2JK8A

Type iv secretion system effector protein bepa complexed with a pyrophosphate moiety
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
291
structure length
291
Chain Sequence
EIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCSHDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMPEMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHPFREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDISNPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYIIGNIDHLPPEQLKILKPGDKITFTAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE CELL FILAMENTATION PROTEIN (BEPA PROTEIN)
publication title Fic Domain Catalyzed Adenylylation: Insight Provided by the Structural Analysis of the Type Iv Secretion System Effector Bepa.
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Cell adhesion
total genus 90
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 2jk8A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2jk8A02
1KQSA 3PF5A 3CCQA 2I0QA 1IBLQ 4X2DA 4X64L 4X65L 1HJPA 1PH8A 4DAYB 3CD6A 3OTOL 2Z0SA 1HR0L 3UE1A 3D0FA 4UP9A 4JI4L 4IPCA 3H3VH 4KHZA 4X2CA 5AJ3L 1YIJA 2VL6A 3J7A5 4APVA 2N3SA 4YWMA 4K0KL 1Q82C 3PO3H 3J81i 4KLKA 3S24A 4DK3C 4L5SA 3G48A 3FP9A 3PIPA 3BU2A 1PV4A 2UXBQ 4LUZA 2UUCQ 2WAQE 5JJIA 1A8VA 2Q2TA 4DV5L 5JJKA 2EQSA 3GTOH 4DV4Q 4AQYL 5IWAL 4JBWA 3TRZA 2B29A 3AFPA 3ZC7A 4UPAA 3SGIA 4A3KH 3ERSX 2E2JH 3STBC 4KI0A 4DR2Q 2E2HH 3HOUG 1A0IA 5HGQA 1R9TH 2OCEA 3PIOA 2Z6KA 4YHHL 2N78A 4BXXG 4JI0L 5GROA 3F1ZA 4GN3B 1WCMH 5FLMG 3EN2A 1X56A 3F8TA 5M3MG 3ULPA 2ZJQA 3KLWA 4JI3Q 4A3LG 3BJUA 4A3BH 2GVAA 1YJWA 1CUKA 4LF4L 3K8AA 3ZJYC 1UE1A 1S3OA 3HOZH 1YHBA 2PI2E 3CQZH 2MQHA 3KDFA 4OONA 2NN6I 4A4IA 3J7ZC 2I5LX 1K9MC 1HNXQ 5GQOA 2UXDL 5IYCG 3HOXH 4O2DA 2ZM6Q 1MKHA 2BH2A 4U07A 4A3IG 1N36L 3T1HQ 1XTDA 1WOCA 1PVOA 5C4XH 1P8LA 1E3PA 4JOIA 1Y1WH 1IBML 2K4KA 2I5MX 4O0AA 1EFWA 3KYHC 5CMTA 3G71A 1VQPA 2HHHQ 3OW2A 2VY3A 4GLXA 3PSIA 1RL2A 2FXQA 2Z6KC 3W5OA 1Y14B 1PFSA 3HOWG 4EX5A 3GTKH 2GVBA 5IE8A 1JJ2A 1PA6A 2F3IA 3M3YH 2F6SA 5HY6A 1PH2A 2A8VA 3A0JA 1WYDA 2ASBA 2YYZA 4IOAA 1K0RA 2EIFA 2NZHA 4BBRG 4A93H 1PH4A 4LUOA 4HJ8A 2IX1A 2PQAB 3JAMi 3FKIG 4QQBX 1YITA 2MFIA 2AHOB 3M4QA 1WI5A 3L2PA 1SROA 1X6OA 4LF5L 4GKKQ 2JEAI 4JOIC 1IBLL 1PYSB 4B3MQ 3A5ZB 3PUYA 5C3EG 5C44H 4A75A 2VNUD 2K5HA 4DV7Q 1KAWA 1PH5A 5ELNA 4C3HH 5GAHC 2BA1A 4A3JG 2JA6H 1HNZQ 1G6PA 2ZTCA 3FHWA 2NVXH 1VQJA 2K14A 1L1OB 1XMOL 1VQ6A 3KJOA 4IFDG 4M16A 1P16A 1E24A 5FJ8H 3CCRA 1Z9FA 3OYYA 3HOYG 2UXBL 4A3DH 1VQ8A 2UUCL 4A3GG 3NENA 3UDXA 4XI8A 2VQFQ 3SN9A 5IYDH 4Y52H 4DV4L 3GTGH 2E5LQ 1X3GA 3S16H 4DR1L 2DGYA 4YWLA 2JA8G 2ID0A 2B3GA 4DR2L 4GKJQ 3TREA 4DR3Q 1VQOA 5K36G 2KHJA 3I4OA 3VDYA 4NB3A 2IHEA 4JBJA 3F2CA 4HIOA 4HJ7A 4DR5Q 3S1RH 2UUAQ 3CC4A 5BR8Q 3M9BA 1N32Q 3L7ZC 5C0XI 2YV5A 1EQRA 1IBKQ 3K7UC 3N3UA 1UWVA 1B8AA 4UP8A 1PYBA 4HJ5A 4C3JH 1SLJA 5LMNL 5M5YH 1HNXL 1VQIA 2PI2A 1XPRA 1HR0W 2UXCQ 1YJNA 1X55A 5M3FH 2N49A 4FDBA 2ZM6L 4A3CH 1KRTA 3H0GH 4BA1I 4YY3Q 3T1HL 4R4IA 2OQ0A 3T1YL 2AMCB 2GN5A 2IHFA 3RZOH 3PO3G 3GTJH 1GKHA 5IP9G 1YEZA 5C0XJ 1N8RC 5IP7H 1EOVA 1VQHA 3G6EA 1VQKA 2PQAA 3AFQA 4DV6Q 1PH1A 1CKMA 1HZ9A 2KCTA 4GN4B 3RN5A 4ALPA 1TWGH 1QZGA 1JE5A 2JQOA 3PO2G 3RLFA 4C2MH 4GOPB 3MXNB 5EU0A 4JI6L 4JG2A 4GLVB 4KHPQ 4B3RQ 5IT9c 4LU4A 5C0XG 1X3EA 4BY1H 1XNQL 1VQ7A 1KHIA 3JC66 3S1QH 4MNOA 2VS1A 1E1TA 2AKWB 2WFWA 3DM3A 4P72A 4Y7NH 3CCEA 1G51A 4A3FG 1I94Q 4BBSH 2VW9A 4JI7Q 2VUMG 3UDGA 4OX9Q 1XMQQ 4L5RC 3HOZG 1CSQA 2JA7H 1N34Q 4B3ML 2D62A 2NVTH 1M1KC 3I4MH 1TWAH 1OXUA 1WJJA 3D31A 3CXCA 3PUWA 2NZOA 3CPWA 4DV7L 1E22A 5H1SE 4DV2Q 1IYJB 2HT1A 2R92H 4LF9Q 3GTQH 4BY7G 3PGZA 1E7ZA 3U4ZA 1OTCA 1OXTA 2UUBQ 1X54A 1K8AC 4MZ9A 4LF8Q 4OO1I 2ZTDA 3PV0A 2VQEQ 4DV1L 2JE6I 1Y1VH 3Q8DA 5IYBG 4HIDA 4DR7Q 2HIXA 5GAGC 2YTYA 3J80c 1OXXK 4X66Q 1C0AA 1YHAA 2VQFL 2CQOA 5M5WH 4PG3A 1D7QA 2A19A 4HIKA 4LFBQ 2E5LL 4AYBG 1G291 1L1OC 3MEFA 1L0WA 1YNXA 2OQKA 1JT8A 2JA5H 1FGUA 2QEXA 4DR3L 4A93G 3NBHB 4X62L 5JJLA 4WJ3M 2JJQA 2MNAA 4JI2Q 4QGUA 2EXDA 1MIUA 5BR8L 4LFCQ 1N9WA 3BZCA 1UE7A 1CKNB 1IBKL 3I7FA 1EIFA 3EBEA 3TEHB 1WFQA 2R7FA 2UU9L 4IPDA 2ZJPA 1LYLA 1JMCA 2R7DA 4R4CA 4IFDI 4OO1G 2UXCL 4P71A 3S17H 3RZDH 4YCVA 2IY5B 2WB1G 3M85A 5IY0A 4B3SQ 4GOPA 4YY3L 4TQUS 4YWKA 1LTLA 1VQ4A 1QVFA 2R7ZG 3HOUH 2MO1A 1FVIA 2ATWA 1FJGQ 4BXXH 1JJGA 4UY8C 4A3DG 5FLMH 1KRSA 2L15A 5E7NA 1VQGA 5M3MH 4DV6L 3CCMA 4A3MG 1XNQQ 3RLOA 1A63A 1J6QA 5IYDG 2KENA 2Q2HA 3G4SA 2CCZA 4JV5Q 4P73A 3EIVA 1X65A 4IFDJ 2I5HA 3ER0A 4KHPL 1BBUA 2H5XA 3KF6B 4X64Q 4X65Q 1TWCH 5J3BA 1A62A 1K3RA 4JCVE 4YCWA 3U58A 1PH9A 2Y0SE 4H02A 3E9HA 4IJLA 4DKAC 1UE5A 3I4NH 3A5UA 2LSSA 4HJ9A 5CKLA 3TQYA 4A3IH 3HOVG 1I94L 4PZ8A 1QUQB 3I55A 2LXJA 4JI7L 3RNUA 3IRBA 3DLLA 4GOPC 4JYAQ 1VQAA 2BA0A 1HZAA 3W1GA 1V9PA 3JAMc 1LM0A 4RG1A 5LMNW 4JBKA 1J5EQ 4QY7A 4LW1A 2R93G 3HOWH 3CCVA 3CUCA 1B7YB 3I2ZA 4DV2L 5CGLA 4AQYQ 5M5XH 4IO9A 1CSPA 2Q2IA 1YBYA 1NMGA 2CWPA 3K0XA 3RLNA 2UUBL 3GO5A 4PMWA 1KIXA 3LGJA 4LF8L 5JFZA 2K75A 1U0LA 2VQEL 4AH6A 4JI0Q 3ICEA 4JI3L 1YHQA 4DR7L 3ZLMA 4DAMA 2V1CC 1NJIC 1AE3A 4X66L 2R6GA 4A3EH 3M4PA 4NXNQ 4GLAC 1PHJA 4DUYQ 2D0PA 3NELA 3PUZA 4U0SA 1Q81C 2BH8A 3S1MH 4IPHA 3GDEA 4BY1G 4DR6Q 2K5NA 2F4VQ 3SE5A 4GNXB 1TWHH 4QIWE 1VQDA 2OTLA 3S6AA 2K50A 4ITRA 4BBSG 4A3JH 1EIYB 3I56A 2B63H 4LWCA 4X6AH 4JI2L 4TVAB 1EUJA 1YJ9A 2HHHL 1SFOH 4DV3Q 1K8GA 1VQ9A 1GM5A 4DPGA 2DUDA 3I4MG 3KDFB 3AEVA 3L0OA 2G03A 3HOYH 1I3QH 2HIVA 5JJ6A 2IX0A 3HKZG 4A3GH 1Q12A 1YZ6A 3HFZB 1NE3A 3K81C 5JEAG 4A3KG 3WWVA 2A1AA 4J15A 4L5QA 1SRUA 4R1JA 3CCJA 4HJAA 3KF6A 1HZCA 1WCMG 3K7AH 4LFAQ 5JJ7A 1N33Q 4OXPA 4EQ5A 1FJGL 4OWWB 1V1QA 3UDIA 4A3BG 4PZ6A 3RN2A 2CFMA 3KF8B 1I6HH 4WGJA 1L1OA 1NY4A 4LF7Q 4MTNA 1V43A 3RR5A 1QUQA 4IOCA 1BKBA 1O7IA 1VQ5A 2JK8A 3CCLA 1S40A 1HH2P 4GKKL 4GS3A 2RHQB 4JV5L 2HQLA 2VZAA 1MJCA 2MO0A 4LF5Q 4B3TQ 3HOXG 4LF6Q 4AYBE 2QA4A 1X3FA 2JA5G 1SMXA 1HNZL 5C4XG 3TS2A 2Q2UA 1Y1WG 4POFA 1C9OA 1Q7YC 4BA2I 3KOJA 4AIMA 2ZTEA 2C35B 1FL0A 1T9HA 1XMOQ 3J80i 3NEMA 4N67A 1DGSA 2JA9A 3ZCBA 2KBNA 3CPFA 1X9NA 5IP9H 4JYAL 1IZ6A 3J81c 1J5EL 5DLQE 1TXYA 2AWNA 5LMUQ 4DR4Q 1QVCA 4NPSA 3PO2H 1Q8KA 3UE0A 4GKJL 2WB1E 4JC0A 4DR1Q 1I50H 2N8NA 2WP8J 4DUZQ 1EYGA 3CC7A 4C3IH 4DR5L 2XTIA 4JI8Q 4GNXA 2UUAL 1B70B 4NXMQ 1N32L 4JI5Q 3A74A 3STBD 2PNHA 3F2BA 2CKZB 4A3FH 1Q46A 2RHSB 3LETA 1ASZA 3S2HH 2VUMH 3M7NA 1E1OA 2WAQG 4NXNL 1Z47A 4RMFA 4PY3A 5C44G 3GTMH 4DUYL 2CWAA 1XJVA 1RIPA 4LNQA 2YTVA 3CAMA 1EWIA 4DV0Q 3H15A 2K52A 5LMNQ 3F2DA 2JA6G 4DR6L 1NBWA 1U5KA 1KL9A 1AH9A 2F4VL 1XNRQ 3I4NG 1HNWQ 1XPOA 2E8GA 3HKSA 2NVYH 4JI1Q 3T1YQ 1PH7A 2IT1A 1I5FA 4U0ZA 4HIMA 4BY7H 2OTJA 1GD7A 4OWXB 5FJ8G 4DV3L 1JJCB 2K5VA 1JB7A 5IYBH 4A3LH 3S1NH 3CCSA 4IJHA 4GNXC 4QJFA 3U4VA 4JBMA 4B3RL 3UDFA 1UEBA 3TS0A 1VQMA 4GN5A 4JI6Q 1L2FA 3OTOQ 3S15H 1HR0Q 1HZBA 5IYCH 3CMAA 4JI4Q 3CP0A 2PMZE 3J81j 4LFAL 1D8LA 1N33L 1S72A 2JEBI 3BZKA 5AJ3Q 4R4TA 3H3VI 2NN6G 4POGA 4K0KQ 1OXVA 4LF7L 1VQFA 4OX9L 1XMQL 2F52A 1VQBA 5GAEC 4A3EG 1N34L 1LUZA 4B3TL 4DV5Q 1C7YA 4LF6L 1SN8A 3E9IA 5M3FG 4A3CG 1YVCA 3M4OH 1PH3A 1OXSC 3H0GG 5IWAQ 3SHGA 5EAYA 4R4OA 3GD7A 1QZHA 1KC8C 1M90C 4P74A 3PUVA 1MJEA 4LF9L 4OWTB 3S14H 4UP7A 1EQQA 2B63G 1W2BA 4YHHQ 1Q86C 2R7ZH 1K83H 4BBRH 5IP7G 2OWOA 3KFUA 2KHIA 4A76A 3CF5A 4WJ4A 3GTLH 3PCOB 2RF4A 4DV1Q 3FKIH 4U04A 1XPUA 5FLXc 3PF4A 1H95A 2LXKA 1CKNA 4R4QA 4A3MH 5LMUL 2D0OA 3HKZE 4X2EA 1NMFA 1SE8A 4XTCS 5C4JH 4DR4L 4LFBL 2NVQH 2E2IH 1GVPA 1PH6A 3AQQA 1SR3A 5C3EH 2QGQA 4LF4Q 3W1BA 2UXDQ 1BBWA 4IPGA 5GADC 1KXLA 2Y0SG 1VQEA 1N36Q 1K73C 5ELOA 1GO3E 2YTXA 4DUZL 1YI2A 1TWFH 5JEAJ 4X62Q 4JI8L 4NXML 4LFCL 3KJPA 2ES2A 2ALYB 3PUXA 4XIGS 4JI5L 3U50C 1KD1C 1BVSA 1IBMQ 3HOVH 2RCNA 1CKOA 1IXRA 3K80C 1ASYA 1Q1BA 1VS0A 2JA7G 4DNIA 1IL2A 5JFFA 4QL5A 4PZ7A 1Q1EA 2ZJRA 2UU9Q 2AWOA 4LUVA 3ULJA 1NTGA 4DV0L 4P75A 2R92G 1VQCA 3B6YA 4B3SL 1UE6A 3CW2C 3E0EA 3AYHB 1XNRL 3GTPH 2R93H 3CC2A 3ULLA 1VQLA 1HNWL 2KCMA 4L5TA 2JA8H 2XGTA 4JI1L 2YU9H 4YCUA 1Y1VG 1QVGA 4U0UA 1VQNA 1W3SA 4ME3A 1AE2A 3CMEA 3CCUA 1VCIA 3S2DH 4DK6C
chains in the Genus database with same CATH superfamily
