2JK8A

Type iv secretion system effector protein bepa complexed with a pyrophosphate moiety
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
291
structure length
291
Chain Sequence
EIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCSHDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMPEMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHPFREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDISNPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYIIGNIDHLPPEQLKILKPGDKITFTAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords PUTATIVE CELL FILAMENTATION PROTEIN (BEPA PROTEIN)
publication title Fic Domain Catalyzed Adenylylation: Insight Provided by the Structural Analysis of the Type Iv Secretion System Effector Bepa.
pubmed doi rcsb
source organism Bartonella henselae
total genus 90
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 2jk8A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2jk8A02
2B3GA 2VS1A 5BR8Q 3PUXA 4PZ7A 4GOPC 3RN2A 4WGJA 1V9PA 4JI0Q 2ZTDA 1Q81C 2R7DA 2F52A 1HR0L 2UUBQ 3E0EA 3CMEA 1XNQL 1VQMA 3J7A5 2ZJPA 5CGLA 2GVBA 1NBWA 4U0ZA 3VDYA 3HOVH 2K5VA 1I6HH 1SE8A 4MTNA 1KHIA 3RLOA 1D8LA 4YCWA 4X64L 4JI3Q 3HKSA 1X54A 2JA6G 1E24A 4GKJL 4JI7L 3ER0A 4NXNQ 1K3RA 2KENA 3ZC7A 2VL6A 3GTKH 3J81c 5IT9c 2MO1A 1L1OB 1Y1VH 3K80C 4A75A 1ASYA 2UXCL 1FGUA 5M3MH 2Q2UA 4LW1A 4AQYL 4JBWA 3LGJA 1K8GA 4BA1I 4LF5L 3I4OA 2HT1A 1PVOA 1HZBA 1NY4A 4R4OA 3K0XA 4ME3A 4A3MH 1WYDA 4P73A 1IBKL 4DAMA 1VQLA 1HNZL 1C9OA 2A19A 5CMTA 3I56A 1MKHA 2A8VA 2IT1A 2ID0A 2XGTA 2MFIA 3M3YH 1K73C 2VW9A 2ASBA 1KL9A 3G48A 4LFCL 2NVYH 4A3EH 1Q46A 2N8NA 1N34Q 1PFSA 1SRUA 3U4VA 2I0QA 4IJLA 3HKZE 2AHOB 1SMXA 4YHHL 4P71A 4LF4Q 2MNAA 3UDIA 2I5MX 2HIVA 2AKWB 4DV6L 1P16A 1QZGA 1IBML 1JB7A 4DNIA 4DV4Q 2UUBL 2R7FA 4LUOA 1PH8A 1HZ9A 3AEVA 5BR8L 5HY6A 3TREA 2H5XA 4C3JH 2JA6H 1I50H 5ELNA 3M4OH 3TS0A 4JV5Q 1Y14B 4PY3A 4JYAQ 4X2DA 4U0UA 2Q2HA 1A8VA 4KI0A 2CCZA 5EU0A 5AJ3Q 1HZAA 3PO3G 3A5UA 4NPSA 3EN2A 4B3MQ 4GN5A 4R4QA 1CKNA 1NTGA 5IE8A 4DUZQ 1L1OC 4XTCS 1MIUA 4JI3L 3HOZG 4DV7Q 3S2HH 2JE6I 1CSQA 1KAWA 2BH2A 3RZOH 1IYJB 4NXNL 5GAHC 1N8RC 1V1QA 2WP8J 1N33Q 1PYBA 2K52A 3PCOB 4JI2Q 3K8AA 2JA7H 2ZM6Q 4BBSG 3SGIA 2ATWA 1EWIA 4YWMA 4R4IA 4QQBX 4LFBL 4A3JG 5IYDG 3ULJA 2C35B 4B3RQ 4A3KG 4YCVA 1EIYB 1XPUA 2E5LQ 1P8LA 4GLXA 1X3EA 1VQHA 4GN4B 3KF8B 2AWOA 3I7FA 1M1KC 4OWTB 2R6GA 4TVAB 2V1CC 3J81i 3N3UA 3MEFA 3RZDH 4LF7Q 1OTCA 1X3GA 4C2MH 3G4SA 4GNXC 1N34L 3A5ZB 2K5HA 2ES2A 3PO2G 4OONA 5JJLA 5H1SE 2I5HA 4TQUS 4LF4L 2E2JH 3S2DH 4Y52H 1VQBA 4GOPA 4NXMQ 3PO3H 4A3DG 1WCMG 1WOCA 3OW2A 2NVXH 4O2DA 4NB3A 2VUMG 2AWNA 2KHJA 4DV4L 4EQ5A 2F6SA 1HNWL 4DV3Q 3HOZH 1YHAA 1A63A 2GN5A 5JFFA 3ZJYC 3CAMA 3CF5A 4C3IH 4JV5L 1G51A 4H02A 5M3FG 5M5WH 4JCVE 4DR2L 4X2CA 4JYAL 1QUQB 2IY5B 3HFZB 5GQOA 1XMQQ 2PI2A 2VY3A 3S6AA 4XIGS 5AJ3L 1BBWA 1RIPA 3KLWA 1Q1EA 2QA4A 1VQFA 3CCLA 4B3ML 4DUZL 4BBSH 1CUKA 2EQSA 1B70B 2Y0SG 4DV7L 4A3JH 3ERSX 1Y1WG 1X65A 1U0LA 3MXNB 5FJ8G 5EAYA 4A3KH 4KLKA 3RLFA 5C3EH 2R7ZH 1QVFA 3ZCBA 1I5FA 1N33L 2R92H 4IFDG 1BKBA 2E2IH 1K0RA 2B63G 4FDBA 1G6PA 3GTJH 2NVTH 2ZM6L 1IXRA 4DR7Q 4BY7G 1HZCA 3GDEA 1H95A 5JFZA 2D0OA 3KF6A 4LUZA 3PO2H 4WJ4A 2LSSA 4MZ9A 4IPDA 1A62A 4B3RL 5C4JH 2UU9Q 3DM3A 4AYBG 4DAYB 1TWCH 2IHEA 1WCMH 5C44G 3M85A 2E5LL 2VUMH 3S1QH 4A3DH 2KBNA 1VS0A 4DPGA 3KDFB 4X62Q 1XNRQ 1HNWQ 3H3VI 5C4XG 4POFA 2N78A 3G6EA 4LF7L 4OWWB 3CMAA 4BY1G 2KHIA 4PG3A 5M3FH 4HJ5A 5JJ6A 1B8AA 3NEMA 1AH9A 4AIMA 2ZTCA 1VQEA 1VQIA 4PMWA 2L15A 4JC0A 1KIXA 4O0AA 3HOUG 4AH6A 3F2BA 2DGYA 2F4VQ 1X9NA 1Y1WH 5FJ8H 2ZJQA 2VQEQ 5ELOA 1E1OA 5M5YH 4A3IH 2DUDA 4A3LG 4LNQA 1WJJA 3FKIH 1TWHH 1L1OA 3K7AH 2Y0SE 2PI2E 3S24A 3SE5A 4DV0Q 3PUZA 2WB1G 5M5XH 2E8GA 2QEXA 4R1JA 4JI6Q 2B63H 5JJKA 1X6OA 1EQQA 1UE7A 4B3TQ 3PUWA 1FL0A 4BY7H 4KHPQ 2N49A 3PUYA 3Q8DA 1YHQA 4JI5Q 1HJPA 4QGUA 3CW2C 5JEAG 5C44H 1BBUA 4JI1Q 4QIWE 2JA5G 2UXDQ 5GAEC 3RNUA 3FP9A 3S1MH 3CPWA 5C4XH 1KRTA 1OXVA 4AYBE 4HIDA 2BA0A 4DR7L 3CP0A 5IYDH 4BY1H 2MQHA 2NN6G 2UXBQ 4J15A 4DV2Q 2F3IA 4JI0L 3WWVA 1YVCA 3CCUA 2JK8A 1Q1BA 3KJOA 2UU9L 2I5LX 1VQ8A 1T9HA 3LETA 1C7YA 3HOUH 2PQAA 4DR6Q 3PIOA 4RG1A 3STBC 3PV0A 1GVPA 4JG2A 3TEHB 4GNXA 4U07A 4YCUA 4X62L 1R9TH 4LFAQ 1XJVA 1VQGA 1L0WA 1EYGA 1XNRL 3CC4A 3GTOH 1VQNA 1X56A 2RF4A 4A3LH 3RLNA 1EFWA 1NMGA 4Y7NH 3W1BA 3S1RH 1VQAA 3H3VH 1VQ6A 1N9WA 4HIKA 1YIJA 2JQOA 3UDGA 2NZOA 3CC7A 1XPOA 1PHJA 2AMCB 4A4IA 2F4VL 1GD7A 4C3HH 4LUVA 3I4NG 1UEBA 2RCNA 2WB1E 3I4MG 5JJIA 1CKOA 2OQKA 1JJCB 1CSPA 4DV5Q 1VQPA 2EIFA 3H0GG 4EX5A 3T1YQ 1YBYA 1LM0A 2BA1A 2JA5H 1C0AA 1PYSB 3PUVA 3S16H 1PH6A 5FLXc 3UE1A 4JI6L 4IFDJ 3HOYG 3PIPA 2ZTEA 3K7UC 4B3TL 3OYYA 4P74A 1K83H 1L2FA 4OXPA 4KHPL 4IPGA 2PNHA 3AYHB 4JI5L 1VQ7A 4LF9Q 1J5EQ 2YTVA 1OXTA 4IOCA 3BJUA 1DGSA 3FHWA 3AFPA 4JI1L 4UY8C 2JA8G 2UXDL 2YTYA 3I55A 2WAQG 4XI8A 1VQCA 3OTOQ 2GVAA 1PH2A 4B3SQ 4PZ8A 1XPRA 3J80c 3CCQA 1HH2P 4KHZA 3U4ZA 4ITRA 3M9BA 5IP7G 4UPAA 4OWXB 1S40A 1HNXQ 4IFDI 2UXBL 4DV2L 1V43A 2K50A 1SLJA 3KOJA 1N36Q 1HR0Q 4LU4A 3NENA 1HR0W 3GD7A 1PH3A 4U0SA 3F2DA 1YJNA 3L2PA 3B6YA 4DR6L 1TXYA 3KFUA 3I4MH 3I4NH 3RR5A 4L5QA 4N67A 3KYHC 1FVIA 2CFMA 4A3BG 4DK6C 4GKKQ 3CPFA 3H0GH 4A93G 1QUQA 3UDFA 1YJWA 4YWLA 1Q8KA 3ULPA 2OTJA 2E2HH 1FJGQ 1VQJA 4X65Q 3F8TA 1G291 3EBEA 4HJ8A 1K9MC 3HOYH 1Q86C 2UXCQ 2JJQA 4JI2L 3GTGH 4X6AH 1JJGA 4DUYQ 2ALYB 1OXUA 2Z6KC 1WFQA 2BH8A 3F1ZA 4DV5L 4L5RC 3PF5A 3AFQA 3CQZH 3D31A 3JAMc 3CCEA 1S3OA 3PSIA 2QGQA 2XTIA 5JEAJ 3TRZA 2YYZA 2JA8H 1GM5A 2RHSB 3GTLH 4L5SA 1X55A 1YI2A 1B7YB 4QY7A 1UE5A 3PF4A 1E7ZA 5E7NA 3SN9A 5IP7H 4JOIC 3HOXG 2OWOA 1KQSA 1IL2A 4ALPA 3GO5A 1PV4A 2WAQE 4JI4Q 5JJ7A 1KC8C 1J5EL 5DLQE 5FLMG 4UP8A 1QZHA 1VQ4A 2CKZB 3W1GA 2YU9H 3KDFA 1M90C 2K75A 4P75A 4HJ9A 1I94Q 4NXML 3CCJA 4X66Q 1TWFH 4DR4Q 2LXJA 1SROA 2NZHA 2G03A 3OTOL 4B3SL 1NJIC 4A3EG 4A3BH 4LF8Q 4A93H 4DV3L 2K5NA 3S14H 1HNXL 1W2BA 4K0KQ 2K4KA 1N36L 1Q12A 1PH7A 3M7NA 2NN6I 4LF6Q 4OO1G 4GLAC 1XMQL 1A0IA 3CCRA 1EOVA 2VQFQ 1AE2A 1OXXK 4QJFA 4A3FG 1LTLA 2A1AA 3L0OA 5GROA 3TS2A 2R93G 2CWAA 5J3BA 5LMNQ 1X3FA 4GKKL 1U5KA 3G71A 3J80i 5LMNW 3CCVA 4DR5Q 4P72A 1QVGA 4JI8Q 1FJGL 3CUCA 1NE3A 2OCEA 1EIFA 4X65L 1JE5A 2UUAQ 1VQDA 3UDXA 4YY3Q 4A3GG 2RHQB 3TQYA 1OXSC 2IX1A 3HOXH 1TWAH 1S72A 1GKHA 1VQOA 2KCTA 4DUYL 4DR1Q 4LFBQ 5FLMH 3HOWG 2HIXA 1SN8A 1XMOQ 3CC2A 4GS3A 1QVCA 1YITA 1XTDA 1MJEA 1LUZA 1JJ2A 1KD1C 4IJHA 1IBLQ 1KXLA 3T1HQ 1PA6A 4HIOA 5IY0A 1I3QH 3H15A 2JA7G 3GTMH 3ICEA 4IPCA 3KJPA 5C0XJ 4BA2I 3CD6A 4LWCA 4IPHA 5GAGC 1N32Q 3NELA 4DV1Q 3UE0A 5LMUQ 4UP9A 1YNXA 4JI4L 4M16A 1EUJA 4IOAA 1YHBA 3JAMi 3SHGA 1VQ9A 2FXQA 3JC66 1I94L 4OX9Q 3S15H 4X66L 4L5TA 2PQAB 4A3FH 4DR4L 1WI5A 4GNXB 4JBJA 2R93H 2KCMA 3A0JA 5IYCG 1SR3A 3CCMA 3AQQA 4LF8L 1CKNB 2UUCQ 4YWKA 3BZKA 3D0FA 3J7ZC 4A76A 4JBKA 4DR2Q 4K0KL 2HHHQ 2VQEL 2B29A 1KRSA 5C0XI 3EIVA 4LF6L 1O7IA 4WJ3M 4RMFA 4DV0L 1ASZA 4A3GH 4APVA 4BBRG 2VQFL 2JEBI 2YV5A 2VZAA 2HQLA 3M4QA 2CQOA 3ZLMA 1VCIA 2VNUD 2IX0A 3CXCA 5LMNL 1Z47A 3STBD 3U50C 3RN5A 4DR3Q 3HOWH 4DK3C 4DR5L 5IWAQ 1YEZA 1YJ9A 4JI8L 4IO9A 3E9IA 1Q7YC 2UUAL 5IYBG 2Z6KA 2JEAI 1UWVA 4YY3L 3I2ZA 1JT8A 4DR1L 3S17H 5C0XG 3M4PA 3DLLA 1UE1A 5C3EG 1AE3A 1W3SA 4R4CA 1XMOL 2Z0SA 2R7ZG 4BXXG 2EXDA 1E3PA 1PH1A 1IBLL 4JOIA 4HIMA 3T1HL 5HGQA 1XNQQ 5CKLA 4POGA 2R92G 1D7QA 2LXKA 4X2EA 3F2CA 4GOPB 4A3CH 5IYCH 2IHFA 5IP9G 4LFAL 4X64Q 3U58A 3L7ZC 1PH4A 4A3CG 1N32L 4DV1L 2Q2IA 5LMUL 4GKJQ 3GTPH 3ULLA 1IZ6A 4JI7Q 2N3SA 2PMZE 1PH9A 3S1NH 3J81j 1PH5A 5K36G 4BBRH 1MJCA 4DKAC 1NMFA 1YZ6A 1E1TA 4PZ6A 1J6QA 2K14A 2OQ0A 3BU2A 2ZJRA 4OX9L 3HOVG 1TWGH 1Q82C 4AQYQ 4HJAA 3PGZA 2CWPA 2UUCL 4LF5Q 4U04A 2MO0A 1RL2A 1IBKQ 4UP7A 2HHHL 1K8AC 3T1YL 3CCSA 1HNZQ 2WFWA 1UE6A 5IYBH 4GLVB 1SFOH 1JMCA 1BVSA 2D62A 2JA9A 2OTLA 3K81C 4JBMA 3W5OA 3IRBA 1Y1VG 1CKMA 5M3MG 4HJ7A 4OO1I 4LFCQ 1VQKA 3GTQH 4DR3L 4BXXH 4QL5A 4A3IG 4MNOA 1E22A 4LF9L 5IWAL 5GADC 4YHHQ 3FKIG 2D0PA 4R4TA 4A3MG 3KF6B 2NVQH 1EQRA 1GO3E 2YTXA 3NBHB 2Q2TA 4DV6Q 3A74A 1IBMQ 3BZCA 1Z9FA 1VQ5A 4GN3B 3E9HA 3HKZG 5IP9H 1LYLA
chains in the Genus database with same CATH superfamily
2B3GA 2VS1A 3PUXA 3R3OA 3RN2A 1I3QB 5K36H 5J1ZA 4V0BA 3CMEA 3J7A5 2PO4A 1NBWA 4U0ZA 1CA6A 1D8LA 4YCWA 4JI3Q 3HKSA 4CDCC 4HSVA 4A3FB 2F0SA 1I4QA 3GTKH 1RTOA 1L1OB 2MO1A 1HHVA 4A75A 1ASYA 1HRJA 1ET9A 1FGUA 4LW1A 2L0CA 4BA1I 4F87A 2BCOA 1PVOA 1HZBA 1NY4A 4P73A 2QDLA 1STBA 3KLRA 3VR3A 1MKHA 1V1PB 2A8VA 2C5CA 2MFIA 3HG9A 1K73C 2VW9A 3G48A 1Q46A 3MXPA 2N8NA 1SRUA 3HKZE 3Q6SA 4YHHL 1SMXA 4P71A 4LF4Q 2WV6D 3UDIA 3RUZA 2HIVA 2AKWB 4DV6L 1ENCA 1IBML 4N9PA 4LUOA 1I50H 2X6LA 1K28A 1TS5A 3TS0A 3EQLC 2TSSA 1AZPA 3I4MB 2O4XA 5T1IA 4K2LA 4GN5A 1CKNA 3GTPB 1MIUA 4JI3L 3S2HH 3SDZA 3M4YA 1AEXA 4C3IG 1E2ZA 1HFNA 5GAHC 1N8RC 1V1QA 2WP8J 1PYBA 2K52A 3PCOB 2EYLA 3Q22A 3GTGB 1CHPD 2JA7H 3ITPA 4BBSG 1E2VA 2F0LA 4YWMA 4R4IA 3I8ZA 1EY0A 4A3JG 3GV3A 2JXMB 4A3KG 1XPUA 2F1MA 3I70A 2L12A 5KYIA 1B1ZA 1VQHA 3I7FA 1WTQA 2CW0D 2R6GA 3UI2A 3N3UA 2F0WA 3W2DA 3MEFA 2FINB 2NVQB 1X3GA 1H9JA 4KV6A 5H1SE 4LF4L 2E2JH 4EQNA 4A3DG 1H9KA 3K5OA 4ZYSA 2AWNA 2KHJA 2J4XA 4DV3Q 1A63A 5JFFA 3CAMA 2K5QA 3CF5A 5M5WH 4KD4A 3ND9A 1XMQQ 3OOCA 1SAPA 1Q1EA 2QA4A 1C4QA 1LLRD 2EQSA 5IYDH 1BUVT 3MXNB 4XT3B 1GUNA 5EAYA 3GTKB 2F0DA 1F2LA 1U4RA 2KA7A 3TP8A 3HP3A 2R92H 2MGSA 3GTJH 1DYQA 1HPCA 2H1EA 2D0OA 2QILA 4RGTA 3PO2H 2LSSA 2A6HD 4MZ9A 1A62A 3HKZB 3DM3A 4DAYB 1TWCH 2IHEA 5C44G 2KBNA 3KDFB 1XNRQ 3TDQA 3H3VI 2QF7A 4J1MA 3G6EA 4BS9A 2KHIA 1FNWA 5JJ6A 1B8AA 4K6LA 2ZTCA 1VQEA 1LTRD 1I6VC 1BCPF 2L15A 4JC0A 1KIXA 4DA2A 3HOUG 1I50B 3F2BA 1LT6D 2DGYA 2KEDA 2Z4HA 