2JK8A

Type iv secretion system effector protein bepa complexed with a pyrophosphate moiety
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
291
structure length
291
Chain Sequence
b'EIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCSHDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMPEMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHPFREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDISNPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYIIGNIDHLPPEQLKILKPGDKITFTAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE CELL FILAMENTATION PROTEIN (BEPA PROTEIN)
publication title Fic Domain Catalyzed Adenylylation: Insight Provided by the Structural Analysis of the Type Iv Secretion System Effector Bepa.
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Cell adhesion
total genus 90
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 2jk8A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2jk8A02
4EX5A 2ZTDA 1L1OA 4JBMA 2R92H 4MTNA 4PMWA 5C0XJ 1Z47A 3M9BA 1L1OC 1GO3E 3EBEA 3H15A 2K5NA 1K3RA 3CPWA 3SN9A 3KDFB 4JI7L 4JI8Q 4A3KH 1VQ4A 1CKNB 5M5YH 1R9TH 5BR8Q 5JJLA 2IHEA 2KHIA 3GTJH 2PNHA 1QUQA 2WFWA 1IBMQ 3BZKA 1QVCA 3DLLA 4A3LG 4WJ3M 3U50C 2YU9H 4ME3A 5FJ8G 1N8RC 2JA6H 5JJIA 4B3RQ 3LETA 2WAQE 1PA6A 3TREA 1EUJA 2VZAA 2IX0A 2AWNA 2PQAA 3PGZA 4BBRG 3CCQA 4HJ5A 1A63A 2Z6KA 1HNWQ 4BBRH 5GAEC 2I5MX 2KCMA 2BA0A 2Z6KC 4A3DG 2K14A 1KHIA 4DUZQ 3M4OH 1PH1A 4YCWA 4YHHL 3RNUA 2WB1G 1PH3A 1VQGA 3ZCBA 5GADC 1EQQA 4YY3Q 1NTGA 2KHJA 3HOUG 1WFQA 5CGLA 1Z9FA 3RLNA 3JAMi 1IBLQ 4IO9A 1U0LA 5EU0A 3GO5A 4B3SQ 2EXDA 4BY7G 3KF6A 2I5HA 4JV5Q 4DV0Q 5IYCH 2N78A 4DR4Q 4IFDI 4AQYQ 1EIFA 1HNWL 1V9PA 3PF4A 2IY5B 3L0OA 4Y52H 4PZ7A 4RG1A 3TRZA 3F8TA 2C35B 4BXXH 4LFAQ 2AMCB 1HZBA 1Q46A 3HKZE 1N36L 3G71A 1L1OB 1Q7YC 1HNZQ 4JI6Q 1C9OA 3FKIG 1FJGQ 1RL2A 3ZC7A 3ULLA 2VY3A 3FKIH 3I4MG 1TWHH 2ZTEA 3RZDH 3HOVG 1GD7A 4FDBA 5GAHC 1IBLL 3HOVH 5C44H 4X66Q 4DPGA 3HOYG 1MJCA 3UE0A 4GNXA 3S2HH 1K83H 1WCMH 3M4PA 3W1BA 2A8VA 3HOYH 1XNQL 1BBUA 1YHBA 3HOZG 1YBYA 4DV0L 3PUYA 4GNXC 2NVXH 1N33L 2JA8H 3HOZH 3SGIA 3CMAA 5ELNA 4DR4L 4NXNL 4AH6A 3CCSA 2UXBL 3OYYA 1VCIA 3PUVA 3I56A 1HZAA 4DK3C 2FXQA 3EN2A 4BY1H 2JEAI 1OXXK 3LGJA 2NN6I 1VQ9A 1SN8A 1M1KC 1MKHA 1SLJA 1XNRQ 4AIMA 3TS0A 2R93G 3S6AA 4U07A 1HNZL 4JI6L 4DNIA 2F4VQ 2UUCQ 4GKJQ 4MZ9A 3A0JA 4OO1I 4JG2A 3PUZA 3U4ZA 3CCEA 1N34Q 1KD1C 2LXKA 4HIMA 1P16A 2D0OA 2F6SA 3DM3A 2QA4A 4X66L 2QEXA 2WB1E 1WYDA 2JE6I 4L5RC 2OQ0A 3AYHB 4OWXB 3J7A5 3UDXA 4DR6L 2JJQA 1YNXA 2CWPA 3FP9A 4DV3Q 4LU4A 3D0FA 3M85A 3CMEA 3KOJA 5GAGC 3CC2A 4PZ6A 3PIOA 4POFA 3KF6B 1YJWA 1X56A 4POGA 2CQOA 3NEMA 3SHGA 2Q2IA 5HGQA 4NB3A 1FVIA 2KBNA 3D31A 2HIXA 4LF6Q 1X54A 3PO3H 4C3JH 2UUCL 3CQZH 4QQBX 1QVFA 1N34L 2UXDQ 4H02A 1NY4A 2D0PA 4IJLA 4LUVA 1VQMA 1PH6A 4NXML 3L2PA 1NBWA 2E8GA 1VQ7A 1X3GA 3E9IA 1JT8A 1HNXQ 2ALYB 1SROA 4DR7Q 4DR5Q 1A8VA 4JOIA 4OWTB 3UDFA 3S2DH 5K36G 1LYLA 4P73A 1C0AA 4DR1Q 4BBSH 3RN5A 1PH7A 3AEVA 1B8AA 2YV5A 3T1YL 4GNXB 5IYBH 2E2HH 4GLAC 3OW2A 1OXVA 4LNQA 1XJVA 4LFBL 4LF7Q 1K0RA 4K0KL 4DAMA 4JI0L 4U0SA 4HJ9A 4LF6L 2JA9A 4GOPB 2MO0A 1Q1BA 5AJ3Q 1GVPA 3AQQA 2R7ZG 2DUDA 3K0XA 3S1NH 2UXDL 5EAYA 3GTPH 3J7ZC 1Q82C 3U4VA 5ELOA 3BZCA 4JI4Q 2ZJPA 2ASBA 2R7ZH 4R4TA 2L15A 4DV5L 1E1TA 1IBKQ 5M3MH 1HNXL 1PH4A 2PI2A 4DR7L 5C4XG 4Y7NH 1WI5A 1I94Q 3M3YH 1N9WA 5IWAQ 2E2IH 4DR1L 3RLFA 1E3PA 1HJPA 4R1JA 2KCTA 3PCOB 5GQOA 1PH5A 1CKOA 2XTIA 4LW1A 2K5VA 4X65Q 1A0IA 4BA2I 4UP9A 4LF7L 2R6GA 3RZOH 4X2CA 1EIYB 1DGSA 2RHQB 4IPGA 4DKAC 1SFOH 1X55A 3VDYA 2UUBQ 5IP9G 4A3LH 1C7YA 4JBJA 1YITA 1KRTA 1JJCB 1P8LA 4OWWB 5FJ8H 4DV6Q 1PH2A 3GTLH 3PO2G 2UXCQ 1T9HA 5IYDG 4LF8Q 3K8AA 3PO2H 5IYDH 3K80C 3L7ZC 2VNUD 2YTYA 5E7NA 2H5XA 1YI2A 1NJIC 1E22A 4XIGS 4YWMA 4QGUA 3G48A 4A3DH 1VQJA 2N3SA 4XI8A 4JI8L 1EFWA 4JI5Q 1EOVA 4A3CG 1VQCA 5BR8L 5FLXc 1VQNA 1D7QA 2VW9A 1G6PA 4A4IA 4X65L 4A3CH 4GS3A 1IBML 5IE8A 2JK8A 3CP0A 4IJHA 3I55A 4LF5Q 4PY3A 4P75A 3H0GG 3HOUH 1K9MC 1YHAA 2UUBL 4KHPQ 4KI0A 3CCLA 3S14H 3NELA 4B3RL 1I50H 4DV6L 1B70B 4BY7H 2UXCL 1HZ9A 1UE1A 3ULPA 2I0QA 3JC66 4WGJA 1TWAH 1VQBA 1HR0W 2Y0SE 1UE7A 1Q1EA 1CSQA 5GROA 4C3HH 4DUZL 3GTGH 2N8NA 2F52A 2HHHQ 4JI3Q 4N67A 1OXUA 3PSIA 4L5TA 5HY6A 4O0AA 1WJJA 3ICEA 1G51A 4GN4B 4BA1I 4LFCQ 4YY3L 2Z0SA 4DUYQ 1YVCA 3UDGA 3T1HQ 1KQSA 4LF5L 3I4MH 3I4OA 1XMOQ 1XPUA 5IP7G 4X64Q 3W1GA 4B3SL 2YTVA 4HIDA 1UEBA 5IP7H 1QUQB 3ZLMA 2R7DA 5IT9c 3CCRA 2B63G 4DV1Q 1IL2A 2B63H 1VQ5A 2JA7G 1GKHA 4JI1Q 1JE5A 5C0XI 2A19A 4AQYL 3KJOA 1JMCA 1D8LA 4YCUA 2ZJQA 3EIVA 2JA7H 4OX9Q 1N32Q 2PQAB 3BJUA 1LUZA 3MXNB 1PHJA 1PFSA 2LXJA 4LFAL 4UY8C 1MJEA 2NVTH 1VQ6A 1VS0A 3S17H 3KYHC 4LF4Q 4GKKQ 4JYAQ 4KLKA 1VQIA 3STBD 2UU9Q 1FJGL 2R93H 3J80i 4DR2Q 1Y1WG 1VQFA 4LFCL 1JJGA 3CC4A 2ZTCA 1Y1WH 1VQ8A 3F2DA 1XMOL 4AYBG 3FHWA 4X64L 5IY0A 4YWLA 3TEHB 2JEBI 5C3EG 2NZOA 3CCJA 4M16A 1JB7A 3TQYA 5M5WH 5C3EH 4DV1L 3CCUA 1HR0Q 1I5FA 1ASZA 1XMQQ 1CKMA 4JI1L 5DLQE 3OTOQ 3J81c 4DAYB 2GN5A 4OX9L 3K7AH 3S16H 1XNRL 3KF8B 3PIPA 4DR3Q 3K7UC 2F4VL 1J5EQ 2UU9L 2NVYH 1A62A 4R4CA 4DV4Q 4A76A 4DR2L 1XPRA 4GKJL 1IZ6A 4X62Q 3G6EA 2UUAQ 2K5HA 4B3TQ 4RMFA 2HT1A 2HQLA 4KHZA 2MFIA 3S1MH 1PH8A 1E1OA 3A74A 3W5OA 1VQLA 1IYJB 4X6AH 4A3EG 1VQDA 3CPFA 2GVAA 2WAQG 4JOIC 1YHQA 4A3FG 4DV3L 1HR0L 3J81j 2Q2TA 2VUMG 4ITRA 1W2BA 3CCMA 2PMZE 4LUOA 3OTOL 3ER0A 1BKBA 3RN2A 4QIWE 5LMNQ 3KLWA 3PUWA 3A5UA 4DV7Q 4B3MQ 1H95A 4DR3L 1PYBA 1EQRA 2R7FA 4PG3A 3F2CA 1J5EL 1NMGA 1G291 4QY7A 5M3FG 4DV4L 2BA1A 5JJ6A 4A3JG 1YJNA 2JA5G 1KXLA 4X62L 5M5XH 5M3FH 4A3JH 2AHOB 2JA5H 2EQSA 3AFQA 3PUXA 5FLMG 3PF5A 4C2MH 4DR5L 2QGQA 2BH2A 1X6OA 4QJFA 3I2ZA 3GTQH 5C4XH 4HJ8A 2K75A 4JI7Q 1UE6A 3M7NA 3CCVA 1SR3A 2XGTA 4A3MG 1XTDA 1AE3A 1K8AC 2OTLA 3E0EA 5LMUQ 4B3ML 4OO1G 1TWCH 2CFMA 4YCVA 4R4OA 1HH2P 1X9NA 4X2DA 1AE2A 1Q86C 1BBWA 1VQKA 4DR6Q 2K50A 5AJ3L 3STBC 3HKZG 4R4IA 5IP9H 5H1SE 1OXTA 4HJAA 2K4KA 2R92G 3I7FA 4JI4L 1X3FA 3HOXG 1Y1VG 1IBKL 3N3UA 3BU2A 3JAMc 5C4JH 4U04A 1Y1VH 3CAMA 3HOXH 1I94L 4A3KG 1PYSB 5IWAL 4YHHQ 3CC7A 3B6YA 3U58A 4LF9Q 1O7IA 4TVAB 1YEZA 4L5QA 2OQKA 5CKLA 3S1QH 5LMUL 2BH8A 1KAWA 4DK6C 2ES2A 2JA6G 2EIFA 4OONA 5JFZA 1KIXA 1RIPA 1YIJA 3S1RH 1OTCA 4A3GG 1M90C 2VS1A 4ALPA 1QZGA 3H0GH 2ZM6Q 2E5LQ 3H3VH 4XTCS 1VQAA 4A3GH 1Q12A 3A5ZB 4LF8L 3E9HA 3S15H 1LTLA 4A3BG 2VQFQ 2D62A 2PI2E 2HIVA 3UE1A 1SRUA 4A3BH 3MEFA 2JQOA 2ZJRA 1JJ2A 1N36Q 4LF9L 1V43A 4UPAA 1YJ9A 4JI5L 4GN5A 4JCVE 2KENA 2YTXA 3M4QA 2MNAA 4P74A 3KFUA 1B7YB 4QL5A 1TWGH 4TQUS 4GLXA 1PV4A 4JBKA 2AWOA 4KHPL 5JJKA 1AH9A 3PV0A 5IYCG 2ZM6L 2E5LL 1XNQQ 4O2DA 2IX1A 3J80c 1N33Q 3CW2C 4JBWA 2E2JH 4U0ZA 4JV5L 4X2EA 4NXNQ 4EQ5A 1V1QA 2UXBQ 1PH9A 4BXXG 3G4SA 1UWVA 1KL9A 2VQFL 4MNOA 1UE5A 2N49A 3CXCA 3UDIA 2VQEQ 4DV2Q 1K8GA 2IHFA 2RCNA 2MQHA 5LMNW 4HIOA 1E7ZA 2WP8J 4JI3L 2HHHL 4LWCA 1I3QH 2GVBA 3RLOA 3NENA 4A93G 1PVOA 1KC8C 3CUCA 4OXPA 4A93H 3GDEA 5C44G 2IT1A 4DUYL 3T1HL 1BVSA 1WCMG 4YWKA 1Q81C 4HJ7A 1HZCA 1W3SA 2JA8G 2OTJA 1SMXA 1YZ6A 3WWVA 3ULJA 2ATWA 3ERSX 2RHSB 4BY1G 4C3IH 1NMFA 3AFPA 2RF4A 1TXYA 5JEAG 4GOPA 1I6HH 3TS2A 4IOAA 1IXRA 3CF5A 1MIUA 3F2BA 2AKWB 3RR5A 2VQEL 4GOPC 4DV2L 2CCZA 1N32L 1EYGA 2DGYA 2CKZB 4NPSA 1VQPA 1K73C 4GKKL 4LF4L 4P71A 2NVQH 4JYAL 2LSSA 2F3IA 4NXMQ 2Q2UA 2VL6A 2OWOA 1ASYA 3KDFA 3HKSA 1XPOA 3CD6A 4JI2Q 3GTOH 1CKNA 3HOWG 4IFDG 1VQHA 3Q8DA 4J15A 4HIKA 3HOWH 5JEAJ 4PZ8A 1E24A 1Q8KA 1U5KA 3T1YQ 1SE8A 1GM5A 4A3EH 1XMQL 4GLVB 1OXSC 1X3EA 4JC0A 2MO1A 1J6QA 4A3FH 1VQOA 2VUMH 3GTMH 4LFBQ 4K0KQ 1FL0A 4JI0Q 3PO3G 4IPCA 4LUZA 2OCEA 1LM0A 1X65A 1WOCA 3S24A 5JJ7A 3K81C 4P72A 1S40A 2I5LX 3NBHB 3H3VI 4B3TL 2UUAL 4A75A 4DV5Q 3SE5A 1L0WA 2V1CC 3J81i 2Q2HA 2G03A 1FGUA 2YYZA 4APVA 3F1ZA 4A3IG 4JI2L 4UP8A 4BBSG 1EWIA 3IRBA 4IFDJ 2A1AA 5C0XG 3HFZB 1NE3A 4UP7A 1S3OA 1Y14B 5FLMH 4A3IH 3I4NG 4IOCA 5IYBG 2NN6G 4R4QA 3I4NH 1TWFH 5JFFA 1CUKA 4IPHA 1QZHA 5J3BA 1KRSA 2K52A 3ZJYC 3GTKH 5LMNL 4AYBE 1VQEA 4A3MH 1L2FA 4DV7L 1CSPA 2ID0A 2Y0SG 4IPDA 3KJPA 2B29A 4WJ4A 3GD7A 2B3GA 1S72A 2CWAA 2NZHA 1QVGA 4L5SA 4GN3B 4U0UA 5CMTA 5M3MG
chains in the Genus database with same CATH superfamily
5C3EB 1F2YA 1LTTD 1YNJD 4JBMA 4MTNA 4PMWA 5LL6S 3C46A 2K5NA 1K3RA 3SN9A 3KDFB 4JI7L 1C4QA 4JI8Q 4TKOB 1VQ4A 5BR8Q 2IL8A 2NVQB 2KHIA 3GTJH 1IBMQ 1B53A 1QVCA 5JJIA 3GTOB 1F77A 2WAQE 2AQ1B 1PA6A 3CCQA 3PGZA 2AWNA 1EEID 1A63A 1F9SA 4FXDA 2BOSA 4A3EB 1V1PA 2BA0A 3OOCA 4DUZQ 3RNUA 3MEHA 4C1NI 4DAVA 3HOUG 2SDFA 2RCFA 1U0LA 2F0MA 2F0DA 2L5TA 4DV0Q 5IYCH 3CHBD 4C3HG 3NUCA 1TWFB 1STBA 3PF4A 1HRJA 2I07B 3URYA 3F8TA 3VYUA 3GTKB 3HZXA 4A3MB 1N36L 1Q46A 3G71A 4JI6Q 3FKIG 1FJGQ 5FO9B 3TZDA 2VY3A 3FKIH 4HCEA 1TWHH 1JB3A 5C44H 4DPGA 3HOYG 5KRUA 3S2HH 4HN7A 1WCMH 3HOYH 1BBUA 1YHBA 5I9OA 4DV0L 4GNXC 4YIJA 3SGIA 3FMCA 3CMAA 4A3KB 2UXBL 3SK6A 1R9TB 1D5ZC 3PUVA 4BY1H 4DK3C 2FXQA 3EN2A 1OXXK 4QB4A 1SN8A 2Z9HA 3ND9A 1V8QA 3S6AA 3QWNA 1I4HA 4JI6L 1EQTA 2YU9B 2F4VQ 3F2UA 1EY0A 1WVLA 3A8KE 2JA6B 3CCEA 3U4ZA 1ESRA 2QF7A 2HDLA 3P20A 3M7GA 2EYPA 4L5RC 4OWXB 3M4YA 1B9MA 3UDXA 1G2SA 3DEOA 3FP9A 4DV3Q 4XYQA 3CMEA 1HHVA 3PIOA 4POFA 3KF6B 1EQVA 2CQOA 2ZXRA 5HGQA 1LT3D 2DY8A 2KJXA 2KUMA 3BVZA 1FR3A 1W6KA 4IJLA 1VQMA 3L2PA 1NBWA 2E8GA 4QF4A 1VQ7A 1X3GA 5CBAE 4WRDA 4DR7Q 5K36G 4OWTB 3Q0AA 4KKUA 2K1BA 2YV5A 3R2TA 2HCIA 2RQXA 1SE4A 1XJVA 4LF7Q 1K0RA 1SDFA 2JA9A 4GOPB 3AQQA 1ESFA 4PQXA 2IPKD 1H9SA 4DV5L 3HOZB 2XRQD 4F87A 4DR7L 3M3YH 2E2IH 2OEOA 3RLFA 5I9PA 1E3PA 1HJPA 3PCOB 1F2MA 1BCPB 4PV1C 2XWBB 4LW1A 1KDBA 1A0IA 4G7HC 5ELFA 4LF7L 2R6GA 2MHVA 4X2CA 5IP9G 2EYJA 1C7YA 4OWWB 3NWTA 4RCNA 5JAVA 1T9HA 5IYDG 1GUNA 4IQZA 3AMUA 5IYDH 3K80C 