2JK8A

Type iv secretion system effector protein bepa complexed with a pyrophosphate moiety
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
291
structure length
291
Chain Sequence
EIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCSHDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMPEMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHPFREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDISNPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYIIGNIDHLPPEQLKILKPGDKITFTAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fic Domain Catalyzed Adenylylation: Insight Provided by the Structural Analysis of the Type Iv Secretion System Effector Bepa.
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Cell adhesion
molecule keywords PUTATIVE CELL FILAMENTATION PROTEIN (BEPA PROTEIN)
total genus 90
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 2jk8A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2jk8A02
4DR5Q 5EU0A 1C9OA 1I94Q 3OYYA 3CUCA 4NXML 1PFSA 4LFAQ 1QVCA 1FGUA 1XPUA 4UY8C 1Z47A 1LTLA 4JI8L 1MKHA 2CWPA 4EX5A 1PH3A 4JI5Q 3GDEA 4N67A 4QY7A 2LXKA 4HIMA 1XMQQ 2HIVA 5JJ6A 4A76A 1JMCA 4X65Q 1AE2A 2VUMH 1L1OB 4DNIA 3EBEA 1HNXQ 3L7ZC 4JI6Q 4LF5L 4A3DG 4GLAC 1RIPA 1OXSC 1HZCA 3DLLA 3CCQA 3RLOA 4IOCA 2K5HA 2JA7H 5FJ8G 4OX9Q 2DUDA 3D31A 3H0GG 3HKZG 3F2BA 2R93G 4POGA 5IP9G 2B29A 3SE5A 2FXQA 1Z9FA 3GTPH 2YV5A 4KI0A 4UPAA 1WFQA 2CKZB 3U4ZA 4DR1Q 2K4KA 4JBKA 4C3IH 4DV1Q 1YJ9A 3T1YL 1MJCA 4JV5Q 1EOVA 4A93G 1X55A 1WJJA 2MO0A 4DK6C 1K8GA 5K36G 2K75A 4LW1A 1VQGA 4OXPA 1NBWA 2VUMG 2UXDL 4A3DH 5LMUQ 4HJ8A 2OQKA 1XMQL 1PH4A 4DUZL 1HH2P 4LUZA 2WB1G 1U5KA 4JC0A 4NPSA 1KRTA 4YHHQ 4DR1L 2UU9L 1WYDA 5IP9H 3S14H 5JJLA 1YZ6A 2R92H 3F2CA 5C3EG 4GNXB 4HJ5A 3I55A 1WI5A 1PYBA 2ZTCA 4DR3L 1IBKQ 1NY4A 4LF8Q 1TXYA 2WAQG 4JI3Q 5BR8Q 2HT1A 2EXDA 5LMUL 1KXLA 2NZHA 4X2DA 2AHOB 1E22A 3CPFA 4GN5A 1CKMA 3UE1A 1JB7A 5GAGC 4DV3L 2A19A 4LWCA 3HOWH 3FKIH 2KHJA 4DR2Q 1QUQA 2I5HA 1FVIA 5JEAG 2E2HH 2NVYH 3U4VA 1X9NA 3CQZH 3M4QA 2UXCL 1ASZA 2XGTA 2UU9Q 4BBSH 4JOIA 3U58A 1CKOA 3RR5A 4A3EH 4A3JG 1XPOA 3CAMA 4IFDI 3HOUG 1HNWQ 1JT8A 4HJ9A 5FLMH 2Y0SE 5GADC 4JG2A 4RMFA 5C4JH 3CCRA 3CMAA 2F4VL 3ERSX 4JV5L 1CKNA 2ID0A 4X66Q 2H5XA 3CMEA 4LF4Q 2G03A 3PUXA 1VQEA 2NN6I 3BJUA 1Y1WG 4B3SL 2JA8H 1XMOQ 3CW2C 5HY6A 2K50A 3M3YH 4KLKA 3CCLA 3PIPA 1R9TH 4LF5Q 5LMNL 2K14A 2ZJRA 4IJHA 3PO2G 5C0XJ 3L0OA 4AYBG 3T1YQ 1KD1C 3HOVH 2VQFQ 2Z6KA 1YVCA 3AFQA 3K7AH 4DV5L 5IWAQ 2YU9H 1Q7YC 4A3LG 2B3GA 4LFAL 1HZ9A 1UEBA 5CMTA 3K8AA 2AWOA 1VQAA 1WOCA 2D62A 1TWFH 1UE7A 4DR4L 2HHHQ 4DR6Q 1EIFA 3S2DH 3I4NG 4X66L 4LF4L 1D7QA 3MXNB 5GAHC 1CSQA 1HNXL 4A75A 5JFFA 1BKBA 2R6GA 1A62A 1YEZA 1YHAA 3J80c 2VQFL 3PUZA 5DLQE 3ULPA 1VQ4A 2CCZA 1YIJA 4OX9L 3S1NH 4U0UA 3EIVA 3KLWA 5C44H 4IOAA 2UXBQ 1I5FA 5J3BA 3I4NH 1VQJA 3SHGA 1YNXA 1EQRA 2CQOA 3CCUA 1N36Q 4BXXH 3NEMA 5HGQA 4A3GG 2NVTH 2PNHA 1B7YB 2NZOA 5IY0A 2AMCB 4R4QA 4A3BG 3A5UA 3UE0A 1JE5A 2GN5A 4FDBA 1UWVA 3J81j 4A3KH 1XNRQ 2Q2TA 2UUBL 2WP8J 3I4MH 2F52A 3NBHB 2HIXA 3GTJH 4LF7Q 4JI7L 2Z6KC 4DV6L 1HR0Q 1VQFA 3ICEA 4C3HH 4EQ5A 2C35B 4JI1Q 4DV4Q 1OXXK 3OW2A 3AYHB 4YCUA 4DAYB 3FP9A 4TVAB 4O0AA 4UP8A 4JI5L 2GVAA 3I7FA 2VL6A 2Q2IA 3KF8B 4DUYL 3RNUA 2B63G 2K52A 4LFBL 1VQLA 4L5QA 4GNXC 3CD6A 4LNQA 1PVOA 4IPHA 1HZAA 1W3SA 3SGIA 2OQ0A 2RHQB 2PI2E 4X62L 1IXRA 1MJEA 4IFDJ 4XIGS 2UXCQ 4A3JH 1PH8A 2E8GA 1VS0A 1T9HA 1FL0A 5GAEC 1X56A 2VQEQ 2IX1A 3ZJYC 4A3FH 1QZHA 3JAMi 3PO3G 4ME3A 3K7UC 5GQOA 4AQYQ 1AH9A 1Q8KA 3PF4A 5IYDH 3HFZB 4OWXB 4AIMA 1YHBA 1PH7A 3A0JA 3CCEA 1KQSA 4A3MG 3PO2H 2KENA 1HZBA 4X65L 1NMGA 1SFOH 2JJQA 4LFCL 1VQ6A 3LGJA 3OTOL 1Y14B 3ER0A 2AWNA 3STBD 2EIFA 1XMOL 2L15A 2YYZA 4JI8Q 3CXCA 1M1KC 1LUZA 1YJWA 1IBMQ 4AQYL 2I5MX 1RL2A 1HNZQ 4U0SA 2A8VA 3J7ZC 3G6EA 3S1MH 3ZLMA 1Q46A 3VDYA 1PA6A 1N33L 1CUKA 1S72A 4PZ8A 1KRSA 1EUJA 5IWAL 2ALYB 1H95A 3UDGA 1Q86C 2R7FA 3W1GA 1BBWA 4A3MH 3BU2A 2KCTA 3UDXA 5M3FH 1IL2A 3S2HH 3KJOA 2JA6H 3KJPA 2E2IH 4YWMA 2PMZE 3PUVA 1A0IA 4MZ9A 1K0RA 4BY1G 3TQYA 5H1SE 1X6OA 2PQAB 2VS1A 4X64L 4DV4L 3HOXH 4DAMA 2WB1E 4BXXG 2R93H 1GVPA 1A8VA 1SROA 5IYBG 3BZCA 1EWIA 2MO1A 2ZM6L 1K73C 5M5YH 2E5LQ 2JA7G 2OTJA 5FJ8H 2MFIA 4B3ML 2NN6G 4GOPB 3PGZA 2IHFA 2ASBA 2E2JH 3ULLA 4LF6L 1Q1EA 1UE6A 3STBC 1K8AC 1GD7A 2JA5G 4PG3A 1J5EQ 1UE1A 1P16A 5C0XG 1PH2A 4R4TA 1VQ8A 3PUWA 4O2DA 4GNXA 3HKZE 4P75A 1N9WA 3A5ZB 4R1JA 1I94L 4YY3L 4NB3A 4X2CA 1BVSA 1ASYA 4OWTB 4DR3Q 5C4XH 1FJGL 1NTGA 2N78A 2D0PA 4GKJL 2QGQA 2RHSB 1K83H 1QUQB 3M4PA 4DV5Q 3E9HA 4L5SA 2UUAQ 1OTCA 2VNUD 4C2MH 1VQCA 1VQMA 4YCVA 4A4IA 1K3RA 1YJNA 1G291 2D0OA 1G51A 4BBRG 4JYAQ 4KHPL 5C0XI 4JCVE 1IBLQ 2UXDQ 3GO5A 1N33Q 2R7ZG 1MIUA 1OXUA 2UUBQ 1BBUA 1TWGH 2YTYA 2XTIA 3CPWA 3NENA 2ZJQA 2QA4A 4DR7L 3K80C 3TEHB 3BZKA 3DM3A 3TS0A 4YY3Q 1HR0W 5JEAJ 5M3MH 3CCVA 3T1HL 2JEBI 1SE8A 4NXNL 4A3LH 3PIOA 4LUOA 1CSPA 1AE3A 3JAMc 2Q2UA 4RG1A 2I0QA 1SLJA 5FLXc 2QEXA 4BBSG 4ITRA 3UDIA 4DV0L 2KCMA 2MQHA 4UP9A 1KL9A 4APVA 2ZTEA 2JE6I 4JBWA 1S3OA 1W2BA 1O7IA 1PH9A 4JI0Q 1E3PA 1OXTA 3S17H 3J80i 2I5LX 2N49A 3GD7A 4GOPC 1KHIA 3K81C 2V1CC 1YITA 1HR0L 4A3CH 1I6HH 4WJ4A 3RLFA 4LF8L 2N8NA 1VQPA 1Q82C 4DV3Q 1QZGA 1EFWA 4IFDG 4YWLA 3HOVG 2IY5B 4P74A 3T1HQ 3TREA 3H15A 4OO1G 4HJAA 2Z0SA 4R4IA 1HNZL 2JA8G 4XI8A 4JI4Q 1M90C 4AH6A 4DUYQ 3M85A 3NELA 3E0EA 3PO3H 2B63H 2K5VA 3OTOQ 3AQQA 3CP0A 5M5XH 4BY1H 2NVQH 1X54A 5EAYA 4B3RQ 1IBLL 4L5RC 4IPGA 1TWHH 4R4OA 1VQ5A 2BA1A 4JI6L 1XTDA 1KIXA 4KHZA 4YCWA 5IYBH 1V1QA 3KDFB 4OONA 3RN2A 3N3UA 3IRBA 1K9MC 3E9IA 2YTVA 3S15H 1C0AA 1VQBA 4JOIC 4IPDA 3CC2A 1SN8A 3AEVA 5GROA 4C3JH 1VQ7A 4B3SQ 3RLNA 4POFA 1IYJB 1EQQA 4MTNA 2ES2A 2UUCL 4GKKL 4DV7Q 2LXJA 2PQAA 5M5WH 2CWAA 4QL5A 5IP7H 4QQBX 4YWKA 1XNQQ 3HOWG 4X6AH 3FKIG 4BBRH 1VQNA 1X3EA 3G48A 5ELNA 1SRUA 2MNAA 3M9BA 2GVBA 2R7DA 3TS2A 3I56A 4A3IG 1GKHA 1N32Q 2Y0SG 5IP7G 3KF6B 5AJ3L 1I3QH 4A3KG 4B3MQ 4A3CG 3J7A5 1VQ9A 2BH2A 2ATWA 4ALPA 1FJGQ 1XPRA 1PHJA 4A3BH 2UUCQ 3FHWA 3J81i 4DV7L 2N3SA 1WCMG 4PZ7A 2HHHL 1VQIA 4DR6L 4GN3B 2WAQE 1GM5A 3PSIA 1TWAH 1QVGA 3TRZA 2JQOA 2IX0A 3PV0A 4GN4B 4R4CA 4IO9A 5IYCG 3S1QH 5CGLA 4DV0Q 3G4SA 4DV2L 5LMNW 2RCNA 2VW9A 1S40A 4LFCQ 4GKKQ 1N32L 1LM0A 3HKSA 3J81c 2JA5H 1B70B 3HOUH 4DK3C 2NVXH 1HNWL 5BR8L 1KC8C 1N34L 4JI2L 3K0XA 3KYHC 1E7ZA 1N36L 4LF9Q 5JJKA 3I4OA 4LFBQ 3JC66 1L0WA 4GS3A 5IYCH 1WCMH 1Y1VG 4BA2I 1JJGA 4PMWA 3D0FA 1C7YA 1IBML 1VQKA 1Q81C 4OWWB 3S1RH 4YHHL 4BY7G 1D8LA 2OWOA 2BH8A 1J6QA 1E1TA 4NXMQ 4LU4A 1CKNB 2JA6G 3S16H 1L1OA 2JA9A 4P73A 1VQOA 5M3FG 3M4OH 5LMNQ 1L1OC 4L5TA 2UXBL 4X2EA 4QJFA 4JI3L 4DV6Q 1TWCH 1X3GA 2WFWA 5CKLA 4BY7H 5IYDG 1UE5A 3ULJA 2K5NA 5C3EH 3Q8DA 4GKJQ 4U04A 3CCMA 3PF5A 4JBMA 3PUYA 4LF9L 4TQUS 2Q2HA 1KAWA 1OXVA 1Q1BA 4DR4Q 2IT1A 2IHEA 4DUZQ 2HQLA 4JYAL 3HOZH 4KHPQ 5C44G 1NJIC 1YBYA 4P72A 3ZC7A 3A74A 4PZ6A 2RF4A 4X62Q 5M3MG 1EIYB 4B3TL 1XNRL 4LUVA 1JJCB 1J5EL 2JEAI 1SMXA 4IPCA 4DPGA 4U0ZA 3HOZG 3WWVA 3H3VI 5ELOA 2KHIA 5IE8A 2OCEA 3L2PA 4GOPA 1X65A 4HJ7A 4A93H 4K0KL 2YTXA 3HOXG 2E5LL 3H0GH 2F4VQ 2ZM6Q 2VQEL 3EN2A 3MEFA 4J15A 1LYLA 3CCSA 3GTGH 3GTMH 3PCOB 4HIOA 1IZ6A 1VCIA 3U50C 1E1OA 2AKWB 3RN5A 3LETA 2BA0A 3I2ZA 3CC7A 4IJLA 4A3IH 2A1AA 1DGSA 1U0LA 3HOYH 2UUAL 1E24A 1X3FA 4GLVB 1Q12A 1PH5A 1EYGA 4B3RL 1V9PA 4H02A 4DV2Q 3CC4A 4OO1I 1G6PA 3G71A 3M7NA 5E7NA 2KBNA 1V43A 2OTLA 3GTLH 2LSSA 1NMFA 4DV1L 3KDFA 1VQDA 2R92G 1XNQL 4DR2L 2JK8A 1PH6A 1SR3A 5C4XG 1HJPA 4U07A 3B6YA 5JFZA 1Y1WH 1PV4A 2DGYA 4A3GH 4WJ3M 3S6AA 4K0KQ 3CF5A 2VY3A 2EQSA 5AJ3Q 2VZAA 2F3IA 3UDFA 4JI7Q 2F6SA 3W5OA 1B8AA 1I50H 1A63A 1NE3A 1PH1A 3HOYG 3I4MG 4Y7NH 3F8TA 3F1ZA 4M16A 1XJVA 4HIKA 2ZTDA 4A3FG 3RZDH 4A3EG 3KF6A 4Y52H 5JJIA 2PI2A 1YI2A 4X64Q 4BA1I 4DKAC 5JJ7A 3SN9A 3CCJA 4HIDA 4JI1L 1Y1VH 2ZJPA 3ZCBA 3KOJA 3W1BA 1PYSB 4XTCS 4DR5L 2R7ZH 5IT9c 4JI0L 1L2FA 4UP7A 3H3VH 4NXNQ 1N8RC 3S24A 3GTOH 3AFPA 5FLMG 1VQHA 4PY3A 4MNOA 4JI2Q 2CFMA 4GLXA 1YHQA 1N34Q 3GTKH 3KFUA 4B3TQ 4AYBE 1P8LA 4JI4L 4LF6Q 4JBJA 1QVFA 4QGUA 1GO3E 3RZOH 3GTQH 1IBKL 3F2DA 4P71A 4LF7L 4DR7Q 1JJ2A 4WGJA 4QIWE
chains in the Genus database with same CATH superfamily
4DR5Q 1H9KA 4KD4A 1I94Q 1QVCA 2F0NA 1XPUA 1Z47A 1MKHA 2CWPA 1CTMA 4QY7A 3S15B 1JMCA 2VUMH 4DNIA 3BZDB 3H3VC 2JA7H 4MN3A 5E3FA 3D31A 3H0GG 3HKZG 1FR3A 4POGA 2EE1A 2F0DA 1Z9FA 3GTPH 2YV5A 5CMDA 2L4NA 4H7BA 4JBKA 3T1YL 1H9RA 4ILWA 3VA5A 4DK6C 1K8GA 3PO2B 1SJHD 4U673 1NBWA 1LTID 2VUMG 2UXDL 1KNAA 1D5MC 2NUDA 4DUZL 5BN4A 2WB1G 1RHPA 3PMFA 2UU9L 4DR1L 3FRPB 4XT3B 3VA7A 5IP9H 3LX0A 3C1EA 2K05A 1PTOC 4ME5A 2X6LA 1V8QA 1WTPA 4HJ5A 4DR3L 1A2TA 1IBKQ 1TXYA 1YNND 2WAQG 2FHTA 2HT1A 1X3PA 4C1NI 4X2DA 4GN5A 3CPFA 4OL7A 5JVH3 4DV3L 2A19A 3HOWH 2KHJA 2A68D 2E2HH 2NVYH 3TN2A 3U4VA 2R61A 3M4QA 3P75A 3NQTA 2JSOA 3CHBD 4Z9CB 1BOSA 1B53A 4K8IA 4K5WA 3RR5A 4N8FA 4IFDI 3CAMA 3K5MA 1IHZA 1U4MA 2EYJA 2EYMA 1LO5D 4OIJA 1TWHB 3S14B 3DM1A 2TMPA 3ERSX 3HS0C 1CKNA 4X66Q 4PV1C 4LF4Q 2BE5C 5C4XB 2O5IC 3I4NB 1S5ED 3BJUA 4B3SL 2JA8H 3VYUA 2EXZA 1XMOQ 3CW2C 3TP8A 4KMUC 1R9TH 4LF5Q 1CA6A 1U9RA 4K14A 3RZOB 1PDQA 1Q3LA 2ZJRA 4IJHA 5C0XJ 3L0OA 3HOVH 2VQFQ 4DV5L 1YVCA 5IGDA 4A3LG 4CHTB 3P20A 4RAUC 2AWOA 3KLSA 3MWYW 2KQ3A 4E6IA 1IW7D 1UE7A 2K1BA 4DR6Q 1EIFA 1E2VA 4P2CB 1TY2A 1STYA 2KCCA 2A69C 3L9AX 2R6GA 1YHAA 2VQFL 5DLQE 5JOBA 4OX9L 2B8GA 1F9PA 1TS2A 3VR2A 3EIVA 1I5FA 1NR4A 1YNXA 1N36Q 3GTGB 3DEOA 3S17B 3NEMA 3NUCA 1I6VC 2PNRC 3F2UA 4JK1C 1WVLA 3JAME 2UUBL 2WP8J 3MAQA 4LF7Q 1HUNA 1A3VA 1BCPD 3RUZA 1HR0Q 3ICEA 4EQ5A 2C35B 3OW2A 4JI5L 1KTKA 4LFBL 2Q2IA 5DNFA 2K52A 1HRJA 4LNQA 1B3AA 4IUPA 2NB0A 2JA7B 4G7OC 1VDZA 3OW7A 4ODGA 5E4WC 