3A56A 5FKAC 4H13C 1SEBD 5FK9C 1L1OA 3K7AH 2PI2E 2E8GA 2QEXA 1EQQA 3S2HB 1K0SA 2K05A 1Y8OB 4BY7H 1EY6A 1JWMD 5CORA 1ILPA 1NUCA 1V1PA 3G7LA 1ML0D 1TY2A 2UXDQ 2JA7B 3RNUA 3FP9A 1UEAB 2WKCA 3S1MH 2M2LA 4HIDA 3CP0A 1M8AA 4K8IA 2XNAC 4UAIA 3X3NA 1VQ8A 4KK7A 4RG1A 3PV0A 1GVPA 4U07A 1EYGA 1XNRL 4LFAQ 1VMCA 1YNND 1SYDA 5ELDA 3GTOH 3EJIA 4A3LH 2E2JB 3RLNA 1EFWA 4OEMB 3S1RH 2RBMA 1ENAA 4RKBA 3I4MG 3CC7A 2AMCB 4LUVA 2RCNA 5M5WB 2K28A 1QE6A 2OQKA 3KBGA 1JJCB 2EIFA 1RJTA 2F4IA 1C0AA 3BYYB 5C6AA 2SOBA 5FLXc 4S3SA 4IFDJ 3NK9A 4IPGA 3AYHB 3FEWX 1SYFA 4FVMA 1VQ7A 5CV7A 2OF1A 1LTAD 2F0UA 3K6OA 2R92B 2UXDL 1WTPA 2YTYA 1NR4A 4XI8A 1VQCA 2NTSA 4BWGB 3OTOQ 4B3SQ 1BNZA 1XPRA 2FJ2A 3U4ZA 5IP7G 3M9BA 1HNXQ 4ZAIA 1TWCB 2KECA 1CA5A 1PH3A 3J81E 2IJ0A 4G7HC 1A2UA 3F2DA 5G3LF 3IFTA 1I6HB 2F0IA 1I4HA 4L5QA 4N67A 1EZ8A 1FVIA 1PTOC 4DK6C 3QIAA 4GKKQ 1K3BC 4A93G 2O5JC 1EY5A 1YJWA 3I73A 3ULPA 2E2HH 1KDCA 1RCVD 3EBEA 1GXDC 4HJ8A 3HOYH 1Q86C 2JJQA 4JI2L 3D4WA 3MC0B 2NUCA 3MXNA 1JJGA 4OGQC 1OXUA 3F1ZA 3CCEA 3JAMc 2QGQA 5JEAJ 1PRTC 2OXPA 4BY7B 4Q0FA 3GTLH 3IKJA 4DNRB 1X55A 1SNCA 1B7YB 3HS0C 2K7VA 4E6IA 1IL2A 4JOIC 3F2UA 3BVZA 2MP1A 1G8ZD 4DAYA 5DLQE 5FLMG 5BN5A 4KN4C 4DAPA 3SVMA 3KDFA 4P75A 2OEOA 1DM0B 1NNXA 1TY0A 1SROA 3OTOL 2JA6B 4B3SL 4LF8Q 2N88A 1H9SB 1W2BA 1HNXL 4K0KQ 2K4KA 3DWQA 4K5XA 4LF6Q 3KBXA 5EBDA 2G5DA 3GTOB 1DOKA 4QJFA 1J8IA 3L0OA 4H0LC 3TS2A 2R93G 5IIFA 4GKKL 1U5KA 1QILA 1I4RA 4P72A 1BBXC 3A7AB 2RSOA 3CUCA 1IKLA 2OCEA 3BG3A 2Z6BA 1ICFB 3I72A 2ZXRA 5KEEA 1Z7TA 2RHQB 1D2BA 4LFBQ 4PV1C 2HIXA 4GS3A 3T13A 1MJEA 1LUZA 4KKSA 1IBLQ 4IJHA 4PMBA 2JA7G 3GTMH 3KJPA 5GAGC 3AMUA 4DV1Q 1VDZA 3FPUB 3QWNA 4KJOA 1VMPA 1YHBA 3GQBA 3K5LA 2K5WA 3SHGA 1AN8A 3NWSA 1GHKA 2FXQA 2L5TA 1EQTA 3BS1A 1II3A 1W6JA 3BYTB 3AQQA 4LF8L 2UUCQ 3BZKA 4DFAA 4DR2Q 4K0KL 2VQEL 1HFGA 1KRSA 5C0XI 2EY5A 2IX3A 4K14A 2CW0C 3H3VC 2K04A 4LF6L 4DV0L 1ESFA 1SJED 4APVA 2HQLA 2CQOA 5HURA 3FMCA 3DM1A 1Z47A 3U50C 2E2HB 3HOWH 2SEBD 5IWAQ 3HOYB 1STGA 4KY6A 3KF8A 2Z6KA 3ND8A 1LT3D 1EQVA 3H6MA 3OWFA 1GUSA 5EPKA 1CK1A 2F0KA 1AE3A 3GTLB 1E3PA 1PH1A 1IBLL 2A73B 1XNQQ 1D7QA 2R92G 2IHFA 1GHJA 2FMMA 4ILWA 4X64Q 5M3FB 1JQYD 1I4GA 3BVMA 1PH4A 4DV1L 2Q2IA 4GKJQ 2DJGC 3ULLA 4NP5A 4JI7Q 5EKLA 1STHA 2NWGA 4HN7A 4XQQA 1I4XA 4BBRH 4H44C 4PZ6A 2OQ0A 4C1NK 1WTVA 4CJ0B 3E0JA 3J81L 3PGZA 5M5YB 3V2TA 2UUCL 1IBKQ 2EYJA 3BDLA 3MTSA 5CBAE 1HTLD 4L63B 2B63B 1BVSA 5CC4A 4RAUC 1WVLA 2J0TD 1CKMA 2OT2A 2CH4A 4BXXH 4AYBB 1FGBD 1E22A 4LF9L 5IWAL 5L37A 1GUOA 2YTXA 1GO3E 4JK1C 1CFMA 3E6ZX 2UUBQ 4BY1B 4A3CH 1LYLA 3NSWA 4ABNA 1V9PA 4R8NA 2ZTDA 2R7DA 4OHJA 3QB3A 1GUGA 1KLUD 1XNQL 2E74C 1VQMA 2ZJPA 3VDYA 3TZDA 3SR1A 4I7ZC 4MTNA 5FO8B 1H9SA 3V96A 2XN9C 4X64L 1X54A 2F0EA 3MHBA 1E24A 3TZUA 2JA6G 4GKJL 3CU7A 4JI7L 1STEA 4X3TA 2VL6A 3R93A 4CBVA 5IT9c 2QDBA 1Y1VH 3K80C 5M3MH 3A7LA 4HCSA 4ZKBB 1K8GA 4PMCA 2HT1A 3K0XA 1IBKL 1WYDA 1EWCA 1VQLA 3K59A 1YNNC 3A8JE 2KEEA 1F2MA 3HOWB 3J80E 1HQRD 4U673 2ASBA 3RD4A 2MJ8A 5JVG3 1B9NA 2I0QA 2RDFA 2AHOB 2Z4IA 5C5MA 1D5XC 3IL8A 2MNAA 2I5MX 1QZGA 4MN3A 1U4MA 2UUBL 1ZXTA 1HZ9A 5HY6A 4C3JH 3M4OH 5AFWA 4OIKA 4PY3A 4JYAQ 2E2DC 1QB5D 2Q2HA 1A8VA 5EU0A 1O80A 5AJ3Q 3VA5A 5IE8A 4DUZQ 1NTGA 4XTCS 3H0GB 4DV7Q 3NXWA 3SEBA 4R8IA 3A8IE 1CSQA 1KAWA 2BH2A 4BBRB 3RZOH 2BOSA 1IYJB 2IL8A 5F2DA 3K8AA 5I9OA 3L9AX 5IGDA 2ATWA 2X6GA 1PDQA 3T53B 5I4DA 4YCVA 1EIYB 2WAQB 1DD2A 2E5LQ 1SE4A 2EYOA 4GN4B 1F9PA 1JWUD 3P7JA 1M1KC 5BN4A 4OWTB 3J81i 4TVAB 5CV4A 1FNUA 5I2XA 1OTCA 1IKMA 2AQ2B 2K5HA 4CHTB 2YU9B 4TQUS 1VF7A 3BDOA 3CRKC 3D4RA 3PO3H 1WCMG 1CQFA 3BDCA 3HOZH 2Z9HA 3H91A 1B2TA 3ZJYC 2FFKB 1SNOA 1G51A 4H02A 5M3FG 4JYAL 2R61A 4JCVE 2IY5B 4KY7A 1JOKA 2GA4B 4XIGS 3S6AA 5AJ3L 1BBWA 3KLWA 4DUZL 1VF5C 1X32A 3NBIA 1STNA 2Y0SG 4DV7L 3ERSX 1X65A 4KLKA 3RLFA 2R7ZH 1S5DD 1Y1VB 1A3TA 1PTOD 2D2CC 3ZCBA 5NUCA 5M3MB 3P20A 5J22A 1BKBA 4IUPA 1K0RA 1JOOA 1EYDA 2B63G 2QKIC 1G6PA 2NVTH 4G57A 3HRZC 1U4PA 2K03A 2NUNA 3MFYA 1KLGD 4IPDA 5C4JH 2K01A 2UU9Q 4AYBG 2E5LL 3CHBD 2VUMH 1PMRA 4DNTB 1HNWQ 4X62Q 5ELFA 5C4XG 1PRTD 1GJXA 2AUKA 2N78A 4OWWB 3CMAA 4BY1G 4CKEA 1LO5D 1RF2D 1T5EA 1AH9A 4NDXA 4QMGA 1B44D 1IW7C 2JP1A 4PMWA 2H4OA 3K57A 4C3JB 3M4OB 2EZVA 3DUZA 2I07B 1MI2A 5JJZA 1Y1WH 5FJ8H 5D3DA 5EPJA 1E1OA 4A3IH 1F9QA 4CJ2C 1ESRA 3P1HA 3S24A 5I2YA 3CKIB 2MPMA 2WB1G 3PUZA 4IFDH 1UE7A 3PUWA 1FL0A 4DF7A 3Q24A 4KHPQ 2N49A 3RZOB 3Q8DA 1F9RA 5M9OA 1HJPA 1DXMA 1RTNA 3QOLA 1G2TA 1STAA 1BBUA 4QIWE 2AQ1B 2A69C 4ZLTF 2L55A 4V190 1XYIA 2UXBQ 4DV2Q 3J80L 2F3IA 3T56B 2TMPA 3WWVA 4IZ8A 4F8MA 1Q1BA 3KJOA 2UU9L 2I5LX 2PQAA 2PMZB 4DR6Q 1WD0A 4JG2A 1YNJD 4QUCA 4X62L 1R9TH 1HNWL 1VQNA 3EROA 1SYCA 1AFPA 3PO3B 3VYRA 2Q8TA 4Y7NH 1C48A 1VQAA 3H3VH 1Z6HA 5EPLA 1HA5A 1YIJA 2JQOA 4P2CB 4H7BA 1PTOB 5CYUA 4A4IA 4C3HH 1VQPA 2RA4A 3H0GG 2HQEA 3T1YQ 1LM0A 2JA5H 1SNQA 1JC7A 1O78A 1PYSB 2FMCA 3S16H 3MXUA 3UE1A 3MVVA 3PIPA 3IAYA 3GTQB 4L8JA 4P74A 2B39A 4OXPA 4KHPL 2NN6H 2R7ZB 1BDOA 2PNHA 1PRTB 1J5EQ 3NWTA 4F88A 1DGSA 2B2TC 2NVTB 3VA7A 4QCLA 2WAQG 5LL6S 1TVXA 4PZ8A 3CCQA 1EU4A 4IFDI 5C4JB 4OWXB 1S40A 2UXBL 4DV2L 2K5DA 2K50A 1N36Q 1HR0Q 2VUMB 4LU4A 1XX8A 1HR0W 1QOHA 3GD7A 2K32A 4U0SA 4DR6L 2IW3A 3I4NH 5KIXA 3KYHC 1EU3A 1CZGA 4J8QA 1DCZA 4K5WA 3F8TA 3SE0A 4N8X1 2UXCQ 1Y1WB 3AB9A 1JE4A 5IGCA 4A3IB 4X6AH 4DUYQ 2ALYB 3D8GA 3D31A 3C1EA 1S3OA 3PSIA 2JA8H 2HDMA 2RHSB 1L0YB 4L5SA 1SYBA 4QY7A 2JSOA 4ALPA 4JI4Q 3I91A 1J5EL 3A54A 1QZHA 1S5CD 2CKZB 5D14A 1I94Q 3NP8A 1TWFH 2LXJA 3KLSX 2NZHA 2G03A 1Y8NB 2F0GA 4M8AA 4A3BH 4DV3L 1G2SA 4PQXA 1SJHD 1N36L 1Q12A 3PIO3 3EA6A 3M7NA 2LMCB 2NN6I 2SDFA 1XMQL 1R9TB 1EOVA 2VQFQ 4A3FG 4Y7NB 3J80i 3CCVA 1EY7A 1QVGA 4RCNA 2UUAQ 3UDXA 4FXDA 4RGOS 4C3HB 3SK6A 3TP6A 3HOXH 2BE5D 2KCTA 4DUYL 5IGFA 1O7LA 1SNMA 2JA5B 1SN8A 3S16B 2EYPA 1YITA 5KGUA 3H15A 4B08A 2B2VC 4MHEA 3CD6A 4LWCA 5CV9A 5CGKA 3QG1A 2F3WA 4UP9A 4JI4L 2BDOA 4ZUJA 4OO1H 1VQ9A 3C3LA 4M1UB 3JC66 1I94L 4OX9Q 3S15H 4L5TA 3MEHA 4GNXB 4JBJA 2KCMA 5K5PA 5IYCG 3CCMA 4YWKA 1LT4D 4A76A 1AW7A 4CKBA 3T4AC 3EIVA 1TU2B 2O2LD 4WJ3M 3I4LA 4A3GH 2VQFL 2YV5A 2VZAA 2VNUD 1R4PB 3VR4A 4NW2A 3CXCA 3STBD 3RN5A 3DMUA 4DR3Q 1YJ9A 3OIPA 4IO9A 5E4WC 5IGEA 3E9IA 1Q7YC 2UUAL 1RHPA 2JEAI 3GTJB 1FNVA 2VB3X 5FO9B 2PZWA 3OHXC 3S17H 3PO2B 2JA8B 1UE1A 4R4CA 2R7ZG 4KD3A 4GZYC 2B2WC 4JOIA 3DXJC 3VR2A 2DNEA 5HGQA 4X2EA 3T51B 3F2CA 5C3WA 5IP9G 4LFAL 3A8KE 2ICIA 3L7ZC 1JICA 4CDDC 5C4HA 1IZ6A 1ZEQX 3S1NH 1PH5A 5K36G 4DKAC 1NMFA 2ZJRA 4OX9L 1JOQA 3BU2A 1QNUA 2A68C 4HJAA 1J9OA 4U04A 1LTGD 1RL2A 3K7AB 1K8AC 1D5ZC 3CCSA 1UE6A 5IYBH 4GLVB 4XXEA 1SFOH 3H09A 1Y69U 2E76C 4B9WA 4ME5A 1B3QA 3IRBA 4OO1I 5C0XH 1VQKA 1DOLA 4EQOA 4DR3L 4IN3A 4A3IG 2KJXA 3KF6B 1D5MC 1XXGA 2JYOA 3S1MB 2VXWA 3MZ5A 3NBHB 3HOXB 2ICEC 5ELBA 3BZCA 1Z9FA 1VQ5A 3E9HA 3HKZG 1TWGH 5BR8Q 4PZ7A 4GOPC 1WTXA 1PZKD 4WGJA 4JI0Q 5I6WA 1Q81C 4X3SA 4ZCKA 1MSHA 2F52A 5KNBA 5CGLA 3HOVH 1KNEA 2K5VA 1SE8A 3RLOA 1KHIA 2XVSA 3NQIA 3S1RB 4HMIA 3ER0A 1K3RA 1B9MA 3ZC7A 2P5ZX 3J81c 3OW7A 5I6YA 1Q8IA 1FYCA 2B2YC 1IW7D 3LGJA 4JBWA 2EPBA 3I4OA 2EY6A 2NYZD 4R4OA 4A3MH 2N55A 4DAMA 4A3GB 1C9OA 2A19A 5CMTA 1YNJC 3I56A 4MTKA 1HXYD 5ELEA 2ID0A 1FR3A 3M3YH 4CGYB 3I3CA 4I65A 4A3EH 2L9HA 1N34Q 1PFSA 1PFNA 3U4VA 4IJLA 1PFMA 1B53A 4IALA 2DJFC 3OWEB 4KMUC 1JB7A 3AEVA 1PH8A 2KOLA 3VYUA 5BR8L 3TREA 5ELNA 2A69D 4JV5Q 1Y14B 5EKIA 1TS2A 4X2DA 3GV6A 4U0UA 3OPOA 2F0FA 4KI0A 1A2TA 1O7YA 3A5UA 4NPSA 4R4QA 1PTOF 2RSNA 1S4ZA 2JE6I 3TMEA 4OIJA 4B9XA 1N33Q 3C46A 5JPMC 4NMZA 2ZM6Q 1EWIA 4QQBX 1KTKA 1U4LA 4LFBL 2F0QA 5IYDG 3ULJA 2IPKD 4LMQD 1PRTF 2EDGA 3LX0A 1SFOB 4B3RQ 3NTKA 1NSNS 2AUJD 4ULLA 1P8LA 4HEDA 4ZRZA 2AWOA 2RDGA 1DONA 4EVOA 5FOBB 2EJMA 4LF7Q 4C2MH 1N34L 4GNXC 2M9VA 2ES2A 3PO2G 5JJLA 4OONA 2EJFC 1OO9B 2I5HA 3S2DH 4NXMQ 1TWGB 4XYOA 1WOCA 2NVXH 5I9PA 4EQ5A 4C3IH 4JV5L 2V4DA 4DR2L 4X2CA 3HOVB 3HFZB 1EY8A 2PI2A 1EZ6A 2VY3A 3RMHA 3CCLA 3FRPB 1VQFA 2KCNA 4OELB 3QO2A 4BBSH 5EQ0A 1CUKA 4YIJA 1B70B 3KLSA 4A3JH 1U0LA 4A3KH 1MBYA 1QVFA 2EE1A 1I5FA 1N33L 1NAPA 1MHWC 2F0TA 2E2IH 4FDBA 2HD3A 1C8CA 2LKVA 3R8BA 2ZM6L 1HQMC 3X3MA 4BY7G 1HZCA 3GDEA 5JFZA 4RHSA 3KF6A 4LUZA 3D3RA 4B3RL 3NBHA 3M3YB 4A3DH 2RKSA 3GTMB 4A3EB 5EGTA 5E1FA 2RCFA 4POFA 3SK5A 4LF7L 4HJ5A 5KNCA 4AIMA 5EJWA 4RH6A 1NCVA 1VQIA 2BE5C 2DN8A 4AH6A 2F4VQ 1G6ZA 1RODA 2ZJQA 1KAAA 3BZDB 4A3LG 5C3XA 2I46A 1ZYRC 1WTWA 1TWHH 3SE5A 3DWAA 5JJKA 5M5XH 1K8MA 3D4DA 4R1JA 4FXGC 2PQEA 1A15A 4B3TQ 1EYCA 3AU7A 3PUYA 1YHQA 1STYA 2NBFA 1SE3A 2G9HD 5T1GA 3CW2C 5E4XA 5C44H 3SHLA 4JI1Q 5GAEC 3CPWA 3TP5A 2L4NA 1KRTA 4Q5VA 2BA0A 2L1BA 3OMGA 2MQHA 3I90A 4J15A 1G91A 3HEJA 2QCPX 1T9HA 3LETA 3HOUH 3STBC 1O7ZA 3WOFA 4TSSA 4C2MB 1XJVA 1VQGA 3CC4A 1CQVA 2Z8LA 4G4KA 1NMGA 2PYKA 3W1BA 2NVXB 1KNAA 1VQ6A 2KUMA 1N9WA 2B2UC 3UDGA 2NZOA 1XPOA 1PHJA 3E3XA 3OIQA 2F4VL 1GD7A 4DK0A 1F2YA 1LTSD 5JJIA 1CKOA 1CSPA 3G6JB 4EX5A 1YBYA 4ZQ3A 2HUGA 5JAVA 1WD1A 3PUVA 1EYAA 1PH6A 4XT1B 3HOYG 4B3TL 3OYYA 3R2TA 1L2FA 4IQZA 1LTTD 4IOCA 2CVRA 2KCCA 3FHWA 4XYQA 2E2IB 3AFPA 1NR2A 3L3OC 4HCEA 4JI1L 2D9UA 4UY8C 2PW5A 2DY8A 1PH2A 3MFGA 3J80c 3J7AV 4KHZA 5JVH3 3KOJA 1EIHA 4DN4M 3EFXD 2HCIA 3L2PA 1YJNA 3B6YA 5D3IB 3I4MH 3P75A 5DEHA 3DWPA 3C2PA 1EEFD 3ZYYX 1QJOA 3UDFA 1H9RA 2OTJA 1PZID 1VQJA 4X65Q 2A74C 3TSSA 4FP5D 2CHBD 5EBCA 4IUVA 3GTGH 2EOTA 2K6AA 1JCKB 2BH8A 1TWHB 5E3FA 4FF1A 4L5RC 3NTIA 3AFQA 3NHHA 2EYMA 4LAAA 5M5XB 4JW0A 2A68D 2XTIA 1SYEA 2A6EC 1GM5A 1KDBA 4UDUC 3U9SA 3SN9A 5CBEE 5IP7H 4HSPA 5C44B 5JJ7A 2L11A 4UP8A 3T16A 5COYA 1VQ4A 4K6DA 2EYFA 3W1GA 3K5MA 3KK7A 1M90C 2K75A 1WTRA 1E0BA 1JWSD 4X66Q 3CCJA 4ODGA 4ZUIA 4ID6A 4A3EG 4A93H 2K5NA 5DAUA 1CTMA 