3MTSA 5E7NA 1NJIC 2DNEA 3MXGA 1TU2B 3FDTA 1VQJA 4HCSA 4FVMA 1AW7A 1TS4A 4A3CG 2A6HC 1VQCA 1VQNA 5FLXc 3PO3B 2BE5C 4X3UA 2VW9A 4A3CH 4LF5Q 4PY3A 1NR2A 1K9MC 3NELA 4B3RL 1DZ1A 1LLRD 1H9RA 4BBSB 1UE1A 5FOBB 3KF8A 1JQYD 4XQNA 3JC66 2QEJC 4WGJA 2E2HB 1T5EA 1D5XC 1F9PA 1NH1A 3GTGH 4JI3Q 1R4QB 2LMCB 4N67A 4F88A 4DFAA 1NR4A 4YY3L 4NDXA 3GTPB 1KQSA 1JORA 4LF5L 3SK5A 1XMOQ 2F0IA 4B3SL 3OIPA 4V0BA 1QWYA 2B63G 3CCRA 3NQIA 5L37A 1IL2A 5A2QE 2B63H 4FF3A 4JI1Q 1JE5A 2TSSA 5CV8A 1D8LA 3G7LA 5I2XA 3GTJB 1FYCA 1LUZA 5CBEE 5IGBA 2R3ZA 1VQ6A 3KYHC 1SFOB 2K7VA 1VQIA 4KLKA 1STGA 4H13C 4K14A 2F0QA 4CKCA 1XMOL 1IW7D 3WDNA 3FHWA 5IY0A 3TEHB 5BN3A 4OEMB 3IFDA 4M16A 2FMMA 2K03A 3TQYA 2K5QA 3CCUA 1HR0Q 1SYGA 2A6HD 4JI1L 5I2YA 1FD7D 2BE5D 1G91A 3D6CA 1LV9A 3T13A 2J7ZA 1D1KA 3HOUB 2NVYH 4DV4Q 4FXGC 1XPRA 3S14B 1II3A 3G6EA 2K5HA 4RMFA 1WTHA 1SYFA 2IJ0A 2CH4A 2G9HD 3W5OA 1VQLA 4C3HB 3Q24A 1VQDA 2GVAA 2WAQG 1HR0L 3J81j 4ITRA 2PMZE 1GXDC 3KLWA 3D4WA 4PG3A 2H1EA 2EXZA 4DV4L 4QY7A 1KXLA 1MHWC 3HS0C 2QILA 3N6RA 2A73B 1G8ZD 5C6AA 1JCKB 3PF5A 4IN3A 4DR5L 1X32A 4QJFA 3GTQH 3S17B 3L3OC 3W3AA 2L9HA 1SR3A 2XGTA 1AE3A 5LMUQ 1Y1WB 2F0FA 2HDMA 3MFGA 4L63B 5CV4A 1Y8PB 2NUCA 5AJ3L 1K28A 3STBC 4R4IA 3V05A 3E5SA 1OXTA 4HJAA 2K4KA 5M5WB 3I7FA 4BS9A 1SMYC 3BU2A 5COYA 1X3PA 3CAMA 1QB5D 1ZYRC 2ZXOA 1BCPF 2A68C 2B2VC 2CVRA 3B6YA 1O7IA 4TVAB 3OSOA 1JOOA 1YEZA 4DGZA 5CKLA 1QCBD 1WTOA 5LMUL 2BH8A 1KAWA 2ES2A 4HMJA 1MSGA 2JSOA 1KIXA 3DM1A 1MSHA 3GV3A 2ZM6Q 1VQAA 1Q12A 2F0WA 1AP0A 2N55A 5DAUA 3I90A 3TMEA 2JQOA 1JJ2A 2P5ZX 3D3RA 4LMQD 2MP1A 4KN7C 2CH4W 4JCVE 1B3AA 3U9OA 5M5XB 2PCFB 3VYSA 5M3FB 1HA6A 1TWGH 1AH9A 4JBKA 2AWOA 4KHPL 5JJKA 1QNKA 4C2MB 2ZM6L 3I8ZA 1XNQQ 3R8BA 3HG9A 1N33Q 3CW2C 2F0NA 4ZCKA 3TN2A 1WTXA 1PH9A 4MNOA 1EFID 4DV2Q 5NUCA 2KEEA 1E7ZA 2WP8J 2HHHL 4LWCA 2L12A 3NENA 1GUSA 3SEBA 1KC8C 1VF5C 4PMCA 3T1HL 1SMYD 2XNAC 1BVSA 5IGGA 4EQOA 1ZYRD 2JA8G 2OTJA 2A68D 3ULJA 3SHLA 2ATWA 1D1IA 1SNPA 5J39A 1NMFA 5JEAG 2RF4A 2XSCA 1G2TA 5JEAH 1MIUA 3OHXC 3F2BA 2AKWB 2CCZA 4DV2L 1DOMA 1STAA 2BDNA 1B9NA 2NVQH 2LSSA 2F3IA 4NXMQ 2OWOA 2EY6A 4OL7A 3GTOH 1PFBA 2EPBA 1VQHA 3I3CA 5DM63 3Q8DA 4WORA 5EJWA 4DU9A 4A3BB 1LTBD 5JEAJ 2LFNA 3MHBA 3GTGB 1U5KA 3T1YQ 1SE8A 4A3EH 2EYOA 2IWHA 4XQJA 1HQMC 2NTTA 1FL0A 4JI0Q 4IPCA 1X65A 1KLUD 3K81C 2I5LX 2UUAL 4L6TB 1Y8NB 2B63B 2B2UC 2YYZA 2F4IA 3F1ZA 3TSSA 5FK9C 1EWIA 2A1AA 5C0XG 5JOBA 1NE3A 2F03A 4EQNA 4IOCA 5DNFA 4KTAA 1TWFH 1D6EC 2ZT9C 1KRSA 3ZJYC 2FJ2A 3GTKH 2Q8IB 5LMNL 4A3MH 1VQEA 4DV7L 1Q8IA 3JAML 1CHQD 4WJ4A 4FNFA 1NUCA 3T53B 5J22A 2CWAA 2NZHA 1NCVA 4GN3B 4CDFC 5CMTA 3C1EA 2K05A 5ELDA 1L1OA 5C0XJ 3H15A 5EKKA 4Q5VA 4PNYA 2XRSD 2SEBD 4A3KH 4CGYB 1R9TH 5JJLA 2PNHA 4RA8A 5ELCA 3BZKA 1M4VA 1I4XA 1S5FD 2B2TA 2YU9H 2HD3A 4ME3A 5FJ8G 5EPLA 3HEJA 2JA6H 1DYQA 3EQLC 3K0YA 4FF2A 2IX0A 2VZAA 2Z6KA 3IL8A 2K04A 1HNWQ 2WAQB 1TS3A 1PH1A 2X69A 2BDOA 3VR2A 4CKEA 2KHJA 1PRTB 1ET9A 3RLNA 1IBLQ 1O78A 2K28A 2I5HA 4DAYA 4F8MA 3U9SA 2N78A 1CZGA 4DR4Q 1HNWL 2IY5B 4Y52H 4K5XA 3TRZA 4BXXH 1PZJD 4TSSA 2PYKA 1Q7YC 1JWMD 4XT1B 1I4GA 3HGBA 1RL2A 4IUNA 1VMCA 3I4MG 1EY7A 3HOVG 4DF7A 1IBLL 1SNDA 1SEBD 3J80E 3HOVH 4E6IA 3UE0A 3HOZG 5IGCA 3DHQA 1FNUA 3PUYA 3HOZH 3P1HA 1EY8A 4DR4L 5ELNA 4NXNL 2JXMB 1HA5A 1SYDA 2JEAI 4N8FA 1QOHA 3LGJA 2NWGA 1VQ9A 3A8JE 3I70A 2R93G 4AIMA 1LT5D 4J8QA 4WFN3 4DNIA 1MBYA 2UUCQ 4NMZA 1N34Q 3MAQA 4HIMA 2C9OA 2D0OA 2F6SA 2WB1E 2Z4HA 4P2CB 2OQ0A 3HRZC 2JYOA 1TY0A 1BCPC 3SVMA 1WTQA 4LU4A 1AEXA 4EVOA 4N9PA 3VA5A 3KOJA 4PZ6A 2PQEA 1ENCA 3SHGA 3TP7A 5FKAC 5A35A 1FVIA 4C3JG 2PW7A 2KECA 1X54A 3PO3H 5IGFA 4C3JH 3D6WA 2UUCL 4FP5D 1K3BC 1B3QA 1RD9D 1N34L 1NY4A 2D0PA 3WOFA 1PH6A 5EQ0A 3SE0A 1A8VA 1JR0D 4P73A 1SNQA 1C0AA 1TY2A 4BBSH 3KLSX 4MN3A 1PH7A 3AEVA 2VB2X 5IYBH 2E2HH 2EZVA 4LNQA 4LFBL 3SXHA 4DAMA 4U0SA 4HJ9A 1Q1BA 2Z8LA 4UAIA 1TS2A 2DUDA 4JK1C 4RHRA 3E6ZX 2F3VA 3GTPH 3U4VA 5ELOA 2WINB 2K5DA 3BZCA 4JI4Q 2ASBA 2NVXB 2JA8B 1H9MA 2L15A 1E1TA 2B2YA 1IBKQ 1TS5A 1PH4A 2PI2A 2CQAA 1HFNA 1E0BA 4DA2A 4R1JA 2KCTA 2XIWA 4LK1C 3K57A 3EA6A 1UAPA 1UUPA 2XTIA 4UP9A 1JWSD 2RHQB 4DKAC 5IGDA 1SFOH 2O5IC 2L0CA 2NUNA 1BCPD 3H94A 4J1MA 2B2VA 3I91A 2VNUD 4RGMA 5G3LF 5M9OA 5F2DA 1BF4A 2Z6BA 2N3SA 5C4HA 4JI8L 1EFWA 4JI5Q 1R4PB 5BR8L 3CQZB 1IBML 5IE8A 1E2VA 4IJHA 3H0GG 3HOUH 1CI3M 4KI0A 3S14H 3VR4A 2BCOA 3S2DB 1IYVA 3KK7A 3MXUA 3ULPA 3SK8A 2I0QA 4DK1A 5CR3A 1VQBA 1HR0W 2Y0SE 1UE7A 1L0XB 4NP5A 4C3HH 4DUZL 3RD4A 1PRTF 3PSIA 2NZ1D 1XYIA 5HY6A 1GUTA 3ICEA 4GN4B 3S1NB 1YVCA 2R7ZB 3I4OA 2XVSA 1QUQB 2J4XA 1LTRD 5C0XI 2A19A 1EYDA 3ZYYX 3KJOA 5JJZA 2ZJQA 1QNUA 1N32Q 4OX9Q 2PQAB 1PHJA 3NBHA 2LXJA 3RZOB 3S17H 1MJEA 4LF4Q 4JYAQ 2UU9Q 3DMUA 1FJGL 3J80i 1Y1WG 1JJGA 4GZYC 3GTLB 2ZTCA 1Y1WH 1XWEA 3F2DA 1SJHD 3EVQA 1EL0A 1V1OA 2JEBI 2NZOA 3CCJA 5M5WH 5I6YA 4IZ8A 1XTCD 3KBXA 3DWAA 2K5WA 1XMQQ 4I65A 1IKMA 5DLQE 4RKLA 4OX9L 3FPUB 1VDZA 2L4NA 3KF8B 3PIPA 1SSOA 1S5ED 3K7UC 2F4VL 2UU9L 2WIIB 1A62A 4A76A 4KV6A 1I50B 4B3TQ 3LX0A 4DNTB 5BN5A 2WKDA 1TWAB 1D2BA 1E1OA 4IUQA 2RDFA 3QJYA 4X6AH 5K36H 4BWGB 4JOIC 1YHQA 4DV3L 1W2BA 4LUOA 2E75C 1PYBA 1EQRA 3I4MB 1G6ZA 2PMZB 3HOVB 5M3FG 1G291 3VR6A 2D5DA 5JJ6A 3KBGA 4DNRB 5M5XH 5M3FH 1TVXA 4EGVA 4TRDA 4C2MH 2SNMA 2BH2A 5I4DA 1KNAA 4UHVA 4B9XA 1KDAA 4I7ZC 3CCVA 2R93B 2A5HA 1EU3A 2M9VA 4OO1G 4X2DA 1Q86C 1BBWA 3NP8A 5IP9H 2F0HA 2R92G 4LAAA 1WTPA 2Q8RE 3K59A 1IW7C 3H6MA 3JAMc 5T1IA 3VYTA 3AU7A 4YHHQ 2HUGA 4LF9Q 3U58A 4K2LA 4C3JB 4IALA 4L5QA 2OQKA 1PMRA 1PTOF 4DK6C 2EIFA 5JFZA 5HGTA 1YIJA 1QZGA 2E5LQ 4XTCS 3JAME 3A5ZB 3E9HA 3PQIA 2O5JC 1HCZA 1LTLA 4A3BG 2WV6D 3UE1A 4A3BH 3MEFA 5FLXE 4G7OC 1EYCA 2PZUA 4LF9L 3T4AC 5IT9L 1V43A 1AZQA 4QUCA 5ELEA 3M4QA 2MNAA 1A3VA 3KFUA 3MWYW 2F0UA 2JA5B 1BUVT 1DOKA 2B2WC 5IOCA 1RKNA 2IW3A 3PV0A 2E5LL 2EDGA 4JBWA 4U0ZA 2RSOA 3A54A 2C5CA 4EQ5A 3G4SA 1UE5A 1K8GA 3UDIA 4F7XA 4WJWA 2RCNA 5LMNW 1S4ZA 4JI3L 1T5XD 3CUCA 4X3TA 3QG1A 1Y8OB 3ITPA 2NUDA 4HJ7A 3WWVA 1VF7A 3I73A 3FPPA 3W2DA 1ONLA 4GOPA 3MA2B 4IOAA 1IXRA 5LL6X 4M8AA 3GV6A 4ZK9B 5HURA 1ML0D 1VQPA 5JVH3 3H0GB 3R2IA 2VL6A 4A3GB 3MVVA 3BS1A 1ASYA 4NKLA 3BYYB 3S15B 4JI2Q 1BXTA 1CKNA 2QKIC 1LTGD 3H91A 4MHEA 4PZ8A 4U68A 1VQOA 1J6QA 5CV6A 1ZKOA 4K0KQ 5TSSA 2RDHA 4LUZA 1CZWA 1NSNS 1LO5D 1Z6HA 3H3VI 3SE5A 1FGUA 2KOLA 3J7YW 4JI2L 4UP7A 3OMCA 4IUTA 1B50A 4K8IA 1CUKA 1I3QB 5KEEA 1QZHA 1PRTC 3K5LA 4A93B 4AYBE 2Y0SG 2ID0A 4JPBW 1S72A 4L5SA 1A3UA 5M3MG 4C3IB 3EBEA 1GO3E 1W6JA 2E74C 2PPBC 4U673 1STEA 3DLLA 4A3LG 1U4LA 2V4DA 3K5NA 5LHY1 1VMPA 3LETA 4G7ZC 1C8CA 3TREA 1EUJA 3HOWB 5G3LD 3TP6A 2I5MX 3QB3A 4A3DG 1PZKD 2K14A 1KHIA 3KUPA 2KQ3A 1PH3A 3ZCBA 4J6HA 5GADC 2EJFC 1S5BD 1SYEA 1HFGA 5D3DA 1TR5A 1WFQA 3OMGA 5CGLA 3NPPA 3JAMi 3NK9A 5EU0A 3GO5A 4DK0A 1H9JA 1E2WA 5ELBA 4BY7G 3ERQA 4AQYQ 1EIFA 1V9PA 1PRTD 5IIFA 5JVG3 2C35B 1CA6A 4X3SA 4LFAQ 1CHPD 3Q23A 4EQPA 1HZBA 3HKZE 1MD2D 1L1OB 5KNDA 1BOSA 1C9OA 5C5LA 1HNZQ 2NYZD 1FNWA 3ULLA 2RVLA 4KK7A 1KNEA 4JW0A 1AZPA 1GD7A 4FDBA 2FFKB 4X66Q 5KGUA 2R92B 4GNXA 2GA4B 4RKBA 3M4PA 5D3IB 1XNQL 2NVXH 4CDDC 1N33L 2DJGC 2JA8H 3OYYA 5M5YB 5JPNC 3I56A 1QE6A 2NN6I 1SLJA 1XNRQ 3TS0A 4U07A 5K5PA 1HNZL 3K6OA 4QMGA 4GKJQ 5EPKA 4OO1I 3I4LA 1S5DD 1SAPA 1KD1C 2LXKA 4ZUJA 1P16A 4X66L 4BBRB 1WYDA 4H7BA 1DOLA 2JE6I 3AYHB 3M4OB 2JJQA 2CWPA 3NE5B 1CT1D 1WTWA 3D0FA 3M85A 2WB1B 3CC2A 2LY7A 4V190 4POGA 2JN4A 4NB3A 2HIXA 1RTOA 3TBIB 3CQZH 1QVFA 2IX3A 5EPJA 2J0TD 4LUVA 4NXML 3VYRA 2SNSA 1JT8A 3DUZA 2A6EC 1HNXQ 1SROA 3S2DH 4JOIA 1RCVD 1LYLA 2L55A 1GHJA 5C0XH 1B8AA 2LS01 3T1YL 1DM0B 2K6AA 3RZDB 3NTKA 4JI0L 3NBIA 1F9RA 1DJRD 1GVPA 1SNOA 2R61A 2R7ZG 3S1NH 1K83B 2PZTA 5EAYA 1Q82C 2B8GA 1LTAD 2R7ZH 1A3TA 2E2DC 2DNCA 1RDPD 1HNXL 3P75A 4Y7NH 1WI5A 1I94Q 5C4XG 1AN8A 5IWAQ 5EBDA 5EKLA 4RH6A 4X65Q 3VA7A 3RZOH 1EIYB 4IPGA 5I6WA 1X55A 3VDYA 4JBJA 1YITA 1P8LA 5FJ8H 1PH2A 3VR5A 3GTLH 4LF8Q 3MXNA 1TT2A 1ET6A 3K8AA 2MUYA 2YTYA 1A15A 1E22A 4YWMA 4QGUA 3G48A 3QOLA 1PTOD 4XI8A 2DN8A 1G6PA 5DM73 2HCCA 4X65L 4GS3A 2JK8A 3D4DA 5T1GA 3BDCA 4P75A 2A6ED 5KYLA 1EZ8A 1TIID 4ODGA 1I50H 1B70B 3EJIA 5IODA 3KLSA 1TWAH 1EWHA 1SE2A 5GROA 4KN4C 2F52A 1ICWA 1TQOA 3X3MA 1JWUD 1OXUA 2PW5A 1WJJA 2Y0SB 4BA1I 4DUYQ 3I4MH 1SE3A 5IP7G 2M00A 3W1GA 5M3MB 1SBBB 4PMBA 1UEBA 5IP7H 1EY6A 3ZLMA 2R7DA 5IT9c 4U0UA 4G57A 1JE4A 2VB3X 4ABNA 3MC0B 3EIVA 3NHHA 3BJUA 1PFSA 4GKKQ 1VS0A 4CJ2C 2R93H 1V1PB 1VQFA 1F2ZA 4Q0FA 5IT9E 1VQ8A 3PO2B 1L0YB 4AYBG 2RA4A 1X3QA 4YWLA 3OWFA 3BYTB 3L9AX 1JB7A 2F0GA 3PIO3 1I4PA 4A3DB 1I5FA 3DWQA 4DXFA 3PIP3 4XQQA 3OTOQ 1O7YA 1LT6D 3R3OA 4DR3Q 2EYLA 5KNBA 1M8AA 1IZ6A 4FF4A 2PZWA 3NQTA 2HT1A 4BY7B 3G6JB 2HQLA 4KHZA 4ULLA 2MFIA 3DXJC 3NWSA 3BZDB 4HAEA 4A3FG 2Q2TA 2VUMG 2B39A 1GUWA 4HTHA 3CCMA 5KYIA 3A55A 3OTOL 3ER0A 1BKBA 4KKSA 4QIWE 5J1ZA 1E2ZA 4C1NK 3PUWA 3A5UA 3E3XA 4B3MQ 4L8JA 1AFPA 2FMCA 1HUMA 3BDLA 1QJOA 4DR3L 3LNNA 2EVBA 3F2CA 1NMGA 2JA5G 3C3LA 2FINB 2F0EA 5CGKA 1YJNA 2JA5H 5D14A 2AHOB 2EQSA 3AFQA 3PUXA 2EYHA 5FLMG 2EJGC 2QGQA 2JA7B 3K5MA 4N9TA 4DXGA 4JI7Q 4R8IA 1UE6A 2NVTB 1XTDA 3ONAB 1K8AC 2OTLA 4JVZA 1LTSD 3E0EA 4B3ML 2CW0C 3MFYA 2CFMA 2ICEC 2K33A 1HH2P 1X9NA 3BG3A 1AE2A 4KD3A 3SR1A 1VQKA 2K50A 3HKZG 1PTOB 4ZAIA 4JI4L 3HOXG 1IBKL 3N3UA 4CHTB 4U04A 3HOXH 2M2LA 1RTNA 2SOBA 2OF1A 3K7AB 3CC7A 3S16B 2X6LA 1A2UA 4HSPA 2NTSA 2AUKA 1JOQA 4OONA 1LTID 1RIPA 2N88A 1Y69U 3S1RH 4A3GG 1M90C 4ALPA 2F3WA 3H3VH 1I4QA 3H0GH 1I4RA 3S1MB 5CV9A 4A3GH 2JP1A 1B4OA 2KCNA 3S15H 2VQFQ 2D62A 2PI2E 2EYFA 1CA5A 1SRUA 3MXPA 1N36Q 1H9SB 2AUJD 4ZKCB 4QCLA 3H3VC 4UPAA 4JI5L 2KENA 4P74A 4A3JB 4XXEA 1B7YB 4QL5A 2KHSA 4GLXA 1PV4A 2MPMA 4LJZC 2LKVA 5IYCG 4O2DA 