4K6DA 3BVMA 5HGTA 3FPUB 4IFDJ 1PH8A 4KN4C 1NSNS 2H4OA 1FL0A 1M4VA 1X56A 3BG3A 3JAMi 3J80E 2KVMA 3PF4A 5IYDH 5NUCA 3CCEA 4A3MG 2F1MA 1SFOH 1NMGA 2PCFB 2CQAA 3LGJA 3SK5A 3K57A 2E2JB 1BDOA 2I5MX 1SDFA 4U0SA 2F3WA 3VDYA 3BVGA 3IL8A 2BCOA 1ESRA 1O80A 1IKMA 1EUJA 1SMYD 1RTNA 3W1GA 1BBWA 4A3MH 3UDXA 3I72A 5KEEA 4S3SA 4DXFA 3TP7A 2KEDA 3KJPA 2E2IH 4YWMA 1PLFA 1K8MA 2EZVA 1CZGA 1A0IA 2XVSA 1EQTA 4X64L 3T16A 5COYA 4DV4L 1GVPA 1SROA 1EWIA 2MO1A 2EJGC 2ZM6L 2OTJA 5FJ8H 1HA6A 2YU9B 4LF6L 3STBC 1RKNA 1K8AC 4PG3A 1UE1A 2HQEA 1VQ8A 2O2LD 4LMQD 3HKZE 4L6TB 4P75A 1I94L 4R1JA 4XT1B 4FXDA 2KHSA 1SE4A 2Z1CA 2LY7A 1B44D 5JPMC 2WAQB 1FJGL 1IYUA 1L0XB 2D0PA 1D5ZC 4IUNA 1TIID 2RHSB 1K83H 5M3FB 3QWNA 3E9HA 3BDCA 1MSHA 2HD3A 4YCVA 2X6GA 1YNJD 4CKBA 2RA4A 2UUBQ 1BBUA 1VMPA 3QIAA 2ZJQA 1ZEQX 4DR7L 1EU3A 4ZUJA 5D14A 2A6HD 1M8AA 4IUTA 1HR0W 3MXGA 5JVG3 1X32A 1SFOB 1PMRA 4NXNL 4CJ1B 1Y8PB 4FO2A 2N88A 1CSPA 2VB3X 1TR5A 1SLJA 2PW5A 2PZWA 2QEXA 1Y1WB 1D1KA 1CZWA 4B9XA 2MQHA 4HSVA 1S3OA 4JBWA 1W2BA 4ZUIA 1E3PA 1HHVA 3J80i 2I5LX 2O5JC 2N49A 3GD7A 1KHIA 1SNPA 1SSOA 4WJ4A 1Q82C 1EFWA 4P74A 2E2IB 3H15A 1STHA 5FO9B 2Z0SA 4R4IA 2JA8G 3DWAA 2RKSA 3V96A 3R2IA 4AH6A 1CHQD 1RCVD 5AFWA 3E0EA 2WV6D 3AQQA 4BY1H 4F8MA 4ZKCB 4RH6A 1X54A 4B3RQ 1U4RA 5EPKA 2FMMA 4NP5A 2BA1A 4I65A 1XTDA 2M2LA 2DY7A 2RDGA 4KHZA 1BCPB 1SYBA 2MUYA 2ZXRA 2RDHA 4YCWA 3VYRA 2PPBC 2PMZB 3N3UA 3IRBA 3S15H 1VQBA 1SN8A 1BUVT 1GOZA 4C3JH 4B3SQ 1H9MA 2EY1A 1IYJB 1KDAA 4JW0A 4MTNA 4IALA 4DV7Q 5M5WH 5IP7H 3GTJB 3HOWG 1DCZA 5DM73 5A35A 2MNAA 3Q22A 5FK9C 5IP7G 1WTHA 1AN8A 4A3KG 4ALPA 1FJGQ 1XPRA 1CHPD 3FHWA 1WCMG 4DR6L 3W3AA 4GN3B 3S16B 1QVGA 4IZ8A 3PV0A 4QUFA 4R4CA 5CR3A 4DV2L 1N32L 1GUTA 5ELDA 4I7AA 5EKKA 4DK3C 2NVXH 2NZ1D 3M4YA 4XYQA 3LNNA 1C4QA 4BA2I 1D6EC 2ZXPA 1IBML 4A3BB 3OIPA 2PO4A 3SEBA 2OWOA 3NBIA 1DM0B 2JA6G 1YNNC 4L5TA 4CJ0B 2UXBL 4KJNA 2EYLA 2NN6H 1F9QA 1TQOA 4GKJQ 1T5XD 2F0HA 5D3DA 2IT1A 2KOLA 4JYAL 4KHPQ 1A6XA 1NJIC 1YBYA 4PZ6A 1JR0D 4XDXA 4X62Q 4I7ZC 3I90A 5CV4A 4EQOA 1EIYB 1QILA 1XNRL 2OEOA 3OMCA 4AYBB 4U0ZA 4CBVA 1EY0A 2BDOA 4GOPA 4C1NK 2R7ZB 1X65A 1Q90A 4HJ7A 3IAYA 2F4VQ 2ZM6Q 2G9DA 1R9TB 4J15A 4FF4A 3RN5A 3U50C 1VCIA 2AKWB 2BA0A 3X3NA 1DGSA 3GTQB 1E24A 1X3FA 4B3RL 1Q12A 1I6HB 3G71A 5E7NA 3SK6A 2KBNA 1TWAB 3KBGA 2R92G 3NBHA 4DR2L 2JK8A 4ZQ3A 1EFID 2DNCA 2EQSA 3U9OA 1NR2A 2F6SA 3W5OA 3J81E 3I4MG 3E5SA 1GUGA 1G8ZD 4RA8A 1FGBD 1XJVA 4HIKA 2F4IA 4Y52H 2K6AA 4X64Q 4HIDA 1LACA 3DHQA 2ZJPA 1HCZA 2R7ZH 4JI0L 1TU2B 3GTKH 4PY3A 4MNOA 2CFMA 3GTLB 4JI4L 2KJXA 3RZOH 3HOYB 3EROA 3F2DA 2NVQB 1JJ2A 1G6ZA 4WGJA 5M5WB 5EU0A 1C9OA 3OYYA 3J7YW 3CUCA 1LTGD 4J8QA 5HURA 3GV3A 4C3JB 1PH3A 2F0QA 4JI5Q 1H9SB 4HIMA 2LXKA 4K2LA 1EYAA 4LJZC 3OHXC 1JWMD 1AE2A 1L1OB 1HTPA 3D6WA 3GTOB 1OXSC 3I3CA 3CCQA 1EOTA 4OX9Q 3KK7A 1Z6HA 5IP9G 1K28A 1KDCA 4DV1Q 2KA7A 1MJCA 5FLXE 1PFMA 1VMCA 2K75A 4LW1A 3S1QB 5KYIA 1VQGA 4WJWA 5M9OA 2OQKA 1XMQL 1PH4A 4LUZA 1HFNA 4YHHQ 4TSSA 2K5QA 4ZCKA 5JJLA 3IFTA 2R92H 3EFXD 2ZTCA 5ELFA 3D4DA 1E22A 1CKMA 2F03A 5GAGC 4LWCA 5ISRA 1NAPA 2EJFC 1QUQA 1FVIA 3D3RA 1ASZA 1QNUA 2JP1A 2D9UA 3BYTB 4A3JG 1XPOA 4FNFA 4KKTA 4CKEA 4HJ9A 3A7LA 5FLMH 1EQVA 3I91A 3MVVA 4L8JA 3DXJC 3CCRA 1QWYA 1ONLA 1DXMA 3H6MA 3TZUA 3CMEA 3E0JA 3FEWX 1VQEA 2F0TA 3GP7A 1Y1WG 3C1FA 5C3WA 1V1PA 5HY6A 5ELBA 3GTMB 1STNA 3AB9A 1STAA 1KD1C 3T1YQ 2AUKA 2Z6KA 3AFQA 4RFBA 2YU9H 4LFAL 3X3MA 1B3QA 4RWSC 5CMTA 2K01A 1ET9A 1NUCA 1VQAA 3K8AA 1JICA 2D62A 3MXPA 3C3LA 3S2DH 2WINB 3MXNB 2KEEA 4EQPA 4RGMA 5JFFA 1BKBA 5C3EB 1VQ4A 2CCZA 3PUZA 1H9SA 3MTSA 2L11A 2NWGA 4IOAA 3I4NH 2B2VC 4DGZA 3SHGA 3CCUA 4K5VA 5HGQA 5IY0A 1TWFB 3J81j 4A3KH 3TSSA 2K04A 2Q2TA 1RD9D 2RQXA 2HIXA 4HCSA 1GXDC 1F2MA 4JI7L 4JI1Q 1OXXK 4TVAB 4O0AA 4UP8A 2MP1A 2RSOA 4L5QA 4GNXC 5C4JB 5EKLA 3SGIA 4FXGC 4FF1A 4X62L 1MJEA 4C2MB 1EY4A 2UXCQ 4KK7A 4A3JH 5IOCA 4HMIA 1ENAA 2VQEQ 2IX1A 2B2VA 3P7JA 4PQXA 3NE5B 4ME3A 1EYCA 3K7UC 5GQOA 2F0EA 4AQYQ 1AH9A 2CH4A 1LLRD 2EYOA 3A0JA 2B2UA 4DNTB 3PO2H 1HZBA 4X65L 4LFCL 4ID6A 1I50B 1VQ6A 1SYEA 1Y14B 3H94A 3H91A 1XYIA 5IT9L 1EWCA 2R92B 2EIFA 2YYZA 4JI8Q 1M1KC 1IBMQ 2E76C 3A55A 3G6EA 1Q46A 1PA6A 2H1EA 1N33L 1S72A 2NVXB 2KCTA 1K83B 2A73B 3VYTA 5M3FH 3S2HH 3KJOA 1BO0A 1RODA 1WD0A 2SDFA 1K0RA 2B2TC 4IQZA 2VS1A 4RKBA 1AEXA 4K6LA 1F9SA 3IKJA 4NW2A 5M5YH 4B3ML 4GOPB 2ASBA 2IHFA 1DOMA 1SMYC 1EEID 3ULLA 3C46A 4WRDA 1UE6A 3DUZA 2E74C 2F0OA 1PH2A 3DEPA 3PUWA 4HEDA 1Y1VB 4NB3A 1ASYA 4OWTB 4CDCC 4DR3Q 5C4XH 3MFYA 3SVMA 1HTLD 2RBMA 1NTGA 1PRTC 2QGQA 2J0TD 4DV5Q 5DAUA 1OTCA 4C2MH 4A4IA 1YJNA 1G291 4JYAQ 2K7VA 4OGQC 3A8KE 1MHWC 1IBLQ 3GO5A 4EQNA 1N33Q 1MIUA 2R7ZG 2EY6A 1TWGH 2CW0C 2L1BA 3NENA 1QG7A 2L5TA 3K80C 3TP6A 1ESFA 1PZKD 3DM3A 3TS0A 2NVYB 1WTWA 4YY3Q 1LABA 2OF1A 4G4KA 2PW7A 1WD1A 3D4RA 2Z6BA 3NP8A 4A3LH 4X3TA 3JAMc 2Q2UA 4RG1A 3I4MB 5FLXc 4FXKC 4ITRA 1JJGA 4APVA 4LF5L 1KL9A 1PH9A 3MEHA 3R8BA 1O7IA 4JI0Q 1I6HH 2B8FA 5CV6A 3RLFA 4LF8L 1AZPA 4IFDG 1KNEA 1I3QB 5FLXL 4M1UB 5M3MB 2B63B 4HJAA 2F0VA 2I46A 3SK8A 1X3QA 1SE3A 2F0MA 4DUYQ 3M85A 4BY7B 2B63H 4CDEC 1EZ8A 2QILA 5IGGA 2VB2X 3S1MB 4L5RC 1TWHH 1PTOH 4JI6L 5BN5A 1FNVA 1KIXA 1V1QA 2NBFA 3E9IA 1HQMC 1WCMB 2PZTA 4IPDA 4XYOA 1PTOF 2LXJA 2A74C 1XNQQ 4X6AH 4UAIA 3HOWB 1KABA 3M9BA 2GVBA 3I56A 4A3IG 3KF6B 4DF7A 3SE0A 4DAVA 1VQ9A 5IODA 3S1RB 5I2XA 1PHJA 4A3BH 4DV7L 4PZ7A 1VQIA 4OEMB 3CRLC 5IGCA 2WAQE 3P1HA 2ZXOA 2F0PA 1LTAD 1HXYD 5CBEE 2IX0A 4DV0Q 3MHBA 1S40A 3SK4A 1IW7C 2JA5H 3UI2A 4JI2L 3HEJA 1R4QB 4LF9Q 4LFBQ 4GS3A 4RGTA 4CDFC 2B2YA 1Y1VG 1VQKA 1Q81C 2X69A 3S1RH 4YHHL 4BY7G 1J6QA 1E1TA 3A7AB 3KBXA 3QJYA 5M3FG 5LMNQ 4ZYSA 4WFN3 1JOQA 2L0CA 2AUJD 1OO9B 4QJFA 1LT4D 2CW0D 3OPOA 1WTVA 3J7AF 2JN4A 1UE5A 3ULJA 1GHKA 1DYQA 5C4HA 1XTCD 4U04A 3PF5A 4TQUS 3VR6A 1KAWA 1Q1BA 4CDDC 2K32A 2IHEA 1UUPA 2HQLA 5CV9A 1JQYD 1SE2A 1EY8A 2B2WA 2RF4A 5M3MG 1GUWA 3MXNA 1TKWB 2CH4W 4LUVA 3VYSA 1I4QA 2JEAI 3HOZB 4U68A 2NTTA 1WTRA 5ELOA 3H3VI 2KHIA 5IE8A 2EJMA 2OCEA 3L2PA 4C3IG 4A93H 2YTXA 4K0KL 2E5LL 1F77A 2VQEL 3EN2A 3MEFA 3CCSA 1LT5D 3PCOB 2ICEC 1E1OA 1ICFB 5KNCA 5EJWA 4A3IH 3ND8A 3VR3A 2UUAL 1PH5A 1BCPC 1V9PA 4H02A 4OO1I 1CFMA 3GV6A 2LSSA 2RSNA 3KDFA 3S2DB 1XNQL 2WKDA 3B6YA 4U07A 1Y1WH 4A3GH 1PFBA 1DZ1A 3S6AA 1EY7A 2J7ZA 3CF5A 5AJ3Q 3SR1A 1CM9A 3DWPA 3TDQA 4JI7Q 1C8CA 1B8AA 2FJ2A 2Q8TA 1NE3A 2E2HB 1PH1A 3HOYG 1A63A 2FINB 3H0GB 1IYVA 3F1ZA 4M16A 2ICIA 5I9PA 4A3FG 3KF6A 3DWQA 2PI2A 1YI2A 4BA1I 4DKAC 4JI1L 1Y1VH 3KOJA 2EY2A 1LTRD 5IT9c 2F0JA 2C9OA 1XX8A 1N8RC 1O7LA 1KLUD 1VQHA 4NKLA 1N34Q 5TSSA 1YHQA 3FMCA 1GO3E 5EPJA 4P71A 1PRTB 4NXML 4LFAQ 1FGUA 1AFPA 4EX5A 1PZJD 4A3MB 4N67A 1G2SA 5I2YA 3FPPA 2HIVA 5JJ6A 4A76A 4X65Q 2XNAC 1J8IA 1GUNA 4JI6Q 1HZCA 3HZXA 5FJ8G 1E0BA 2DUDA 5EBCA 1VF7A 2B29A 1WFQA 2CKZB 3U4ZA 2K4KA 4G7ZC 4C3IH 4A93G 4JV5Q 1EOVA 2F0FA 3HOUB 2IX3A 1L0YB 1WJJA 2EYPA 5K36G 5I6YA 4A3DH 1S5BD 3Q24A 5LMUQ 4HJ8A 1HH2P 2IWHA 1AW7A 4KKSA 4ZAIA 4N9PA 1U5KA 1KRTA 4KY5A 1EIGA 1WYDA 3F2CA 5C3EG 4GNXB 3M7GA 1PYBA 1NY4A 4LF8Q 4JI3Q 5LMUL 2NZHA 3K0YA 3K6OA 2AHOB 3UE1A 1JB7A 1JWSD 4KHVA 3MXUA 3FKIH 2F0IA 3EA6A 2FFKB 3CQZH 4ZKBB 4F87A 2F0WA 1LTTD 3GQBA 2IL8A 2A6ED 4KKUA 4FP5D 4FVMA 3QOJA 3HOUG 1HNWQ 1JT8A 4BS9A 5GADC 5F2DA 5C4JH 3CMAA 4IFDH 2LMCB 2H5XA 3IFDA 1SNOA 2G03A 2WB1B 3PUXA 2NN6I 4KTAA 2NYZD 3J81L 3TP5A 1CQFA 3M3YH 2HCCA 3CCLA 3PIPA 5LMNL 1S4ZA 1SEBD 3PQIA 3PO2G 1Z7TA 5BN3A 2TSSA 4AYBG 2MGSA 4A3KB 4CGYB 5L37A 1Q7YC 1CA5A 4A3GB 1I4XA 1BR9A 3NWTA 4DR4L 3TZDA 3PIO3 2ENBA 5J22A 3RZDB 5GAHC 1CSQA 1HNXL 1SNDA 4A75A 3WDNA 3OIQA 1HQRD 4RCNA 1JB3A 1YEZA 3ULPA 4PMCA 1YIJA 1I4HA 4U0UA 5C44H 4R8IA 5J3BA 3L3OC 4C56C 1VQJA 3U9SA 1EY5A 4A3FB 3HKZB 1EQRA 2CQOA 4BXXH 1DOLA 1ENFA 4A3GG 2PNHA 2NZOA 2MJ8A 3GTPB 4A3BG 5G3LD 1JE5A 4CKCA 2GN5A 4FDBA 1UWVA 1KAAA 1XNRQ 3I4MH 4KY6A 3NBHB 1FNWA 1HA5A 5JPNC 5CV7A 2Z6KC 4HMJA 1EWHA 5EKIA 4C3HH 4DV4Q 1O7ZA 4HN7A 2EPBA 4ZRZA 5M5XB 1A3UA 2XSCA 1ENCA 2VL6A 4RGOS 3KF8B 4C3HG 3RNUA 3TMEA 1PVOA 4C3JG 4QUCA 1W3SA 2RHQB 3QG1A 1IXRA 4OELB 4XIGS 3I4LA 1R4PB 1TY0A 1EYDA 2RCFA 2XN9C 4A3FH 1QZHA 4QIWB 1GUSA 1Q8KA 3FVQA 5C5LA 4AIMA 4OWXB 1YHBA 2XRSD 1PH7A 5C6AA 3AMUA 4HCEA 1KQSA 1CK1A 2KENA 3QR8A 2JJQA 2B2UC 1NNXA 4QMGA 3OTOL 2Z4IA 4ABNA 3STBD 2L15A 3CXCA 1BBXC 1LUZA 4AQYL 4G57A 2A8VA 3ZLMA 1CUKA 3ONAB 1H95A 5IWAL 2ALYB 4OIKA 3UDGA 2R7FA 3I70A 3BU2A 1F2YA 2EY5A 1IL2A 2BDNA 4KV6A 2EDGA 2JA6H 3WOFA 2CHBD 4MZ9A 3PUVA 3TQYA 4J1MA 3NSWA 4IN3A 1Y69U 1G91A 1X6OA 4DAMA 2WB1E 1A8VA 2JA7G 2MFIA 2NN6G 3PGZA 2E2JH 1B9MA 4UDUC 3K7AB 1Q1EA 1J5EQ 4DNRB 5C0XG 4O2DA 1SNQA 3H09A 5CYUA 1N9WA 3A5ZB 2MHVA 3M3YB 2WACA 2V4DA 4YY3L 4C3HB 4X2CA 1ZKOA 1WTXA 2D2CC 5KNBA 4F88A 2N78A 4GKJL 1QUQB 1MSGA 4A3JB 2UUAQ 2VNUD 1VQMA 3NK9A 1K3RA 2DNEA 4BBRG 1G51A 1RTOA 4JCVE 2Y0SB 1OXUA 3SXHA 5IGEA 2YTYA 3JAML 3A8IE 3BZKA 1D1IA 3ZYYX 1AP0A 1C48A 2JEBI 2OXPA 3O13A 3V05A 3PIOA 2NUNA 4R8NA 4BBSG 1STGA 2KCMA 4UP9A 2Q8IB 1PZID 1OXTA 1D5XC 4HTHA 1HR0L 4A3CH 1VQPA 1QZGA 1K3BC 4YWLA 3HOVG 1ZYRD 3T1HQ 4IURA 3S9WA 1HNZL 2DJFC 4BBRB 4JI4Q 5K36H 4C3IB 3PO3H 4O1NA 2K5VA 3CP0A 5M5XH 1JWUD 1U4PA 1IBLL 4A93B 2QF7A 4IPGA 5IT9E 2F0GA 1FNUA 1RJTA 4H44C 4OONA 1K9MC 4B08A 1C0AA 4F7XA 2SNMA 4JOIC 3CC2A 3C2PA 2NVTB 5KRUA 5A2QE 1VQ7A 3RLNA 4POFA 1EQQA 2ES2A 1S5DD 1SNMA 4QL5A 4QQBX 1HFGA 2L9HA 4DAYA 2B39A 1SAPA 3FKIG 4BBRH 1X3EA 5ELNA 3NWSA 1SRUA 3S2HB 2BOSA 2R7DA 1GKHA 2Y0SG 1PTOB 1E2WA 3LWUA 3QB3A 4B3MQ 1SJED 4DN4M 4DU9A 3J81i 1II3A 1GM5A 1DD2A 1TWAH 1QCBD 2Q8RE 4YIJA 2JQOA 2QDBA 3G4SA 2RCNA 3HKSA 5CC4A 1B70B 3K59A 2K28A 2M00A 1DJRD 4KD3A 1JOKA 1E7ZA 5JJKA 4MHEA 3JC66 5IYCH 1FD7D 1C7YA 2XRQD 