA 3I8ZA 5DM63 4X62Q 2VB3X 2F0VA 4C3IH 2G9DA 2A6EC 4K2KA 4B3TL 2Q8IB 4X3SA 4FO2A 2JA7H 3PO2G 3OIQA 3PO3G 2WKCA 3QIAA 3QO2A 2L4NA 3SR1A 4IJLA 1G2TA 1J8IA 1IYVA 3FEWX 5EQ0A 1HCZA 2NZ1D 1PRTD 1NR2A 3SGIA 5ISRA 1VQDA 5C0XI 3GD7A 1KIXA 3CHBD 1HPCA 1HR0W 4DA2A 5JAVA 1TWCB 3UDFA 3A54A 4ZUJA 1HNXL 2K75A 2VB2X 1B7YB 1I5FA 3H91A 4BY7G 4AIMA 1Y8OB 4DR5L 3PGZA 2A8VA 2XIWA 3H3VI 3LWUA 1Y1VG 3D0FA 3Q23A 3DHQA 4DNTB 3T53B 3K7UC 1CT1D 1Q1EA 4L5TA 3F1ZA 1X3QA 3LWEA 5M3FH 5C0XG 2BA0A 4ULLA 3WWVA 1RIPA 1SYCA 2CVRA 4HJ5A 2KBNA 1NR4A 2NUCA 4JPBW 3F2BA 1S5DD 3SE5A 1TS3A 3ONAB 1TWFB 1U9RA 4OIJA 2UXDQ 2XVSA 4M8AA 4A3FB 4OHJA 1EQTA 1ENFA 1TT2A 3CPWA 5IP7G 1EWIA 4HIOA 1YNXA 1HZCA 4U0SA 5C5MA 3QOLA 3SK4A 3FRPB 2F0EA 1I4PA 4G7OC 1A8VA 4LF5L 1K83B 1KHIA 4IQZA 2Z4HA 1BOSA 2D0PA 1F2MA 4KHPL 4EQ5A 4BBRB 2J7ZA 1QJOA 1Q8KA 2RVLA 1H9SB 2PCFB 3MVVA 4DV1Q 4ZLTF 1AH9A 1EFID 1KRSA 1PDQA 1K8OA 1TY0A 2L12A 1PFSA 4DPGA 4I7AA 3OOCA 1VQOA 1OXSC 1QUQA 1EY9A 1LT4D 1JC7A 5EBDA 4ZRZA 4U673 2JXMB 1BUVT 1Q3LA 2QDBA 1QG7A 1AP0A 4RGTA 3AB9A 5M3MH 3RUZA 1SROA 5IGEA 3VA5A 4QIWB 2P5ZX 2JA6H 3Q24A 4GKJQ 3HEJA 1HHVA 3DLLA 3S1MH 2B2VA 2PQEA 1WTXA 4YCVA 4KHVA 1OXXK 5H1SE 1KABA 5FK9C 4DV7L 2N3SA 1FJGQ 1D6EC 1DCZA 1S5ED 1AW7A 2BCOA 1LTID 3CCQA 3M4OH 4GOPC 1EIFA 3MXNB 3T51B 4XIGS 3BVMA 1PRTF 2M2LA 2OXPA 2XN9C 3T1YL 1EL0A 2B2YA 3M7NA 2NBFA 4XQNA 4R4QA 2CHBD 1VF5C 3KUPA 3I7FA 4WRDA 1X55A 4J1MA 3BJUA 3OTOQ 1VQPA 2OTLA 1E22A 5JJ6A 4IUQA 4K14A 5GAHC 2CH4W 2XTIA 4R4OA 1I6HH 4DR7Q 4YWLA 2WINB 2F0LA 2PO4A 1A15A 2D5DA 4HJ7A 4JI6L 1LTRD 3FKIB 4A3KH 1I6VC 1S3OA 2B2TA 5M5XH 1U5KA 1SYEA 2CFMA 2K5DA 3CRLC 3HKZE 1D1IA 1VMPA 1CK1A 3BZDB 5I2XA 4JI7Q 4B3ML 1NNXA 1X54A 4R9WA 1G91A 2WFWA 4K0KL 3J7AF 5JEAJ 1F9QA 5EPLA 3SEBA 2NUNA 1PH4A 4N9PA 1DOMA 2UU9L 3I90A 2EE1A 4DUYL 4DK0A 1XX8A 4DAYB 2CW0D 4NKLA 3E9IA 2E5LQ 1DZ1A 5CV9A 1DYQA 2K5NA 2ZTEA 1JWMD 5JVG3 1JWSD 1H9JA 3MC0B 3C1FA 2RSOA 1H9MA 4IUUA 1ZXTA 4DV5Q 4CDCC 1LUZA 3ICEA 5EAYA 1UE5A 4GN3B 2B63B 2R7ZH 1IBLL 2SNMA 2RBMA 2ZM6L 1Z7TA 2L15A 4TRDA 3KJOA 5CC4A 4DR3L 1VQLA 1UEAB 2C9OA 3OMCA 4DR2L 3FP9A 1E2WA 3S14H 1LV9A 1YNNC 3M3YH 4NPSA 4AH6A 4A3JH 1R4QB 3T1HQ 2N55A 3JAMc 4Q0FA 2QEXA 5IYCH 2KCTA 3J80E 1PTOH 3NQIA 4JYAL 3KFUA 1HUNA 1SNDA 3MFGA 2E2HH 4GKKQ 1PH9A 5FJ8H 5C44B 4XQJA 2NVYB 1Y1WG 1B44D 2F0JA 1ET9A 4NDXA 1KC8C 2R92H 2EXDA 1P16A 2HHHL 3HG9A 1JE5A 1S4ZA 1XNRQ 2A69D 4B3TQ 3M4PA 4POGA 1UWVA 1RJTA 5JJZA 1IBMQ 1CKMA 2XWBB 3PIP3 2B8FA 4IPHA 4IURA 1PVOA 3NE5B 4KN7C 4S3SA 3KBGA 3OWEB 1YHQA 4FF4A 1N8RC 1N33Q 1AZPA 3RD4A 3NXWA 1PFMA 3I4MH 4L5SA 4JV5L 2K4KA 4YY3L 3E0JA 3FKIG 1L1OB 4K5VA 4KN4C 1S40A 4ME5A 4DK1A 3PO2H 3ZJYC 1TIID 3PO3H 1C9OA 4J15A 3J81i 1OO9B 2Y0SB 3A8KE 2CH4A 3BDLA 2O5IC 4OONA 4A3MB 4LF7L 2PZUA 3DXJC 2L9HA 4O1NA 4OXPA 4DUZQ 1EOTA 4P75A 1PZID 2MJ8A 3MHBA 2ZTDA 1HZBA 1RKNA 2OQ0A 4X62L 1KL9A 1PRTC 1K8GA 2RDGA 3S2HB 1Y1VH 2Q2IA 4OL7A 4KY6A 2UXBL 1EUJA 4U04A 2K5VA 5C0XH 3FMCA 2F4IA 1CFMA 2HCIA 5D3DA 2B2WC 3ULJA 4YHHQ 1VQ5A 1GHJA 3CU7A 3UI2A 1SE8A 4L6TB 3S15B 3H3VH 3KYHC 2ASBA 4CKEA 1CI3M 4PNYA 2AWNA 1GHKA 1FR3A 1JCKB 1VQFA 4ILWA 5IP7H 2I0QA 1BXTA 2ES2A 4HJAA 3KF6A 1N32Q 4A93B 1I4XA 3HOXB 3S16B 1CQFA 2F0SA 4CBVA 1HFGA 5C4JH 1F9PA 1X3GA 2DJGC 1IL8A 1JR0D 5C44G 1J5EQ 1OXTA 4PV1C 2ZTCA 2Z6BA 3S1QH 4AQYQ 3CCMA 4LF8Q 1BVSA 4Y7NB 2MGSA 5ELFA 2UXDL 3BZCA 2L0CA 3E0EA 3BVGA 3NWTA 4K2LA 5M5YH 2O5JC 1Q86C 3JC66 1Z47A 3EA6A 4O0AA 2G9HD 3UDIA 2RCNA 1TY2A 1U4MA 1WTWA 1D5ZC 2GVAA 1SMXA 3R8BA 1MI2A 2B3GA 4ODGA 4DK6C 2RSNA 2SEBD 1UNSA 4KTAA 2R7ZB 5CV7A 3E5SA 5HGTA 3TZDA 4DV1L 2VS1A 1GD7A 4A3EG 3BZKA 3PMFA 4O2DA 1ENAA 4ZCKA 2HDLA 1GUTA 2A68D 2F0PA 3T1YQ 1WOCA 3SDZA 1VQJA 4LJZC 1HZAA 2LMCB 3L7ZC 4BA2I 2HQLA 2Y0SG 4ZQ3A 2Y0SE 4B9XA 4A3MG 1FYCA 3BDCA 1SFOB 2E2HB 4R4TA 5AJ3Q 3URYA 5CGLA 3TN2A 3A8JE 2WB1B 1S5BD 3N3UA 4JBWA 1PZKD 5DEHA 4IFDI 4WJ3M 1TWCH 1PHJA 4DXFA 4X64Q 1XNQQ 2PPBC 3R2IA 4XQQA 3P1HA 1GO3E 2F0TA 4OGQC 4GKJL 3NP8A 1U4LA 1PH1A 4N67A 2MUYA 4UPAA 2BOSA 4OWWB 1UE7A 1I4QA 4IFDG 1QVFA 3TP7A 2PQAA 2K03A 1FJGL 1D5XC 1K3RA 3A7LA 3MEFA 4HMIA 4X3TA 3RMHA 2OTJA 1STGA 4G4KA 2NB0A 1TWFH 3FVQA 3CW2C 5LHY1 2BE5D 1JOQA 5GQOA 4A3FH 1EZ6A 2EDGA 4CHTB 5M9OA 2RHSB 3NHHA 2CWPA 4E6IA 3L3OC 2B2VC 3PO2B 4LFBQ 1A63A 1MGSA 3HOXG 3D4RA 3SN9A 4L8JA 3M4QA 3UE1A 3OTOL 1K83H 3K7AB 4MHEA 4HJ8A 3QWNA 3NUCA 1PFNA 1XWEA 1WJJA 4EGVA 1B3QA 1SEBD 4ABNA 2R93B 4DR7L 3BDOA 4Q5VA 5JPMC 4BY7B 5IGCA 5CKLA 4JBKA 1JWUD 1WYDA 4U07A 5M5WB 4FP5D 2MP1A 2V4DA 2RCFA 3X3NA 4OO1I 1Y1VB 1LT5D 4YCUA 3C3LA 3STBD 3CMEA 4LF6Q 3DEPA 2AHOB 1DOKA 2EY6A 1KQSA 2L5TA 4I65A 2CW0C 1IYJB 4JI1Q 1LO5D 1TQOA 1CHQD 1YZ6A 1ZYRC 4RCNA 4RKLA 4NXMQ 1KAWA 5IT9L 5I4DA 1CTMA 3I4NB 4V190 2EPBA 3IFDA 4UP8A 2FFKB 4JK1C 3D3RA 4RGMA 3EROA 2B2TC 3ULLA 1N9WA 2E5LL 4X66Q 1NE3A 3EQLC 1KAAA 1QB5D 1NSNS 1HNZQ 1YHBA 2HQEA 2H5XA 4DV5L 5C4JB 3OIPA 4HCEA 4CKCA 1ONLA 5E4WC 1SYBA 1LYLA 5IWAQ 2WB1G 1JORA 2WB1E 4U0UA 1YNJD 1BKBA 4GNXB 2RDHA 3P7JA 2JA8G 2I5MX 1HQMC 3K80C 2SNSA 3SXHA 2UXCQ 4G7HC 3E9HA 4H13C 4HTHA 4GS3A 4IOCA 1V1PB 3T1HL 4LUZA 5KEEA 1PXUA 5CORA 2JEAI 1YITA 1BBXC 3EBEA 3M7GA 4A3DB 4GKKL 1B8AA 4LF7Q 2KCNA 1ET6A 3OSOA 1CZWA 3QOJA 4QY7A 4F8MA 2E75C 1V9PA 5COYA 2ENBA 2FXQA 1O7ZA 1IXRA 2VQFQ 2HDMA 4IPCA 2Q8TA 1XNRL 3FKIH 2EYLA 2CCZA 1IBML 1LLRD 3AMUA 2UXBQ 3CXCA 3TRZA 3G7LA 1W6JA 3K81C 1BR9A 1Y69U 3PUVA 2F0DA 5D3IB 3GP7A 1E0BA 2WACA 1GVPA 2EYFA 3J80i 3S1RB 1N33L 2R93G 1M4VA 4O42A 4HIMA 1HR0Q 3PF5A 3IAYA 1EU3A 1HRJA 2Z6KA 5IODA 5C3EB 1VQ8A 2DJFC 2ICEC 3AFQA 4V0BA 3KLSX 1XMOQ 4KY5A 3S17B 1Q46A 1A6XA 3KF8A 1Q7YC 4LMQD 2YYZA 3TQYA 2IHFA 5KNDA 2F0FA 1JB3A 1ICFB 2K6AA 3A55A 3CC2A 3FHWA 1EU4A 2B63H 4A3LG 1WCMB 5J22A 4BS9A 1XTDA 4DUZL 3EJIA 3I4NG 3A7AB 3VR2A 5ELBA 1MBYA 1K8AC 2F0QA 1XJVA 1ZKOA 3W1GA 4LWCA 2LFNA 4FYDA 5JFFA 3CCEA 5FLXc 1E2VA 1VQ4A 4JI2L 2DN8A 2RDFA 1XPOA 4F7XA 2KJXA 3D6CA 1H9KA 1BCPD 3HKZB 4L5QA 1A2UA 2R3ZA 2IX0A 1B70B 3K57A 1WTPA 3W2DA 1CA5A 3BG3A 5C44H 3E6ZX 4YHHL 3D6WA 1HTPA 2F3IA 3DM3A 1EYAA 1W6KA 1CSQA 2EYMA 2KA7A 2NVYH 3D4DA 3LX0A 4C3HG 5IGFA 3I72A 1RF2D 5JJKA 1TS2A 3GTGB 4IZ8A 3PIOA 1VQHA 1VDZA 3GTJB 1TS4A 2NTSA 4PZ7A 5IGBA 3ZC7A 5NUCA 1NAPA 3VYTA 1SNCA 1AFPA 4HIKA 3RNUA 1N32L 4JOIA 1TWHB 3KF6B 5FKAC 4KV6A 1ASZA 1B50A 4A3DG 2CQOA 2Z9HA 1J5EL 4X2EA 3B6YA 3KDFB 4AQYL 4FF1A 4LF8L 1WTVA 2F6SA 2F0MA 1JMCA 1K0SA 1JT8A 4GOPB 1X9NA 2JA9A 4RKBA 3F2DA 3WOFA 1N34Q 3V2TA 5KYLA 4CJ2C 2F0WA 1SMYD 4J8QA 3QB3A 1CKNA 1UUPA 3J7A5 3HOUG 4YWMA 5KRUA 1I3QB 2D62A 1LM0A 1C8CA 1VQAA 4A3MH 2A68C 2I07B 1YVCA 3OPOA 1VQKA 3IKJA 2OEOA 1LTLA 5GAGC 2JA5B 2Z0SA 2MHVA 1QVCA 2QKIC 1Y1WB 2WP8J 1KNAA 3V96A 2EJFC 5C3EG 1O7LA 3HOVG 3GTMB 3NQTA 3AU7A 1STAA 2NZOA 2G5DA 2LS01 1RTOA 3WOEA 2ZJQA 3S2HH 1O80A 3DWPA 2QW7A 3ULPA 2M9VA 3MZ5A 3QG1A 3RN2A 5EU0A 2NTTA 4XYQA 4JI4Q 3U58A 5EPKA 4IFDH 3MTSA 2WV6D 4B08A 4PMBA 2BDOA 2AQ2B 3VYRA 4IO9A 1KD1C 5AJ3L 1PTOD 1A3UA 1EYDA 1TS5A 1WCMG 3RLOA 2EY2A 3J81c 3CCLA 2YTYA 1M1KC 3S15H 3SHGA 1LT6D 1PZJD 1SNQA 4PQXA 4LUVA 2K7VA 4X64L 3DUZA 1XNQL 4ZK9B 1YI2A 1LTAD 1KXLA 1H9RA 1AE2A 1QOHA 4X6AH 2O2LD 1AE3A 1G51A 2AMCB 2MO0A 1XPRA 4LF4Q 3VR6A 4ZKCB 3HKZG 1STEA 4A93H 2RF4A 4CDDC 4WJ4A 3C46A 3HOXH 5C3XA 5T1GA 3S16H 5JJLA 2BE5C 2F3WA 3O13A 3GQBA 1VQBA 1FVIA 1XYIA 1BCPF 1SRUA 4X3UA 2PQAB 4DV0Q 2AWOA 1CA6A 2YTVA 2L55A 5IT9E 2ZJRA 1DGSA 4Y7NH 1TR5A 2NZHA 4JW0A 5G3LD 3V05A 1O7YA 3J7AV 1L0XB 1WTOA 3I73A 3D31A 3RZOB 2ATWA 4C3JB 4LFBL 1NTGA 1LTSD 1YBYA 1IKMA 5C0XJ 1Q82C 1SNOA 4POFA 1X3PA 5IIFA 3H6MA 4LFCQ 4MZ9A 3STBC 3R2TA 5E3FA 5FLMG 1U4RA 1SNMA 4IUNA 5FO7B 1HA5A 4JI3Q 2N49A 1GUGA 4PMCA 1NJIC 1V1QA 4DN4M 3MFYA 1YIJA 1IZ6A 3CRKC 1GKHA 4DK3C 1L0YB 1GUNA 4LF6L 3OWFA 1K8MA 3T4AC 4KJNA 3KOJA 4A4IA 1SFOH 2RKSA 1SBBB 3IRBA 1C48A 4KLKA 2IX1A 1YHAA 2PZTA 4JI1L 2JA5G 4OX9Q 1ILPA 2ZXPA 4NXML 2JJQA 2NVTB 2OT2A 1XXGA 1K9MC 1HZ9A 2V1CC 5I9PA 4A3BB 3A0JA 4X66L 