3PF5A 4QF4A 3CCQA 1IBLQ 4DAPA 3DWQA 2PYKA 1EZ8A 3ERQA 4JI4L 3A55A 3H3VH 4KHZA 3F2UA 4RHRA 3NQIA 4APVA 1X32A 1O7YA 3S24A 1D6EC 2L1BA 4L5SA 3FP9A 3BU2A 2UXBQ 2VB2X 2WAQE 4OEMB 2NUCA 4I7AA 4DV5L 2Q2TA 5JJKA 3K5LA 2EQSA 1EWCA 1ENFA 4TRDA 4AQYL 5IWAL 1GUOA 3AFPA 4RGMA 2K6AA 1SNOA 3OMCA 4KI0A 4ABNA 3PIOA 2Z6KA 4BXXG 3FDTA 1WCMH 1JWMD 3ULPA 3BJUA 2B2WA 3DEPA 5C4ZA 1STNA 1VF7A 1QNUA 1S5DD 1JICA 3HOZH 4C3HB 3KDFA 4A4IA 2VXWA 2B8GA 1K9MC 2NYZD 5ELBA 2NVXB 2EJFC 3HOXH 2AQ2B 4O2DA 2ZM6Q 1N36L 2A6HD 3T1HQ 3WOEA 1PVOA 2QILA 1P8LA 1WTHA 2I5MX 4A3MB 4O0AA 5CMTA 3G71A 3K59A 3H3VC 2RSOA 2VY3A 4GLXA 3OW2A 2NVQB 1OO9B 2FXQA 1Q3LA 3M3YH 5CV7A 5C5MA 2A8VA 3A0JA 1TS3A 2DY8A 2YYZA 2SEBD 4IOAA 3A7LA 2Z9HA 1RD9D 1EOTA 3Q22A 2IX1A 2EYFA 4K5VA 3FKIG 2AHOB 4OELB 4GKKQ 2JEAI 4JOIC 3H0GB 3PUYA 5C44H 1DOKA 5GAHC 2IPKD 3IL8A 2ZTCA 2OT2A 2K14A 1XMOL 4EQNA 3KJOA 4M16A 5EKKA 1TWGB 1EY4A 1E24A 3ZYYX 3CCRA 3HS0C 1VQ8A 1K3BC 2A73B 2F0KA 5IYDH 4I7ZC 4Y52H 4DV4L 1PXUA 4G7HC 2DGYA 1SNDA 3SE0A 4Y7NB 2B3GA 5K36G 2L11A 2KHJA 2NB0A 4HIOA 3CC4A 2DN8A 1S5ED 3KLRA 3I4MB 2K5DA 4KJOA 3DEOA 1PYBA 5LMNL 3GTQB 5M5YH 1XPRA 2DY7A 2PI2A 4K6DA 5FO7B 2F4IA 1KRTA 4BA1I 4NP5A 1Y8NB 3T1YL 3SK8A 3J80L 5ELEA 3OOCA 5C0XJ 2AUJD 1F2YA 1GHKA 4GN4B 1I6VC 4ALPA 4IUUA 4Q0FA 2JA5B 4GOPB 2A68D 2F0FA 4JG2A 2WV6D 3TP7A 4KHPQ 2XVSA 5IT9c 1X3EA 2F0MA 4BY1H 5CR3A 1VQ7A 1KHIA 4N8X1 4BBSH 3DM3A 4RGTA 1I94Q 3VYUA 2EE1A 1HFNA 2B2TA 1XWEA 4OX9Q 3C1EA 1AP0A 4L5RC 3HOZG 1PTOF 2JA7H 4TKOB 1TWAH 1WJJA 3FMCA 3RD4A 3CPWA 1EIGA 1S4ZA 1XTCD 4LF9Q 3PGZA 2EYOA 1X54A 3K5MA 1RTNA 1K8AC 1KDAA 4MZ9A 4LF8Q 2ZTDA 4XQNA 2RQXA 4DV1L 5IYBG 3ONAB 3X3MA 4HIDA 3PQIA 5CC4A 2IJ0A 2VQFL 1PRTB 4PG3A 1SAPA 2E5LL 4AYBG 1L1OC 4H13C 1TS2A 1YNXA 1JT8A 3I72A 3VR2A 4G7OC 5D3IB 2BDNA 4QGUA 3J80E 1JB3A 5E4WC 1NR4A 1UE7A 2F0PA 1IBKL 3EBEA 3TEHB 2R7FA 1JMCA 4R4CA 1SYDA 4P2CB 3MVVA 2IY5B 1J9OA 2WB1G 1LT3D 1LTLA 2ATWA 2QCPX 2EYHA 1VQGA 5M3MH 1A63A 3RLOA 5IYDG 4JV5Q 3EIVA 2BDOA 4O42A 1TWHB 1HRJA 3ER0A 2KA7A 1TWCH 1H9SA 4DKAC 1UE5A 1SFOB 1YNNC 3I4NH 3A5UA 3J7AV 1RODA 1TIID 2LXJA 1F2LA 3HOYB 1I3QB 1UUPA 4XT1B 2PW5A 1VQAA 4RGOS 1FNUA 4R8NA 1ENAA 2BA0A 3DMUA 1HZAA 2CW0D 1V9PA 3W1GA 1LM0A 5LMNW 4QY7A 1T5EA 2ENBA 3HOWH 1NH1A 1B7YB 1I4XA 1SE2A 3BVGA 2V4DA 2DJFC 1IKLA 2CWPA 1ENCA 3K0XA 4RCOA 3PMFA 3GO5A 3I73A 2K75A 1I4GA 1U0LA 4JI0Q 4UAIA 3JAME 1JOOA 2NN6H 3X3NA 3DM1A 2R6GA 2WKDA 1DONA 4GLAC 4DUYQ 3NELA 1CFMA 3PUZA 1Q81C 3NWTA 4CJ1B 4BY1G 1F2MA 2K5NA 4GNXB 1VQDA 3T53B 3S6AA 4BBSG 1D5ZC 4X6AH 4IUPA 2A69D 1YJ9A 1RJTA 1K8GA 4CBVA 3KDFB 1PRTD 3L0OA 2EXZA 2IX0A 1Z7TA 3K81C 5KEEA 4HEDA 4A3KG 4QIWB 4C3IB 2A1AA 1A2UA 3GQBA 4J15A 3CCJA 4KN4C 1HZCA 3K7AH 1V1QA 3KF8B 4WGJA 2HUGA 1KNAA 4GKKL 1O7IA 3CCLA 1S40A 4DXFA 2RHQB 2HQLA 2VZAA 1MJCA 1G2SA 4LF5Q 2GA4B 2MP1A 4LF6Q 3EQLC 2B2UA 4AYBE 2L12A 2EZVA 4BY7B 1SMXA 2F3VA 1Y1WG 1C9OA 3KOJA 3EA6A 3J80i 3S1NB 4OGQC 3NEMA 3PIO3 1MD2D 2JA9A 3ZCBA 5LL6S 1IZ6A 1J5EL 5DLQE 4XYOA 1STYA 4NPSA 3PO2H 1Q8KA 2WB1E 3LWEA 4JC0A 1I50H 2SNMA 2N8NA 4U68A 1QCBD 2XTIA 3OWFA 4JI5Q 1MSGA 5FKAC 4A3FH 2CKZB 1EYAA 2VUMH 1E1OA 5I2XA 3J7YW 3GTMH 1UEAB 2YTVA 4NMZA 3CAMA 1EFID 1IHZA 4KK7A 4DR6L 1NBWA 3I4NG 5JAVA 1HNWQ 1XPOA 2E8GA 2D9UA 2NVYH 1JOKA 2IT1A 2KEDA 4DV3L 4ZQ3A 4RKLA 4FYDA 4A3LH 4FXKC 4IJHA 2NZ1D 1UEBA 4GN5A 1TWFB 1AEXA 3S15H 2B2YC 4JI4Q 3HOVB 4LFAL 1TS4A 2JEBI 3W2DA 2NN6G 1M8AA 1VQFA 4KKSA 4OX9L 3UI2A 2F52A 2R93B 4WFN3 4DV5Q 3Q24A 1C7YA 5M3FG 4A3CG 2JA8B 1LT6D 2EJGC 1OXSC 5IWAQ 4LF9L 2J4XA 2MUYA 3GP7A 1SJED 3W3AA 4X3SA 5EBCA 2R7ZH 1ILQA 4BBRH 4IURA 5L37A 1RF2D 4A76A 3M4YA 2RF4A 1KABA 5FLXc 4QMGA 1CA6A 5E3FA 4DR4L 4J1MA 2CH4W 3MTSA 2E2IH 1PH6A 5C3EH 3W1BA 1I4RA 1N36Q 5KIXA 2ES2A 1IYVA 3LNNA 1SE4A 3K80C 4IFDH 1VS0A 3GTOB 3QB3A 4GZYC 1IL2A 4HCEA 4PZ7A 1Q1EA 5LL6X 4LUVA 3ULJA 1NTGA 3B6YA 2HDMA 5CV8A 3GTPH 1XNRL 3CC2A 3ULLA 4A3FB 1B2TA 4JI1L 2YU9H 5FO9B 2VUMB 1Y1VG 3MFYA 4DN4M 1E2WA 1VQNA 1HQRD 1W3SA 3CMEA 3NUCA 4N9TA 3ND8A 1R4QB 1IKMA 3PIP3 2I0QA 3NHHA 1PH8A 2NVYB 1RCVD 2EY2A 5I6WA 3OTOL 1HR0L 3UE1A 3D0FA 4IPCA 5AFWA 4V0BA 2VL6A 2BE5D 4K0KL 4YWMA 3PO3H 3KLSA 1L0YB 4LUZA 1A8VA 4LAAA 1HUNA 4DV4Q 2K33A 4JBWA 4A93B 4UPAA 2E2JH 3HOUG 5TSSA 3I91A 3AMUA 4JI0L 4GN3B 5FLMG 3FPUB 1LTRD 2NTSA 3NK9A 4JI3Q 2WAQB 4A3BH 4A3LG 2XWJB 4JPBW 2RBMA 3ZJYC 1UE1A 1S3OA 1U4MA 2PI2E 3CQZH 3J7ZC 1HA5A 1YNJC 4KTAA 4KV6A 2UXDL 1IL8A 4U07A 4A3IG 4O1NA 1RTOA 3NPPA 3OMGA 3EVQA 4U673 1LTBD 4A3DB 4JOIA 1GJXA 3KYHC 1VQPA 3HEJA 4OHJA 2E2IB 3W5OA 5HGTA 1PFSA 3S16B 2F0OA 2GVBA 3SK4A 1JJ2A 3VYTA 1GHJA 1K8OA 4K6LA 4KMUC 4RH6A 5M9OA 1B1ZA 4R9WA 2EIFA 4BBRG 4FF4A 1EY0A 4LUOA 4HJ8A 1EY8A 4LJZC 3E6ZX 1QB5D 2MFIA 4C3JB 3M4QA 4LF5L 3GTPB 1PYSB 3KBXA 4DXGA 5KYLA 5C3EG 4A75A 2VNUD 2YU9B 3OSOA 5ELNA 4C3HH 2IWHA 2BA1A 1BCPB 4A3JG 1CA5A 3GTJB 2JA6H 3FHWA 2NVXH 1DD2A 1ZXTA 1K28A 1VQ6A 1KNEA 4IFDG 4TSSA 5FJ8H 2UUCL 2PZWA 1ZYRD 2VQFQ 3SN9A 4S3SA 1S5BD 3SVMA 2E5LQ 2CVRA 1Y8OB 2M9VA 4DR2L 4GKJQ 1O80A 2J0TD 5LHY1 1PFBA 1AZPA 3TMEA 5CGKA 3F2CA 3VDYA 4HJ7A 1BUVT 4DR5Q 2UUAQ 3D4RA 3M9BA 5C0XI 2F0IA 1PMRA 1IBKQ 2ICIA 3HRZC 4KN7C 2R92B 4HJ5A 1SLJA 2EDGA 1HNXL 1HR0W 2LY7A 1YJNA 1X55A 2N49A 4FDBA 5JOBA 3H0GH 5EKIA 4R4IA 2OQ0A 1QG7A 4K8IA 2IHFA 3RZOH 3PO3G 1RKNA 2L4NA 1YEZA 4QCLA 5M5WB 4G57A 2PQAA 1EQVA 1CKMA 2C9OA 3V05A 1TWGH 3HP3A 1JE5A 2JQOA 4WJWA 3MXNB 5EU0A 3FPPA 5K5PA 4LU4A 5C0XG 3S1QH 1ESFA 3JC66 2WFWA 4Y7NH 1ICWA 3CCEA 2VB3X 3BVZA 1DOLA 1STEA 1GUSA 5J22A 1ESRA 5EPLA 3S17B 1CSQA 3RZDB 3I4MH 1N34Q 5G3LF 3URYA 1HQMC 2NZOA 4DV7L 1IYJB 2E75C 3GTQH 4KY7A 1OTCA 1E7ZA 1OXTA 4IUQA 5JVH3 3PV0A 3Q8DA 1LO5D 2HIXA 5GAGC 3HGBA 1DXMA 1HFGA 2CQOA 2BCOA 1F9QA 1DM0B 2XIWA 3SEBA 2JA6B 1D7QA 5IIFA 3MZ5A 4LFBQ 1PZID 1G291 3ND9A 4OIKA 1BCPD 1L0WA 2OQKA 2JA5H 1ML0D 2QEXA 4DR3L 3QOJA 1ZKOA 3NBHB 5JJLA 3H6MA 2MNAA 4JVZA 4L6TB 1U4PA 5BR8L 4LFCQ 1N9WA 2F1MA 3A7AB 1EIFA 1HXYD 1LYLA 3MWYW 4DFAA 5D65A 5M5XB 3I8ZA 2UXCL 4P71A 1SYCA 5C3WA 2JSOA 4TQUS 4DAYA 2ZXPA 2NUDA 1GXDC 4UY8C 2XRSD 4ZUJA 1F9SA 3E0JA 1TT2A 4MN3A 4DV6L 1CHPD 4A3MG 3G4SA 2KENA 2Q2HA 3S1MB 2CHBD 4IFDJ 2ZXRA 4CJ0B 2R61A 2F3WA 1LTID 2H5XA 3KF6B 4X64Q 2B8FA 2B63B 1A62A 3RZOB 2Y0SE 1A3UA 3FEWX 2LSSA 3CU7A 3TQYA 3K0YA 4PZ8A 1QUQB 2CW0C 3IRBA 3DLLA 3VR3A 4GOPC 1SNMA 1BR9A 2KCNA 4RG1A 2WINB 4X3KA 4JBKA 4WORA 1J5EQ 3S1QB 3CUCA 3SXHA 4UHVA 5CGLA 1NMGA 3N52A 1KIXA 4PMWA 3T56B 4JI3L 1MBYA 3ZLMA 2K04A 2V1CC 2K05A 3MXPA 5CV5A 2K01A 5J1ZA 4X66L 4HMJA 1LT5D 1KLGD 4IPHA 4DR6Q 1AFPA 2KQ3A 1TWHH 2OTLA 4ITRA 3NTIA 1NSNS 1PRTC 4TVAB 4RGNA 1G2TA 5EPJA 1SFOH 5EBDA 4DV3Q 4NDXA 1O7LA 3MA2B 4NW2A 1QWYA 3I4MG 1D1IA 1T5XD 4HSVA 3HOYH 1I3QH 4EQOA 5JJ6A 4A3GH 3D4WA 1YZ6A 1NE3A 1STBA 1B9NA 1TQOA 1WCMG 3EROA 4LFAQ 4OXPA 4OWWB 1CZGA 3D4DA 4PZ6A 2CFMA 1V43A 1XNQL 1VQ5A 2FFKB 1NR2A 4GS3A 5IODA 3HOXG 4FNFA 1BBXC 2JA5G 1JCKB 4POFA 4BA2I 3NQTA 4AIMA 2ZTEA 1DGSA 3CPFA 5IP9H 1V1PA 2EYLA 2O4XA 4AYBB 4DR4Q 1SEBD 2F0LA 4GKJL 4DR1Q 2L5TA 2WP8J 5A35A 3JAML 1EYGA 4DR5L 4C3IH 2UUAL 4DAVA 5IGEA 2F0JA 3L3OC 3DWPA 2PNHA 4CKBA 3J81E 3S2HH 3LETA 4ZCKA 2O5JC 1CT1D 3M4OB 2B2YA 4NXNL 5C44G 1BF4A 1XJVA 1M4VA 2WB1B 5I6YA 1EWIA 4DK1A 4QUCA 2K52A 3F2DA 1U5KA 1KL9A 1K83B 2F0HA 3QWNA 1XNRQ 1AH9A 4JI1Q 4BY7H 4U0ZA 1UNSA 4HIMA 1A3VA 2H4OA 1FD7D 3C1FA 5EJWA 5F2DA 3S1NH 4H0LC 1B53A 4GNXC 2EY6A 3UDFA 4N9PA 4JI6Q 3OTOQ 2B2WC 2K03A 3P75A 1HR0Q 5IYCH 4DU9A 3CP0A 2PMZE 3J81j 1N33L 3R93A 3CRLC 5KNBA 1S72A 1EY9A 4K0KQ 4LF7L 4A3GB 2DJGC 5GAEC 1N34L 2N55A 2KUMA 5IOCA 5HURA 4B3TL 4K2KA 3E9IA 1H9JA 3SHGA 5A2QE 2WACA 3D6WA 4OO1H 4IALA 1MJEA 4PNYA 4PQXA 3S2DB 2L9HA 1Q86C 2K5QA 2OWOA 4WJ4A 2F0EA 2KOLA 4U04A 1XPUA 1B3AA 2K32A 4LFBL 1SE8A 1GVPA 2UXDQ 4I65A 4IPGA 2FMCA 1VQEA 1K73C 4DUZL 1YI2A 1TWFH 4X62Q 4NXML 4LFCL 2ALYB 3PUXA 4RCNA 3U50C 1NUCA 1KD1C 3HOVH 1EY5A 4BWGB 2JA7G 4DNIA 5JFFA 4C1NK 1QNKA 3MAQA 4A3KB 2SNSA 2E2HB 4DV0L 4P75A 1R9TB 3E0EA 3AYHB 2R93H 3RMHA 1PLFA 1PFNA 3EJIA 1VQLA 2JA8H 2B39A 3S2HB 3TP8A 4YCUA 3NP8A 4CGYB 1EEFD 1AE2A 1E2ZA 2LKVA 1EIHA 4CJ2C 4X2DA 1JQYD 4X64L 4EGVA 1B50A 4DAYB 5DM73 1TR5A 4UP9A 1GUWA 1F9RA 1E0BA 1G91A 4K8JA 5CMDA 5AJ3L 1YIJA 1AZQA 5DAUA 1Q82C 