1MD2D 4V0BA 1D8LA 5KIXA 3QO2A 4LAAA 1CKNB 3S16H 1L1OA 4P73A 1VQOA 4IUQA 3EVQA 3M4OH 3T51B 4X2EA 4JI3L 4DV6Q 1TWCH 1X3GA 2WFWA 4HR7B 1JC7A 2L12A 2K5NA 4JBMA 1LTSD 2XIWA 1BF4A 1TWGB 2M9VA 3URYA 1ILPA 2Z4HA 3T56B 3KUPA 5C44G 4P72A 3ZC7A 3A74A 2AQ1B 3T53B 4B3TL 1O7YA 1STBA 1J5EL 1SMXA 4DPGA 1A3TA 4G7HC 2E75C 3HOZG 2IJ0A 1EY9A 3CU7A 1LT6D 3HOXG 3G6JB 3GTGH 2EVBA 1IZ6A 4KN7C 1U4LA 3LETA 3NQIA 4A3DB 3I2ZA 3CC7A 4IJLA 2JA6B 3HOYH 3T4AC 5JJZA 3W2DA 1G6PA 5LHY1 4DV2Q 2G9HD 3M7NA 2OTLA 3GTLH 1VQDA 4X3KA 1G2TA 1SR3A 4O42A 1PV4A 4BWGB 4WJ3M 3S1NB 2VY3A 3E6ZX 2Z8LA 5ELCA 2VZAA 1EY6A 3UDFA 5J39A 3KF8A 4H0LC 1EL0A 2HCIA 3CRKC 4FF3A 3RZDH 3MFGA 5JJ7A 3CCJA 1UAPA 1PYSB 4ULLA 4DXGA 4JPBW 4DR5L 3HP3A 1PRTF 2QDLA 4NXNQ 3GTOH 2K33A 5ELEA 4GLXA 2F0KA 3KFUA 2XWJB 3N6RA 2RDFA 4AYBE 1TS3A 1CQVA 4JBJA 4TRDA 5IGBA 4IUUA 4QGUA 4OHJA 3GTQH 4LF7L 4DR7Q 1AE3A 4N9TA 2B63G 4QIWE 1MBYA 2B2YC 4ZK9B 1PFSA 4UY8C 1LTLA 4JI8L 3V2TA 1NH1A 3GDEA 3T13A 1XMQQ 2A5HA 3QOLA 1HNXQ 3EBEA 4A3DG 3L7ZC 1JCKB 4GLAC 1RIPA 2EOTA 3DLLA 3M4OB 3RLOA 1PTOD 2K5HA 4IOCA 2R93G 3F2BA 3HOXB 3SE5A 2FXQA 4KI0A 5M5YB 4UPAA 3RMHA 4DR1Q 5E4XA 1YJ9A 1EIHA 2KCNA 1X55A 1PRTD 2MO0A 1TS4A 3BVZA 2A68C 5C44B 4OXPA 1BNZA 1SBBB 4JC0A 1D2BA 4NPSA 2F0SA 1A2UA 3S14H 3D8GA 1YZ6A 5C3XA 4XQNA 1JE4A 3R2TA 3EQLC 5KNDA 3I55A 1WI5A 1MGSA 2KUMA 5BR8Q 2EXDA 1KXLA 3CKIB 1B50A 1MI2A 4J6HA 5FO7B 5A2QL 4LK1C 5CV8A 2QEJC 3N52A 4DR2Q 2I5HA 5JEAG 3A56A 4UHVA 1X9NA 3A8JE 2UXCL 2HDLA 1YNJC 2XGTA 2UU9Q 4BBSH 4JOIA 3U58A 1CKOA 4A3EH 1FYCA 2Z9HA 2Y0SE 2XWBB 4JG2A 4RMFA 4R9WA 4KY7A 1O78A 2F4VL 1CT1D 3K5NA 4JV5L 2ID0A 2FMCA 2A69D 4K5XA 4DK0A 4RGNA 4EVOA 4BBSB 1UEAB 1RF2D 1SXTA 4M8AA 2K50A 3CQZB 4KLKA 1SYCA 3Q23A 3A54A 4QB4A 2A6HC 1I4PA 3OMGA 2K14A 4Y7NB 5I6WA 3FKIB 5CV5A 1PFNA 3K7AH 5IWAQ 2C5CA 1EEFD 2B3GA 1HZ9A 1UEBA 1JOOA 2DN8A 2MPMA 3Q0AA 1AZQA 1WOCA 1TWFH 2HHHQ 3I4NG 4X66L 4LF4L 1D7QA 1A62A 1TVXA 4B3TQ 3J80c 1B1ZA 3J7AV 4DA2A 3S1NH 5FOBB 1SNCA 2UXBQ 3KLWA 4JVZA 4K8JA 4PNYA 2K5WA 3NHHA 2NVTH 1B7YB 5KYLA 1VF5C 2AMCB 4R4QA 1Q8IA 4EGVA 3PIP3 3UE0A 3A5UA 1ZYRC 3HOVB 2F52A 3GTJH 1W6JA 3FDTA 4DV6L 1VQFA 3K5OA 5EQ0A 2RVLA 1F2LA 3AYHB 2F3VA 4YCUA 4DAYB 3FP9A 2N55A 2GVAA 3MZ5A 3I7FA 4DUYL 1VQLA 3AU7A 3CD6A 1I4RA 3NXWA 4IPHA 1HZAA 1ML0D 1TT2A 1RDPD 2OQ0A 5EPLA 2PI2E 2VUMB 5FKAC 4RHRA 4BY1B 1I4GA 2E8GA 1VS0A 1T9HA 4QF4A 3SDZA 5GAEC 2R93B 3OSOA 3ZJYC 3PO3G 1GHJA 3NPPA 3ERQA 5E1FA 1SYFA 2R3ZA 3HFZB 4XQQA 5T1IA 4QCLA 1Y8OB 5K5PA 2DJGC 3VR4A 3HG9A 3ER0A 2AWNA 5CBAE 1XMOL 2IW3A 1J9OA 5DM63 1YJWA 1RL2A 1HNZQ 3J7ZC 3S1MH 5EBDA 2J4XA 1V1PB 1Y8NB 4PZ8A 1KRSA 1ICWA 1Q86C 3VR5A 1PXUA 2NTSA 3G7LA 2PMZE 2JA8B 5EGTA 4BY1G 5H1SE 1EZ6A 1TS5A 2QKIC 3LWEA 2PQAB 3HOXH 2R93H 4BXXG 2PQEA 4RKLA 5IYBG 3BZCA 1K73C 2E5LQ 5I9OA 2SOBA 1B4OA 1GD7A 4XQJA 2JA5G 1P16A 2D5DA 3OWFA 4HSPA 4R4TA 5LL6S 4GNXA 3NTHA 2LFNA 1EU4A 1LTBD 1BVSA 2JYOA 2QW7A 4HAEA 2IPKD 1W6KA 2EYHA 2DY8A 3M4PA 1TWCB 4L5SA 3SHLA 1VQCA 1QNKA 3R3OA 4KHPL 2D0OA 1GUOA 3BDLA 5C0XI 3K5LA 5D3IB 2UXDQ 4KJOA 2PZUA 2XTIA 3NTIA 3CPWA 2QA4A 3GTKB 1B9NA 2WKCA 1GJXA 1K0SA 3TEHB 3EJIA 2LKVA 4WORA 5JEAJ 5M3MH 3CCVA 4CJ2C 3T1HL 5C5MA 3R93A 1SYDA 1SE8A 2BE5D 4LUOA 2I0QA 2JA5B 4FYDA 2A6EC 4L63B 5J1ZA 3UDIA 3K58A 1T5EA 3E3XA 4DV0L 2ZTEA 2JE6I 1BQQT 1ET6A 3S17H 5IIFA 4PMBA 4GOPC 1QJOA 1YITA 3K81C 2V1CC 3TBIB 2N8NA 4DV3Q 2IY5B 4OO1G 3D6CA 3TREA 3I8ZA 5CORA 4XI8A 4RCOA 1M90C 4NDXA 4K2KA 2HDMA 3NELA 3BYYB 5LL6X 3OTOQ 1BCPF 1KLGD 4DK1A 2NVQH 5EAYA 5KGUA 4X3UA 5CGKA 3OWEB 4R4OA 1VQ5A 1LV9A 1DOKA 2K03A 4RHSA 4H13C 5IYBH 3KDFB 3RN2A 1SYGA 2YTVA 3AEVA 5GROA 4X3SA 1IL8A 2UUCL 4GKKL 5JEAH 2PQAA 2VXWA 3PO3B 2CWAA 1K8OA 4YWKA 1VQNA 3G48A 4MIUA 3TS2A 2B2WC 2GA4B 1WTQA 1N32Q 5AJ3L 1I3QH 4A3CG 3J7A5 1ILQA 2L55A 2ATWA 2BH2A 2UUCQ 4GKKQ 2N3SA 4A3EB 3RD4A 2HHHL 2WIIB 3PSIA 3TRZA 4ZLTF 4GN4B 1XXGA 2P5ZX 4IO9A 5IYCG 3S1QH 5CGLA 1E2ZA 5LMNW 2VW9A 4LFCQ 3MC0B 1LM0A 3J81c 3HOUH 1CI3M 1HNWL 5T1GA 5BR8L 1KC8C 1N34L 1S5CD 3K0XA 4GZYC 3KYHC 3I73A 1N36L 1QB5D 1BXTA 3I4OA 1PYWD 2JXMB 5DEHA 1L0WA 3WOEA 1WCMH 4PMWA 3D0FA 3KLRA 4OWWB 2BH8A 4NXMQ 4LU4A 2SNSA 5C4ZA 2QCPX 4MTKA 2AQ3B 2JA9A 5IGFA 1L1OC 2OT2A 3NTKA 3ND9A 2E2DC 3J80L 3BS1A 5CKLA 4BY7H 5IYDG 4V190 5G3LF 4XXEA 1IKLA 5C3EH 3Q8DA 3CCMA 2B2TA 3PUYA 4LF9L 2Q2HA 1OXVA 4DR4Q 4DUZQ 3HOZH 5C0XH 2SEBD 5D65A 1JJCB 1LT3D 5JAVA 4IPCA 4Q5VA 1B2TA 5FO8B 4B9WA 3WWVA 4FF2A 3DMUA 4IUVA 1A15A 1F2ZA 2LS01 4NMZA 3H0GH 4TKOB 3GTMH 1LYLA 4HIOA 1ZXTA 1UNSA 2A1AA 1U0LA 4Q0FA 2F0UA 2F0LA 4GLVB 4DAPA 1EYGA 3CC4A 1HUMA 3D4WA 4N8X1 3Q6SA 2EYFA 1V43A 2K5DA 1NMFA 2O4XA 3HRZC 4DV1L 1H9JA 1WTOA 1HPCA 3OOCA 3HGBA 1PH6A 5C4XG 1QOHA 1HJPA 5JFZA 2DGYA 2G5DA 3MA2B 4K0KQ 2AQ2B 3KLSX 1JORA 1F9RA 2KECA 2F3IA 1V1OA 2CVRA 1STEA 4DFAA 1I50H 2HUGA 1XWEA 4Y7NH 5I4DA 3F8TA 4A3IB 1QE6A 2ZTDA 3BDOA 1KDBA 2ZT9C 4A3EG 5JJIA 3SN9A 1S5FD 3ZCBA 3W1BA 4XTCS 2PYKA 1L2FA 4UP7A 1NCVA 3H3VH 2I07B 3S24A 3AFPA 5FLMG 4JI2Q 4OO1H 1P8LA 4LF6Q 1QVFA 3ITPA 1IBKL 1DONA 2NUCA
chains in the Genus database with same CATH topology
4DR5Q 5EU0A 1C9OA 1I94Q 3OYYA 3CUCA 4NXML 1PFSA 4LFAQ 1QVCA 1FGUA 1XPUA 4UY8C 1Z47A 1LTLA 4JI8L 1MKHA 2CWPA 4EX5A 1PH3A 4JI5Q 3GDEA 4N67A 4QY7A 2LXKA 4HIMA 1XMQQ 2HIVA 5JJ6A 4A76A 1JMCA 4X65Q 1AE2A 2VUMH 1L1OB 4DNIA 3EBEA 1HNXQ 3L7ZC 4JI6Q 4LF5L 4A3DG 4GLAC 1RIPA 1OXSC 1HZCA 3DLLA 3CCQA 3RLOA 4IOCA 2K5HA 2JA7H 5FJ8G 4OX9Q 2DUDA 3D31A 3H0GG 3HKZG 3F2BA 2R93G 4POGA 5IP9G 2B29A 3SE5A 2FXQA 1Z9FA 3GTPH 2YV5A 4KI0A 4UPAA 1WFQA 2CKZB 3U4ZA 4DR1Q 2K4KA 4JBKA 4C3IH 4DV1Q 1YJ9A 3T1YL 1MJCA 4JV5Q 1EOVA 4A93G 1X55A 1WJJA 2MO0A 4DK6C 1K8GA 5K36G 2K75A 4LW1A 1VQGA 4OXPA 1NBWA 2VUMG 2UXDL 4A3DH 5LMUQ 4HJ8A 2OQKA 1XMQL 1PH4A 4DUZL 1HH2P 4LUZA 2WB1G 1U5KA 4JC0A 4NPSA 1KRTA 4YHHQ 4DR1L 2UU9L 1WYDA 5IP9H 3S14H 5JJLA 1YZ6A 2R92H 3F2CA 5C3EG 4GNXB 4HJ5A 3I55A 1WI5A 1PYBA 2ZTCA 4DR3L 1IBKQ 1NY4A 4LF8Q 1TXYA 2WAQG 4JI3Q 5BR8Q 2HT1A 2EXDA 5LMUL 1KXLA 2NZHA 4X2DA 2AHOB 1E22A 3CPFA 4GN5A 1CKMA 3UE1A 1JB7A 5GAGC 4DV3L 2A19A 4LWCA 3HOWH 3FKIH 2KHJA 4DR2Q 1QUQA 2I5HA 1FVIA 5JEAG 2E2HH 2NVYH 3U4VA 1X9NA 3CQZH 3M4QA 2UXCL 1ASZA 2XGTA 2UU9Q 4BBSH 4JOIA 3U58A 1CKOA 3RR5A 4A3EH 4A3JG 1XPOA 3CAMA 4IFDI 3HOUG 1HNWQ 1JT8A 4HJ9A 5FLMH 2Y0SE 5GADC 4JG2A 4RMFA 5C4JH 3CCRA 3CMAA 2F4VL 3ERSX 4JV5L 1CKNA 2ID0A 4X66Q 2H5XA 3CMEA 4LF4Q 2G03A 3PUXA 1VQEA 2NN6I 3BJUA 1Y1WG 4B3SL 2JA8H 1XMOQ 3CW2C 5HY6A 2K50A 3M3YH 4KLKA 3CCLA 3PIPA 1R9TH 4LF5Q 5LMNL 2K14A 2ZJRA 4IJHA 3PO2G 5C0XJ 3L0OA 4AYBG 3T1YQ 1KD1C 3HOVH 2VQFQ 2Z6KA 1YVCA 3AFQA 3K7AH 4DV5L 5IWAQ 2YU9H 1Q7YC 4A3LG 2B3GA 4LFAL 1HZ9A 1UEBA 5CMTA 3K8AA 2AWOA 1VQAA 1WOCA 2D62A 1TWFH 1UE7A 4DR4L 2HHHQ 4DR6Q 1EIFA 3S2DH 3I4NG 4X66L 4LF4L 1D7QA 3MXNB 5GAHC 1CSQA 1HNXL 4A75A 5JFFA 1BKBA 2R6GA 1A62A 1YEZA 1YHAA 3J80c 2VQFL 3PUZA 5DLQE 3ULPA 1VQ4A 2CCZA 1YIJA 4OX9L 3S1NH 4U0UA 3EIVA 3KLWA 5C44H 4IOAA 2UXBQ 1I5FA 5J3BA 3I4NH 1VQJA 3SHGA 1YNXA 1EQRA 2CQOA 3CCUA 1N36Q 4BXXH 3NEMA 5HGQA 4A3GG 2NVTH 2PNHA 1B7YB 2NZOA 5IY0A 2AMCB 4R4QA 4A3BG 3A5UA 3UE0A 1JE5A 2GN5A 4FDBA 1UWVA 3J81j 4A3KH 1XNRQ 2Q2TA 2UUBL 2WP8J 3I4MH 2F52A 3NBHB 2HIXA 3GTJH 4LF7Q 4JI7L 2Z6KC 4DV6L 1HR0Q 1VQFA 3ICEA 4C3HH 4EQ5A 2C35B 4JI1Q 4DV4Q 1OXXK 3OW2A 3AYHB 4YCUA 4DAYB 3FP9A 4TVAB 4O0AA 4UP8A 4JI5L 2GVAA 3I7FA 2VL6A 2Q2IA 3KF8B 4DUYL 3RNUA 2B63G 2K52A 4LFBL 1VQLA 4L5QA 4GNXC 3CD6A 4LNQA 1PVOA 4IPHA 1HZAA 1W3SA 3SGIA 2OQ0A 2RHQB 2PI2E 4X62L 1IXRA 1MJEA 4IFDJ 4XIGS 2UXCQ 4A3JH 1PH8A 2E8GA 1VS0A 1T9HA 1FL0A 5GAEC 1X56A 2VQEQ 2IX1A 3ZJYC 4A3FH 1QZHA 3JAMi 3PO3G 4ME3A 3K7UC 5GQOA 4AQYQ 1AH9A 1Q8KA 3PF4A 5IYDH 3HFZB 4OWXB 4AIMA 1YHBA 1PH7A 3A0JA 3CCEA 1KQSA 4A3MG 3PO2H 2KENA 1HZBA 4X65L 1NMGA 1SFOH 2JJQA 4LFCL 1VQ6A 3LGJA 3OTOL 1Y14B 3ER0A 2AWNA 3STBD 2EIFA 1XMOL 2L15A 2YYZA 4JI8Q 3CXCA 1M1KC 1LUZA 1YJWA 1IBMQ 4AQYL 2I5MX 1RL2A 1HNZQ 4U0SA 2A8VA 3J7ZC 3G6EA 3S1MH 3ZLMA 1Q46A 3VDYA 1PA6A 1N33L 1CUKA 1S72A 4PZ8A 1KRSA 1EUJA 5IWAL 2ALYB 1H95A 3UDGA 1Q86C 2R7FA 3W1GA 1BBWA 4A3MH 3BU2A 2KCTA 3UDXA 5M3FH 1IL2A 3S2HH 3KJOA 2JA6H 3KJPA 2E2IH 4YWMA 2PMZE 3PUVA 1A0IA 4MZ9A 1K0RA 4BY1G 3TQYA 5H1SE 1X6OA 2PQAB 2VS1A 4X64L 4DV4L 3HOXH 4DAMA 2WB1E 4BXXG 2R93H 1GVPA 1A8VA 1SROA 5IYBG 3BZCA 1EWIA 2MO1A 2ZM6L 1K73C 5M5YH 2E5LQ 2JA7G 2OTJA 5FJ8H 2MFIA 4B3ML 2NN6G 4GOPB 3PGZA 2IHFA 2ASBA 2E2JH 3ULLA 4LF6L 1Q1EA 1UE6A 3STBC 1K8AC 1GD7A 2JA5G 4PG3A 1J5EQ 1UE1A 1P16A 5C0XG 1PH2A 4R4TA 1VQ8A 3PUWA 4O2DA 4GNXA 3HKZE 4P75A 1N9WA 3A5ZB 4R1JA 1I94L 4YY3L 4NB3A 4X2CA 1BVSA 1ASYA 4OWTB 4DR3Q 5C4XH 1FJGL 1NTGA 2N78A 2D0PA 4GKJL 2QGQA 2RHSB 1K83H 1QUQB 3M4PA 4DV5Q 3E9HA 4L5SA 2UUAQ 1OTCA 2VNUD 4C2MH 1VQCA 1VQMA 4YCVA 4A4IA 1K3RA 1YJNA 1G291 2D0OA 1G51A 4BBRG 4JYAQ 4KHPL 5C0XI 4JCVE 1IBLQ 2UXDQ 3GO5A 1N33Q 2R7ZG 1MIUA 1OXUA 2UUBQ 1BBUA 1TWGH 2YTYA 2XTIA 3CPWA 3NENA 2ZJQA 2QA4A 4DR7L 3K80C 3TEHB 3BZKA 3DM3A 3TS0A 4YY3Q 1HR0W 5JEAJ 5M3MH 3CCVA 3T1HL 2JEBI 1SE8A 4NXNL 4A3LH 3PIOA 4LUOA 1CSPA 1AE3A 3JAMc 2Q2UA 4RG1A 2I0QA 1SLJA 5FLXc 2QEXA 4BBSG 4ITRA 3UDIA 4DV0L 2KCMA 2MQHA 4UP9A 1KL9A 4APVA 2ZTEA 2JE6I 4JBWA 1S3OA 1W2BA 1O7IA 1PH9A 4JI0Q 1E3PA 1OXTA 3S17H 3J80i 2I5LX 2N49A 3GD7A 4GOPC 1KHIA 3K81C 2V1CC 1YITA 1HR0L 4A3CH 1I6HH 4WJ4A 3RLFA 4LF8L 2N8NA 1VQPA 1Q82C 4DV3Q 1QZGA 1EFWA 4IFDG 4YWLA 3HOVG 2IY5B 4P74A 3T1HQ 3TREA 3H15A 4OO1G 4HJAA 2Z0SA 4R4IA 1HNZL 2JA8G 4XI8A 4JI4Q 1M90C 4AH6A 4DUYQ 3M85A 3NELA 3E0EA 3PO3H 2B63H 2K5VA 3OTOQ 3AQQA 3CP0A 5M5XH 4BY1H 2NVQH 1X54A 5EAYA 4B3RQ 1IBLL 4L5RC 4IPGA 1TWHH 4R4OA 1VQ5A 2BA1A 4JI6L 1XTDA 1KIXA 4KHZA 4YCWA 5IYBH 1V1QA 3KDFB 4OONA 3RN2A 3N3UA 3IRBA 1K9MC 3E9IA 