2F03A 1X65A 1STNA 4IUTA 1YNJC 1HNZL 4DV3Q 2PW7A 4FXGC 1F2YA 4JI0Q 1EY8A 1Y8PB 3I4LA 3I56A 2VQEQ 5IWAL 4UDUC 4APVA 4UHVA 3A5ZB 3BVZA 5J1ZA 2HT1A 1PTOF 4IJHA 2N88A 2KENA 3SE0A 4A3EB 4JC0A 1VQMA 5FOBB 5I2YA 2UXCL 5BN4A 2A74C 1F77A 2FINB 2DGYA 1P8LA 1PRTB 3H0GB 4RHSA 1PH8A 3S1NB 4RH6A 5CV6A 1HQRD 4DNRB 1DXMA 4DAPA 3I91A 3K7AH 2K04A 2J0TD 4R4IA 5LMNL 4PY3A 1EY0A 4UAIA 2RQXA 3T16A 4LU4A 2R93H 1VQCA 2PNRC 2NYZD 4LAAA 3Q22A 3I3CA 4BY7H 5C4HA 4H44C 2VQFL 3G48A 2NVXB 5M5WH 1B1ZA 4RFBA 3U50C 3Q8DA 4CDEC 1HFNA 4U0ZA 4JI2Q 4C3JG 1F9SA 5G3LF 3HFZB 1NMGA 2PZWA 3MXUA 4B3SQ 1IW7D 5K5PA 2AQ3B 1N36Q 4JI5Q 4H02A 4PZ6A 1FNWA 1TWAB 3TP6A 4A3LH 2KOLA 2AUJD 4MTNA 1NMFA 1HR0L 1CZGA 4RWSC 3I4NH 1SYDA 3K0YA 2R7FA 1NY4A 1DD2A 2I5LX 2KEDA 3ERSX 1ASYA 3BYYB 4KK7A 3LETA 4FXDA 4DR1Q 1M8AA 4R1JA 4HAEA 3OW2A 2H4OA 1XMOL 2VZAA 1CUKA 2NN6I 1M90C 3MEHA 2FMCA 2ALYB 2JYOA 3JAML 1H9SA 1D8LA 2A6HD 1NH1A 2D0OA 2JE6I 4QB4A 4JVZA 5TSSA 3AEVA 3HOWG 1BCPC 3SVMA 2AKWB 2ICIA 3VDYA 4C3HH 2Z6KC 5D65A 4DF7A 2NN6G 1AN8A 5A2QL 4A3BG 3CCUA 4R8IA 1XTCD 5K36G 2VNUD 3U4VA 3SHLA 1W2BA 3X3MA 2L11A 5C6AA 3VYSA 1HA6A 3K5OA 4DU9A 3F2CA 2EYPA 4WGJA 1FGBD 2E8GA 1SN8A 4A3DH 4DV6Q 4N8X1 1GUSA 1V1OA 1Q1BA 2KHSA 1C0AA 1G2SA 3EIVA 3KBXA 2F0KA 4M1UB 1D2BA 4BBSB 4G7ZC 1RHPA 1G291 1YJWA 4F88A 3TMEA 1FGUA 4C1NI 2K05A 4LFAQ 2SOBA 3H0GG 3RZDB 1Q90A 4XDXA 1OTCA 1QILA 1STYA 4JG2A 3HOUH 5IP9G 1SE4A 3ZLMA 4TQUS 1OXVA 1QUQB 3MXNA 2UUAQ 1TVXA 1LABA 5CBEE 4HN7A 3S1RH 1SMYC 5C4ZA 2QILA 2HCCA 3HOZB 1EY7A 1Q12A 2BH8A 5C3EH 3UDGA 2TMPA 1GM5A 2JA8B 1N34L 4FVMA 2YTXA 1BQQT 3FPPA 4YCWA 2R6GA 3CCRA 3S17H 1UE1A 4JOIC 1WTRA 3TSSA 2BA1A 1II3A 4RAUC 3M9BA 3PIPA 3FPUB 4R8NA 1F2ZA 1WD1A 1WCMH 3MA2B 2C5CA 4NB3A 5JVH3 4DFAA 3K58A 2EYHA 3G6EA 3G4SA 1JE4A 2CWAA 2DUDA 4WFN3 3VA7A 4BXXG 1WVLA 4JCVE 3J80c 3CD6A 1PTOC 4TVAB 2JEBI 1I4GA 1MD2D 1Z6HA 4A3CG 4JI4L 4RMFA 1MHWC 5ELCA 1HTLD 5F2DA 2FHTA 4LK1C 5HGQA 1PH3A 3GDEA 2XWJB 4DR6Q 1I94Q 4DAYA 2KHJA 1D1KA 2F3VA 5EBCA 3GTPB 3NBHA 3GTGH 1DJRD 3ZCBA 3GTJH 2ZXOA 3L0OA 1FNVA 5IYBG 1B53A 4L5RC 5C4XG 2JSOA 4LF4L 1QCBD 3BYTB 5J3BA 2MNAA 1TWHH 1TKWB 3K5LA 4A3GG 4NXNQ 1G8ZD 1PFBA 4HIDA 1B2TA 3L2PA 1KDCA 4DV0L 2I5HA 1RCVD 4A3IB 3AQQA 1C4QA 5A35A 4GLAC 4BBSG 3ITPA 3G6JB 4MNOA 2BH2A 4OO1G 3Q6SA 5IE8A 5FLMH 4A75A 2NUDA 3U9SA 2D9UA 4R4CA 3HZXA 2KCCA 1TWGB 5EKLA 2OF1A 3PUXA 2F4VQ 4PMWA 4OELB 4HSPA 1QVGA 4J6HA 4Z9CB 4M16A 1I3QH 3C2PA 2E74C 3RLNA 1X32A 3A74A 1D5MC 3ER0A 5JOBA 4GN4B
chains in the Genus database with same CATH topology
2JA5H 3JAMc 4A3DG 2K50A 2QEXA 2CQOA 4LFCL 2KCTA 5IYCH 1Y1WH 4X2EA 1VQIA 1J5EL 3I55A 3HOZG 1E3PA 3B6YA 4GLXA 4JYAL 3KDFB 4AQYL 4ME3A 3KFUA 2E2HH 1MKHA 3I2ZA 3GTMH 4GKKQ 1PH9A 5FJ8H 4LF8L 1OXUA 2YU9H 4QL5A 2F6SA 2KHIA 4JI3L 1JMCA 5IYCG 1VCIA 4GN5A 4DV7Q 1Y1WG 1K73C 4GOPB 1X9NA 1KC8C 2JA9A 1JT8A 5IYDG 3F2DA 5IT9c 1N34Q 4QJFA 2EXDA 1P16A 2R92H 2HHHL 1JE5A 2KCMA 4ALPA 1L0WA 1XNRQ 5M3MG 4B3TQ 1CKNA 3M4PA 3T1HQ 4POGA 3J7A5 3HOUG 4YWMA 1UWVA 2UUCL 3U4ZA 4A76A 5HY6A 5LMNQ 1IBMQ 3S2DH 2R92G 1CKMA 2D62A 4OX9L 1EOVA 1LM0A 3HKSA 1VQAA 3CAMA 3UE0A 4JBJA 4OWXB 1L1OA 1YVCA 4A3MH 1VQ9A 5JFZA 2JA6G 3HOVH 1YEZA 1VQKA 4IPHA 1PVOA 2Q2UA 1LTLA 2IY5B 5GAGC 3J7ZC 2Z0SA 1QVCA 1JJGA 2WP8J 4P72A 2ZJPA 1YHQA 1TXYA 5C3EG 1N8RC 4LW1A 1N33Q 3HOVG 3EN2A 1BBWA 3PUZA 1CKNB 3AYHB 2OCEA 3UDXA 3I4MH 2NZOA 4LF9Q 4L5SA 3S2HH 2ZJQA 3M85A 4JV5L 2K4KA 4YY3L 3ULPA 4QGUA 4DV3L 3FKIG 1L1OB 2OWOA 3RN2A 5EU0A 4DNIA 4JI0L 4JI4Q 1S40A 3GTKH 3U58A 2VQEL 3PO2H 3ZJYC 4JI6Q 3PO3H 3I4MG 4UP9A 3TEHB 1C9OA 4J15A 3J81i 4HJ9A 1YJNA 1R9TH 5JJIA 1KD1C 4IO9A 5AJ3L 1QZGA 1WCMG 3RLOA 3CP0A 2HIVA 2NVQH 3J81c 3CCLA 4OONA 2YTYA 1M1KC 4LF7L 3S15H 3SHGA 4LUVA 4B3RL 3AFPA 4X65L 4DV2L 1WI5A 2EIFA 4OXPA 4X64L 1EQQA 1XNQL 1BBUA 4B3MQ 1YI2A 4DUZQ 1Q81C 3RZOH 4P75A 1KXLA 4C3JH 2ZTDA 1AE2A 1Z9FA 1IBKQ 1HZBA 1T9HA 1IL2A 2OQ0A 4K0KQ 4X6AH 1SR3A 1AE3A 1X56A 4X62L 4IPGA 4X2DA 2MO0A 2AMCB 1G51A 1KL9A 1XPRA 4LF4Q 4IFDJ 3HKZG 4A93H 3J81j 2RF4A 1K8GA 2UU9Q 4WJ4A 5JEAG 3HOXH 3CC7A 3GTOH 3S16H 5JJLA 1A0IA 3HOYH 2UUBL 1CKOA 1Y1VH 4DUYQ 4DR4L 2Q2IA 2UXBL 1L2FA 4A3KG 1PH7A 1EUJA 4A3IG 1PH6A 2YV5A 1VQ6A 1VQBA 5GROA 1FVIA 4U04A 1SRUA 2K5VA 3GO5A 2PQAB 3RR5A 2AWOA 4DV0Q 1E1OA 1ASZA 4A93G 2YTVA 3LGJA 3ULJA 3KLWA 1DGSA 2ZJRA 4YHHQ 5LMUQ 1VQ5A 4Y7NH 2NZHA 3CPFA 1SE8A 1JJCB 3H3VH 4BBRH 1HNWL 3KYHC 2ASBA 1I50H 1IBLQ 3D31A 2AWNA 4B3SL 2ZM6Q 2ATWA 4JI5L 1N36L 4LFBL 1NTGA 1VQFA 5IP7H 1YBYA 2I0QA 2K52A 1JB7A 4DR3Q 3TREA 2ES2A 4DV4L 5IY0A 4HJAA 1O7IA 5C0XJ 3KF6A 1Q82C 2JQOA 1N32Q 1KRTA 4DR2Q 4P71A 3HOWH 2E2JH 4P74A 4POFA 3CCVA 2NVTH 2MFIA 5C4JH 1X3GA 4LFCQ 5C44G 1J5EQ 1OXTA 4MZ9A 3PF4A 2ZTCA 4DR1L 4JYAQ 3STBC 4A3BH 3S1QH 4AQYQ 2RHQB 4JI7L 1PYBA 2PI2E 1UEBA 5FLMG 3CCMA 1PYSB 4PG3A 1BVSA 4LF8Q 2PI2A 4X2CA 1VQ7A 2R7ZG 4JI3Q 1PA6A 2UXDL 3BZCA 2N49A 4C2MH 5ELNA 3E0EA 1V1QA 1NJIC 2CKZB 4GLVB 1YIJA 1IZ6A 5M5YH 2HHHQ 3A5UA 1GKHA 4DK3C 4LF6L 1Q86C 3JC66 1Z47A 4IPDA 1WFQA 4O0AA 4UP7A 3UDIA 3KOJA 4A4IA 1SFOH 2RCNA 3IRBA 2LXKA 4A3JG 2UUCQ 2GVAA 1SMXA 3NELA 4KLKA 1YHAA 4JI1L 2IX1A 2JA5G 1W3SA 4OX9Q 2B3GA 4DK6C 4JBMA 1MJEA 4A3EH 4NXML 2JJQA 2C35B 1EFWA 3PUYA 4AYBG 3CCSA 2K5HA 3F8TA 4AYBE 1K9MC 1HZ9A 5FJ8G 1S72A 3H0GH 2V1CC 4JI8L 3GTLH 5GADC 4DV1L 3A0JA 3S1NH 4X66L 2VS1A 1GD7A 4A3EG 1X65A 1Y14B 5ELOA 3GTQH 3BZKA 1XMQL 5IP9H 2GVBA 4O2DA 4DAMA 3NEMA 3PSIA 3W1BA 3BU2A 3T1YQ 3RLFA 1U0LA 2IHEA 4DV6L 1FL0A 1WOCA 4JV5Q 1VQJA 2ID0A 4PZ8A 1HZAA 4YY3Q 4DV3Q 1HNZL 1MIUA 3L7ZC 2OQKA 4BA2I 2HQLA 4JI0Q 1HJPA 4BA1I 3I56A 3CQZH 2WAQG 3K0XA 2VQEQ 5IWAL 2Y0SG 2WAQE 4APVA 2Y0SE 4A3MG 2A19A 2K14A 3A5ZB 3PCOB 4BY1H 1JJ2A 4R4TA 5AJ3Q 2NVXH 5CGLA 2HT1A 4IFDI 3N3UA 4JBWA 3G71A 1VQEA 4IJHA 4LFAL 2KENA 1VQMA 4WJ3M 4JC0A 1EIYB 3I4OA 2UXCL 1TWCH 5BR8Q 4B3RQ 1PHJA 4X65Q 4DV2Q 4X64Q 5LMNW 1A62A 3S6AA 4GNXC 1XNQQ 2VUMH 4EX5A 2DGYA 4RG1A 1C7YA 1P8LA 4KI0A 1E24A 2XGTA 1K0RA 1PH8A 1GO3E 1TWAH 2UUAL 4X62Q 4GKJL 3K7AH 4C3IH 4B3TL 1PH1A 4N67A 4R4IA 4UPAA 1MJCA 2UUBQ 4ITRA 1UE7A 5LMNL 4OWWB 1QVFA 2JA7H 4PY3A 3PO3G 3PO2G 4DR4Q 4IFDG 4LU4A 2PQAA 2R93H 3CCJA 3S24A 3CUCA 4IJLA 1FJGL 4BXXH 1VQCA 1K3RA 2VL6A 3MEFA 4BY7H 2OTJA 2VQFL 1EYGA 2N78A 1TWFH 3G48A 3CW2C 1VQDA 3SGIA 5C0XI 5M5WH 4A3CH 3GD7A 3U50C 3Q8DA 1KIXA 5GQOA 4A3FH 4U0ZA 4JI2Q 1HR0W 3UDFA 3NENA 1HNXL 1HNWQ 2K75A 3HFZB 1B7YB 1I5FA 1NMGA 2RHSB 3TS0A 4BY7G 4AIMA 2CWPA 4B3SQ 3K8AA 1N36Q 4DR5L 4JI5Q 4LFBQ 3PGZA 4H02A 4PZ6A 5E7NA 2A8VA 3HOXG 3H3VI 1A63A 3SN9A 4A3FG 3HOYG 5CMTA 1Y1VG 4DV4Q 3D0FA 2R7DA 3M4QA 3UE1A 3OTOL 1K83H 3K7UC 4HJ8A 4A3LH 1Q1EA 4L5TA 4MTNA 1NMFA 3F1ZA 1HR0L 3CC4A 5M3FH 1WJJA 5C0XG 3I4NH 2BA0A 3WWVA 1RIPA 2R7FA 5IYBH 1NY4A 4HJ5A 2I5LX 1HH2P 2KBNA 3ERSX 5C4XH 1ASYA 4DR7L 3LETA 4DR1Q 3PUWA 1VS0A 3H15A 4OWTB 3F2BA 4R1JA 3KJPA 3SE5A 5CKLA 1EQRA 2MO1A 3OW2A 4A3GH 4JBKA 1XMOL 2VZAA 4BBRG 1CUKA 2NN6I 1WYDA 1X6OA 1PV4A 4U07A 1M90C 2UXDQ 2ALYB 4QQBX 4DR6L 4OO1I 1I94L 3CMAA 3CPWA 5GAEC 5IP7G 4YCUA 1D8LA 1EWIA 4HIOA 1YNXA 1HZCA 4U0SA 4LUOA 3STBD 3CMEA 4LF6Q 4BBSH 2F52A 2AHOB 2D0OA 2JE6I 3AEVA 1KQSA 1YJ9A 1J6QA 2B29A 3OYYA 3HOWG 1A8VA 2AKWB 3VDYA 3NBHB 4C3HH 2Q2TA 1IYJB 2Z6KC 4LF5L 4JI1Q 1KHIA 1YZ6A 2D0PA 2NN6G 1KAWA 4NXMQ 4KHPL 3RZDH 4EQ5A 4A3BG 3CCUA 4UP8A 5K36G 2VNUD 1Q8KA 3U4VA 1W2BA 4NXNL 3PV0A 4JI8Q 3ULLA 1G6PA 1N9WA 2PNHA 2PMZE 4DV1Q 2E5LL 4X66Q 1AH9A 1NE3A 3F2CA 1KRSA 4GNXA 1XMQQ 4WGJA 2E8GA 2LXJA 1SN8A 4A3DH 2N8NA 4DV6Q 1PFSA 1Q1BA 4DPGA 1SLJA 1YHBA 1HNZQ 3HOZH 1C0AA 2H5XA 4DV5L 4Y52H 2HIXA 1E1TA 2GN5A 3EIVA 2A1AA 4QIWE 2JA8H 2MQHA 1VQOA 1LYLA 1OXSC 1QUQA 2WB1G 1G291 5IWAQ 4UY8C 1V43A 1YJWA 2WB1E 4U0UA 2F4VL 2G03A 5DLQE 4P73A 5IYDH 4IOAA 1VQGA 1BKBA 1FGUA 4GNXB 2JA8G 4LFAQ 2I5MX 3K80C 3H0GG 2UXCQ 5M3MH 3E9HA 1OTCA 4JG2A 4GS3A 3HOUH 1SROA 4IOCA 5IP9G 3ZLMA 3T1HL 4TQUS 4LUZA 1OXVA 1QUQB 2Q2HA 2JA6H 2UUAQ 4GKJQ 2JEAI 1H95A 1QZHA 1YITA 1UE6A 