4Y7NB 5C4XB 2UXBQ 1V1QA 3MZ5A 3A7LA 5AFWA 1KL9A 2VQFL 1JOKA 2N49A 2VQEQ 1SYBA 1PXUA 2CW0D 3FVQA 2MQHA 1TWCB 1I3QH 2GVBA 4R8NA 3T56B 4A93G 4MIUA 4OXPA 4A93H 3GDEA 5C44G 1NNXA 2F0PA 3WOEA 3J81L 1K8OA 2DY7A 1WCMG 4YWKA 1W3SA 5E1FA 5C4JB 1Y1VB 3SK4A 1YZ6A 4C3IG 2F0TA 2MGSA 3V2TA 1I6VC 4C3IH 4BY1G 1IHZA 3AFPA 4FO2A 1I6HH 3TS2A 5DEHA 3CF5A 3RR5A 2VQEL 3S1QB 1N32L 4NPSA 2QCPX 4CKBA 1K73C 2KVMA 4LF4L 4K8JA 4JYAL 2XWJB 5CYUA 1EU4A 4B9WA 3KDFA 1JICA 1XXGA 3HOWG 1Z7TA 4J15A 1EYAA 3HOWH 4RFBA 3I72A 3BDOA 5EKIA 1XMQL 4GLVB 1OXSC 1X3EA 4JC0A 2PNRC 4S3SA 5CV5A 1CK1A 4FYDA 1CM9A 2OCEA 4OGQC 3S24A 5JJ7A 1S40A 1JC7A 2B2UA 2EY1A 4HSVA 4A75A 4DV5Q 4KKTA 4B3TL 1L0WA 2E2JB 3LWUA 2Q2HA 4APVA 4A3IG 2F0KA 4UP8A 4IURA 4A3IH 1FNVA 1S3OA 5EBCA 5C3XA 2WACA 4CJ0B 2NN6G 4R4QA 3C2PA 5JFFA 4ILWA 4IPHA 1CQVA 2NN6H 1A6XA 5C3WA 4QUFA 1L2FA 3D8GA 1CSPA 4IPDA 3GD7A 4OO1H 3NTIA 4AYBB 2K32A 4EX5A 2ZTDA 3VR3A 2R92H 2EY2A 1Z47A 3M9BA 1L1OC 3P7JA 4XDXA 3CPWA 1RF2D 2AQ2B 2QDLA 1CKNB 5M5YH 3PMFA 2IHEA 4H44C 4XT3B 1QUQA 2WFWA 4H0LC 4WJ3M 1LACA 3U50C 1SYCA 1N8RC 4B3RQ 2B2TC 1HXYD 2PQAA 4BBRG 1SNCA 4HJ5A 4BBRH 5GAEC 4Z9CB 1GUOA 2KCMA 1PLFA 2Z6KC 4A3FB 5ISRA 2VUMB 3GTMB 1H9KA 3M4OH 1TKWB 1FGBD 4YCWA 2WB1G 4YHHL 3V96A 1VQGA 1RHPA 1STNA 3J80L 4IUPA 1EQQA 2ENBA 4YY3Q 1NTGA 1KDCA 1Z9FA 5EGTA 2PO4A 4IO9A 3FEWX 4B3SQ 2EXDA 2G5DA 1SNMA 3KF6A 2F0SA 4JV5Q 1GUGA 1J8IA 3A8IE 4IFDI 3I4NB 4UDUC 3SDZA 3L0OA 4PZ7A 4RG1A 5FO8B 3E0JA 2AMCB 4CDEC 1HTPA 3ZC7A 1WD0A 5IGEA 3FRPB 5CMDA 2ZTEA 3RZDH 3HKZB 2E76C 2I46A 5GAHC 1MGSA 3A56A 1MJCA 1QG7A 1K83H 3HOXB 3W1BA 2A8VA 5E3FA 4JV5L 4ZRZA 4DR6Q 1YBYA 3RUZA 4AH6A 3CCSA 1VCIA 3BVGA 1HZAA 2F0OA 1M1KC 1MKHA 4IUVA 3LWEA 3OPOA 3A0JA 4MZ9A 5FO7B 3S1RB 4JG2A 3PUZA 5D65A 1EIHA 1ICFB 3UI2A 3J7AF 3DM3A 2QA4A 1CQFA 2TMPA 2QEXA 1GJXA 3J7A5 4DR6L 3EROA 1YNXA 1PFNA 2Z1CA 1B1ZA 4OIJA 1O7ZA 3GQBA 5GAGC 3DEPA 1U9RA 1YJWA 1X56A 4N8X1 3NEMA 2Q2IA 4KY5A 3D31A 2KBNA 3QR8A 4LF6Q 2MJ8A 4QQBX 2UXDQ 4H02A 3NTHA 1ILQA 3CKIB 3D4RA 3E9IA 2ALYB 4DR5Q 2RBMA 4IUUA 3UDFA 4DR1Q 3RN5A 1ZEQX 4GNXB 3QOJA 4K2KA 4GLAC 3OW2A 1OXVA 2B8FA 3K5OA 3FKIB 1TWHB 1WTRA 4K0KL 4LF6L 2MO0A 5AJ3Q 5C44B 1GHKA 1U4PA 3K0XA 3S2HB 1CTMA 1WCMB 2UXDL 3J7ZC 3HOYB 1IL8A 2ZJPA 4R4TA 1BR9A 5M3MH 2FHTA 1HUNA 1I6HB 2B2YC 4BY1B 1EY5A 1N9WA 4DR1L 3EFXD 1PYWD 5GQOA 1PH5A 4M1UB 1CKOA 1OO9B 2HQEA 4RGOS 1IYUA 2K5VA 4RHSA 4BA2I 4ZLTF 5KIXA 1DGSA 2UUBQ 1QILA 4A3LH 1GOZA 1KRTA 1JJCB 3T16A 4DV6Q 3TP8A 3PO2G 2UXCQ 3TDQA 2OXPA 3PO2H 1Q3LA 3L7ZC 4CBVA 1A2TA 2H5XA 1EZ6A 1YI2A 4XIGS 4K6DA 4A3DH 4KY6A 3HP3A 2H4OA 1EOVA 2F0VA 3NXWA 1D7QA 5C5MA 1EIGA 4A4IA 3IAYA 1WTVA 3CP0A 3I55A 2UUBL 1YHAA 4KHPQ 3CCLA 4DV6L 4BY7H 4A3IB 2UXCL 1HZ9A 1STYA 1Q1EA 1CSQA 3NSWA 1DD2A 1S5CD 2N8NA 4HR7B 4ZQ3A 2HHHQ 4L5TA 2EJMA 4O0AA 1ZXTA 1G51A 4K5VA 2RDGA 4LFCQ 2Z0SA 3TZUA 3T1HQ 3UDGA 1XPUA 3N52A 4X64Q 2YTVA 4HIDA 5KNCA 1ENFA 4O42A 3M3YB 2E2IB 1DCZA 4DV1Q 1PFMA 1EY4A 1VQ5A 2K01A 2JA7G 1GKHA 1MI2A 4AQYL 1JMCA 4XYOA 2JA7H 4YCUA 3K58A 4UY8C 3MXNB 1YNNC 4B08A 4LFAL 2NVTH 4CDCC 3STBD 4DR2Q 4LFCL 3CC4A 2QDBA 4ZUIA 4X64L 1BBXC 2G9DA 5C3EG 1PTOH 4R9WA 2Z4IA 5C3EH 4DV1L 5E4WC 1ASZA 2WKCA 3QO2A 1CKMA 3GP7A 3BVMA 3J81c 1DXMA 4DAYB 1LABA 2GN5A 1J9OA 3K7AH 3C1FA 3S16H 1O7LA 1XNRL 1PTOC 1J5EQ 4GKJL 4R4CA 4DR2L 4X62Q 2UUAQ 2A74C 3S1MH 1PH8A 3A74A 1IYJB 3J81E 1U4RA 4A3EG 1B44D 1D5MC 3CPFA 2KA7A 3RN2A 4ID6A 5LMNQ 4DV7Q 4OHJA 1H95A 4C56C 2R7FA 1C48A 1J5EL 5E4XA 4A3JG 2A69C 4QIWB 2BA1A 3Q6SA 2D2CC 4RCOA 4X62L 4A3JH 2NBFA 4X3KA 3IKJA 4OIKA 1KLGD 3OW7A 2QW7A 1U4MA 1X6OA 1YNND 3I2ZA 2XN9C 2VXWA 2K75A 5C4XH 4HJ8A 3M7NA 1K8MA 4A3MG 2EY5A 2AQ3B 4KJOA 4K6LA 1TWCH 4YCVA 4R4OA 1UEAB 5CORA 3X3NA 3TP5A 3OIQA 3KLRA 5H1SE 4KY7A 4DN4M 5FLXL 2F1MA 1X3FA 3A7AB 1PZID 1Y1VG 3ND8A 2L1BA 4CJ1B 5C4JH 1DONA 1Y1VH 1BO0A 1I94L 4A3KG 1BQQT 1PYSB 5IWAL 4HMIA 4RGNA 2D9UA 2NVYB 2OT2A 3S1QH 4MTKA 2JA6G 5A2QL 5BN4A 1OTCA 1KAAA 2VS1A 1PDQA 2L11A 2KEDA 5JPMC 4KHVA 4LF8L 1IKLA 1NAPA 2HIVA 5CC4A 2ZJRA 1KABA 3CU7A 1WD1A 4KMUC 2ZXPA 1YJ9A 2ICIA 4GN5A 2A69D 1HPCA 1B2TA 2YTXA 4NW2A 2B2WA 1XX8A 1HQRD 2F0JA 3IFTA 4TQUS 4ZYSA 4OELB 1K0SA 4RAUC 4ZKBB 2IX1A 3J80c 2E2JH 2DJFC 3GTQB 4X2EA 4NXNQ 3CRKC 4BXXG 3Q22A 2X6GA 1UWVA 2EOTA 3CRLC 3CXCA 3RMHA 3OWEB 2IHFA 4HIOA 1KTKA 2O2LD 3R93A 3RLOA 1PVOA 1STHA 2F0LA 1SJED 2NB0A 1EWCA 2IT1A 4DUYL 1EOTA 2KCCA 4KD4A 5C4ZA 1Q81C 4FF1A 1F2LA 1HZCA 1ENAA 1SMXA 1BNZA 1Q90A 3ERSX 4RWSC 3O13A 1TXYA 4I7AA 1YNJC 1SXTA 1CFMA 4GOPC 2RSNA 1EYGA 2DGYA 2CKZB 4GKKL 2RKSA 4P71A 1F9QA 1EEFD 1LT4D 2Q2UA 2O4XA 4HEDA 3QIAA 1XPOA 3HKSA 3CD6A 4IFDG 3AB9A 3H09A 4HIKA 4IFDH 1E24A 1Q8KA 1GM5A 3DWPA 2Q8TA 4RGTA 2EYMA 2MO1A 4A3FH 2VUMH 3GTMH 4LFBQ 3J7AV 3PO3G 4O1NA 5CV7A 3S9WA 1RODA 1LM0A 1RJTA 1TWGB 1ILPA 1WOCA 2CHBD 4P72A 3NBHB 3T51B 2V1CC 3J81i 2G03A 1UNSA 1BDOA 4IFDJ 4BBSG 3IRBA 3HFZB 5FLMH 1Y14B 3I4NG 4K5WA 5IYBG 4ME5A 3I4NH 4DAPA 5J3BA 2K52A 4FXKC 4KJNA 1EY9A 3KJPA 1HTLD 2B29A 2B3GA 1QVGA 2EE1A 4G4KA 2RHSB 1O80A
chains in the Genus database with same CATH topology
4EX5A 2ZTDA 1L1OA 4JBMA 2R92H 4MTNA 4PMWA 5C0XJ 1Z47A 3M9BA 1L1OC 1GO3E 3EBEA 3H15A 2K5NA 1K3RA 3CPWA 3SN9A 3KDFB 4JI7L 4JI8Q 4A3KH 1VQ4A 1CKNB 5M5YH 1R9TH 5BR8Q 5JJLA 2IHEA 2KHIA 3GTJH 2PNHA 1QUQA 2WFWA 1IBMQ 3BZKA 1QVCA 3DLLA 4A3LG 4WJ3M 3U50C 2YU9H 4ME3A 5FJ8G 1N8RC 2JA6H 5JJIA 4B3RQ 3LETA 2WAQE 1PA6A 3TREA 1EUJA 2VZAA 2IX0A 2AWNA 2PQAA 3PGZA 4BBRG 3CCQA 4HJ5A 1A63A 2Z6KA 1HNWQ 4BBRH 5GAEC 2I5MX 2KCMA 2BA0A 2Z6KC 4A3DG 2K14A 1KHIA 4DUZQ 3M4OH 1PH1A 4YCWA 4YHHL 3RNUA 2WB1G 1PH3A 1VQGA 3ZCBA 5GADC 1EQQA 4YY3Q 1NTGA 2KHJA 3HOUG 1WFQA 5CGLA 1Z9FA 3RLNA 3JAMi 1IBLQ 4IO9A 1U0LA 5EU0A 3GO5A 4B3SQ 2EXDA 4BY7G 3KF6A 2I5HA 4JV5Q 4DV0Q 5IYCH 2N78A 4DR4Q 4IFDI 4AQYQ 1EIFA 1HNWL 1V9PA 3PF4A 2IY5B 3L0OA 4Y52H 4PZ7A 4RG1A 3TRZA 3F8TA 2C35B 4BXXH 4LFAQ 2AMCB 1HZBA 1Q46A 3HKZE 1N36L 3G71A 1L1OB 1Q7YC 1HNZQ 4JI6Q 1C9OA 3FKIG 1FJGQ 1RL2A 3ZC7A 3ULLA 2VY3A 3FKIH 3I4MG 1TWHH 2ZTEA 3RZDH 3HOVG 1GD7A 4FDBA 5GAHC 1IBLL 3HOVH 5C44H 4X66Q 4DPGA 3HOYG 1MJCA 3UE0A 4GNXA 3S2HH 1K83H 1WCMH 3M4PA 3W1BA 2A8VA 3HOYH 1XNQL 1BBUA 1YHBA 3HOZG 1YBYA 4DV0L 3PUYA 4GNXC 2NVXH 1N33L 2JA8H 3HOZH 3SGIA 3CMAA 5ELNA 4DR4L 4NXNL 4AH6A 3CCSA 2UXBL 3OYYA 1VCIA 3PUVA 3I56A 1HZAA 4DK3C 2FXQA 3EN2A 4BY1H 2JEAI 1OXXK 3LGJA 2NN6I 1VQ9A 1SN8A 1M1KC 1MKHA 1SLJA 1XNRQ 4AIMA 3TS0A 2R93G 3S6AA 4U07A 1HNZL 4JI6L 4DNIA 2F4VQ 2UUCQ 4GKJQ 4MZ9A 3A0JA 4OO1I 4JG2A 3PUZA 3U4ZA 3CCEA 1N34Q 1KD1C 2LXKA 4HIMA 1P16A 2D0OA 2F6SA 3DM3A 2QA4A 4X66L 2QEXA 2WB1E 1WYDA 2JE6I 4L5RC 2OQ0A 3AYHB 4OWXB 3J7A5 3UDXA 4DR6L 2JJQA 1YNXA 2CWPA 3FP9A 4DV3Q 4LU4A 3D0FA 3M85A 3CMEA 3KOJA 5GAGC 3CC2A 4PZ6A 3PIOA 4POFA 3KF6B 1YJWA 1X56A 4POGA 2CQOA 3NEMA 3SHGA 2Q2IA 5HGQA 4NB3A 1FVIA 2KBNA 3D31A 2HIXA 4LF6Q 1X54A 3PO3H 4C3JH 2UUCL 3CQZH 4QQBX 1QVFA 1N34L 2UXDQ 4H02A 1NY4A 2D0PA 4IJLA 4LUVA 1VQMA 1PH6A 4NXML 3L2PA 1NBWA 2E8GA 1VQ7A 1X3GA 3E9IA 1JT8A 1HNXQ 2ALYB 1SROA 4DR7Q 4DR5Q 1A8VA 4JOIA 4OWTB 3UDFA 3S2DH 5K36G 1LYLA 4P73A 1C0AA 4DR1Q 4BBSH 3RN5A 1PH7A 3AEVA 1B8AA 2YV5A 3T1YL 4GNXB 5IYBH 2E2HH 4GLAC 3OW2A 1OXVA 4LNQA 1XJVA 4LFBL 4LF7Q 1K0RA 4K0KL 4DAMA 4JI0L 4U0SA 4HJ9A 4LF6L 2JA9A 4GOPB 2MO0A 1Q1BA 5AJ3Q 1GVPA 3AQQA 2R7ZG 2DUDA 3K0XA 3S1NH 2UXDL 5EAYA 3GTPH 3J7ZC 1Q82C 3U4VA 5ELOA 3BZCA 4JI4Q 2ZJPA 2ASBA 2R7ZH 4R4TA 2L15A 4DV5L 1E1TA 1IBKQ 5M3MH 1HNXL 1PH4A 2PI2A 4DR7L 5C4XG 4Y7NH 1WI5A 1I94Q 3M3YH 1N9WA 5IWAQ 2E2IH 4DR1L 3RLFA 1E3PA 1HJPA 4R1JA 2KCTA 3PCOB 5GQOA 1PH5A 1CKOA 2XTIA 4LW1A 2K5VA 4X65Q 1A0IA 4BA2I 4UP9A 4LF7L 2R6GA 3RZOH 4X2CA 1EIYB 1DGSA 2RHQB 4IPGA 4DKAC 1SFOH 1X55A 3VDYA 2UUBQ 5IP9G 4A3LH 1C7YA 4JBJA 1YITA 1KRTA 1JJCB 1P8LA 4OWWB 5FJ8H 4DV6Q 1PH2A 3GTLH 3PO2G 2UXCQ 1T9HA 5IYDG 4LF8Q 3K8AA 3PO2H 5IYDH 3K80C 3L7ZC 2VNUD 2YTYA 5E7NA 2H5XA 1YI2A 1NJIC 1E22A 4XIGS 4YWMA 4QGUA 3G48A 4A3DH 1VQJA 2N3SA 4XI8A 4JI8L 1EFWA 4JI5Q 1EOVA 4A3CG 1VQCA 5BR8L 5FLXc 1VQNA 1D7QA 2VW9A 1G6PA 4A4IA 4X65L 4A3CH 4GS3A 1IBML 5IE8A 2JK8A 3CP0A 4IJHA 3I55A 4LF5Q 4PY3A 4P75A 3H0GG 3HOUH 1K9MC 1YHAA 2UUBL 4KHPQ 4KI0A 3CCLA 3S14H 3NELA 4B3RL 1I50H 4DV6L 1B70B 4BY7H 2UXCL 1HZ9A 1UE1A 3ULPA 2I0QA 3JC66 4WGJA 1TWAH 1VQBA 1HR0W 2Y0SE 1UE7A 1Q1EA 1CSQA 5GROA 4C3HH 4DUZL 3GTGH 2N8NA 2F52A 2HHHQ 4JI3Q 4N67A 1OXUA 3PSIA 4L5TA 5HY6A 4O0AA 1WJJA 3ICEA 1G51A 4GN4B 4BA1I 4LFCQ 4YY3L 2Z0SA 4DUYQ 1YVCA 3UDGA 3T1HQ 1KQSA 4LF5L 3I4MH 3I4OA 1XMOQ 1XPUA 5IP7G 4X64Q 3W1GA 4B3SL 2YTVA 4HIDA 1UEBA 5IP7H 1QUQB 3ZLMA 2R7DA 5IT9c 3CCRA 2B63G 4DV1Q 1IL2A 2B63H 1VQ5A 2JA7G 1GKHA 4JI1Q 1JE5A 5C0XI 2A19A 4AQYL 3KJOA 1JMCA 1D8LA 4YCUA 2ZJQA 3EIVA 2JA7H 4OX9Q 1N32Q 2PQAB 3BJUA 1LUZA 3MXNB 1PHJA 1PFSA 2LXJA 4LFAL 4UY8C 1MJEA 2NVTH 1VQ6A 1VS0A 3S17H 3KYHC 4LF4Q 4GKKQ 4JYAQ 4KLKA 1VQIA 3STBD 2UU9Q 1FJGL 2R93H 3J80i 4DR2Q 1Y1WG 1VQFA 4LFCL 1JJGA 3CC4A 2ZTCA 1Y1WH 1VQ8A 3F2DA 1XMOL 4AYBG 3FHWA 4X64L 5IY0A 4YWLA 3TEHB 2JEBI 5C3EG 2NZOA 3CCJA 4M16A 1JB7A 3TQYA 5M5WH 5C3EH 4DV1L 3CCUA 1HR0Q 1I5FA 1ASZA 1XMQQ 1CKMA 4JI1L 5DLQE 3OTOQ 3J81c 4DAYB 2GN5A 4OX9L 3K7AH 3S16H 1XNRL 3KF8B 3PIPA 4DR3Q 3K7UC 2F4VL 1J5EQ 2UU9L 2NVYH 1A62A 4R4CA 4DV4Q 4A76A 4DR2L 1XPRA 4GKJL 1IZ6A 4X62Q 3G6EA 2UUAQ 2K5HA 4B3TQ 4RMFA 2HT1A 2HQLA 4KHZA 2MFIA 3S1MH 1PH8A 1E1OA 3A74A 3W5OA 1VQLA 1IYJB 4X6AH 4A3EG 1VQDA 3CPFA 2GVAA 2WAQG 4JOIC 1YHQA 4A3FG 4DV3L 1HR0L 3J81j 2Q2TA 2VUMG 4ITRA 1W2BA 3CCMA 2PMZE 4LUOA 3OTOL 3ER0A 1BKBA 3RN2A 4QIWE 5LMNQ 3KLWA 3PUWA 3A5UA 4DV7Q 4B3MQ 1H95A 4DR3L 1PYBA 1EQRA 2R7FA 4PG3A 3F2CA 1J5EL 1NMGA 1G291 4QY7A 5M3FG 4DV4L 2BA1A 5JJ6A 4A3JG 1YJNA 2JA5G 1KXLA 4X62L 5M5XH 