2YTVA 3S15H 1C0AA 1VQBA 4JOIC 4IPDA 3CC2A 1SN8A 3AEVA 5GROA 4C3JH 1VQ7A 4B3SQ 3RLNA 4POFA 1IYJB 1EQQA 4MTNA 2ES2A 2UUCL 4GKKL 4DV7Q 2LXJA 2PQAA 5M5WH 2CWAA 4QL5A 5IP7H 4QQBX 4YWKA 1XNQQ 3HOWG 4X6AH 3FKIG 4BBRH 1VQNA 1X3EA 3G48A 5ELNA 1SRUA 2MNAA 3M9BA 2GVBA 2R7DA 3TS2A 3I56A 4A3IG 1GKHA 1N32Q 2Y0SG 5IP7G 3KF6B 5AJ3L 1I3QH 4A3KG 4B3MQ 4A3CG 3J7A5 1VQ9A 2BH2A 2ATWA 4ALPA 1FJGQ 1XPRA 1PHJA 4A3BH 2UUCQ 3FHWA 3J81i 4DV7L 2N3SA 1WCMG 4PZ7A 2HHHL 1VQIA 4DR6L 4GN3B 2WAQE 1GM5A 3PSIA 1TWAH 1QVGA 3TRZA 2JQOA 2IX0A 3PV0A 4GN4B 4R4CA 4IO9A 5IYCG 3S1QH 5CGLA 4DV0Q 3G4SA 4DV2L 5LMNW 2RCNA 2VW9A 1S40A 4LFCQ 4GKKQ 1N32L 1LM0A 3HKSA 3J81c 2JA5H 1B70B 3HOUH 4DK3C 2NVXH 1HNWL 5BR8L 1KC8C 1N34L 4JI2L 3K0XA 3KYHC 1E7ZA 1N36L 4LF9Q 5JJKA 3I4OA 4LFBQ 3JC66 1L0WA 4GS3A 5IYCH 1WCMH 1Y1VG 4BA2I 1JJGA 4PMWA 3D0FA 1C7YA 1IBML 1VQKA 1Q81C 4OWWB 3S1RH 4YHHL 4BY7G 1D8LA 2OWOA 2BH8A 1J6QA 1E1TA 4NXMQ 4LU4A 1CKNB 2JA6G 3S16H 1L1OA 2JA9A 4P73A 1VQOA 5M3FG 3M4OH 5LMNQ 1L1OC 4L5TA 2UXBL 4X2EA 4QJFA 4JI3L 4DV6Q 1TWCH 1X3GA 2WFWA 5CKLA 4BY7H 5IYDG 1UE5A 3ULJA 2K5NA 5C3EH 3Q8DA 4GKJQ 4U04A 3CCMA 3PF5A 4JBMA 3PUYA 4LF9L 4TQUS 2Q2HA 1KAWA 1OXVA 1Q1BA 4DR4Q 2IT1A 2IHEA 4DUZQ 2HQLA 4JYAL 3HOZH 4KHPQ 5C44G 1NJIC 1YBYA 4P72A 3ZC7A 3A74A 4PZ6A 2RF4A 4X62Q 5M3MG 1EIYB 4B3TL 1XNRL 4LUVA 1JJCB 1J5EL 2JEAI 1SMXA 4IPCA 4DPGA 4U0ZA 3HOZG 3WWVA 3H3VI 5ELOA 2KHIA 5IE8A 2OCEA 3L2PA 4GOPA 1X65A 4HJ7A 4A93H 4K0KL 2YTXA 3HOXG 2E5LL 3H0GH 2F4VQ 2ZM6Q 2VQEL 3EN2A 3MEFA 4J15A 1LYLA 3CCSA 3GTGH 3GTMH 3PCOB 4HIOA 1IZ6A 1VCIA 3U50C 1E1OA 2AKWB 3RN5A 3LETA 2BA0A 3I2ZA 3CC7A 4IJLA 4A3IH 2A1AA 1DGSA 1U0LA 3HOYH 2UUAL 1E24A 1X3FA 4GLVB 1Q12A 1PH5A 1EYGA 4B3RL 1V9PA 4H02A 4DV2Q 3CC4A 4OO1I 1G6PA 3G71A 3M7NA 5E7NA 2KBNA 1V43A 2OTLA 3GTLH 2LSSA 1NMFA 4DV1L 3KDFA 1VQDA 2R92G 1XNQL 4DR2L 2JK8A 1PH6A 1SR3A 5C4XG 1HJPA 4U07A 3B6YA 5JFZA 1Y1WH 1PV4A 2DGYA 4A3GH 4WJ3M 3S6AA 4K0KQ 3CF5A 2VY3A 2EQSA 5AJ3Q 2VZAA 2F3IA 3UDFA 4JI7Q 2F6SA 3W5OA 1B8AA 1I50H 1A63A 1NE3A 1PH1A 3HOYG 3I4MG 4Y7NH 3F8TA 3F1ZA 4M16A 1XJVA 4HIKA 2ZTDA 4A3FG 3RZDH 4A3EG 3KF6A 4Y52H 5JJIA 2PI2A 1YI2A 4X64Q 4BA1I 4DKAC 5JJ7A 3SN9A 3CCJA 4HIDA 4JI1L 1Y1VH 2ZJPA 3ZCBA 3KOJA 3W1BA 1PYSB 4XTCS 4DR5L 2R7ZH 5IT9c 4JI0L 1L2FA 4UP7A 3H3VH 4NXNQ 1N8RC 3S24A 3GTOH 3AFPA 5FLMG 1VQHA 4PY3A 4MNOA 4JI2Q 2CFMA 4GLXA 1YHQA 1N34Q 3GTKH 3KFUA 4B3TQ 4AYBE 1P8LA 4JI4L 4LF6Q 4JBJA 1QVFA 4QGUA 1GO3E 3RZOH 3GTQH 1IBKL 3F2DA 4P71A 4LF7L 4DR7Q 1JJ2A 4WGJA 4QIWE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 Q;  5EU0 A;  1C9O A;  1I94 Q;  3OYY A;  3CUC A;  4NXM L;  1PFS A;  4LFA Q;  1QVC A;  1FGU A;  1XPU A;  4UY8 C;  1Z47 A;  1LTL A;  4JI8 L;  1MKH A;  2CWP A;  4EX5 A;  1PH3 A;  4JI5 Q;  3GDE A;  4N67 A;  4QY7 A;  2LXK A;  4HIM A;  1XMQ Q;  2HIV A;  5JJ6 A;  4A76 A;  1JMC A;  4X65 Q;  1AE2 A;  2VUM H;  1L1O B;  4DNI A;  3EBE A;  1HNX Q;  3L7Z C;  4JI6 Q;  4LF5 L;  4A3D G;  4GLA C;  1RIP A;  1OXS C;  1HZC A;  3DLL A;  3CCQ A;  3RLO A;  4IOC A;  2K5H A;  2JA7 H;  5FJ8 G;  4OX9 Q;  2DUD A;  3D31 A;  3H0G G;  3HKZ G;  3F2B A;  2R93 G;  4POG A;  5IP9 G;  2B29 A;  3SE5 A;  2FXQ A;  1Z9F A;  3GTP H;  2YV5 A;  4KI0 A;  4UPA A;  1WFQ A;  2CKZ B;  3U4Z A;  4DR1 Q;  2K4K A;  4JBK A;  4C3I H;  4DV1 Q;  1YJ9 A;  3T1Y L;  1MJC A;  4JV5 Q;  1EOV A;  4A93 G;  1X55 A;  1WJJ A;  2MO0 A;  4DK6 C;  1K8G A;  5K36 G;  2K75 A;  4LW1 A;  1VQG A;  4OXP A;  1NBW A;  2VUM G;  2UXD L;  4A3D H;  5LMU Q;  4HJ8 A;  2OQK A;  1XMQ L;  1PH4 A;  4DUZ L;  1HH2 P;  4LUZ A;  2WB1 G;  1U5K A;  4JC0 A;  4NPS A;  1KRT A;  4YHH Q;  4DR1 L;  2UU9 L;  1WYD A;  5IP9 H;  3S14 H;  5JJL A;  1YZ6 A;  2R92 H;  3F2C A;  5C3E G;  4GNX B;  4HJ5 A;  3I55 A;  1WI5 A;  1PYB A;  2ZTC A;  4DR3 L;  1IBK Q;  1NY4 A;  4LF8 Q;  1TXY A;  2WAQ G;  4JI3 Q;  5BR8 Q;  2HT1 A;  2EXD A;  5LMU L;  1KXL A;  2NZH A;  4X2D A;  2AHO B;  1E22 A;  3CPF A;  4GN5 A;  1CKM A;  3UE1 A;  1JB7 A;  5GAG C;  4DV3 L;  2A19 A;  4LWC A;  3HOW H;  3FKI H;  2KHJ A;  4DR2 Q;  1QUQ A;  2I5H A;  1FVI A;  5JEA G;  2E2H H;  2NVY H;  3U4V A;  1X9N A;  3CQZ H;  3M4Q A;  2UXC L;  1ASZ A;  2XGT A;  2UU9 Q;  4BBS H;  4JOI A;  3U58 A;  1CKO A;  3RR5 A;  4A3E H;  4A3J G;  1XPO A;  3CAM A;  4IFD I;  3HOU G;  1HNW Q;  1JT8 A;  4HJ9 A;  5FLM H;  2Y0S E;  5GAD C;  4JG2 A;  4RMF A;  5C4J H;  3CCR A;  3CMA A;  2F4V L;  3ERS X;  4JV5 L;  1CKN A;  2ID0 A;  4X66 Q;  2H5X A;  3CME A;  4LF4 Q;  2G03 A;  3PUX A;  1VQE A;  2NN6 I;  3BJU A;  1Y1W G;  4B3S L;  2JA8 H;  1XMO Q;  3CW2 C;  5HY6 A;  2K50 A;  3M3Y H;  4KLK A;  3CCL A;  3PIP A;  1R9T H;  4LF5 Q;  5LMN L;  2K14 A;  2ZJR A;  4IJH A;  3PO2 G;  5C0X J;  3L0O A;  4AYB G;  3T1Y Q;  1KD1 C;  3HOV H;  2VQF Q;  2Z6K A;  1YVC A;  3AFQ A;  3K7A H;  4DV5 L;  5IWA Q;  2YU9 H;  1Q7Y C;  4A3L G;  2B3G A;  4LFA L;  1HZ9 A;  1UEB A;  5CMT A;  3K8A A;  2AWO A;  1VQA A;  1WOC A;  2D62 A;  1TWF H;  1UE7 A;  4DR4 L;  2HHH Q;  4DR6 Q;  1EIF A;  3S2D H;  3I4N G;  4X66 L;  4LF4 L;  1D7Q A;  3MXN B;  5GAH C;  1CSQ A;  1HNX L;  4A75 A;  5JFF A;  1BKB A;  2R6G A;  1A62 A;  1YEZ A;  1YHA A;  3J80 c;  2VQF L;  3PUZ A;  5DLQ E;  3ULP A;  1VQ4 A;  2CCZ A;  1YIJ A;  4OX9 L;  3S1N H;  4U0U A;  3EIV A;  3KLW A;  5C44 H;  4IOA A;  2UXB Q;  1I5F A;  5J3B A;  3I4N H;  1VQJ A;  3SHG A;  1YNX A;  1EQR A;  2CQO A;  3CCU A;  1N36 Q;  4BXX H;  3NEM A;  5HGQ A;  4A3G G;  2NVT H;  2PNH A;  1B7Y B;  2NZO A;  5IY0 A;  2AMC B;  4R4Q A;  4A3B G;  3A5U A;  3UE0 A;  1JE5 A;  2GN5 A;  4FDB A;  1UWV A;  3J81 j;  4A3K H;  1XNR Q;  2Q2T A;  2UUB L;  2WP8 J;  3I4M H;  2F52 A;  3NBH B;  2HIX A;  3GTJ H;  4LF7 Q;  4JI7 L;  2Z6K C;  4DV6 L;  1HR0 Q;  1VQF A;  3ICE A;  4C3H H;  4EQ5 A;  2C35 B;  4JI1 Q;  4DV4 Q;  1OXX K;  3OW2 A;  3AYH B;  4YCU A;  4DAY B;  3FP9 A;  4TVA B;  4O0A A;  4UP8 A;  4JI5 L;  2GVA A;  3I7F A;  2VL6 A;  2Q2I A;  3KF8 B;  4DUY L;  3RNU A;  2B63 G;  2K52 A;  4LFB L;  1VQL A;  4L5Q A;  4GNX C;  3CD6 A;  4LNQ A;  1PVO A;  4IPH A;  1HZA A;  1W3S A;  3SGI A;  2OQ0 A;  2RHQ B;  2PI2 E;  4X62 L;  1IXR A;  1MJE A;  4IFD J;  4XIG S;  2UXC Q;  4A3J H;  1PH8 A;  2E8G A;  1VS0 A;  1T9H A;  1FL0 A;  5GAE C;  1X56 A;  2VQE Q;  2IX1 A;  3ZJY C;  4A3F H;  1QZH A;  3JAM i;  3PO3 G;  4ME3 A;  3K7U C;  5GQO A;  4AQY Q;  1AH9 A;  1Q8K A;  3PF4 A;  5IYD H;  3HFZ B;  4OWX B;  4AIM A;  1YHB A;  1PH7 A;  3A0J A;  3CCE A;  1KQS A;  4A3M G;  3PO2 H;  2KEN A;  1HZB A;  4X65 L;  1NMG A;  1SFO H;  2JJQ A;  4LFC L;  1VQ6 A;  3LGJ A;  3OTO L;  1Y14 B;  3ER0 A;  2AWN A;  3STB D;  2EIF A;  1XMO L;  2L15 A;  2YYZ A;  4JI8 Q;  3CXC A;  1M1K C;  1LUZ A;  1YJW A;  1IBM Q;  4AQY L;  2I5M X;  1RL2 A;  1HNZ Q;  4U0S A;  2A8V A;  3J7Z C;  3G6E A;  3S1M H;  3ZLM A;  1Q46 A;  3VDY A;  1PA6 A;  1N33 L;  1CUK A;  1S72 A;  4PZ8 A;  1KRS A;  1EUJ A;  5IWA L;  2ALY B;  1H95 A;  3UDG A;  1Q86 C;  2R7F A;  3W1G A;  1BBW A;  4A3M H;  3BU2 A;  2KCT A;  3UDX A;  5M3F H;  1IL2 A;  3S2H H;  3KJO A;  2JA6 H;  3KJP A;  2E2I H;  4YWM A;  2PMZ E;  3PUV A;  1A0I A;  4MZ9 A;  1K0R A;  4BY1 G;  3TQY A;  5H1S E;  1X6O A;  2PQA B;  2VS1 A;  4X64 L;  4DV4 L;  3HOX H;  4DAM A;  2WB1 E;  4BXX G;  2R93 H;  1GVP A;  1A8V A;  1SRO A;  5IYB G;  3BZC A;  1EWI A;  2MO1 A;  2ZM6 L;  1K73 C;  5M5Y H;  2E5L Q;  2JA7 G;  2OTJ A;  5FJ8 H;  2MFI A;  4B3M L;  2NN6 G;  4GOP B;  3PGZ A;  2IHF A;  2ASB A;  2E2J H;  3ULL A;  4LF6 L;  1Q1E A;  1UE6 A;  3STB C;  1K8A C;  1GD7 A;  2JA5 G;  4PG3 A;  1J5E Q;  1UE1 A;  1P16 A;  5C0X G;  1PH2 A;  4R4T A;  1VQ8 A;  3PUW A;  4O2D A;  4GNX A;  3HKZ E;  4P75 A;  1N9W A;  3A5Z B;  4R1J A;  1I94 L;  4YY3 L;  4NB3 A;  4X2C A;  1BVS A;  1ASY A;  4OWT B;  4DR3 Q;  5C4X H;  1FJG L;  1NTG A;  2N78 A;  2D0P A;  4GKJ L;  2QGQ A;  2RHS B;  1K83 H;  1QUQ B;  3M4P A;  4DV5 Q;  3E9H A;  4L5S A;  2UUA Q;  1OTC A;  2VNU D;  4C2M H;  1VQC A;  1VQM A;  4YCV A;  4A4I A;  1K3R A;  1YJN A;  1G29 1;  2D0O A;  1G51 A;  4BBR G;  4JYA Q;  4KHP L;  5C0X I;  4JCV E;  1IBL Q;  2UXD Q;  3GO5 A;  1N33 Q;  2R7Z G;  1MIU A;  1OXU A;  2UUB Q;  1BBU A;  1TWG H;  2YTY A;  2XTI A;  3CPW A;  3NEN A;  2ZJQ A;  2QA4 A;  4DR7 L;  3K80 C;  3TEH B;  3BZK A;  3DM3 A;  3TS0 A;  4YY3 Q;  1HR0 W;  5JEA J;  5M3M H;  3CCV A;  3T1H L;  2JEB I;  1SE8 A;  4NXN L;  4A3L H;  3PIO A;  4LUO A;  1CSP A;  1AE3 A;  3JAM c;  2Q2U A;  4RG1 A;  2I0Q A;  1SLJ A;  5FLX c;  2QEX A;  4BBS G;  4ITR A;  3UDI A;  4DV0 L;  2KCM A;  2MQH A;  4UP9 A;  1KL9 A;  4APV A;  2ZTE A;  2JE6 I;  4JBW A;  1S3O A;  1W2B A;  1O7I A;  1PH9 A;  4JI0 Q;  1E3P A;  1OXT A;  3S17 H;  3J80 i;  2I5L X;  2N49 A;  3GD7 A;  4GOP C;  1KHI A;  3K81 C;  2V1C C;  1YIT A;  1HR0 L;  4A3C H;  1I6H H;  4WJ4 A;  3RLF A;  4LF8 L;  2N8N A;  1VQP A;  1Q82 C;  4DV3 Q;  1QZG A;  1EFW A;  4IFD G;  4YWL A;  3HOV G;  2IY5 B;  4P74 A;  3T1H Q;  3TRE A;  3H15 A;  4OO1 G;  4HJA A;  2Z0S A;  4R4I A;  1HNZ L;  2JA8 G;  4XI8 A;  4JI4 Q;  1M90 C;  4AH6 A;  4DUY Q;  3M85 A;  3NEL A;  3E0E A;  3PO3 H;  2B63 H;  2K5V A;  3OTO Q;  3AQQ A;  3CP0 A;  5M5X H;  4BY1 H;  2NVQ H;  1X54 A;  5EAY A;  4B3R Q;  1IBL L;  4L5R C;  4IPG A;  1TWH H;  4R4O A;  1VQ5 A;  2BA1 A;  4JI6 L;  1XTD A;  1KIX A;  4KHZ A;  4YCW A;  5IYB H;  1V1Q A;  3KDF B;  4OON A;  3RN2 A;  3N3U A;  3IRB A;  1K9M C;  3E9I A;  2YTV A;  3S15 H;  1C0A A;  1VQB A;  4JOI C;  4IPD A;  3CC2 A;  1SN8 A;  3AEV A;  5GRO A;  4C3J H;  1VQ7 A;  4B3S Q;  3RLN A;  4POF A;  1IYJ B;  1EQQ A;  4MTN A;  2ES2 A;  2UUC L;  4GKK L;  4DV7 Q;  2LXJ A;  2PQA