1PH7A 2C9OA 3HOUB 1TQOA 1A0IA 3CCRA 1H9MA 1HA6A 4DK1A 1NH1A 1LTLA 5LMNQ 5LMNW 4DGZA 2LS01 4JI8Q 4X65L 1JE5A 3FDTA 3J7YW 1S5BD 1OXSC 3MA2B 1TWAH 1GKHA 4QUFA 4DR1Q 1VQOA 1LACA 2XRQD 2NUDA 1EL0A 1B3AA 4CKCA 5FLMH 3HOWG 1CZWA 1MSGA 1QVCA 1XTDA 4N9TA 1GUTA 1JJ2A 1PXUA 1KD1C 1FD7D 3ICEA 1A3UA 2B2TA 4IPHA 4RWSC 1D1KA 1N32Q 3NELA 3UE0A 5LMUQ 3OMCA 1YNXA 4M16A 1EUJA 5CV5A 3NUCA 5TSSA 4X66L 1BCPC 5ISRA 4K8JA 3HOZB 1WI5A 2R93H 3A0JA 1D1IA 1SR3A 2O5IC 4FYDA 5HGTA 1PYWD 3D0FA 3J7ZC 1M4VA 2HHHQ 2B29A 3DHQA 1UNSA 5JEAH 3K5NA 1O7IA 4RMFA 1ASZA 4BBRG 2JEBI 1ENFA 3M4QA 3ZLMA 1VCIA 1SDFA 2IX0A 5LMNL 4DK3C 1YEZA 1PLFA 2VB2X 4RFBA 4JI8L 3PMFA 4C1NI 1JR0D 3I2ZA 4N8FA 1JT8A 4IUQA 4RGMA 4U68A 4DR1L 1LTBD 3DLLA 5ELCA 4BXXG 4HTHA 1BO0A 4HIMA 4JPBW 5CKLA 5LHY1 4POGA 4EQPA 2LXKA 3GP7A 4GOPB 1BQQT 1SMYD 4A3CG 1N32L 1S5ED 5DM73 1CM9A 3NPPA 5LMUL 4F7XA 3URYA 1ONLA 1ET6A 1MJCA 1YZ6A 4A93B 2BDNA 2K14A 1Q82C 3DEPA 2EXZA 4AQYQ 1WTHA 5KNDA 2CWPA 4LF5Q 1SNDA 2HHHL 3T1YL 1HNZQ 1JMCA 2D62A 1T5XD 3K81C 4JBMA 1Q90A 2NB0A 1Y1VG 4QIWB 5M3MG 4LFCQ 1BR9A 1MD2D 1IHZA 3K58A 4MNOA 4O42A 5GADC 2D0PA 2EYHA 3WOEA 1EQRA 3PQIA 1TWAB 1UUPA 5A2QE 1A3VA 4GN3B 3W3AA 1F77A 2B8FA 5KRUA 2F03A 3E5SA 1V8QA 1AZQA 1HR0L 2B2VA 3E0EA 1LV9A 2F0MA 2GVBA 2R3ZA 1I6HH 1TT2A 4C3JG 3D6CA 4NXNQ 2KENA 2K33A 2XSCA 4IUTA 5FLXE 2R93B 2UXCL 2Q2UA 2EJGC 4AQYL 2XIWA 3BVGA 2XWJB 4LF5L 4ME3A 1HNZL 2F0JA 4HR7B 1WTOA 4NKLA 2IT1A 2XGTA 3Q0AA 2KVMA 5EKKA 1TS3A 1ZYRD 5A35A 1KL9A 4LFCL 2NVYH 3HGBA 2Z1CA 3CRLC 4CDFC 1IL8A 1TIID 3MWYW 1P16A 4DNIA 4DV4Q 2R7FA 5CV6A 1BF4A 2H5XA 2JA6H 2B2WA 5JOBA 3VR5A 4RHRA 1QNKA 2PZUA 2CCZA 1MGSA 5IGBA 1SBBB 2F0OA 1HZAA 3PO3G 3FVQA 4B3MQ 3EN2A 3I4NB 4UHVA 1L1OC 3HOZG 4WRDA 3JAME 3QOJA 2LY7A 1EEID 4NXNL 1BOSA 2PCFB 4KJNA 4RKLA 1CT1D 1X3QA 2J7ZA 3NE5B 4JI2Q 5JPNC 4IUNA 3SGIA 3WDNA 3D6WA 2C35B 3U9OA 4DU9A 1IYVA 1TKWB 4GLXA 3LWUA 1E2WA 1X3EA 3KF8B 2V1CC 2FHTA 4XQJA 4DXFA 3RZDH 4KKUA 4FF4A 1KABA 3G4SA 3A5ZB 4Y52H 1D6EC 1TWFB 1VQBA 3M7GA 4GOPA 4WJWA 1LTID 3OW2A 2VUMG 4O2DA 4NB3A 4Z9CB 4A3BB 4DV4L 1QWYA 2F6SA 4IURA 1YHAA 2ZXPA 2GN5A 2KHSA 4FF3A 1SXTA 3Q23A 5CV8A 3QJYA 3VYTA 1K8OA 1U9RA 1QUQB 5GQOA 2RDHA 3LNNA 4WFN3 5C4ZA 3MXGA 4ZK9B 3DEOA 1RIPA 4B3ML 2RVLA 5DM63 3IFDA 1CHQD 1Y1WG 4PNYA 1SSOA 5FJ8G 5C3EH 4KN7C 4EGVA 2B2YA 2B8GA 4IFDG 4G7ZC 1IXRA 4DR7Q 1TS4A 2WIIB 3O13A 4J6HA 1H95A 4WJ4A 1HCZA 1EWHA 2MUYA 2WKDA 1DZ1A 3S1QH 1V1OA 3M85A 1WCMH 1PZJD 2CH4W 5IGGA 3OSOA 2NVYB 1VS0A 4DPGA 1B4OA 2A6ED 2X69A 5A2QL 4PG3A 1RKNA 5M3FH 3NEMA 2XRSD 3K0YA 3S15B 2PPBC 1A6XA 4O0AA 1I4PA 1LABA 1X9NA 4KKTA 2VQEQ 5ELOA 5M5YH 2DUDA 3LWEA 5CR3A 4LNQA 1WJJA 3FKIH 2F0NA 4DXGA 2K1BA 4DV0Q 2Y0SE 4X3KA 4JI6Q 2B63H 4LJZC 1X6OA 1CI3M 2F3VA 5CMDA 5FLXL 1SNPA 1JB3A 4C3HG 1DOMA 4JI5Q 2QW7A 4QGUA 2DNCA 5JEAG 2JA5G 3HZXA 5C4XH 3S17B 1OXVA 4AYBE 4DR7L 1KDAA 4BY1H 2NN6G 2CQAA 4JI0L 1YVCA 3CCUA 2JK8A 1C7YA 3RZDB 3PIOA 4GNXA 3TEHB 4YCUA 1L0WA 1X56A 1EFID 2RF4A 3S1NB 3ONAB 4X3UA 5IOCA 1F2ZA 2RQXA 4HIKA 2LFNA 3I4NG 1UEBA 2WB1E 3SXHA 4DV5Q 1BCPD 1QG7A 1HUMA 1SE2A 4KHVA 1HTPA 1R4QB 2BA1A 1EIGA 3FPPA 1SMYC 3JAML 1PFBA 4JI6L 2HDLA 4R9WA 3H94A 2ZTEA 3K7UC 5C3EB 1K83H 1DJRD 2F0VA 4JI5L 4LF9Q 2YTVA 1OXTA 3BJUA 3QR8A 2JA8G 3N6RA 3I55A 3TBIB 4HAEA 2GVAA 3C1FA 1Y8PB 1GUWA 1GOZA 1HH2P 4ITRA 1L0XB 4UPAA 2NZ1D 3S1QB 1V43A 1WCMB 1SLJA 3NENA 5IT9E 1TXYA 3KFUA 2Q8IB 3S9WA 2EY1A 3RR5A 2CFMA 4A3BG 3CPFA 3H0GH 1QUQA 4YWLA 1Q8KA 1HUNA 1FJGQ 5C5LA 1G291 1ICWA 1K9MC 2PNRC 2Y0SB 2A6HC 4FNFA 3A55A 1EY4A 3FKIB 2MHVA 1WFQA 2Z6KC 4A3MB 4DV5L 3PF5A 3CQZH 2Q8RE 3TRZA 2YYZA 4L6TB 4I7AA 3VYSA 1YI2A 1UE5A 3PF4A 1E7ZA 5E7NA 1JORA 2PW7A 1B50A 3HOXG 2OWOA 1KQSA 4TKOB 2QEJC 3GO5A 1PV4A 2WAQE 1KC8C 5C4XB 2YU9H 1RDPD 2NTTA 4HJ9A 4NXML 4DR4Q 3TP7A 2DY7A 1NJIC 5DNFA 1S5FD 3S14H 2D5DA 3V05A 4OO1G 1BCPB 4GLAC 1AE2A 4QF4A 1OXXK 2A1AA 4QB4A 5GROA 1QCBD 2CWAA 5J3BA 1X3FA 4IUUA 3G71A 4RA8A 2WB1B 2B2UA 5G3LD 4DR5Q 1FJGL 1NE3A 3N52A 1EIFA 1VQDA 4FF2A 5BN3A 4YY3Q 4A3GG 3TQYA 1LT5D 1BXTA 1S72A 2ENBA 1XMOQ 3CC2A 2ZT9C 2IWHA 1XWEA 3PIP3 1KXLA 3T1HQ 3NQTA 1PA6A 1K83B 4HIOA 4LK1C 1I3QH 5IY0A 4OL7A 1EY9A 4IPCA 5C0XJ 4BA2I 4KY5A 1TR5A 2AQ3B 2ZXOA 3S2DB 4IOAA 3JAMi 2PZTA 4MIUA 3NTHA 1X3PA 2E75C 4DR4L 2PQAB 4A3FH 4CJ1B 1RD9D 4C3IB 1CKNB 2WACA 5J39A 4JBKA 3MAQA 2KQ3A 4JVZA 1XTCD 3R2IA 4FXKC 4BBSB 2A5HA 4K5VA 4O1NA 2WINB 4A3JB 2M00A 3J7AF 4A3KB 5FO7B 2HCCA 4TRDA 4DR5L 5IODA 1UAPA 5IYBG 1UWVA 3EVQA 2JN4A 2F0HA 4YY3L 4DAVA 3VR6A 3SK8A 3CQZB 5C0XG 3SK4A 3M4PA 5C3EG 1W3SA 1XMOL 2Z0SA 4A3DB 2EXDA 1SYGA 3T1HL 4HMJA 1W6KA 4C56C 5IYCH 3U58A 3GTPH 2XWBB 2N3SA 2PMZE 1PH9A 3J81j 1IYUA 4XDXA 1E1TA 1J6QA 3HOVG 3S14B 5IT9L 1PTOH 3TN2A 4WORA 4G7OC 4K2KA 5D65A 2MO0A 4UP7A 1ZKOA 2WFWA 2SNSA 2F0PA 2G9DA 4CDEC 2SNMA 2OTLA 1F9SA 2JA9A 3ERQA 2EVBA 3W5OA 2EY2A 4HJ7A 4RCOA 4ZKCB 1Q3LA 4RGNA 3GTQH 1AP0A 4FO2A 4QL5A 5KYLA 4YHHQ 3FKIG 1ILQA 4R4TA 1EOTA 4A3MG 4KTAA 2NVQH 5LL6X 4XQNA 2Q2TA 4DV6Q 3A74A 1IBMQ 3KUPA 5IP9H 2IX1A
chains in the Genus database with same CATH topology
2B3GA 2VS1A 5BR8Q 3PUXA 4PZ7A 4GOPC 3RN2A 4WGJA 1V9PA 4JI0Q 2ZTDA 1Q81C 2R7DA 2F52A 1HR0L 2UUBQ 3E0EA 3CMEA 1XNQL 1VQMA 3J7A5 2ZJPA 5CGLA 2GVBA 1NBWA 4U0ZA 3VDYA 3HOVH 2K5VA 1I6HH 1SE8A 4MTNA 1KHIA 3RLOA 1D8LA 4YCWA 4X64L 4JI3Q 3HKSA 1X54A 2JA6G 1E24A 4GKJL 4JI7L 3ER0A 4NXNQ 1K3RA 2KENA 3ZC7A 2VL6A 3GTKH 3J81c 5IT9c 2MO1A 1L1OB 1Y1VH 3K80C 4A75A 1ASYA 2UXCL 1FGUA 5M3MH 2Q2UA 4LW1A 4AQYL 4JBWA 3LGJA 1K8GA 4BA1I 4LF5L 3I4OA 2HT1A 1PVOA 1HZBA 1NY4A 4R4OA 3K0XA 4ME3A 4A3MH 1WYDA 4P73A 1IBKL 4DAMA 1VQLA 1HNZL 1C9OA 2A19A 5CMTA 3I56A 1MKHA 2A8VA 2IT1A 2ID0A 2XGTA 2MFIA 3M3YH 1K73C 2VW9A 2ASBA 1KL9A 3G48A 4LFCL 2NVYH 4A3EH 1Q46A 2N8NA 1N34Q 1PFSA 1SRUA 3U4VA 2I0QA 4IJLA 3HKZE 2AHOB 1SMXA 4YHHL 4P71A 4LF4Q 2MNAA 3UDIA 2I5MX 2HIVA 2AKWB 4DV6L 1P16A 1QZGA 1IBML 1JB7A 4DNIA 4DV4Q 2UUBL 2R7FA 4LUOA 1PH8A 1HZ9A 3AEVA 5BR8L 5HY6A 3TREA 2H5XA 4C3JH 2JA6H 1I50H 5ELNA 3M4OH 3TS0A 4JV5Q 1Y14B 4PY3A 4JYAQ 4X2DA 4U0UA 2Q2HA 1A8VA 4KI0A 2CCZA 5EU0A 5AJ3Q 1HZAA 3PO3G 3A5UA 4NPSA 3EN2A 4B3MQ 4GN5A 4R4QA 1CKNA 1NTGA 5IE8A 4DUZQ 1L1OC 4XTCS 1MIUA 4JI3L 3HOZG 4DV7Q 3S2HH 2JE6I 1CSQA 1KAWA 2BH2A 3RZOH 1IYJB 4NXNL 5GAHC 1N8RC 1V1QA 2WP8J 1N33Q 1PYBA 2K52A 3PCOB 4JI2Q 3K8AA 2JA7H 2ZM6Q 4BBSG 3SGIA 2ATWA 1EWIA 4YWMA 4R4IA 4QQBX 4LFBL 4A3JG 5IYDG 3ULJA 2C35B 4B3RQ 4A3KG 4YCVA 1EIYB 1XPUA 2E5LQ 1P8LA 4GLXA 1X3EA 1VQHA 4GN4B 3KF8B 2AWOA 3I7FA 1M1KC 4OWTB 2R6GA 4TVAB 2V1CC 3J81i 3N3UA 3MEFA 3RZDH 4LF7Q 1OTCA 1X3GA 4C2MH 3G4SA 4GNXC 1N34L 3A5ZB 2K5HA 2ES2A 3PO2G 4OONA 5JJLA 5H1SE 2I5HA 4TQUS 4LF4L 2E2JH 3S2DH 4Y52H 1VQBA 4GOPA 4NXMQ 3PO3H 4A3DG 1WCMG 1WOCA 3OW2A 2NVXH 4O2DA 4NB3A 2VUMG 2AWNA 2KHJA 4DV4L 4EQ5A 2F6SA 1HNWL 4DV3Q 3HOZH 1YHAA 1A63A 2GN5A 5JFFA 3ZJYC 3CAMA 3CF5A 4C3IH 4JV5L 1G51A 4H02A 5M3FG 5M5WH 4JCVE 4DR2L 4X2CA 4JYAL 1QUQB 2IY5B 3HFZB 5GQOA 1XMQQ 2PI2A 2VY3A 3S6AA 4XIGS 5AJ3L 1BBWA 1RIPA 3KLWA 1Q1EA 2QA4A 1VQFA 3CCLA 4B3ML 4DUZL 4BBSH 1CUKA 2EQSA 1B70B 2Y0SG 4DV7L 4A3JH 3ERSX 1Y1WG 1X65A 1U0LA 3MXNB 5FJ8G 5EAYA 4A3KH 4KLKA 3RLFA 5C3EH 2R7ZH 1QVFA 3ZCBA 1I5FA 1N33L 2R92H 4IFDG 1BKBA 2E2IH 1K0RA 2B63G 4FDBA 1G6PA 3GTJH 2NVTH 2ZM6L 1IXRA 4DR7Q 4BY7G 1HZCA 3GDEA 1H95A 5JFZA 2D0OA 3KF6A 4LUZA 3PO2H 4WJ4A 2LSSA 4MZ9A 4IPDA 1A62A 4B3RL 5C4JH 2UU9Q 3DM3A 4AYBG 4DAYB 1TWCH 2IHEA 1WCMH 5C44G 3M85A 2E5LL 2VUMH 3S1QH 4A3DH 2KBNA 1VS0A 4DPGA 3KDFB 4X62Q 1XNRQ 1HNWQ 3H3VI 5C4XG 4POFA 2N78A 3G6EA 4LF7L 4OWWB 3CMAA 4BY1G 2KHIA 4PG3A 5M3FH 4HJ5A 5JJ6A 1B8AA 3NEMA 1AH9A 4AIMA 2ZTCA 1VQEA 1VQIA 4PMWA 2L15A 4JC0A 1KIXA 4O0AA 3HOUG 4AH6A 3F2BA 2DGYA 2F4VQ 1X9NA 1Y1WH 5FJ8H 2ZJQA 2VQEQ 5ELOA 1E1OA 5M5YH 4A3IH 2DUDA 4A3LG 4LNQA 1WJJA 3FKIH 1TWHH 1L1OA 3K7AH 2Y0SE 2PI2E 3S24A 3SE5A 4DV0Q 3PUZA 2WB1G 5M5XH 2E8GA 2QEXA 4R1JA 4JI6Q 2B63H 5JJKA 1X6OA 1EQQA 1UE7A 4B3TQ 3PUWA 1FL0A 4BY7H 4KHPQ 2N49A 3PUYA 3Q8DA 1YHQA 4JI5Q 1HJPA 4QGUA 3CW2C 5JEAG 5C44H 1BBUA 4JI1Q 4QIWE 2JA5G 2UXDQ 5GAEC 3RNUA 3FP9A 3S1MH 3CPWA 5C4XH 1KRTA 1OXVA 4AYBE 4HIDA 2BA0A 4DR7L 3CP0A 5IYDH 4BY1H 2MQHA 2NN6G 2UXBQ 4J15A 4DV2Q 2F3IA 4JI0L 3WWVA 1YVCA 3CCUA 2JK8A 1Q1BA 3KJOA 2UU9L 2I5LX 1VQ8A 1T9HA 3LETA 1C7YA 3HOUH 2PQAA 4DR6Q 3PIOA 4RG1A 3STBC 3PV0A 1GVPA 4JG2A 3TEHB 4GNXA 4U07A 4YCUA 4X62L 1R9TH 4LFAQ 1XJVA 1VQGA 1L0WA 1EYGA 1XNRL 3CC4A 3GTOH 1VQNA 1X56A 2RF4A 4A3LH 3RLNA 1EFWA 1NMGA 4Y7NH 3W1BA 3S1RH 1VQAA 3H3VH 1VQ6A 1N9WA 4HIKA 1YIJA 2JQOA 3UDGA 2NZOA 3CC7A 1XPOA 1PHJA 2AMCB 4A4IA 2F4VL 1GD7A 4C3HH 4LUVA 3I4NG 1UEBA 2RCNA 2WB1E 3I4MG 5JJIA 1CKOA 2OQKA 1JJCB 1CSPA 4DV5Q 1VQPA 2EIFA 3H0GG 4EX5A 3T1YQ 1YBYA 1LM0A 2BA1A 2JA5H 1C0AA 1PYSB 3PUVA 3S16H 1PH6A 5FLXc 3UE1A 4JI6L 4IFDJ 3HOYG 3PIPA 2ZTEA 3K7UC 4B3TL 3OYYA 4P74A 1K83H 1L2FA 4OXPA 4KHPL 4IPGA 2PNHA 3AYHB 4JI5L 1VQ7A 4LF9Q 1J5EQ 2YTVA 1OXTA 4IOCA 3BJUA 1DGSA 3FHWA 3AFPA 4JI1L 4UY8C 2JA8G 2UXDL 2YTYA 3I55A 2WAQG 4XI8A 1VQCA 3OTOQ 2GVAA 1PH2A 4B3SQ 4PZ8A 1XPRA 3J80c 3CCQA 1HH2P 4KHZA 3U4ZA 4ITRA 3M9BA 5IP7G 4UPAA 4OWXB 1S40A 1HNXQ 4IFDI 2UXBL 4DV2L 1V43A 2K50A 1SLJA 3KOJA 1N36Q 1HR0Q 4LU4A 3NENA 1HR0W 3GD7A 1PH3A 4U0SA 3F2DA 1YJNA 3L2PA 3B6YA 4DR6L 1TXYA 3KFUA 3I4MH 3I4NH 3RR5A 4L5QA 4N67A 3KYHC 1FVIA 2CFMA 4A3BG 4DK6C 4GKKQ 3CPFA 3H0GH 4A93G 1QUQA 3UDFA 1YJWA 4YWLA 1Q8KA 3ULPA 2OTJA 2E2HH 1FJGQ 1VQJA 4X65Q 3F8TA 1G291 3EBEA 4HJ8A 1K9MC 3HOYH 1Q86C 2UXCQ 2JJQA 4JI2L 3GTGH 4X6AH 1JJGA 4DUYQ 2ALYB 1OXUA 2Z6KC 1WFQA 2BH8A 3F1ZA 4DV5L 4L5RC 3PF5A 3AFQA 3CQZH 3D31A 3JAMc 3CCEA 1S3OA 3PSIA 2QGQA 2XTIA 5JEAJ 3TRZA 2YYZA 2JA8H 1GM5A 2RHSB 3GTLH 4L5SA 1X55A 1YI2A 