5M3FH 4A3JH 2AHOB 2JA5H 2EQSA 3AFQA 3PUXA 5FLMG 3PF5A 4C2MH 4DR5L 2QGQA 2BH2A 1X6OA 4QJFA 3I2ZA 3GTQH 5C4XH 4HJ8A 2K75A 4JI7Q 1UE6A 3M7NA 3CCVA 1SR3A 2XGTA 4A3MG 1XTDA 1AE3A 1K8AC 2OTLA 3E0EA 5LMUQ 4B3ML 4OO1G 1TWCH 2CFMA 4YCVA 4R4OA 1HH2P 1X9NA 4X2DA 1AE2A 1Q86C 1BBWA 1VQKA 4DR6Q 2K50A 5AJ3L 3STBC 3HKZG 4R4IA 5IP9H 5H1SE 1OXTA 4HJAA 2K4KA 2R92G 3I7FA 4JI4L 1X3FA 3HOXG 1Y1VG 1IBKL 3N3UA 3BU2A 3JAMc 5C4JH 4U04A 1Y1VH 3CAMA 3HOXH 1I94L 4A3KG 1PYSB 5IWAL 4YHHQ 3CC7A 3B6YA 3U58A 4LF9Q 1O7IA 4TVAB 1YEZA 4L5QA 2OQKA 5CKLA 3S1QH 5LMUL 2BH8A 1KAWA 4DK6C 2ES2A 2JA6G 2EIFA 4OONA 5JFZA 1KIXA 1RIPA 1YIJA 3S1RH 1OTCA 4A3GG 1M90C 2VS1A 4ALPA 1QZGA 3H0GH 2ZM6Q 2E5LQ 3H3VH 4XTCS 1VQAA 4A3GH 1Q12A 3A5ZB 4LF8L 3E9HA 3S15H 1LTLA 4A3BG 2VQFQ 2D62A 2PI2E 2HIVA 3UE1A 1SRUA 4A3BH 3MEFA 2JQOA 2ZJRA 1JJ2A 1N36Q 4LF9L 1V43A 4UPAA 1YJ9A 4JI5L 4GN5A 4JCVE 2KENA 2YTXA 3M4QA 2MNAA 4P74A 3KFUA 1B7YB 4QL5A 1TWGH 4TQUS 4GLXA 1PV4A 4JBKA 2AWOA 4KHPL 5JJKA 1AH9A 3PV0A 5IYCG 2ZM6L 2E5LL 1XNQQ 4O2DA 2IX1A 3J80c 1N33Q 3CW2C 4JBWA 2E2JH 4U0ZA 4JV5L 4X2EA 4NXNQ 4EQ5A 1V1QA 2UXBQ 1PH9A 4BXXG 3G4SA 1UWVA 1KL9A 2VQFL 4MNOA 1UE5A 2N49A 3CXCA 3UDIA 2VQEQ 4DV2Q 1K8GA 2IHFA 2RCNA 2MQHA 5LMNW 4HIOA 1E7ZA 2WP8J 4JI3L 2HHHL 4LWCA 1I3QH 2GVBA 3RLOA 3NENA 4A93G 1PVOA 1KC8C 3CUCA 4OXPA 4A93H 3GDEA 5C44G 2IT1A 4DUYL 3T1HL 1BVSA 1WCMG 4YWKA 1Q81C 4HJ7A 1HZCA 1W3SA 2JA8G 2OTJA 1SMXA 1YZ6A 3WWVA 3ULJA 2ATWA 3ERSX 2RHSB 4BY1G 4C3IH 1NMFA 3AFPA 2RF4A 1TXYA 5JEAG 4GOPA 1I6HH 3TS2A 4IOAA 1IXRA 3CF5A 1MIUA 3F2BA 2AKWB 3RR5A 2VQEL 4GOPC 4DV2L 2CCZA 1N32L 1EYGA 2DGYA 2CKZB 4NPSA 1VQPA 1K73C 4GKKL 4LF4L 4P71A 2NVQH 4JYAL 2LSSA 2F3IA 4NXMQ 2Q2UA 2VL6A 2OWOA 1ASYA 3KDFA 3HKSA 1XPOA 3CD6A 4JI2Q 3GTOH 1CKNA 3HOWG 4IFDG 1VQHA 3Q8DA 4J15A 4HIKA 3HOWH 5JEAJ 4PZ8A 1E24A 1Q8KA 1U5KA 3T1YQ 1SE8A 1GM5A 4A3EH 1XMQL 4GLVB 1OXSC 1X3EA 4JC0A 2MO1A 1J6QA 4A3FH 1VQOA 2VUMH 3GTMH 4LFBQ 4K0KQ 1FL0A 4JI0Q 3PO3G 4IPCA 4LUZA 2OCEA 1LM0A 1X65A 1WOCA 3S24A 5JJ7A 3K81C 4P72A 1S40A 2I5LX 3NBHB 3H3VI 4B3TL 2UUAL 4A75A 4DV5Q 3SE5A 1L0WA 2V1CC 3J81i 2Q2HA 2G03A 1FGUA 2YYZA 4APVA 3F1ZA 4A3IG 4JI2L 4UP8A 4BBSG 1EWIA 3IRBA 4IFDJ 2A1AA 5C0XG 3HFZB 1NE3A 4UP7A 1S3OA 1Y14B 5FLMH 4A3IH 3I4NG 4IOCA 5IYBG 2NN6G 4R4QA 3I4NH 1TWFH 5JFFA 1CUKA 4IPHA 1QZHA 5J3BA 1KRSA 2K52A 3ZJYC 3GTKH 5LMNL 4AYBE 1VQEA 4A3MH 1L2FA 4DV7L 1CSPA 2ID0A 2Y0SG 4IPDA 3KJPA 2B29A 4WJ4A 3GD7A 2B3GA 1S72A 2CWAA 2NZHA 1QVGA 4L5SA 4GN3B 4U0UA 5CMTA 5M3MG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EX5 A;  2ZTD A;  1L1O A;  4JBM A;  2R92 H;  4MTN A;  4PMW A;  5C0X J;  1Z47 A;  3M9B A;  1L1O C;  1GO3 E;  3EBE A;  3H15 A;  2K5N A;  1K3R A;  3CPW A;  3SN9 A;  3KDF B;  4JI7 L;  4JI8 Q;  4A3K H;  1VQ4 A;  1CKN B;  5M5Y H;  1R9T H;  5BR8 Q;  5JJL A;  2IHE A;  2KHI A;  3GTJ H;  2PNH A;  1QUQ A;  2WFW A;  1IBM Q;  3BZK A;  1QVC A;  3DLL A;  4A3L G;  4WJ3 M;  3U50 C;  2YU9 H;  4ME3 A;  5FJ8 G;  1N8R C;  2JA6 H;  5JJI A;  4B3R Q;  3LET A;  2WAQ E;  1PA6 A;  3TRE A;  1EUJ A;  2VZA A;  2IX0 A;  2AWN A;  2PQA A;  3PGZ A;  4BBR G;  3CCQ A;  4HJ5 A;  1A63 A;  2Z6K A;  1HNW Q;  4BBR H;  5GAE C;  2I5M X;  2KCM A;  2BA0 A;  2Z6K C;  4A3D G;  2K14 A;  1KHI A;  4DUZ Q;  3M4O H;  1PH1 A;  4YCW A;  4YHH L;  3RNU A;  2WB1 G;  1PH3 A;  1VQG A;  3ZCB A;  5GAD C;  1EQQ A;  4YY3 Q;  1NTG A;  2KHJ A;  3HOU G;  1WFQ A;  5CGL A;  1Z9F A;  3RLN A;  3JAM i;  1IBL Q;  4IO9 A;  1U0L A;  5EU0 A;  3GO5 A;  4B3S Q;  2EXD A;  4BY7 G;  3KF6 A;  2I5H A;  4JV5 Q;  4DV0 Q;  5IYC H;  2N78 A;  4DR4 Q;  4IFD I;  4AQY Q;  1EIF A;  1HNW L;  1V9P A;  3PF4 A;  2IY5 B;  3L0O A;  4Y52 H;  4PZ7 A;  4RG1 A;  3TRZ A;  3F8T A;  2C35 B;  4BXX H;  4LFA Q;  2AMC B;  1HZB A;  1Q46 A;  3HKZ E;  1N36 L;  3G71 A;  1L1O B;  1Q7Y C;  1HNZ Q;  4JI6 Q;  1C9O A;  3FKI G;  1FJG Q;  1RL2 A;  3ZC7 A;  3ULL A;  2VY3 A;  3FKI H;  3I4M G;  1TWH H;  2ZTE A;  3RZD H;  3HOV G;  1GD7 A;  4FDB A;  5GAH C;  1IBL L;  3HOV H;  5C44 H;  4X66 Q;  4DPG A;  3HOY G;  1MJC A;  3UE0 A;  4GNX A;  3S2H H;  1K83 H;  1WCM H;  3M4P A;  3W1B A;  2A8V A;  3HOY H;  1XNQ L;  1BBU A;  1YHB A;  3HOZ G;  1YBY A;  4DV0 L;  3PUY A;  4GNX C;  2NVX H;  1N33 L;  2JA8 H;  3HOZ H;  3SGI A;  3CMA A;  5ELN A;  4DR4 L;  4NXN L;  4AH6 A;  3CCS A;  2UXB L;  3OYY A;  1VCI A;  3PUV A;  3I56 A;  1HZA A;  4DK3 C;  2FXQ A;  3EN2 A;  4BY1 H;  2JEA I;  1OXX K;  3LGJ A;  2NN6 I;  1VQ9 A;  1SN8 A;  1M1K C;  1MKH A;  1SLJ A;  1XNR Q;  4AIM A;  3TS0 A;  2R93 G;  3S6A A;  4U07 A;  1HNZ L;  4JI6 L;  4DNI A;  2F4V Q;  2UUC Q;  4GKJ Q;  4MZ9 A;  3A0J A;  4OO1 I;  4JG2 A;  3PUZ A;  3U4Z A;  3CCE A;  1N34 Q;  1KD1 C;  2LXK A;  4HIM A;  1P16 A;  2D0O A;  2F6S A;  3DM3 A;  2QA4 A;  4X66 L;  2QEX A;  2WB1 E;  1WYD A;  2JE6 I;  4L5R C;  2OQ0 A;  3AYH B;  4OWX B;  3J7A 5;  3UDX A;  4DR6 L;  2JJQ A;  1YNX A;  2CWP A;  3FP9 A;  4DV3 Q;  4LU4 A;  3D0F A;  3M85 A;  3CME A;  3KOJ A;  5GAG C;  3CC2 A;  4PZ6 A;  3PIO A;  4POF A;  3KF6 B;  1YJW A;  1X56 A;  4POG A;  2CQO A;  3NEM A;  3SHG A;  2Q2I A;  5HGQ A;  4NB3 A;  1FVI A;  2KBN A;  3D31 A;  2HIX A;  4LF6 Q;  1X54 A;  3PO3 H;  4C3J H;  2UUC L;  3CQZ H;  4QQB X;  1QVF A;  1N34 L;  2UXD Q;  4H02 A;  1NY4 A;  2D0P A;  4IJL A;  4LUV A;  1VQM A;  1PH6 A;  4NXM L;  3L2P A;  1NBW A;  2E8G A;  1VQ7 A;  1X3G A;  3E9I A;  1JT8 A;  1HNX Q;  2ALY B;  1SRO A;  4DR7 Q;  4DR5 Q;  1A8V A;  4JOI A;  4OWT B;  3UDF A;  3S2D H;  5K36 G;  1LYL A;  4P73 A;  1C0A A;  4DR1 Q;  4BBS H;  3RN5 A;  1PH7 A;  3AEV A;  1B8A A;  2YV5 A;  3T1Y L;  4GNX B;  5IYB H;  2E2H H;  4GLA C;  3OW2 A;  1OXV A;  4LNQ A;  1XJV A;  4LFB L;  4LF7 Q;  1K0R A;  4K0K L;  4DAM A;  4JI0 L;  4U0S A;  4HJ9 A;  4LF6 L;  2JA9 A;  4GOP B;  2MO0 A;  1Q1B A;  5AJ3 Q;  1GVP A;  3AQQ A;  2R7Z G;  2DUD A;  3K0X A;  3S1N H;  2UXD L;  5EAY A;  3GTP H;  3J7Z C;  1Q82 C;  3U4V A;  5ELO A;  3BZC A;  4JI4 Q;  2ZJP A;  2ASB A;  2R7Z H;  4R4T A;  2L15 A;  4DV5 L;  1E1T A;  1IBK Q;  5M3M H;  1HNX L;  1PH4 A;  2PI2 A;  4DR7 L;  5C4X G;  4Y7N H;  1WI5 A;  1I94 Q;  3M3Y H;  1N9W A;  5IWA Q;  2E2I H;  4DR1 L;  3RLF A;  1E3P A;  1HJP A;  4R1J A;  2KCT A;  3PCO B;  5GQO A;  1PH5 A;  1CKO A;  2XTI A;  4LW1 A;  2K5V A;  4X65 Q;  1A0I A;  4BA2 I;  4UP9 A;  4LF7 L;  2R6G A;  3RZO H;  4X2C A;  1EIY B;  1DGS A;  2RHQ B;  4IPG A;  4DKA C;  1SFO H;  1X55 A;  3VDY A;  2UUB Q;  5IP9 G;  4A3L H;  1C7Y A;  4JBJ A;  1YIT A;  1KRT A;  1JJC B;  1P8L A;  4OWW B;  5FJ8 H;  4DV6 Q;  1PH2 A;  3GTL H;  3PO2 G;  2UXC Q;  1T9H A;  5IYD G;  4LF8 Q;  3K8A A;  3PO2 H;  5IYD H;  3K80 C;  3L7Z C;  2VNU D;  2YTY A;  5E7N A;  2H5X A;  1YI2 A;  1NJI C;  1E22 A;  4XIG S;  4YWM A;  4QGU A;  3G48 A;  4A3D H;  1VQJ A;  2N3S A;  4XI8 A;  4JI8 L;  1EFW A;  4JI5 Q;  1EOV A;  4A3C G;  1VQC A;  5BR8 L;  5FLX c;  1VQN A;  1D7Q A;  2VW9 A;  1G6P A;  4A4I A;  4X65 L;  4A3C H;  4GS3 A;  1IBM L;  5IE8 A;  2JK8 A;  3CP0 A;  4IJH A;  3I55 A;  4LF5 Q;  4PY3 A;  4P75 A;  3H0G G;  3HOU H;  1K9M C;  1YHA A;  2UUB L;  4KHP Q;  4KI0 A;  3CCL A;  3S14 H;  3NEL A;  4B3R L;  1I50 H;  4DV6 L;  1B70 B;  4BY7 H;  2UXC L;  1HZ9 A;  1UE1 A;  3ULP A;  2I0Q A;  3JC6 6;  4WGJ A;  1TWA H;  1VQB A;  1HR0 W;  2Y0S E;  1UE7 A;  1Q1E A;  1CSQ A;  5GRO A;  4C3H H;  4DUZ L;  3GTG H;  2N8N A;  2F52 A;  2HHH Q;  4JI3 Q;  4N67 A;  1OXU A;  3PSI A;  4L5T A;  5HY6 A;  4O0A A;  1WJJ A;  3ICE A;  1G51 A;  4GN4 B;  4BA1 I;  4LFC Q;  4YY3 L;  2Z0S A;  4DUY Q;  1YVC A;  3UDG A;  3T1H Q;  1KQS A;  4LF5 L;  3I4M H;  3I4O A;  1XMO Q;  1XPU A;  5IP7 G;  4X64 Q;  3W1G A;  4B3S L;  2YTV A;  4HID A;  1UEB A;  5IP7 H;  1QUQ B;  3ZLM A;  2R7D A;  5IT9 c;  3CCR A;  2B63 G;  4DV1 Q;  1IL2 A;  2B63 H;  1VQ5 A;  2JA7 G;  1GKH A;  4JI1 Q;  1JE5 A;  5C0X I;  2A19 A;  4AQY L;  3KJO A;  1JMC A;  1D8L A;  4YCU A;  2ZJQ A;  3EIV A;  2JA7 H;  4OX9 Q;  1N32 Q;  2PQA B;  3BJU A;  1LUZ A;  3MXN B;  1PHJ A;  1PFS A;  2LXJ A;  4LFA L;  4UY8 C;  1MJE A;  2NVT H;  1VQ6 A;  1VS0 A;  3S17 H;  3KYH C;  4LF4 Q;  4GKK Q;  4JYA Q;  4KLK A;  1VQI A;  3STB D;  2UU9 Q;  1FJG L;  2R93 H;  3J80 i;  4DR2 Q;  1Y1W G;  1VQF A;  4LFC L;  1JJG A;  3CC4 A;  2ZTC A;  1Y1W H;  1VQ8 A;  3F2D A;  1XMO L;  4AYB G;  3FHW A;  4X64 L;  5IY0 A;  4YWL A;  3TEH B;  2JEB I;  5C3E G;  2NZO A;  3CCJ A;  4M16 A;  1JB7 A;  3TQY A;  5M5W H;  5C3E H;  4DV1 L;  3CCU A;  1HR0 Q;  1I5F A;  1ASZ A;  1XMQ Q;  1CKM A;  4JI1 L;  5DLQ E;  3OTO Q;  3J81 c;  4DAY B;  2GN5 A;  4OX9 L;  3K7A H;  3S16 H;  1XNR L;  3KF8 B;  3PIP A;  4DR3 Q;  3K7U C;  2F4V L;  1J5E Q;  2UU9 L;  2NVY H;  1A62 A;  4R4C A;  4DV4 Q;  4A76 A;  4DR2 L;  1XPR A;  4GKJ L;  1IZ6 A;  4X62 Q;  3G6E A;  2UUA Q;  2K5H A;  4B3T Q;  4RMF A;  2HT1 A;  2HQL A;  4KHZ A;  2MFI A;  3S1M H;  1PH8 A;  1E1O A;  3A74 A;  3W5O A;  1VQL A;  1IYJ B;  4X6A H;  4A3E G;  1VQD A;  3CPF A;  2GVA A;  2WAQ G;  4JOI C;  1YHQ A;  4A3F G;  4DV3 L;  1HR0 L;  3J81 j;  2Q2T A;  2VUM G;  4ITR A;  1W2B A;  3CCM A;  2PMZ E;  4LUO A;  3OTO L;  3ER0 A;  1BKB A;  3RN2 A;  4QIW E;  5LMN Q;  3KLW A;  3PUW A;  3A5U A;  4DV7 Q;  4B3M Q;  1H95 A;  4DR3 L;  1PYB A;  1EQR A;  2R7F A;  4PG3 A;  3F2C A;  1J5E L;  1NMG A;  1G29 1;  4QY7 A;  5M3F G;  4DV4 L;  2BA1 A;  5JJ6 A;  4A3J G;  1YJN A;  2JA5 G;  1KXL A;  4X62 L;  5M5X H;  5M3F H;  4A3J H;  2AHO B;  2JA5 H;  2EQS A;  3AFQ A;  3PUX A;  5FLM G;  3PF5 A;  4C2M H;  4DR5 L;  2QGQ A;  2BH2 A;  1X6O A;  4QJF A;  3I2Z A;  3GTQ H;  5C4X H;  4HJ8 A;  2K75 A;  4JI7 Q;  1UE6 A;  3M7N A;  