A;  5M5W H;  2CWA A;  4QL5 A;  5IP7 H;  4QQB X;  4YWK A;  1XNQ Q;  3HOW G;  4X6A H;  3FKI G;  4BBR H;  1VQN A;  1X3E A;  3G48 A;  5ELN A;  1SRU A;  2MNA A;  3M9B A;  2GVB A;  2R7D A;  3TS2 A;  3I56 A;  4A3I G;  1GKH A;  1N32 Q;  2Y0S G;  5IP7 G;  3KF6 B;  5AJ3 L;  1I3Q H;  4A3K G;  4B3M Q;  4A3C G;  3J7A 5;  1VQ9 A;  2BH2 A;  2ATW A;  4ALP A;  1FJG Q;  1XPR A;  1PHJ A;  4A3B H;  2UUC Q;  3FHW A;  3J81 i;  4DV7 L;  2N3S A;  1WCM G;  4PZ7 A;  2HHH L;  1VQI A;  4DR6 L;  4GN3 B;  2WAQ E;  1GM5 A;  3PSI A;  1TWA H;  1QVG A;  3TRZ A;  2JQO A;  2IX0 A;  3PV0 A;  4GN4 B;  4R4C A;  4IO9 A;  5IYC G;  3S1Q H;  5CGL A;  4DV0 Q;  3G4S A;  4DV2 L;  5LMN W;  2RCN A;  2VW9 A;  1S40 A;  4LFC Q;  4GKK Q;  1N32 L;  1LM0 A;  3HKS A;  3J81 c;  2JA5 H;  1B70 B;  3HOU H;  4DK3 C;  2NVX H;  1HNW L;  5BR8 L;  1KC8 C;  1N34 L;  4JI2 L;  3K0X A;  3KYH C;  1E7Z A;  1N36 L;  4LF9 Q;  5JJK A;  3I4O A;  4LFB Q;  3JC6 6;  1L0W A;  4GS3 A;  5IYC H;  1WCM H;  1Y1V G;  4BA2 I;  1JJG A;  4PMW A;  3D0F A;  1C7Y A;  1IBM L;  1VQK A;  1Q81 C;  4OWW B;  3S1R H;  4YHH L;  4BY7 G;  1D8L A;  2OWO A;  2BH8 A;  1J6Q A;  1E1T A;  4NXM Q;  4LU4 A;  1CKN B;  2JA6 G;  3S16 H;  1L1O A;  2JA9 A;  4P73 A;  1VQO A;  5M3F G;  3M4O H;  5LMN Q;  1L1O C;  4L5T A;  2UXB L;  4X2E A;  4QJF A;  4JI3 L;  4DV6 Q;  1TWC H;  1X3G A;  2WFW A;  5CKL A;  4BY7 H;  5IYD G;  1UE5 A;  3ULJ A;  2K5N A;  5C3E H;  3Q8D A;  4GKJ Q;  4U04 A;  3CCM A;  3PF5 A;  4JBM A;  3PUY A;  4LF9 L;  4TQU S;  2Q2H A;  1KAW A;  1OXV A;  1Q1B A;  4DR4 Q;  2IT1 A;  2IHE A;  4DUZ Q;  2HQL A;  4JYA L;  3HOZ H;  4KHP Q;  5C44 G;  1NJI C;  1YBY A;  4P72 A;  3ZC7 A;  3A74 A;  4PZ6 A;  2RF4 A;  4X62 Q;  5M3M G;  1EIY B;  4B3T L;  1XNR L;  4LUV A;  1JJC B;  1J5E L;  2JEA I;  1SMX A;  4IPC A;  4DPG A;  4U0Z A;  3HOZ G;  3WWV A;  3H3V I;  5ELO A;  2KHI A;  5IE8 A;  2OCE A;  3L2P A;  4GOP A;  1X65 A;  4HJ7 A;  4A93 H;  4K0K L;  2YTX A;  3HOX G;  2E5L L;  3H0G H;  2F4V Q;  2ZM6 Q;  2VQE L;  3EN2 A;  3MEF A;  4J15 A;  1LYL A;  3CCS A;  3GTG H;  3GTM H;  3PCO B;  4HIO A;  1IZ6 A;  1VCI A;  3U50 C;  1E1O A;  2AKW B;  3RN5 A;  3LET A;  2BA0 A;  3I2Z A;  3CC7 A;  4IJL A;  4A3I H;  2A1A A;  1DGS A;  1U0L A;  3HOY H;  2UUA L;  1E24 A;  1X3F A;  4GLV B;  1Q12 A;  1PH5 A;  1EYG A;  4B3R L;  1V9P A;  4H02 A;  4DV2 Q;  3CC4 A;  4OO1 I;  1G6P A;  3G71 A;  3M7N A;  5E7N A;  2KBN A;  1V43 A;  2OTL A;  3GTL H;  2LSS A;  1NMF A;  4DV1 L;  3KDF A;  1VQD A;  2R92 G;  1XNQ L;  4DR2 L;  2JK8 A;  1PH6 A;  1SR3 A;  5C4X G;  1HJP A;  4U07 A;  3B6Y A;  5JFZ A;  1Y1W H;  1PV4 A;  2DGY A;  4A3G H;  4WJ3 M;  3S6A A;  4K0K Q;  3CF5 A;  2VY3 A;  2EQS A;  5AJ3 Q;  2VZA A;  2F3I A;  3UDF A;  4JI7 Q;  2F6S A;  3W5O A;  1B8A A;  1I50 H;  1A63 A;  1NE3 A;  1PH1 A;  3HOY G;  3I4M G;  4Y7N H;  3F8T A;  3F1Z A;  4M16 A;  1XJV A;  4HIK A;  2ZTD A;  4A3F G;  3RZD H;  4A3E G;  3KF6 A;  4Y52 H;  5JJI A;  2PI2 A;  1YI2 A;  4X64 Q;  4BA1 I;  4DKA C;  5JJ7 A;  3SN9 A;  3CCJ A;  4HID A;  4JI1 L;  1Y1V H;  2ZJP A;  3ZCB A;  3KOJ A;  3W1B A;  1PYS B;  4XTC S;  4DR5 L;  2R7Z H;  5IT9 c;  4JI0 L;  1L2F A;  4UP7 A;  3H3V H;  4NXN Q;  1N8R C;  3S24 A;  3GTO H;  3AFP A;  5FLM G;  1VQH A;  4PY3 A;  4MNO A;  4JI2 Q;  2CFM A;  4GLX A;  1YHQ A;  1N34 Q;  3GTK H;  3KFU A;  4B3T Q;  4AYB E;  1P8L A;  4JI4 L;  4LF6 Q;  4JBJ A;  1QVF A;  4QGU A;  1GO3 E;  3RZO H;  3GTQ H;  1IBK L;  3F2D A;  4P71 A;  4LF7 L;  4DR7 Q;  1JJ2 A;  4WGJ A;  4QIW E; 
#chains in the Genus database with same CATH topology
 4DR5 Q;  1H9K A;  4KD4 A;  1I94 Q;  1QVC A;  2F0N A;  1XPU A;  1Z47 A;  1MKH A;  2CWP A;  1CTM A;  4QY7 A;  3S15 B;  1JMC A;  2VUM H;  4DNI A;  3BZD B;  3H3V C;  2JA7 H;  4MN3 A;  5E3F A;  3D31 A;  3H0G G;  3HKZ G;  1FR3 A;  4POG A;  2EE1 A;  2F0D A;  1Z9F A;  3GTP H;  2YV5 A;  5CMD A;  2L4N A;  4H7B A;  4JBK A;  3T1Y L;  1H9R A;  4ILW A;  3VA5 A;  4DK6 C;  1K8G A;  3PO2 B;  1SJH D;  4U67 3;  1NBW A;  1LTI D;  2VUM G;  2UXD L;  1KNA A;  1D5M C;  2NUD A;  4DUZ L;  5BN4 A;  2WB1 G;  1RHP A;  3PMF A;  2UU9 L;  4DR1 L;  3FRP B;  4XT3 B;  3VA7 A;  5IP9 H;  3LX0 A;  3C1E A;  2K05 A;  1PTO C;  4ME5 A;  2X6L A;  1V8Q A;  1WTP A;  4HJ5 A;  4DR3 L;  1A2T A;  1IBK Q;  1TXY A;  1YNN D;  2WAQ G;  2FHT A;  2HT1 A;  1X3P A;  4C1N I;  4X2D A;  4GN5 A;  3CPF A;  4OL7 A;  5JVH 3;  4DV3 L;  2A19 A;  3HOW H;  2KHJ A;  2A68 D;  2E2H H;  2NVY H;  3TN2 A;  3U4V A;  2R61 A;  3M4Q A;  3P75 A;  3NQT A;  2JSO A;  3CHB D;  4Z9C B;  1BOS A;  1B53 A;  4K8I A;  4K5W A;  3RR5 A;  4N8F A;  4IFD I;  3CAM A;  3K5M A;  1IHZ A;  1U4M A;  2EYJ A;  2EYM A;  1LO5 D;  4OIJ A;  1TWH B;  3S14 B;  3DM1 A;  2TMP A;  3ERS X;  3HS0 C;  1CKN A;  4X66 Q;  4PV1 C;  4LF4 Q;  2BE5 C;  5C4X B;  2O5I C;  3I4N B;  1S5E D;  3BJU A;  4B3S L;  2JA8 H;  3VYU A;  2EXZ A;  1XMO Q;  3CW2 C;  3TP8 A;  4KMU C;  1R9T H;  4LF5 Q;  1CA6 A;  1U9R A;  4K14 A;  3RZO B;  1PDQ A;  1Q3L A;  2ZJR A;  4IJH A;  5C0X J;  3L0O A;  3HOV H;  2VQF Q;  4DV5 L;  1YVC A;  5IGD A;  4A3L G;  4CHT B;  3P20 A;  4RAU C;  2AWO A;  3KLS A;  3MWY W;  2KQ3 A;  4E6I A;  1IW7 D;  1UE7 A;  2K1B A;  4DR6 Q;  1EIF A;  1E2V A;  4P2C B;  1TY2 A;  1STY A;  2KCC A;  2A69 C;  3L9A X;  2R6G A;  1YHA A;  2VQF L;  5DLQ E;  5JOB A;  4OX9 L;  2B8G A;  1F9P A;  1TS2 A;  3VR2 A;  3EIV A;  1I5F A;  1NR4 A;  1YNX A;  1N36 Q;  3GTG B;  3DEO A;  3S17 B;  3NEM A;  3NUC A;  1I6V C;  2PNR C;  3F2U A;  4JK1 C;  1WVL A;  3JAM E;  2UUB L;  2WP8 J;  3MAQ A;  4LF7 Q;  1HUN A;  1A3V A;  1BCP D;  3RUZ A;  1HR0 Q;  3ICE A;  4EQ5 A;  2C35 B;  3OW2 A;  4JI5 L;  1KTK A;  4LFB L;  2Q2I A;  5DNF A;  2K52 A;  1HRJ A;  4LNQ A;  1B3A A;  4IUP A;  2NB0 A;  2JA7 B;  4G7O C;  1VDZ A;  3OW7 A;  4ODG A;  5E4W C;  4K6D A;  3BVM A;  5HGT A;  3FPU B;  4IFD J;  1PH8 A;  4KN4 C;  1NSN S;  2H4O A;  1FL0 A;  1M4V A;  1X56 A;  3BG3 A;  3JAM i;  3J80 E;  2KVM A;  3PF4 A;  5IYD H;  5NUC A;  3CCE A;  4A3M G;  2F1M A;  1SFO H;  1NMG A;  2PCF B;  2CQA A;  3LGJ A;  3SK5 A;  3K57 A;  2E2J B;  1BDO A;  2I5M X;  1SDF A;  4U0S A;  2F3W A;  3VDY A;  3BVG A;  3IL8 A;  2BCO A;  1ESR A;  1O80 A;  1IKM A;  1EUJ A;  1SMY D;  1RTN A;  3W1G A;  1BBW A;  4A3M H;  3UDX A;  3I72 A;  5KEE A;  4S3S A;  4DXF A;  3TP7 A;  2KED A;  3KJP A;  2E2I H;  4YWM A;  1PLF A;  1K8M A;  2EZV A;  1CZG A;  1A0I A;  2XVS A;  1EQT A;  4X64 L;  3T16 A;  5COY A;  4DV4 L;  1GVP A;  1SRO A;  1EWI A;  2MO1 A;  2EJG C;  2ZM6 L;  2OTJ A;  5FJ8 H;  1HA6 A;  2YU9 B;  4LF6 L;  3STB C;  1RKN A;  1K8A C;  4PG3 A;  1UE1 A;  2HQE A;  1VQ8 A;  2O2L D;  4LMQ D;  3HKZ E;  4L6T B;  4P75 A;  1I94 L;  4R1J A;  4XT1 B;  4FXD A;  2KHS A;  1SE4 A;  2Z1C A;  2LY7 A;  1B44 D;  5JPM C;  2WAQ B;  1FJG L;  1IYU A;  1L0X B;  2D0P A;  1D5Z C;  4IUN A;  1TII D;  2RHS B;  1K83 H;  5M3F B;  3QWN A;  3E9H A;  3BDC A;  1MSH A;  2HD3 A;  4YCV A;  2X6G A;  1YNJ D;  4CKB A;  2RA4 A;  2UUB Q;  1BBU A;  1VMP A;  3QIA A;  2ZJQ A;  1ZEQ X;  4DR7 L;  1EU3 A;  4ZUJ A;  5D14 A;  2A6H D;  1M8A A;  4IUT A;  1HR0 W;  3MXG A;  5JVG 3;  1X32 A;  1SFO B;  1PMR A;  4NXN L;  4CJ1 B;  1Y8P B;  4FO2 A;  2N88 A;  1CSP A;  2VB3 X;  1TR5 A;  1SLJ A;  2PW5 A;  2PZW A;  2QEX A;  1Y1W B;  1D1K A;  1CZW A;  4B9X A;  2MQH A;  4HSV A;  1S3O A;  4JBW A;  1W2B A;  4ZUI A;  1E3P A;  1HHV A;  3J80 i;  2I5L X;  2O5J C;  2N49 A;  3GD7 A;  1KHI A;  1SNP A;  1SSO A;  4WJ4 A;  1Q82 C;  1EFW A;  4P74 A;  2E2I B;  3H15 A;  1STH A;  5FO9 B;  2Z0S A;  4R4I A;  2JA8 G;  3DWA A;  2RKS A;  3V96 A;  3R2I A;  4AH6 A;  1CHQ D;  1RCV D;  5AFW A;  3E0E A;  2WV6 D;  3AQQ A;  4BY1 H;  4F8M A;  4ZKC B;  4RH6 A;  1X54 A;  4B3R Q;  1U4R A;  5EPK A;  2FMM A;  4NP5 A;  2BA1 A;  4I65 A;  1XTD A;  2M2L A;  2DY7 A;  2RDG A;  4KHZ A;  1BCP B;  1SYB A;  2MUY A;  2ZXR A;  2RDH A;  4YCW A;  3VYR A;  2PPB C;  2PMZ B;  3N3U A;  3IRB A;  3S15 H;  1VQB A;  1SN8 A;  1BUV T;  1GOZ A;  4C3J H;  4B3S Q;  1H9M A;  2EY1 A;  1IYJ B;  1KDA A;  4JW0 A;  4MTN A;  4IAL A;  4DV7 Q;  5M5W H;  5IP7 H;  3GTJ B;  3HOW G;  1DCZ A;  5DM7 3;  5A35 A;  2MNA A;  3Q22 A;  5FK9 C;  5IP7 G;  1WTH A;  1AN8 A;  4A3K G;  4ALP A;  1FJG Q;  1XPR A;  1CHP D;  3FHW A;  1WCM G;  4DR6 L;  3W3A A;  4GN3 B;  3S16 B;  1QVG A;  4IZ8 A;  3PV0 A;  4QUF A;  4R4C A;  5CR3 A;  4DV2 L;  1N32 L;  1GUT A;  5ELD A;  4I7A A;  5EKK A;  4DK3 C;  2NVX H;  2NZ1 D;  3M4Y A;  4XYQ A;  3LNN A;  1C4Q A;  4BA2 I;  1D6E C;  2ZXP A;  1IBM L;  4A3B B;  3OIP A;  2PO4 A;  3SEB A;  2OWO A;  3NBI A;  1DM0 B;  2JA6 G;  1YNN C;  4L5T A;  4CJ0 B;  2UXB L;  4KJN A;  2EYL A;  2NN6 H;  1F9Q A;  1TQO A;  4GKJ Q;  1T5X D;  2F0H A;  5D3D A;  2IT1 A;  2KOL A;  4JYA L;  4KHP Q;  1A6X A;  1NJI C;  1YBY A;  4PZ6 A;  1JR0 D;  4XDX A;  4X62 Q;  4I7Z C;  3I90 A;  5CV4 A;  4EQO A;  1EIY B;  1QIL A;  1XNR L;  2OEO A;  3OMC A;  4AYB B;  4U0Z A;  4CBV A;  1EY0 A;  2BDO A;  4GOP A;  4C1N K;  2R7Z B;  1X65 A;  1Q90 A;  4HJ7 A;  3IAY A;  2F4V Q;  2ZM6 Q;  2G9D A;  1R9T B;  4J15 A;  4FF4 A;  3RN5 A;  3U50 C;  1VCI A;  2AKW B;  2BA0 A;  3X3N A;  1DGS A;  3GTQ B;  1E24 A;  1X3F A;  4B3R L;  1Q12 A;  1I6H B;  3G71 A;  5E7N A;  3SK6 A;  2KBN A;  1TWA B;  3KBG A;  2R92 G;  3NBH A;  4DR2 L;  2JK8 A;  4ZQ3 A;  1EFI D;  2DNC A;  2EQS A;  3U9O A;  1NR2 A;  2F6S A;  3W5O A;  3J81 E;  3I4M G;  3E5S A;  1GUG A;  1G8Z D;  4RA8 A;  1FGB D;  1XJV A;  4HIK A;  2F4I A;  4Y52 H;  2K6A A;  4X64 Q;  4HID A;  1LAC A;  3DHQ A;  2ZJP A;  1HCZ A;  2R7Z H;  4JI0 L;  1TU2 B;  3GTK H;  