3DLLA 3S1RH 3S1MH 3EBEA 4GKKL 4YCVA 1B8AA 4LF7Q 1OXXK 1Q12A 5H1SE 1NBWA 2BH8A 5C3EH 4YWKA 4DV7L 2N3SA 4BY1G 3UDGA 1GM5A 4QY7A 1FJGQ 1N34L 2JK8A 4XI8A 1V9PA 4KHZA 2YTXA 4YCWA 2FXQA 2VQFQ 1IXRA 2R6GA 3CCQA 4IPCA 3CCRA 3M4OH 4GOPC 1XNRL 1EIFA 1UE1A 3FKIH 3MXNB 4JOIC 4XIGS 3S17H 2QGQA 2VUMG 2CCZA 4XTCS 2BA1A 1IBML 2UXBQ 1XPUA 3CXCA 1HNXQ 3M9BA 3K81C 3T1YL 3TRZA 3PIPA 2VY3A 3M7NA 1RL2A 1WCMH 3PUVA 3GTPH 4DR5Q 4NB3A 4R4QA 3I7FA 1X55A 2IT1A 2JA7G 1GVPA 3BJUA 3G6EA 3OTOQ 3G4SA 2CWAA 3J80i 1N33L 1VQPA 4HIMA 1HR0Q 1VQNA 2R93G 2OTLA 3PF5A 2DUDA 1E22A 5JJ6A 3TS2A 4BXXG 5GAHC 4JCVE 2LSSA 3J80c 4LF9L 1PH5A 3CD6A 2Z6KA 2XTIA 4R4OA 4TVAB 4DR7Q 4YWLA 1VQ8A 1X3EA 1I6HH 5BR8L 4DKAC 2JEBI 1D7QA 4A3CG 2EQSA 3AFQA 4JI4L 4RMFA 4HJ7A 2QA4A 1XMOQ 4JI6L 5HGQA 4A3KH 1PH3A 1L1OC 1S3OA 4A3IH 5M5XH 1Q46A 3GDEA 1U5KA 1Q7YC 4DR6Q 1I94Q 2YYZA 2CFMA 2IHFA 3TQYA 3HKZE 3CC2A 2KHJA 3FHWA 3RN5A 1E7ZA 2B63H 4A3LG 1TWGH 3GTGH 4JI7Q 4B3ML 1XTDA 5M3FG 4DUZL 3I4NG 3ZCBA 1X54A 4FDBA 3GTJH 3L0OA 5IYBG 4LF5Q 1IBKL 2WFWA 1K8AC 4L5RC 4K0KL 5C4XG 5JEAJ 1XJVA 3W1GA 4LWCA 1PH4A 4LF4L 2B63G 4KHPQ 5JFFA 3CCEA 3KF8B 5J3BA 2UU9L 2MNAA 1TWHH 5FLXc 1VQ4A 1PH2A 4A3GG 4JI2L 1X3FA 4DUYL 4NXNQ 1XPOA 4DAYB 4HIDA 3E9IA 4L5QA 2E5LQ 3L2PA 2VW9A 4DV0L 2I5HA 2K5NA 2IX0A 2ZTEA 1CSPA 1B70B 3AQQA 4GLAC 4BBSG 5C44H 5LMUL 4MNOA 4YHHL 2BH2A 2F3IA 4DV5Q 3DM3A 2E2IH 4OO1G 2NVYH 1CSQA 1LUZA 5IE8A 5EAYA 5FLMH 1UE5A 4A75A 3ICEA 4GN3B 4R4CA 5JJKA 2R7ZH 1IBLL 3PIOA 3KDFA 1VQHA 3PUXA 2ZM6L 3CF5A 4LNQA 2F4VQ 2L15A 4PMWA 3KJOA 4PZ7A 3ZC7A 1QVGA 5JJ7A 4DR3L 1VQLA 4M16A 1I3QH 4HIKA 3RNUA 1N32L 3RLNA 4GOPA 4DR2L 3JAMi 3FP9A 4JOIA 3S14H 3KF6B 3M3YH 4NPSA 3A74A 4AH6A 4A3JH 3ER0A 3W5OA 4GN4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA5 H;  3JAM c;  4A3D G;  2K50 A;  2QEX A;  2CQO A;  4LFC L;  2KCT A;  5IYC H;  1Y1W H;  4X2E A;  1VQI A;  1J5E L;  3I55 A;  3HOZ G;  1E3P A;  3B6Y A;  4GLX A;  4JYA L;  3KDF B;  4AQY L;  4ME3 A;  3KFU A;  2E2H H;  1MKH A;  3I2Z A;  3GTM H;  4GKK Q;  1PH9 A;  5FJ8 H;  4LF8 L;  1OXU A;  2YU9 H;  4QL5 A;  2F6S A;  2KHI A;  4JI3 L;  1JMC A;  5IYC G;  1VCI A;  4GN5 A;  4DV7 Q;  1Y1W G;  1K73 C;  4GOP B;  1X9N A;  1KC8 C;  2JA9 A;  1JT8 A;  5IYD G;  3F2D A;  5IT9 c;  1N34 Q;  4QJF A;  2EXD A;  1P16 A;  2R92 H;  2HHH L;  1JE5 A;  2KCM A;  4ALP A;  1L0W A;  1XNR Q;  5M3M G;  4B3T Q;  1CKN A;  3M4P A;  3T1H Q;  4POG A;  3J7A 5;  3HOU G;  4YWM A;  1UWV A;  2UUC L;  3U4Z A;  4A76 A;  5HY6 A;  5LMN Q;  1IBM Q;  3S2D H;  2R92 G;  1CKM A;  2D62 A;  4OX9 L;  1EOV A;  1LM0 A;  3HKS A;  1VQA A;  3CAM A;  3UE0 A;  4JBJ A;  4OWX B;  1L1O A;  1YVC A;  4A3M H;  1VQ9 A;  5JFZ A;  2JA6 G;  3HOV H;  1YEZ A;  1VQK A;  4IPH A;  1PVO A;  2Q2U A;  1LTL A;  2IY5 B;  5GAG C;  3J7Z C;  2Z0S A;  1QVC A;  1JJG A;  2WP8 J;  4P72 A;  2ZJP A;  1YHQ A;  1TXY A;  5C3E G;  1N8R C;  4LW1 A;  1N33 Q;  3HOV G;  3EN2 A;  1BBW A;  3PUZ A;  1CKN B;  3AYH B;  2OCE A;  3UDX A;  3I4M H;  2NZO A;  4LF9 Q;  4L5S A;  3S2H H;  2ZJQ A;  3M85 A;  4JV5 L;  2K4K A;  4YY3 L;  3ULP A;  4QGU A;  4DV3 L;  3FKI G;  1L1O B;  2OWO A;  3RN2 A;  5EU0 A;  4DNI A;  4JI0 L;  4JI4 Q;  1S40 A;  3GTK H;  3U58 A;  2VQE L;  3PO2 H;  3ZJY C;  4JI6 Q;  3PO3 H;  3I4M G;  4UP9 A;  3TEH B;  1C9O A;  4J15 A;  3J81 i;  4HJ9 A;  1YJN A;  1R9T H;  5JJI A;  1KD1 C;  4IO9 A;  5AJ3 L;  1QZG A;  1WCM G;  3RLO A;  3CP0 A;  2HIV A;  2NVQ H;  3J81 c;  3CCL A;  4OON A;  2YTY A;  1M1K C;  4LF7 L;  3S15 H;  3SHG A;  4LUV A;  4B3R L;  3AFP A;  4X65 L;  4DV2 L;  1WI5 A;  2EIF A;  4OXP A;  4X64 L;  1EQQ A;  1XNQ L;  1BBU A;  4B3M Q;  1YI2 A;  4DUZ Q;  1Q81 C;  3RZO H;  4P75 A;  1KXL A;  4C3J H;  2ZTD A;  1AE2 A;  1Z9F A;  1IBK Q;  1HZB A;  1T9H A;  1IL2 A;  2OQ0 A;  4K0K Q;  4X6A H;  1SR3 A;  1AE3 A;  1X56 A;  4X62 L;  4IPG A;  4X2D A;  2MO0 A;  2AMC B;  1G51 A;  1KL9 A;  1XPR A;  4LF4 Q;  4IFD J;  3HKZ G;  4A93 H;  3J81 j;  2RF4 A;  1K8G A;  2UU9 Q;  4WJ4 A;  5JEA G;  3HOX H;  3CC7 A;  3GTO H;  3S16 H;  5JJL A;  1A0I A;  3HOY H;  2UUB L;  1CKO A;  1Y1V H;  4DUY Q;  4DR4 L;  2Q2I A;  2UXB L;  1L2F A;  4A3K G;  1PH7 A;  1EUJ A;  4A3I G;  1PH6 A;  2YV5 A;  1VQ6 A;  1VQB A;  5GRO A;  1FVI A;  4U04 A;  1SRU A;  2K5V A;  3GO5 A;  2PQA B;  3RR5 A;  2AWO A;  4DV0 Q;  1E1O A;  1ASZ A;  4A93 G;  2YTV A;  3LGJ A;  3ULJ A;  3KLW A;  1DGS A;  2ZJR A;  4YHH Q;  5LMU Q;  1VQ5 A;  4Y7N H;  2NZH A;  3CPF A;  1SE8 A;  1JJC B;  3H3V H;  4BBR H;  1HNW L;  3KYH C;  2ASB A;  1I50 H;  1IBL Q;  3D31 A;  2AWN A;  4B3S L;  2ZM6 Q;  2ATW A;  4JI5 L;  1N36 L;  4LFB L;  1NTG A;  1VQF A;  5IP7 H;  1YBY A;  2I0Q A;  2K52 A;  1JB7 A;  4DR3 Q;  3TRE A;  2ES2 A;  4DV4 L;  5IY0 A;  4HJA A;  1O7I A;  5C0X J;  3KF6 A;  1Q82 C;  2JQO A;  1N32 Q;  1KRT A;  4DR2 Q;  4P71 A;  3HOW H;  2E2J H;  4P74 A;  4POF A;  3CCV A;  2NVT H;  2MFI A;  5C4J H;  1X3G A;  4LFC Q;  5C44 G;  1J5E Q;  1OXT A;  4MZ9 A;  3PF4 A;  2ZTC A;  4DR1 L;  4JYA Q;  3STB C;  4A3B H;  3S1Q H;  4AQY Q;  2RHQ B;  4JI7 L;  1PYB A;  2PI2 E;  1UEB A;  5FLM G;  3CCM A;  1PYS B;  4PG3 A;  1BVS A;  4LF8 Q;  2PI2 A;  4X2C A;  1VQ7 A;  2R7Z G;  4JI3 Q;  1PA6 A;  2UXD L;  3BZC A;  2N49 A;  4C2M H;  5ELN A;  3E0E A;  1V1Q A;  1NJI C;  2CKZ B;  4GLV B;  1YIJ A;  1IZ6 A;  5M5Y H;  2HHH Q;  3A5U A;  1GKH A;  4DK3 C;  4LF6 L;  1Q86 C;  3JC6 6;  1Z47 A;  4IPD A;  1WFQ A;  4O0A A;  4UP7 A;  3UDI A;  3KOJ A;  4A4I A;  1SFO H;  2RCN A;  3IRB A;  2LXK A;  4A3J G;  2UUC Q;  2GVA A;  1SMX A;  3NEL A;  4KLK A;  1YHA A;  4JI1 L;  2IX1 A;  2JA5 G;  1W3S A;  4OX9 Q;  2B3G A;  4DK6 C;  4JBM A;  1MJE A;  4A3E H;  4NXM L;  2JJQ A;  2C35 B;  1EFW A;  3PUY A;  4AYB G;  3CCS A;  2K5H A;  3F8T A;  4AYB E;  1K9M C;  1HZ9 A;  5FJ8 G;  1S72 A;  3H0G H;  2V1C C;  4JI8 L;  3GTL H;  5GAD C;  4DV1 L;  3A0J A;  3S1N H;  4X66 L;  2VS1 A;  1GD7 A;  4A3E G;  1X65 A;  1Y14 B;  5ELO A;  3GTQ H;  3BZK A;  1XMQ L;  5IP9 H;  2GVB A;  4O2D A;  4DAM A;  3NEM A;  3PSI A;  3W1B A;  3BU2 A;  3T1Y Q;  3RLF A;  1U0L A;  2IHE A;  4DV6 L;  1FL0 A;  1WOC A;  4JV5 Q;  1VQJ A;  2ID0 A;  4PZ8 A;  1HZA A;  4YY3 Q;  4DV3 Q;  1HNZ L;  1MIU A;  3L7Z C;  2OQK A;  4BA2 I;  2HQL A;  4JI0 Q;  1HJP A;  4BA1 I;  3I56 A;  3CQZ H;  2WAQ G;  3K0X A;  2VQE Q;  5IWA L;  2Y0S G;  2WAQ E;  4APV A;  2Y0S E;  4A3M G;  2A19 A;  2K14 A;  3A5Z B;  3PCO B;  4BY1 H;  1JJ2 A;  4R4T A;  5AJ3 Q;  2NVX H;  5CGL A;  2HT1 A;  4IFD I;  3N3U A;  4JBW A;  3G71 A;  1VQE A;  4IJH A;  4LFA L;  2KEN A;  1VQM A;  4WJ3 M;  4JC0 A;  1EIY B;  3I4O A;  2UXC L;  1TWC H;  5BR8 Q;  4B3R Q;  1PHJ A;  4X65 Q;  4DV2 Q;  4X64 Q;  5LMN W;  1A62 A;  3S6A A;  4GNX C;  1XNQ Q;  2VUM H;  4EX5 A;  2DGY A;  4RG1 A;  1C7Y A;  1P8L A;  4KI0 A;  1E24 A;  2XGT A;  1K0R A;  1PH8 A;  1GO3 E;  1TWA H;  2UUA L;  4X62 Q;  4GKJ L;  3K7A H;  4C3I H;  4B3T L;  1PH1 A;  4N67 A;  4R4I A;  4UPA A;  1MJC A;  2UUB Q;  4ITR A;  1UE7 A;  5LMN L;  4OWW B;  1QVF A;  2JA7 H;  4PY3 A;  3PO3 G;  3PO2 G;  4DR4 Q;  4IFD G;  4LU4 A;  2PQA A;  2R93 H;  3CCJ A;  3S24 A;  3CUC A;  4IJL A;  1FJG L;  4BXX H;  1VQC A;  1K3R A;  2VL6 A;  3MEF A;  4BY7 H;  2OTJ A;  2VQF L;  1EYG A;  2N78 A;  1TWF H;  3G48 A;  3CW2 C;  1VQD A;  3SGI A;  5C0X I;  5M5W H;  4A3C H;  3GD7 A;  3U50 C;  3Q8D A;  1KIX A;  5GQO A;  4A3F H;  4U0Z A;  4JI2 Q;  1HR0 W;  3UDF A;  3NEN A;  1HNX L;  1HNW Q;  2K75 A;  3HFZ B;  1B7Y B;  1I5F A;  1NMG A;  2RHS B;  3TS0 A;  4BY7 G;  4AIM A;  2CWP A;  4B3S Q;  3K8A A;  1N36 Q;  4DR5 L;  4JI5 Q;  4LFB Q;  3PGZ A;  4H02 A;  4PZ6 A;  5E7N A;  2A8V A;  3HOX G;  3H3V I;  1A63 A;  3SN9 A;  4A3F G;  3HOY G;  5CMT A;  1Y1V G;  4DV4 Q;  3D0F A;  2R7D A;  3M4Q A;  3UE1 A;  3OTO L;  1K83 H;  3K7U C;  4HJ8 A;  4A3L H;  1Q1E A;  4L5T A;  4MTN A;  1NMF A;  3F1Z A;  1HR0 L;  3CC4 