3CCV A;  1SR3 A;  2XGT A;  4A3M G;  1XTD A;  1AE3 A;  1K8A C;  2OTL A;  3E0E A;  5LMU Q;  4B3M L;  4OO1 G;  1TWC H;  2CFM A;  4YCV A;  4R4O A;  1HH2 P;  1X9N A;  4X2D A;  1AE2 A;  1Q86 C;  1BBW A;  1VQK A;  4DR6 Q;  2K50 A;  5AJ3 L;  3STB C;  3HKZ G;  4R4I A;  5IP9 H;  5H1S E;  1OXT A;  4HJA A;  2K4K A;  2R92 G;  3I7F A;  4JI4 L;  1X3F A;  3HOX G;  1Y1V G;  1IBK L;  3N3U A;  3BU2 A;  3JAM c;  5C4J H;  4U04 A;  1Y1V H;  3CAM A;  3HOX H;  1I94 L;  4A3K G;  1PYS B;  5IWA L;  4YHH Q;  3CC7 A;  3B6Y A;  3U58 A;  4LF9 Q;  1O7I A;  4TVA B;  1YEZ A;  4L5Q A;  2OQK A;  5CKL A;  3S1Q H;  5LMU L;  2BH8 A;  1KAW A;  4DK6 C;  2ES2 A;  2JA6 G;  2EIF A;  4OON A;  5JFZ A;  1KIX A;  1RIP A;  1YIJ A;  3S1R H;  1OTC A;  4A3G G;  1M90 C;  2VS1 A;  4ALP A;  1QZG A;  3H0G H;  2ZM6 Q;  2E5L Q;  3H3V H;  4XTC S;  1VQA A;  4A3G H;  1Q12 A;  3A5Z B;  4LF8 L;  3E9H A;  3S15 H;  1LTL A;  4A3B G;  2VQF Q;  2D62 A;  2PI2 E;  2HIV A;  3UE1 A;  1SRU A;  4A3B H;  3MEF A;  2JQO A;  2ZJR A;  1JJ2 A;  1N36 Q;  4LF9 L;  1V43 A;  4UPA A;  1YJ9 A;  4JI5 L;  4GN5 A;  4JCV E;  2KEN A;  2YTX A;  3M4Q A;  2MNA A;  4P74 A;  3KFU A;  1B7Y B;  4QL5 A;  1TWG H;  4TQU S;  4GLX A;  1PV4 A;  4JBK A;  2AWO A;  4KHP L;  5JJK A;  1AH9 A;  3PV0 A;  5IYC G;  2ZM6 L;  2E5L L;  1XNQ Q;  4O2D A;  2IX1 A;  3J80 c;  1N33 Q;  3CW2 C;  4JBW A;  2E2J H;  4U0Z A;  4JV5 L;  4X2E A;  4NXN Q;  4EQ5 A;  1V1Q A;  2UXB Q;  1PH9 A;  4BXX G;  3G4S A;  1UWV A;  1KL9 A;  2VQF L;  4MNO A;  1UE5 A;  2N49 A;  3CXC A;  3UDI A;  2VQE Q;  4DV2 Q;  1K8G A;  2IHF A;  2RCN A;  2MQH A;  5LMN W;  4HIO A;  1E7Z A;  2WP8 J;  4JI3 L;  2HHH L;  4LWC A;  1I3Q H;  2GVB A;  3RLO A;  3NEN A;  4A93 G;  1PVO A;  1KC8 C;  3CUC A;  4OXP A;  4A93 H;  3GDE A;  5C44 G;  2IT1 A;  4DUY L;  3T1H L;  1BVS A;  1WCM G;  4YWK A;  1Q81 C;  4HJ7 A;  1HZC A;  1W3S A;  2JA8 G;  2OTJ A;  1SMX A;  1YZ6 A;  3WWV A;  3ULJ A;  2ATW A;  3ERS X;  2RHS B;  4BY1 G;  4C3I H;  1NMF A;  3AFP A;  2RF4 A;  1TXY A;  5JEA G;  4GOP A;  1I6H H;  3TS2 A;  4IOA A;  1IXR A;  3CF5 A;  1MIU A;  3F2B A;  2AKW B;  3RR5 A;  2VQE L;  4GOP C;  4DV2 L;  2CCZ A;  1N32 L;  1EYG A;  2DGY A;  2CKZ B;  4NPS A;  1VQP A;  1K73 C;  4GKK L;  4LF4 L;  4P71 A;  2NVQ H;  4JYA L;  2LSS A;  2F3I A;  4NXM Q;  2Q2U A;  2VL6 A;  2OWO A;  1ASY A;  3KDF A;  3HKS A;  1XPO A;  3CD6 A;  4JI2 Q;  3GTO H;  1CKN A;  3HOW G;  4IFD G;  1VQH A;  3Q8D A;  4J15 A;  4HIK A;  3HOW H;  5JEA J;  4PZ8 A;  1E24 A;  1Q8K A;  1U5K A;  3T1Y Q;  1SE8 A;  1GM5 A;  4A3E H;  1XMQ L;  4GLV B;  1OXS C;  1X3E A;  4JC0 A;  2MO1 A;  1J6Q A;  4A3F H;  1VQO A;  2VUM H;  3GTM H;  4LFB Q;  4K0K Q;  1FL0 A;  4JI0 Q;  3PO3 G;  4IPC A;  4LUZ A;  2OCE A;  1LM0 A;  1X65 A;  1WOC A;  3S24 A;  5JJ7 A;  3K81 C;  4P72 A;  1S40 A;  2I5L X;  3NBH B;  3H3V I;  4B3T L;  2UUA L;  4A75 A;  4DV5 Q;  3SE5 A;  1L0W A;  2V1C C;  3J81 i;  2Q2H A;  2G03 A;  1FGU A;  2YYZ A;  4APV A;  3F1Z A;  4A3I G;  4JI2 L;  4UP8 A;  4BBS G;  1EWI A;  3IRB A;  4IFD J;  2A1A A;  5C0X G;  3HFZ B;  1NE3 A;  4UP7 A;  1S3O A;  1Y14 B;  5FLM H;  4A3I H;  3I4N G;  4IOC A;  5IYB G;  2NN6 G;  4R4Q A;  3I4N H;  1TWF H;  5JFF A;  1CUK A;  4IPH A;  1QZH A;  5J3B A;  1KRS A;  2K52 A;  3ZJY C;  3GTK H;  5LMN L;  4AYB E;  1VQE A;  4A3M H;  1L2F A;  4DV7 L;  1CSP A;  2ID0 A;  2Y0S G;  4IPD A;  3KJP A;  2B29 A;  4WJ4 A;  3GD7 A;  2B3G A;  1S72 A;  2CWA A;  2NZH A;  1QVG A;  4L5S A;  4GN3 B;  4U0U A;  5CMT A;  5M3M G; 
#chains in the Genus database with same CATH topology
 5C3E B;  1F2Y A;  1LTT D;  1YNJ D;  4JBM A;  4MTN A;  4PMW A;  5LL6 S;  3C46 A;  2K5N A;  1K3R A;  3SN9 A;  3KDF B;  4JI7 L;  1C4Q A;  4JI8 Q;  4TKO B;  1VQ4 A;  5BR8 Q;  2IL8 A;  2NVQ B;  2KHI A;  3GTJ H;  1IBM Q;  1B53 A;  1QVC A;  5JJI A;  3GTO B;  1F77 A;  2WAQ E;  2AQ1 B;  1PA6 A;  3CCQ A;  3PGZ A;  2AWN A;  1EEI D;  1A63 A;  1F9S A;  4FXD A;  2BOS A;  4A3E B;  1V1P A;  2BA0 A;  3OOC A;  4DUZ Q;  3RNU A;  3MEH A;  4C1N I;  4DAV A;  3HOU G;  2SDF A;  2RCF A;  1U0L A;  2F0M A;  2F0D A;  2L5T A;  4DV0 Q;  5IYC H;  3CHB D;  4C3H G;  3NUC A;  1TWF B;  1STB A;  3PF4 A;  1HRJ A;  2I07 B;  3URY A;  3F8T A;  3VYU A;  3GTK B;  3HZX A;  4A3M B;  1N36 L;  1Q46 A;  3G71 A;  4JI6 Q;  3FKI G;  1FJG Q;  5FO9 B;  3TZD A;  2VY3 A;  3FKI H;  4HCE A;  1TWH H;  1JB3 A;  5C44 H;  4DPG A;  3HOY G;  5KRU A;  3S2H H;  4HN7 A;  1WCM H;  3HOY H;  1BBU A;  1YHB A;  5I9O A;  4DV0 L;  4GNX C;  4YIJ A;  3SGI A;  3FMC A;  3CMA A;  4A3K B;  2UXB L;  3SK6 A;  1R9T B;  1D5Z C;  3PUV A;  4BY1 H;  4DK3 C;  2FXQ A;  3EN2 A;  1OXX K;  4QB4 A;  1SN8 A;  2Z9H A;  3ND9 A;  1V8Q A;  3S6A A;  3QWN A;  1I4H A;  4JI6 L;  1EQT A;  2YU9 B;  2F4V Q;  3F2U A;  1EY0 A;  1WVL A;  3A8K E;  2JA6 B;  3CCE A;  3U4Z A;  1ESR A;  2QF7 A;  2HDL A;  3P20 A;  3M7G A;  2EYP A;  4L5R C;  4OWX B;  3M4Y A;  1B9M A;  3UDX A;  1G2S A;  3DEO A;  3FP9 A;  4DV3 Q;  4XYQ A;  3CME A;  1HHV A;  3PIO A;  4POF A;  3KF6 B;  1EQV A;  2CQO A;  2ZXR A;  5HGQ A;  1LT3 D;  2DY8 A;  2KJX A;  2KUM A;  3BVZ A;  1FR3 A;  1W6K A;  4IJL A;  1VQM A;  3L2P A;  1NBW A;  2E8G A;  4QF4 A;  1VQ7 A;  1X3G A;  5CBA E;  4WRD A;  4DR7 Q;  5K36 G;  4OWT B;  3Q0A A;  4KKU A;  2K1B A;  2YV5 A;  3R2T A;  2HCI A;  2RQX A;  1SE4 A;  1XJV A;  4LF7 Q;  1K0R A;  1SDF A;  2JA9 A;  4GOP B;  3AQQ A;  1ESF A;  4PQX A;  2IPK D;  1H9S A;  4DV5 L;  3HOZ B;  2XRQ D;  4F87 A;  4DR7 L;  3M3Y H;  2E2I H;  2OEO A;  3RLF A;  5I9P A;  1E3P A;  1HJP A;  3PCO B;  1F2M A;  1BCP B;  4PV1 C;  2XWB B;  4LW1 A;  1KDB A;  1A0I A;  4G7H C;  5ELF A;  4LF7 L;  2R6G A;  2MHV A;  4X2C A;  5IP9 G;  2EYJ A;  1C7Y A;  4OWW B;  3NWT A;  4RCN A;  5JAV A;  1T9H A;  5IYD G;  1GUN A;  4IQZ A;  3AMU A;  5IYD H;  3K80 C;  3MTS A;  5E7N A;  1NJI C;  2DNE A;  3MXG A;  1TU2 B;  3FDT A;  1VQJ A;  4HCS A;  4FVM A;  1AW7 A;  1TS4 A;  4A3C G;  2A6H C;  1VQC A;  1VQN A;  5FLX c;  3PO3 B;  2BE5 C;  4X3U A;  2VW9 A;  4A3C H;  4LF5 Q;  4PY3 A;  1NR2 A;  1K9M C;  3NEL A;  4B3R L;  1DZ1 A;  1LLR D;  1H9R A;  4BBS B;  1UE1 A;  5FOB B;  3KF8 A;  1JQY D;  4XQN A;  3JC6 6;  2QEJ C;  4WGJ A;  2E2H B;  1T5E A;  1D5X C;  1F9P A;  1NH1 A;  3GTG H;  4JI3 Q;  1R4Q B;  2LMC B;  4N67 A;  4F88 A;  4DFA A;  1NR4 A;  4YY3 L;  4NDX A;  3GTP B;  1KQS A;  1JOR A;  4LF5 L;  3SK5 A;  1XMO Q;  2F0I A;  4B3S L;  3OIP A;  4V0B A;  1QWY A;  2B63 G;  3CCR A;  3NQI A;  5L37 A;  1IL2 A;  5A2Q E;  2B63 H;  4FF3 A;  4JI1 Q;  1JE5 A;  2TSS A;  5CV8 A;  1D8L A;  3G7L A;  5I2X A;  3GTJ B;  1FYC A;  1LUZ A;  5CBE E;  5IGB A;  2R3Z A;  1VQ6 A;  3KYH C;  1SFO B;  2K7V A;  1VQI A;  4KLK A;  1STG A;  4H13 C;  4K14 A;  2F0Q A;  4CKC A;  1XMO L;  1IW7 D;  3WDN A;  3FHW A;  5IY0 A;  3TEH B;  5BN3 A;  4OEM B;  3IFD A;  4M16 A;  2FMM A;  2K03 A;  3TQY A;  2K5Q A;  3CCU A;  1HR0 Q;  1SYG A;  2A6H D;  4JI1 L;  5I2Y A;  1FD7 D;  2BE5 D;  1G91 A;  3D6C A;  1LV9 A;  3T13 A;  2J7Z A;  1D1K A;  3HOU B;  2NVY H;  4DV4 Q;  4FXG C;  1XPR A;  3S14 B;  1II3 A;  3G6E A;  2K5H A;  4RMF A;  1WTH A;  1SYF A;  2IJ0 A;  2CH4 A;  2G9H D;  3W5O A;  1VQL A;  4C3H B;  3Q24 A;  1VQD A;  2GVA A;  2WAQ G;  1HR0 L;  3J81 j;  4ITR A;  2PMZ E;  1GXD C;  3KLW A;  3D4W A;  4PG3 A;  2H1E A;  2EXZ A;  4DV4 L;  4QY7 A;  1KXL A;  1MHW C;  3HS0 C;  2QIL A;  3N6R A;  2A73 B;  1G8Z D;  5C6A A;  1JCK B;  3PF5 A;  4IN3 A;  4DR5 L;  1X32 A;  4QJF A;  3GTQ H;  3S17 B;  3L3O C;  3W3A A;  2L9H A;  1SR3 A;  2XGT A;  1AE3 A;  5LMU Q;  1Y1W B;  2F0F A;  2HDM A;  3MFG A;  4L63 B;  5CV4 A;  1Y8P B;  2NUC A;  5AJ3 L;  1K28 A;  3STB C;  4R4I A;  3V05 A;  3E5S A;  1OXT A;  4HJA A;  2K4K A;  5M5W B;  3I7F A;  4BS9 A;  1SMY C;  3BU2 A;  5COY A;  1X3P A;  3CAM A;  1QB5 D;  1ZYR C;  2ZXO A;  1BCP F;  2A68 C;  2B2V C;  2CVR A;  3B6Y A;  1O7I A;  4TVA B;  3OSO A;  1JOO A;  1YEZ A;  4DGZ A;  5CKL A;  1QCB D;  1WTO A;  5LMU L;  2BH8 A;  1KAW A;  2ES2 A;  4HMJ A;  1MSG A;  2JSO A;  1KIX A;  3DM1 A;  1MSH A;  3GV3 A;  2ZM6 Q;  1VQA A;  1Q12 A;  2F0W A;  1AP0 A;  2N55 A;  5DAU A;  3I90 A;  3TME A;  2JQO A;  1JJ2 A;  2P5Z X;  3D3R A;  4LMQ D;  2MP1 A;  4KN7 C;  2CH4 W;  4JCV E;  1B3A A;  3U9O A;  5M5X B;  2PCF B;  3VYS A;  5M3F B;  1HA6 A;  1TWG H;  1AH9 A;  4JBK A;  2AWO A;  4KHP L;  5JJK A;  1QNK A;  4C2M B;  2ZM6 L;  3I8Z A;  1XNQ Q;  3R8B A;  3HG9 A;  1N33 Q;  3CW2 C;  2F0N A;  4ZCK A;  3TN2 A;  1WTX A;  1PH9 A;  4MNO A;  1EFI D;  4DV2 Q;  5NUC A;  2KEE A;  1E7Z A;  2WP8 J;  2HHH L;  4LWC A;  2L12 A;  3NEN A;  1GUS A;  3SEB A;  1KC8 C;  1VF5 C;  4PMC A;  3T1H L;  1SMY D;  2XNA C;  1BVS A;  5IGG A;  4EQO A;  1ZYR D;  2JA8 G;  2OTJ A;  2A68 D;  3ULJ A;  3SHL A;  2ATW A;  1D1I A;  1SNP A;  5J39 A;  1NMF A;  5JEA G;  2RF4 A;  2XSC A;  1G2T A;  5JEA H;  1MIU A;  3OHX C;  3F2B A;  2AKW B;  2CCZ A;  4DV2 L;  1DOM A;  1STA A;  2BDN A;  1B9N A;  2NVQ H;  2LSS A;  2F3I A;  4NXM Q;  2OWO A;  2EY6 A;  4OL7 A;  3GTO H;  1PFB A;  2EPB A;  1VQH A;  3I3C A;  5DM6 3;  3Q8D A;  4WOR A;  5EJW A;  4DU9 A;  4A3B B;  1LTB D;  5JEA J;  2LFN A;  3MHB A;  3GTG B;  1U5K A;  3T1Y Q;  1SE8 A;  4A3E H;  2EYO A;  2IWH A;  4XQJ A;  1HQM C;  2NTT A;  1FL0 A;  4JI0 Q;  4IPC A;  1X65 A;  1KLU D;  3K81 C;  2I5L X;  2UUA L;  4L6T B;  1Y8N B;  2B63 B;  2B2U C;  2YYZ A;  2F4I A;  3F1Z A;  3TSS A;  5FK9 C;  1EWI A;  2A1A A;  5C0X G;  5JOB A;  1NE3 A;  2F03 A;  4EQN A;  4IOC A;  5DNF A;  4KTA A;  1TWF H;  1D6E C;  2ZT9 C;  1KRS A;  3ZJY C;  2FJ2 A;  3GTK H;  2Q8I B;  5LMN L;  