3J81i 4KLKA 3G48A 2UUCQ 3GTOH 3TRZA 2B29A 3ZC7A 5C5LA 3ERSX 3STBC 4DR2Q 5FK9C 1A0IA 4YHHL 5GROA 3F1ZA 4CDEC 3A8IE 4C1NI 5M3MG 3KUPA 2GVAA 3I70A 1CUKA 4LF4L 2MQHA 2NN6I 2I5LX 1HNXQ 2B2TC 5IYCG 4XXEA 1MKHA 2PZTA 2ZT9C 4RA8A 5C4XH 4IUTA 2PPBC 1KDBA 1E3PA 1IBML 3AB9A 1EFWA 3A8KE 3I3CA 2QDLA 1RL2A 4Q5VA 3GTGB 4DNTB 1FGBD 3TP6A 3HOWG 1H9KA 3GTKH 1KLUD 2F0WA 2F3IA 3R8BA 2F6SA 1PH2A 1X3QA 1A15A 4IUVA 2ASBA 4HMIA 4H7BA 3S1RB 3FVQA 3Q23A 1SMYC 4CKCA 1K0RA 4A93H 1PH4A 1GUGA 1K0SA 3BDCA 4OL7A 1F9PA 3JAMi 4ZYSA 1YITA 4QQBX 3L2PA 2WIIB 1X6OA 1NCVA 1TS5A 1II3A 3NWSA 1Q90A 4DV7Q 1KAWA 1PH5A 4M8AA 1PZKD 3KBGA 2I07B 1VQJA 4Z9CB 5FO8B 3HZXA 1YNND 1Z9FA 3OYYA 4C2MB 4A3DH 3H94A 4DNRB 3C2PA 3Q6SA 2EOTA 2K1BA 2B2VA 2XNAC 2A74C 3S16H 1SYFA 4ODGA 4DR1L 1WTVA 4YWLA 1WTXA 2ID0A 2JA8G 1KDCA 3TREA 3MEHA 4DR3Q 1VQOA 3Q0AA 4FF3A 3I4OA 4NB3A 4JBJA 4CHTB 5BR8Q 2NVTB 3L7ZC 3HKZB 4M1UB 1UWVA 1DZ1A 1LT4D 4ZKBB 4F8MA 4UP8A 4C3JH 3G7LA 2UXCQ 1VQIA 1O7ZA 1EQTA 4DF7A 1H9MA 3IFDA 1W6KA 5CORA 1S5FD 5EKLA 3GV3A 3GTJH 1VQKA 5IP7H 3G6EA 3AFQA 4DV6Q 1HZ9A 2F0TA 2KCTA 4XQJA 3RN5A 1QZGA 3OW7A 4RFBA 3A8JE 5G3LD 3PO2G 1TY2A 2I46A 4JI6L 1WTPA 4GLVB 1AW7A 4BS9A 5C4XB 4B3RQ 4OIJA 4IUNA 1CK1A 4XYQA 2VS1A 1E1TA 2AKWB 4MIUA 4P72A 4A3FG 1G51A 2VW9A 3GTKB 2VUMG 3I90A 3D8GA 5I9OA 3J7AF 2Z6BA 1PRTF 4B3ML 2RDGA 4KKTA 1M1KC 5IT9E 5DNFA 1H9SB 5BN5A 3PUWA 2RKSA 2AQ1B 3WDNA 1E22A 3HOUB 2HT1A 2R92H 1RHPA 1O78A 4CDFC 1BDOA 1ET6A 2N88A 1U4LA 1J8IA 4KKUA 4B9WA 1ICFB 3IAYA 3J80c 1OXXK 4X66Q 1C0AA 1PTOB 1YHAA 1BCPC 2G5DA 4PMBA 2A6HC 5M5WH 3R2IA 2A19A 2SDFA 4HIKA 5I9PA 3MEFA 4J6HA 4A3IB 1GOZA 1FGUA 4A93G 4X62L 2KVMA 2JJQA 1GUTA 1MIUA 5DEHA 1HA6A 3I7FA 2M00A 4IPDA 1A6XA 4RKBA 4IFDI 2RDFA 3S17H 3RZDH 3M85A 5IY0A 4B3SQ 4GOPA 4YY3L 3TP5A 4ZLTF 1VQ4A 1QVFA 2R7ZG 1V1OA 2MO1A 1FVIA 3D6CA 1SE3A 4A3EB 4BXXH 1JJGA 4A3DG 1KRSA 2L15A 2F0QA 1XNQQ 1J6QA 5KRUA 2LFNA 2LS01 1I4PA 1X65A 4P73A 4ZK9B 1EEID 2I5HA 1BBUA 4X65Q 2EJMA 2XSCA 4A3JB 3U58A 1K3RA 2E76C 4JCVE 1PH9A 4H02A 4IJLA 2JXMB 3TDQA 3I55A 4JI7L 4FXDA 1QOHA 3JAMc 1VMPA 4LW1A 3CCVA 4DV2L 2Y0SB 5M5XH 1X3PA 4IO9A 2Q2IA 1YBYA 4RHSA 4DA2A 1ET9A 1I6HB 4H44C 3RLNA 2UUBL 1CZWA 1F2ZA 3LGJA 2D2CC 1JOQA 4G7ZC 2VQEL 4DR7L 1NJIC 3BDOA 4NXNQ 1PHJA 3R3OA 2P5ZX 3P20A 2BH8A 3S1MH 4J8QA 2AQ3B 1A2TA 2Q8IB 2QKIC 2E74C 3SE5A 1IW7D 1EIYB 3I56A 2B63H 2OF1A 4JI2L 2NBFA 1WTOA 2A68C 2QF7A 3DUZA 4DPGA 1GM5A 3E3XA 4CDDC 1PTOD 4PMCA 1DJRD 2HIVA 2MGSA 3S9WA 2IW3A 2OXPA 4K5WA 4XQQA 4L5QA 1SBBB 4HJAA 2ICEC 2MPMA 3O13A 3V96A 2DNCA 2K7VA 5JJ7A 1N33Q 3VA5A 5K36H 1FJGL 4A3BG 3RN2A 3MFGA 3VYRA 1L1OA 1DYQA 1NY4A 5IGCA 4LF7Q 4MTNA 4IOCA 3T13A 1BKBA 2JK8A 2X6GA 2MO0A 5COYA 4B3TQ 4FP5D 3ITPA 1Y8PB 1Q7YC 4KD3A 1C4QA 2C35B 1FL0A 1T9HA 5D14A 1DCZA 2Z8LA 1MSHA 4N67A 4JYAL 2NTTA 4XT3B 3K57A 1EU3A 3NXWA 3K5OA 2A6ED 4HCSA 4HSPA 3UE0A 1A3TA 3TZUA 2G9DA 4RWSC 4DUZQ 3K58A 3CC7A 4NXMQ 2Z1CA 4GNXA 1B70B 5C6AA 3A74A 3WOFA 3F2BA 2RHSB 5EPKA 5CV9A 4F87A 2F0NA 4RMFA 5EQ0A 2Z4IA 3S14B 1NAPA 1RIPA 4C3HG 4DV0Q 2JA6G 2F4VL 3GTLB 1ONLA 1YNJD 5FLXL 3FKIB 3OHXC 5FJ8G 4OWXB 1JJCB 5C4JB 1D5MC 1XX8A 1HCZA 3H09A 5IYBH 3KF8A 3CCSA 1PZJD 1RDPD 3U4VA 4JBMA 3P7JA 4B3RL 1VQMA 1HTLD 5KNDA 1HZBA 5CV6A 1D8LA 1G6ZA 1CQFA 5AJ3Q 5ISRA 3H3VI 4POGA 4KD4A 1FNWA 4ID6A 3T4AC 3RUZA 3QG1A 1KAAA 3U9SA 1LUZA 1YVCA 3M4OH 4EVOA 3H0GG 5EAYA 1M90C 3GD7A 1KC8C 3PUVA 2PMZB 4K14A 4OWTB 4UP7A 1EQQA 2B63G 2F0DA 1W2BA 1B4OA 4YHHQ 4LK1C 1K83H 1HTPA 5BN4A 4ILWA 4EQPA 3P1HA 1QILA 3PF4A 2LXKA 1CKNA 4R4QA 4LF4Q 5LMUL 2A69C 1SR3A 2F0UA 2L0CA 2ZXOA 5GADC 4K2LA 3A56A 3LX0A 3J81L 2D5DA 4JI8L 1TVXA 3KJPA 4KY6A 4XIGS 5FLXE 1IBMQ 4C56C 2RCNA 1W6JA 3SHLA 1WD0A 2QDBA 4ME5A 3T16A 4QL5A 2ZJRA 2UU9Q 2AWOA 5J39A 4B3SL 3TBIB 2O2LD 1WCMB 2XGTA 1WTWA 1MGSA 1QVGA 4U0UA 1SJHD 4ME3A 3CCUA 4B9XA 1PH1A 3BZCA 3HOZB 4FO2A 3S2DH 2EYMA 2PW7A 2XWBB 1KQSA 1CHQD 2J7ZA 4B08A 1JE4A 3BS1A 3HOXB 4X65L 3NTHA 1HJPA 3A54A 3CD6A 4WRDA 4JK1C 1ILPA 2Z0SA 2EPBA 4X2CA 2KHSA 3J7A5 3BDLA 1S5CD 2N3SA 3CRKC 4DK3C 3PIPA 3M3YB 1PV4A 5JJIA 3GV6A 3BG3A 5A2QL 1FYCA 3OWEB 1H9RA 5I4DA 3SGIA 1EYDA 4A3KH 2E2HH 1R9TH 2Q8TA 3NSWA 2OCEA 5HGQA 1WTQA 2N78A 3EN2A 4JW0A 1X56A 3F8TA 2ZJQA 3KLWA 5JPMC 2Z4HA 3TSSA 5C44B 1YJWA 1EZ6A 4X3UA 3K8AA 5DM63 1EY7A 1YHBA 4OONA 2X6LA 5ELDA 5GQOA 2RVLA 2BH2A 2BOSA 2FMMA 1XTDA 3TN2A 1WOCA 3AU7A 2E2DC 4E6IA 2NWGA 1Y1WH 2K4KA 2LMCB 1SYEA 2HHHQ 2PO4A 3PSIA 2Z6KC 1Y14B 4R8IA 4EX5A 5IE8A 1PA6A 2L55A 1GUNA 5HY6A 1VF5C 2F0SA 3BYTB 3FRPB 5C3XA 1WYDA 1BCPF 4HAEA 5T1GA 5JVG3 3TZDA 2PZUA 2NZHA 3KK7A 4ZKCB 4IZ8A 2PQAB 5D3DA 2A5HA 1BNZA 1WI5A 5M5YB 1SROA 1TY0A 5EGTA 1IBLL 4B3MQ 3A5ZB 2XN9C 2K5HA 1LTSD 1CTMA 1HNZQ 1G6PA 1JC7A 1SDFA 2IL8A 3QIAA 1L1OB 1P16A 3HOYG 2UXBL 1D5XC 4A3GG 3NENA 3UDXA 4XI8A 1BOSA 4MTKA 4BY1B 4KHVA 4LMQD 3GTGH 1X3GA 2X69A 1I4QA 4IN3A 5C4HA 4BBSB 2RSNA 1F77A 3L9AX 4KY5A 2KEEA 5KNCA 1XYIA 1WTRA 1JORA 2IHEA 2KECA 4NKLA 3S1RH 4X3TA 2JA7B 1N32Q 1TWAB 1ZEQX 2YV5A 1EQRA 3K7UC 3N3UA 1AN8A 1B8AA 5KYIA 4MHEA 2K5WA 5ELCA 5BN3A 1FR3A 1STHA 4A3CH 1STAA 3CHBD 5M3FH 2ZM6L 1LTGD 3T1HL 4YY3Q 2AMCB 1E2VA 2GN5A 2HCCA 1STGA 1GKHA 5IP9G 1N8RC 1EOVA 1VQHA 2KJXA 3RLFA 4C2MH 1Z6HA 4UDUC 1BXTA 2RA4A 4HR7B 3K5NA 2BE5C 3N6RA 1Y1WB 3KLSX 1U9RA 1LLRD 2C5CA 4C3IG 4MNOA 2WKCA 4JI7Q 3SDZA 3UDGA 3SR1A 1MI2A 2PCFB 3VR6A 3DHQA 1XMQQ 2NVTH 1K8MA 2D62A 2SOBA 1EWHA 1OXUA 4DK0A 3D31A 3CXCA 5H1SE 4DV2Q 5JEAH 4N8FA 4BY7G 3U4ZA 3LWUA 2UUBQ 1R4PB 5M3MB 5CYUA 4OO1I 2VQEQ 2JE6I 1Y1VH 4DR7Q 2TMPA 2MHVA 2YTYA 5JPNC 5I2YA 1TWCB 3HG9A 3I4NB 1EY6A 2QEJC 3BYYB 1EU4A 1B44D 4WJ3M 1HUMA 4JI2Q 2EXDA 2H1EA 5CV4A 2EY5A 2HDLA 3E5SA 1CKNB 2RCFA 1WFQA 3HOWB 2UU9L 2ZJPA 2FHTA 2R7DA 4L8JA 1U4RA 4OO1G 2F0VA 4YCVA 3MXUA 3MXNA 4YWKA 1BQQT 1EL0A 2JN4A 1LACA 1LV9A 4IQZA 4FF2A 3HOUH 1FJGQ 3BVMA 5FLMH 5E7NA 3EFXD 3H91A 3CCMA 3VYSA 2CCZA 5M3FB 3U9OA 3VR4A 3NBIA 4KHPL 1PTOH 1NNXA 5J3BA 4YCWA 3E9HA 2QW7A 1EYCA 2HQEA 4HJ9A 5CKLA 1JR0D 1SNQA 4A3IH 3C46A 3HOVG 1I94L 1ZYRC 3RNUA 1KTKA 2JP1A 5E1FA 1SNCA 5IT9L 4JYAQ 3NE5B 3QR8A 2RDHA 2R93G 3I2ZA 2HD3A 4AQYQ 3K7AB 1CSPA 3DWAA 1TKWB 4LF8L 5JFZA 1V1PB 3NBHA 4AH6A 3ICEA 1YHQA 4YIJA 3SK6A 4DAMA 1AE3A 2EVBA 2G9HD 2PNRC 4XDXA 5KGUA 4A3EH 3M4PA 3MC0B 1B9MA 4ULLA 1IYUA 2D0PA 5NUCA 1CM9A 1IW7C 4U0SA 1B3QA 3GDEA 2F4VQ 2HCIA 3QJYA 4QIWE 1Y1VB 2K50A 3K6OA 4A3JH 2PQEA 4LWCA 1PTOC 1EUJA 4CDCC 2HHHL 3DXJC 1TU2B 3V2TA 1D2BA 1VQ9A 1WVLA 2DUDA 3AEVA 1XXGA 2G03A 3PO2B 1VMCA 1CI3M 3HKZG 1I50B 1Q12A 4DGZA 3G6JB 3HFZB 3I4LA 5JEAG 3WWVA 1QJOA 1SRUA 4R1JA 1LTTD 3KF6A 1SYGA 2EYJA 4EQ5A 3R2TA 1FNVA 1C8CA 4CKEA 3UDIA 1I6HH 2DNEA 4L63B 3GTMB 2JYOA 3IKJA 1PYWD 3RR5A 3OIQA 1PFMA 1QUQA 2KCCA 3MHBA 1HH2P 2AUKA 4JV5L 4FXGC 2M2LA 3NTKA 3CKIB 2QA4A 1X3FA 5T1IA 1HNZL 5C4XG 1V8QA 3TS2A 2Q2UA 2OEOA 3BZDB 4HTHA 2CQAA 1QE6A 3VR5A 2XRQD 1XMOQ 3MXGA 1JWSD 2KBNA 1X9NA 2A6EC 2O5IC 3C3LA 2F0GA 2TSSA 3J81c 5E4XA 3S15B 1TXYA 2AWNA 5LMUQ 1MHWC 1QVCA 4DK6C 1I4HA 4QB4A 1BO0A 5IGDA 5C0XH 2B2UC 2R3ZA 2FINB 4RAUC 4JI8Q 1N32L 1HPCA 1WD1A 3STBD 1Q46A 1ASZA 4F88A 3M7NA 2WAQG 1Z47A 4PY3A 4DUYL 2CWAA 3QOLA 4LNQA 1LTAD 4ZUIA 2K28A 5ELFA 3H15A 5LMNQ 1UAPA 2R7ZB 4BBRB 1C48A 3HKSA 1PH7A 3T1YQ 1I5FA 2OTJA 1GD7A 1SXTA 3QO2A 2K5VA 3SK5A 1JB7A 3M7GA 5C3EB 1Q8IA 4QJFA 1SNPA 3TS0A 1L2FA 5IGFA 1DOMA 3CMAA 5IGBA 1LABA 3BZKA 4R4TA 1SYBA 2FJ2A 1OXVA 4FVMA 1SMYD 1XMQL 1L0XB 1VQBA 4A3EG 4C3JG 4ZAIA 3VA7A 4LF6L 1SN8A 3OIPA 1PH3A 4ZRZA 4R4OA 1QZHA 3D3RA 3T51B 3S14H 4P74A 5IGGA 3KFUA 5IP7G 2KHIA 3CF5A 3GTLH 1G8ZD 3PCOB 4DV1Q 1CQVA 3FKIH 2EY1A 4KJNA 4QUFA 1H95A 4A3MH 2D0OA 3HKZE 4X2EA 1NMFA 5C4JH 4XTCS 2NVQH 4PV1C 2MJ8A 2F03A 3AQQA 2QGQA 1BBWA 1KXLA 2Y0SG 3PO3B 5ELOA 1GO3E 2YTXA 4K5XA 5JEAJ 4HN7A 1PDQA 5JJZA 4JI5L 2EYPA 1BVSA 5CBAE 1CKOA 1IXRA 1ASYA 1Q1BA 5FOBB 4V190 1D1KA 2E2JB 2R92G 1VQCA 1UE6A 3CW2C 1Y69U 4FF1A 2Q8RE 1JWUD 1HNWL 2KCMA 4L5TA 2B2VC 4F7XA 2CH4A 3IFTA 3OPOA 4A3BB 1SSOA 1VDZA 2NUNA 1HHVA 5CBEE 2IX3A 1VCIA 3CQZB 4G4KA
chains in the Genus database with same CATH topology