1B7YB 4QY7A 1UE5A 3PF4A 1E7ZA 5E7NA 3SN9A 5IP7H 4JOIC 3HOXG 2OWOA 1KQSA 1IL2A 4ALPA 3GO5A 1PV4A 2WAQE 4JI4Q 5JJ7A 1KC8C 1J5EL 5DLQE 5FLMG 4UP8A 1QZHA 1VQ4A 2CKZB 3W1GA 2YU9H 3KDFA 1M90C 2K75A 4P75A 4HJ9A 1I94Q 4NXML 3CCJA 4X66Q 1TWFH 4DR4Q 2LXJA 1SROA 2NZHA 2G03A 3OTOL 4B3SL 1NJIC 4A3EG 4A3BH 4LF8Q 4A93H 4DV3L 2K5NA 3S14H 1HNXL 1W2BA 4K0KQ 2K4KA 1N36L 1Q12A 1PH7A 3M7NA 2NN6I 4LF6Q 4OO1G 4GLAC 1XMQL 1A0IA 3CCRA 1EOVA 2VQFQ 1AE2A 1OXXK 4QJFA 4A3FG 1LTLA 2A1AA 3L0OA 5GROA 3TS2A 2R93G 2CWAA 5J3BA 5LMNQ 1X3FA 4GKKL 1U5KA 3G71A 3J80i 5LMNW 3CCVA 4DR5Q 4P72A 1QVGA 4JI8Q 1FJGL 3CUCA 1NE3A 2OCEA 1EIFA 4X65L 1JE5A 2UUAQ 1VQDA 3UDXA 4YY3Q 4A3GG 2RHQB 3TQYA 1OXSC 2IX1A 3HOXH 1TWAH 1S72A 1GKHA 1VQOA 2KCTA 4DUYL 4DR1Q 4LFBQ 5FLMH 3HOWG 2HIXA 1SN8A 1XMOQ 3CC2A 4GS3A 1QVCA 1YITA 1XTDA 1MJEA 1LUZA 1JJ2A 1KD1C 4IJHA 1IBLQ 1KXLA 3T1HQ 1PA6A 4HIOA 5IY0A 1I3QH 3H15A 2JA7G 3GTMH 3ICEA 4IPCA 3KJPA 5C0XJ 4BA2I 3CD6A 4LWCA 4IPHA 5GAGC 1N32Q 3NELA 4DV1Q 3UE0A 5LMUQ 4UP9A 1YNXA 4JI4L 4M16A 1EUJA 4IOAA 1YHBA 3JAMi 3SHGA 1VQ9A 2FXQA 3JC66 1I94L 4OX9Q 3S15H 4X66L 4L5TA 2PQAB 4A3FH 4DR4L 1WI5A 4GNXB 4JBJA 2R93H 2KCMA 3A0JA 5IYCG 1SR3A 3CCMA 3AQQA 4LF8L 1CKNB 2UUCQ 4YWKA 3BZKA 3D0FA 3J7ZC 4A76A 4JBKA 4DR2Q 4K0KL 2HHHQ 2VQEL 2B29A 1KRSA 5C0XI 3EIVA 4LF6L 1O7IA 4WJ3M 4RMFA 4DV0L 1ASZA 4A3GH 4APVA 4BBRG 2VQFL 2JEBI 2YV5A 2VZAA 2HQLA 3M4QA 2CQOA 3ZLMA 1VCIA 2VNUD 2IX0A 3CXCA 5LMNL 1Z47A 3STBD 3U50C 3RN5A 4DR3Q 3HOWH 4DK3C 4DR5L 5IWAQ 1YEZA 1YJ9A 4JI8L 4IO9A 3E9IA 1Q7YC 2UUAL 5IYBG 2Z6KA 2JEAI 1UWVA 4YY3L 3I2ZA 1JT8A 4DR1L 3S17H 5C0XG 3M4PA 3DLLA 1UE1A 5C3EG 1AE3A 1W3SA 4R4CA 1XMOL 2Z0SA 2R7ZG 4BXXG 2EXDA 1E3PA 1PH1A 1IBLL 4JOIA 4HIMA 3T1HL 5HGQA 1XNQQ 5CKLA 4POGA 2R92G 1D7QA 2LXKA 4X2EA 3F2CA 4GOPB 4A3CH 5IYCH 2IHFA 5IP9G 4LFAL 4X64Q 3U58A 3L7ZC 1PH4A 4A3CG 1N32L 4DV1L 2Q2IA 5LMUL 4GKJQ 3GTPH 3ULLA 1IZ6A 4JI7Q 2N3SA 2PMZE 1PH9A 3S1NH 3J81j 1PH5A 5K36G 4BBRH 1MJCA 4DKAC 1NMFA 1YZ6A 1E1TA 4PZ6A 1J6QA 2K14A 2OQ0A 3BU2A 2ZJRA 4OX9L 3HOVG 1TWGH 1Q82C 4AQYQ 4HJAA 3PGZA 2CWPA 2UUCL 4LF5Q 4U04A 2MO0A 1RL2A 1IBKQ 4UP7A 2HHHL 1K8AC 3T1YL 3CCSA 1HNZQ 2WFWA 1UE6A 5IYBH 4GLVB 1SFOH 1JMCA 1BVSA 2D62A 2JA9A 2OTLA 3K81C 4JBMA 3W5OA 3IRBA 1Y1VG 1CKMA 5M3MG 4HJ7A 4OO1I 4LFCQ 1VQKA 3GTQH 4DR3L 4BXXH 4QL5A 4A3IG 4MNOA 1E22A 4LF9L 5IWAL 5GADC 4YHHQ 3FKIG 2D0PA 4R4TA 4A3MG 3KF6B 2NVQH 1EQRA 1GO3E 2YTXA 3NBHB 2Q2TA 4DV6Q 3A74A 1IBMQ 3BZCA 1Z9FA 1VQ5A 4GN3B 3E9HA 3HKZG 5IP9H 1LYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3G A;  2VS1 A;  5BR8 Q;  3PUX A;  4PZ7 A;  4GOP C;  3RN2 A;  4WGJ A;  1V9P A;  4JI0 Q;  2ZTD A;  1Q81 C;  2R7D A;  2F52 A;  1HR0 L;  2UUB Q;  3E0E A;  3CME A;  1XNQ L;  1VQM A;  3J7A 5;  2ZJP A;  5CGL A;  2GVB A;  1NBW A;  4U0Z A;  3VDY A;  3HOV H;  2K5V A;  1I6H H;  1SE8 A;  4MTN A;  1KHI A;  3RLO A;  1D8L A;  4YCW A;  4X64 L;  4JI3 Q;  3HKS A;  1X54 A;  2JA6 G;  1E24 A;  4GKJ L;  4JI7 L;  3ER0 A;  4NXN Q;  1K3R A;  2KEN A;  3ZC7 A;  2VL6 A;  3GTK H;  3J81 c;  5IT9 c;  2MO1 A;  1L1O B;  1Y1V H;  3K80 C;  4A75 A;  1ASY A;  2UXC L;  1FGU A;  5M3M H;  2Q2U A;  4LW1 A;  4AQY L;  4JBW A;  3LGJ A;  1K8G A;  4BA1 I;  4LF5 L;  3I4O A;  2HT1 A;  1PVO A;  1HZB A;  1NY4 A;  4R4O A;  3K0X A;  4ME3 A;  4A3M H;  1WYD A;  4P73 A;  1IBK L;  4DAM A;  1VQL A;  1HNZ L;  1C9O A;  2A19 A;  5CMT A;  3I56 A;  1MKH A;  2A8V A;  2IT1 A;  2ID0 A;  2XGT A;  2MFI A;  3M3Y H;  1K73 C;  2VW9 A;  2ASB A;  1KL9 A;  3G48 A;  4LFC L;  2NVY H;  4A3E H;  1Q46 A;  2N8N A;  1N34 Q;  1PFS A;  1SRU A;  3U4V A;  2I0Q A;  4IJL A;  3HKZ E;  2AHO B;  1SMX A;  4YHH L;  4P71 A;  4LF4 Q;  2MNA A;  3UDI A;  2I5M X;  2HIV A;  2AKW B;  4DV6 L;  1P16 A;  1QZG A;  1IBM L;  1JB7 A;  4DNI A;  4DV4 Q;  2UUB L;  2R7F A;  4LUO A;  1PH8 A;  1HZ9 A;  3AEV A;  5BR8 L;  5HY6 A;  3TRE A;  2H5X A;  4C3J H;  2JA6 H;  1I50 H;  5ELN A;  3M4O H;  3TS0 A;  4JV5 Q;  1Y14 B;  4PY3 A;  4JYA Q;  4X2D A;  4U0U A;  2Q2H A;  1A8V A;  4KI0 A;  2CCZ A;  5EU0 A;  5AJ3 Q;  1HZA A;  3PO3 G;  3A5U A;  4NPS A;  3EN2 A;  4B3M Q;  4GN5 A;  4R4Q A;  1CKN A;  1NTG A;  5IE8 A;  4DUZ Q;  1L1O C;  4XTC S;  1MIU A;  4JI3 L;  3HOZ G;  4DV7 Q;  3S2H H;  2JE6 I;  1CSQ A;  1KAW A;  2BH2 A;  3RZO H;  1IYJ B;  4NXN L;  5GAH C;  1N8R C;  1V1Q A;  2WP8 J;  1N33 Q;  1PYB A;  2K52 A;  3PCO B;  4JI2 Q;  3K8A A;  2JA7 H;  2ZM6 Q;  4BBS G;  3SGI A;  2ATW A;  1EWI A;  4YWM A;  4R4I A;  4QQB X;  4LFB L;  4A3J G;  5IYD G;  3ULJ A;  2C35 B;  4B3R Q;  4A3K G;  4YCV A;  1EIY B;  1XPU A;  2E5L Q;  1P8L A;  4GLX A;  1X3E A;  1VQH A;  4GN4 B;  3KF8 B;  2AWO A;  3I7F A;  1M1K C;  4OWT B;  2R6G A;  4TVA B;  2V1C C;  3J81 i;  3N3U A;  3MEF A;  3RZD H;  4LF7 Q;  1OTC A;  1X3G A;  4C2M H;  3G4S A;  4GNX C;  1N34 L;  3A5Z B;  2K5H A;  2ES2 A;  3PO2 G;  4OON A;  5JJL A;  5H1S E;  2I5H A;  4TQU S;  4LF4 L;  2E2J H;  3S2D H;  4Y52 H;  1VQB A;  4GOP A;  4NXM Q;  3PO3 H;  4A3D G;  1WCM G;  1WOC A;  3OW2 A;  2NVX H;  4O2D A;  4NB3 A;  2VUM G;  2AWN A;  2KHJ A;  4DV4 L;  4EQ5 A;  2F6S A;  1HNW L;  4DV3 Q;  3HOZ H;  1YHA A;  1A63 A;  2GN5 A;  5JFF A;  3ZJY C;  3CAM A;  3CF5 A;  4C3I H;  4JV5 L;  1G51 A;  4H02 A;  5M3F G;  5M5W H;  4JCV E;  4DR2 L;  4X2C A;  4JYA L;  1QUQ B;  2IY5 B;  3HFZ B;  5GQO A;  1XMQ Q;  2PI2 A;  2VY3 A;  3S6A A;  4XIG S;  5AJ3 L;  1BBW A;  1RIP A;  3KLW A;  1Q1E A;  2QA4 A;  1VQF A;  3CCL A;  4B3M L;  4DUZ L;  4BBS H;  1CUK A;  2EQS A;  1B70 B;  2Y0S G;  4DV7 L;  4A3J H;  3ERS X;  1Y1W G;  1X65 A;  1U0L A;  3MXN B;  5FJ8 G;  5EAY A;  4A3K H;  4KLK A;  3RLF A;  5C3E H;  2R7Z H;  1QVF A;  3ZCB A;  1I5F A;  1N33 L;  2R92 H;  4IFD G;  1BKB A;  2E2I H;  1K0R A;  2B63 G;  4FDB A;  1G6P A;  3GTJ H;  2NVT H;  2ZM6 L;  1IXR A;  4DR7 Q;  4BY7 G;  1HZC A;  3GDE A;  1H95 A;  5JFZ A;  2D0O A;  3KF6 A;  4LUZ A;  3PO2 H;  4WJ4 A;  2LSS A;  4MZ9 A;  4IPD A;  1A62 A;  4B3R L;  5C4J H;  2UU9 Q;  3DM3 A;  4AYB G;  4DAY B;  1TWC H;  2IHE A;  1WCM H;  5C44 G;  3M85 A;  2E5L L;  2VUM H;  3S1Q H;  4A3D H;  2KBN A;  1VS0 A;  4DPG A;  3KDF B;  4X62 Q;  1XNR Q;  1HNW Q;  3H3V I;  5C4X G;  4POF A;  2N78 A;  3G6E A;  4LF7 L;  4OWW B;  3CMA A;  4BY1 G;  2KHI A;  4PG3 A;  5M3F H;  4HJ5 A;  5JJ6 A;  1B8A A;  3NEM A;  1AH9 A;  4AIM A;  2ZTC A;  1VQE A;  1VQI A;  4PMW A;  2L15 A;  4JC0 A;  1KIX A;  4O0A A;  3HOU G;  4AH6 A;  3F2B A;  2DGY A;  2F4V Q;  1X9N A;  1Y1W H;  5FJ8 H;  2ZJQ A;  2VQE Q;  5ELO A;  1E1O A;  5M5Y H;  4A3I H;  2DUD A;  4A3L G;  4LNQ A;  1WJJ A;  3FKI H;  1TWH H;  1L1O A;  3K7A H;  2Y0S E;  2PI2 E;  3S24 A;  3SE5 A;  4DV0 Q;  3PUZ A;  2WB1 G;  5M5X H;  2E8G A;  2QEX A;  4R1J A;  4JI6 Q;  2B63 H;  5JJK A;  1X6O A;  1EQQ A;  1UE7 A;  4B3T Q;  3PUW A;  1FL0 A;  4BY7 H;  4KHP Q;  2N49 A;  3PUY A;  3Q8D A;  1YHQ A;  4JI5 Q;  1HJP A;  4QGU A;  3CW2 C;  5JEA G;  5C44 H;  1BBU A;  4JI1 Q;  4QIW E;  2JA5 G;  2UXD Q;  5GAE C;  3RNU A;  3FP9 A;  3S1M H;  3CPW A;  5C4X H;  1KRT A;  1OXV A;  4AYB E;  4HID A;  2BA0 A;  4DR7 L;  3CP0 A;  5IYD H;  4BY1 H;  2MQH A;  2NN6 G;  2UXB Q;  4J15 A;  4DV2 Q;  2F3I A;  4JI0 L;  3WWV A;  1YVC A;  3CCU A;  2JK8 A;  1Q1B A;  3KJO A;  2UU9 L;  2I5L X;  1VQ8 A;  1T9H A;  3LET A;  1C7Y A;  3HOU H;  2PQA A;  4DR6 Q;  3PIO A;  4RG1 A;  3STB C;  3PV0 A;  1GVP A;  4JG2 A;  3TEH B;  4GNX A;  4U07 A;  4YCU A;  4X62 L;  1R9T H;  4LFA Q;  1XJV A;  1VQG A;  1L0W A;  1EYG A;  1XNR L;  3CC4 A;  3GTO H;  1VQN A;  1X56 A;  2RF4 A;  4A3L H;  3RLN A;  1EFW A;  1NMG A;  4Y7N H;  3W1B A;  3S1R H;  1VQA A;  3H3V H;  1VQ6 A;  1N9W A;  4HIK A;  1YIJ A;  2JQO A;  3UDG A;  2NZO A;  3CC7 A;  1XPO A;  1PHJ A;  2AMC B;  4A4I A;  2F4V L;  1GD7 A;  4C3H H;  4LUV A;  3I4N G;  1UEB A;  2RCN A;  2WB1 E;  3I4M G;  5JJI A;  1CKO A;  2OQK A;  1JJC B;  1CSP A;  4DV5 Q;  1VQP A;  2EIF A;  3H0G G;  4EX5 A;  3T1Y Q;  1YBY A;  1LM0 A;  2BA1 A;  2JA5 H;  1C0A A;  1PYS B;  3PUV A;  3S16 H;  1PH6 A;  5FLX c;  3UE1 A;  4JI6 L;  4IFD J;  3HOY G;  3PIP A;  2ZTE A;  3K7U C;  4B3T L;  3OYY A;  4P74 A;  1K83 H;  1L2F A;  4OXP A;  4KHP L;  4IPG A;  2PNH A;  3AYH B;  4JI5 L;  1VQ7 A;  4LF9 Q;  1J5E Q;  2YTV A;  1OXT A;  4IOC A;  3BJU A;  1DGS A;  3FHW A;  3AFP A;  4JI1 L;  4UY8 C;  2JA8 G;  2UXD L;  2YTY A;  3I55 A;  2WAQ G;  4XI8 A;  1VQC A;  3OTO Q;  2GVA A;  1PH2 A;  4B3S Q;  4PZ8 A;  1XPR A;  3J80 c;  3CCQ A;  1HH2 P;  4KHZ A;  3U4Z A;  4ITR A;  3M9B A;  5IP7 G;  4UPA A;  4OWX B;  1S40 A;  1HNX Q;  4IFD I;  2UXB L;  4DV2 L;  1V43 A;  2K50 A;  1SLJ A;  3KOJ A;  1N36 Q;  1HR0 Q;  4LU4 A;  3NEN A;  1HR0 W;  3GD7 A;  1PH3 A;  4U0S A;  3F2D A;  1YJN A;  3L2P A;  3B6Y A;  4DR6 L;  1TXY A;  3KFU A;  3I4M H;  3I4N H;  3RR5 A;  4L5Q A;  4N67 A;  3KYH C;  1FVI A;  2CFM A;  4A3B G;  4DK6 C;  4GKK Q;  3CPF A;  3H0G H;  4A93 G;  1QUQ A;  3UDF A;  1YJW A;  4YWL A;  1Q8K A;  3ULP A;  2OTJ A;  2E2H H;  1FJG Q;  1VQJ A;  4X65 Q;  3F8T A;  1G29 1;  3EBE A;  4HJ8 A;  1K9M C;  3HOY H;  1Q86 C;  2UXC Q;  2JJQ A;  4JI2 L;  3GTG H;  4X6A H;  1JJG A;  4DUY Q;  2ALY B;  1OXU A;  2Z6K C;  1WFQ A;  2BH8 A;  3F1Z A;  4DV5 L;  4L5R C;  3PF5 A;  3AFQ A;  3CQZ H;  3D31 A;  3JAM c;  3CCE A;  1S3O A;  3PSI A;  2QGQ A;  2XTI A;  5JEA J;  3TRZ A;  2YYZ A;  2JA8 H;  1GM5 A;  2RHS B;  3GTL H;  4L5S A;  1X55 A;  1YI2 A;  1B7Y B;  4QY7 A;  1UE5 A;  3PF4 A;  1E7Z A;  5E7N A;  3SN9 A;  5IP7 H;  4JOI C;  3HOX G;  2OWO A;  1KQS A;  1IL2 A;  4ALP A;  3GO5 A;  1PV4 A;  2WAQ E;  4JI4 Q;  5JJ7 A;  1KC8 C;  1J5E L;  5DLQ E;  5FLM G;  4UP8 A;  1QZH A;  1VQ4 A;  2CKZ B;  3W1G A;  2YU9 H;  3KDF A;  1M90 C;  2K75 A;  4P75 A;  4HJ9 A;  1I94 Q;  4NXM L;  3CCJ A;  4X66 Q;  1TWF H;  4DR4 Q;  2LXJ A;  1SRO A;  2NZH A;  2G03 A;  3OTO L;  4B3S L;  1NJI C;  4A3E G;  4A3B H;  4LF8 Q;  4A93 H;  4DV3 L;  2K5N A;  3S14 H;  1HNX L;  1W2B A;  4K0K Q;  2K4K A;  1N36 L;  1Q12 A;  1PH7 A;  3M7N A;  2NN6 I;  4LF6 Q;  4OO1 G;  4GLA C;  1XMQ L;  1A0I A;  3CCR A;  1EOV A;  2VQF Q;  1AE2 A;  1OXX K;  4QJF A;  4A3F G;  1LTL A;  2A1A A;  3L0O A;  5GRO A;  3TS2 A;  2R93 G;  2CWA A;  5J3B A;  5LMN Q;  1X3F A;  4GKK L;  1U5K A;  3G71 A;  3J80 i;  5LMN W;  3CCV A;  4DR5 Q;  4P72 A;  1QVG A;  4JI8 Q;  1FJG L;  3CUC A;  1NE3 A;  2OCE A;  1EIF A;  4X65 L;  1JE5 A;  2UUA Q;  1VQD A;  3UDX A;  4YY3 Q;  4A3G G;  2RHQ B;  3TQY A;  1OXS C;  2IX1 A;  3HOX H;  1TWA H;  1S72 A;  1GKH A;  1VQO A;  2KCT A;  4DUY L;  4DR1 Q;  4LFB Q;  5FLM H;  3HOW G;  2HIX A;  1SN8 A;  1XMO Q;  3CC2 A;  4GS3 A;  1QVC A;  1YIT A;  1XTD A;  1MJE A;  1LUZ A;  1JJ2 A;  1KD1 C;  4IJH A;  1IBL Q;  1KXL A;  3T1H Q;  1PA6 A;  4HIO A;  5IY0 A;  1I3Q H;  3H15 A;  2JA7 G;  3GTM H;  3ICE A;  4IPC A;  3KJP A;  5C0X J;  4BA2 I;  3CD6 A;  4LWC A;  4IPH A;  5GAG C;  1N32 Q;  3NEL A;  4DV1 Q;  3UE0 A;  5LMU Q;  4UP9 A;  1YNX A;  4JI4 L;  4M16 A;  1EUJ A;  4IOA A;  1YHB A;  3JAM i;  3SHG A;  1VQ9 A;  2FXQ A;  3JC6 6;  1I94 L;  4OX9 Q;  3S15 H;  4X66 L;  4L5T A;  2PQA B;  4A3F H;  4DR4 L;  1WI5 A;  4GNX B;  4JBJ A;  2R93 H;  2KCM A;  3A0J A;  5IYC G;  1SR3 A;  3CCM A;  3AQQ A;  4LF8 L;  1CKN B;  2UUC Q;  4YWK A;  3BZK A;  3D0F A;  3J7Z C;  4A76 A;  4JBK A;  4DR2 Q;  4K0K L;  2HHH Q;  2VQE L;  2B29 A;  1KRS A;  5C0X I;  3EIV A;  4LF6 L;  1O7I A;  4WJ3 M;  4RMF A;  4DV0 L;  1ASZ A;  4A3G H;  4APV A;  4BBR G;  2VQF L;  2JEB I;  2YV5 A;  2VZA A;  2HQL A;  3M4Q A;  2CQO A;  3ZLM A;  1VCI A;  2VNU D;  2IX0 A;  3CXC A;  5LMN L;  1Z47 A;  3STB D;  3U50 C;  3RN5 A;  4DR3 Q;  3HOW H;  4DK3 C;  4DR5 L;  5IWA Q;  1YEZ A;  1YJ9 A;  4JI8 L;  4IO9 A;  3E9I A;  1Q7Y C;  2UUA L;  5IYB G;  2Z6K A;  2JEA I;  1UWV A;  4YY3 L;  3I2Z A;  1JT8 A;  4DR1 L;  3S17 H;  5C0X G;  3M4P A;  3DLL A;  1UE1 A;  5C3E G;  1AE3 A;  1W3S A;  4R4C A;  1XMO L;  2Z0S A;  2R7Z G;  4BXX G;  2EXD A;  1E3P A;  1PH1 A;  1IBL L;  4JOI A;  4HIM A;  3T1H L;  5HGQ A;  1XNQ Q;  5CKL A;  4POG A;  2R92 G;  1D7Q A;  2LXK A;  4X2E A;  3F2C A;  4GOP B;  4A3C H;  5IYC H;  2IHF A;  5IP9 G;  4LFA L;  4X64 Q;  3U58 A;  3L7Z C;  1PH4 A;  4A3C G;  1N32 L;  4DV1 L;  2Q2I A;  5LMU L;  4GKJ Q;  3GTP H;  3ULL A;  1IZ6 A;  4JI7 Q;  2N3S A;  2PMZ E;  1PH9 A;  3S1N H;  3J81 j;  1PH5 A;  5K36 G;  4BBR H;  1MJC A;  4DKA C;  1NMF A;  1YZ6 A;  1E1T A;  4PZ6 A;  1J6Q A;  2K14 A;  2OQ0 A;  3BU2 A;  2ZJR A;  4OX9 L;  3HOV G;  1TWG H;  1Q82 C;  4AQY Q;  4HJA A;  3PGZ A;  2CWP A;  2UUC L;  4LF5 Q;  4U04 A;  2MO0 A;  1RL2 A;  1IBK Q;  4UP7 A;  2HHH L;  1K8A C;  3T1Y L;  3CCS A;  1HNZ Q;  2WFW A;  1UE6 A;  5IYB H;  4GLV B;  1SFO H;  1JMC A;  1BVS A;  2D62 A;  2JA9 A;  2OTL A;  3K81 C;  4JBM A;  3W5O A;  3IRB A;  1Y1V G;  1CKM A;  5M3M G;  4HJ7 A;  4OO1 I;  4LFC Q;  1VQK A;  3GTQ H;  4DR3 L;  4BXX H;  4QL5 A;  4A3I G;  4MNO A;  1E22 A;  4LF9 L;  5IWA L;  5GAD C;  4YHH Q;  3FKI G;  2D0P A;  4R4T A;  4A3M G;  3KF6 B;  2NVQ H;  1EQR A;  1GO3 E;  2YTX A;  3NBH B;  2Q2T A;  4DV6 Q;  3A74 A;  1IBM Q;  3BZC A;  1Z9F A;  1VQ5 A;  4GN3 B;  3E9H A;  3HKZ G;  5IP9 H;  1LYL A; 
#chains in the Genus database with same CATH topology
 2B3G A;  2VS1 A;  3PUX A;  3R3O A;  3RN2 A;  1I3Q B;  5K36 H;  5J1Z A;  4V0B A;  3CME A;  3J7A 5;  2PO4 A;  1NBW A;  4U0Z A;  1CA6 A;  1D8L A;  4YCW A;  4JI3 Q;  3HKS A;  4CDC C;  4HSV A;  4A3F B;  2F0S A;  1I4Q A;  3GTK H;  1RTO A;  1L1O B;  2MO1 A;  1HHV A;  4A75 A;  1ASY A;  1HRJ A;  1ET9 A;  1FGU A;  4LW1 A;  2L0C A;  4BA1 I;  4F87 A;  2BCO A;  1PVO A;  1HZB A;  1NY4 A;  4P73 A;  2QDL A;  1STB A;  3KLR A;  3VR3 A;  1MKH A;  1V1P B;  2A8V A;  2C5C A;  2MFI A;  3HG9 A;  1K73 C;  2VW9 A;  3G48 A;  1Q46 A;  3MXP A;  2N8N A;  1SRU A;  3HKZ E;  3Q6S A;  4YHH L;  1SMX A;  4P71 A;  4LF4 Q;  2WV6 D;  3UDI A;  3RUZ A;  2HIV A;  2AKW B;  4DV6 L;  1ENC A;  1IBM L;  4N9P A;  4LUO A;  1I50 H;  2X6L A;  1K28 A;  1TS5 A;  3TS0 A;  3EQL C;  2TSS A;  1AZP A;  3I4M B;  2O4X A;  5T1I A;  4K2L A;  4GN5 A;  1CKN A;  3GTP B;  1MIU A;  4JI3 L;  3S2H H;  3SDZ A;  3M4Y A;  1AEX A;  4C3I G;  1E2Z A;  1HFN A;  5GAH C;  1N8R C;  1V1Q A;  2WP8 J;  1PYB A;  2K52 A;  3PCO B;  2EYL A;  3Q22 A;  3GTG B;  1CHP D;  2JA7 H;  3ITP A;  4BBS G;  1E2V A;  2F0L A;  4YWM A;  4R4I A;  3I8Z A;  1EY0 A;  4A3J G;  3GV3 A;  2JXM B;  4A3K G;  1XPU A;  2F1M A;  3I70 A;  2L12 A;  5KYI A;  1B1Z A;  1VQH A;  3I7F A;  1WTQ A;  2CW0 D;  2R6G A;  3UI2 A;  3N3U A;  2F0W A;  3W2D A;  3MEF A;  2FIN B;  2NVQ B;  1X3G A;  1H9J A;  4KV6 A;  5H1S E;  4LF4 L;  2E2J H;  4EQN A;  4A3D G;  1H9K A;  3K5O A;  4ZYS A;  2AWN A;  2KHJ A;  2J4X A;  4DV3 Q;  1A63 A;  5JFF A;  3CAM A;  2K5Q A;  3CF5 A;  5M5W H;  4KD4 A;  3ND9 A;  1XMQ Q;  3OOC A;  1SAP A;  1Q1E A;  2QA4 A;  1C4Q A;  1LLR D;  2EQS A;  5IYD H;  1BUV T;  3MXN B;  4XT3 B;  1GUN A;  5EAY A;  3GTK B;  2F0D A;  1F2L A;  1U4R A;  2KA7 A;  3TP8 A;  3HP3 A;  2R92 H;  2MGS A;  3GTJ H;  1DYQ A;  1HPC A;  2H1E A;  2D0O A;  2QIL A;  4RGT A;  3PO2 H;  2LSS A;  2A6H D;  4MZ9 A;  1A62 A;  3HKZ B;  3DM3 A;  4DAY B;  1TWC H;  2IHE A;  5C44 G;  2KBN A;  3KDF B;  1XNR Q;  3TDQ A;  3H3V I;  2QF7 A;  4J1M A;  3G6E A;  4BS9 A;  2KHI A;  1FNW A;  5JJ6 A;  1B8A A;  4K6L A;  2ZTC A;  1VQE A;  1LTR D;  1I6V C;  1BCP F;  2L15 A;  4JC0 A;  1KIX A;  4DA2 A;  3HOU G;  1I50 B;  3F2B A;  1LT6 D;  2DGY A;  2KED A;  2Z4H A;  3A56 A;  5FKA C;  4H13 C;  1SEB D;  5FK9 C;  1L1O A;  3K7A H;  2PI2 E;  2E8G A;  2QEX A;  1EQQ A;  3S2H B;  1K0S A;  2K05 A;  1Y8O B;  4BY7 H;  1EY6 A;  1JWM D;  5COR A;  1ILP A;  1NUC A;  1V1P A;  3G7L A;  1ML0 D;  1TY2 A;  2UXD Q;  2JA7 B;  3RNU A;  3FP9 A;  1UEA B;  2WKC A;  3S1M H;  2M2L A;  4HID A;  3CP0 A;  1M8A A;  4K8I A;  2XNA C;  4UAI A;  3X3N A;  1VQ8 A;  4KK7 A;  4RG1 A;  3PV0 A;  1GVP A;  4U07 A;  1EYG A;  1XNR L;  4LFA Q;  1VMC A;  1YNN D;  1SYD A;  5ELD A;  3GTO H;  3EJI A;  4A3L H;  2E2J B;  3RLN A;  1EFW A;  4OEM B;  3S1R H;  2RBM A;  1ENA A;  4RKB A;  3I4M G;  3CC7 A;  2AMC B;  4LUV A;  2RCN A;  5M5W B;  2K28 A;  1QE6 A;  2OQK A;  3KBG A;  1JJC B;  2EIF A;  1RJT A;  2F4I A;  1C0A A;  3BYY B;  5C6A A;  2SOB A;  5FLX c;  4S3S A;  4IFD J;  3NK9 A;  4IPG A;  3AYH B;  3FEW X;  1SYF A;  4FVM A;  1VQ7 A;  5CV7 A;  2OF1 A;  1LTA D;  2F0U A;  3K6O A;  2R92 B;  2UXD L;  1WTP A;  2YTY A;  1NR4 A;  4XI8 A;  1VQC A;  2NTS A;  4BWG B;  3OTO Q;  4B3S Q;  1BNZ A;  1XPR A;  2FJ2 A;  3U4Z A;  5IP7 G;  3M9B A;  1HNX Q;  4ZAI A;  1TWC B;  2KEC A;  1CA5 A;  1PH3 A;  3J81 E;  2IJ0 A;  4G7H C;  1A2U A;  3F2D A;  5G3L F;  3IFT A;  1I6H B;  2F0I A;  1I4H A;  4L5Q A;  4N67 A;  1EZ8 A;  1FVI A;  1PTO C;  4DK6 C;  3QIA A;  4GKK Q;  1K3B C;  4A93 G;  2O5J C;  1EY5 A;  1YJW A;  3I73 A;  3ULP A;  2E2H H;  1KDC A;  1RCV D;  3EBE A;  1GXD C;  4HJ8 A;  3HOY H;  1Q86 C;  2JJQ A;  4JI2 L;  3D4W A;  3MC0 B;  2NUC A;  3MXN A;  1JJG A;  4OGQ C;  1OXU A;  3F1Z A;  3CCE A;  3JAM c;  2QGQ A;  5JEA J;  1PRT C;  2OXP A;  4BY7 B;  4Q0F A;  3GTL H;  3IKJ A;  4DNR B;  1X55 A;  1SNC A;  1B7Y B;  3HS0 C;  2K7V A;  4E6I A;  1IL2 A;  4JOI C;  3F2U A;  3BVZ A;  2MP1 A;  1G8Z D;  4DAY A;  5DLQ E;  5FLM G;  5BN5 A;  4KN4 C;  4DAP A;  3SVM A;  3KDF A;  4P75 A;  2OEO A;  1DM0 B;  1NNX A;  1TY0 A;  1SRO A;  3OTO L;  2JA6 B;  4B3S L;  4LF8 Q;  2N88 A;  1H9S B;  1W2B A;  1HNX L;  4K0K Q;  2K4K A;  3DWQ A;  4K5X A;  4LF6 Q;  3KBX A;  5EBD A;  2G5D A;  3GTO B;  1DOK A;  4QJF A;  1J8I A;  3L0O A;  4H0L C;  3TS2 A;  2R93 G;  5IIF A;  4GKK L;  1U5K A;  1QIL A;  1I4R A;  4P72 A;  1BBX C;  3A7A B;  2RSO A;  3CUC A;  1IKL A;  2OCE A;  3BG3 A;  2Z6B A;  1ICF B;  3I72 A;  2ZXR A;  5KEE A;  1Z7T A;  2RHQ B;  1D2B A;  4LFB Q;  4PV1 C;  2HIX A;  4GS3 A;  3T13 A;  1MJE A;  1LUZ A;  4KKS A;  1IBL Q;  4IJH A;  4PMB A;  2JA7 G;  3GTM H;  3KJP A;  5GAG C;  3AMU A;  4DV1 Q;  1VDZ A;  3FPU B;  3QWN A;  4KJO A;  1VMP A;  1YHB A;  3GQB A;  3K5L A;  2K5W A;  3SHG A;  1AN8 A;  3NWS A;  1GHK A;  2FXQ A;  2L5T A;  1EQT A;  3BS1 A;  1II3 A;  1W6J A;  3BYT B;  3AQQ A;  4LF8 L;  2UUC Q;  3BZK A;  4DFA A;  4DR2 Q;  4K0K L;  2VQE L;  1HFG A;  1KRS A;  5C0X I;  2EY5 A;  2IX3 A;  4K14 A;  2CW0 C;  3H3V C;  2K04 A;  4LF6 L;  4DV0 L;  1ESF A;  1SJE D;  4APV A;  2HQL A;  2CQO A;  5HUR A;  3FMC A;  3DM1 A;  1Z47 A;  3U50 C;  2E2H B;  3HOW H;  2SEB D;  5IWA Q;  3HOY B;  1STG A;  4KY6 A;  3KF8 A;  2Z6K A;  3ND8 A;  1LT3 D;  1EQV A;  3H6M A;  3OWF A;  1GUS A;  5EPK A;  1CK1 A;  2F0K A;  1AE3 A;  3GTL B;  1E3P A;  1PH1 A;  1IBL L;  2A73 B;  1XNQ Q;  1D7Q A;  2R92 G;  2IHF A;  1GHJ A;  2FMM A;  4ILW A;  4X64 Q;  5M3F B;  1JQY D;  1I4G A;  3BVM A;  1PH4 A;  4DV1 L;  2Q2I A;  4GKJ Q;  2DJG C;  3ULL A;  4NP5 A;  4JI7 Q;  5EKL A;  1STH A;  2NWG A;  4HN7 A;  4XQQ A;  1I4X A;  4BBR H;  4H44 C;  4PZ6 A;  2OQ0 A;  4C1N K;  1WTV A;  4CJ0 B;  3E0J A;  3J81 L;  3PGZ A;  5M5Y B;  3V2T A;  2UUC L;  1IBK Q;  2EYJ A;  3BDL A;  3MTS A;  5CBA E;  1HTL D;  4L63 B;  2B63 B;  1BVS A;  5CC4 A;  4RAU C;  1WVL A;  2J0T D;  1CKM A;  2OT2 A;  2CH4 A;  4BXX H;  4AYB B;  1FGB D;  1E22 A;  4LF9 L;  5IWA L;  5L37 A;  