A;  5M3F H;  1WJJ A;  5C0X G;  3I4N H;  2BA0 A;  3WWV A;  1RIP A;  2R7F A;  5IYB H;  1NY4 A;  4HJ5 A;  2I5L X;  1HH2 P;  2KBN A;  3ERS X;  5C4X H;  1ASY A;  4DR7 L;  3LET A;  4DR1 Q;  3PUW A;  1VS0 A;  3H15 A;  4OWT B;  3F2B A;  4R1J A;  3KJP A;  3SE5 A;  5CKL A;  1EQR A;  2MO1 A;  3OW2 A;  4A3G H;  4JBK A;  1XMO L;  2VZA A;  4BBR G;  1CUK A;  2NN6 I;  1WYD A;  1X6O A;  1PV4 A;  4U07 A;  1M90 C;  2UXD Q;  2ALY B;  4QQB X;  4DR6 L;  4OO1 I;  1I94 L;  3CMA A;  3CPW A;  5GAE C;  5IP7 G;  4YCU A;  1D8L A;  1EWI A;  4HIO A;  1YNX A;  1HZC A;  4U0S A;  4LUO A;  3STB D;  3CME A;  4LF6 Q;  4BBS H;  2F52 A;  2AHO B;  2D0O A;  2JE6 I;  3AEV A;  1KQS A;  1YJ9 A;  1J6Q A;  2B29 A;  3OYY A;  3HOW G;  1A8V A;  2AKW B;  3VDY A;  3NBH B;  4C3H H;  2Q2T A;  1IYJ B;  2Z6K C;  4LF5 L;  4JI1 Q;  1KHI A;  1YZ6 A;  2D0P A;  2NN6 G;  1KAW A;  4NXM Q;  4KHP L;  3RZD H;  4EQ5 A;  4A3B G;  3CCU A;  4UP8 A;  5K36 G;  2VNU D;  1Q8K A;  3U4V A;  1W2B A;  4NXN L;  3PV0 A;  4JI8 Q;  3ULL A;  1G6P A;  1N9W A;  2PNH A;  2PMZ E;  4DV1 Q;  2E5L L;  4X66 Q;  1AH9 A;  1NE3 A;  3F2C A;  1KRS A;  4GNX A;  1XMQ Q;  4WGJ A;  2E8G A;  2LXJ A;  1SN8 A;  4A3D H;  2N8N A;  4DV6 Q;  1PFS A;  1Q1B A;  4DPG A;  1SLJ A;  1YHB A;  1HNZ Q;  3HOZ H;  1C0A A;  2H5X A;  4DV5 L;  4Y52 H;  2HIX A;  1E1T A;  2GN5 A;  3EIV A;  2A1A A;  4QIW E;  2JA8 H;  2MQH A;  1VQO A;  1LYL A;  1OXS C;  1QUQ A;  2WB1 G;  1G29 1;  5IWA Q;  4UY8 C;  1V43 A;  1YJW A;  2WB1 E;  4U0U A;  2F4V L;  2G03 A;  5DLQ E;  4P73 A;  5IYD H;  4IOA A;  1VQG A;  1BKB A;  1FGU A;  4GNX B;  2JA8 G;  4LFA Q;  2I5M X;  3K80 C;  3H0G G;  2UXC Q;  5M3M H;  3E9H A;  1OTC A;  4JG2 A;  4GS3 A;  3HOU H;  1SRO A;  4IOC A;  5IP9 G;  3ZLM A;  3T1H L;  4TQU S;  4LUZ A;  1OXV A;  1QUQ B;  2Q2H A;  2JA6 H;  2UUA Q;  4GKJ Q;  2JEA I;  1H95 A;  1QZH A;  1YIT A;  1UE6 A;  3DLL A;  3S1R H;  3S1M H;  3EBE A;  4GKK L;  4YCV A;  1B8A A;  4LF7 Q;  1OXX K;  1Q12 A;  5H1S E;  1NBW A;  2BH8 A;  5C3E H;  4YWK A;  4DV7 L;  2N3S A;  4BY1 G;  3UDG A;  1GM5 A;  4QY7 A;  1FJG Q;  1N34 L;  2JK8 A;  4XI8 A;  1V9P A;  4KHZ A;  2YTX A;  4YCW A;  2FXQ A;  2VQF Q;  1IXR A;  2R6G A;  3CCQ A;  4IPC A;  3CCR A;  3M4O H;  4GOP C;  1XNR L;  1EIF A;  1UE1 A;  3FKI H;  3MXN B;  4JOI C;  4XIG S;  3S17 H;  2QGQ A;  2VUM G;  2CCZ A;  4XTC S;  2BA1 A;  1IBM L;  2UXB Q;  1XPU A;  3CXC A;  1HNX Q;  3M9B A;  3K81 C;  3T1Y L;  3TRZ A;  3PIP A;  2VY3 A;  3M7N A;  1RL2 A;  1WCM H;  3PUV A;  3GTP H;  4DR5 Q;  4NB3 A;  4R4Q A;  3I7F A;  1X55 A;  2IT1 A;  2JA7 G;  1GVP A;  3BJU A;  3G6E A;  3OTO Q;  3G4S A;  2CWA A;  3J80 i;  1N33 L;  1VQP A;  4HIM A;  1HR0 Q;  1VQN A;  2R93 G;  2OTL A;  3PF5 A;  2DUD A;  1E22 A;  5JJ6 A;  3TS2 A;  4BXX G;  5GAH C;  4JCV E;  2LSS A;  3J80 c;  4LF9 L;  1PH5 A;  3CD6 A;  2Z6K A;  2XTI A;  4R4O A;  4TVA B;  4DR7 Q;  4YWL A;  1VQ8 A;  1X3E A;  1I6H H;  5BR8 L;  4DKA C;  2JEB I;  1D7Q A;  4A3C G;  2EQS A;  3AFQ A;  4JI4 L;  4RMF A;  4HJ7 A;  2QA4 A;  1XMO Q;  4JI6 L;  5HGQ A;  4A3K H;  1PH3 A;  1L1O C;  1S3O A;  4A3I H;  5M5X H;  1Q46 A;  3GDE A;  1U5K A;  1Q7Y C;  4DR6 Q;  1I94 Q;  2YYZ A;  2CFM A;  2IHF A;  3TQY A;  3HKZ E;  3CC2 A;  2KHJ A;  3FHW A;  3RN5 A;  1E7Z A;  2B63 H;  4A3L G;  1TWG H;  3GTG H;  4JI7 Q;  4B3M L;  1XTD A;  5M3F G;  4DUZ L;  3I4N G;  3ZCB A;  1X54 A;  4FDB A;  3GTJ H;  3L0O A;  5IYB G;  4LF5 Q;  1IBK L;  2WFW A;  1K8A C;  4L5R C;  4K0K L;  5C4X G;  5JEA J;  1XJV A;  3W1G A;  4LWC A;  1PH4 A;  4LF4 L;  2B63 G;  4KHP Q;  5JFF A;  3CCE A;  3KF8 B;  5J3B A;  2UU9 L;  2MNA A;  1TWH H;  5FLX c;  1VQ4 A;  1PH2 A;  4A3G G;  4JI2 L;  1X3F A;  4DUY L;  4NXN Q;  1XPO A;  4DAY B;  4HID A;  3E9I A;  4L5Q A;  2E5L Q;  3L2P A;  2VW9 A;  4DV0 L;  2I5H A;  2K5N A;  2IX0 A;  2ZTE A;  1CSP A;  1B70 B;  3AQQ A;  4GLA C;  4BBS G;  5C44 H;  5LMU L;  4MNO A;  4YHH L;  2BH2 A;  2F3I A;  4DV5 Q;  3DM3 A;  2E2I H;  4OO1 G;  2NVY H;  1CSQ A;  1LUZ A;  5IE8 A;  5EAY A;  5FLM H;  1UE5 A;  4A75 A;  3ICE A;  4GN3 B;  4R4C A;  5JJK A;  2R7Z H;  1IBL L;  3PIO A;  3KDF A;  1VQH A;  3PUX A;  2ZM6 L;  3CF5 A;  4LNQ A;  2F4V Q;  2L15 A;  4PMW A;  3KJO A;  4PZ7 A;  3ZC7 A;  1QVG A;  5JJ7 A;  4DR3 L;  1VQL A;  4M16 A;  1I3Q H;  4HIK A;  3RNU A;  1N32 L;  3RLN A;  4GOP A;  4DR2 L;  3JAM i;  3FP9 A;  4JOI A;  3S14 H;  3KF6 B;  3M3Y H;  4NPS A;  3A74 A;  4AH6 A;  4A3J H;  3ER0 A;  3W5O A;  4GN4 B; 
#chains in the Genus database with same CATH topology
 2JA5 H;  2EVB A;  4LFC L;  1Y1W H;  1VQI A;  3HOZ G;  4C3H B;  1E3P A;  4GLX A;  3I2Z A;  3GTM H;  1OXU A;  3TZU A;  2YU9 H;  1STH A;  4JI3 L;  2E2I B;  4QF4 A;  2E76 C;  1VCI A;  5IYC G;  4GN5 A;  4MIU A;  5IYD G;  2A5H A;  4ALP A;  1S5C D;  1L0W A;  3EFX D;  2F0N A;  4CJ0 B;  2B39 A;  1AZQ A;  1HXY D;  3H3V C;  2A69 C;  3FDT A;  4KD3 A;  2R61 A;  4A76 A;  5HY6 A;  5DAU A;  5LMN Q;  2R92 G;  1SE2 A;  4HMJ A;  1EOV A;  4OX9 L;  1VQ9 A;  3CAM A;  3UE0 A;  3GV3 A;  2F0I A;  1K3B C;  1L1O A;  4JBJ A;  3J7Y W;  3K5N A;  1YEZ A;  2IY5 B;  2NWG A;  1DON A;  1JJG A;  3TDQ A;  4P72 A;  4AYB B;  1QWY A;  4NP5 A;  4LW1 A;  1LTG D;  2AUK A;  1BBW A;  3AYH B;  2OCE A;  3UDX A;  2QDL A;  4BWG B;  4LF9 Q;  2JN4 A;  3NBI A;  3HOU B;  3ZYY X;  4DGZ A;  1GUO A;  3BS1 A;  4DV3 L;  4H7B A;  2OWO A;  4JI0 L;  4RCO A;  2VQE L;  3I4M G;  4UP9 A;  1GOZ A;  4HJ9 A;  5JJI A;  4I7Z C;  1QZG A;  1DOL A;  1RDP D;  3CP0 A;  3S2D B;  4KKU A;  1ZEQ X;  3D8G A;  4K8I A;  3HOV B;  1WI5 A;  2EIF A;  3RZO H;  1Q81 C;  4C3J H;  1Z9F A;  3H94 A;  1R4P B;  1IBK Q;  1BNZ A;  3R3O A;  1X56 A;  3JAM E;  4IFD J;  1ENC A;  3W3A A;  5JEA G;  1A0I A;  3QR8 A;  4A3I G;  3T56 B;  2YV5 A;  1ESF A;  3GTK B;  2WKD A;  3GO5 A;  3RR5 A;  1IW7 C;  1EIG A;  2XRQ D;  3LGJ A;  4KD4 A;  1R9T B;  4HCS A;  5LMU Q;  5A2Q E;  2NVQ B;  1EEF D;  5C3W A;  4KKS A;  4B3S L;  2SDF A;  4H0L C;  4JI5 L;  1N36 L;  2K52 A;  1JB7 A;  3KLR A;  1IKL A;  1IYU A;  2JQO A;  2F0G A;  1KRT A;  4P71 A;  3HOW H;  3GTO B;  3N52 A;  4P74 A;  3CCV A;  3HOY B;  2GA4 B;  2NVT H;  4ZUI A;  1GXD C;  1DM0 B;  2NN6 H;  2A6H C;  3PF4 A;  4DR1 L;  4A3B H;  2X69 A;  2RHQ B;  2AQ1 B;  5K36 H;  1A3V A;  1T5E A;  1EYC A;  4PG3 A;  2PI2 A;  4X2C A;  3U9O A;  2MPM A;  1KLU D;  2KUM A;  5IGG A;  2IJ0 A;  1I50 B;  3A5U A;  1CM9 A;  3N6R A;  2UUC Q;  3NEL A;  1W3S A;  3HGB A;  4A3E H;  2E2J B;  1EFW A;  4AYB G;  3CCS A;  4K5W A;  2K5H A;  3F8T A;  4AYB E;  2M00 A;  1PYW D;  3OHX C;  3H0G H;  3GTL H;  5GAD C;  5DM7 3;  3S1N H;  5ELO A;  5IP9 H;  2GVB A;  1ROD A;  2PMZ B;  2Z1C A;  3W1B A;  4ZYS A;  4NMZ A;  3ND9 A;  4DV6 L;  1FL0 A;  5CYU A;  4C2M B;  1MIU A;  2OQK A;  1HJP A;  4BA1 I;  4XT3 B;  2EYO A;  4U68 A;  5J39 A;  2A19 A;  3DM1 A;  1Q8I A;  4FF3 A;  2FMM A;  2NVX H;  2K01 A;  1SAP A;  2YU9 B;  5KGU A;  3G71 A;  4LFA L;  1VQE A;  4KY7 A;  4B3R Q;  5ELD A;  1A2T A;  4X65 Q;  4DV2 Q;  1A62 A;  1EIH A;  4EX5 A;  1E2Z A;  4KI0 A;  2XGT A;  1TWA H;  2UUA L;  4IAL A;  3KLS A;  3D4W A;  3GTQ B;  2LKV A;  1FD7 D;  1T5X D;  1QNK A;  2EOT A;  1PMR A;  4G57 A;  1MJC A;  2UUB Q;  4ITR A;  3VR4 A;  1WD0 A;  4DR4 Q;  2L1B A;  4K8J A;  1BF4 A;  3CCJ A;  2B2U A;  3S24 A;  3CUC A;  3CQZ B;  4BXX H;  4EQP A;  2VL6 A;  3SK5 A;  1EYG A;  2K1B A;  2N78 A;  4BY1 B;  5FLX L;  1G6Z A;  4A3C H;  4RGO S;  5IOC A;  1VMC A;  3NEN A;  1HNW Q;  5C5L A;  3TS0 A;  3ERQ A;  5IGD A;  2VUM B;  2QF7 A;  1IHZ A;  1FNU A;  3K8A A;  2FJ2 A;  3TBI B;  5E7N A;  4A3F G;  3HOY G;  5CMT A;  3LNN A;  4DV4 Q;  4F87 A;  2R7D A;  3QJY A;  5E1F A;  4C3I B;  4KMU C;  3CKI B;  4RGN A;  5BN3 A;  3CC4 A;  2KEE A;  2JA7 B;  5IYB H;  1HH2 P;  5C4X H;  1WTH A;  4RHR A;  5CV8 A;  3PUW A;  2IWH A;  1VS0 A;  3H15 A;  3PQI A;  4OWT B;  3VYU A;  3KJP A;  