1KQSA 3PF5A 3CCQA 2I0QA 1IBLQ 4X2DA 4X64L 4X65L 1HJPA 1PH8A 4DAYB 3CD6A 3OTOL 2Z0SA 1HR0L 3UE1A 3D0FA 4UP9A 4JI4L 4IPCA 3H3VH 4KHZA 4X2CA 5AJ3L 1YIJA 2VL6A 3J7A5 4APVA 2N3SA 4YWMA 4K0KL 1Q82C 3PO3H 3J81i 4KLKA 3S24A 4DK3C 4L5SA 3G48A 3FP9A 3PIPA 3BU2A 1PV4A 2UXBQ 4LUZA 2UUCQ 2WAQE 5JJIA 1A8VA 2Q2TA 4DV5L 5JJKA 2EQSA 3GTOH 4DV4Q 4AQYL 5IWAL 4JBWA 3TRZA 2B29A 3AFPA 3ZC7A 4UPAA 3SGIA 4A3KH 3ERSX 2E2JH 3STBC 4KI0A 4DR2Q 2E2HH 3HOUG 1A0IA 5HGQA 1R9TH 2OCEA 3PIOA 2Z6KA 4YHHL 2N78A 4BXXG 4JI0L 5GROA 3F1ZA 4GN3B 1WCMH 5FLMG 3EN2A 1X56A 3F8TA 5M3MG 3ULPA 2ZJQA 3KLWA 4JI3Q 4A3LG 3BJUA 4A3BH 2GVAA 1YJWA 1CUKA 4LF4L 3K8AA 3ZJYC 1UE1A 1S3OA 3HOZH 1YHBA 2PI2E 3CQZH 2MQHA 3KDFA 4OONA 2NN6I 4A4IA 3J7ZC 2I5LX 1K9MC 1HNXQ 5GQOA 2UXDL 5IYCG 3HOXH 4O2DA 2ZM6Q 1MKHA 2BH2A 4U07A 4A3IG 1N36L 3T1HQ 1XTDA 1WOCA 1PVOA 5C4XH 1P8LA 1E3PA 4JOIA 1Y1WH 1IBML 2K4KA 2I5MX 4O0AA 1EFWA 3KYHC 5CMTA 3G71A 1VQPA 2HHHQ 3OW2A 2VY3A 4GLXA 3PSIA 1RL2A 2FXQA 2Z6KC 3W5OA 1Y14B 1PFSA 3HOWG 4EX5A 3GTKH 2GVBA 5IE8A 1JJ2A 1PA6A 2F3IA 3M3YH 2F6SA 5HY6A 1PH2A 2A8VA 3A0JA 1WYDA 2ASBA 2YYZA 4IOAA 1K0RA 2EIFA 2NZHA 4BBRG 4A93H 1PH4A 4LUOA 4HJ8A 2IX1A 2PQAB 3JAMi 3FKIG 4QQBX 1YITA 2MFIA 2AHOB 3M4QA 1WI5A 3L2PA 1SROA 1X6OA 4LF5L 4GKKQ 2JEAI 4JOIC 1IBLL 1PYSB 4B3MQ 3A5ZB 3PUYA 5C3EG 5C44H 4A75A 2VNUD 2K5HA 4DV7Q 1KAWA 1PH5A 5ELNA 4C3HH 5GAHC 2BA1A 4A3JG 2JA6H 1HNZQ 1G6PA 2ZTCA 3FHWA 2NVXH 1VQJA 2K14A 1L1OB 1XMOL 1VQ6A 3KJOA 4IFDG 4M16A 1P16A 1E24A 5FJ8H 3CCRA 1Z9FA 3OYYA 3HOYG 2UXBL 4A3DH 1VQ8A 2UUCL 4A3GG 3NENA 3UDXA 4XI8A 2VQFQ 3SN9A 5IYDH 4Y52H 4DV4L 3GTGH 2E5LQ 1X3GA 3S16H 4DR1L 2DGYA 4YWLA 2JA8G 2ID0A 2B3GA 4DR2L 4GKJQ 3TREA 4DR3Q 1VQOA 5K36G 2KHJA 3I4OA 3VDYA 4NB3A 2IHEA 4JBJA 3F2CA 4HIOA 4HJ7A 4DR5Q 3S1RH 2UUAQ 3CC4A 5BR8Q 3M9BA 1N32Q 3L7ZC 5C0XI 2YV5A 1EQRA 1IBKQ 3K7UC 3N3UA 1UWVA 1B8AA 4UP8A 1PYBA 4HJ5A 4C3JH 1SLJA 5LMNL 5M5YH 1HNXL 1VQIA 2PI2A 1XPRA 1HR0W 2UXCQ 1YJNA 1X55A 5M3FH 2N49A 4FDBA 2ZM6L 4A3CH 1KRTA 3H0GH 4BA1I 4YY3Q 3T1HL 4R4IA 2OQ0A 3T1YL 2AMCB 2GN5A 2IHFA 3RZOH 3PO3G 3GTJH 1GKHA 5IP9G 1YEZA 5C0XJ 1N8RC 5IP7H 1EOVA 1VQHA 3G6EA 1VQKA 2PQAA 3AFQA 4DV6Q 1PH1A 1CKMA 1HZ9A 2KCTA 4GN4B 3RN5A 4ALPA 1TWGH 1QZGA 1JE5A 2JQOA 3PO2G 3RLFA 4C2MH 4GOPB 3MXNB 5EU0A 4JI6L 4JG2A 4GLVB 4KHPQ 4B3RQ 5IT9c 4LU4A 5C0XG 1X3EA 4BY1H 1XNQL 1VQ7A 1KHIA 3JC66 3S1QH 4MNOA 2VS1A 1E1TA 2AKWB 2WFWA 3DM3A 4P72A 4Y7NH 3CCEA 1G51A 4A3FG 1I94Q 4BBSH 2VW9A 4JI7Q 2VUMG 3UDGA 4OX9Q 1XMQQ 4L5RC 3HOZG 1CSQA 2JA7H 1N34Q 4B3ML 2D62A 2NVTH 1M1KC 3I4MH 1TWAH 1OXUA 1WJJA 3D31A 3CXCA 3PUWA 2NZOA 3CPWA 4DV7L 1E22A 5H1SE 4DV2Q 1IYJB 2HT1A 2R92H 4LF9Q 3GTQH 4BY7G 3PGZA 1E7ZA 3U4ZA 1OTCA 1OXTA 2UUBQ 1X54A 1K8AC 4MZ9A 4LF8Q 4OO1I 2ZTDA 3PV0A 2VQEQ 4DV1L 2JE6I 1Y1VH 3Q8DA 5IYBG 4HIDA 4DR7Q 2HIXA 5GAGC 2YTYA 3J80c 1OXXK 4X66Q 1C0AA 1YHAA 2VQFL 2CQOA 5M5WH 4PG3A 1D7QA 2A19A 4HIKA 4LFBQ 2E5LL 4AYBG 1G291 1L1OC 3MEFA 1L0WA 1YNXA 2OQKA 1JT8A 2JA5H 1FGUA 2QEXA 4DR3L 4A93G 3NBHB 4X62L 5JJLA 4WJ3M 2JJQA 2MNAA 4JI2Q 4QGUA 2EXDA 1MIUA 5BR8L 4LFCQ 1N9WA 3BZCA 1UE7A 1CKNB 1IBKL 3I7FA 1EIFA 3EBEA 3TEHB 1WFQA 2R7FA 2UU9L 4IPDA 2ZJPA 1LYLA 1JMCA 2R7DA 4R4CA 4IFDI 4OO1G 2UXCL 4P71A 3S17H 3RZDH 4YCVA 2IY5B 2WB1G 3M85A 5IY0A 4B3SQ 4GOPA 4YY3L 4TQUS 4YWKA 1LTLA 1VQ4A 1QVFA 2R7ZG 3HOUH 2MO1A 1FVIA 2ATWA 1FJGQ 4BXXH 1JJGA 4UY8C 4A3DG 5FLMH 1KRSA 2L15A 5E7NA 1VQGA 5M3MH 4DV6L 3CCMA 4A3MG 1XNQQ 3RLOA 1A63A 1J6QA 5IYDG 2KENA 2Q2HA 3G4SA 2CCZA 4JV5Q 4P73A 3EIVA 1X65A 4IFDJ 2I5HA 3ER0A 4KHPL 1BBUA 2H5XA 3KF6B 4X64Q 4X65Q 1TWCH 5J3BA 1A62A 1K3RA 4JCVE 4YCWA 3U58A 1PH9A 2Y0SE 4H02A 3E9HA 4IJLA 4DKAC 1UE5A 3I4NH 3A5UA 2LSSA 4HJ9A 5CKLA 3TQYA 4A3IH 3HOVG 1I94L 4PZ8A 1QUQB 3I55A 2LXJA 4JI7L 3RNUA 3IRBA 3DLLA 4GOPC 4JYAQ 1VQAA 2BA0A 1HZAA 3W1GA 1V9PA 3JAMc 1LM0A 4RG1A 5LMNW 4JBKA 1J5EQ 4QY7A 4LW1A 2R93G 3HOWH 3CCVA 3CUCA 1B7YB 3I2ZA 4DV2L 5CGLA 4AQYQ 5M5XH 4IO9A 1CSPA 2Q2IA 1YBYA 1NMGA 2CWPA 3K0XA 3RLNA 2UUBL 3GO5A 4PMWA 1KIXA 3LGJA 4LF8L 5JFZA 2K75A 1U0LA 2VQEL 4AH6A 4JI0Q 3ICEA 4JI3L 1YHQA 4DR7L 3ZLMA 4DAMA 2V1CC 1NJIC 1AE3A 4X66L 2R6GA 4A3EH 3M4PA 4NXNQ 4GLAC 1PHJA 4DUYQ 2D0PA 3NELA 3PUZA 4U0SA 1Q81C 2BH8A 3S1MH 4IPHA 3GDEA 4BY1G 4DR6Q 2K5NA 2F4VQ 3SE5A 4GNXB 1TWHH 4QIWE 1VQDA 2OTLA 3S6AA 2K50A 4ITRA 4BBSG 4A3JH 1EIYB 3I56A 2B63H 4LWCA 4X6AH 4JI2L 4TVAB 1EUJA 1YJ9A 2HHHL 1SFOH 4DV3Q 1K8GA 1VQ9A 1GM5A 4DPGA 2DUDA 3I4MG 3KDFB 3AEVA 3L0OA 2G03A 3HOYH 1I3QH 2HIVA 5JJ6A 2IX0A 3HKZG 4A3GH 1Q12A 1YZ6A 3HFZB 1NE3A 3K81C 5JEAG 4A3KG 3WWVA 2A1AA 4J15A 4L5QA 1SRUA 4R1JA 3CCJA 4HJAA 3KF6A 1HZCA 1WCMG 3K7AH 4LFAQ 5JJ7A 1N33Q 4OXPA 4EQ5A 1FJGL 4OWWB 1V1QA 3UDIA 4A3BG 4PZ6A 3RN2A 2CFMA 3KF8B 1I6HH 4WGJA 1L1OA 1NY4A 4LF7Q 4MTNA 1V43A 3RR5A 1QUQA 4IOCA 1BKBA 1O7IA 1VQ5A 2JK8A 3CCLA 1S40A 1HH2P 4GKKL 4GS3A 2RHQB 4JV5L 2HQLA 2VZAA 1MJCA 2MO0A 4LF5Q 4B3TQ 3HOXG 4LF6Q 4AYBE 2QA4A 1X3FA 2JA5G 1SMXA 1HNZL 5C4XG 3TS2A 2Q2UA 1Y1WG 4POFA 1C9OA 1Q7YC 4BA2I 3KOJA 4AIMA 2ZTEA 2C35B 1FL0A 1T9HA 1XMOQ 3J80i 3NEMA 4N67A 1DGSA 2JA9A 3ZCBA 2KBNA 3CPFA 1X9NA 5IP9H 4JYAL 1IZ6A 3J81c 1J5EL 5DLQE 1TXYA 2AWNA 5LMUQ 4DR4Q 1QVCA 4NPSA 3PO2H 1Q8KA 3UE0A 4GKJL 2WB1E 4JC0A 4DR1Q 1I50H 2N8NA 2WP8J 4DUZQ 1EYGA 3CC7A 4C3IH 4DR5L 2XTIA 4JI8Q 4GNXA 2UUAL 1B70B 4NXMQ 1N32L 4JI5Q 3A74A 3STBD 2PNHA 3F2BA 2CKZB 4A3FH 1Q46A 2RHSB 3LETA 1ASZA 3S2HH 2VUMH 3M7NA 1E1OA 2WAQG 4NXNL 1Z47A 4RMFA 4PY3A 5C44G 3GTMH 4DUYL 2CWAA 1XJVA 1RIPA 4LNQA 2YTVA 3CAMA 1EWIA 4DV0Q 3H15A 2K52A 5LMNQ 3F2DA 2JA6G 4DR6L 1NBWA 1U5KA 1KL9A 1AH9A 2F4VL 1XNRQ 3I4NG 1HNWQ 1XPOA 2E8GA 3HKSA 2NVYH 4JI1Q 3T1YQ 1PH7A 2IT1A 1I5FA 4U0ZA 4HIMA 4BY7H 2OTJA 1GD7A 4OWXB 5FJ8G 4DV3L 1JJCB 2K5VA 1JB7A 5IYBH 4A3LH 3S1NH 3CCSA 4IJHA 4GNXC 4QJFA 3U4VA 4JBMA 4B3RL 3UDFA 1UEBA 3TS0A 1VQMA 4GN5A 4JI6Q 1L2FA 3OTOQ 3S15H 1HR0Q 1HZBA 5IYCH 3CMAA 4JI4Q 3CP0A 2PMZE 3J81j 4LFAL 1D8LA 1N33L 1S72A 2JEBI 3BZKA 5AJ3Q 4R4TA 3H3VI 2NN6G 4POGA 4K0KQ 1OXVA 4LF7L 1VQFA 4OX9L 1XMQL 2F52A 1VQBA 5GAEC 4A3EG 1N34L 1LUZA 4B3TL 4DV5Q 1C7YA 4LF6L 1SN8A 3E9IA 5M3FG 4A3CG 1YVCA 3M4OH 1PH3A 1OXSC 3H0GG 5IWAQ 3SHGA 5EAYA 4R4OA 3GD7A 1QZHA 1KC8C 1M90C 4P74A 3PUVA 1MJEA 4LF9L 4OWTB 3S14H 4UP7A 1EQQA 2B63G 1W2BA 4YHHQ 1Q86C 2R7ZH 1K83H 4BBRH 5IP7G 2OWOA 3KFUA 2KHIA 4A76A 3CF5A 4WJ4A 3GTLH 3PCOB 2RF4A 4DV1Q 3FKIH 4U04A 1XPUA 5FLXc 3PF4A 1H95A 2LXKA 1CKNA 4R4QA 4A3MH 5LMUL 2D0OA 3HKZE 4X2EA 1NMFA 1SE8A 4XTCS 5C4JH 4DR4L 4LFBL 2NVQH 2E2IH 1GVPA 1PH6A 3AQQA 1SR3A 5C3EH 2QGQA 4LF4Q 3W1BA 2UXDQ 1BBWA 4IPGA 5GADC 1KXLA 2Y0SG 1VQEA 1N36Q 1K73C 5ELOA 1GO3E 2YTXA 4DUZL 1YI2A 1TWFH 5JEAJ 4X62Q 4JI8L 4NXML 4LFCL 3KJPA 2ES2A 2ALYB 3PUXA 4XIGS 4JI5L 3U50C 1KD1C 1BVSA 1IBMQ 3HOVH 2RCNA 1CKOA 1IXRA 3K80C 1ASYA 1Q1BA 1VS0A 2JA7G 4DNIA 1IL2A 5JFFA 4QL5A 4PZ7A 1Q1EA 2ZJRA 2UU9Q 2AWOA 4LUVA 3ULJA 1NTGA 4DV0L 4P75A 2R92G 1VQCA 3B6YA 4B3SL 1UE6A 3CW2C 3E0EA 3AYHB 1XNRL 3GTPH 2R93H 3CC2A 3ULLA 1VQLA 1HNWL 2KCMA 4L5TA 2JA8H 2XGTA 4JI1L 2YU9H 4YCUA 1Y1VG 1QVGA 4U0UA 1VQNA 1W3SA 4ME3A 1AE2A 3CMEA 3CCUA 1VCIA 3S2DH 4DK6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS A;  3PF5 A;  3CCQ A;  2I0Q A;  1IBL Q;  4X2D A;  4X64 L;  4X65 L;  1HJP A;  1PH8 A;  4DAY B;  3CD6 A;  3OTO L;  2Z0S A;  1HR0 L;  3UE1 A;  3D0F A;  4UP9 A;  4JI4 L;  4IPC A;  3H3V H;  4KHZ A;  4X2C A;  5AJ3 L;  1YIJ A;  2VL6 A;  3J7A 5;  4APV A;  2N3S A;  4YWM A;  4K0K L;  1Q82 C;  3PO3 H;  3J81 i;  4KLK A;  3S24 A;  4DK3 C;  4L5S A;  3G48 A;  3FP9 A;  3PIP A;  3BU2 A;  1PV4 A;  2UXB Q;  4LUZ A;  2UUC Q;  2WAQ E;  5JJI A;  1A8V A;  2Q2T A;  4DV5 L;  5JJK A;  2EQS A;  3GTO H;  4DV4 Q;  4AQY L;  5IWA L;  4JBW A;  3TRZ A;  2B29 A;  3AFP A;  3ZC7 A;  4UPA A;  3SGI A;  4A3K H;  3ERS X;  2E2J H;  3STB C;  4KI0 A;  4DR2 Q;  2E2H H;  3HOU G;  1A0I A;  5HGQ A;  1R9T H;  2OCE A;  3PIO A;  2Z6K A;  4YHH L;  2N78 A;  4BXX G;  4JI0 L;  5GRO A;  3F1Z A;  4GN3 B;  1WCM H;  5FLM G;  3EN2 A;  1X56 A;  3F8T A;  5M3M G;  3ULP A;  2ZJQ A;  3KLW A;  4JI3 Q;  4A3L G;  3BJU A;  4A3B H;  2GVA A;  1YJW A;  1CUK A;  4LF4 L;  3K8A A;  3ZJY C;  1UE1 A;  1S3O A;  3HOZ H;  1YHB A;  2PI2 E;  3CQZ H;  2MQH A;  3KDF A;  4OON A;  2NN6 I;  4A4I A;  3J7Z C;  2I5L X;  1K9M C;  1HNX Q;  5GQO A;  