1GUO A;  2YTX A;  1GO3 E;  4JK1 C;  1CFM A;  3E6Z X;  2UUB Q;  4BY1 B;  4A3C H;  1LYL A;  3NSW A;  4ABN A;  1V9P A;  4R8N A;  2ZTD A;  2R7D A;  4OHJ A;  3QB3 A;  1GUG A;  1KLU D;  1XNQ L;  2E74 C;  1VQM A;  2ZJP A;  3VDY A;  3TZD A;  3SR1 A;  4I7Z C;  4MTN A;  5FO8 B;  1H9S A;  3V96 A;  2XN9 C;  4X64 L;  1X54 A;  2F0E A;  3MHB A;  1E24 A;  3TZU A;  2JA6 G;  4GKJ L;  3CU7 A;  4JI7 L;  1STE A;  4X3T A;  2VL6 A;  3R93 A;  4CBV A;  5IT9 c;  2QDB A;  1Y1V H;  3K80 C;  5M3M H;  3A7L A;  4HCS A;  4ZKB B;  1K8G A;  4PMC A;  2HT1 A;  3K0X A;  1IBK L;  1WYD A;  1EWC A;  1VQL A;  3K59 A;  1YNN C;  3A8J E;  2KEE A;  1F2M A;  3HOW B;  3J80 E;  1HQR D;  4U67 3;  2ASB A;  3RD4 A;  2MJ8 A;  5JVG 3;  1B9N A;  2I0Q A;  2RDF A;  2AHO B;  2Z4I A;  5C5M A;  1D5X C;  3IL8 A;  2MNA A;  2I5M X;  1QZG A;  4MN3 A;  1U4M A;  2UUB L;  1ZXT A;  1HZ9 A;  5HY6 A;  4C3J H;  3M4O H;  5AFW A;  4OIK A;  4PY3 A;  4JYA Q;  2E2D C;  1QB5 D;  2Q2H A;  1A8V A;  5EU0 A;  1O80 A;  5AJ3 Q;  3VA5 A;  5IE8 A;  4DUZ Q;  1NTG A;  4XTC S;  3H0G B;  4DV7 Q;  3NXW A;  3SEB A;  4R8I A;  3A8I E;  1CSQ A;  1KAW A;  2BH2 A;  4BBR B;  3RZO H;  2BOS A;  1IYJ B;  2IL8 A;  5F2D A;  3K8A A;  5I9O A;  3L9A X;  5IGD A;  2ATW A;  2X6G A;  1PDQ A;  3T53 B;  5I4D A;  4YCV A;  1EIY B;  2WAQ B;  1DD2 A;  2E5L Q;  1SE4 A;  2EYO A;  4GN4 B;  1F9P A;  1JWU D;  3P7J A;  1M1K C;  5BN4 A;  4OWT B;  3J81 i;  4TVA B;  5CV4 A;  1FNU A;  5I2X A;  1OTC A;  1IKM A;  2AQ2 B;  2K5H A;  4CHT B;  2YU9 B;  4TQU S;  1VF7 A;  3BDO A;  3CRK C;  3D4R A;  3PO3 H;  1WCM G;  1CQF A;  3BDC A;  3HOZ H;  2Z9H A;  3H91 A;  1B2T A;  3ZJY C;  2FFK B;  1SNO A;  1G51 A;  4H02 A;  5M3F G;  4JYA L;  2R61 A;  4JCV E;  2IY5 B;  4KY7 A;  1JOK A;  2GA4 B;  4XIG S;  3S6A A;  5AJ3 L;  1BBW A;  3KLW A;  4DUZ L;  1VF5 C;  1X32 A;  3NBI A;  1STN A;  2Y0S G;  4DV7 L;  3ERS X;  1X65 A;  4KLK A;  3RLF A;  2R7Z H;  1S5D D;  1Y1V B;  1A3T A;  1PTO D;  2D2C C;  3ZCB A;  5NUC A;  5M3M B;  3P20 A;  5J22 A;  1BKB A;  4IUP A;  1K0R A;  1JOO A;  1EYD A;  2B63 G;  2QKI C;  1G6P A;  2NVT H;  4G57 A;  3HRZ C;  1U4P A;  2K03 A;  2NUN A;  3MFY A;  1KLG D;  4IPD A;  5C4J H;  2K01 A;  2UU9 Q;  4AYB G;  2E5L L;  3CHB D;  2VUM H;  1PMR A;  4DNT B;  1HNW Q;  4X62 Q;  5ELF A;  5C4X G;  1PRT D;  1GJX A;  2AUK A;  2N78 A;  4OWW B;  3CMA A;  4BY1 G;  4CKE A;  1LO5 D;  1RF2 D;  1T5E A;  1AH9 A;  4NDX A;  4QMG A;  1B44 D;  1IW7 C;  2JP1 A;  4PMW A;  2H4O A;  3K57 A;  4C3J B;  3M4O B;  2EZV A;  3DUZ A;  2I07 B;  1MI2 A;  5JJZ A;  1Y1W H;  5FJ8 H;  5D3D A;  5EPJ A;  1E1O A;  4A3I H;  1F9Q A;  4CJ2 C;  1ESR A;  3P1H A;  3S24 A;  5I2Y A;  3CKI B;  2MPM A;  2WB1 G;  3PUZ A;  4IFD H;  1UE7 A;  3PUW A;  1FL0 A;  4DF7 A;  3Q24 A;  4KHP Q;  2N49 A;  3RZO B;  3Q8D A;  1F9R A;  5M9O A;  1HJP A;  1DXM A;  1RTN A;  3QOL A;  1G2T A;  1STA A;  1BBU A;  4QIW E;  2AQ1 B;  2A69 C;  4ZLT F;  2L55 A;  4V19 0;  1XYI A;  2UXB Q;  4DV2 Q;  3J80 L;  2F3I A;  3T56 B;  2TMP A;  3WWV A;  4IZ8 A;  4F8M A;  1Q1B A;  3KJO A;  2UU9 L;  2I5L X;  2PQA A;  2PMZ B;  4DR6 Q;  1WD0 A;  4JG2 A;  1YNJ D;  4QUC A;  4X62 L;  1R9T H;  1HNW L;  1VQN A;  3ERO A;  1SYC A;  1AFP A;  3PO3 B;  3VYR A;  2Q8T A;  4Y7N H;  1C48 A;  1VQA A;  3H3V H;  1Z6H A;  5EPL A;  1HA5 A;  1YIJ A;  2JQO A;  4P2C B;  4H7B A;  1PTO B;  5CYU A;  4A4I A;  4C3H H;  1VQP A;  2RA4 A;  3H0G G;  2HQE A;  3T1Y Q;  1LM0 A;  2JA5 H;  1SNQ A;  1JC7 A;  1O78 A;  1PYS B;  2FMC A;  3S16 H;  3MXU A;  3UE1 A;  3MVV A;  3PIP A;  3IAY A;  3GTQ B;  4L8J A;  4P74 A;  2B39 A;  4OXP A;  4KHP L;  2NN6 H;  2R7Z B;  1BDO A;  2PNH A;  1PRT B;  1J5E Q;  3NWT A;  4F88 A;  1DGS A;  2B2T C;  2NVT B;  3VA7 A;  4QCL A;  2WAQ G;  5LL6 S;  1TVX A;  4PZ8 A;  3CCQ A;  1EU4 A;  4IFD I;  5C4J B;  4OWX B;  1S40 A;  2UXB L;  4DV2 L;  2K5D A;  2K50 A;  1N36 Q;  1HR0 Q;  2VUM B;  4LU4 A;  1XX8 A;  1HR0 W;  1QOH A;  3GD7 A;  2K32 A;  4U0S A;  4DR6 L;  2IW3 A;  3I4N H;  5KIX A;  3KYH C;  1EU3 A;  1CZG A;  4J8Q A;  1DCZ A;  4K5W A;  3F8T A;  3SE0 A;  4N8X 1;  2UXC Q;  1Y1W B;  3AB9 A;  1JE4 A;  5IGC A;  4A3I B;  4X6A H;  4DUY Q;  2ALY B;  3D8G A;  3D31 A;  3C1E A;  1S3O A;  3PSI A;  2JA8 H;  2HDM A;  2RHS B;  1L0Y B;  4L5S A;  1SYB A;  4QY7 A;  2JSO A;  4ALP A;  4JI4 Q;  3I91 A;  1J5E L;  3A54 A;  1QZH A;  1S5C D;  2CKZ B;  5D14 A;  1I94 Q;  3NP8 A;  1TWF H;  2LXJ A;  3KLS X;  2NZH A;  2G03 A;  1Y8N B;  2F0G A;  4M8A A;  4A3B H;  4DV3 L;  1G2S A;  4PQX A;  1SJH D;  1N36 L;  1Q12 A;  3PIO 3;  3EA6 A;  3M7N A;  2LMC B;  2NN6 I;  2SDF A;  1XMQ L;  1R9T B;  1EOV A;  2VQF Q;  4A3F G;  4Y7N B;  3J80 i;  3CCV A;  1EY7 A;  1QVG A;  4RCN A;  2UUA Q;  3UDX A;  4FXD A;  4RGO S;  4C3H B;  3SK6 A;  3TP6 A;  3HOX H;  2BE5 D;  2KCT A;  4DUY L;  5IGF A;  1O7L A;  1SNM A;  2JA5 B;  1SN8 A;  3S16 B;  2EYP A;  1YIT A;  5KGU A;  3H15 A;  4B08 A;  2B2V C;  4MHE A;  3CD6 A;  4LWC A;  5CV9 A;  5CGK A;  3QG1 A;  2F3W A;  4UP9 A;  4JI4 L;  2BDO A;  4ZUJ A;  4OO1 H;  1VQ9 A;  3C3L A;  4M1U B;  3JC6 6;  1I94 L;  4OX9 Q;  3S15 H;  4L5T A;  3MEH A;  4GNX B;  4JBJ A;  2KCM A;  5K5P A;  5IYC G;  3CCM A;  4YWK A;  1LT4 D;  4A76 A;  1AW7 A;  4CKB A;  3T4A C;  3EIV A;  1TU2 B;  2O2L D;  4WJ3 M;  3I4L A;  4A3G H;  2VQF L;  2YV5 A;  2VZA A;  2VNU D;  1R4P B;  3VR4 A;  4NW2 A;  3CXC A;  3STB D;  3RN5 A;  3DMU A;  4DR3 Q;  1YJ9 A;  3OIP A;  4IO9 A;  5E4W C;  5IGE A;  3E9I A;  1Q7Y C;  2UUA L;  1RHP A;  2JEA I;  3GTJ B;  1FNV A;  2VB3 X;  5FO9 B;  2PZW A;  3OHX C;  3S17 H;  3PO2 B;  2JA8 B;  1UE1 A;  4R4C A;  2R7Z G;  4KD3 A;  4GZY C;  2B2W C;  4JOI A;  3DXJ C;  3VR2 A;  2DNE A;  5HGQ A;  4X2E A;  3T51 B;  3F2C A;  5C3W A;  5IP9 G;  4LFA L;  3A8K E;  2ICI A;  3L7Z C;  1JIC A;  4CDD C;  5C4H A;  1IZ6 A;  1ZEQ X;  3S1N H;  1PH5 A;  5K36 G;  4DKA C;  1NMF A;  2ZJR A;  4OX9 L;  1JOQ A;  3BU2 A;  1QNU A;  2A68 C;  4HJA A;  1J9O A;  4U04 A;  1LTG D;  1RL2 A;  3K7A B;  1K8A C;  1D5Z C;  3CCS A;  1UE6 A;  5IYB H;  4GLV B;  4XXE A;  1SFO H;  3H09 A;  1Y69 U;  2E76 C;  4B9W A;  4ME5 A;  1B3Q A;  3IRB A;  4OO1 I;  5C0X H;  1VQK A;  1DOL A;  4EQO A;  4DR3 L;  4IN3 A;  4A3I G;  2KJX A;  3KF6 B;  1D5M C;  1XXG A;  2JYO A;  3S1M B;  2VXW A;  3MZ5 A;  3NBH B;  3HOX B;  2ICE C;  5ELB A;  3BZC A;  1Z9F A;  1VQ5 A;  3E9H A;  3HKZ G;  1TWG H;  5BR8 Q;  4PZ7 A;  4GOP C;  1WTX A;  1PZK D;  4WGJ A;  4JI0 Q;  5I6W A;  1Q81 C;  4X3S A;  4ZCK A;  1MSH A;  2F52 A;  5KNB A;  5CGL A;  3HOV H;  1KNE A;  2K5V A;  1SE8 A;  3RLO A;  1KHI A;  2XVS A;  3NQI A;  3S1R B;  4HMI A;  3ER0 A;  1K3R A;  1B9M A;  3ZC7 A;  2P5Z X;  3J81 c;  3OW7 A;  5I6Y A;  1Q8I A;  1FYC A;  2B2Y C;  1IW7 D;  3LGJ A;  4JBW A;  2EPB A;  3I4O A;  2EY6 A;  2NYZ D;  4R4O A;  4A3M H;  2N55 A;  4DAM A;  4A3G B;  1C9O A;  2A19 A;  5CMT A;  1YNJ C;  3I56 A;  4MTK A;  1HXY D;  5ELE A;  2ID0 A;  1FR3 A;  3M3Y H;  4CGY B;  3I3C A;  4I65 A;  4A3E H;  2L9H A;  1N34 Q;  1PFS A;  1PFN A;  3U4V A;  4IJL A;  1PFM A;  1B53 A;  4IAL A;  2DJF C;  3OWE B;  4KMU C;  1JB7 A;  3AEV A;  1PH8 A;  2KOL A;  3VYU A;  5BR8 L;  3TRE A;  5ELN A;  2A69 D;  4JV5 Q;  1Y14 B;  5EKI A;  1TS2 A;  4X2D A;  3GV6 A;  4U0U A;  3OPO A;  2F0F A;  4KI0 A;  1A2T A;  1O7Y A;  3A5U A;  4NPS A;  4R4Q A;  1PTO F;  2RSN A;  1S4Z A;  2JE6 I;  3TME A;  4OIJ A;  4B9X A;  1N33 Q;  3C46 A;  5JPM C;  4NMZ A;  2ZM6 Q;  1EWI A;  4QQB X;  1KTK A;  1U4L A;  4LFB L;  2F0Q A;  5IYD G;  3ULJ A;  2IPK D;  4LMQ D;  1PRT F;  2EDG A;  3LX0 A;  1SFO B;  4B3R Q;  3NTK A;  1NSN S;  2AUJ D;  4ULL A;  1P8L A;  4HED A;  4ZRZ A;  2AWO A;  2RDG A;  1DON A;  4EVO A;  5FOB B;  2EJM A;  4LF7 Q;  4C2M H;  1N34 L;  4GNX C;  2M9V A;  2ES2 A;  3PO2 G;  5JJL A;  4OON A;  2EJF C;  1OO9 B;  2I5H A;  3S2D H;  4NXM Q;  1TWG B;  4XYO A;  1WOC A;  2NVX H;  5I9P A;  4EQ5 A;  4C3I H;  4JV5 L;  2V4D A;  4DR2 L;  4X2C A;  3HOV B;  3HFZ B;  1EY8 A;  2PI2 A;  1EZ6 A;  2VY3 A;  3RMH A;  3CCL A;  3FRP B;  1VQF A;  2KCN A;  4OEL B;  3QO2 A;  4BBS H;  5EQ0 A;  1CUK A;  4YIJ A;  1B70 B;  3KLS A;  4A3J H;  1U0L A;  4A3K H;  1MBY A;  1QVF A;  2EE1 A;  1I5F A;  1N33 L;  1NAP A;  1MHW C;  2F0T A;  2E2I H;  4FDB A;  2HD3 A;  1C8C A;  2LKV A;  3R8B A;  2ZM6 L;  1HQM C;  3X3M A;  4BY7 G;  1HZC A;  3GDE A;  5JFZ A;  4RHS A;  3KF6 A;  4LUZ A;  3D3R A;  4B3R L;  3NBH A;  3M3Y B;  4A3D H;  2RKS A;  3GTM B;  4A3E B;  5EGT A;  5E1F A;  2RCF A;  4POF A;  3SK5 A;  4LF7 L;  4HJ5 A;  5KNC A;  4AIM A;  5EJW A;  4RH6 A;  1NCV A;  1VQI A;  2BE5 C;  2DN8 A;  4AH6 A;  2F4V Q;  1G6Z A;  1ROD A;  2ZJQ A;  1KAA A;  3BZD B;  4A3L G;  5C3X A;  2I46 A;  1ZYR C;  1WTW A;  1TWH H;  3SE5 A;  3DWA A;  5JJK A;  5M5X H;  1K8M A;  3D4D A;  4R1J A;  4FXG C;  2PQE A;  1A15 A;  4B3T Q;  1EYC A;  3AU7 A;  3PUY A;  1YHQ A;  1STY A;  2NBF A;  1SE3 A;  2G9H D;  5T1G A;  3CW2 C;  5E4X A;  5C44 H;  3SHL A;  4JI1 Q;  5GAE C;  3CPW A;  3TP5 A;  2L4N A;  1KRT A;  4Q5V A;  2BA0 A;  2L1B A;  3OMG A;  2MQH A;  3I90 A;  4J15 A;  1G91 A;  3HEJ A;  2QCP X;  1T9H A;  3LET A;  3HOU H;  3STB C;  1O7Z A;  3WOF A;  4TSS A;  4C2M B;  1XJV A;  1VQG A;  3CC4 A;  1CQV A;  2Z8L A;  4G4K A;  1NMG A;  2PYK A;  3W1B A;  2NVX B;  1KNA A;  1VQ6 A;  2KUM A;  1N9W A;  2B2U C;  3UDG A;  2NZO A;  1XPO A;  1PHJ A;  3E3X A;  3OIQ A;  2F4V L;  1GD7 A;  4DK0 A;  1F2Y A;  1LTS D;  5JJI A;  1CKO A;  1CSP A;  3G6J B;  4EX5 A;  1YBY A;  4ZQ3 A;  2HUG A;  5JAV A;  1WD1 A;  3PUV A;  1EYA A;  1PH6 A;  4XT1 B;  3HOY G;  4B3T L;  3OYY A;  3R2T