4PY3 A;  4MNO A;  2CFM A;  3GTL B;  4JI4 L;  2KJX A;  3RZO H;  3HOY B;  3ERO A;  3F2D A;  2NVQ B;  1JJ2 A;  1G6Z A;  4WGJ A;  5M5W B;  5EU0 A;  1C9O A;  3OYY A;  3J7Y W;  3CUC A;  1LTG D;  4J8Q A;  5HUR A;  3GV3 A;  4C3J B;  1PH3 A;  2F0Q A;  4JI5 Q;  1H9S B;  4HIM A;  2LXK A;  4K2L A;  1EYA A;  4LJZ C;  3OHX C;  1JWM D;  1AE2 A;  1L1O B;  1HTP A;  3D6W A;  3GTO B;  1OXS C;  3I3C A;  3CCQ A;  1EOT A;  4OX9 Q;  3KK7 A;  1Z6H A;  5IP9 G;  1K28 A;  1KDC A;  4DV1 Q;  2KA7 A;  1MJC A;  5FLX E;  1PFM A;  1VMC A;  2K75 A;  4LW1 A;  3S1Q B;  5KYI A;  1VQG A;  4WJW A;  5M9O A;  2OQK A;  1XMQ L;  1PH4 A;  4LUZ A;  1HFN A;  4YHH Q;  4TSS A;  2K5Q A;  4ZCK A;  5JJL A;  3IFT A;  2R92 H;  3EFX D;  2ZTC A;  5ELF A;  3D4D A;  1E22 A;  1CKM A;  2F03 A;  5GAG C;  4LWC A;  5ISR A;  1NAP A;  2EJF C;  1QUQ A;  1FVI A;  3D3R A;  1ASZ A;  1QNU A;  2JP1 A;  2D9U A;  3BYT B;  4A3J G;  1XPO A;  4FNF A;  4KKT A;  4CKE A;  4HJ9 A;  3A7L A;  5FLM H;  1EQV A;  3I91 A;  3MVV A;  4L8J A;  3DXJ C;  3CCR A;  1QWY A;  1ONL A;  1DXM A;  3H6M A;  3TZU A;  3CME A;  3E0J A;  3FEW X;  1VQE A;  2F0T A;  3GP7 A;  1Y1W G;  3C1F A;  5C3W A;  1V1P A;  5HY6 A;  5ELB A;  3GTM B;  1STN A;  3AB9 A;  1STA A;  1KD1 C;  3T1Y Q;  2AUK A;  2Z6K A;  3AFQ A;  4RFB A;  2YU9 H;  4LFA L;  3X3M A;  1B3Q A;  4RWS C;  5CMT A;  2K01 A;  1ET9 A;  1NUC A;  1VQA A;  3K8A A;  1JIC A;  2D62 A;  3MXP A;  3C3L A;  3S2D H;  2WIN B;  3MXN B;  2KEE A;  4EQP A;  4RGM A;  5JFF A;  1BKB A;  5C3E B;  1VQ4 A;  2CCZ A;  3PUZ A;  1H9S A;  3MTS A;  2L11 A;  2NWG A;  4IOA A;  3I4N H;  2B2V C;  4DGZ A;  3SHG A;  3CCU A;  4K5V A;  5HGQ A;  5IY0 A;  1TWF B;  3J81 j;  4A3K H;  3TSS A;  2K04 A;  2Q2T A;  1RD9 D;  2RQX A;  2HIX A;  4HCS A;  1GXD C;  1F2M A;  4JI7 L;  4JI1 Q;  1OXX K;  4TVA B;  4O0A A;  4UP8 A;  2MP1 A;  2RSO A;  4L5Q A;  4GNX C;  5C4J B;  5EKL A;  3SGI A;  4FXG C;  4FF1 A;  4X62 L;  1MJE A;  4C2M B;  1EY4 A;  2UXC Q;  4KK7 A;  4A3J H;  5IOC A;  4HMI A;  1ENA A;  2VQE Q;  2IX1 A;  2B2V A;  3P7J A;  4PQX A;  3NE5 B;  4ME3 A;  1EYC A;  3K7U C;  5GQO A;  2F0E A;  4AQY Q;  1AH9 A;  2CH4 A;  1LLR D;  2EYO A;  3A0J A;  2B2U A;  4DNT B;  3PO2 H;  1HZB A;  4X65 L;  4LFC L;  4ID6 A;  1I50 B;  1VQ6 A;  1SYE A;  1Y14 B;  3H94 A;  3H91 A;  1XYI A;  5IT9 L;  1EWC A;  2R92 B;  2EIF A;  2YYZ A;  4JI8 Q;  1M1K C;  1IBM Q;  2E76 C;  3A55 A;  3G6E A;  1Q46 A;  1PA6 A;  2H1E A;  1N33 L;  1S72 A;  2NVX B;  2KCT A;  1K83 B;  2A73 B;  3VYT A;  5M3F H;  3S2H H;  3KJO A;  1BO0 A;  1ROD A;  1WD0 A;  2SDF A;  1K0R A;  2B2T C;  4IQZ A;  2VS1 A;  4RKB A;  1AEX A;  4K6L A;  1F9S A;  3IKJ A;  4NW2 A;  5M5Y H;  4B3M L;  4GOP B;  2ASB A;  2IHF A;  1DOM A;  1SMY C;  1EEI D;  3ULL A;  3C46 A;  4WRD A;  1UE6 A;  3DUZ A;  2E74 C;  2F0O A;  1PH2 A;  3DEP A;  3PUW A;  4HED A;  1Y1V B;  4NB3 A;  1ASY A;  4OWT B;  4CDC C;  4DR3 Q;  5C4X H;  3MFY A;  3SVM A;  1HTL D;  2RBM A;  1NTG A;  1PRT C;  2QGQ A;  2J0T D;  4DV5 Q;  5DAU A;  1OTC A;  4C2M H;  4A4I A;  1YJN A;  1G29 1;  4JYA Q;  2K7V A;  4OGQ C;  3A8K E;  1MHW C;  1IBL Q;  3GO5 A;  4EQN A;  1N33 Q;  1MIU A;  2R7Z G;  2EY6 A;  1TWG H;  2CW0 C;  2L1B A;  3NEN A;  1QG7 A;  2L5T A;  3K80 C;  3TP6 A;  1ESF A;  1PZK D;  3DM3 A;  3TS0 A;  2NVY B;  1WTW A;  4YY3 Q;  1LAB A;  2OF1 A;  4G4K A;  2PW7 A;  1WD1 A;  3D4R A;  2Z6B A;  3NP8 A;  4A3L H;  4X3T A;  3JAM c;  2Q2U A;  4RG1 A;  3I4M B;  5FLX c;  4FXK C;  4ITR A;  1JJG A;  4APV A;  4LF5 L;  1KL9 A;  1PH9 A;  3MEH A;  3R8B A;  1O7I A;  4JI0 Q;  1I6H H;  2B8F A;  5CV6 A;  3RLF A;  4LF8 L;  1AZP A;  4IFD G;  1KNE A;  1I3Q B;  5FLX L;  4M1U B;  5M3M B;  2B63 B;  4HJA A;  2F0V A;  2I46 A;  3SK8 A;  1X3Q A;  1SE3 A;  2F0M A;  4DUY Q;  3M85 A;  4BY7 B;  2B63 H;  4CDE C;  1EZ8 A;  2QIL A;  5IGG A;  2VB2 X;  3S1M B;  4L5R C;  1TWH H;  1PTO H;  4JI6 L;  5BN5 A;  1FNV A;  1KIX A;  1V1Q A;  2NBF A;  3E9I A;  1HQM C;  1WCM B;  2PZT A;  4IPD A;  4XYO A;  1PTO F;  2LXJ A;  2A74 C;  1XNQ Q;  4X6A H;  4UAI A;  3HOW B;  1KAB A;  3M9B A;  2GVB A;  3I56 A;  4A3I G;  3KF6 B;  4DF7 A;  3SE0 A;  4DAV A;  1VQ9 A;  5IOD A;  3S1R B;  5I2X A;  1PHJ A;  4A3B H;  4DV7 L;  4PZ7 A;  1VQI A;  4OEM B;  3CRL C;  5IGC A;  2WAQ E;  3P1H A;  2ZXO A;  2F0P A;  1LTA D;  1HXY D;  5CBE E;  2IX0 A;  4DV0 Q;  3MHB A;  1S40 A;  3SK4 A;  1IW7 C;  2JA5 H;  3UI2 A;  4JI2 L;  3HEJ A;  1R4Q B;  4LF9 Q;  4LFB Q;  4GS3 A;  4RGT A;  4CDF C;  2B2Y A;  1Y1V G;  1VQK A;  1Q81 C;  2X69 A;  3S1R H;  4YHH L;  4BY7 G;  1J6Q A;  1E1T A;  3A7A B;  3KBX A;  3QJY A;  5M3F G;  5LMN Q;  4ZYS A;  4WFN 3;  1JOQ A;  2L0C A;  2AUJ D;  1OO9 B;  4QJF A;  1LT4 D;  2CW0 D;  3OPO A;  1WTV A;  3J7A F;  2JN4 A;  1UE5 A;  3ULJ A;  1GHK A;  1DYQ A;  5C4H A;  1XTC D;  4U04 A;  3PF5 A;  4TQU S;  3VR6 A;  1KAW A;  1Q1B A;  4CDD C;  2K32 A;  2IHE A;  1UUP A;  2HQL A;  5CV9 A;  1JQY D;  1SE2 A;  1EY8 A;  2B2W A;  2RF4 A;  5M3M G;  1GUW A;  3MXN A;  1TKW B;  2CH4 W;  4LUV A;  3VYS A;  1I4Q A;  2JEA I;  3HOZ B;  4U68 A;  2NTT A;  1WTR A;  5ELO A;  3H3V I;  2KHI A;  5IE8 A;  2EJM A;  2OCE A;  3L2P A;  4C3I G;  4A93 H;  2YTX A;  4K0K L;  2E5L L;  1F77 A;  2VQE L;  3EN2 A;  3MEF A;  3CCS A;  1LT5 D;  3PCO B;  2ICE C;  1E1O A;  1ICF B;  5KNC A;  5EJW A;  4A3I H;  3ND8 A;  3VR3 A;  2UUA L;  1PH5 A;  1BCP C;  1V9P A;  4H02 A;  4OO1 I;  1CFM A;  3GV6 A;  2LSS A;  2RSN A;  3KDF A;  3S2D B;  1XNQ L;  2WKD A;  3B6Y A;  4U07 A;  1Y1W H;  4A3G H;  1PFB A;  1DZ1 A;  3S6A A;  1EY7 A;  2J7Z A;  3CF5 A;  5AJ3 Q;  3SR1 A;  1CM9 A;  3DWP A;  3TDQ A;  4JI7 Q;  1C8C A;  1B8A A;  2FJ2 A;  2Q8T A;  1NE3 A;  2E2H B;  1PH1 A;  3HOY G;  1A63 A;  2FIN B;  3H0G B;  1IYV A;  3F1Z A;  4M16 A;  2ICI A;  5I9P A;  4A3F G;  3KF6 A;  3DWQ A;  2PI2 A;  1YI2 A;  4BA1 I;  4DKA C;  4JI1 L;  1Y1V H;  3KOJ A;  2EY2 A;  1LTR D;  5IT9 c;  2F0J A;  2C9O A;  1XX8 A;  1N8R C;  1O7L A;  1KLU D;  1VQH A;  4NKL A;  1N34 Q;  5TSS A;  1YHQ A;  3FMC A;  1GO3 E;  5EPJ A;  4P71 A;  1PRT B;  4NXM L;  4LFA Q;  1FGU A;  1AFP A;  4EX5 A;  1PZJ D;  4A3M B;  4N67 A;  1G2S A;  5I2Y A;  3FPP A;  2HIV A;  5JJ6 A;  4A76 A;  4X65 Q;  2XNA C;  1J8I A;  1GUN A;  4JI6 Q;  1HZC A;  3HZX A;  5FJ8 G;  1E0B A;  2DUD A;  5EBC A;  1VF7 A;  2B29 A;  1WFQ A;  2CKZ B;  3U4Z A;  2K4K A;  4G7Z C;  4C3I H;  4A93 G;  4JV5 Q;  1EOV A;  2F0F A;  3HOU B;  2IX3 A;  1L0Y B;  1WJJ A;  2EYP A;  5K36 G;  5I6Y A;  4A3D H;  1S5B D;  3Q24 A;  5LMU Q;  4HJ8 A;  1HH2 P;  2IWH A;  1AW7 A;  4KKS A;  4ZAI A;  4N9P A;  1U5K A;  1KRT A;  4KY5 A;  1EIG A;  1WYD A;  3F2C A;  5C3E G;  4GNX B;  3M7G A;  1PYB A;  1NY4 A;  4LF8 Q;  4JI3 Q;  5LMU L;  2NZH A;  3K0Y A;  3K6O A;  2AHO B;  3UE1 A;  1JB7 A;  1JWS D;  4KHV A;  3MXU A;  3FKI H;  2F0I A;  3EA6 A;  2FFK B;  3CQZ H;  4ZKB B;  4F87 A;  2F0W A;  1LTT D;  3GQB A;  2IL8 A;  2A6E D;  4KKU A;  4FP5 D;  4FVM A;  3QOJ A;  3HOU G;  1HNW Q;  1JT8 A;  4BS9 A;  5GAD C;  5F2D A;  5C4J H;  3CMA A;  4IFD H;  2LMC B;  2H5X A;  3IFD A;  1SNO A;  2G03 A;  2WB1 B;  3PUX A;  2NN6 I;  4KTA A;  2NYZ D;  3J81 L;  3TP5 A;  1CQF A;  3M3Y H;  2HCC A;  3CCL A;  3PIP A;  5LMN L;  1S4Z A;  1SEB D;  3PQI A;  3PO2 G;  1Z7T A;  5BN3 A;  2TSS A;  4AYB G;  2MGS A;  4A3K B;  4CGY B;  5L37 A;  1Q7Y C;  1CA5 A;  4A3G B;  1I4X A;  1BR9 A;  3NWT A;  4DR4 L;  3TZD A;  3PIO 3;  2ENB A;  5J22 A;  3RZD B;  5GAH C;  1CSQ A;  1HNX L;  1SND A;  4A75 A;  3WDN A;  3OIQ A;  1HQR D;  4RCN A;  1JB3 A;  1YEZ A;  3ULP A;  4PMC A;  1YIJ A;  1I4H A;  4U0U A;  5C44 H;  4R8I A;  5J3B A;  3L3O C;  4C56 C;  1VQJ A;  3U9S A;  1EY5 A;  4A3F B;  3HKZ B;  1EQR A;  2CQO A;  4BXX H;  1DOL A;  1ENF A;  4A3G G;  2PNH A;  2NZO A;  2MJ8 A;  3GTP B;  4A3B G;  5G3L D;  1JE5 A;  4CKC A;  2GN5 A;  4FDB A;  1UWV A;  1KAA A;  1XNR Q;  3I4M H;  4KY6 A;  3NBH B;  1FNW A;  1HA5 A;  5JPN C;  5CV7 A;  2Z6K C;  4HMJ A;  1EWH A;  5EKI A;  4C3H H;  4DV4 Q;  1O7Z A;  4HN7 A;  2EPB A;  4ZRZ A;  5M5X B;  1A3U A;  2XSC A;  1ENC A;  2VL6 A;  4RGO S;  3KF8 B;  4C3H G;  3RNU A;  3TME A;  1PVO A;  4C3J G;  4QUC A;  1W3S A;  2RHQ B;  3QG1 A;  1IXR A;  4OEL B;  4XIG S;  3I4L A;  1R4P B;  1TY0 A;  1EYD A;  2RCF A;  2XN9 C;  4A3F H;  1QZH A;  4QIW B;  1GUS A;  1Q8K A;  3FVQ A;  5C5L A;  4AIM A;  4OWX B;  1YHB A;  2XRS D;  1PH7 A;  5C6A A;  3AMU A;  4HCE A;  1KQS A;  1CK1 A;  2KEN A;  3QR8 A;  2JJQ A;  2B2U C;  1NNX A;  4QMG A;  3OTO L;  2Z4I A;  4ABN A;  3STB D;  2L15 A;  3CXC A;  1BBX C;  1LUZ A;  4AQY L;  4G57 A;  2A8V A;  3ZLM A;  1CUK A;  3ONA B;  1H95 A;  5IWA L;  2ALY B;  4OIK A;  3UDG A;  2R7F A;  3I70 A;  3BU2 A;  1F2Y A;  2EY5 A;  1IL2 A;  2BDN A;  4KV6 A;  2EDG A;  2JA6 H;  3WOF A;  2CHB D;  4MZ9 A;  3PUV A;  3TQY A;  4J1M A;  3NSW A;  4IN3 A;  1Y69 U;  1G91 A;  1X6O A;  4DAM A;  2WB1 E;  1A8V A;  2JA7 G;  2MFI A;  2NN6 G;  3PGZ A;  2E2J H;  1B9M A;  4UDU C;  3K7A B;  1Q1E A;  1J5E Q;  4DNR B;  5C0X G;  4O2D A;  1SNQ A;  3H09 A;  5CYU A;  1N9W A;  3A5Z B;  2MHV A;  3M3Y B;  2WAC A;  2V4D A;  4YY3 L;  4C3H B;  4X2C A;  1ZKO A;  1WTX A;  2D2C C;  5KNB A;  4F88 A;  2N78 A;  4GKJ L;  1QUQ B;  1MSG A;  4A3J B;  2UUA Q;  2VNU D;  1VQM A;  3NK9 A;  1K3R A;  2DNE A;  4BBR G;  1G51 A;  1RTO A;  4JCV E;  2Y0S B;  1OXU A;  3SXH A;  5IGE A;  2YTY A;  3JAM L;  3A8I E;  3BZK A;  1D1I A;  3ZYY X;  1AP0 A;  1C48 A;  2JEB I;  2OXP A;  3O13 A;  3V05 A;  3PIO A;  2NUN A;  4R8N A;  4BBS G;  1STG A;  2KCM A;  4UP9 A;  2Q8I B;  1PZI D;  1OXT A;  1D5X C;  4HTH A;  1HR0 