2UXD L;  5IYC G;  3HOX H;  4O2D A;  2ZM6 Q;  1MKH A;  2BH2 A;  4U07 A;  4A3I G;  1N36 L;  3T1H Q;  1XTD A;  1WOC A;  1PVO A;  5C4X H;  1P8L A;  1E3P A;  4JOI A;  1Y1W H;  1IBM L;  2K4K A;  2I5M X;  4O0A A;  1EFW A;  3KYH C;  5CMT A;  3G71 A;  1VQP A;  2HHH Q;  3OW2 A;  2VY3 A;  4GLX A;  3PSI A;  1RL2 A;  2FXQ A;  2Z6K C;  3W5O A;  1Y14 B;  1PFS A;  3HOW G;  4EX5 A;  3GTK H;  2GVB A;  5IE8 A;  1JJ2 A;  1PA6 A;  2F3I A;  3M3Y H;  2F6S A;  5HY6 A;  1PH2 A;  2A8V A;  3A0J A;  1WYD A;  2ASB A;  2YYZ A;  4IOA A;  1K0R A;  2EIF A;  2NZH A;  4BBR G;  4A93 H;  1PH4 A;  4LUO A;  4HJ8 A;  2IX1 A;  2PQA B;  3JAM i;  3FKI G;  4QQB X;  1YIT A;  2MFI A;  2AHO B;  3M4Q A;  1WI5 A;  3L2P A;  1SRO A;  1X6O A;  4LF5 L;  4GKK Q;  2JEA I;  4JOI C;  1IBL L;  1PYS B;  4B3M Q;  3A5Z B;  3PUY A;  5C3E G;  5C44 H;  4A75 A;  2VNU D;  2K5H A;  4DV7 Q;  1KAW A;  1PH5 A;  5ELN A;  4C3H H;  5GAH C;  2BA1 A;  4A3J G;  2JA6 H;  1HNZ Q;  1G6P A;  2ZTC A;  3FHW A;  2NVX H;  1VQJ A;  2K14 A;  1L1O B;  1XMO L;  1VQ6 A;  3KJO A;  4IFD G;  4M16 A;  1P16 A;  1E24 A;  5FJ8 H;  3CCR A;  1Z9F A;  3OYY A;  3HOY G;  2UXB L;  4A3D H;  1VQ8 A;  2UUC L;  4A3G G;  3NEN A;  3UDX A;  4XI8 A;  2VQF Q;  3SN9 A;  5IYD H;  4Y52 H;  4DV4 L;  3GTG H;  2E5L Q;  1X3G A;  3S16 H;  4DR1 L;  2DGY A;  4YWL A;  2JA8 G;  2ID0 A;  2B3G A;  4DR2 L;  4GKJ Q;  3TRE A;  4DR3 Q;  1VQO A;  5K36 G;  2KHJ A;  3I4O A;  3VDY A;  4NB3 A;  2IHE A;  4JBJ A;  3F2C A;  4HIO A;  4HJ7 A;  4DR5 Q;  3S1R H;  2UUA Q;  3CC4 A;  5BR8 Q;  3M9B A;  1N32 Q;  3L7Z C;  5C0X I;  2YV5 A;  1EQR A;  1IBK Q;  3K7U C;  3N3U A;  1UWV A;  1B8A A;  4UP8 A;  1PYB A;  4HJ5 A;  4C3J H;  1SLJ A;  5LMN L;  5M5Y H;  1HNX L;  1VQI A;  2PI2 A;  1XPR A;  1HR0 W;  2UXC Q;  1YJN A;  1X55 A;  5M3F H;  2N49 A;  4FDB A;  2ZM6 L;  4A3C H;  1KRT A;  3H0G H;  4BA1 I;  4YY3 Q;  3T1H L;  4R4I A;  2OQ0 A;  3T1Y L;  2AMC B;  2GN5 A;  2IHF A;  3RZO H;  3PO3 G;  3GTJ H;  1GKH A;  5IP9 G;  1YEZ A;  5C0X J;  1N8R C;  5IP7 H;  1EOV A;  1VQH A;  3G6E A;  1VQK A;  2PQA A;  3AFQ A;  4DV6 Q;  1PH1 A;  1CKM A;  1HZ9 A;  2KCT A;  4GN4 B;  3RN5 A;  4ALP A;  1TWG H;  1QZG A;  1JE5 A;  2JQO A;  3PO2 G;  3RLF A;  4C2M H;  4GOP B;  3MXN B;  5EU0 A;  4JI6 L;  4JG2 A;  4GLV B;  4KHP Q;  4B3R Q;  5IT9 c;  4LU4 A;  5C0X G;  1X3E A;  4BY1 H;  1XNQ L;  1VQ7 A;  1KHI A;  3JC6 6;  3S1Q H;  4MNO A;  2VS1 A;  1E1T A;  2AKW B;  2WFW A;  3DM3 A;  4P72 A;  4Y7N H;  3CCE A;  1G51 A;  4A3F G;  1I94 Q;  4BBS H;  2VW9 A;  4JI7 Q;  2VUM G;  3UDG A;  4OX9 Q;  1XMQ Q;  4L5R C;  3HOZ G;  1CSQ A;  2JA7 H;  1N34 Q;  4B3M L;  2D62 A;  2NVT H;  1M1K C;  3I4M H;  1TWA H;  1OXU A;  1WJJ A;  3D31 A;  3CXC A;  3PUW A;  2NZO A;  3CPW A;  4DV7 L;  1E22 A;  5H1S E;  4DV2 Q;  1IYJ B;  2HT1 A;  2R92 H;  4LF9 Q;  3GTQ H;  4BY7 G;  3PGZ A;  1E7Z A;  3U4Z A;  1OTC A;  1OXT A;  2UUB Q;  1X54 A;  1K8A C;  4MZ9 A;  4LF8 Q;  4OO1 I;  2ZTD A;  3PV0 A;  2VQE Q;  4DV1 L;  2JE6 I;  1Y1V H;  3Q8D A;  5IYB G;  4HID A;  4DR7 Q;  2HIX A;  5GAG C;  2YTY A;  3J80 c;  1OXX K;  4X66 Q;  1C0A A;  1YHA A;  2VQF L;  2CQO A;  5M5W H;  4PG3 A;  1D7Q A;  2A19 A;  4HIK A;  4LFB Q;  2E5L L;  4AYB G;  1G29 1;  1L1O C;  3MEF A;  1L0W A;  1YNX A;  2OQK A;  1JT8 A;  2JA5 H;  1FGU A;  2QEX A;  4DR3 L;  4A93 G;  3NBH B;  4X62 L;  5JJL A;  4WJ3 M;  2JJQ A;  2MNA A;  4JI2 Q;  4QGU A;  2EXD A;  1MIU A;  5BR8 L;  4LFC Q;  1N9W A;  3BZC A;  1UE7 A;  1CKN B;  1IBK L;  3I7F A;  1EIF A;  3EBE A;  3TEH B;  1WFQ A;  2R7F A;  2UU9 L;  4IPD A;  2ZJP A;  1LYL A;  1JMC A;  2R7D A;  4R4C A;  4IFD I;  4OO1 G;  2UXC L;  4P71 A;  3S17 H;  3RZD H;  4YCV A;  2IY5 B;  2WB1 G;  3M85 A;  5IY0 A;  4B3S Q;  4GOP A;  4YY3 L;  4TQU S;  4YWK A;  1LTL A;  1VQ4 A;  1QVF A;  2R7Z G;  3HOU H;  2MO1 A;  1FVI A;  2ATW A;  1FJG Q;  4BXX H;  1JJG A;  4UY8 C;  4A3D G;  5FLM H;  1KRS A;  2L15 A;  5E7N A;  1VQG A;  5M3M H;  4DV6 L;  3CCM A;  4A3M G;  1XNQ Q;  3RLO A;  1A63 A;  1J6Q A;  5IYD G;  2KEN A;  2Q2H A;  3G4S A;  2CCZ A;  4JV5 Q;  4P73 A;  3EIV A;  1X65 A;  4IFD J;  2I5H A;  3ER0 A;  4KHP L;  1BBU A;  2H5X A;  3KF6 B;  4X64 Q;  4X65 Q;  1TWC H;  5J3B A;  1A62 A;  1K3R A;  4JCV E;  4YCW A;  3U58 A;  1PH9 A;  2Y0S E;  4H02 A;  3E9H A;  4IJL A;  4DKA C;  1UE5 A;  3I4N H;  3A5U A;  2LSS A;  4HJ9 A;  5CKL A;  3TQY A;  4A3I H;  3HOV G;  1I94 L;  4PZ8 A;  1QUQ B;  3I55 A;  2LXJ A;  4JI7 L;  3RNU A;  3IRB A;  3DLL A;  4GOP C;  4JYA Q;  1VQA A;  2BA0 A;  1HZA A;  3W1G A;  1V9P A;  3JAM c;  1LM0 A;  4RG1 A;  5LMN W;  4JBK A;  1J5E Q;  4QY7 A;  4LW1 A;  2R93 G;  3HOW H;  3CCV A;  3CUC A;  1B7Y B;  3I2Z A;  4DV2 L;  5CGL A;  4AQY Q;  5M5X H;  4IO9 A;  1CSP A;  2Q2I A;  1YBY A;  1NMG A;  2CWP A;  3K0X A;  3RLN A;  2UUB L;  3GO5 A;  4PMW A;  1KIX A;  3LGJ A;  4LF8 L;  5JFZ A;  2K75 A;  1U0L A;  2VQE L;  4AH6 A;  4JI0 Q;  3ICE A;  4JI3 L;  1YHQ A;  4DR7 L;  3ZLM A;  4DAM A;  2V1C C;  1NJI C;  1AE3 A;  4X66 L;  2R6G A;  4A3E H;  3M4P A;  4NXN Q;  4GLA C;  1PHJ A;  4DUY Q;  2D0P A;  3NEL A;  3PUZ A;  4U0S A;  1Q81 C;  2BH8 A;  3S1M H;  4IPH A;  3GDE A;  4BY1 G;  4DR6 Q;  2K5N A;  2F4V Q;  3SE5 A;  4GNX B;  1TWH H;  4QIW E;  1VQD A;  2OTL A;  3S6A A;  2K50 A;  4ITR A;  4BBS G;  4A3J H;  1EIY B;  3I56 A;  2B63 H;  4LWC A;  4X6A H;  4JI2 L;  4TVA B;  1EUJ A;  1YJ9 A;  2HHH L;  1SFO H;  4DV3 Q;  1K8G A;  1VQ9 A;  1GM5 A;  4DPG A;  2DUD A;  3I4M G;  3KDF B;  3AEV A;  3L0O A;  2G03 A;  3HOY H;  1I3Q H;  2HIV A;  5JJ6 A;  2IX0 A;  3HKZ G;  4A3G H;  1Q12 A;  1YZ6 A;  3HFZ B;  1NE3 A;  3K81 C;  5JEA G;  4A3K G;  3WWV A;  2A1A A;  4J15 A;  4L5Q A;  1SRU A;  4R1J A;  3CCJ A;  4HJA A;  3KF6 A;  1HZC A;  1WCM G;  3K7A H;  4LFA Q;  5JJ7 A;  1N33 Q;  4OXP A;  4EQ5 A;  1FJG L;  4OWW B;  1V1Q A;  3UDI A;  4A3B G;  4PZ6 A;  3RN2 A;  2CFM A;  3KF8 B;  1I6H H;  4WGJ A;  1L1O A;  1NY4 A;  4LF7 Q;  4MTN A;  1V43 A;  3RR5 A;  1QUQ A;  4IOC A;  1BKB A;  1O7I A;  1VQ5 A;  2JK8 A;  3CCL A;  1S40 A;  1HH2 P;  4GKK L;  4GS3 A;  2RHQ B;  4JV5 L;  2HQL A;  2VZA A;  1MJC A;  2MO0 A;  4LF5 Q;  4B3T Q;  3HOX G;  4LF6 Q;  4AYB E;  2QA4 A;  1X3F A;  2JA5 G;  1SMX A;  1HNZ L;  5C4X G;  3TS2 A;  2Q2U A;  1Y1W G;  4POF A;  1C9O A;  1Q7Y C;  4BA2 I;  3KOJ A;  4AIM A;  2ZTE A;  2C35 B;  1FL0 A;  1T9H A;  1XMO Q;  3J80 i;  3NEM A;  4N67 A;  1DGS A;  2JA9 A;  3ZCB A;  2KBN A;  3CPF A;  1X9N A;  5IP9 H;  4JYA L;  1IZ6 A;  3J81 c;  1J5E L;  5DLQ E;  1TXY A;  2AWN A;  5LMU Q;  4DR4 Q;  1QVC A;  4NPS A;  3PO2 H;  1Q8K A;  3UE0 A;  4GKJ L;  2WB1 E;  4JC0 A;  4DR1 Q;  1I50 H;  2N8N A;  2WP8 J;  4DUZ Q;  1EYG A;  3CC7 A;  4C3I H;  4DR5 L;  2XTI A;  4JI8 Q;  4GNX A;  2UUA L;  1B70 B;  4NXM Q;  1N32 L;  4JI5 Q;  3A74 A;  3STB D;  2PNH A;  3F2B A;  2CKZ B;  4A3F H;  1Q46 A;  2RHS B;  3LET A;  1ASZ A;  3S2H H;  2VUM H;  3M7N A;  1E1O A;  2WAQ G;  4NXN L;  1Z47 A;  4RMF A;  4PY3 A;  5C44 G;  3GTM H;  4DUY L;  2CWA A;  1XJV A;  1RIP A;  4LNQ A;  2YTV A;  3CAM A;  1EWI A;  4DV0 Q;  3H15 A;  2K52 A;  5LMN Q;  3F2D A;  2JA6 G;  4DR6 L;  1NBW A;  1U5K A;  1KL9 A;  1AH9 A;  2F4V L;  1XNR Q;  3I4N G;  1HNW Q;  1XPO A;  2E8G A;  3HKS A;  2NVY H;  4JI1 Q;  3T1Y Q;  1PH7 A;  2IT1 A;  1I5F A;  4U0Z A;  4HIM A;  4BY7 H;  2OTJ A;  1GD7 A;  4OWX B;  5FJ8 G;  4DV3 L;  1JJC B;  2K5V A;  1JB7 A;  5IYB H;  4A3L H;  3S1N H;  3CCS A;  4IJH A;  4GNX C;  4QJF A;  3U4V A;  4JBM A;  4B3R L;  3UDF A;  1UEB A;  3TS0 A;  1VQM A;  4GN5 A;  4JI6 Q;  1L2F A;  3OTO Q;  3S15 H;  1HR0 Q;  1HZB A;  5IYC H;  3CMA A;  4JI4 Q;  3CP0 A;  2PMZ E;  3J81 j;  4LFA L;  1D8L A;  1N33 L;  1S72 A;  2JEB I;  3BZK A;  5AJ3 Q;  4R4T A;  3H3V I;  2NN6 G;  4POG A;  4K0K Q;  1OXV A;  4LF7 L;  1VQF A;  4OX9 L;  1XMQ L;  2F52 A;  1VQB A;  5GAE C;  4A3E G;  1N34 L;  1LUZ A;  4B3T L;  4DV5 Q;  1C7Y A;  4LF6 L;  1SN8 A;  3E9I A;  5M3F G;  4A3C G;  1YVC A;  3M4O H;  1PH3 A;  1OXS C;  3H0G G;  5IWA Q;  3SHG A;  5EAY A;  4R4O A;  3GD7 A;  1QZH A;  1KC8 C;  1M90 C;  4P74 A;  3PUV A;  1MJE A;  4LF9 L;  4OWT