A;  1L2F A;  4IQZ A;  1LTT D;  4IOC A;  2CVR A;  2KCC A;  3FHW A;  4XYQ A;  2E2I B;  3AFP A;  1NR2 A;  3L3O C;  4HCE A;  4JI1 L;  2D9U A;  4UY8 C;  2PW5 A;  2DY8 A;  1PH2 A;  3MFG A;  3J80 c;  3J7A V;  4KHZ A;  5JVH 3;  3KOJ A;  1EIH A;  4DN4 M;  3EFX D;  2HCI A;  3L2P A;  1YJN A;  3B6Y A;  5D3I B;  3I4M H;  3P75 A;  5DEH A;  3DWP A;  3C2P A;  1EEF D;  3ZYY X;  1QJO A;  3UDF A;  1H9R A;  2OTJ A;  1PZI D;  1VQJ A;  4X65 Q;  2A74 C;  3TSS A;  4FP5 D;  2CHB D;  5EBC A;  4IUV A;  3GTG H;  2EOT A;  2K6A A;  1JCK B;  2BH8 A;  1TWH B;  5E3F A;  4FF1 A;  4L5R C;  3NTI A;  3AFQ A;  3NHH A;  2EYM A;  4LAA A;  5M5X B;  4JW0 A;  2A68 D;  2XTI A;  1SYE A;  2A6E C;  1GM5 A;  1KDB A;  4UDU C;  3U9S A;  3SN9 A;  5CBE E;  5IP7 H;  4HSP A;  5C44 B;  5JJ7 A;  2L11 A;  4UP8 A;  3T16 A;  5COY A;  1VQ4 A;  4K6D A;  2EYF A;  3W1G A;  3K5M A;  3KK7 A;  1M90 C;  2K75 A;  1WTR A;  1E0B A;  1JWS D;  4X66 Q;  3CCJ A;  4ODG A;  4ZUI A;  4ID6 A;  4A3E G;  4A93 H;  2K5N A;  5DAU A;  1CTM A;  1PH7 A;  2C9O A;  3HOU B;  1TQO A;  1A0I A;  3CCR A;  1H9M A;  1HA6 A;  4DK1 A;  1NH1 A;  1LTL A;  5LMN Q;  5LMN W;  4DGZ A;  2LS0 1;  4JI8 Q;  4X65 L;  1JE5 A;  3FDT A;  3J7Y W;  1S5B D;  1OXS C;  3MA2 B;  1TWA H;  1GKH A;  4QUF A;  4DR1 Q;  1VQO A;  1LAC A;  2XRQ D;  2NUD A;  1EL0 A;  1B3A A;  4CKC A;  5FLM H;  3HOW G;  1CZW A;  1MSG A;  1QVC A;  1XTD A;  4N9T A;  1GUT A;  1JJ2 A;  1PXU A;  1KD1 C;  1FD7 D;  3ICE A;  1A3U A;  2B2T A;  4IPH A;  4RWS C;  1D1K A;  1N32 Q;  3NEL A;  3UE0 A;  5LMU Q;  3OMC A;  1YNX A;  4M16 A;  1EUJ A;  5CV5 A;  3NUC A;  5TSS A;  4X66 L;  1BCP C;  5ISR A;  4K8J A;  3HOZ B;  1WI5 A;  2R93 H;  3A0J A;  1D1I A;  1SR3 A;  2O5I C;  4FYD A;  5HGT A;  1PYW D;  3D0F A;  3J7Z C;  1M4V A;  2HHH Q;  2B29 A;  3DHQ A;  1UNS A;  5JEA H;  3K5N A;  1O7I A;  4RMF A;  1ASZ A;  4BBR G;  2JEB I;  1ENF A;  3M4Q A;  3ZLM A;  1VCI A;  1SDF A;  2IX0 A;  5LMN L;  4DK3 C;  1YEZ A;  1PLF A;  2VB2 X;  4RFB A;  4JI8 L;  3PMF A;  4C1N I;  1JR0 D;  3I2Z A;  4N8F A;  1JT8 A;  4IUQ A;  4RGM A;  4U68 A;  4DR1 L;  1LTB D;  3DLL A;  5ELC A;  4BXX G;  4HTH A;  1BO0 A;  4HIM A;  4JPB W;  5CKL A;  5LHY 1;  4POG A;  4EQP A;  2LXK A;  3GP7 A;  4GOP B;  1BQQ T;  1SMY D;  4A3C G;  1N32 L;  1S5E D;  5DM7 3;  1CM9 A;  3NPP A;  5LMU L;  4F7X A;  3URY A;  1ONL A;  1ET6 A;  1MJC A;  1YZ6 A;  4A93 B;  2BDN A;  2K14 A;  1Q82 C;  3DEP A;  2EXZ A;  4AQY Q;  1WTH A;  5KND A;  2CWP A;  4LF5 Q;  1SND A;  2HHH L;  3T1Y L;  1HNZ Q;  1JMC A;  2D62 A;  1T5X D;  3K81 C;  4JBM A;  1Q90 A;  2NB0 A;  1Y1V G;  4QIW B;  5M3M G;  4LFC Q;  1BR9 A;  1MD2 D;  1IHZ A;  3K58 A;  4MNO A;  4O42 A;  5GAD C;  2D0P A;  2EYH A;  3WOE A;  1EQR A;  3PQI A;  1TWA B;  1UUP A;  5A2Q E;  1A3V A;  4GN3 B;  3W3A A;  1F77 A;  2B8F A;  5KRU A;  2F03 A;  3E5S A;  1V8Q A;  1AZQ A;  1HR0 L;  2B2V A;  3E0E A;  1LV9 A;  2F0M A;  2GVB A;  2R3Z A;  1I6H H;  1TT2 A;  4C3J G;  3D6C A;  4NXN Q;  2KEN A;  2K33 A;  2XSC A;  4IUT A;  5FLX E;  2R93 B;  2UXC L;  2Q2U A;  2EJG C;  4AQY L;  2XIW A;  3BVG A;  2XWJ B;  4LF5 L;  4ME3 A;  1HNZ L;  2F0J A;  4HR7 B;  1WTO A;  4NKL A;  2IT1 A;  2XGT A;  3Q0A A;  2KVM A;  5EKK A;  1TS3 A;  1ZYR D;  5A35 A;  1KL9 A;  4LFC L;  2NVY H;  3HGB A;  2Z1C A;  3CRL C;  4CDF C;  1IL8 A;  1TII D;  3MWY W;  1P16 A;  4DNI A;  4DV4 Q;  2R7F A;  5CV6 A;  1BF4 A;  2H5X A;  2JA6 H;  2B2W A;  5JOB A;  3VR5 A;  4RHR A;  1QNK A;  2PZU A;  2CCZ A;  1MGS A;  5IGB A;  1SBB B;  2F0O A;  1HZA A;  3PO3 G;  3FVQ A;  4B3M Q;  3EN2 A;  3I4N B;  4UHV A;  1L1O C;  3HOZ G;  4WRD A;  3JAM E;  3QOJ A;  2LY7 A;  1EEI D;  4NXN L;  1BOS A;  2PCF B;  4KJN A;  4RKL A;  1CT1 D;  1X3Q A;  2J7Z A;  3NE5 B;  4JI2 Q;  5JPN C;  4IUN A;  3SGI A;  3WDN A;  3D6W A;  2C35 B;  3U9O A;  4DU9 A;  1IYV A;  1TKW B;  4GLX A;  3LWU A;  1E2W A;  1X3E A;  3KF8 B;  2V1C C;  2FHT A;  4XQJ A;  4DXF A;  3RZD H;  4KKU A;  4FF4 A;  1KAB A;  3G4S A;  3A5Z B;  4Y52 H;  1D6E C;  1TWF B;  1VQB A;  3M7G A;  4GOP A;  4WJW A;  1LTI D;  3OW2 A;  2VUM G;  4O2D A;  4NB3 A;  4Z9C B;  4A3B B;  4DV4 L;  1QWY A;  2F6S A;  4IUR A;  1YHA A;  2ZXP A;  2GN5 A;  2KHS A;  4FF3 A;  1SXT A;  3Q23 A;  5CV8 A;  3QJY A;  3VYT A;  1K8O A;  1U9R A;  1QUQ B;  5GQO A;  2RDH A;  3LNN A;  4WFN 3;  5C4Z A;  3MXG A;  4ZK9 B;  3DEO A;  1RIP A;  4B3M L;  2RVL A;  5DM6 3;  3IFD A;  1CHQ D;  1Y1W G;  4PNY A;  1SSO A;  5FJ8 G;  5C3E H;  4KN7 C;  4EGV A;  2B2Y A;  2B8G A;  4IFD G;  4G7Z C;  1IXR A;  4DR7 Q;  1TS4 A;  2WII B;  3O13 A;  4J6H A;  1H95 A;  4WJ4 A;  1HCZ A;  1EWH A;  2MUY A;  2WKD A;  1DZ1 A;  3S1Q H;  1V1O A;  3M85 A;  1WCM H;  1PZJ D;  2CH4 W;  5IGG A;  3OSO A;  2NVY B;  1VS0 A;  4DPG A;  1B4O A;  2A6E D;  2X69 A;  5A2Q L;  4PG3 A;  1RKN A;  5M3F H;  3NEM A;  2XRS D;  3K0Y A;  3S15 B;  2PPB C;  1A6X A;  4O0A A;  1I4P A;  1LAB A;  1X9N A;  4KKT A;  2VQE Q;  5ELO A;  5M5Y H;  2DUD A;  3LWE A;  5CR3 A;  4LNQ A;  1WJJ A;  3FKI H;  2F0N A;  4DXG A;  2K1B A;  4DV0 Q;  2Y0S E;  4X3K A;  4JI6 Q;  2B63 H;  4LJZ C;  1X6O A;  1CI3 M;  2F3V A;  5CMD A;  5FLX L;  1SNP A;  1JB3 A;  4C3H G;  1DOM A;  4JI5 Q;  2QW7 A;  4QGU A;  2DNC A;  5JEA G;  2JA5 G;  3HZX A;  5C4X H;  3S17 B;  1OXV A;  4AYB E;  4DR7 L;  1KDA A;  4BY1 H;  2NN6 G;  2CQA A;  4JI0 L;  1YVC A;  3CCU A;  2JK8 A;  1C7Y A;  3RZD B;  3PIO A;  4GNX A;  3TEH B;  4YCU A;  1L0W A;  1X56 A;  1EFI D;  2RF4 A;  3S1N B;  3ONA B;  4X3U A;  5IOC A;  1F2Z A;  2RQX A;  4HIK A;  2LFN A;  3I4N G;  1UEB A;  2WB1 E;  3SXH A;  4DV5 Q;  1BCP D;  1QG7 A;  1HUM A;  1SE2 A;  4KHV A;  1HTP A;  1R4Q B;  2BA1 A;  1EIG A;  3FPP A;  1SMY C;  3JAM L;  1PFB A;  4JI6 L;  2HDL A;  4R9W A;  3H94 A;  2ZTE A;  3K7U C;  5C3E B;  1K83 H;  1DJR D;  2F0V A;  4JI5 L;  4LF9 Q;  2YTV A;  1OXT A;  3BJU A;  3QR8 A;  2JA8 G;  3N6R A;  3I55 A;  3TBI B;  4HAE A;  2GVA A;  3C1F A;  1Y8P B;  1GUW A;  1GOZ A;  1HH2 P;  4ITR A;  1L0X B;  4UPA A;  2NZ1 D;  3S1Q B;  1V43 A;  1WCM B;  1SLJ A;  3NEN A;  5IT9 E;  1TXY A;  3KFU A;  2Q8I B;  3S9W A;  2EY1 A;  3RR5 A;  2CFM A;  4A3B G;  3CPF A;  3H0G H;  1QUQ A;  4YWL A;  1Q8K A;  1HUN A;  1FJG Q;  5C5L A;  1G29 1;  1ICW A;  1K9M C;  2PNR C;  2Y0S B;  2A6H C;  4FNF A;  3A55 A;  1EY4 A;  3FKI B;  2MHV A;  1WFQ A;  2Z6K C;  4A3M B;  4DV5 L;  3PF5 A;  3CQZ H;  2Q8R E;  3TRZ A;  2YYZ A;  4L6T B;  4I7A A;  3VYS A;  1YI2 A;  1UE5 A;  3PF4 A;  1E7Z A;  5E7N A;  1JOR A;  2PW7 A;  1B50 A;  3HOX G;  2OWO A;  1KQS A;  4TKO B;  2QEJ C;  3GO5 A;  1PV4 A;  2WAQ E;  1KC8 C;  5C4X B;  2YU9 H;  1RDP D;  2NTT A;  4HJ9 A;  4NXM L;  4DR4 Q;  3TP7 A;  2DY7 A;  1NJI C;  5DNF A;  1S5F D;  3S14 H;  2D5D A;  3V05 A;  4OO1 G;  1BCP B;  4GLA C;  1AE2 A;  4QF4 A;  1OXX K;  2A1A A;  4QB4 A;  5GRO A;  1QCB D;  2CWA A;  5J3B A;  1X3F A;  4IUU A;  3G71 A;  4RA8 A;  2WB1 B;  2B2U A;  5G3L D;  4DR5 Q;  1FJG L;  1NE3 A;  3N52 A;  1EIF A;  1VQD A;  4FF2 A;  5BN3 A;  4YY3 Q;  4A3G G;  3TQY A;  1LT5 D;  1BXT A;  1S72 A;  2ENB A;  1XMO Q;  3CC2 A;  2ZT9 C;  2IWH A;  1XWE A;  3PIP 3;  1KXL A;  3T1H Q;  3NQT A;  1PA6 A;  1K83 B;  4HIO A;  4LK1 C;  1I3Q H;  5IY0 A;  4OL7 A;  1EY9 A;  4IPC A;  5C0X J;  4BA2 I;  4KY5 A;  1TR5 A;  2AQ3 B;  2ZXO A;  3S2D B;  4IOA A;  3JAM i;  2PZT A;  4MIU A;  3NTH A;  1X3P A;  2E75 C;  4DR4 L;  2PQA B;  4A3F H;  4CJ1 B;  1RD9 D;  4C3I B;  1CKN B;  2WAC A;  5J39 A;  4JBK A;  3MAQ A;  2KQ3 A;  4JVZ A;  1XTC D;  3R2I A;  4FXK C;  4BBS B;  2A5H A;  4K5V A;  4O1N A;  2WIN B;  4A3J B;  2M00 A;  3J7A F;  4A3K B;  5FO7 B;  2HCC A;  4TRD A;  4DR5 L;  5IOD A;  1UAP A;  5IYB G;  1UWV A;  3EVQ A;  2JN4 A;  2F0H A;  4YY3 L;  4DAV A;  3VR6 A;  3SK8 A;  3CQZ B;  5C0X G;  3SK4 A;  3M4P A;  5C3E G;  1W3S A;  1XMO L;  2Z0S A;  4A3D B;  2EXD A;  1SYG A;  3T1H L;  4HMJ A;  1W6K A;  4C56 C;  5IYC H;  3U58 A;  3GTP H;  2XWB B;  2N3S A;  2PMZ E;  1PH9 A;  3J81 j;  1IYU A;  4XDX A;  1E1T A;  1J6Q A;  3HOV G;  3S14 B;  5IT9 L;  1PTO H;  3TN2 A;  4WOR A;  4G7O C;  4K2K A;  5D65 A;  2MO0 A;  4UP7 A;  1ZKO A;  2WFW A;  2SNS A;  2F0P A;  2G9D A;  4CDE C;  2SNM A;  2OTL A;  1F9S A;  2JA9 A;  3ERQ A;  2EVB A;  3W5O A;  2EY2 A;  4HJ7 A;  4RCO A;  4ZKC B;  1Q3L A;  4RGN A;  3GTQ H;  1AP0 A;  4FO2 A;  4QL5 A;  5KYL A;  4YHH Q;  3FKI G;  1ILQ A;  4R4T A;  1EOT A;  4A3M G;  4KTA A;  2NVQ H;  5LL6 X;  4XQN A;  2Q2T A;  4DV6 Q;  3A74 A;  1IBM Q;  3KUP A;  5IP9 H;  2IX1 A; 
#chains in the Genus database with same CATH homology