4A3M H;  1VQE A;  4DV7 L;  1Q8I A;  3JAM L;  1CHQ D;  4WJ4 A;  4FNF A;  1NUC A;  3T53 B;  5J22 A;  2CWA A;  2NZH A;  1NCV A;  4GN3 B;  4CDF C;  5CMT A;  3C1E A;  2K05 A;  5ELD A;  1L1O A;  5C0X J;  3H15 A;  5EKK A;  4Q5V A;  4PNY A;  2XRS D;  2SEB D;  4A3K H;  4CGY B;  1R9T H;  5JJL A;  2PNH A;  4RA8 A;  5ELC A;  3BZK A;  1M4V A;  1I4X A;  1S5F D;  2B2T A;  2YU9 H;  2HD3 A;  4ME3 A;  5FJ8 G;  5EPL A;  3HEJ A;  2JA6 H;  1DYQ A;  3EQL C;  3K0Y A;  4FF2 A;  2IX0 A;  2VZA A;  2Z6K A;  3IL8 A;  2K04 A;  1HNW Q;  2WAQ B;  1TS3 A;  1PH1 A;  2X69 A;  2BDO A;  3VR2 A;  4CKE A;  2KHJ A;  1PRT B;  1ET9 A;  3RLN A;  1IBL Q;  1O78 A;  2K28 A;  2I5H A;  4DAY A;  4F8M A;  3U9S A;  2N78 A;  1CZG A;  4DR4 Q;  1HNW L;  2IY5 B;  4Y52 H;  4K5X A;  3TRZ A;  4BXX H;  1PZJ D;  4TSS A;  2PYK A;  1Q7Y C;  1JWM D;  4XT1 B;  1I4G A;  3HGB A;  1RL2 A;  4IUN A;  1VMC A;  3I4M G;  1EY7 A;  3HOV G;  4DF7 A;  1IBL L;  1SND A;  1SEB D;  3J80 E;  3HOV H;  4E6I A;  3UE0 A;  3HOZ G;  5IGC A;  3DHQ A;  1FNU A;  3PUY A;  3HOZ H;  3P1H A;  1EY8 A;  4DR4 L;  5ELN A;  4NXN L;  2JXM B;  1HA5 A;  1SYD A;  2JEA I;  4N8F A;  1QOH A;  3LGJ A;  2NWG A;  1VQ9 A;  3A8J E;  3I70 A;  2R93 G;  4AIM A;  1LT5 D;  4J8Q A;  4WFN 3;  4DNI A;  1MBY A;  2UUC Q;  4NMZ A;  1N34 Q;  3MAQ A;  4HIM A;  2C9O A;  2D0O A;  2F6S A;  2WB1 E;  2Z4H A;  4P2C B;  2OQ0 A;  3HRZ C;  2JYO A;  1TY0 A;  1BCP C;  3SVM A;  1WTQ A;  4LU4 A;  1AEX A;  4EVO A;  4N9P A;  3VA5 A;  3KOJ A;  4PZ6 A;  2PQE A;  1ENC A;  3SHG A;  3TP7 A;  5FKA C;  5A35 A;  1FVI A;  4C3J G;  2PW7 A;  2KEC A;  1X54 A;  3PO3 H;  5IGF A;  4C3J H;  3D6W A;  2UUC L;  4FP5 D;  1K3B C;  1B3Q A;  1RD9 D;  1N34 L;  1NY4 A;  2D0P A;  3WOF A;  1PH6 A;  5EQ0 A;  3SE0 A;  1A8V A;  1JR0 D;  4P73 A;  1SNQ A;  1C0A A;  1TY2 A;  4BBS H;  3KLS X;  4MN3 A;  1PH7 A;  3AEV A;  2VB2 X;  5IYB H;  2E2H H;  2EZV A;  4LNQ A;  4LFB L;  3SXH A;  4DAM A;  4U0S A;  4HJ9 A;  1Q1B A;  2Z8L A;  4UAI A;  1TS2 A;  2DUD A;  4JK1 C;  4RHR A;  3E6Z X;  2F3V A;  3GTP H;  3U4V A;  5ELO A;  2WIN B;  2K5D A;  3BZC A;  4JI4 Q;  2ASB A;  2NVX B;  2JA8 B;  1H9M A;  2L15 A;  1E1T A;  2B2Y A;  1IBK Q;  1TS5 A;  1PH4 A;  2PI2 A;  2CQA A;  1HFN A;  1E0B A;  4DA2 A;  4R1J A;  2KCT A;  2XIW A;  4LK1 C;  3K57 A;  3EA6 A;  1UAP A;  1UUP A;  2XTI A;  4UP9 A;  1JWS D;  2RHQ B;  4DKA C;  5IGD A;  1SFO H;  2O5I C;  2L0C A;  2NUN A;  1BCP D;  3H94 A;  4J1M A;  2B2V A;  3I91 A;  2VNU D;  4RGM A;  5G3L F;  5M9O A;  5F2D A;  1BF4 A;  2Z6B A;  2N3S A;  5C4H A;  4JI8 L;  1EFW A;  4JI5 Q;  1R4P B;  5BR8 L;  3CQZ B;  1IBM L;  5IE8 A;  1E2V A;  4IJH A;  3H0G G;  3HOU H;  1CI3 M;  4KI0 A;  3S14 H;  3VR4 A;  2BCO A;  3S2D B;  1IYV A;  3KK7 A;  3MXU A;  3ULP A;  3SK8 A;  2I0Q A;  4DK1 A;  5CR3 A;  1VQB A;  1HR0 W;  2Y0S E;  1UE7 A;  1L0X B;  4NP5 A;  4C3H H;  4DUZ L;  3RD4 A;  1PRT F;  3PSI A;  2NZ1 D;  1XYI A;  5HY6 A;  1GUT A;  3ICE A;  4GN4 B;  3S1N B;  1YVC A;  2R7Z B;  3I4O A;  2XVS A;  1QUQ B;  2J4X A;  1LTR D;  5C0X I;  2A19 A;  1EYD A;  3ZYY X;  3KJO A;  5JJZ A;  2ZJQ A;  1QNU A;  1N32 Q;  4OX9 Q;  2PQA B;  1PHJ A;  3NBH A;  2LXJ A;  3RZO B;  3S17 H;  1MJE A;  4LF4 Q;  4JYA Q;  2UU9 Q;  3DMU A;  1FJG L;  3J80 i;  1Y1W G;  1JJG A;  4GZY C;  3GTL B;  2ZTC A;  1Y1W H;  1XWE A;  3F2D A;  1SJH D;  3EVQ A;  1EL0 A;  1V1O A;  2JEB I;  2NZO A;  3CCJ A;  5M5W H;  5I6Y A;  4IZ8 A;  1XTC D;  3KBX A;  3DWA A;  2K5W A;  1XMQ Q;  4I65 A;  1IKM A;  5DLQ E;  4RKL A;  4OX9 L;  3FPU B;  1VDZ A;  2L4N A;  3KF8 B;  3PIP A;  1SSO A;  1S5E D;  3K7U C;  2F4V L;  2UU9 L;  2WII B;  1A62 A;  4A76 A;  4KV6 A;  1I50 B;  4B3T Q;  3LX0 A;  4DNT B;  5BN5 A;  2WKD A;  1TWA B;  1D2B A;  1E1O A;  4IUQ A;  2RDF A;  3QJY A;  4X6A H;  5K36 H;  4BWG B;  4JOI C;  1YHQ A;  4DV3 L;  1W2B A;  4LUO A;  2E75 C;  1PYB A;  1EQR A;  3I4M B;  1G6Z A;  2PMZ B;  3HOV B;  5M3F G;  1G29 1;  3VR6 A;  2D5D A;  5JJ6 A;  3KBG A;  4DNR B;  5M5X H;  5M3F H;  1TVX A;  4EGV A;  4TRD A;  4C2M H;  2SNM A;  2BH2 A;  5I4D A;  1KNA A;  4UHV A;  4B9X A;  1KDA A;  4I7Z C;  3CCV A;  2R93 B;  2A5H A;  1EU3 A;  2M9V A;  4OO1 G;  4X2D A;  1Q86 C;  1BBW A;  3NP8 A;  5IP9 H;  2F0H A;  2R92 G;  4LAA A;  1WTP A;  2Q8R E;  3K59 A;  1IW7 C;  3H6M A;  3JAM c;  5T1I A;  3VYT A;  3AU7 A;  4YHH Q;  2HUG A;  4LF9 Q;  3U58 A;  4K2L A;  4C3J B;  4IAL A;  4L5Q A;  2OQK A;  1PMR A;  1PTO F;  4DK6 C;  2EIF A;  5JFZ A;  5HGT A;  1YIJ A;  1QZG A;  2E5L Q;  4XTC S;  3JAM E;  3A5Z B;  3E9H A;  3PQI A;  2O5J C;  1HCZ A;  1LTL A;  4A3B G;  2WV6 D;  3UE1 A;  4A3B H;  3MEF A;  5FLX E;  4G7O C;  1EYC A;  2PZU A;  4LF9 L;  3T4A C;  5IT9 L;  1V43 A;  1AZQ A;  4QUC A;  5ELE A;  3M4Q A;  2MNA A;  1A3V A;  3KFU A;  3MWY W;  2F0U A;  2JA5 B;  1BUV T;  1DOK A;  2B2W C;  5IOC A;  1RKN A;  2IW3 A;  3PV0 A;  2E5L L;  2EDG A;  4JBW A;  4U0Z A;  2RSO A;  3A54 A;  2C5C A;  4EQ5 A;  3G4S A;  1UE5 A;  1K8G A;  3UDI A;  4F7X A;  4WJW A;  2RCN A;  5LMN W;  1S4Z A;  4JI3 L;  1T5X D;  3CUC A;  4X3T A;  3QG1 A;  1Y8O B;  3ITP A;  2NUD A;  4HJ7 A;  3WWV A;  1VF7 A;  3I73 A;  3FPP A;  3W2D A;  1ONL A;  4GOP A;  3MA2 B;  4IOA A;  1IXR A;  5LL6 X;  4M8A A;  3GV6 A;  4ZK9 B;  5HUR A;  1ML0 D;  1VQP A;  5JVH 3;  3H0G B;  3R2I A;  2VL6 A;  4A3G B;  3MVV A;  3BS1 A;  1ASY A;  4NKL A;  3BYY B;  3S15 B;  4JI2 Q;  1BXT A;  1CKN A;  2QKI C;  1LTG D;  3H91 A;  4MHE A;  4PZ8 A;  4U68 A;  1VQO A;  1J6Q A;  5CV6 A;  1ZKO A;  4K0K Q;  5TSS A;  2RDH A;  4LUZ A;  1CZW A;  1NSN S;  1LO5 D;  1Z6H A;  3H3V I;  3SE5 A;  1FGU A;  2KOL A;  3J7Y W;  4JI2 L;  4UP7 A;  3OMC A;  4IUT A;  1B50 A;  4K8I A;  1CUK A;  1I3Q B;  5KEE A;  1QZH A;  1PRT C;  3K5L A;  4A93 B;  4AYB E;  2Y0S G;  2ID0 A;  4JPB W;  1S72 A;  4L5S A;  1A3U A;  5M3M G;  4C3I B;  3EBE A;  1GO3 E;  1W6J A;  2E74 C;  2PPB C;  4U67 3;  1STE A;  3DLL A;  4A3L G;  1U4L A;  2V4D A;  3K5N A;  5LHY 1;  1VMP A;  3LET A;  4G7Z C;  1C8C A;  3TRE A;  1EUJ A;  3HOW B;  5G3L D;  3TP6 A;  2I5M X;  3QB3 A;  4A3D G;  1PZK D;  2K14 A;  1KHI A;  3KUP A;  2KQ3 A;  1PH3 A;  3ZCB A;  4J6H A;  5GAD C;  2EJF C;  1S5B D;  1SYE A;  1HFG A;  5D3D A;  1TR5 A;  1WFQ A;  3OMG A;  5CGL A;  3NPP A;  3JAM i;  3NK9 A;  5EU0 A;  3GO5 A;  4DK0 A;  1H9J A;  1E2W A;  5ELB A;  4BY7 G;  3ERQ A;  4AQY Q;  1EIF A;  1V9P A;  1PRT D;  5IIF A;  5JVG 3;  2C35 B;  1CA6 A;  4X3S A;  4LFA Q;  1CHP D;  3Q23 A;  4EQP A;  1HZB A;  3HKZ E;  1MD2 D;  1L1O B;  5KND A;  1BOS A;  1C9O A;  5C5L A;  1HNZ Q;  2NYZ D;  1FNW A;  3ULL A;  2RVL A;  4KK7 A;  1KNE A;  4JW0 A;  1AZP A;  1GD7 A;  4FDB A;  2FFK B;  4X66 Q;  5KGU A;  2R92 B;  4GNX A;  2GA4 B;  4RKB A;  3M4P A;  5D3I B;  1XNQ L;  2NVX H;  4CDD C;  1N33 L;  2DJG C;  2JA8 H;  3OYY A;  5M5Y B;  5JPN C;  3I56 A;  1QE6 A;  2NN6 I;  1SLJ A;  1XNR Q;  3TS0 A;  4U07 A;  5K5P A;  1HNZ L;  3K6O A;  4QMG A;  4GKJ Q;  5EPK A;  4OO1 I;  3I4L A;  1S5D D;  1SAP A;  1KD1 C;  2LXK A;  4ZUJ A;  1P16 A;  4X66 L;  4BBR B;  1WYD A;  4H7B A;  1DOL A;  2JE6 I;  3AYH B;  3M4O B;  2JJQ A;  2CWP A;  3NE5 B;  1CT1 D;  1WTW A;  3D0F A;  3M85 A;  2WB1 B;  3CC2 A;  2LY7 A;  4V19 0;  4POG A;  2JN4 A;  4NB3 A;  2HIX A;  1RTO A;  3TBI B;  3CQZ H;  1QVF A;  2IX3 A;  5EPJ A;  2J0T D;  4LUV A;  4NXM L;  3VYR A;  2SNS A;  1JT8 A;  3DUZ A;  2A6E C;  1HNX Q;  1SRO A;  3S2D H;  4JOI A;  1RCV D;  1LYL A;  2L55 A;  1GHJ A;  5C0X H;  1B8A A;  2LS0 1;  3T1Y L;  1DM0 B;  2K6A A;  3RZD B;  3NTK A;  4JI0 L;  3NBI A;  1F9R A;  1DJR D;  1GVP A;  1SNO A;  2R61 A;  2R7Z G;  3S1N H;  1K83 B;  2PZT A;  5EAY A;  1Q82 C;  2B8G A;  1LTA D;  2R7Z H;  1A3T A;  2E2D C;  2DNC A;  1RDP D;  1HNX L;  3P75 A;  4Y7N H;  1WI5 A;  1I94 Q;  5C4X G;  1AN8 A;  5IWA Q;  5EBD A;  5EKL A;  4RH6 A;  4X65 Q;  3VA7 A;  3RZO H;  1EIY B;  4IPG A;  5I6W A;  1X55 A;  3VDY A;  4JBJ A;  1YIT A;  1P8L A;  5FJ8 H;  1PH2 A;  3VR5 A;  3GTL H;  4LF8 Q;  3MXN A;  1TT2 A;  1ET6 A;  3K8A A;  2MUY A;  2YTY A;  1A15 A;  1E22 A;  4YWM A;  4QGU A;  3G48 A;  3QOL A;  1PTO D;  4XI8 A;  2DN8 A;  1G6P A;  5DM7 3;  2HCC A;  4X65 L;  4GS3 A;  2JK8 A;  3D4D A;  5T1G A;  3BDC A;  4P75 A;  2A6E D;  5KYL A;  1EZ8 A;  1TII D;  4ODG A;  1I50 H;  1B70 B;  3EJI A;  5IOD A;  3KLS A;  1TWA H;  1EWH A;  1SE2 A;  5GRO A;  4KN4 C;  2F52 A;  1ICW A;  1TQO A;  3X3M A;  1JWU D;  1OXU A;  2PW5 A;  1WJJ A;  2Y0S B;  4BA1 I;  4DUY Q;  3I4M H;  1SE3 A;  5IP7 G;  2M00 A;  3W1G A;  5M3M B;  1SBB B;  4PMB A;  1UEB A;  5IP7 H;  1EY6 A;  3ZLM A;  2R7D A;  5IT9 c;  4U0U A;  4G57 A;  1JE4 A;  2VB3 X;  4ABN A;  3MC0 B;  3EIV A;  3NHH A;  3BJU A;  1PFS A;  4GKK Q;  1VS0 A;  4CJ2 C;  2R93 H;  1V1P B;  1VQF A;  1F2Z A;  4Q0F A;  5IT9 E;  1VQ8 A;  3PO2 B;  1L0Y B;  4AYB G;  2RA4 A;  1X3Q A;  4YWL A;  3OWF A;  3BYT B;  3L9A X;  1JB7 A;  2F0G A;  3PIO 3;  1I4P A;  4A3D B;  1I5F A;  3DWQ A;  4DXF A;  3PIP 3;  4XQQ A;  3OTO Q;  1O7Y A;  1LT6 D;  3R3O A;  4DR3 Q;  2EYL A;  5KNB A;  1M8A A;  1IZ6 A;  4FF4 A;  2PZW A;  3NQT A;  2HT1 A;  4BY7 B;  3G6J B;  2HQL A;  4KHZ A;  4ULL A;  2MFI A;  3DXJ C;  3NWS A;  3BZD B;  4HAE A;  4A3F G;  2Q2T A;  2VUM G;  2B39 A;  1GUW A;  4HTH A;  3CCM A;  5KYI A;  3A55 A;  3OTO L;  3ER0 A;  1BKB A;  4KKS A;  4QIW E;  5J1Z A;  1E2Z A;  4C1N K;  3PUW A;  3A5U A;  3E3X A;  4B3M Q;  4L8J A;  1AFP A;  2FMC A;  1HUM A;  3BDL A;  1QJO A;  4DR3 L;  3LNN A;  2EVB A;  3F2C A;  1NMG A;  2JA5 G;  3C3L A;  2FIN B;  2F0E A;  5CGK A;  1YJN A;  2JA5 H;  5D14 A;  2AHO B;  2EQS A;  3AFQ A;  3PUX A;  2EYH A;  5FLM G;  2EJG C;  2QGQ A;  2JA7 B;  3K5M A;  4N9T A;  4DXG A;  4JI7 Q;  4R8I A;  1UE6 A;  2NVT B;  1XTD A;  3ONA B;  1K8A C;  2OTL A;  4JVZ A;  1LTS D;  3E0E A;  4B3M L;  2CW0 C;  3MFY A;  2CFM A;  2ICE C;  2K33 A;  1HH2 P;  1X9N A;  3BG3 A;  1AE2 A;  4KD3 A;  3SR1 A;  1VQK A;  2K50 A;  3HKZ G;  1PTO B;  4ZAI A;  4JI4 L;  3HOX G;  1IBK L;  3N3U A;  4CHT B;  4U04 A;  3HOX H;  2M2L A;  1RTN A;  2SOB A;  2OF1 A;  3K7A B;  3CC7 A;  3S16 B;  2X6L A;  1A2U A;  4HSP A;  2NTS A;  2AUK A;  1JOQ A;  4OON A;  1LTI D;  1RIP A;  2N88 A;  1Y69 U;  3S1R H;  4A3G G;  1M90 C;  4ALP A;  2F3W A;  3H3V H;  1I4Q A;  3H0G H;  1I4R A;  3S1M B;  5CV9 A;  4A3G H;  2JP1 A;  1B4O A;  2KCN A;  3S15 H;  2VQF Q;  2D62 A;  2PI2 E;  2EYF A;  1CA5 A;  1SRU A;  3MXP A;  1N36 Q;  1H9S B;  2AUJ D;  4ZKC B;  4QCL A;  3H3V C;  4UPA A;  4JI5 L;  2KEN A;  4P74 A;  4A3J B;  4XXE A;  1B7Y B;  4QL5 A;  2KHS A;  4GLX A;  1PV4 A;  2MPM A;  4LJZ C;  2LKV A;  5IYC G;  4O2D A;  4Y7N B;  5C4X B;  2UXB Q;  1V1Q A;  3MZ5 A;  3A7L A;  5AFW A;  1KL9 A;  2VQF L;  1JOK A;  2N49 A;  2VQE Q;  1SYB A;  1PXU A;  2CW0 D;  3FVQ A;  2MQH A;  1TWC B;  1I3Q H;  2GVB A;  4R8N A;  3T56 B;  4A93 G;  4MIU A;  4OXP A;  4A93 H;  3GDE A;  5C44 G;  1NNX A;  2F0P A;  3WOE A;  3J81 L;  1K8O A;  2DY7 A;  1WCM G;  4YWK A;  1W3S A;  5E1F A;  5C4J B;  1Y1V B;  3SK4 A;  1YZ6 A;  4C3I G;  2F0T A;  2MGS A;  3V2T A;  1I6V C;  4C3I H;  4BY1 G;  1IHZ A;  3AFP A;  4FO2 A;  1I6H H;  3TS2 A;  5DEH A;  3CF5 A;  3RR5 A;  2VQE L;  3S1Q B;  1N32 L;  4NPS A;  2QCP X;  4CKB A;  1K73 C;  2KVM A;  4LF4 L;  4K8J A;  4JYA L;  2XWJ B;  5CYU A;  1EU4 A;  4B9W A;  3KDF A;  1JIC A;  1XXG A;  3HOW G;  1Z7T A;  4J15 A;  1EYA A;  3HOW H;  4RFB A;  3I72 A;  3BDO A;  5EKI A;  1XMQ L;  4GLV B;  1OXS C;  1X3E A;  4JC0 A;  2PNR C;  4S3S A;  5CV5 A;  1CK1 A;  4FYD A;  1CM9 A;  2OCE A;  4OGQ C;  3S24 A;  5JJ7 A;  1S40 A;  1JC7 A;  2B2U A;  2EY1 A;  4HSV A;  4A75 A;  4DV5 Q;  4KKT A;  4B3T L;  1L0W A;  2E2J B;  3LWU A;  2Q2H A;  4APV A;  4A3I G;  2F0K A;  4UP8 A;  4IUR A;  4A3I H;  1FNV A;  1S3O A;  5EBC A;  5C3X A;  2WAC A;  4CJ0 B;  2NN6 G;  4R4Q A;  3C2P A;  5JFF A;  4ILW A;  4IPH A;  1CQV A;  2NN6 H;  1A6X A;  5C3W A;  4QUF A;  1L2F A;  3D8G A;  1CSP A;  4IPD A;  3GD7 A;  4OO1 H;  3NTI A;  4AYB B;  2K32 A;  4EX5 A;  2ZTD A;  3VR3 A;  2R92 H;  2EY2 A;  1Z47 A;  3M9B A;  1L1O C;  3P7J A;  4XDX A;  3CPW A;  1RF2 D;  2AQ2 B;  2QDL A;  1CKN B;  5M5Y H;  3PMF A;  2IHE A;  4H44 C;  4XT3 B;  1QUQ A;  2WFW A;  4H0L C;  4WJ3 M;  1LAC A;  3U50 C;  1SYC A;  1N8R C;  4B3R Q;  2B2T C;  1HXY D;  2PQA A;  4BBR G;  1SNC A;  4HJ5 A;  4BBR H;  5GAE C;  4Z9C B;  1GUO A;  2KCM A;  1PLF A;  2Z6K C;  4A3F B;  5ISR A;  2VUM B;  3GTM B;  1H9K A;  3M4O H;  1TKW B;  1FGB D;  4YCW A;  2WB1 G;  4YHH L;  3V96 A;  1VQG A;  1RHP A;  1STN A;  3J80 L;  4IUP A;  1EQQ A;  2ENB A;  4YY3 Q;  1NTG A;  1KDC A;  1Z9F A;  5EGT A;  2PO4 A;  4IO9 A;  3FEW X;  4B3S Q;  2EXD A;  2G5D A;  1SNM A;  3KF6 A;  2F0S A;  4JV5 Q;  1GUG A;  1J8I A;  3A8I E;  4IFD I;  3I4N B;  4UDU C;  3SDZ A;  3L0O A;  4PZ7 A;  4RG1 A;  5FO8 B;  3E0J A;  2AMC B;  4CDE C;  1HTP A;  3ZC7 A;  1WD0 A;  5IGE A;  3FRP B;  5CMD A;  2ZTE A;  3RZD H;  3HKZ B;  2E76 C;  2I46 A;  5GAH C;  1MGS A;  3A56 A;  1MJC A;  1QG7 A;  1K83 H;  3HOX B;  3W1B A;  2A8V A;  5E3F A;  4JV5 L;  4ZRZ A;  4DR6 Q;  1YBY A;  3RUZ A;  4AH6 A;  3CCS A;  1VCI A;  3BVG A;  1HZA A;  2F0O A;  1M1K C;  1MKH A;  4IUV A;  3LWE A;  3OPO A;  3A0J A;  4MZ9 A;  5FO7 B;  3S1R B;  4JG2 A;  3PUZ A;  5D65 A;  1EIH A;  1ICF B;  3UI2 A;  3J7A F;  3DM3 A;  2QA4 A;  1CQF A;  2TMP A;  2QEX A;  1GJX A;  3J7A 5;  4DR6 L;  3ERO A;  1YNX A;  1PFN A;  2Z1C A;  1B1Z A;  4OIJ A;  1O7Z A;  3GQB A;  5GAG C;  3DEP A;  1U9R A;  1YJW A;  1X56 A;  4N8X 1;  3NEM A;  2Q2I A;  4KY5 A;  3D31 A;  2KBN A;  3QR8 A;  4LF6 Q;  2MJ8 A;  4QQB X;  2UXD Q;  4H02 A;  3NTH A;  1ILQ A;  3CKI B;  3D4R A;  3E9I A;  2ALY B;  4DR5 Q;  2RBM A;  4IUU A;  3UDF A;  4DR1 Q;  3RN5 A;  1ZEQ X;  4GNX B;  3QOJ A;  4K2K A;  4GLA C;  3OW2 A;  1OXV A;  2B8F A;  3K5O A;  3FKI B;  1TWH B;  1WTR A;  4K0K L;  4LF6 L;  2MO0 A;  5AJ3 Q;  5C44 B;  1GHK A;  1U4P A;  3K0X A;  3S2H B;  1CTM A;  1WCM B;  2UXD L;  3J7Z C;  3HOY B;  1IL8 A;  2ZJP A;  4R4T A;  1BR9 A;  5M3M H;  2FHT A;  1HUN A;  1I6H B;  2B2Y C;  4BY1 B;  1EY5 A;  1N9W A;  4DR1 L;  3EFX D;  1PYW D;  5GQO A;  1PH5 A;  4M1U B;  1CKO A;  1OO9 B;  2HQE A;  4RGO S;  1IYU A;  2K5V A;  4RHS A;  4BA2 I;  4ZLT F;  5KIX A;  1DGS A;  2UUB Q;  1QIL A;  4A3L H;  1GOZ A;  1KRT A;  1JJC B;  3T16 A;  4DV6 Q;  3TP8 A;  3PO2 G;  2UXC Q;  3TDQ A;  2OXP A;  3PO2 H;  1Q3L A;  3L7Z C;  4CBV A;  1A2T A;  2H5X A;  1EZ6 A;  1YI2 A;  4XIG S;  4K6D A;  4A3D H;  4KY6 A;  3HP3 A;  2H4O A;  1EOV A;  2F0V A;  3NXW A;  1D7Q A;  5C5M A;  1EIG A;  4A4I A;  3IAY A;  1WTV A;  3CP0 A;  3I55 A;  2UUB L;  1YHA A;  4KHP Q;  3CCL A;  4DV6 L;  4BY7 H;  4A3I B;  2UXC L;  1HZ9 A;  1STY A;  1Q1E A;  1CSQ A;  3NSW A;  1DD2 A;  1S5C D;  2N8N A;  4HR7 B;  4ZQ3 A;  2HHH Q;  4L5T A;  2EJM A;  4O0A A;  1ZXT A;  1G51 A;  4K5V A;  2RDG A;  4LFC Q;  2Z0S A;  3TZU A;  3T1H Q;  3UDG A;  1XPU A;  3N52 A;  4X64 Q;  2YTV A;  4HID A;  5KNC A;  1ENF A;  4O42 A;  3M3Y B;  2E2I B;  1DCZ A;  4DV1 Q;  1PFM A;  1EY4 A;  1VQ5 A;  2K01 A;  2JA7 G;  1GKH A;  1MI2 A;  4AQY L;  1JMC A;  4XYO A;  2JA7 H;  4YCU A;  3K58 A;  4UY8 C;  3MXN B;  1YNN C;  4B08 A;  4LFA L;  2NVT H;  4CDC C;  3STB D;  4DR2 Q;  4LFC L;  3CC4 A;  2QDB A;  4ZUI A;  4X64 L;  1BBX C;  2G9D A;  5C3E G;  1PTO H;  4R9W A;  2Z4I A;  5C3E H;  4DV1 L;  5E4W C;  1ASZ A;  2WKC A;  3QO2 A;  1CKM A;  3GP7 A;  3BVM A;  3J81 c;  1DXM A;  4DAY B;  1LAB A;  2GN5 A;  1J9O A;  3K7A H;  3C1F A;  3S16 H;  1O7L A;  1XNR L;  1PTO C;  1J5E Q;  4GKJ L;  4R4C A;  4DR2 L;  4X62 Q;  2UUA Q;  2A74 C;  3S1M H;  1PH8 A;  3A74 A;  1IYJ B;  3J81 E;  1U4R A;  4A3E G;  1B44 D;  1D5M C;  3CPF A;  2KA7 A;  3RN2 A;  4ID6 A;  5LMN Q;  4DV7 Q;  4OHJ A;  1H95 A;  4C56 C;  2R7F A;  1C48 A;  1J5E L;  5E4X A;  4A3J G;  2A69 C;  4QIW B;  2BA1 A;  3Q6S A;  2D2C C;  4RCO A;  4X62 L;  4A3J H;  2NBF A;  4X3K A;  3IKJ A;  4OIK A;  1KLG D;  3OW7 A;  2QW7 A;  1U4M A;  1X6O A;  1YNN D;  3I2Z A;  2XN9 C;  2VXW A;  2K75 A;  5C4X H;  4HJ8 A;  3M7N A;  1K8M A;  4A3M G;  2EY5 A;  2AQ3 B;  4KJO A;  4K6L A;  1TWC H;  4YCV A;  4R4O A;  1UEA B;  5COR A;  3X3N A;  3TP5 A;  3OIQ A;  3KLR A;  5H1S E;  4KY7 A;  4DN4 M;  5FLX L;  2F1M A;  1X3F A;  3A7A B;  1PZI D;  1Y1V G;  3ND8 A;  2L1B A;  4CJ1 B;  5C4J H;  1DON A;  1Y1V H;  1BO0 A;  1I94 L;  4A3K G;  1BQQ T;  1PYS B;  5IWA L;  4HMI A;  4RGN A;  2D9U A;  2NVY B;  2OT2 A;  3S1Q H;  4MTK A;  2JA6 G;  5A2Q L;  5BN4 A;  1OTC A;  1KAA A;  2VS1 A;  1PDQ A;  2L11 A;  2KED A;  5JPM C;  4KHV A;  4LF8 L;  1IKL A;  1NAP A;  2HIV A;  5CC4 A;  2ZJR A;  1KAB A;  3CU7 A;  1WD1 A;  4KMU C;  2ZXP A;  1YJ9 A;  2ICI A;  4GN5 A;  2A69 D;  1HPC A;  1B2T A;  2YTX A;  4NW2 A;  2B2W A;  1XX8 A;  1HQR D;  2F0J A;  3IFT A;  4TQU S;  4ZYS A;  4OEL B;  1K0S A;  4RAU C;  4ZKB B;  2IX1 A;  3J80 c;  2E2J H;  2DJF C;  3GTQ B;  4X2E A;  4NXN Q;  3CRK C;  4BXX G;  3Q22 A;  2X6G A;  1UWV A;  2EOT A;  3CRL C;  3CXC A;  3RMH A;  3OWE B;  2IHF A;  4HIO A;  1KTK A;  2O2L D;  3R93 A;  3RLO A;  1PVO A;  1STH A;  2F0L A;  1SJE D;  2NB0 A;  1EWC A;  2IT1 A;  4DUY L;  1EOT A;  2KCC A;  4KD4 A;  5C4Z A;  1Q81 C;  4FF1 A;  1F2L A;  1HZC A;  1ENA A;  1SMX A;  1BNZ A;  1Q90 A;  3ERS X;  4RWS C;  3O13 A;  1TXY A;  4I7A A;  1YNJ C;  1SXT A;  1CFM A;  4GOP C;  2RSN A;  1EYG A;  2DGY A;  2CKZ B;  4GKK L;  2RKS A;  4P71 A;  1F9Q A;  1EEF D;  1LT4 D;  2Q2U A;  2O4X A;  4HED A;  3QIA A;  1XPO A;  3HKS A;  3CD6 A;  4IFD G;  3AB9 A;  3H09 A;  4HIK A;  4IFD H;  1E24 A;  1Q8K A;  1GM5 A;  3DWP A;  2Q8T A;  4RGT A;  2EYM A;  2MO1 A;  4A3F H;  2VUM H;  3GTM H;  4LFB Q;  3J7A V;  3PO3 G;  4O1N A;  5CV7 A;  3S9W A;  1ROD A;  1LM0 A;  1RJT A;  1TWG B;  1ILP A;  1WOC A;  2CHB D;  4P72 A;  3NBH B;  3T51 B;  2V1C C;  3J81 i;  2G03 A;  1UNS A;  1BDO A;  4IFD J;  4BBS G;  3IRB A;  3HFZ B;  5FLM H;  1Y14 B;  3I4N G;  4K5W A;  5IYB G;  4ME5 A;  3I4N H;  4DAP A;  5J3B A;  2K52 A;  4FXK C;  4KJN A;  1EY9 A;  3KJP A;  1HTL D;  2B29 A;  2B3G A;  1QVG A;  2EE1 A;  4G4K A;  2RHS B;  1O80 A; 
#chains in the Genus database with same CATH homology