B;  3S14 H;  4UP7 A;  1EQQ A;  2B63 G;  1W2B A;  4YHH Q;  1Q86 C;  2R7Z H;  1K83 H;  4BBR H;  5IP7 G;  2OWO A;  3KFU A;  2KHI A;  4A76 A;  3CF5 A;  4WJ4 A;  3GTL H;  3PCO B;  2RF4 A;  4DV1 Q;  3FKI H;  4U04 A;  1XPU A;  5FLX c;  3PF4 A;  1H95 A;  2LXK A;  1CKN A;  4R4Q A;  4A3M H;  5LMU L;  2D0O A;  3HKZ E;  4X2E A;  1NMF A;  1SE8 A;  4XTC S;  5C4J H;  4DR4 L;  4LFB L;  2NVQ H;  2E2I H;  1GVP A;  1PH6 A;  3AQQ A;  1SR3 A;  5C3E H;  2QGQ A;  4LF4 Q;  3W1B A;  2UXD Q;  1BBW A;  4IPG A;  5GAD C;  1KXL A;  2Y0S G;  1VQE A;  1N36 Q;  1K73 C;  5ELO A;  1GO3 E;  2YTX A;  4DUZ L;  1YI2 A;  1TWF H;  5JEA J;  4X62 Q;  4JI8 L;  4NXM L;  4LFC L;  3KJP A;  2ES2 A;  2ALY B;  3PUX A;  4XIG S;  4JI5 L;  3U50 C;  1KD1 C;  1BVS A;  1IBM Q;  3HOV H;  2RCN A;  1CKO A;  1IXR A;  3K80 C;  1ASY A;  1Q1B A;  1VS0 A;  2JA7 G;  4DNI A;  1IL2 A;  5JFF A;  4QL5 A;  4PZ7 A;  1Q1E A;  2ZJR A;  2UU9 Q;  2AWO A;  4LUV A;  3ULJ A;  1NTG A;  4DV0 L;  4P75 A;  2R92 G;  1VQC A;  3B6Y A;  4B3S L;  1UE6 A;  3CW2 C;  3E0E A;  3AYH B;  1XNR L;  3GTP H;  2R93 H;  3CC2 A;  3ULL A;  1VQL A;  1HNW L;  2KCM A;  4L5T A;  2JA8 H;  2XGT A;  4JI1 L;  2YU9 H;  4YCU A;  1Y1V G;  1QVG A;  4U0U A;  1VQN A;  1W3S A;  4ME3 A;  1AE2 A;  3CME A;  3CCU A;  1VCI A;  3S2D H;  4DK6 C; 
#chains in the Genus database with same CATH topology
 3PF5 A;  4QF4 A;  3CCQ A;  1IBL Q;  4DAP A;  3DWQ A;  2PYK A;  1EZ8 A;  3ERQ A;  4JI4 L;  3A55 A;  3H3V H;  4KHZ A;  3F2U A;  4RHR A;  3NQI A;  4APV A;  1X32 A;  1O7Y A;  3S24 A;  1D6E C;  2L1B A;  4L5S A;  3FP9 A;  3BU2 A;  2UXB Q;  2VB2 X;  2WAQ E;  4OEM B;  2NUC A;  4I7A A;  4DV5 L;  2Q2T A;  5JJK A;  3K5L A;  2EQS A;  1EWC A;  1ENF A;  4TRD A;  4AQY L;  5IWA L;  1GUO A;  3AFP A;  4RGM A;  2K6A A;  1SNO A;  3OMC A;  4KI0 A;  4ABN A;  3PIO A;  2Z6K A;  4BXX G;  3FDT A;  1WCM H;  1JWM D;  3ULP A;  3BJU A;  2B2W A;  3DEP A;  5C4Z A;  1STN A;  1VF7 A;  1QNU A;  1S5D D;  1JIC A;  3HOZ H;  4C3H B;  3KDF A;  4A4I A;  2VXW A;  2B8G A;  1K9M C;  2NYZ D;  5ELB A;  2NVX B;  2EJF C;  3HOX H;  2AQ2 B;  4O2D A;  2ZM6 Q;  1N36 L;  2A6H D;  3T1H Q;  3WOE A;  1PVO A;  2QIL A;  1P8L A;  1WTH A;  2I5M X;  4A3M B;  4O0A A;  5CMT A;  3G71 A;  3K59 A;  3H3V C;  2RSO A;  2VY3 A;  4GLX A;  3OW2 A;  2NVQ B;  1OO9 B;  2FXQ A;  1Q3L A;  3M3Y H;  5CV7 A;  5C5M A;  2A8V A;  3A0J A;  1TS3 A;  2DY8 A;  2YYZ A;  2SEB D;  4IOA A;  3A7L A;  2Z9H A;  1RD9 D;  1EOT A;  3Q22 A;  2IX1 A;  2EYF A;  4K5V A;  3FKI G;  2AHO B;  4OEL B;  4GKK Q;  2JEA I;  4JOI C;  3H0G B;  3PUY A;  5C44 H;  1DOK A;  5GAH C;  2IPK D;  3IL8 A;  2ZTC A;  2OT2 A;  2K14 A;  1XMO L;  4EQN A;  3KJO A;  4M16 A;  5EKK A;  1TWG B;  1EY4 A;  1E24 A;  3ZYY X;  3CCR A;  3HS0 C;  1VQ8 A;  1K3B C;  2A73 B;  2F0K A;  5IYD H;  4I7Z C;  4Y52 H;  4DV4 L;  1PXU A;  4G7H C;  2DGY A;  1SND A;  3SE0 A;  4Y7N B;  2B3G A;  5K36 G;  2L11 A;  2KHJ A;  2NB0 A;  4HIO A;  3CC4 A;  2DN8 A;  1S5E D;  3KLR A;  3I4M B;  2K5D A;  4KJO A;  3DEO A;  1PYB A;  5LMN L;  3GTQ B;  5M5Y H;  1XPR A;  2DY7 A;  2PI2 A;  4K6D A;  5FO7 B;  2F4I A;  1KRT A;  4BA1 I;  4NP5 A;  1Y8N B;  3T1Y L;  3SK8 A;  3J80 L;  5ELE A;  3OOC A;  5C0X J;  2AUJ D;  1F2Y A;  1GHK A;  4GN4 B;  1I6V C;  4ALP A;  4IUU A;  4Q0F A;  2JA5 B;  4GOP B;  2A68 D;  2F0F A;  4JG2 A;  2WV6 D;  3TP7 A;  4KHP Q;  2XVS A;  5IT9 c;  1X3E A;  2F0M A;  4BY1 H;  5CR3 A;  1VQ7 A;  1KHI A;  4N8X 1;  4BBS H;  3DM3 A;  4RGT A;  1I94 Q;  3VYU A;  2EE1 A;  1HFN A;  2B2T A;  1XWE A;  4OX9 Q;  3C1E A;  1AP0 A;  4L5R C;  3HOZ G;  1PTO F;  2JA7 H;  4TKO B;  1TWA H;  1WJJ A;  3FMC A;  3RD4 A;  3CPW A;  1EIG A;  1S4Z A;  1XTC D;  4LF9 Q;  3PGZ A;  2EYO A;  1X54 A;  3K5M A;  1RTN A;  1K8A C;  1KDA A;  4MZ9 A;  4LF8 Q;  2ZTD A;  4XQN A;  2RQX A;  4DV1 L;  5IYB G;  3ONA B;  3X3M A;  4HID A;  3PQI A;  5CC4 A;  2IJ0 A;  2VQF L;  1PRT B;  4PG3 A;  1SAP A;  2E5L L;  4AYB G;  1L1O C;  4H13 C;  1TS2 A;  1YNX A;  1JT8 A;  3I72 A;  3VR2 A;  4G7O C;  5D3I B;  2BDN A;  4QGU A;  3J80 E;  1JB3 A;  5E4W C;  1NR4 A;  1UE7 A;  2F0P A;  1IBK L;  3EBE A;  3TEH B;  2R7F A;  1JMC A;  4R4C A;  1SYD A;  4P2C B;  3MVV A;  2IY5 B;  1J9O A;  2WB1 G;  1LT3 D;  1LTL A;  2ATW A;  2QCP X;  2EYH A;  1VQG A;  5M3M H;  1A63 A;  3RLO A;  5IYD G;  4JV5 Q;  3EIV A;  2BDO A;  4O42 A;  1TWH B;  1HRJ A;  3ER0 A;  2KA7 A;  1TWC H;  1H9S A;  4DKA C;  1UE5 A;  1SFO B;  1YNN C;  3I4N H;  3A5U A;  3J7A V;  1ROD A;  1TII D;  2LXJ A;  1F2L A;  3HOY B;  1I3Q B;  1UUP A;  4XT1 B;  2PW5 A;  1VQA A;  4RGO S;  1FNU A;  4R8N A;  1ENA A;  2BA0 A;  3DMU A;  1HZA A;  2CW0 D;  1V9P A;  3W1G A;  1LM0 A;  5LMN W;  4QY7 A;  1T5E A;  2ENB A;  3HOW H;  1NH1 A;  1B7Y B;  1I4X A;  1SE2 A;  3BVG A;  2V4D A;  2DJF C;  1IKL A;  2CWP A;  1ENC A;  3K0X A;  4RCO A;  3PMF A;  3GO5 A;  3I73 A;  2K75 A;  1I4G A;  1U0L A;  4JI0 Q;  4UAI A;  3JAM E;  1JOO A;  2NN6 H;  3X3N A;  3DM1 A;  2R6G A;  2WKD A;  1DON A;  4GLA C;  4DUY Q;  3NEL A;  1CFM A;  3PUZ A;  1Q81 C;  3NWT A;  4CJ1 B;  4BY1 G;  1F2M A;  2K5N A;  4GNX B;  1VQD A;  3T53 B;  3S6A A;  4BBS G;  1D5Z C;  4X6A H;  4IUP A;  2A69 D;  1YJ9 A;  1RJT A;  1K8G A;  4CBV A;  3KDF B;  1PRT D;  3L0O A;  2EXZ A;  2IX0 A;  1Z7T A;  3K81 C;  5KEE A;  4HED A;  4A3K G;  4QIW B;  4C3I B;  2A1A A;  1A2U A;  3GQB A;  4J15 A;  3CCJ A;  4KN4 C;  1HZC A;  3K7A H;  1V1Q A;  3KF8 B;  4WGJ A;  2HUG A;  1KNA A;  4GKK L;  1O7I A;  3CCL A;  1S40 A;  4DXF A;  2RHQ B;  2HQL A;  2VZA A;  1MJC A;  1G2S A;  4LF5 Q;  2GA4 B;  2MP1 A;  4LF6 Q;  3EQL C;  2B2U A;  4AYB E;  2L12 A;  2EZV A;  4BY7 B;  1SMX A;  2F3V A;  1Y1W G;  1C9O A;  3KOJ A;  3EA6 A;  3J80 i;  3S1N B;  4OGQ C;  3NEM A;  3PIO 3;  1MD2 D;  2JA9 A;  3ZCB A;  5LL6 S;  1IZ6 A;  1J5E L;  5DLQ E;  4XYO A;  1STY A;  4NPS A;  3PO2 H;  1Q8K A;  2WB1 E;  3LWE A;  4JC0 A;  1I50 H;  2SNM A;  2N8N A;  4U68 A;  1QCB D;  2XTI A;  3OWF A;  4JI5 Q;  1MSG A;  5FKA C;  4A3F H;  2CKZ B;  1EYA A;  2VUM H;  1E1O A;  5I2X A;  3J7Y W;  3GTM H;  1UEA B;  2YTV A;  4NMZ A;  3CAM A;  1EFI D;  1IHZ A;  4KK7 A;  4DR6 L;  1NBW A;  3I4N G;  5JAV A;  1HNW Q;  1XPO A;  2E8G A;  2D9U A;  2NVY H;  1JOK A;  2IT1 A;  2KED A;  4DV3 L;  4ZQ3 A;  4RKL A;  4FYD A;  4A3L H;  4FXK C;  4IJH A;  2NZ1 D;  1UEB A;  4GN5 A;  1TWF B;  1AEX A;  3S15 H;  2B2Y C;  4JI4 Q;  3HOV B;  4LFA L;  1TS4 A;  2JEB I;  3W2D A;  2NN6 G;  1M8A A;  1VQF A;  4KKS A;  4OX9 L;  3UI2 A;  2F52 A;  2R93 B;  4WFN 3;  4DV5 Q;  3Q24 A;  1C7Y A;  5M3F G;  4A3C G;  2JA8 B;  1LT6 D;  2EJG C;  1OXS C;  5IWA Q;  4LF9 L;  2J4X A;  2MUY A;  3GP7 A;  1SJE D;  3W3A A;  4X3S A;  5EBC A;  2R7Z H;  1ILQ A;  4BBR H;  4IUR A;  5L37 A;  1RF2 D;  4A76 A;  3M4Y A;  2RF4 A;  1KAB A;  5FLX c;  4QMG A;  1CA6 A;  5E3F A;  4DR4 L;  4J1M A;  2CH4 W;  3MTS A;  2E2I H;  1PH6 A;  5C3E H;  3W1B A;  1I4R A;  1N36 Q;  5KIX A;  2ES2 A;  1IYV A;  3LNN A;  1SE4 A;  3K80 C;  4IFD H;  1VS0 A;  3GTO B;  3QB3 A;  4GZY C;  1IL2 A;  4HCE A;  4PZ7 A;  1Q1E A;  5LL6 X;  4LUV A;  3ULJ A;  1NTG A;  3B6Y A;  2HDM A;  5CV8 A;  3GTP H;  1XNR L;  3CC2 A;  3ULL A;  4A3F B;  1B2T A;  4JI1 L;  2YU9 H;  5FO9 B;  2VUM B;  1Y1V G;  3MFY A;  4DN4 M;  1E2W A;  1VQN A;  1HQR D;  1W3S A;  3CME A;  3NUC A;  4N9T A;  3ND8 A;  1R4Q B;  1IKM A;  3PIP 3;  2I0Q A;  3NHH A;  1PH8 A;  2NVY B;  1RCV D;  2EY2 A;  5I6W A;  3OTO L;  1HR0 L;  3UE1 A;  3D0F A;  4IPC A;  5AFW A;  4V0B A;  2VL6 A;  2BE5 D;  4K0K L;  4YWM A;  3PO3 H;  3KLS A;  1L0Y B;  4LUZ A;  1A8V A;  4LAA A;  1HUN A;  4DV4 Q;  2K33 A;  4JBW A;  4A93 B;  4UPA A;  2E2J H;  3HOU G;  5TSS A;  3I91 A;  3AMU A;  4JI0 L;  4GN3 B;  5FLM G;  3FPU B;  1LTR D;  2NTS A;  3NK9 A;  4JI3 Q;  2WAQ B;  4A3B H;  4A3L G;  2XWJ B;  4JPB W;  2RBM A;  3ZJY C;  1UE1 A;  1S3O A;  1U4M A;  2PI2 E;  3CQZ H;  3J7Z C;  1HA5 A;  1YNJ C;  4KTA A;  4KV6 A;  2UXD L;  1IL8 A;  4U07 A;  4A3I G;  4O1N A;  1RTO A;  3NPP A;  3OMG A;  3EVQ A;  4U67 3;  1LTB D;  4A3D B;  4JOI A;  1GJX A;  3KYH C;  1VQP A;  3HEJ A;  4OHJ A;  