 2B3G A;  2VS1 A;  5BR8 Q;  3PUX A;  4PZ7 A;  4GOP C;  3RN2 A;  4WGJ A;  1V9P A;  4JI0 Q;  2ZTD A;  1Q81 C;  2R7D A;  2F52 A;  1HR0 L;  2UUB Q;  3E0E A;  3CME A;  1XNQ L;  1VQM A;  3J7A 5;  2ZJP A;  5CGL A;  2GVB A;  1NBW A;  4U0Z A;  3VDY A;  3HOV H;  2K5V A;  1I6H H;  1SE8 A;  4MTN A;  1KHI A;  3RLO A;  1D8L A;  4YCW A;  4X64 L;  4JI3 Q;  3HKS A;  1X54 A;  2JA6 G;  1E24 A;  4GKJ L;  4JI7 L;  3ER0 A;  4NXN Q;  1K3R A;  2KEN A;  3ZC7 A;  2VL6 A;  3GTK H;  3J81 c;  5IT9 c;  2MO1 A;  1L1O B;  1Y1V H;  3K80 C;  4A75 A;  1ASY A;  2UXC L;  1FGU A;  5M3M H;  2Q2U A;  4LW1 A;  4AQY L;  4JBW A;  3LGJ A;  1K8G A;  4BA1 I;  4LF5 L;  3I4O A;  2HT1 A;  1PVO A;  1HZB A;  1NY4 A;  4R4O A;  3K0X A;  4ME3 A;  4A3M H;  1WYD A;  4P73 A;  1IBK L;  4DAM A;  1VQL A;  1HNZ L;  1C9O A;  2A19 A;  5CMT A;  3I56 A;  1MKH A;  2A8V A;  2IT1 A;  2ID0 A;  2XGT A;  2MFI A;  3M3Y H;  1K73 C;  2VW9 A;  2ASB A;  1KL9 A;  3G48 A;  4LFC L;  2NVY H;  4A3E H;  1Q46 A;  2N8N A;  1N34 Q;  1PFS A;  1SRU A;  3U4V A;  2I0Q A;  4IJL A;  3HKZ E;  2AHO B;  1SMX A;  4YHH L;  4P71 A;  4LF4 Q;  2MNA A;  3UDI A;  2I5M X;  2HIV A;  2AKW B;  4DV6 L;  1P16 A;  1QZG A;  1IBM L;  1JB7 A;  4DNI A;  4DV4 Q;  2UUB L;  2R7F A;  4LUO A;  1PH8 A;  1HZ9 A;  3AEV A;  5BR8 L;  5HY6 A;  3TRE A;  2H5X A;  4C3J H;  2JA6 H;  1I50 H;  5ELN A;  3M4O H;  3TS0 A;  4JV5 Q;  1Y14 B;  4PY3 A;  4JYA Q;  4X2D A;  4U0U A;  2Q2H A;  1A8V A;  4KI0 A;  2CCZ A;  5EU0 A;  5AJ3 Q;  1HZA A;  3PO3 G;  3A5U A;  4NPS A;  3EN2 A;  4B3M Q;  4GN5 A;  4R4Q A;  1CKN A;  1NTG A;  5IE8 A;  4DUZ Q;  1L1O C;  4XTC S;  1MIU A;  4JI3 L;  3HOZ G;  4DV7 Q;  3S2H H;  2JE6 I;  1CSQ A;  1KAW A;  2BH2 A;  3RZO H;  1IYJ B;  4NXN L;  5GAH C;  1N8R C;  1V1Q A;  2WP8 J;  1N33 Q;  1PYB A;  2K52 A;  3PCO B;  4JI2 Q;  3K8A A;  2JA7 H;  2ZM6 Q;  4BBS G;  3SGI A;  2ATW A;  1EWI A;  4YWM A;  4R4I A;  4QQB X;  4LFB L;  4A3J G;  5IYD G;  3ULJ A;  2C35 B;  4B3R Q;  4A3K G;  4YCV A;  1EIY B;  1XPU A;  2E5L Q;  1P8L A;  4GLX A;  1X3E A;  1VQH A;  4GN4 B;  3KF8 B;  2AWO A;  3I7F A;  1M1K C;  4OWT B;  2R6G A;  4TVA B;  2V1C C;  3J81 i;  3N3U A;  3MEF A;  3RZD H;  4LF7 Q;  1OTC A;  1X3G A;  4C2M H;  3G4S A;  4GNX C;  1N34 L;  3A5Z B;  2K5H A;  2ES2 A;  3PO2 G;  4OON A;  5JJL A;  5H1S E;  2I5H A;  4TQU S;  4LF4 L;  2E2J H;  3S2D H;  4Y52 H;  1VQB A;  4GOP A;  4NXM Q;  3PO3 H;  4A3D G;  1WCM G;  1WOC A;  3OW2 A;  2NVX H;  4O2D A;  4NB3 A;  2VUM G;  2AWN A;  2KHJ A;  4DV4 L;  4EQ5 A;  2F6S A;  1HNW L;  4DV3 Q;  3HOZ H;  1YHA A;  1A63 A;  2GN5 A;  5JFF A;  3ZJY C;  3CAM A;  3CF5 A;  4C3I H;  4JV5 L;  1G51 A;  4H02 A;  5M3F G;  5M5W H;  4JCV E;  4DR2 L;  4X2C A;  4JYA L;  1QUQ B;  2IY5 B;  3HFZ B;  5GQO A;  1XMQ Q;  2PI2 A;  2VY3 A;  3S6A A;  4XIG S;  5AJ3 L;  1BBW A;  1RIP A;  3KLW A;  1Q1E A;  2QA4 A;  1VQF A;  3CCL A;  4B3M L;  4DUZ L;  4BBS H;  1CUK A;  2EQS A;  1B70 B;  2Y0S G;  4DV7 L;  4A3J H;  3ERS X;  1Y1W G;  1X65 A;  1U0L A;  3MXN B;  5FJ8 G;  5EAY A;  4A3K H;  4KLK A;  3RLF A;  5C3E H;  2R7Z H;  1QVF A;  3ZCB A;  1I5F A;  1N33 L;  2R92 H;  4IFD G;  1BKB A;  2E2I H;  1K0R A;  2B63 G;  4FDB A;  1G6P A;  3GTJ H;  2NVT H;  2ZM6 L;  1IXR A;  4DR7 Q;  4BY7 G;  1HZC A;  3GDE A;  1H95 A;  5JFZ A;  2D0O A;  3KF6 A;  4LUZ A;  3PO2 H;  4WJ4 A;  2LSS A;  4MZ9 A;  4IPD A;  1A62 A;  4B3R L;  5C4J H;  2UU9 Q;  3DM3 A;  4AYB G;  4DAY B;  1TWC H;  2IHE A;  1WCM H;  5C44 G;  3M85 A;  2E5L L;  2VUM H;  3S1Q H;  4A3D H;  2KBN A;  1VS0 A;  4DPG A;  3KDF B;  4X62 Q;  1XNR Q;  1HNW Q;  3H3V I;  5C4X G;  4POF A;  2N78 A;  3G6E A;  4LF7 L;  4OWW B;  3CMA A;  4BY1 G;  2KHI A;  4PG3 A;  5M3F H;  4HJ5 A;  5JJ6 A;  1B8A A;  3NEM A;  1AH9 A;  4AIM A;  2ZTC A;  1VQE A;  1VQI A;  4PMW A;  2L15 A;  4JC0 A;  1KIX A;  4O0A A;  3HOU G;  4AH6 A;  3F2B A;  2DGY A;  2F4V Q;  1X9N A;  1Y1W H;  5FJ8 H;  2ZJQ A;  2VQE Q;  5ELO A;  1E1O A;  5M5Y H;  4A3I H;  2DUD A;  4A3L G;  4LNQ A;  1WJJ A;  3FKI H;  1TWH H;  1L1O A;  3K7A H;  2Y0S E;  2PI2 E;  3S24 A;  3SE5 A;  4DV0 Q;  3PUZ A;  2WB1 G;  5M5X H;  2E8G A;  2QEX A;  4R1J A;  4JI6 Q;  2B63 H;  5JJK A;  1X6O A;  1EQQ A;  1UE7 A;  4B3T Q;  3PUW A;  1FL0 A;  4BY7 H;  4KHP Q;  2N49 A;  3PUY A;  3Q8D A;  1YHQ A;  4JI5 Q;  1HJP A;  4QGU A;  3CW2 C;  5JEA G;  5C44 H;  1BBU A;  4JI1 Q;  4QIW E;  2JA5 G;  2UXD Q;  5GAE C;  3RNU A;  3FP9 A;  3S1M H;  3CPW A;  5C4X H;  1KRT A;  1OXV A;  4AYB E;  4HID A;  2BA0 A;  4DR7 L;  3CP0 A;  5IYD H;  4BY1 H;  2MQH A;  2NN6 G;  2UXB Q;  4J15 A;  4DV2 Q;  2F3I A;  4JI0 L;  3WWV A;  1YVC A;  3CCU A;  2JK8 A;  1Q1B A;  3KJO A;  2UU9 L;  2I5L X;  1VQ8 A;  1T9H A;  3LET A;  1C7Y A;  3HOU H;  2PQA A;  4DR6 Q;  3PIO A;  4RG1 A;  3STB C;  3PV0 A;  1GVP A;  4JG2 A;  3TEH B;  4GNX A;  4U07 A;  4YCU A;  4X62 L;  1R9T H;  4LFA Q;  1XJV A;  1VQG A;  1L0W A;  1EYG A;  1XNR L;  3CC4 A;  3GTO H;  1VQN A;  1X56 A;  2RF4 A;  4A3L H;  3RLN A;  1EFW A;  1NMG A;  4Y7N H;  3W1B A;  3S1R H;  1VQA A;  3H3V H;  1VQ6 A;  1N9W A;  4HIK A;  1YIJ A;  2JQO A;  3UDG A;  2NZO A;  3CC7 A;  1XPO A;  1PHJ A;  2AMC B;  4A4I A;  2F4V L;  1GD7 A;  4C3H H;  4LUV A;  3I4N G;  1UEB A;  2RCN A;  2WB1 E;  3I4M G;  5JJI A;  1CKO A;  2OQK A;  1JJC B;  1CSP A;  4DV5 Q;  1VQP A;  2EIF A;  3H0G G;  4EX5 A;  3T1Y Q;  1YBY A;  1LM0 A;  2BA1 A;  2JA5 H;  1C0A A;  1PYS B;  3PUV A;  3S16 H;  1PH6 A;  5FLX c;  3UE1 A;  4JI6 L;  4IFD J;  3HOY G;  3PIP A;  2ZTE A;  3K7U C;  4B3T L;  3OYY A;  4P74 A;  1K83 H;  1L2F A;  4OXP A;  4KHP L;  4IPG A;  2PNH A;  3AYH B;  4JI5 L;  1VQ7 A;  4LF9 Q;  1J5E Q;  2YTV A;  1OXT A;  4IOC A;  3BJU A;  1DGS A;  3FHW A;  3AFP A;  4JI1 L;  4UY8 C;  2JA8 G;  2UXD L;  2YTY A;  3I55 A;  2WAQ G;  4XI8 A;  1VQC A;  3OTO Q;  2GVA A;  1PH2 A;  4B3S Q;  4PZ8 A;  1XPR A;  3J80 c;  3CCQ A;  1HH2 P;  4KHZ A;  3U4Z A;  4ITR A;  3M9B A;  5IP7 G;  4UPA A;  4OWX B;  1S40 A;  1HNX Q;  4IFD I;  2UXB L;  4DV2 L;  1V43 A;  2K50 A;  1SLJ A;  3KOJ A;  1N36 Q;  1HR0 Q;  4LU4 A;  3NEN A;  1HR0 W;  3GD7 A;  1PH3 A;  4U0S A;  3F2D A;  1YJN A;  3L2P A;  3B6Y A;  4DR6 L;  1TXY A;  3KFU A;  3I4M H;  3I4N H;  3RR5 A;  4L5Q A;  4N67 A;  3KYH C;  1FVI A;  2CFM A;  4A3B G;  4DK6 C;  4GKK Q;  3CPF A;  3H0G H;  4A93 G;  1QUQ A;  3UDF A;  1YJW A;  4YWL A;  1Q8K A;  3ULP A;  2OTJ A;  2E2H H;  1FJG Q;  1VQJ A;  4X65 Q;  3F8T A;  1G29 1;  3EBE A;  4HJ8 A;  1K9M C;  3HOY H;  1Q86 C;  2UXC Q;  2JJQ A;  4JI2 L;  3GTG H;  4X6A H;  1JJG A;  4DUY Q;  2ALY B;  1OXU A;  2Z6K C;  1WFQ A;  2BH8 A;  3F1Z A;  4DV5 L;  4L5R C;  3PF5 A;  3AFQ A;  3CQZ H;  3D31 A;  3JAM c;  3CCE A;  1S3O A;  3PSI A;  2QGQ A;  2XTI A;  5JEA J;  3TRZ A;  2YYZ A;  2JA8 H;  1GM5 A;  2RHS B;  3GTL H;  4L5S A;  1X55 A;  1YI2 A;  1B7Y B;  4QY7 A;  1UE5 A;  3PF4 A;  1E7Z A;  5E7N A;  3SN9 A;  5IP7 H;  4JOI C;  3HOX G;  2OWO A;  1KQS A;  1IL2 A;  4ALP A;  3GO5 A;  1PV4 A;  2WAQ E;  4JI4 Q;  5JJ7 A;  1KC8 C;  1J5E L;  5DLQ E;  5FLM G;  4UP8 A;  1QZH A;  1VQ4 A;  2CKZ B;  3W1G A;  2YU9 H;  3KDF A;  1M90 C;  2K75 A;  4P75 A;  4HJ9 A;  1I94 Q;  4NXM L;  3CCJ A;  4X66 Q;  1TWF H;  4DR4 Q;  2LXJ A;  1SRO A;  2NZH A;  2G03 A;  3OTO L;  4B3S L;  1NJI C;  4A3E G;  4A3B H;  4LF8 Q;  4A93 H;  4DV3 L;  2K5N A;  3S14 H;  1HNX L;  1W2B A;  4K0K Q;  2K4K A;  1N36 L;  1Q12 A;  1PH7 A;  3M7N A;  2NN6 I;  4LF6 Q;  4OO1 G;  4GLA C;  1XMQ L;  1A0I A;  3CCR A;  1EOV A;  2VQF Q;  1AE2 A;  1OXX K;  4QJF A;  4A3F G;  1LTL A;  2A1A A;  3L0O A;  5GRO A;  3TS2 A;  2R93 G;  2CWA A;  5J3B A;  5LMN Q;  1X3F A;  4GKK L;  1U5K A;  3G71 A;  3J80 i;  5LMN W;  3CCV A;  4DR5 Q;  4P72 A;  1QVG A;  4JI8 Q;  1FJG L;  3CUC A;  1NE3 A;  2OCE A;  1EIF A;  4X65 L;  1JE5 A;  2UUA Q;  1VQD A;  3UDX A;  4YY3 Q;  4A3G G;  2RHQ B;  3TQY A;  1OXS C;  2IX1 A;  3HOX H;  1TWA H;  1S72 A;  1GKH A;  1VQO A;  2KCT A;  4DUY L;  4DR1 Q;  4LFB Q;  5FLM H;  3HOW G;  2HIX A;  1SN8 A;  1XMO Q;  3CC2 A;  4GS3 A;  1QVC A;  1YIT A;  1XTD A;  1MJE A;  1LUZ A;  1JJ2 A;  1KD1 C;  4IJH A;  1IBL Q;  1KXL A;  3T1H Q;  1PA6 A;  4HIO A;  5IY0 A;  1I3Q H;  3H15 A;  2JA7 G;  3GTM H;  3ICE A;  4IPC A;  3KJP A;  5C0X J;  4BA2 I;  3CD6 A;  4LWC A;  4IPH A;  5GAG C;  1N32 Q;  3NEL A;  4DV1 Q;  3UE0 A;  5LMU Q;  4UP9 A;  1YNX A;  4JI4 L;  4M16 A;  1EUJ A;  4IOA A;  1YHB A;  3JAM i;  3SHG A;  1VQ9 A;  2FXQ A;  3JC6 6;  1I94 L;  4OX9 Q;  3S15 H;  4X66 L;  4L5T A;  2PQA B;  4A3F H;  4DR4 L;  1WI5 A;  4GNX B;  4JBJ A;  2R93 H;  2KCM A;  3A0J A;  5IYC G;  1SR3 A;  3CCM A;  3AQQ A;  4LF8 L;  1CKN B;  2UUC Q;  4YWK A;  3BZK A;  3D0F A;  3J7Z C;  4A76 A;  4JBK A;  4DR2 Q;  4K0K L;  2HHH Q;  2VQE L;  2B29 A;  1KRS A;  5C0X I;  3EIV A;  4LF6 L;  1O7I A;  4WJ3 M;  4RMF A;  4DV0 L;  1ASZ A;  4A3G H;  4APV A;  4BBR G;  2VQF L;  2JEB I;  2YV5 A;  2VZA A;  2HQL A;  3M4Q A;  2CQO A;  3ZLM A;  1VCI A;  2VNU D;  2IX0 A;  3CXC A;  5LMN L;  1Z47 A;  3STB D;  3U50 C;  3RN5 A;  4DR3 Q;  3HOW H;  4DK3 C;  4DR5 L;  5IWA Q;  1YEZ A;  1YJ9 A;  4JI8 L;  4IO9 A;  3E9I A;  1Q7Y C;  2UUA L;  5IYB G;  2Z6K A;  2JEA I;  1UWV A;  4YY3 L;  3I2Z A;  1JT8 A;  4DR1 L;  3S17 H;  5C0X G;  3M4P A;  3DLL A;  1UE1 A;  5C3E G;  1AE3 A;  1W3S A;  4R4C A;  1XMO L;  2Z0S A;  2R7Z G;  4BXX G;  2EXD A;  1E3P A;  1PH1 A;  1IBL L;  4JOI A;  4HIM A;  3T1H L;  5HGQ A;  1XNQ Q;  5CKL A;  4POG A;  2R92 G;  1D7Q A;  2LXK A;  4X2E A;  3F2C A;  4GOP B;  4A3C H;  5IYC H;  2IHF A;  5IP9 G;  4LFA L;  4X64 Q;  3U58 A;  3L7Z C;  1PH4 A;  4A3C G;  1N32 L;  4DV1 L;  2Q2I A;  5LMU L;  4GKJ Q;  3GTP H;  3ULL A;  1IZ6 A;  4JI7 Q;  2N3S A;  2PMZ E;  1PH9 A;  3S1N H;  3J81 j;  1PH5 A;  5K36 G;  4BBR H;  1MJC A;  4DKA C;  1NMF A;  1YZ6 A;  1E1T A;  4PZ6 A;  1J6Q A;  2K14 A;  2OQ0 A;  3BU2 A;  2ZJR A;  4OX9 L;  3HOV G;  1TWG H;  1Q82 C;  4AQY Q;  4HJA A;  3PGZ A;  2CWP A;  2UUC L;  4LF5 Q;  4U04 A;  2MO0 A;  1RL2 A;  1IBK Q;  4UP7 A;  2HHH L;  1K8A C;  3T1Y L;  3CCS A;  1HNZ Q;  2WFW A;  1UE6 A;  5IYB H;  4GLV B;  1SFO H;  1JMC A;  1BVS A;  2D62 A;  2JA9 A;  2OTL A;  3K81 C;  4JBM A;  3W5O A;  3IRB A;  1Y1V G;  1CKM A;  5M3M G;  4HJ7 A;  4OO1 I;  4LFC Q;  1VQK A;  3GTQ H;  4DR3 L;  4BXX H;  4QL5 A;  4A3I G;  4MNO A;  1E22 A;  4LF9 L;  5IWA L;  5GAD C;  4YHH Q;  3FKI G;  2D0P A;  4R4T A;  4A3M G;  3KF6 B;  2NVQ H;  1EQR A;  1GO3 E;  2YTX A;  3NBH B;  2Q2T A;  4DV6 Q;  3A74 A;  1IBM Q;  3BZC A;  1Z9F A;  1VQ5 A;  4GN3 B;  3E9H A;  3HKZ G;  5IP9 H;  1LYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...