1STB A;  1EQR A;  2MO1 A;  1Y8N B;  4A3G H;  3NSW A;  4BBR G;  4P2C B;  1X6O A;  1JIC A;  1PV4 A;  1UAP A;  4GZY C;  4QQB X;  1EWC A;  4DR6 L;  1I94 L;  3CMA A;  1PLF A;  5GAE C;  4X3K A;  1LT3 D;  2K28 A;  4LUO A;  4BBS H;  2F0H A;  4K6D A;  2ZXR A;  2F52 A;  3F2U A;  1YJ9 A;  1J6Q A;  2B29 A;  3OYY A;  4OO1 H;  3NBH B;  2XSC A;  3M4Y A;  2Q2T A;  2Q8R E;  1MSH A;  1ZYR D;  5EKI A;  5CR3 A;  5EKK A;  5M3F B;  3RZD H;  5E4X A;  2DNE A;  4NXN L;  4OIK A;  1NUC A;  3PV0 A;  4EVO A;  3K6O A;  4JI8 Q;  1G6P A;  2PNH A;  2PMZ E;  4GNX A;  1XMQ Q;  4IUV A;  2B8G A;  4CGY B;  2LXJ A;  2N8N A;  1U4P A;  2A73 B;  4DXG A;  3HOW B;  3HOZ H;  5I6W A;  1SLJ A;  2X6G A;  2IX3 A;  4Y52 H;  1V1P A;  1E1T A;  2GN5 A;  2HIX A;  2A1A A;  4QIW E;  2JA8 H;  2MQH A;  1SXT A;  3L9A X;  3A56 A;  3DMU A;  1V43 A;  4UY8 C;  4QCL A;  2F4V L;  2G03 A;  5DLQ E;  5FO8 B;  2EYJ A;  4P73 A;  1NCV A;  5IYD H;  4IOA A;  1VQG A;  5EPJ A;  4ZAI A;  1ICW A;  1B9M A;  5LL6 X;  4DAV A;  3OMG A;  4HSV A;  1KTK A;  4WOR A;  1BDO A;  1CQV A;  2EJM A;  1SYF A;  1WTQ A;  2KQ3 A;  2IPK D;  2KEC A;  2Q2H A;  1H95 A;  2ZT9 C;  4K6L A;  3J81 L;  1QZH A;  1UE6 A;  3Q0A A;  1HUM A;  1NBW A;  3NK9 A;  1GUW A;  3HP3 A;  3P75 A;  4YWK A;  4BY1 G;  1SYG A;  3GTL B;  2JK8 A;  4XI8 A;  4KHZ A;  2EZV A;  1JQY D;  1JOO A;  2QCP X;  2A6E D;  4EQN A;  2DY7 A;  1BO0 A;  2QGQ A;  2F0O A;  2VUM G;  4QUC A;  4FF2 A;  4XTC S;  1XPU A;  5M3M B;  1HNX Q;  2CQA A;  2VY3 A;  4TKO B;  5KNB A;  4C3I G;  1RL2 A;  3GTP H;  3MXG A;  4DR5 Q;  2JA6 B;  2IT1 A;  2JA7 G;  3S1M B;  1VQN A;  3TS2 A;  2LSS A;  4LF9 L;  3DWQ A;  1PH5 A;  3VR5 A;  2JP1 A;  1MSG A;  1X3E A;  5BR8 L;  1I4R A;  2QEJ C;  4DKA C;  1D7Q A;  4TSS A;  2EQS A;  3IFT A;  5JEA H;  3NTK A;  2KVM A;  2QA4 A;  2EY1 A;  3R93 A;  5EJW A;  3M4O B;  2WII B;  1L1O C;  4A3I H;  1SJH D;  1O78 A;  1SNP A;  2K5W A;  2DY8 A;  2IW3 A;  1BCP B;  1EEI D;  4EQO A;  3RN5 A;  1E7Z A;  4HED A;  5JPN C;  1TWG H;  5M3F G;  4FDB A;  5L37 A;  4LF5 Q;  1IBK L;  5CV5 A;  2D2C C;  4B9W A;  2B63 G;  4KHP Q;  5T1I A;  3KF8 B;  4C56 C;  3NTI A;  3WDN A;  4QMG A;  1PH2 A;  1X3F A;  3K5M A;  1I6H B;  3NTH A;  1A3T A;  4N9T A;  2VW9 A;  4ID6 A;  3NWS A;  1CSP A;  4A3K B;  5M5X B;  5LMU L;  1B4O A;  3T13 A;  5KNC A;  3S9W A;  2E2I H;  4CKB A;  5D14 A;  5C4X B;  1F9R A;  4C1N K;  1ESR A;  3KDF A;  4K5X A;  3CF5 A;  4LNQ A;  4A3G B;  2EY5 A;  1EY5 A;  1QNU A;  5JJ7 A;  1KDA A;  1SDF A;  1RD9 D;  4GOP A;  3JAM i;  1TU2 B;  3OW7 A;  2E2D C;  5ELE A;  4ME3 A;  1K28 A;  3W5O A;  3MWY W;  4N8F A;  5KIX A;  2K50 A;  3I55 A;  4HR7 B;  2EXZ A;  3TP8 A;  1MKH A;  2XNA C;  1CHP D;  4QL5 A;  2KHI A;  1K73 C;  4DV7 Q;  2F0U A;  2BDN A;  5IT9 c;  2PYK A;  2EJG C;  4QJF A;  2VXW A;  2KCM A;  1RTN A;  4XYO A;  5M3M G;  3HS0 C;  4CDF C;  1EZ8 A;  2UUC L;  3A8I E;  3U4Z A;  3IL8 A;  3S2D H;  4KKT A;  3HKS A;  4OWX B;  2JA6 G;  2H1E A;  5EGT A;  3MAQ A;  3HOV H;  5JFZ A;  3S14 B;  3M3Y B;  4A3J B;  2Q2U A;  1JOK A;  3ND8 A;  3J7Z C;  5FLX E;  1PTO B;  2ZJP A;  4MN3 A;  1TXY A;  1SE3 A;  4YIJ A;  3EN2 A;  3PUZ A;  1CKN B;  4CJ1 B;  3M85 A;  1SJE D;  4QGU A;  2R92 B;  4DNI A;  5CV4 A;  3GTK H;  4NW2 A;  4JI6 Q;  5FO9 B;  3SK8 A;  3TEH B;  1YJN A;  1R9T H;  3K59 A;  1S5F D;  2WAQ B;  2NVQ H;  2HIV A;  1QE6 A;  1LAC A;  2K33 A;  2K5Q A;  4B3R L;  3AFP A;  4X65 L;  4DV2 L;  1ILQ A;  1EQQ A;  1BBU A;  4B3M Q;  1IL2 A;  1T9H A;  2O4X A;  4K0K Q;  1SR3 A;  1I4H A;  3GV6 A;  4X2D A;  2IL8 A;  4IPG A;  3I4M B;  2Z8L A;  1EY4 A;  3J81 j;  2UU9 Q;  1AEX A;  1B3A A;  3CC7 A;  3GTO H;  4FNF A;  3HOY H;  2UUB L;  1CKO A;  4DUY Q;  4DR4 L;  4MTK A;  1L2F A;  4A3K G;  1PH7 A;  1PH6 A;  2HD3 A;  1VQ6 A;  2X6L A;  4QUF A;  5GRO A;  4ZKB B;  3P20 A;  1F2L A;  1E1O A;  3PO3 B;  4A93 G;  5CGK A;  3KLW A;  5I6Y A;  3EVQ A;  3CPF A;  1GJX A;  1JJC B;  4BBR H;  1HNW L;  1I50 H;  3PIO 3;  1IBL Q;  4FXK C;  1B9N A;  5LL6 S;  2ZM6 Q;  3E3X A;  4DR3 Q;  3TRE A;  4DV4 L;  5IY0 A;  1O7I A;  1LTT D;  2XRS D;  3C1E A;  2B2U C;  2B2Y C;  4DR2 Q;  2E2J H;  2MFI A;  2PW5 A;  5AFW A;  5CBA E;  4L63 B;  4IN3 A;  4JYA Q;  1KDB A;  1KLG D;  4JI7 L;  1J9O A;  1PYB A;  2PI2 E;  1UEB A;  1PYS B;  3KK7 A;  4WJW A;  1VQ7 A;  1YNN D;  2R7Z G;  1PA6 A;  5HUR A;  4C2M H;  5DNF A;  5ELN A;  2RA4 A;  2CKZ B;  4GLV B;  2I46 A;  2HHH Q;  4IPD A;  1WFQ A;  3DWA A;  4UP7 A;  3J81 E;  4KJO A;  2Z4I A;  3TP5 A;  2LXK A;  4A3J G;  4XT1 B;  2TSS A;  1ML0 D;  1MJE A;  4JBM A;  2C35 B;  4RA8 A;  3HRZ C;  3PUY A;  1SSO A;  5CMD A;  4IUP A;  1VF7 A;  5FJ8 G;  1S72 A;  4JI8 L;  3DEO A;  3S1Q B;  3I70 A;  1Y14 B;  3GTQ H;  3H09 A;  1XMQ L;  4DAM A;  1LTB D;  3NEM A;  3PSI A;  4XXE A;  3BU2 A;  3RLF A;  1U0L A;  2HUG A;  1EQV A;  2IHE A;  3MXP A;  4JV5 Q;  4PZ8 A;  2ID0 A;  4YY3 Q;  5BN5 A;  5KYI A;  5M5Y B;  1EWH A;  3CQZ H;  5I9O A;  1KNE A;  2WAQ G;  3K0X A;  2DNC A;  2WAQ E;  1V8Q A;  1EY6 A;  2K14 A;  2K32 A;  3PCO B;  4BY1 H;  3J80 L;  1JJ2 A;  3NPP A;  3SK6 A;  2LY7 A;  2B2W A;  4OEM B;  3I4O A;  1EIY B;  5BR8 Q;  3VR3 A;  5LMN W;  3S6A A;  4GNX C;  2VUM H;  2F1M A;  4RG1 A;  1C7Y A;  2J4X A;  1E24 A;  1K0R A;  3I8Z A;  5DM6 3;  4X62 Q;  2VB3 X;  2F0V A;  4C3I H;  2G9D A;  2A6E C;  4K2K A;  4B3T L;  2Q8I B;  4X3S A;  4FO2 A;  2JA7 H;  3PO2 G;  3OIQ A;  3PO3 G;  2WKC A;  3QIA A;  3QO2 A;  2L4N A;  3SR1 A;  4IJL A;  1G2T A;  1J8I A;  1IYV A;  3FEW X;  5EQ0 A;  1HCZ A;  2NZ1 D;  1PRT D;  1NR2 A;  3SGI A;  5ISR A;  1VQD A;  5C0X I;  3GD7 A;  1KIX A;  3CHB D;  1HPC A;  1HR0 W;  4DA2 A;  5JAV A;  1TWC B;  3UDF A;  3A54 A;  4ZUJ A;  1HNX L;  2K75 A;  2VB2 X;  1B7Y B;  1I5F A;  3H91 A;  4BY7 G;  4AIM A;  1Y8O B;  4DR5 L;  3PGZ A;  2A8V A;  2XIW A;  3H3V I;  3LWU A;  1Y1V G;  3D0F A;  3Q23 A;  3DHQ A;  4DNT B;  3T53 B;  3K7U C;  1CT1 D;  1Q1E A;  4L5T A;  3F1Z A;  1X3Q A;  3LWE A;  5M3F H;  5C0X G;  2BA0 A;  4ULL A;  3WWV A;  1RIP A;  1SYC A;  2CVR A;  4HJ5 A;  2KBN A;  1NR4 A;  2NUC A;  4JPB W;  3F2B A;  1S5D D;  3SE5 A;  1TS3 A;  3ONA B;  1TWF B;  1U9R A;  4OIJ A;  2UXD Q;  2XVS A;  4M8A A;  4A3F B;  4OHJ A;  1EQT A;  1ENF A;  1TT2 A;  3CPW A;  5IP7 G;  1EWI A;  4HIO A;  1YNX A;  1HZC A;  4U0S A;  5C5M A;  3QOL A;  3SK4 A;  3FRP B;  2F0E A;  1I4P A;  4G7O C;  1A8V A;  4LF5 L;  1K83 B;  1KHI A;  4IQZ A;  2Z4H A;  1BOS A;  2D0P A;  1F2M A;  4KHP L;  4EQ5 A;  4BBR B;  2J7Z A;  1QJO A;  1Q8K A;  2RVL A;  1H9S B;  2PCF B;  3MVV A;  4DV1 Q;  4ZLT F;  1AH9 A;  1EFI D;  1KRS A;  1PDQ A;  1K8O A;  1TY0 A;  2L12 A;  1PFS A;  4DPG A;  4I7A A;  3OOC A;  1VQO A;  1OXS C;  1QUQ A;  1EY9 A;  1LT4 D;  1JC7 A;  5EBD A;  4ZRZ A;  4U67 3;  2JXM B;  1BUV T;  1Q3L A;  2QDB A;  1QG7 A;  1AP0 A;  4RGT A;  3AB9 A;  5M3M H;  3RUZ A;  1SRO A;  5IGE A;  3VA5 A;  4QIW B;  2P5Z X;  2JA6 H;  3Q24 A;  4GKJ Q;  3HEJ A;  1HHV A;  3DLL A;  3S1M H;  2B2V A;  2PQE A;  1WTX A;  4YCV A;  4KHV A;  1OXX K;  5H1S E;  1KAB A;  5FK9 C;  4DV7 L;  2N3S A;  1FJG Q;  1D6E C;  1DCZ A;  1S5E D;  1AW7 A;  2BCO A;  1LTI D;  3CCQ A;  3M4O H;  4GOP C;  1EIF A;  3MXN B;  3T51 B;  4XIG S;  3BVM A;  1PRT F;  2M2L A;  2OXP A;  2XN9 C;  3T1Y L;  1EL0 A;  2B2Y A;  3M7N A;  2NBF A;  4XQN A;  4R4Q A;  2CHB D;  1VF5 C;  3KUP A;  3I7F A;  4WRD A;  1X55 A;  4J1M A;  3BJU A;  3OTO Q;  1VQP A;  2OTL A;  1E22 A;  5JJ6 A;  4IUQ A;  4K14 A;  5GAH C;  2CH4 W;  2XTI A;  4R4O A;  1I6H H;  4DR7 Q;  4YWL A;  2WIN B;  2F0L A;  2PO4 A;  1A15 A;  2D5D A;  4HJ7 A;  4JI6 L;  1LTR D;  3FKI B;  4A3K H;  1I6V C;  1S3O A;  2B2T A;  5M5X H;  1U5K A;  1SYE A;  2CFM A;  2K5D A;  3CRL C;  3HKZ E;  1D1I A;  1VMP A;  1CK1 A;  3BZD B;  5I2X A;  4JI7 Q;  4B3M L;  1NNX A;  1X54 A;  4R9W A;  1G91 A;  2WFW A;  4K0K L;  3J7A F;  