2E2I B;  3W5O A;  5HGT A;  1PFS A;  3S16 B;  2F0O A;  2GVB A;  3SK4 A;  1JJ2 A;  3VYT A;  1GHJ A;  1K8O A;  4K6L A;  4KMU C;  4RH6 A;  5M9O A;  1B1Z A;  4R9W A;  2EIF A;  4BBR G;  4FF4 A;  1EY0 A;  4LUO A;  4HJ8 A;  1EY8 A;  4LJZ C;  3E6Z X;  1QB5 D;  2MFI A;  4C3J B;  3M4Q A;  4LF5 L;  3GTP B;  1PYS B;  3KBX A;  4DXG A;  5KYL A;  5C3E G;  4A75 A;  2VNU D;  2YU9 B;  3OSO A;  5ELN A;  4C3H H;  2IWH A;  2BA1 A;  1BCP B;  4A3J G;  1CA5 A;  3GTJ B;  2JA6 H;  3FHW A;  2NVX H;  1DD2 A;  1ZXT A;  1K28 A;  1VQ6 A;  1KNE A;  4IFD G;  4TSS A;  5FJ8 H;  2UUC L;  2PZW A;  1ZYR D;  2VQF Q;  3SN9 A;  4S3S A;  1S5B D;  3SVM A;  2E5L Q;  2CVR A;  1Y8O B;  2M9V A;  4DR2 L;  4GKJ Q;  1O80 A;  2J0T D;  5LHY 1;  1PFB A;  1AZP A;  3TME A;  5CGK A;  3F2C A;  3VDY A;  4HJ7 A;  1BUV T;  4DR5 Q;  2UUA Q;  3D4R A;  3M9B A;  5C0X I;  2F0I A;  1PMR A;  1IBK Q;  2ICI A;  3HRZ C;  4KN7 C;  2R92 B;  4HJ5 A;  1SLJ A;  2EDG A;  1HNX L;  1HR0 W;  2LY7 A;  1YJN A;  1X55 A;  2N49 A;  4FDB A;  5JOB A;  3H0G H;  5EKI A;  4R4I A;  2OQ0 A;  1QG7 A;  4K8I A;  2IHF A;  3RZO H;  3PO3 G;  1RKN A;  2L4N A;  1YEZ A;  4QCL A;  5M5W B;  4G57 A;  2PQA A;  1EQV A;  1CKM A;  2C9O A;  3V05 A;  1TWG H;  3HP3 A;  1JE5 A;  2JQO A;  4WJW A;  3MXN B;  5EU0 A;  3FPP A;  5K5P A;  4LU4 A;  5C0X G;  3S1Q H;  1ESF A;  3JC6 6;  2WFW A;  4Y7N H;  1ICW A;  3CCE A;  2VB3 X;  3BVZ A;  1DOL A;  1STE A;  1GUS A;  5J22 A;  1ESR A;  5EPL A;  3S17 B;  1CSQ A;  3RZD B;  3I4M H;  1N34 Q;  5G3L F;  3URY A;  1HQM C;  2NZO A;  4DV7 L;  1IYJ B;  2E75 C;  3GTQ H;  4KY7 A;  1OTC A;  1E7Z A;  1OXT A;  4IUQ A;  5JVH 3;  3PV0 A;  3Q8D A;  1LO5 D;  2HIX A;  5GAG C;  3HGB A;  1DXM A;  1HFG A;  2CQO A;  2BCO A;  1F9Q A;  1DM0 B;  2XIW A;  3SEB A;  2JA6 B;  1D7Q A;  5IIF A;  3MZ5 A;  4LFB Q;  1PZI D;  1G29 1;  3ND9 A;  4OIK A;  1BCP D;  1L0W A;  2OQK A;  2JA5 H;  1ML0 D;  2QEX A;  4DR3 L;  3QOJ A;  1ZKO A;  3NBH B;  5JJL A;  3H6M A;  2MNA A;  4JVZ A;  4L6T B;  1U4P A;  5BR8 L;  4LFC Q;  1N9W A;  2F1M A;  3A7A B;  1EIF A;  1HXY D;  1LYL A;  3MWY W;  4DFA A;  5D65 A;  5M5X B;  3I8Z A;  2UXC L;  4P71 A;  1SYC A;  5C3W A;  2JSO A;  4TQU S;  4DAY A;  2ZXP A;  2NUD A;  1GXD C;  4UY8 C;  2XRS D;  4ZUJ A;  1F9S A;  3E0J A;  1TT2 A;  4MN3 A;  4DV6 L;  1CHP D;  4A3M G;  3G4S A;  2KEN A;  2Q2H A;  3S1M B;  2CHB D;  4IFD J;  2ZXR A;  4CJ0 B;  2R61 A;  2F3W A;  1LTI D;  2H5X A;  3KF6 B;  4X64 Q;  2B8F A;  2B63 B;  1A62 A;  3RZO B;  2Y0S E;  1A3U A;  3FEW X;  2LSS A;  3CU7 A;  3TQY A;  3K0Y A;  4PZ8 A;  1QUQ B;  2CW0 C;  3IRB A;  3DLL A;  3VR3 A;  4GOP C;  1SNM A;  1BR9 A;  2KCN A;  4RG1 A;  2WIN B;  4X3K A;  4JBK A;  4WOR A;  1J5E Q;  3S1Q B;  3CUC A;  3SXH A;  4UHV A;  5CGL A;  1NMG A;  3N52 A;  1KIX A;  4PMW A;  3T56 B;  4JI3 L;  1MBY A;  3ZLM A;  2K04 A;  2V1C C;  2K05 A;  3MXP A;  5CV5 A;  2K01 A;  5J1Z A;  4X66 L;  4HMJ A;  1LT5 D;  1KLG D;  4IPH A;  4DR6 Q;  1AFP A;  2KQ3 A;  1TWH H;  2OTL A;  4ITR A;  3NTI A;  1NSN S;  1PRT C;  4TVA B;  4RGN A;  1G2T A;  5EPJ A;  1SFO H;  5EBD A;  4DV3 Q;  4NDX A;  1O7L A;  3MA2 B;  4NW2 A;  1QWY A;  3I4M G;  1D1I A;  1T5X D;  4HSV A;  3HOY H;  1I3Q H;  4EQO A;  5JJ6 A;  4A3G H;  3D4W A;  1YZ6 A;  1NE3 A;  1STB A;  1B9N A;  1TQO A;  1WCM G;  3ERO A;  4LFA Q;  4OXP A;  4OWW B;  1CZG A;  3D4D A;  4PZ6 A;  2CFM A;  1V43 A;  1XNQ L;  1VQ5 A;  2FFK B;  1NR2 A;  4GS3 A;  5IOD A;  3HOX G;  4FNF A;  1BBX C;  2JA5 G;  1JCK B;  4POF A;  4BA2 I;  3NQT A;  4AIM A;  2ZTE A;  1DGS A;  3CPF A;  5IP9 H;  1V1P A;  2EYL A;  2O4X A;  4AYB B;  4DR4 Q;  1SEB D;  2F0L A;  4GKJ L;  4DR1 Q;  2L5T A;  2WP8 J;  5A35 A;  3JAM L;  1EYG A;  4DR5 L;  4C3I H;  2UUA L;  4DAV A;  5IGE A;  2F0J A;  3L3O C;  3DWP A;  2PNH A;  4CKB A;  3J81 E;  3S2H H;  3LET A;  4ZCK A;  2O5J C;  1CT1 D;  3M4O B;  2B2Y A;  4NXN L;  5C44 G;  1BF4 A;  1XJV A;  1M4V A;  2WB1 B;  5I6Y A;  1EWI A;  4DK1 A;  4QUC A;  2K52 A;  3F2D A;  1U5K A;  1KL9 A;  1K83 B;  2F0H A;  3QWN A;  1XNR Q;  1AH9 A;  4JI1 Q;  4BY7 H;  4U0Z A;  1UNS A;  4HIM A;  1A3V A;  2H4O A;  1FD7 D;  3C1F A;  5EJW A;  5F2D A;  3S1N H;  4H0L C;  1B53 A;  4GNX C;  2EY6 A;  3UDF A;  4N9P A;  4JI6 Q;  3OTO Q;  2B2W C;  2K03 A;  3P75 A;  1HR0 Q;  5IYC H;  4DU9 A;  3CP0 A;  2PMZ E;  3J81 j;  1N33 L;  3R93 A;  3CRL C;  5KNB A;  1S72 A;  1EY9 A;  4K0K Q;  4LF7 L;  4A3G B;  2DJG C;  5GAE C;  1N34 L;  2N55 A;  2KUM A;  5IOC A;  5HUR A;  4B3T L;  4K2K A;  3E9I A;  1H9J A;  3SHG A;  5A2Q E;  2WAC A;  3D6W A;  4OO1 H;  4IAL A;  1MJE A;  4PNY A;  4PQX A;  3S2D B;  2L9H A;  1Q86 C;  2K5Q A;  2OWO A;  4WJ4 A;  2F0E A;  2KOL A;  4U04 A;  1XPU A;  1B3A A;  2K32 A;  4LFB L;  1SE8 A;  1GVP A;  2UXD Q;  4I65 A;  4IPG A;  2FMC A;  1VQE A;  1K73 C;  4DUZ L;  1YI2 A;  1TWF H;  4X62 Q;  4NXM L;  4LFC L;  2ALY B;  3PUX A;  4RCN A;  3U50 C;  1NUC A;  1KD1 C;  3HOV H;  1EY5 A;  4BWG B;  2JA7 G;  4DNI A;  5JFF A;  4C1N K;  1QNK A;  3MAQ A;  4A3K B;  2SNS A;  2E2H B;  4DV0 L;  4P75 A;  1R9T B;  3E0E A;  3AYH B;  2R93 H;  3RMH A;  1PLF A;  1PFN A;  3EJI A;  1VQL A;  2JA8 H;  2B39 A;  3S2H B;  3TP8 A;  4YCU A;  3NP8 A;  4CGY B;  1EEF D;  1AE2 A;  1E2Z A;  2LKV A;  1EIH A;  4CJ2 C;  4X2D A;  1JQY D;  4X64 L;  4EGV A;  1B50 A;  4DAY B;  5DM7 3;  1TR5 A;  4UP9 A;  1GUW A;  1F9R A;  1E0B A;  1G91 A;  4K8J A;  5CMD A;  5AJ3 L;  1YIJ A;  1AZQ A;  5DAU A;  1Q82 C;  3J81 i;  4KLK A;  3G48 A;  2UUC Q;  3GTO H;  3TRZ A;  2B29 A;  3ZC7 A;  5C5L A;  3ERS X;  3STB C;  4DR2 Q;  5FK9 C;  1A0I A;  4YHH L;  5GRO A;  3F1Z A;  4CDE C;  3A8I E;  4C1N I;  5M3M G;  3KUP A;  2GVA A;  3I70 A;  1CUK A;  4LF4 L;  2MQH A;  2NN6 I;  2I5L X;  1HNX Q;  2B2T C;  5IYC G;  4XXE A;  1MKH A;  2PZT A;  2ZT9 C;  4RA8 A;  5C4X H;  4IUT A;  2PPB C;  1KDB A;  1E3P A;  1IBM L;  3AB9 A;  1EFW A;  3A8K E;  3I3C A;  2QDL A;  1RL2 A;  4Q5V A;  3GTG B;  4DNT B;  1FGB D;  3TP6 A;  3HOW G;  1H9K A;  3GTK H;  1KLU D;  2F0W A;  2F3I A;  3R8B A;  2F6S A;  1PH2 A;  1X3Q A;  1A15 A;  4IUV A;  2ASB A;  4HMI A;  4H7B A;  3S1R B;  3FVQ A;  3Q23 A;  1SMY C;  4CKC A;  1K0R A;  4A93 H;  1PH4 A;  1GUG A;  1K0S A;  3BDC A;  4OL7 A;  1F9P A;  3JAM i;  4ZYS A;  1YIT A;  4QQB X;  3L2P A;  2WII B;  1X6O A;  1NCV A;  1TS5 A;  1II3 A;  3NWS A;  1Q90 A;  4DV7 Q;  1KAW A;  1PH5 A;  4M8A A;  1PZK D;  3KBG A;  2I07 B;  1VQJ A;  4Z9C B;  5FO8 B;  3HZX A;  1YNN D;  1Z9F A;  3OYY A;  4C2M B;  4A3D H;  3H94 A;  4DNR B;  3C2P A;  3Q6S A;  2EOT A;  2K1B A;  2B2V A;  2XNA C;  2A74 C;  3S16 H;  1SYF A;  4ODG A;  4DR1 L;  1WTV A;  4YWL A;  1WTX A;  2ID0 A;  2JA8 G;  1KDC A;  3TRE A;  3MEH A;  4DR3 Q;  1VQO A;  3Q0A A;  4FF3 A;  3I4O A;  4NB3 A;  4JBJ A;  4CHT B;  5BR8 Q;  2NVT B;  3L7Z C;  3HKZ B;  4M1U B;  1UWV A;  1DZ1 A;  1LT4 D;  4ZKB B;  4F8M A;  4UP8 A;  4C3J H;  3G7L A;  2UXC Q;  1VQI A;  1O7Z A;  1EQT A;  4DF7 A;  1H9M A;  3IFD A;  1W6K A;  5COR A;  1S5F D;  5EKL A;  3GV3 A;  3GTJ H;  1VQK A;  5IP7 H;  3G6E A;  3AFQ A;  4DV6 Q;  1HZ9 A;  2F0T A;  2KCT A;  4XQJ A;  3RN5 A;  1QZG A;  3OW7 A;  4RFB A;  3A8J E;  5G3L D;  3PO2 G;  1TY2 A;  2I46 A;  4JI6 L;  1WTP A;  4GLV B;  1AW7 A;  4BS9 A;  5C4X B;  4B3R Q;  4OIJ A;  4IUN A;  1CK1 A;  4XYQ A;  2VS1 A;  1E1T A;  2AKW B;  4MIU A;  4P72 A;  4A3F G;  1G51 A;  2VW9 A;  3GTK B;  2VUM G;  3I90 A;  3D8G A;  5I9O A;  3J7A F;  2Z6B A;  1PRT F;  4B3M L;  2RDG A;  4KKT A;  1M1K C;  5IT9 E;  5DNF A;  1H9S B;  5BN5 A;  3PUW A;  2RKS A;  2AQ1 B;  3WDN A;  1E22 A;  3HOU B;  2HT1 A;  2R92 H;  1RHP A;  1O78 A;  4CDF C;  1BDO A;  1ET6 A;  2N88 A;  1U4L A;  1J8I A;  4KKU A;  4B9W A;  1ICF B;  3IAY A;  3J80 c;  1OXX K;  4X66 Q;  1C0A A;  1PTO B;  1YHA A;  1BCP C;  2G5D A;  4PMB A;  2A6H C;  5M5W H;  3R2I A;  2A19 A;  2SDF A;  4HIK A;  5I9P A;  3MEF A;  4J6H A;  4A3I B;  1GOZ A;  1FGU A;  4A93 G;  4X62 L;  2KVM A;  2JJQ A;  1GUT A;  1MIU A;  5DEH A;  1HA6 A;  3I7F A;  2M00 A;  4IPD A;  1A6X A;  4RKB A;  4IFD I;  2RDF A;  3S17 H;  3RZD H;  3M85 A;  5IY0 A;  4B3S Q;  4GOP