L;  4A3C H;  1VQP A;  1QZG A;  1K3B C;  4YWL A;  3HOV G;  1ZYR D;  3T1H Q;  4IUR A;  3S9W A;  1HNZ L;  2DJF C;  4BBR B;  4JI4 Q;  5K36 H;  4C3I B;  3PO3 H;  4O1N A;  2K5V A;  3CP0 A;  5M5X H;  1JWU D;  1U4P A;  1IBL L;  4A93 B;  2QF7 A;  4IPG A;  5IT9 E;  2F0G A;  1FNU A;  1RJT A;  4H44 C;  4OON A;  1K9M C;  4B08 A;  1C0A A;  4F7X A;  2SNM A;  4JOI C;  3CC2 A;  3C2P A;  2NVT B;  5KRU A;  5A2Q E;  1VQ7 A;  3RLN A;  4POF A;  1EQQ A;  2ES2 A;  1S5D D;  1SNM A;  4QL5 A;  4QQB X;  1HFG A;  2L9H A;  4DAY A;  2B39 A;  1SAP A;  3FKI G;  4BBR H;  1X3E A;  5ELN A;  3NWS A;  1SRU A;  3S2H B;  2BOS A;  2R7D A;  1GKH A;  2Y0S G;  1PTO B;  1E2W A;  3LWU A;  3QB3 A;  4B3M Q;  1SJE D;  4DN4 M;  4DU9 A;  3J81 i;  1II3 A;  1GM5 A;  1DD2 A;  1TWA H;  1QCB D;  2Q8R E;  4YIJ A;  2JQO A;  2QDB A;  3G4S A;  2RCN A;  3HKS A;  5CC4 A;  1B70 B;  3K59 A;  2K28 A;  2M00 A;  1DJR D;  4KD3 A;  1JOK A;  1E7Z A;  5JJK A;  4MHE A;  3JC6 6;  5IYC H;  1FD7 D;  1C7Y A;  2XRQ D;  1MD2 D;  4V0B A;  1D8L A;  5KIX A;  3QO2 A;  4LAA A;  1CKN B;  3S16 H;  1L1O A;  4P73 A;  1VQO A;  4IUQ A;  3EVQ A;  3M4O H;  3T51 B;  4X2E A;  4JI3 L;  4DV6 Q;  1TWC H;  1X3G A;  2WFW A;  4HR7 B;  1JC7 A;  2L12 A;  2K5N A;  4JBM A;  1LTS D;  2XIW A;  1BF4 A;  1TWG B;  2M9V A;  3URY A;  1ILP A;  2Z4H A;  3T56 B;  3KUP A;  5C44 G;  4P72 A;  3ZC7 A;  3A74 A;  2AQ1 B;  3T53 B;  4B3T L;  1O7Y A;  1STB A;  1J5E L;  1SMX A;  4DPG A;  1A3T A;  4G7H C;  2E75 C;  3HOZ G;  2IJ0 A;  1EY9 A;  3CU7 A;  1LT6 D;  3HOX G;  3G6J B;  3GTG H;  2EVB A;  1IZ6 A;  4KN7 C;  1U4L A;  3LET A;  3NQI A;  4A3D B;  3I2Z A;  3CC7 A;  4IJL A;  2JA6 B;  3HOY H;  3T4A C;  5JJZ A;  3W2D A;  1G6P A;  5LHY 1;  4DV2 Q;  2G9H D;  3M7N A;  2OTL A;  3GTL H;  1VQD A;  4X3K A;  1G2T A;  1SR3 A;  4O42 A;  1PV4 A;  4BWG B;  4WJ3 M;  3S1N B;  2VY3 A;  3E6Z X;  2Z8L A;  5ELC A;  2VZA A;  1EY6 A;  3UDF A;  5J39 A;  3KF8 A;  4H0L C;  1EL0 A;  2HCI A;  3CRK C;  4FF3 A;  3RZD H;  3MFG A;  5JJ7 A;  3CCJ A;  1UAP A;  1PYS B;  4ULL A;  4DXG A;  4JPB W;  4DR5 L;  3HP3 A;  1PRT F;  2QDL A;  4NXN Q;  3GTO H;  2K33 A;  5ELE A;  4GLX A;  2F0K A;  3KFU A;  2XWJ B;  3N6R A;  2RDF A;  4AYB E;  1TS3 A;  1CQV A;  4JBJ A;  4TRD A;  5IGB A;  4IUU A;  4QGU A;  4OHJ A;  3GTQ H;  4LF7 L;  4DR7 Q;  1AE3 A;  4N9T A;  2B63 G;  4QIW E;  1MBY A;  2B2Y C;  4ZK9 B;  1PFS A;  4UY8 C;  1LTL A;  4JI8 L;  3V2T A;  1NH1 A;  3GDE A;  3T13 A;  1XMQ Q;  2A5H A;  3QOL A;  1HNX Q;  3EBE A;  4A3D G;  3L7Z C;  1JCK B;  4GLA C;  1RIP A;  2EOT A;  3DLL A;  3M4O B;  3RLO A;  1PTO D;  2K5H A;  4IOC A;  2R93 G;  3F2B A;  3HOX B;  3SE5 A;  2FXQ A;  4KI0 A;  5M5Y B;  4UPA A;  3RMH A;  4DR1 Q;  5E4X A;  1YJ9 A;  1EIH A;  2KCN A;  1X55 A;  1PRT D;  2MO0 A;  1TS4 A;  3BVZ A;  2A68 C;  5C44 B;  4OXP A;  1BNZ A;  1SBB B;  4JC0 A;  1D2B A;  4NPS A;  2F0S A;  1A2U A;  3S14 H;  3D8G A;  1YZ6 A;  5C3X A;  4XQN A;  1JE4 A;  3R2T A;  3EQL C;  5KND A;  3I55 A;  1WI5 A;  1MGS A;  2KUM A;  5BR8 Q;  2EXD A;  1KXL A;  3CKI B;  1B50 A;  1MI2 A;  4J6H A;  5FO7 B;  5A2Q L;  4LK1 C;  5CV8 A;  2QEJ C;  3N52 A;  4DR2 Q;  2I5H A;  5JEA G;  3A56 A;  4UHV A;  1X9N A;  3A8J E;  2UXC L;  2HDL A;  1YNJ C;  2XGT A;  2UU9 Q;  4BBS H;  4JOI A;  3U58 A;  1CKO A;  4A3E H;  1FYC A;  2Z9H A;  2Y0S E;  2XWB B;  4JG2 A;  4RMF A;  4R9W A;  4KY7 A;  1O78 A;  2F4V L;  1CT1 D;  3K5N A;  4JV5 L;  2ID0 A;  2FMC A;  2A69 D;  4K5X A;  4DK0 A;  4RGN A;  4EVO A;  4BBS B;  1UEA B;  1RF2 D;  1SXT A;  4M8A A;  2K50 A;  3CQZ B;  4KLK A;  1SYC A;  3Q23 A;  3A54 A;  4QB4 A;  2A6H C;  1I4P A;  3OMG A;  2K14 A;  4Y7N B;  5I6W A;  3FKI B;  5CV5 A;  1PFN A;  3K7A H;  5IWA Q;  2C5C A;  1EEF D;  2B3G A;  1HZ9 A;  1UEB A;  1JOO A;  2DN8 A;  2MPM A;  3Q0A A;  1AZQ A;  1WOC A;  1TWF H;  2HHH Q;  3I4N G;  4X66 L;  4LF4 L;  1D7Q A;  1A62 A;  1TVX A;  4B3T Q;  3J80 c;  1B1Z A;  3J7A V;  4DA2 A;  3S1N H;  5FOB B;  1SNC A;  2UXB Q;  3KLW A;  4JVZ A;  4K8J A;  4PNY A;  2K5W A;  3NHH A;  2NVT H;  1B7Y B;  5KYL A;  1VF5 C;  2AMC B;  4R4Q A;  1Q8I A;  4EGV A;  3PIP 3;  3UE0 A;  3A5U A;  1ZYR C;  3HOV B;  2F52 A;  3GTJ H;  1W6J A;  3FDT A;  4DV6 L;  1VQF A;  3K5O A;  5EQ0 A;  2RVL A;  1F2L A;  3AYH B;  2F3V A;  4YCU A;  4DAY B;  3FP9 A;  2N55 A;  2GVA A;  3MZ5 A;  3I7F A;  4DUY L;  1VQL A;  3AU7 A;  3CD6 A;  1I4R A;  3NXW A;  4IPH A;  1HZA A;  1ML0 D;  1TT2 A;  1RDP D;  2OQ0 A;  5EPL A;  2PI2 E;  2VUM B;  5FKA C;  4RHR A;  4BY1 B;  1I4G A;  2E8G A;  1VS0 A;  1T9H A;  4QF4 A;  3SDZ A;  5GAE C;  2R93 B;  3OSO A;  3ZJY C;  3PO3 G;  1GHJ A;  3NPP A;  3ERQ A;  5E1F A;  1SYF A;  2R3Z A;  3HFZ B;  4XQQ A;  5T1I A;  4QCL A;  1Y8O B;  5K5P A;  2DJG C;  3VR4 A;  3HG9 A;  3ER0 A;  2AWN A;  5CBA E;  1XMO L;  2IW3 A;  1J9O A;  5DM6 3;  1YJW A;  1RL2 A;  1HNZ Q;  3J7Z C;  3S1M H;  5EBD A;  2J4X A;  1V1P B;  1Y8N B;  4PZ8 A;  1KRS A;  1ICW A;  1Q86 C;  3VR5 A;  1PXU A;  2NTS A;  3G7L A;  2PMZ E;  2JA8 B;  5EGT A;  4BY1 G;  5H1S E;  1EZ6 A;  1TS5 A;  2QKI C;  3LWE A;  2PQA B;  3HOX H;  2R93 H;  4BXX G;  2PQE A;  4RKL A;  5IYB G;  3BZC A;  1K73 C;  2E5L Q;  5I9O A;  2SOB A;  1B4O A;  1GD7 A;  4XQJ A;  2JA5 G;  1P16 A;  2D5D A;  3OWF A;  4HSP A;  4R4T A;  5LL6 S;  4GNX A;  3NTH A;  2LFN A;  1EU4 A;  1LTB D;  1BVS A;  2JYO A;  2QW7 A;  4HAE A;  2IPK D;  1W6K A;  2EYH A;  2DY8 A;  3M4P A;  1TWC B;  4L5S A;  3SHL A;  1VQC A;  1QNK A;  3R3O A;  4KHP L;  2D0O A;  1GUO A;  3BDL A;  5C0X I;  3K5L A;  5D3I B;  2UXD Q;  4KJO A;  2PZU A;  2XTI A;  3NTI A;  3CPW A;  2QA4 A;  3GTK B;  1B9N A;  2WKC A;  1GJX A;  1K0S A;  3TEH B;  3EJI A;  2LKV A;  4WOR A;  5JEA J;  5M3M H;  3CCV A;  4CJ2 C;  3T1H L;  5C5M A;  3R93 A;  1SYD A;  1SE8 A;  2BE5 D;  4LUO A;  2I0Q A;  2JA5 B;  4FYD A;  2A6E C;  4L63 B;  5J1Z A;  3UDI A;  3K58 A;  1T5E A;  3E3X A;  4DV0 L;  2ZTE A;  2JE6 I;  1BQQ T;  1ET6 A;  3S17 H;  5IIF A;  4PMB A;  4GOP C;  1QJO A;  1YIT A;  3K81 C;  2V1C C;  3TBI B;  2N8N A;  4DV3 Q;  2IY5 B;  4OO1 G;  3D6C A;  3TRE A;  3I8Z A;  5COR A;  4XI8 A;  4RCO A;  1M90 C;  4NDX A;  4K2K A;  2HDM A;  3NEL A;  3BYY B;  5LL6 X;  3OTO Q;  1BCP F;  1KLG D;  4DK1 A;  2NVQ H;  5EAY A;  5KGU A;  4X3U A;  5CGK A;  3OWE B;  4R4O A;  1VQ5 A;  1LV9 A;  1DOK A;  2K03 A;  4RHS A;  4H13 C;  5IYB H;  3KDF B;  3RN2 A;  1SYG A;  2YTV A;  3AEV A;  5GRO A;  4X3S A;  1IL8 A;  2UUC L;  4GKK L;  5JEA H;  2PQA A;  2VXW A;  3PO3 B;  2CWA A;  1K8O A;  4YWK A;  1VQN A;  3G48 A;  4MIU A;  3TS2 A;  2B2W C;  2GA4 B;  1WTQ A;  1N32 Q;  5AJ3 L;  1I3Q H;  4A3C G;  3J7A 5;  1ILQ A;  2L55 A;  2ATW A;  2BH2 A;  2UUC Q;  4GKK Q;  2N3S A;  4A3E B;  3RD4 A;  2HHH L;  2WII B;  3PSI A;  3TRZ A;  4ZLT F;  4GN4 B;  1XXG A;  2P5Z X;  4IO9 A;  5IYC G;  3S1Q H;  5CGL A;  1E2Z A;  5LMN W;  2VW9 A;  4LFC Q;  3MC0 B;  1LM0 A;  3J81 c;  3HOU H;  1CI3 M;  1HNW L;  5T1G A;  5BR8 L;  1KC8 C;  1N34 L;  1S5C D;  3K0X A;  4GZY C;  3KYH C;  3I73 A;  1N36 L;  1QB5 D;  1BXT A;  3I4O A;  1PYW D;  2JXM B;  5DEH A;  1L0W A;  3WOE A;  1WCM H;  4PMW A;  3D0F A;  3KLR A;  4OWW B;  2BH8 A;  4NXM Q;  4LU4 A;  2SNS A;  5C4Z A;  2QCP X;  4MTK A;  2AQ3 B;  2JA9 A;  5IGF A;  1L1O C;  2OT2 A;  3NTK A;  3ND9 A;  2E2D C;  3J80 L;  3BS1 A;  5CKL A;  4BY7 H;  5IYD G;  4V19 0;  5G3L F;  4XXE A;  1IKL A;  5C3E H;  3Q8D A;  3CCM A;  2B2T A;  3PUY A;  4LF9 L;  2Q2H A;  1OXV A;  4DR4 Q;  4DUZ Q;  3HOZ H;  5C0X H;  2SEB D;  5D65 A;  1JJC B;  1LT3 D;  5JAV A;  4IPC A;  4Q5V A;  1B2T A;  5FO8 B;  4B9W A;  3WWV A;  4FF2 A;  3DMU A;  4IUV A;  1A15 A;  1F2Z A;  2LS0 1;  4NMZ A;  3H0G H;  4TKO B;  3GTM H;  1LYL A;  4HIO A;  1ZXT A;  1UNS A;  2A1A A;  1U0L A;  4Q0F A;  2F0U A;  2F0L A;  4GLV B;  4DAP A;  1EYG A;  3CC4 A;  1HUM A;  3D4W A;  4N8X 1;  3Q6S A;  2EYF A;  1V43 A;  2K5D A;  1NMF A;  2O4X A;  3HRZ C;  4DV1 L;  1H9J A;  1WTO A;  1HPC A;  3OOC A;  3HGB A;  1PH6 A;  5C4X G;  1QOH A;  1HJP A;  5JFZ A;  2DGY A;  2G5D A;  3MA2 B;  4K0K Q;  2AQ2 B;  3KLS X;  1JOR A;  1F9R A;  2KEC A;  2F3I A;  1V1O A;  2CVR A;  1STE A;  4DFA A;  1I50 H;  2HUG A;  1XWE A;  4Y7N H;  5I4D A;  3F8T A;  4A3I B;  1QE6 A;  2ZTD A;  3BDO A;  1KDB A;  2ZT9 C;  4A3E G;  5JJI A;  3SN9 A;  1S5F D;  3ZCB A;  3W1B A;  4XTC S;  2PYK A;  1L2F A;  4UP7 A;  1NCV A;  3H3V H;  2I07 B;  3S24 A;  3AFP A;  5FLM G;  4JI2 Q;  4OO1 H;  1P8L A;  4LF6 Q;  1QVF A;  3ITP A;  1IBK L;  1DON A;  2NUC A; 
#chains in the Genus database with same CATH homology