5JEA J;  1F9Q A;  5EPL A;  3SEB A;  2NUN A;  1PH4 A;  4N9P A;  1DOM A;  2UU9 L;  3I90 A;  2EE1 A;  4DUY L;  4DK0 A;  1XX8 A;  4DAY B;  2CW0 D;  4NKL A;  3E9I A;  2E5L Q;  1DZ1 A;  5CV9 A;  1DYQ A;  2K5N A;  2ZTE A;  1JWM D;  5JVG 3;  1JWS D;  1H9J A;  3MC0 B;  3C1F A;  2RSO A;  1H9M A;  4IUU A;  1ZXT A;  4DV5 Q;  4CDC C;  1LUZ A;  3ICE A;  5EAY A;  1UE5 A;  4GN3 B;  2B63 B;  2R7Z H;  1IBL L;  2SNM A;  2RBM A;  2ZM6 L;  1Z7T A;  2L15 A;  4TRD A;  3KJO A;  5CC4 A;  4DR3 L;  1VQL A;  1UEA B;  2C9O A;  3OMC A;  4DR2 L;  3FP9 A;  1E2W A;  3S14 H;  1LV9 A;  1YNN C;  3M3Y H;  4NPS A;  4AH6 A;  4A3J H;  1R4Q B;  3T1H Q;  2N55 A;  3JAM c;  4Q0F A;  2QEX A;  5IYC H;  2KCT A;  3J80 E;  1PTO H;  3NQI A;  4JYA L;  3KFU A;  1HUN A;  1SND A;  3MFG A;  2E2H H;  4GKK Q;  1PH9 A;  5FJ8 H;  5C44 B;  4XQJ A;  2NVY B;  1Y1W G;  1B44 D;  2F0J A;  1ET9 A;  4NDX A;  1KC8 C;  2R92 H;  2EXD A;  1P16 A;  2HHH L;  3HG9 A;  1JE5 A;  1S4Z A;  1XNR Q;  2A69 D;  4B3T Q;  3M4P A;  4POG A;  1UWV A;  1RJT A;  5JJZ A;  1IBM Q;  1CKM A;  2XWB B;  3PIP 3;  2B8F A;  4IPH A;  4IUR A;  1PVO A;  3NE5 B;  4KN7 C;  4S3S A;  3KBG A;  3OWE B;  1YHQ A;  4FF4 A;  1N8R C;  1N33 Q;  1AZP A;  3RD4 A;  3NXW A;  1PFM A;  3I4M H;  4L5S A;  4JV5 L;  2K4K A;  4YY3 L;  3E0J A;  3FKI G;  1L1O B;  4K5V A;  4KN4 C;  1S40 A;  4ME5 A;  4DK1 A;  3PO2 H;  3ZJY C;  1TII D;  3PO3 H;  1C9O A;  4J15 A;  3J81 i;  1OO9 B;  2Y0S B;  3A8K E;  2CH4 A;  3BDL A;  2O5I C;  4OON A;  4A3M B;  4LF7 L;  2PZU A;  3DXJ C;  2L9H A;  4O1N A;  4OXP A;  4DUZ Q;  1EOT A;  4P75 A;  1PZI D;  2MJ8 A;  3MHB A;  2ZTD A;  1HZB A;  1RKN A;  2OQ0 A;  4X62 L;  1KL9 A;  1PRT C;  1K8G A;  2RDG A;  3S2H B;  1Y1V H;  2Q2I A;  4OL7 A;  4KY6 A;  2UXB L;  1EUJ A;  4U04 A;  2K5V A;  5C0X H;  3FMC A;  2F4I A;  1CFM A;  2HCI A;  5D3D A;  2B2W C;  3ULJ A;  4YHH Q;  1VQ5 A;  1GHJ A;  3CU7 A;  3UI2 A;  1SE8 A;  4L6T B;  3S15 B;  3H3V H;  3KYH C;  2ASB A;  4CKE A;  1CI3 M;  4PNY A;  2AWN A;  1GHK A;  1FR3 A;  1JCK B;  1VQF A;  4ILW A;  5IP7 H;  2I0Q A;  1BXT A;  2ES2 A;  4HJA A;  3KF6 A;  1N32 Q;  4A93 B;  1I4X A;  3HOX B;  3S16 B;  1CQF A;  2F0S A;  4CBV A;  1HFG A;  5C4J H;  1F9P A;  1X3G A;  2DJG C;  1IL8 A;  1JR0 D;  5C44 G;  1J5E Q;  1OXT A;  4PV1 C;  2ZTC A;  2Z6B A;  3S1Q H;  4AQY Q;  3CCM A;  4LF8 Q;  1BVS A;  4Y7N B;  2MGS A;  5ELF A;  2UXD L;  3BZC A;  2L0C A;  3E0E A;  3BVG A;  3NWT A;  4K2L A;  5M5Y H;  2O5J C;  1Q86 C;  3JC6 6;  1Z47 A;  3EA6 A;  4O0A A;  2G9H D;  3UDI A;  2RCN A;  1TY2 A;  1U4M A;  1WTW A;  1D5Z C;  2GVA A;  1SMX A;  3R8B A;  1MI2 A;  2B3G A;  4ODG A;  4DK6 C;  2RSN A;  2SEB D;  1UNS A;  4KTA A;  2R7Z B;  5CV7 A;  3E5S A;  5HGT A;  3TZD A;  4DV1 L;  2VS1 A;  1GD7 A;  4A3E G;  3BZK A;  3PMF A;  4O2D A;  1ENA A;  4ZCK A;  2HDL A;  1GUT A;  2A68 D;  2F0P A;  3T1Y Q;  1WOC A;  3SDZ A;  1VQJ A;  4LJZ C;  1HZA A;  2LMC B;  3L7Z C;  4BA2 I;  2HQL A;  2Y0S G;  4ZQ3 A;  2Y0S E;  4B9X A;  4A3M G;  1FYC A;  3BDC A;  1SFO B;  2E2H B;  4R4T A;  5AJ3 Q;  3URY A;  5CGL A;  3TN2 A;  3A8J E;  2WB1 B;  1S5B D;  3N3U A;  4JBW A;  1PZK D;  5DEH A;  4IFD I;  4WJ3 M;  1TWC H;  1PHJ A;  4DXF A;  4X64 Q;  1XNQ Q;  2PPB C;  3R2I A;  4XQQ A;  3P1H A;  1GO3 E;  2F0T A;  4OGQ C;  4GKJ L;  3NP8 A;  1U4L A;  1PH1 A;  4N67 A;  2MUY A;  4UPA A;  2BOS A;  4OWW B;  1UE7 A;  1I4Q A;  4IFD G;  1QVF A;  3TP7 A;  2PQA A;  2K03 A;  1FJG L;  1D5X C;  1K3R A;  3A7L A;  3MEF A;  4HMI A;  4X3T A;  3RMH A;  2OTJ A;  1STG A;  4G4K A;  2NB0 A;  1TWF H;  3FVQ A;  3CW2 C;  5LHY 1;  2BE5 D;  1JOQ A;  5GQO A;  4A3F H;  1EZ6 A;  2EDG A;  4CHT B;  5M9O A;  2RHS B;  3NHH A;  2CWP A;  4E6I A;  3L3O C;  2B2V C;  3PO2 B;  4LFB Q;  1A63 A;  1MGS A;  3HOX G;  3D4R A;  3SN9 A;  4L8J A;  3M4Q A;  3UE1 A;  3OTO L;  1K83 H;  3K7A B;  4MHE A;  4HJ8 A;  3QWN A;  3NUC A;  1PFN A;  1XWE A;  1WJJ A;  4EGV A;  1B3Q A;  1SEB D;  4ABN A;  2R93 B;  4DR7 L;  3BDO A;  4Q5V A;  5JPM C;  4BY7 B;  5IGC A;  5CKL A;  4JBK A;  1JWU D;  1WYD A;  4U07 A;  5M5W B;  4FP5 D;  2MP1 A;  2V4D A;  2RCF A;  3X3N A;  4OO1 I;  1Y1V B;  1LT5 D;  4YCU A;  3C3L A;  3STB D;  3CME A;  4LF6 Q;  3DEP A;  2AHO B;  1DOK A;  2EY6 A;  1KQS A;  2L5T A;  4I65 A;  2CW0 C;  1IYJ B;  4JI1 Q;  1LO5 D;  1TQO A;  1CHQ D;  1YZ6 A;  1ZYR C;  4RCN A;  4RKL A;  4NXM Q;  1KAW A;  5IT9 L;  5I4D A;  1CTM A;  3I4N B;  4V19 0;  2EPB A;  3IFD A;  4UP8 A;  2FFK B;  4JK1 C;  3D3R A;  4RGM A;  3ERO A;  2B2T C;  3ULL A;  1N9W A;  2E5L L;  4X66 Q;  1NE3 A;  3EQL C;  1KAA A;  1QB5 D;  1NSN S;  1HNZ Q;  1YHB A;  2HQE A;  2H5X A;  4DV5 L;  5C4J B;  3OIP A;  4HCE A;  4CKC A;  1ONL A;  5E4W C;  1SYB A;  1LYL A;  5IWA Q;  2WB1 G;  1JOR A;  2WB1 E;  4U0U A;  1YNJ D;  1BKB A;  4GNX B;  2RDH A;  3P7J A;  2JA8 G;  2I5M X;  1HQM C;  3K80 C;  2SNS A;  3SXH A;  2UXC Q;  4G7H C;  3E9H A;  4H13 C;  4HTH A;  4GS3 A;  4IOC A;  1V1P B;  3T1H L;  4LUZ A;  5KEE A;  1PXU A;  5COR A;  2JEA I;  1YIT A;  1BBX C;  3EBE A;  3M7G A;  4A3D B;  4GKK L;  1B8A A;  4LF7 Q;  2KCN A;  1ET6 A;  3OSO A;  1CZW A;  3QOJ A;  4QY7 A;  4F8M A;  2E75 C;  1V9P A;  5COY A;  2ENB A;  2FXQ A;  1O7Z A;  1IXR A;  2VQF Q;  2HDM A;  4IPC A;  2Q8T A;  1XNR L;  3FKI H;  2EYL A;  2CCZ A;  1IBM L;  1LLR D;  3AMU A;  2UXB Q;  3CXC A;  3TRZ A;  3G7L A;  1W6J A;  3K81 C;  1BR9 A;  1Y69 U;  3PUV A;  2F0D A;  5D3I B;  3GP7 A;  1E0B A;  2WAC A;  1GVP A;  2EYF A;  3J80 i;  3S1R B;  1N33 L;  2R93 G;  1M4V A;  4O42 A;  4HIM A;  1HR0 Q;  3PF5 A;  3IAY A;  1EU3 A;  1HRJ A;  2Z6K A;  5IOD A;  5C3E B;  1VQ8 A;  2DJF C;  2ICE C;  3AFQ A;  4V0B A;  3KLS X;  1XMO Q;  4KY5 A;  3S17 B;  1Q46 A;  1A6X A;  3KF8 A;  1Q7Y C;  4LMQ D;  2YYZ A;  3TQY A;  2IHF A;  5KND A;  2F0F A;  1JB3 A;  1ICF B;  2K6A A;  3A55 A;  3CC2 A;  3FHW A;  1EU4 A;  2B63 H;  4A3L G;  1WCM B;  5J22 A;  4BS9 A;  1XTD A;  4DUZ L;  3EJI A;  3I4N G;  3A7A B;  3VR2 A;  5ELB A;  1MBY A;  1K8A C;  2F0Q A;  1XJV A;  1ZKO A;  3W1G A;  4LWC A;  2LFN A;  4FYD A;  5JFF A;  3CCE A;  5FLX c;  1E2V A;  1VQ4 A;  4JI2 L;  2DN8 A;  2RDF A;  1XPO A;  4F7X A;  2KJX A;  3D6C A;  1H9K A;  1BCP D;  3HKZ B;  4L5Q A;  1A2U A;  2R3Z A;  2IX0 A;  1B70 B;  3K57 A;  1WTP A;  3W2D A;  1CA5 A;  3BG3 A;  5C44 H;  3E6Z X;  4YHH L;  3D6W A;  1HTP A;  2F3I A;  3DM3 A;  1EYA A;  1W6K A;  1CSQ A;  2EYM A;  2KA7 A;  2NVY H;  3D4D A;  3LX0 A;  4C3H G;  5IGF A;  3I72 A;  1RF2 D;  5JJK A;  1TS2 A;  3GTG B;  4IZ8 A;  3PIO A;  1VQH A;  1VDZ A;  3GTJ B;  1TS4 A;  2NTS A;  4PZ7 A;  5IGB A;  3ZC7 A;  5NUC A;  1NAP A;  3VYT A;  1SNC A;  1AFP A;  4HIK A;  3RNU A;  1N32 L;  4JOI A;  1TWH B;  3KF6 B;  5FKA C;  4KV6 A;  1ASZ A;  1B50 A;  4A3D G;  2CQO A;  2Z9H A;  1J5E L;  4X2E A;  3B6Y A;  3KDF B;  4AQY L;  4FF1 A;  4LF8 L;  1WTV A;  2F6S A;  2F0M A;  1JMC A;  1K0S A;  1JT8 A;  4GOP B;  1X9N A;  2JA9 A;  4RKB A;  3F2D A;  3WOF A;  1N34 Q;  3V2T A;  5KYL A;  4CJ2 C;  2F0W A;  1SMY D;  4J8Q A;  3QB3 A;  1CKN A;  1UUP A;  3J7A 5;  3HOU G;  4YWM A;  5KRU A;  1I3Q B;  2D62 A;  1LM0 A;  1C8C A;  1VQA A;  4A3M H;  2A68 C;  2I07 B;  1YVC A;  3OPO A;  1VQK A;  3IKJ A;  2OEO A;  1LTL A;  5GAG C;  2JA5 B;  2Z0S A;  2MHV A;  1QVC A;  2QKI C;  1Y1W B;  2WP8 J;  1KNA A;  3V96 A;  2EJF C;  5C3E G;  1O7L A;  3HOV G;  3GTM B;  3NQT A;  3AU7 A;  1STA A;  2NZO A;  2G5D A;  2LS0 1;  1RTO A;  3WOE A;  2ZJQ A;  3S2H H;  1O80 A;  3DWP A;  2QW7 A;  3ULP A;  2M9V A;  3MZ5 A;  3QG1 A;  3RN2 A;  5EU0 A;  2NTT A;  4XYQ A;  4JI4 Q;  3U58 A;  5EPK A;  4IFD H;  3MTS A;  2WV6 D;  4B08 A;  4PMB A;  2BDO A;  2AQ2 B;  3VYR A;  4IO9 A;  1KD1 C;  5AJ3 L;  1PTO D;  1A3U A;  1EYD A;  1TS5 A;  1WCM G;  3RLO A;  2EY2 A;  3J81 c;  3CCL A;  2YTY A;  1M1K C;  3S15 H;  3SHG A;  1LT6 D;  1PZJ D;  1SNQ A;  4PQX