 4EX5 A;  2ZTD A;  1L1O A;  4JBM A;  2R92 H;  4MTN A;  4PMW A;  5C0X J;  1Z47 A;  3M9B A;  1L1O C;  1GO3 E;  3EBE A;  3H15 A;  2K5N A;  1K3R A;  3CPW A;  3SN9 A;  3KDF B;  4JI7 L;  4JI8 Q;  4A3K H;  1VQ4 A;  1CKN B;  5M5Y H;  1R9T H;  5BR8 Q;  5JJL A;  2IHE A;  2KHI A;  3GTJ H;  2PNH A;  1QUQ A;  2WFW A;  1IBM Q;  3BZK A;  1QVC A;  3DLL A;  4A3L G;  4WJ3 M;  3U50 C;  2YU9 H;  4ME3 A;  5FJ8 G;  1N8R C;  2JA6 H;  5JJI A;  4B3R Q;  3LET A;  2WAQ E;  1PA6 A;  3TRE A;  1EUJ A;  2VZA A;  2IX0 A;  2AWN A;  2PQA A;  3PGZ A;  4BBR G;  3CCQ A;  4HJ5 A;  1A63 A;  2Z6K A;  1HNW Q;  4BBR H;  5GAE C;  2I5M X;  2KCM A;  2BA0 A;  2Z6K C;  4A3D G;  2K14 A;  1KHI A;  4DUZ Q;  3M4O H;  1PH1 A;  4YCW A;  4YHH L;  3RNU A;  2WB1 G;  1PH3 A;  1VQG A;  3ZCB A;  5GAD C;  1EQQ A;  4YY3 Q;  1NTG A;  2KHJ A;  3HOU G;  1WFQ A;  5CGL A;  1Z9F A;  3RLN A;  3JAM i;  1IBL Q;  4IO9 A;  1U0L A;  5EU0 A;  3GO5 A;  4B3S Q;  2EXD A;  4BY7 G;  3KF6 A;  2I5H A;  4JV5 Q;  4DV0 Q;  5IYC H;  2N78 A;  4DR4 Q;  4IFD I;  4AQY Q;  1EIF A;  1HNW L;  1V9P A;  3PF4 A;  2IY5 B;  3L0O A;  4Y52 H;  4PZ7 A;  4RG1 A;  3TRZ A;  3F8T A;  2C35 B;  4BXX H;  4LFA Q;  2AMC B;  1HZB A;  1Q46 A;  3HKZ E;  1N36 L;  3G71 A;  1L1O B;  1Q7Y C;  1HNZ Q;  4JI6 Q;  1C9O A;  3FKI G;  1FJG Q;  1RL2 A;  3ZC7 A;  3ULL A;  2VY3 A;  3FKI H;  3I4M G;  1TWH H;  2ZTE A;  3RZD H;  3HOV G;  1GD7 A;  4FDB A;  5GAH C;  1IBL L;  3HOV H;  5C44 H;  4X66 Q;  4DPG A;  3HOY G;  1MJC A;  3UE0 A;  4GNX A;  3S2H H;  1K83 H;  1WCM H;  3M4P A;  3W1B A;  2A8V A;  3HOY H;  1XNQ L;  1BBU A;  1YHB A;  3HOZ G;  1YBY A;  4DV0 L;  3PUY A;  4GNX C;  2NVX H;  1N33 L;  2JA8 H;  3HOZ H;  3SGI A;  3CMA A;  5ELN A;  4DR4 L;  4NXN L;  4AH6 A;  3CCS A;  2UXB L;  3OYY A;  1VCI A;  3PUV A;  3I56 A;  1HZA A;  4DK3 C;  2FXQ A;  3EN2 A;  4BY1 H;  2JEA I;  1OXX K;  3LGJ A;  2NN6 I;  1VQ9 A;  1SN8 A;  1M1K C;  1MKH A;  1SLJ A;  1XNR Q;  4AIM A;  3TS0 A;  2R93 G;  3S6A A;  4U07 A;  1HNZ L;  4JI6 L;  4DNI A;  2F4V Q;  2UUC Q;  4GKJ Q;  4MZ9 A;  3A0J A;  4OO1 I;  4JG2 A;  3PUZ A;  3U4Z A;  3CCE A;  1N34 Q;  1KD1 C;  2LXK A;  4HIM A;  1P16 A;  2D0O A;  2F6S A;  3DM3 A;  2QA4 A;  4X66 L;  2QEX A;  2WB1 E;  1WYD A;  2JE6 I;  4L5R C;  2OQ0 A;  3AYH B;  4OWX B;  3J7A 5;  3UDX A;  4DR6 L;  2JJQ A;  1YNX A;  2CWP A;  3FP9 A;  4DV3 Q;  4LU4 A;  3D0F A;  3M85 A;  3CME A;  3KOJ A;  5GAG C;  3CC2 A;  4PZ6 A;  3PIO A;  4POF A;  3KF6 B;  1YJW A;  1X56 A;  4POG A;  2CQO A;  3NEM A;  3SHG A;  2Q2I A;  5HGQ A;  4NB3 A;  1FVI A;  2KBN A;  3D31 A;  2HIX A;  4LF6 Q;  1X54 A;  3PO3 H;  4C3J H;  2UUC L;  3CQZ H;  4QQB X;  1QVF A;  1N34 L;  2UXD Q;  4H02 A;  1NY4 A;  2D0P A;  4IJL A;  4LUV A;  1VQM A;  1PH6 A;  4NXM L;  3L2P A;  1NBW A;  2E8G A;  1VQ7 A;  1X3G A;  3E9I A;  1JT8 A;  1HNX Q;  2ALY B;  1SRO A;  4DR7 Q;  4DR5 Q;  1A8V A;  4JOI A;  4OWT B;  3UDF A;  3S2D H;  5K36 G;  1LYL A;  4P73 A;  1C0A A;  4DR1 Q;  4BBS H;  3RN5 A;  1PH7 A;  3AEV A;  1B8A A;  2YV5 A;  3T1Y L;  4GNX B;  5IYB H;  2E2H H;  4GLA C;  3OW2 A;  1OXV A;  4LNQ A;  1XJV A;  4LFB L;  4LF7 Q;  1K0R A;  4K0K L;  4DAM A;  4JI0 L;  4U0S A;  4HJ9 A;  4LF6 L;  2JA9 A;  4GOP B;  2MO0 A;  1Q1B A;  5AJ3 Q;  1GVP A;  3AQQ A;  2R7Z G;  2DUD A;  3K0X A;  3S1N H;  2UXD L;  5EAY A;  3GTP H;  3J7Z C;  1Q82 C;  3U4V A;  5ELO A;  3BZC A;  4JI4 Q;  2ZJP A;  2ASB A;  2R7Z H;  4R4T A;  2L15 A;  4DV5 L;  1E1T A;  1IBK Q;  5M3M H;  1HNX L;  1PH4 A;  2PI2 A;  4DR7 L;  5C4X G;  4Y7N H;  1WI5 A;  1I94 Q;  3M3Y H;  1N9W A;  5IWA Q;  2E2I H;  4DR1 L;  3RLF A;  1E3P A;  1HJP A;  4R1J A;  2KCT A;  3PCO B;  5GQO A;  1PH5 A;  1CKO A;  2XTI A;  4LW1 A;  2K5V A;  4X65 Q;  1A0I A;  4BA2 I;  4UP9 A;  4LF7 L;  2R6G A;  3RZO H;  4X2C A;  1EIY B;  1DGS A;  2RHQ B;  4IPG A;  4DKA C;  1SFO H;  1X55 A;  3VDY A;  2UUB Q;  5IP9 G;  4A3L H;  1C7Y A;  4JBJ A;  1YIT A;  1KRT A;  1JJC B;  1P8L A;  4OWW B;  5FJ8 H;  4DV6 Q;  1PH2 A;  3GTL H;  3PO2 G;  2UXC Q;  1T9H A;  5IYD G;  4LF8 Q;  3K8A A;  3PO2 H;  5IYD H;  3K80 C;  3L7Z C;  2VNU D;  2YTY A;  5E7N A;  2H5X A;  1YI2 A;  1NJI C;  1E22 A;  4XIG S;  4YWM A;  4QGU A;  3G48 A;  4A3D H;  1VQJ A;  2N3S A;  4XI8 A;  4JI8 L;  1EFW A;  4JI5 Q;  1EOV A;  4A3C G;  1VQC A;  5BR8 L;  5FLX c;  1VQN A;  1D7Q A;  2VW9 A;  1G6P A;  4A4I A;  4X65 L;  4A3C H;  4GS3 A;  1IBM L;  5IE8 A;  2JK8 A;  3CP0 A;  4IJH A;  3I55 A;  4LF5 Q;  4PY3 A;  4P75 A;  3H0G G;  3HOU H;  1K9M C;  1YHA A;  2UUB L;  4KHP Q;  4KI0 A;  3CCL A;  3S14 H;  3NEL A;  4B3R L;  1I50 H;  4DV6 L;  1B70 B;  4BY7 H;  2UXC L;  1HZ9 A;  1UE1 A;  3ULP A;  2I0Q A;  3JC6 6;  4WGJ A;  1TWA H;  1VQB A;  1HR0 W;  2Y0S E;  1UE7 A;  1Q1E A;  1CSQ A;  5GRO A;  4C3H H;  4DUZ L;  3GTG H;  2N8N A;  2F52 A;  2HHH Q;  4JI3 Q;  4N67 A;  1OXU A;  3PSI A;  4L5T A;  5HY6 A;  4O0A A;  1WJJ A;  3ICE A;  1G51 A;  4GN4 B;  4BA1 I;  4LFC Q;  4YY3 L;  2Z0S A;  4DUY Q;  1YVC A;  3UDG A;  3T1H Q;  1KQS A;  4LF5 L;  3I4M H;  3I4O A;  1XMO Q;  1XPU A;  5IP7 G;  4X64 Q;  3W1G A;  4B3S L;  2YTV A;  4HID A;  1UEB A;  5IP7 H;  1QUQ B;  3ZLM A;  2R7D A;  5IT9 c;  3CCR A;  2B63 G;  4DV1 Q;  1IL2 A;  2B63 H;  1VQ5 A;  2JA7 G;  1GKH A;  4JI1 Q;  1JE5 A;  5C0X I;  2A19 A;  4AQY L;  3KJO A;  1JMC A;  1D8L A;  4YCU A;  2ZJQ A;  3EIV A;  2JA7 H;  4OX9 Q;  1N32 Q;  2PQA B;  3BJU A;  1LUZ A;  3MXN B;  1PHJ A;  1PFS A;  2LXJ A;  4LFA L;  4UY8 C;  1MJE A;  2NVT H;  1VQ6 A;  1VS0 A;  3S17 H;  3KYH C;  4LF4 Q;  4GKK Q;  4JYA Q;  4KLK A;  1VQI A;  3STB D;  2UU9 Q;  1FJG L;  2R93 H;  3J80 i;  4DR2 Q;  1Y1W G;  1VQF A;  4LFC L;  1JJG A;  3CC4 A;  2ZTC A;  1Y1W H;  1VQ8 A;  3F2D A;  1XMO L;  4AYB G;  3FHW A;  4X64 L;  5IY0 A;  4YWL A;  3TEH B;  2JEB I;  5C3E G;  2NZO A;  3CCJ A;  4M16 A;  1JB7 A;  3TQY A;  5M5W H;  5C3E H;  4DV1 L;  3CCU A;  1HR0 Q;  1I5F A;  1ASZ A;  1XMQ Q;  1CKM A;  4JI1 L;  5DLQ E;  3OTO Q;  3J81 c;  4DAY B;  2GN5 A;  4OX9 L;  3K7A H;  3S16 H;  1XNR L;  3KF8 B;  3PIP A;  4DR3 Q;  3K7U C;  2F4V L;  1J5E Q;  2UU9 L;  2NVY H;  1A62 A;  4R4C A;  4DV4 Q;  4A76 A;  4DR2 L;  1XPR A;  4GKJ L;  1IZ6 A;  4X62 Q;  3G6E A;  2UUA Q;  2K5H A;  4B3T Q;  4RMF A;  2HT1 A;  2HQL A;  4KHZ A;  2MFI A;  3S1M H;  1PH8 A;  1E1O A;  3A74 A;  3W5O A;  1VQL A;  1IYJ B;  4X6A H;  4A3E G;  1VQD A;  3CPF A;  2GVA A;  2WAQ G;  4JOI C;  1YHQ A;  4A3F G;  4DV3 L;  1HR0 L;  3J81 j;  2Q2T A;  2VUM G;  4ITR A;  1W2B A;  3CCM A;  2PMZ E;  4LUO A;  3OTO L;  3ER0 A;  1BKB A;  3RN2 A;  4QIW E;  5LMN Q;  3KLW A;  3PUW A;  3A5U A;  4DV7 Q;  4B3M Q;  1H95 A;  4DR3 L;  1PYB A;  1EQR A;  2R7F A;  4PG3 A;  3F2C A;  1J5E L;  1NMG A;  1G29 1;  4QY7 A;  5M3F G;  4DV4 L;  2BA1 A;  5JJ6 A;  4A3J G;  1YJN A;  2JA5 G;  1KXL A;  4X62 L;  5M5X H;  5M3F H;  4A3J H;  2AHO B;  2JA5 H;  2EQS A;  3AFQ A;  3PUX A;  5FLM G;  3PF5 A;  4C2M H;  4DR5 L;  2QGQ A;  2BH2 A;  1X6O A;  4QJF A;  3I2Z A;  3GTQ H;  5C4X H;  4HJ8 A;  2K75 A;  4JI7 Q;  1UE6 A;  3M7N A;  3CCV A;  1SR3 A;  2XGT A;  4A3M G;  1XTD A;  1AE3 A;  1K8A C;  2OTL A;  3E0E A;  5LMU Q;  4B3M L;  4OO1 G;  1TWC H;  2CFM A;  4YCV A;  4R4O A;  1HH2 P;  1X9N A;  4X2D A;  1AE2 A;  1Q86 C;  1BBW A;  1VQK A;  4DR6 Q;  2K50 A;  5AJ3 L;  3STB C;  3HKZ G;  4R4I A;  5IP9 H;  5H1S E;  1OXT A;  4HJA A;  2K4K A;  2R92 G;  3I7F A;  4JI4 L;  1X3F A;  3HOX G;  1Y1V G;  1IBK L;  3N3U A;  3BU2 A;  3JAM c;  5C4J H;  4U04 A;  1Y1V H;  3CAM A;  3HOX H;  1I94 L;  4A3K G;  1PYS B;  5IWA L;  4YHH Q;  3CC7 A;  3B6Y A;  3U58 A;  4LF9 Q;  1O7I A;  4TVA B;  1YEZ A;  4L5Q A;  2OQK A;  5CKL A;  3S1Q H;  5LMU L;  2BH8 A;  1KAW A;  4DK6 C;  2ES2 A;  2JA6 G;  2EIF A;  4OON A;  5JFZ A;  1KIX A;  1RIP A;  1YIJ A;  3S1R H;  1OTC A;  4A3G G;  1M90 C;  2VS1 A;  4ALP A;  1QZG A;  3H0G H;  2ZM6 Q;  2E5L Q;  3H3V H;  4XTC S;  1VQA A;  4A3G H;  1Q12 A;  3A5Z B;  4LF8 L;  3E9H A;  3S15 H;  1LTL A;  4A3B G;  2VQF Q;  2D62 A;  2PI2 E;  2HIV A;  3UE1 A;  1SRU A;  4A3B H;  3MEF A;  2JQO A;  2ZJR A;  1JJ2 A;  1N36 Q;  4LF9 L;  1V43 A;  4UPA A;  1YJ9 A;  4JI5 L;  4GN5 A;  4JCV E;  2KEN A;  2YTX A;  3M4Q A;  2MNA A;  4P74 A;  3KFU A;  1B7Y B;  4QL5 A;  1TWG H;  4TQU S;  4GLX A;  1PV4 A;  4JBK A;  2AWO A;  4KHP L;  5JJK A;  1AH9 A;  3PV0 A;  5IYC G;  2ZM6 L;  2E5L L;  1XNQ Q;  4O2D A;  2IX1 A;  3J80 c;  1N33 Q;  3CW2 C;  4JBW A;  2E2J H;  4U0Z A;  4JV5 L;  4X2E A;  4NXN Q;  4EQ5 A;  1V1Q A;  2UXB Q;  1PH9 A;  4BXX G;  3G4S A;  1UWV A;  1KL9 A;  2VQF L;  4MNO A;  1UE5 A;  2N49 A;  3CXC A;  3UDI A;  2VQE Q;  4DV2 Q;  1K8G A;  2IHF A;  2RCN A;  2MQH A;  5LMN W;  4HIO A;  1E7Z A;  2WP8 J;  4JI3 L;  2HHH L;  4LWC A;  1I3Q H;  2GVB A;  3RLO A;  3NEN A;  4A93 G;  1PVO A;  1KC8 C;  3CUC A;  4OXP A;  4A93 H;  3GDE A;  5C44 G;  2IT1 A;  4DUY L;  3T1H L;  1BVS A;  1WCM G;  4YWK A;  1Q81 C;  4HJ7 A;  1HZC A;  1W3S A;  2JA8 G;  2OTJ A;  1SMX A;  1YZ6 A;  3WWV A;  3ULJ A;  2ATW A;  3ERS X;  2RHS B;  4BY1 G;  4C3I H;  1NMF A;  3AFP A;  2RF4 A;  1TXY A;  5JEA G;  4GOP A;  1I6H H;  3TS2 A;  4IOA A;  1IXR A;  3CF5 A;  1MIU A;  3F2B A;  2AKW B;  3RR5 A;  2VQE L;  4GOP C;  4DV2 L;  2CCZ A;  1N32 L;  1EYG A;  2DGY A;  2CKZ B;  4NPS A;  1VQP A;  1K73 C;  4GKK L;  4LF4 L;  4P71 A;  2NVQ H;  4JYA L;  2LSS A;  2F3I A;  4NXM Q;  2Q2U A;  2VL6 A;  2OWO A;  1ASY A;  3KDF A;  3HKS A;  1XPO A;  3CD6 A;  4JI2 Q;  3GTO H;  1CKN A;  3HOW G;  4IFD G;  1VQH A;  3Q8D A;  4J15 A;  4HIK A;  3HOW H;  5JEA J;  4PZ8 A;  1E24 A;  1Q8K A;  1U5K A;  3T1Y Q;  1SE8 A;  1GM5 A;  4A3E H;  1XMQ L;  4GLV B;  1OXS C;  1X3E A;  4JC0 A;  2MO1 A;  1J6Q A;  4A3F H;  1VQO A;  2VUM H;  3GTM H;  4LFB Q;  4K0K Q;  1FL0 A;  4JI0 Q;  3PO3 G;  4IPC A;  4LUZ A;  2OCE A;  1LM0 A;  1X65 A;  1WOC A;  3S24 A;  5JJ7 A;  3K81 C;  4P72 A;  1S40 A;  2I5L X;  3NBH B;  3H3V I;  4B3T L;  2UUA L;  4A75 A;  4DV5 Q;  3SE5 A;  1L0W A;  2V1C C;  3J81 i;  2Q2H A;  2G03 A;  1FGU A;  2YYZ A;  4APV A;  3F1Z A;  4A3I G;  4JI2 L;  4UP8 A;  4BBS G;  1EWI A;  3IRB A;  4IFD J;  2A1A A;  5C0X G;  3HFZ B;  1NE3 A;  4UP7 A;  1S3O A;  1Y14 B;  5FLM H;  4A3I H;  3I4N G;  4IOC A;  5IYB G;  2NN6 G;  4R4Q A;  3I4N H;  1TWF H;  5JFF A;  1CUK A;  4IPH A;  1QZH A;  5J3B A;  1KRS A;  2K52 A;  3ZJY C;  3GTK H;  5LMN L;  4AYB E;  1VQE A;  4A3M H;  1L2F A;  4DV7 L;  1CSP A;  2ID0 A;  2Y0S G;  4IPD A;  3KJP A;  2B29 A;  4WJ4 A;  3GD7 A;  2B3G A;  1S72 A;  2CWA A;  2NZH A;  1QVG A;  4L5S A;  4GN3 B;  4U0U A;  5CMT A;  5M3M G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...