 4DR5 Q;  5EU0 A;  1C9O A;  1I94 Q;  3OYY A;  3CUC A;  4NXM L;  1PFS A;  4LFA Q;  1QVC A;  1FGU A;  1XPU A;  4UY8 C;  1Z47 A;  1LTL A;  4JI8 L;  1MKH A;  2CWP A;  4EX5 A;  1PH3 A;  4JI5 Q;  3GDE A;  4N67 A;  4QY7 A;  2LXK A;  4HIM A;  1XMQ Q;  2HIV A;  5JJ6 A;  4A76 A;  1JMC A;  4X65 Q;  1AE2 A;  2VUM H;  1L1O B;  4DNI A;  3EBE A;  1HNX Q;  3L7Z C;  4JI6 Q;  4LF5 L;  4A3D G;  4GLA C;  1RIP A;  1OXS C;  1HZC A;  3DLL A;  3CCQ A;  3RLO A;  4IOC A;  2K5H A;  2JA7 H;  5FJ8 G;  4OX9 Q;  2DUD A;  3D31 A;  3H0G G;  3HKZ G;  3F2B A;  2R93 G;  4POG A;  5IP9 G;  2B29 A;  3SE5 A;  2FXQ A;  1Z9F A;  3GTP H;  2YV5 A;  4KI0 A;  4UPA A;  1WFQ A;  2CKZ B;  3U4Z A;  4DR1 Q;  2K4K A;  4JBK A;  4C3I H;  4DV1 Q;  1YJ9 A;  3T1Y L;  1MJC A;  4JV5 Q;  1EOV A;  4A93 G;  1X55 A;  1WJJ A;  2MO0 A;  4DK6 C;  1K8G A;  5K36 G;  2K75 A;  4LW1 A;  1VQG A;  4OXP A;  1NBW A;  2VUM G;  2UXD L;  4A3D H;  5LMU Q;  4HJ8 A;  2OQK A;  1XMQ L;  1PH4 A;  4DUZ L;  1HH2 P;  4LUZ A;  2WB1 G;  1U5K A;  4JC0 A;  4NPS A;  1KRT A;  4YHH Q;  4DR1 L;  2UU9 L;  1WYD A;  5IP9 H;  3S14 H;  5JJL A;  1YZ6 A;  2R92 H;  3F2C A;  5C3E G;  4GNX B;  4HJ5 A;  3I55 A;  1WI5 A;  1PYB A;  2ZTC A;  4DR3 L;  1IBK Q;  1NY4 A;  4LF8 Q;  1TXY A;  2WAQ G;  4JI3 Q;  5BR8 Q;  2HT1 A;  2EXD A;  5LMU L;  1KXL A;  2NZH A;  4X2D A;  2AHO B;  1E22 A;  3CPF A;  4GN5 A;  1CKM A;  3UE1 A;  1JB7 A;  5GAG C;  4DV3 L;  2A19 A;  4LWC A;  3HOW H;  3FKI H;  2KHJ A;  4DR2 Q;  1QUQ A;  2I5H A;  1FVI A;  5JEA G;  2E2H H;  2NVY H;  3U4V A;  1X9N A;  3CQZ H;  3M4Q A;  2UXC L;  1ASZ A;  2XGT A;  2UU9 Q;  4BBS H;  4JOI A;  3U58 A;  1CKO A;  3RR5 A;  4A3E H;  4A3J G;  1XPO A;  3CAM A;  4IFD I;  3HOU G;  1HNW Q;  1JT8 A;  4HJ9 A;  5FLM H;  2Y0S E;  5GAD C;  4JG2 A;  4RMF A;  5C4J H;  3CCR A;  3CMA A;  2F4V L;  3ERS X;  4JV5 L;  1CKN A;  2ID0 A;  4X66 Q;  2H5X A;  3CME A;  4LF4 Q;  2G03 A;  3PUX A;  1VQE A;  2NN6 I;  3BJU A;  1Y1W G;  4B3S L;  2JA8 H;  1XMO Q;  3CW2 C;  5HY6 A;  2K50 A;  3M3Y H;  4KLK A;  3CCL A;  3PIP A;  1R9T H;  4LF5 Q;  5LMN L;  2K14 A;  2ZJR A;  4IJH A;  3PO2 G;  5C0X J;  3L0O A;  4AYB G;  3T1Y Q;  1KD1 C;  3HOV H;  2VQF Q;  2Z6K A;  1YVC A;  3AFQ A;  3K7A H;  4DV5 L;  5IWA Q;  2YU9 H;  1Q7Y C;  4A3L G;  2B3G A;  4LFA L;  1HZ9 A;  1UEB A;  5CMT A;  3K8A A;  2AWO A;  1VQA A;  1WOC A;  2D62 A;  1TWF H;  1UE7 A;  4DR4 L;  2HHH Q;  4DR6 Q;  1EIF A;  3S2D H;  3I4N G;  4X66 L;  4LF4 L;  1D7Q A;  3MXN B;  5GAH C;  1CSQ A;  1HNX L;  4A75 A;  5JFF A;  1BKB A;  2R6G A;  1A62 A;  1YEZ A;  1YHA A;  3J80 c;  2VQF L;  3PUZ A;  5DLQ E;  3ULP A;  1VQ4 A;  2CCZ A;  1YIJ A;  4OX9 L;  3S1N H;  4U0U A;  3EIV A;  3KLW A;  5C44 H;  4IOA A;  2UXB Q;  1I5F A;  5J3B A;  3I4N H;  1VQJ A;  3SHG A;  1YNX A;  1EQR A;  2CQO A;  3CCU A;  1N36 Q;  4BXX H;  3NEM A;  5HGQ A;  4A3G G;  2NVT H;  2PNH A;  1B7Y B;  2NZO A;  5IY0 A;  2AMC B;  4R4Q A;  4A3B G;  3A5U A;  3UE0 A;  1JE5 A;  2GN5 A;  4FDB A;  1UWV A;  3J81 j;  4A3K H;  1XNR Q;  2Q2T A;  2UUB L;  2WP8 J;  3I4M H;  2F52 A;  3NBH B;  2HIX A;  3GTJ H;  4LF7 Q;  4JI7 L;  2Z6K C;  4DV6 L;  1HR0 Q;  1VQF A;  3ICE A;  4C3H H;  4EQ5 A;  2C35 B;  4JI1 Q;  4DV4 Q;  1OXX K;  3OW2 A;  3AYH B;  4YCU A;  4DAY B;  3FP9 A;  4TVA B;  4O0A A;  4UP8 A;  4JI5 L;  2GVA A;  3I7F A;  2VL6 A;  2Q2I A;  3KF8 B;  4DUY L;  3RNU A;  2B63 G;  2K52 A;  4LFB L;  1VQL A;  4L5Q A;  4GNX C;  3CD6 A;  4LNQ A;  1PVO A;  4IPH A;  1HZA A;  1W3S A;  3SGI A;  2OQ0 A;  2RHQ B;  2PI2 E;  4X62 L;  1IXR A;  1MJE A;  4IFD J;  4XIG S;  2UXC Q;  4A3J H;  1PH8 A;  2E8G A;  1VS0 A;  1T9H A;  1FL0 A;  5GAE C;  1X56 A;  2VQE Q;  2IX1 A;  3ZJY C;  4A3F H;  1QZH A;  3JAM i;  3PO3 G;  4ME3 A;  3K7U C;  5GQO A;  4AQY Q;  1AH9 A;  1Q8K A;  3PF4 A;  5IYD H;  3HFZ B;  4OWX B;  4AIM A;  1YHB A;  1PH7 A;  3A0J A;  3CCE A;  1KQS A;  4A3M G;  3PO2 H;  2KEN A;  1HZB A;  4X65 L;  1NMG A;  1SFO H;  2JJQ A;  4LFC L;  1VQ6 A;  3LGJ A;  3OTO L;  1Y14 B;  3ER0 A;  2AWN A;  3STB D;  2EIF A;  1XMO L;  2L15 A;  2YYZ A;  4JI8 Q;  3CXC A;  1M1K C;  1LUZ A;  1YJW A;  1IBM Q;  4AQY L;  2I5M X;  1RL2 A;  1HNZ Q;  4U0S A;  2A8V A;  3J7Z C;  3G6E A;  3S1M H;  3ZLM A;  1Q46 A;  3VDY A;  1PA6 A;  1N33 L;  1CUK A;  1S72 A;  4PZ8 A;  1KRS A;  1EUJ A;  5IWA L;  2ALY B;  1H95 A;  3UDG A;  1Q86 C;  2R7F A;  3W1G A;  1BBW A;  4A3M H;  3BU2 A;  2KCT A;  3UDX A;  5M3F H;  1IL2 A;  3S2H H;  3KJO A;  2JA6 H;  3KJP A;  2E2I H;  4YWM A;  2PMZ E;  3PUV A;  1A0I A;  4MZ9 A;  1K0R A;  4BY1 G;  3TQY A;  5H1S E;  1X6O A;  2PQA B;  2VS1 A;  4X64 L;  4DV4 L;  3HOX H;  4DAM A;  2WB1 E;  4BXX G;  2R93 H;  1GVP A;  1A8V A;  1SRO A;  5IYB G;  3BZC A;  1EWI A;  2MO1 A;  2ZM6 L;  1K73 C;  5M5Y H;  2E5L Q;  2JA7 G;  2OTJ A;  5FJ8 H;  2MFI A;  4B3M L;  2NN6 G;  4GOP B;  3PGZ A;  2IHF A;  2ASB A;  2E2J H;  3ULL A;  4LF6 L;  1Q1E A;  1UE6 A;  3STB C;  1K8A C;  1GD7 A;  2JA5 G;  4PG3 A;  1J5E Q;  1UE1 A;  1P16 A;  5C0X G;  1PH2 A;  4R4T A;  1VQ8 A;  3PUW A;  4O2D A;  4GNX A;  3HKZ E;  4P75 A;  1N9W A;  3A5Z B;  4R1J A;  1I94 L;  4YY3 L;  4NB3 A;  4X2C A;  1BVS A;  1ASY A;  4OWT B;  4DR3 Q;  5C4X H;  1FJG L;  1NTG A;  2N78 A;  2D0P A;  4GKJ L;  2QGQ A;  2RHS B;  1K83 H;  1QUQ B;  3M4P A;  4DV5 Q;  3E9H A;  4L5S A;  2UUA Q;  1OTC A;  2VNU D;  4C2M H;  1VQC A;  1VQM A;  4YCV A;  4A4I A;  1K3R A;  1YJN A;  1G29 1;  2D0O A;  1G51 A;  4BBR G;  4JYA Q;  4KHP L;  5C0X I;  4JCV E;  1IBL Q;  2UXD Q;  3GO5 A;  1N33 Q;  2R7Z G;  1MIU A;  1OXU A;  2UUB Q;  1BBU A;  1TWG H;  2YTY A;  2XTI A;  3CPW A;  3NEN A;  2ZJQ A;  2QA4 A;  4DR7 L;  3K80 C;  3TEH B;  3BZK A;  3DM3 A;  3TS0 A;  4YY3 Q;  1HR0 W;  5JEA J;  5M3M H;  3CCV A;  3T1H L;  2JEB I;  1SE8 A;  4NXN L;  4A3L H;  3PIO A;  4LUO A;  1CSP A;  1AE3 A;  3JAM c;  2Q2U A;  4RG1 A;  2I0Q A;  1SLJ A;  5FLX c;  2QEX A;  4BBS G;  4ITR A;  3UDI A;  4DV0 L;  2KCM A;  2MQH A;  4UP9 A;  1KL9 A;  4APV A;  2ZTE A;  2JE6 I;  4JBW A;  1S3O A;  1W2B A;  1O7I A;  1PH9 A;  4JI0 Q;  1E3P A;  1OXT A;  3S17 H;  3J80 i;  2I5L X;  2N49 A;  3GD7 A;  4GOP C;  1KHI A;  3K81 C;  2V1C C;  1YIT A;  1HR0 L;  4A3C H;  1I6H H;  4WJ4 A;  3RLF A;  4LF8 L;  2N8N A;  1VQP A;  1Q82 C;  4DV3 Q;  1QZG A;  1EFW A;  4IFD G;  4YWL A;  3HOV G;  2IY5 B;  4P74 A;  3T1H Q;  3TRE A;  3H15 A;  4OO1 G;  4HJA A;  2Z0S A;  4R4I A;  1HNZ L;  2JA8 G;  4XI8 A;  4JI4 Q;  1M90 C;  4AH6 A;  4DUY Q;  3M85 A;  3NEL A;  3E0E A;  3PO3 H;  2B63 H;  2K5V A;  3OTO Q;  3AQQ A;  3CP0 A;  5M5X H;  4BY1 H;  2NVQ H;  1X54 A;  5EAY A;  4B3R Q;  1IBL L;  4L5R C;  4IPG A;  1TWH H;  4R4O A;  1VQ5 A;  2BA1 A;  4JI6 L;  1XTD A;  1KIX A;  4KHZ A;  4YCW A;  5IYB H;  1V1Q A;  3KDF B;  4OON A;  3RN2 A;  3N3U A;  3IRB A;  1K9M C;  3E9I A;  2YTV A;  3S15 H;  1C0A A;  1VQB A;  4JOI C;  4IPD A;  3CC2 A;  1SN8 A;  3AEV A;  5GRO A;  4C3J H;  1VQ7 A;  4B3S Q;  3RLN A;  4POF A;  1IYJ B;  1EQQ A;  4MTN A;  2ES2 A;  2UUC L;  4GKK L;  4DV7 Q;  2LXJ A;  2PQA A;  5M5W H;  2CWA A;  4QL5 A;  5IP7 H;  4QQB X;  4YWK A;  1XNQ Q;  3HOW G;  4X6A H;  3FKI G;  4BBR H;  1VQN A;  1X3E A;  3G48 A;  5ELN A;  1SRU A;  2MNA A;  3M9B A;  2GVB A;  2R7D A;  3TS2 A;  3I56 A;  4A3I G;  1GKH A;  1N32 Q;  2Y0S G;  5IP7 G;  3KF6 B;  5AJ3 L;  1I3Q H;  4A3K G;  4B3M Q;  4A3C G;  3J7A 5;  1VQ9 A;  2BH2 A;  2ATW A;  4ALP A;  1FJG Q;  1XPR A;  1PHJ A;  4A3B H;  2UUC Q;  3FHW A;  3J81 i;  4DV7 L;  2N3S A;  1WCM G;  4PZ7 A;  2HHH L;  1VQI A;  4DR6 L;  4GN3 B;  2WAQ E;  1GM5 A;  3PSI A;  1TWA H;  1QVG A;  3TRZ A;  2JQO A;  2IX0 A;  3PV0 A;  4GN4 B;  4R4C A;  4IO9 A;  5IYC G;  3S1Q H;  5CGL A;  4DV0 Q;  3G4S A;  4DV2 L;  5LMN W;  2RCN A;  2VW9 A;  1S40 A;  4LFC Q;  4GKK Q;  1N32 L;  1LM0 A;  3HKS A;  3J81 c;  2JA5 H;  1B70 B;  3HOU H;  4DK3 C;  2NVX H;  1HNW L;  5BR8 L;  1KC8 C;  1N34 L;  4JI2 L;  3K0X A;  3KYH C;  1E7Z A;  1N36 L;  4LF9 Q;  5JJK A;  3I4O A;  4LFB Q;  3JC6 6;  1L0W A;  4GS3 A;  5IYC H;  1WCM H;  1Y1V G;  4BA2 I;  1JJG A;  4PMW A;  3D0F A;  1C7Y A;  1IBM L;  1VQK A;  1Q81 C;  4OWW B;  3S1R H;  4YHH L;  4BY7 G;  1D8L A;  2OWO A;  2BH8 A;  1J6Q A;  1E1T A;  4NXM Q;  4LU4 A;  1CKN B;  2JA6 G;  3S16 H;  1L1O A;  2JA9 A;  4P73 A;  1VQO A;  5M3F G;  3M4O H;  5LMN Q;  1L1O C;  4L5T A;  2UXB L;  4X2E A;  4QJF A;  4JI3 L;  4DV6 Q;  1TWC H;  1X3G A;  2WFW A;  5CKL A;  4BY7 H;  5IYD G;  1UE5 A;  3ULJ A;  2K5N A;  5C3E H;  3Q8D A;  4GKJ Q;  4U04 A;  3CCM A;  3PF5 A;  4JBM A;  3PUY A;  4LF9 L;  4TQU S;  2Q2H A;  1KAW A;  1OXV A;  1Q1B A;  4DR4 Q;  2IT1 A;  2IHE A;  4DUZ Q;  2HQL A;  4JYA L;  3HOZ H;  4KHP Q;  5C44 G;  1NJI C;  1YBY A;  4P72 A;  3ZC7 A;  3A74 A;  4PZ6 A;  2RF4 A;  4X62 Q;  5M3M G;  1EIY B;  4B3T L;  1XNR L;  4LUV A;  1JJC B;  1J5E L;  2JEA I;  1SMX A;  4IPC A;  4DPG A;  4U0Z A;  3HOZ G;  3WWV A;  3H3V I;  5ELO A;  2KHI A;  5IE8 A;  2OCE A;  3L2P A;  4GOP A;  1X65 A;  4HJ7 A;  4A93 H;  4K0K L;  2YTX A;  3HOX G;  2E5L L;  3H0G H;  2F4V Q;  2ZM6 Q;  2VQE L;  3EN2 A;  3MEF A;  4J15 A;  1LYL A;  3CCS A;  3GTG H;  3GTM H;  3PCO B;  4HIO A;  1IZ6 A;  1VCI A;  3U50 C;  1E1O A;  2AKW B;  3RN5 A;  3LET A;  2BA0 A;  3I2Z A;  3CC7 A;  4IJL A;  4A3I H;  2A1A A;  1DGS A;  1U0L A;  3HOY H;  2UUA L;  1E24 A;  1X3F A;  4GLV B;  1Q12 A;  1PH5 A;  1EYG A;  4B3R L;  1V9P A;  4H02 A;  4DV2 Q;  3CC4 A;  4OO1 I;  1G6P A;  3G71 A;  3M7N A;  5E7N A;  2KBN A;  1V43 A;  2OTL A;  3GTL H;  2LSS A;  1NMF A;  4DV1 L;  3KDF A;  1VQD A;  2R92 G;  1XNQ L;  4DR2 L;  2JK8 A;  1PH6 A;  1SR3 A;  5C4X G;  1HJP A;  4U07 A;  3B6Y A;  5JFZ A;  1Y1W H;  1PV4 A;  2DGY A;  4A3G H;  4WJ3 M;  3S6A A;  4K0K Q;  3CF5 A;  2VY3 A;  2EQS A;  5AJ3 Q;  2VZA A;  2F3I A;  3UDF A;  4JI7 Q;  2F6S A;  3W5O A;  1B8A A;  1I50 H;  1A63 A;  1NE3 A;  1PH1 A;  3HOY G;  3I4M G;  4Y7N H;  3F8T A;  3F1Z A;  4M16 A;  1XJV A;  4HIK A;  2ZTD A;  4A3F G;  3RZD H;  4A3E G;  3KF6 A;  4Y52 H;  5JJI A;  2PI2 A;  1YI2 A;  4X64 Q;  4BA1 I;  4DKA C;  5JJ7 A;  3SN9 A;  3CCJ A;  4HID A;  4JI1 L;  1Y1V H;  2ZJP A;  3ZCB A;  3KOJ A;  3W1B A;  1PYS B;  4XTC S;  4DR5 L;  2R7Z H;  5IT9 c;  4JI0 L;  1L2F A;  4UP7 A;  3H3V H;  4NXN Q;  1N8R C;  3S24 A;  3GTO H;  3AFP A;  5FLM G;  1VQH A;  4PY3 A;  4MNO A;  4JI2 Q;  2CFM A;  4GLX A;  1YHQ A;  1N34 Q;  3GTK H;  3KFU A;  4B3T Q;  4AYB E;  1P8L A;  4JI4 L;  4LF6 Q;  4JBJ A;  1QVF A;  4QGU A;  1GO3 E;  3RZO H;  3GTQ H;  1IBK L;  3F2D A;  4P71 A;  4LF7 L;  4DR7 Q;  1JJ2 A;  4WGJ A;  4QIW E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...