A;  4LUV A;  2K7V A;  4X64 L;  3DUZ A;  1XNQ L;  4ZK9 B;  1YI2 A;  1LTA D;  1KXL A;  1H9R A;  1AE2 A;  1QOH A;  4X6A H;  2O2L D;  1AE3 A;  1G51 A;  2AMC B;  2MO0 A;  1XPR A;  4LF4 Q;  3VR6 A;  4ZKC B;  3HKZ G;  1STE A;  4A93 H;  2RF4 A;  4CDD C;  4WJ4 A;  3C46 A;  3HOX H;  5C3X A;  5T1G A;  3S16 H;  5JJL A;  2BE5 C;  2F3W A;  3O13 A;  3GQB A;  1VQB A;  1FVI A;  1XYI A;  1BCP F;  1SRU A;  4X3U A;  2PQA B;  4DV0 Q;  2AWO A;  1CA6 A;  2YTV A;  2L55 A;  5IT9 E;  2ZJR A;  1DGS A;  4Y7N H;  1TR5 A;  2NZH A;  4JW0 A;  5G3L D;  3V05 A;  1O7Y A;  3J7A V;  1L0X B;  1WTO A;  3I73 A;  3D31 A;  3RZO B;  2ATW A;  4C3J B;  4LFB L;  1NTG A;  1LTS D;  1YBY A;  1IKM A;  5C0X J;  1Q82 C;  1SNO A;  4POF A;  1X3P A;  5IIF A;  3H6M A;  4LFC Q;  4MZ9 A;  3STB C;  3R2T A;  5E3F A;  5FLM G;  1U4R A;  1SNM A;  4IUN A;  5FO7 B;  1HA5 A;  4JI3 Q;  2N49 A;  1GUG A;  4PMC A;  1NJI C;  1V1Q A;  4DN4 M;  3MFY A;  1YIJ A;  1IZ6 A;  3CRK C;  1GKH A;  4DK3 C;  1L0Y B;  1GUN A;  4LF6 L;  3OWF A;  1K8M A;  3T4A C;  4KJN A;  3KOJ A;  4A4I A;  1SFO H;  2RKS A;  1SBB B;  3IRB A;  1C48 A;  4KLK A;  2IX1 A;  1YHA A;  2PZT A;  4JI1 L;  2JA5 G;  4OX9 Q;  1ILP A;  2ZXP A;  4NXM L;  2JJQ A;  2NVT B;  2OT2 A;  1XXG A;  1K9M C;  1HZ9 A;  2V1C C;  5I9P A;  4A3B B;  3A0J A;  4X66 L;  2F03 A;  1X65 A;  1STN A;  4IUT A;  1YNJ C;  1HNZ L;  4DV3 Q;  2PW7 A;  4FXG C;  1F2Y A;  4JI0 Q;  1EY8 A;  1Y8P B;  3I4L A;  3I56 A;  2VQE Q;  5IWA L;  4UDU C;  4APV A;  4UHV A;  3A5Z B;  3BVZ A;  5J1Z A;  2HT1 A;  1PTO F;  4IJH A;  2N88 A;  2KEN A;  3SE0 A;  4A3E B;  4JC0 A;  1VQM A;  5FOB B;  5I2Y A;  2UXC L;  5BN4 A;  2A74 C;  1F77 A;  2FIN B;  2DGY A;  1P8L A;  1PRT B;  3H0G B;  4RHS A;  1PH8 A;  3S1N B;  4RH6 A;  5CV6 A;  1HQR D;  4DNR B;  1DXM A;  4DAP A;  3I91 A;  3K7A H;  2K04 A;  2J0T D;  4R4I A;  5LMN L;  4PY3 A;  1EY0 A;  4UAI A;  2RQX A;  3T16 A;  4LU4 A;  2R93 H;  1VQC A;  2PNR C;  2NYZ D;  4LAA A;  3Q22 A;  3I3C A;  4BY7 H;  5C4H A;  4H44 C;  2VQF L;  3G48 A;  2NVX B;  5M5W H;  1B1Z A;  4RFB A;  3U50 C;  3Q8D A;  4CDE C;  1HFN A;  4U0Z A;  4JI2 Q;  4C3J G;  1F9S A;  5G3L F;  3HFZ B;  1NMG A;  2PZW A;  3MXU A;  4B3S Q;  1IW7 D;  5K5P A;  2AQ3 B;  1N36 Q;  4JI5 Q;  4H02 A;  4PZ6 A;  1FNW A;  1TWA B;  3TP6 A;  4A3L H;  2KOL A;  2AUJ D;  4MTN A;  1NMF A;  1HR0 L;  1CZG A;  4RWS C;  3I4N H;  1SYD A;  3K0Y A;  2R7F A;  1NY4 A;  1DD2 A;  2I5L X;  2KED A;  3ERS X;  1ASY A;  3BYY B;  4KK7 A;  3LET A;  4FXD A;  4DR1 Q;  1M8A A;  4R1J A;  4HAE A;  3OW2 A;  2H4O A;  1XMO L;  2VZA A;  1CUK A;  2NN6 I;  1M90 C;  3MEH A;  2FMC A;  2ALY B;  2JYO A;  3JAM L;  1H9S A;  1D8L A;  2A6H D;  1NH1 A;  2D0O A;  2JE6 I;  4QB4 A;  4JVZ A;  5TSS A;  3AEV A;  3HOW G;  1BCP C;  3SVM A;  2AKW B;  2ICI A;  3VDY A;  4C3H H;  2Z6K C;  5D65 A;  4DF7 A;  2NN6 G;  1AN8 A;  5A2Q L;  4A3B G;  3CCU A;  4R8I A;  1XTC D;  5K36 G;  2VNU D;  3U4V A;  3SHL A;  1W2B A;  3X3M A;  2L11 A;  5C6A A;  3VYS A;  1HA6 A;  3K5O A;  4DU9 A;  3F2C A;  2EYP A;  4WGJ A;  1FGB D;  2E8G A;  1SN8 A;  4A3D H;  4DV6 Q;  4N8X 1;  1GUS A;  1V1O A;  1Q1B A;  2KHS A;  1C0A A;  1G2S A;  3EIV A;  3KBX A;  2F0K A;  4M1U B;  1D2B A;  4BBS B;  4G7Z C;  1RHP A;  1G29 1;  1YJW A;  4F88 A;  3TME A;  1FGU A;  4C1N I;  2K05 A;  4LFA Q;  2SOB A;  3H0G G;  3RZD B;  1Q90 A;  4XDX A;  1OTC A;  1QIL A;  1STY A;  4JG2 A;  3HOU H;  5IP9 G;  1SE4 A;  3ZLM A;  4TQU S;  1OXV A;  1QUQ B;  3MXN A;  2UUA Q;  1TVX A;  1LAB A;  5CBE E;  4HN7 A;  3S1R H;  1SMY C;  5C4Z A;  2QIL A;  2HCC A;  3HOZ B;  1EY7 A;  1Q12 A;  2BH8 A;  5C3E H;  3UDG A;  2TMP A;  1GM5 A;  2JA8 B;  1N34 L;  4FVM A;  2YTX A;  1BQQ T;  3FPP A;  4YCW A;  2R6G A;  3CCR A;  3S17 H;  1UE1 A;  4JOI C;  1WTR A;  3TSS A;  2BA1 A;  1II3 A;  4RAU C;  3M9B A;  3PIP A;  3FPU B;  4R8N A;  1F2Z A;  1WD1 A;  1WCM H;  3MA2 B;  2C5C A;  4NB3 A;  5JVH 3;  4DFA A;  3K58 A;  2EYH A;  3G6E A;  3G4S A;  1JE4 A;  2CWA A;  2DUD A;  4WFN 3;  3VA7 A;  4BXX G;  1WVL A;  4JCV E;  3J80 c;  3CD6 A;  1PTO C;  4TVA B;  2JEB I;  1I4G A;  1MD2 D;  1Z6H A;  4A3C G;  4JI4 L;  4RMF A;  1MHW C;  5ELC A;  1HTL D;  5F2D A;  2FHT A;  4LK1 C;  5HGQ A;  1PH3 A;  3GDE A;  2XWJ B;  4DR6 Q;  1I94 Q;  4DAY A;  2KHJ A;  1D1K A;  2F3V A;  5EBC A;  3GTP B;  3NBH A;  3GTG H;  1DJR D;  3ZCB A;  3GTJ H;  2ZXO A;  3L0O A;  1FNV A;  5IYB G;  1B53 A;  4L5R C;  5C4X G;  2JSO A;  4LF4 L;  1QCB D;  3BYT B;  5J3B A;  2MNA A;  1TWH H;  1TKW B;  3K5L A;  4A3G G;  4NXN Q;  1G8Z D;  1PFB A;  4HID A;  1B2T A;  3L2P A;  1KDC A;  4DV0 L;  2I5H A;  1RCV D;  4A3I B;  3AQQ A;  1C4Q A;  5A35 A;  4GLA C;  4BBS G;  3ITP A;  3G6J B;  4MNO A;  2BH2 A;  4OO1 G;  3Q6S A;  5IE8 A;  5FLM H;  4A75 A;  2NUD A;  3U9S A;  2D9U A;  4R4C A;  3HZX A;  2KCC A;  1TWG B;  5EKL A;  2OF1 A;  3PUX A;  2F4V Q;  4PMW A;  4OEL B;  4HSP A;  1QVG A;  4J6H A;  4Z9C B;  4M16 A;  1I3Q H;  3C2P A;  2E74 C;  3RLN A;  1X32 A;  3A74 A;  1D5M C;  3ER0 A;  5JOB A;  4GN4 B; 
#chains in the Genus database with same CATH homology
 2JA5 H;  3JAM c;  4A3D G;  2K50 A;  2QEX A;  2CQO A;  4LFC L;  2KCT A;  5IYC H;  1Y1W H;  4X2E A;  1VQI A;  1J5E L;  3I55 A;  3HOZ G;  1E3P A;  3B6Y A;  4GLX A;  4JYA L;  3KDF B;  4AQY L;  4ME3 A;  3KFU A;  2E2H H;  1MKH A;  3I2Z A;  3GTM H;  4GKK Q;  1PH9 A;  5FJ8 H;  4LF8 L;  1OXU A;  2YU9 H;  4QL5 A;  2F6S A;  2KHI A;  4JI3 L;  1JMC A;  5IYC G;  1VCI A;  4GN5 A;  4DV7 Q;  1Y1W G;  1K73 C;  4GOP B;  1X9N A;  1KC8 C;  2JA9 A;  1JT8 A;  5IYD G;  3F2D A;  5IT9 c;  1N34 Q;  4QJF A;  2EXD A;  1P16 A;  2R92 H;  2HHH L;  1JE5 A;  2KCM A;  4ALP A;  1L0W A;  1XNR Q;  5M3M G;  4B3T Q;  1CKN A;  3M4P A;  3T1H Q;  4POG A;  3J7A 5;  3HOU G;  4YWM A;  1UWV A;  2UUC L;  3U4Z A;  4A76 A;  5HY6 A;  5LMN Q;  1IBM Q;  3S2D H;  2R92 G;  1CKM A;  2D62 A;  4OX9 L;  1EOV A;  1LM0 A;  3HKS A;  1VQA A;  3CAM A;  3UE0 A;  4JBJ A;  4OWX B;  1L1O A;  1YVC A;  4A3M H;  1VQ9 A;  5JFZ A;  2JA6 G;  3HOV H;  1YEZ A;  1VQK A;  4IPH A;  1PVO A;  2Q2U A;  1LTL A;  2IY5 B;  5GAG C;  3J7Z C;  2Z0S A;  1QVC A;  1JJG A;  2WP8 J;  4P72 A;  2ZJP A;  1YHQ A;  1TXY A;  5C3E G;  1N8R C;  4LW1 A;  1N33 Q;  3HOV G;  3EN2 A;  1BBW A;  3PUZ A;  1CKN B;  3AYH B;  2OCE A;  3UDX A;  3I4M H;  2NZO A;  4LF9 Q;  4L5S A;  3S2H H;  2ZJQ A;  3M85 A;  4JV5 L;  2K4K A;  4YY3 L;  3ULP A;  4QGU A;  4DV3 L;  3FKI G;  1L1O B;  2OWO A;  3RN2 A;  5EU0 A;  4DNI A;  4JI0 L;  4JI4 Q;  1S40 A;  3GTK H;  3U58 A;  2VQE L;  3PO2 H;  3ZJY C;  4JI6 Q;  3PO3 H;  3I4M G;  4UP9 A;  3TEH B;  1C9O A;  4J15 A;  3J81 i;  4HJ9 A;  1YJN A;  1R9T H;  5JJI A;  1KD1 C;  4IO9 A;  5AJ3 L;  1QZG A;  1WCM G;  3RLO A;  3CP0 A;  2HIV A;  2NVQ H;  3J81 c;  3CCL A;  4OON A;  2YTY A;  1M1K C;  4LF7 L;  3S15 H;  3SHG A;  4LUV A;  4B3R L;  3AFP A;  4X65 L;  4DV2 L;  1WI5 A;  2EIF A;  4OXP A;  4X64 L;  1EQQ A;  1XNQ L;  1BBU A;  4B3M Q;  1YI2 A;  4DUZ Q;  1Q81 C;  3RZO H;  4P75 A;  1KXL A;  4C3J H;  2ZTD A;  1AE2 A;  1Z9F A;  1IBK Q;  1HZB A;  1T9H A;  1IL2 A;  2OQ0 A;  4K0K Q;  4X6A H;  1SR3 A;  1AE3 A;  1X56 A;  4X62 L;  4IPG A;  4X2D A;  2MO0 A;  2AMC B;  1G51 A;  1KL9 A;  1XPR A;  4LF4 Q;  4IFD J;  3HKZ G;  4A93 H;  3J81 j;  2RF4 A;  1K8G A;  2UU9 Q;  4WJ4 A;  5JEA G;  3HOX H;  3CC7 A;  3GTO H;  3S16 H;  5JJL A;  1A0I A;  3HOY H;  2UUB L;  1CKO A;  1Y1V H;  4DUY Q;  4DR4 L;  2Q2I A;  2UXB L;  1L2F A;  4A3K G;  1PH7 A;  1EUJ A;  4A3I G;  1PH6 A;  2YV5 A;  1VQ6 A;  1VQB A;  5GRO A;  1FVI A;  4U04 A;  1SRU A;  2K5V A;  3GO5 A;  2PQA B;  3RR5 A;  2AWO A;  4DV0 Q;  1E1O A;  1ASZ A;  4A93 G;  2YTV A;  3LGJ A;  3ULJ A;  3KLW A;  1DGS A;  2ZJR A;  4YHH Q;  5LMU Q;  1VQ5 A;  4Y7N H;  2NZH A;  3CPF A;  1SE8 A;  1JJC B;  3H3V H;  4BBR H;  1HNW L;  3KYH C;  2ASB A;  1I50 H;  1IBL Q;  3D31 A;  2AWN A;  4B3S L;  2ZM6 Q;  2ATW A;  4JI5 L;  1N36 L;  4LFB L;  1NTG A;  1VQF A;  5IP7 H;  1YBY A;  2I0Q A;  2K52 A;  1JB7 A;  4DR3 Q;  3TRE A;  2ES2 A;  4DV4 L;  5IY0 A;  4HJA A;  1O7I A;  5C0X J;  3KF6 A;  1Q82 C;  2JQO A;  1N32 Q;  1KRT A;  4DR2 Q;  4P71 A;  3HOW H;  2E2J H;  4P74 A;  4POF A;  3CCV A;  2NVT H;  2MFI A;  5C4J H;  1X3G A;  4LFC Q;  5C44 G;  1J5E Q;  1OXT A;  4MZ9 A;  3PF4 A;  2ZTC A;  4DR1 L;  4JYA Q;  3STB C;  4A3B H;  3S1Q H;  4AQY Q;  2RHQ B;  4JI7 L;  1PYB A;  2PI2 E;  1UEB A;  5FLM G;  3CCM A;  1PYS B;  4PG3 A;  1BVS A;  4LF8 Q;  2PI2 A;  4X2C A;  1VQ7 A;  2R7Z G;  4JI3 Q;  1PA6 A;  2UXD L;  3BZC A;  2N49 A;  4C2M H;  5ELN A;  3E0E A;  1V1Q A;  1NJI C;  2CKZ B;  4GLV B;  1YIJ A;  1IZ6 A;  5M5Y H;  2HHH Q;  3A5U A;  1GKH A;  4DK3 C;  4LF6 L;  1Q86 C;  3JC6 6;  1Z47 A;  4IPD A;  1WFQ A;  4O0A A;  4UP7 A;  3UDI A;  3KOJ A;  4A4I A;  1SFO H;  2RCN A;  3IRB A;  2LXK A;  4A3J G;  2UUC Q;  2GVA A;  1SMX A;  3NEL A;  4KLK A;  1YHA A;  4JI1 L;  2IX1 A;  2JA5 G;  1W3S A;  4OX9 Q;  2B3G A;  4DK6 C;  4JBM A;  1MJE A;  4A3E H;  4NXM L;  2JJQ A;  2C35 B;  1EFW A;  3PUY A;  4AYB G;  3CCS A;  2K5H A;  3F8T A;  4AYB E;  1K9M C;  1HZ9 A;  5FJ8 G;  1S72 A;  3H0G H;  2V1C C;  4JI8 L;  3GTL H;  5GAD C;  4DV1 L;  3A0J A;  3S1N H;  4X66 L;  2VS1 A;  1GD7 A;  4A3E G;  1X65 A;  1Y14 B;  5ELO A;  3GTQ H;  3BZK A;  1XMQ L;  5IP9 H;  2GVB A;  4O2D A;  4DAM A;  3NEM A;  3PSI A;  3W1B A;  3BU2 A;  3T1Y Q;  3RLF A;  1U0L A;  2IHE A;  4DV6 L;  1FL0 A;  1WOC A;  4JV5 Q;  1VQJ A;  2ID0 A;  4PZ8 A;  1HZA A;  4YY3 Q;  4DV3 Q;  1HNZ L;  1MIU A;  3L7Z C;  2OQK A;  4BA2 I;  2HQL A;  4JI0 Q;  1HJP A;  4BA1 I;  3I56 A;  3CQZ H;  2WAQ G;  3K0X A;  2VQE Q;  5IWA L;  2Y0S G;  2WAQ E;  4APV A;  2Y0S E;  4A3M G;  2A19 A;  2K14 A;  3A5Z B;  3PCO B;  4BY1 H;  1JJ2 A;  4R4T A;  5AJ3 Q;  2NVX H;  5CGL A;  2HT1 A;  4IFD I;  3N3U A;  4JBW A;  3G71 A;  1VQE A;  4IJH A;  4LFA L;  2KEN A;  1VQM A;  4WJ3 M;  4JC0 A;  1EIY B;  3I4O A;  2UXC L;  1TWC H;  5BR8 Q;  4B3R Q;  1PHJ A;  4X65 Q;  4DV2 Q;  4X64 Q;  5LMN W;  1A62 A;  3S6A A;  4GNX C;  1XNQ Q;  2VUM H;  4EX5 A;  2DGY A;  4RG1 A;  1C7Y A;  1P8L A;  4KI0 A;  1E24 A;  2XGT A;  1K0R A;  1PH8 A;  1GO3 E;  1TWA H;  2UUA L;  4X62 Q;  4GKJ L;  3K7A H;  4C3I H;  4B3T L;  1PH1 A;  4N67 A;  4R4I A;  4UPA A;  1MJC A;  2UUB Q;  4ITR A;  1UE7 A;  5LMN L;  4OWW B;  1QVF A;  2JA7 H;  4PY3 A;  3PO3 G;  3PO2 G;  4DR4 Q;  4IFD G;  4LU4 A;  2PQA A;  2R93 H;  3CCJ A;  3S24 A;  3CUC A;  4IJL A;  1FJG L;  4BXX H;  1VQC A;  1K3R A;  2VL6 A;  3MEF A;  4BY7 H;  2OTJ A;  2VQF L;  1EYG A;  2N78 A;  1TWF H;  3G48 A;  3CW2 C;  1VQD A;  3SGI A;  5C0X I;  5M5W H;  4A3C H;  3GD7 A;  3U50 C;  3Q8D A;  1KIX A;  5GQO A;  4A3F H;  4U0Z A;  4JI2 Q;  1HR0 W;  3UDF A;  3NEN A;  1HNX L;  1HNW Q;  2K75 A;  3HFZ B;  1B7Y B;  1I5F A;  1NMG A;  2RHS B;  3TS0 A;  4BY7 G;  4AIM A;  2CWP A;  4B3S Q;  3K8A A;  1N36 Q;  4DR5 L;  4JI5 Q;  4LFB Q;  3PGZ A;  4H02 A;  4PZ6 A;  5E7N A;  2A8V A;  3HOX G;  3H3V I;  1A63 A;  3SN9 A;  4A3F G;  3HOY G;  5CMT A;  1Y1V G;  4DV4 Q;  3D0F A;  2R7D A;  3M4Q A;  3UE1 A;  3OTO L;  1K83 H;  3K7U C;  4HJ8 A;  4A3L H;  1Q1E A;  4L5T A;  4MTN A;  1NMF A;  3F1Z A;  1HR0 L;  3CC4 A;  5M3F H;  1WJJ A;  5C0X G;  3I4N H;  2BA0 A;  3WWV A;  1RIP A;  2R7F A;  5IYB H;  1NY4 A;  4HJ5 A;  2I5L X;  1HH2 P;  2KBN A;  3ERS X;  5C4X H;  1ASY A;  4DR7 L;  3LET A;  4DR1 Q;  3PUW A;  1VS0 A;  3H15 A;  4OWT B;  3F2B A;  4R1J A;  3KJP A;  3SE5 A;  5CKL A;  1EQR A;  2MO1 A;  3OW2 A;  4A3G H;  4JBK A;  1XMO L;  2VZA A;  4BBR G;  1CUK A;  2NN6 I;  1WYD A;  1X6O A;  1PV4 A;  4U07 A;  1M90 C;  2UXD Q;  2ALY B;  4QQB X;  4DR6 L;  4OO1 I;  1I94 L;  3CMA A;  3CPW A;  5GAE C;  5IP7 G;  4YCU A;  1D8L A;  1EWI A;  4HIO A;  1YNX A;  1HZC A;  4U0S A;  4LUO A;  3STB D;  3CME A;  4LF6 Q;  4BBS H;  2F52 A;  2AHO B;  2D0O A;  2JE6 I;  3AEV A;  1KQS A;  1YJ9 A;  1J6Q A;  2B29 A;  3OYY A;  3HOW G;  1A8V A;  2AKW B;  3VDY A;  3NBH B;  4C3H H;  2Q2T A;  1IYJ B;  2Z6K C;  4LF5 L;  4JI1 Q;  1KHI A;  1YZ6 A;  2D0P A;  2NN6 G;  1KAW A;  4NXM Q;  4KHP L;  3RZD H;  4EQ5 A;  4A3B G;  3CCU A;  4UP8 A;  5K36 G;  2VNU D;  1Q8K A;  3U4V A;  1W2B A;  4NXN L;  3PV0 A;  4JI8 Q;  3ULL A;  1G6P A;  1N9W A;  2PNH A;  2PMZ E;  4DV1 Q;  2E5L L;  4X66 Q;  1AH9 A;  1NE3 A;  3F2C A;  1KRS A;  4GNX A;  1XMQ Q;  4WGJ A;  2E8G A;  2LXJ A;  1SN8 A;  4A3D H;  2N8N A;  4DV6 Q;  1PFS A;  1Q1B A;  4DPG A;  1SLJ A;  1YHB A;  1HNZ Q;  3HOZ H;  1C0A A;  2H5X A;  4DV5 L;  4Y52 H;  2HIX A;  1E1T A;  2GN5 A;  3EIV A;  2A1A A;  4QIW E;  2JA8 H;  2MQH A;  1VQO A;  1LYL A;  1OXS C;  1QUQ A;  2WB1 G;  1G29 1;  5IWA Q;  4UY8 C;  1V43 A;  1YJW A;  2WB1 E;  4U0U A;  2F4V L;  2G03 A;  5DLQ E;  4P73 A;  5IYD H;  4IOA A;  1VQG A;  1BKB A;  1FGU A;  4GNX B;  2JA8 G;  4LFA Q;  2I5M X;  3K80 C;  3H0G G;  2UXC Q;  5M3M H;  3E9H A;  1OTC A;  4JG2 A;  4GS3 A;  3HOU H;  1SRO A;  4IOC A;  5IP9 G;  3ZLM A;  3T1H L;  4TQU S;  4LUZ A;  1OXV A;  1QUQ B;  2Q2H A;  2JA6 H;  2UUA Q;  4GKJ Q;  2JEA I;  1H95 A;  1QZH A;  1YIT A;  1UE6 A;  3DLL A;  3S1R H;  3S1M H;  3EBE A;  4GKK L;  4YCV A;  1B8A A;  4LF7 Q;  1OXX K;  1Q12 A;  5H1S E;  1NBW A;  2BH8 A;  5C3E H;  4YWK A;  4DV7 L;  2N3S A;  4BY1 G;  3UDG A;  1GM5 A;  4QY7 A;  1FJG Q;  1N34 L;  2JK8 A;  4XI8 A;  1V9P A;  4KHZ A;  2YTX A;  4YCW A;  2FXQ A;  2VQF Q;  1IXR A;  2R6G A;  3CCQ A;  4IPC A;  3CCR A;  3M4O H;  4GOP C;  1XNR L;  1EIF A;  1UE1 A;  3FKI H;  3MXN B;  4JOI C;  4XIG S;  3S17 H;  2QGQ A;  2VUM G;  2CCZ A;  4XTC S;  2BA1 A;  1IBM L;  2UXB Q;  1XPU A;  3CXC A;  1HNX Q;  3M9B A;  3K81 C;  3T1Y L;  3TRZ A;  3PIP A;  2VY3 A;  3M7N A;  1RL2 A;  1WCM H;  3PUV A;  3GTP H;  4DR5 Q;  4NB3 A;  4R4Q A;  3I7F A;  1X55 A;  2IT1 A;  2JA7 G;  1GVP A;  3BJU A;  3G6E A;  3OTO Q;  3G4S A;  2CWA A;  3J80 i;  1N33 L;  1VQP A;  4HIM A;  1HR0 Q;  1VQN A;  2R93 G;  2OTL A;  3PF5 A;  2DUD A;  1E22 A;  5JJ6 A;  3TS2 A;  4BXX G;  5GAH C;  4JCV E;  2LSS A;  3J80 c;  4LF9 L;  1PH5 A;  3CD6 A;  2Z6K A;  2XTI A;  4R4O A;  4TVA B;  4DR7 Q;  4YWL A;  1VQ8 A;  1X3E A;  1I6H H;  5BR8 L;  4DKA C;  2JEB I;  1D7Q A;  4A3C G;  2EQS A;  3AFQ A;  4JI4 L;  4RMF A;  4HJ7 A;  2QA4 A;  1XMO Q;  4JI6 L;  5HGQ A;  4A3K H;  1PH3 A;  1L1O C;  1S3O A;  4A3I H;  5M5X H;  1Q46 A;  3GDE A;  1U5K A;  1Q7Y C;  4DR6 Q;  1I94 Q;  2YYZ A;  2CFM A;  2IHF A;  3TQY A;  3HKZ E;  3CC2 A;  2KHJ A;  3FHW A;  3RN5 A;  1E7Z A;  2B63 H;  4A3L G;  1TWG H;  3GTG H;  4JI7 Q;  4B3M L;  1XTD A;  5M3F G;  4DUZ L;  3I4N G;  3ZCB A;  1X54 A;  4FDB A;  3GTJ H;  3L0O A;  5IYB G;  4LF5 Q;  1IBK L;  2WFW A;  1K8A C;  4L5R C;  4K0K L;  5C4X G;  5JEA J;  1XJV A;  3W1G A;  4LWC A;  1PH4 A;  4LF4 L;  2B63 G;  4KHP Q;  5JFF A;  3CCE A;  3KF8 B;  5J3B A;  2UU9 L;  2MNA A;  1TWH H;  5FLX c;  1VQ4 A;  1PH2 A;  4A3G G;  4JI2 L;  1X3F A;  4DUY L;  4NXN Q;  1XPO A;  4DAY B;  4HID A;  3E9I A;  4L5Q A;  2E5L Q;  3L2P A;  2VW9 A;  4DV0 L;  2I5H A;  2K5N A;  2IX0 A;  2ZTE A;  1CSP A;  1B70 B;  3AQQ A;  4GLA C;  4BBS G;  5C44 H;  5LMU L;  4MNO A;  4YHH L;  2BH2 A;  2F3I A;  4DV5 Q;  3DM3 A;  2E2I H;  4OO1 G;  2NVY H;  1CSQ A;  1LUZ A;  5IE8 A;  5EAY A;  5FLM H;  1UE5 A;  4A75 A;  3ICE A;  4GN3 B;  4R4C A;  5JJK A;  2R7Z H;  1IBL L;  3PIO A;  3KDF A;  1VQH A;  3PUX A;  2ZM6 L;  3CF5 A;  4LNQ A;  2F4V Q;  2L15 A;  4PMW A;  3KJO A;  4PZ7 A;  3ZC7 A;  1QVG A;  5JJ7 A;  4DR3 L;  1VQL A;  4M16 A;  1I3Q H;  4HIK A;  3RNU A;  1N32 L;  3RLN A;  4GOP A;  4DR2 L;  3JAM i;  3FP9 A;  4JOI A;  3S14 H;  3KF6 B;  3M3Y H;  4NPS A;  3A74 A;  4AH6 A;  4A3J H;  3ER0 A;  3W5O A;  4GN4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...