A;  4YY3 L;  3TP5 A;  4ZLT F;  1VQ4 A;  1QVF A;  2R7Z G;  1V1O A;  2MO1 A;  1FVI A;  3D6C A;  1SE3 A;  4A3E B;  4BXX H;  1JJG A;  4A3D G;  1KRS A;  2L15 A;  2F0Q A;  1XNQ Q;  1J6Q A;  5KRU A;  2LFN A;  2LS0 1;  1I4P A;  1X65 A;  4P73 A;  4ZK9 B;  1EEI D;  2I5H A;  1BBU A;  4X65 Q;  2EJM A;  2XSC A;  4A3J B;  3U58 A;  1K3R A;  2E76 C;  4JCV E;  1PH9 A;  4H02 A;  4IJL A;  2JXM B;  3TDQ A;  3I55 A;  4JI7 L;  4FXD A;  1QOH A;  3JAM c;  1VMP A;  4LW1 A;  3CCV A;  4DV2 L;  2Y0S B;  5M5X H;  1X3P A;  4IO9 A;  2Q2I A;  1YBY A;  4RHS A;  4DA2 A;  1ET9 A;  1I6H B;  4H44 C;  3RLN A;  2UUB L;  1CZW A;  1F2Z A;  3LGJ A;  2D2C C;  1JOQ A;  4G7Z C;  2VQE L;  4DR7 L;  1NJI C;  3BDO A;  4NXN Q;  1PHJ A;  3R3O A;  2P5Z X;  3P20 A;  2BH8 A;  3S1M H;  4J8Q A;  2AQ3 B;  1A2T A;  2Q8I B;  2QKI C;  2E74 C;  3SE5 A;  1IW7 D;  1EIY B;  3I56 A;  2B63 H;  2OF1 A;  4JI2 L;  2NBF A;  1WTO A;  2A68 C;  2QF7 A;  3DUZ A;  4DPG A;  1GM5 A;  3E3X A;  4CDD C;  1PTO D;  4PMC A;  1DJR D;  2HIV A;  2MGS A;  3S9W A;  2IW3 A;  2OXP A;  4K5W A;  4XQQ A;  4L5Q A;  1SBB B;  4HJA A;  2ICE C;  2MPM A;  3O13 A;  3V96 A;  2DNC A;  2K7V A;  5JJ7 A;  1N33 Q;  3VA5 A;  5K36 H;  1FJG L;  4A3B G;  3RN2 A;  3MFG A;  3VYR A;  1L1O A;  1DYQ A;  1NY4 A;  5IGC A;  4LF7 Q;  4MTN A;  4IOC A;  3T13 A;  1BKB A;  2JK8 A;  2X6G A;  2MO0 A;  5COY A;  4B3T Q;  4FP5 D;  3ITP A;  1Y8P B;  1Q7Y C;  4KD3 A;  1C4Q A;  2C35 B;  1FL0 A;  1T9H A;  5D14 A;  1DCZ A;  2Z8L A;  1MSH A;  4N67 A;  4JYA L;  2NTT A;  4XT3 B;  3K57 A;  1EU3 A;  3NXW A;  3K5O A;  2A6E D;  4HCS A;  4HSP A;  3UE0 A;  1A3T A;  3TZU A;  2G9D A;  4RWS C;  4DUZ Q;  3K58 A;  3CC7 A;  4NXM Q;  2Z1C A;  4GNX A;  1B70 B;  5C6A A;  3A74 A;  3WOF A;  3F2B A;  2RHS B;  5EPK A;  5CV9 A;  4F87 A;  2F0N A;  4RMF A;  5EQ0 A;  2Z4I A;  3S14 B;  1NAP A;  1RIP A;  4C3H G;  4DV0 Q;  2JA6 G;  2F4V L;  3GTL B;  1ONL A;  1YNJ D;  5FLX L;  3FKI B;  3OHX C;  5FJ8 G;  4OWX B;  1JJC B;  5C4J B;  1D5M C;  1XX8 A;  1HCZ A;  3H09 A;  5IYB H;  3KF8 A;  3CCS A;  1PZJ D;  1RDP D;  3U4V A;  4JBM A;  3P7J A;  4B3R L;  1VQM A;  1HTL D;  5KND A;  1HZB A;  5CV6 A;  1D8L A;  1G6Z A;  1CQF A;  5AJ3 Q;  5ISR A;  3H3V I;  4POG A;  4KD4 A;  1FNW A;  4ID6 A;  3T4A C;  3RUZ A;  3QG1 A;  1KAA A;  3U9S A;  1LUZ A;  1YVC A;  3M4O H;  4EVO A;  3H0G G;  5EAY A;  1M90 C;  3GD7 A;  1KC8 C;  3PUV A;  2PMZ B;  4K14 A;  4OWT B;  4UP7 A;  1EQQ A;  2B63 G;  2F0D A;  1W2B A;  1B4O A;  4YHH Q;  4LK1 C;  1K83 H;  1HTP A;  5BN4 A;  4ILW A;  4EQP A;  3P1H A;  1QIL A;  3PF4 A;  2LXK A;  1CKN A;  4R4Q A;  4LF4 Q;  5LMU L;  2A69 C;  1SR3 A;  2F0U A;  2L0C A;  2ZXO A;  5GAD C;  4K2L A;  3A56 A;  3LX0 A;  3J81 L;  2D5D A;  4JI8 L;  1TVX A;  3KJP A;  4KY6 A;  4XIG S;  5FLX E;  1IBM Q;  4C56 C;  2RCN A;  1W6J A;  3SHL A;  1WD0 A;  2QDB A;  4ME5 A;  3T16 A;  4QL5 A;  2ZJR A;  2UU9 Q;  2AWO A;  5J39 A;  4B3S L;  3TBI B;  2O2L D;  1WCM B;  2XGT A;  1WTW A;  1MGS A;  1QVG A;  4U0U A;  1SJH D;  4ME3 A;  3CCU A;  4B9X A;  1PH1 A;  3BZC A;  3HOZ B;  4FO2 A;  3S2D H;  2EYM A;  2PW7 A;  2XWB B;  1KQS A;  1CHQ D;  2J7Z A;  4B08 A;  1JE4 A;  3BS1 A;  3HOX B;  4X65 L;  3NTH A;  1HJP A;  3A54 A;  3CD6 A;  4WRD A;  4JK1 C;  1ILP A;  2Z0S A;  2EPB A;  4X2C A;  2KHS A;  3J7A 5;  3BDL A;  1S5C D;  2N3S A;  3CRK C;  4DK3 C;  3PIP A;  3M3Y B;  1PV4 A;  5JJI A;  3GV6 A;  3BG3 A;  5A2Q L;  1FYC A;  3OWE B;  1H9R A;  5I4D A;  3SGI A;  1EYD A;  4A3K H;  2E2H H;  1R9T H;  2Q8T A;  3NSW A;  2OCE A;  5HGQ A;  1WTQ A;  2N78 A;  3EN2 A;  4JW0 A;  1X56 A;  3F8T A;  2ZJQ A;  3KLW A;  5JPM C;  2Z4H A;  3TSS A;  5C44 B;  1YJW A;  1EZ6 A;  4X3U A;  3K8A A;  5DM6 3;  1EY7 A;  1YHB A;  4OON A;  2X6L A;  5ELD A;  5GQO A;  2RVL A;  2BH2 A;  2BOS A;  2FMM A;  1XTD A;  3TN2 A;  1WOC A;  3AU7 A;  2E2D C;  4E6I A;  2NWG A;  1Y1W H;  2K4K A;  2LMC B;  1SYE A;  2HHH Q;  2PO4 A;  3PSI A;  2Z6K C;  1Y14 B;  4R8I A;  4EX5 A;  5IE8 A;  1PA6 A;  2L55 A;  1GUN A;  5HY6 A;  1VF5 C;  2F0S A;  3BYT B;  3FRP B;  5C3X A;  1WYD A;  1BCP F;  4HAE A;  5T1G A;  5JVG 3;  3TZD A;  2PZU A;  2NZH A;  3KK7 A;  4ZKC B;  4IZ8 A;  2PQA B;  5D3D A;  2A5H A;  1BNZ A;  1WI5 A;  5M5Y B;  1SRO A;  1TY0 A;  5EGT A;  1IBL L;  4B3M Q;  3A5Z B;  2XN9 C;  2K5H A;  1LTS D;  1CTM A;  1HNZ Q;  1G6P A;  1JC7 A;  1SDF A;  2IL8 A;  3QIA A;  1L1O B;  1P16 A;  3HOY G;  2UXB L;  1D5X C;  4A3G G;  3NEN A;  3UDX A;  4XI8 A;  1BOS A;  4MTK A;  4BY1 B;  4KHV A;  4LMQ D;  3GTG H;  1X3G A;  2X69 A;  1I4Q A;  4IN3 A;  5C4H A;  4BBS B;  2RSN A;  1F77 A;  3L9A X;  4KY5 A;  2KEE A;  5KNC A;  1XYI A;  1WTR A;  1JOR A;  2IHE A;  2KEC A;  4NKL A;  3S1R H;  4X3T A;  2JA7 B;  1N32 Q;  1TWA B;  1ZEQ X;  2YV5 A;  1EQR A;  3K7U C;  3N3U A;  1AN8 A;  1B8A A;  5KYI A;  4MHE A;  2K5W A;  5ELC A;  5BN3 A;  1FR3 A;  1STH A;  4A3C H;  1STA A;  3CHB D;  5M3F H;  2ZM6 L;  1LTG D;  3T1H L;  4YY3 Q;  2AMC B;  1E2V A;  2GN5 A;  2HCC A;  1STG A;  1GKH A;  5IP9 G;  1N8R C;  1EOV A;  1VQH A;  2KJX A;  3RLF A;  4C2M H;  1Z6H A;  4UDU C;  1BXT A;  2RA4 A;  4HR7 B;  3K5N A;  2BE5 C;  3N6R A;  1Y1W B;  3KLS X;  1U9R A;  1LLR D;  2C5C A;  4C3I G;  4MNO A;  2WKC A;  4JI7 Q;  3SDZ A;  3UDG A;  3SR1 A;  1MI2 A;  2PCF B;  3VR6 A;  3DHQ A;  1XMQ Q;  2NVT H;  1K8M A;  2D62 A;  2SOB A;  1EWH A;  1OXU A;  4DK0 A;  3D31 A;  3CXC A;  5H1S E;  4DV2 Q;  5JEA H;  4N8F A;  4BY7 G;  3U4Z A;  3LWU A;  2UUB Q;  1R4P B;  5M3M B;  5CYU A;  4OO1 I;  2VQE Q;  2JE6 I;  1Y1V H;  4DR7 Q;  2TMP A;  2MHV A;  2YTY A;  5JPN C;  5I2Y A;  1TWC B;  3HG9 A;  3I4N B;  1EY6 A;  2QEJ C;  3BYY B;  1EU4 A;  1B44 D;  4WJ3 M;  1HUM A;  4JI2 Q;  2EXD A;  2H1E A;  5CV4 A;  2EY5 A;  2HDL A;  3E5S A;  1CKN B;  2RCF A;  1WFQ A;  3HOW B;  2UU9 L;  2ZJP A;  2FHT A;  2R7D A;  4L8J A;  1U4R A;  4OO1 G;  2F0V A;  4YCV A;  3MXU A;  3MXN A;  4YWK A;  1BQQ T;  1EL0 A;  2JN4 A;  1LAC A;  1LV9 A;  4IQZ A;  4FF2 A;  3HOU H;  1FJG Q;  3BVM A;  5FLM H;  5E7N A;  3EFX D;  3H91 A;  3CCM A;  3VYS A;  2CCZ A;  5M3F B;  3U9O A;  3VR4 A;  3NBI A;  4KHP L;  1PTO H;  1NNX A;  5J3B A;  4YCW A;  3E9H A;  2QW7 A;  1EYC A;  2HQE A;  4HJ9 A;  5CKL A;  1JR0 D;  1SNQ A;  4A3I H;  3C46 A;  3HOV G;  1I94 L;  1ZYR C;  3RNU A;  1KTK A;  2JP1 A;  5E1F A;  1SNC A;  5IT9 L;  4JYA Q;  3NE5 B;  3QR8 A;  2RDH A;  2R93 G;  3I2Z A;  2HD3 A;  4AQY Q;  3K7A B;  1CSP A;  3DWA A;  1TKW B;  4LF8 L;  5JFZ A;  1V1P B;  3NBH A;  4AH6 A;  3ICE A;  1YHQ A;  4YIJ A;  3SK6 A;  4DAM A;  1AE3 A;  2EVB A;  2G9H D;  2PNR C;  4XDX A;  5KGU A;  4A3E H;  3M4P A;  3MC0 B;  1B9M A;  4ULL A;  1IYU A;  2D0P A;  5NUC A;  1CM9 A;  1IW7 C;  4U0S A;  1B3Q A;  3GDE A;  2F4V Q;  2HCI A;  3QJY A;  4QIW E;  1Y1V B;  2K50 A;  3K6O A;  4A3J H;  2PQE A;  4LWC A;  1PTO C;  1EUJ A;  4CDC C;  2HHH L;  3DXJ C;  1TU2 B;  3V2T A;  1D2B A;  1VQ9 A;  1WVL A;  2DUD A;  3AEV A;  1XXG A;  2G03 A;  3PO2 B;  1VMC A;  1CI3 M;  3HKZ G;  1I50 B;  1Q12 A;  4DGZ A;  3G6J B;  3HFZ B;  3I4L A;  5JEA G;  3WWV A;  1QJO A;  1SRU A;  4R1J A;  1LTT D;  3KF6 A;  1SYG A;  2EYJ A;  4EQ5 A;  3R2T A;  1FNV A;  1C8C A;  4CKE A;  3UDI A;  1I6H H;  2DNE A;  4L63 B;  3GTM B;  2JYO A;  3IKJ A;  1PYW D;  3RR5 A;  3OIQ A;  1PFM A;  1QUQ A;  2KCC A;  3MHB A;  1HH2 P;  2AUK A;  4JV5 L;  4FXG C;  2M2L A;  3NTK A;  3CKI B;  2QA4 A;  1X3F A;  5T1I A;  1HNZ L;  5C4X G;  1V8Q A;  3TS2 A;  2Q2U A;  2OEO A;  3BZD B;  4HTH A;  2CQA A;  1QE6 A;  3VR5 A;  2XRQ D;  1XMO Q;  3MXG A;  1JWS D;  2KBN A;  1X9N A;  2A6E C;  2O5I C;  3C3L A;  2F0G A;  2TSS A;  3J81 c;  5E4X A;  3S15 B;  1TXY A;  2AWN A;  5LMU Q;  1MHW C;  1QVC A;  4DK6 C;  1I4H A;  4QB4 A;  1BO0 A;  5IGD A;  5C0X H;  2B2U C;  2R3Z A;  2FIN B;  4RAU C;  4JI8 Q;  1N32 L;  1HPC A;  1WD1 A;  3STB D;  1Q46 A;  1ASZ A;  4F88 A;  3M7N A;  2WAQ G;  1Z47 A;  4PY3 A;  4DUY L;  2CWA A;  3QOL A;  4LNQ A;  1LTA D;  4ZUI A;  2K28 A;  5ELF A;  3H15 A;  5LMN Q;  1UAP A;  2R7Z B;  4BBR B;  1C48 A;  3HKS A;  1PH7 A;  3T1Y Q;  1I5F A;  2OTJ A;  1GD7 A;  1SXT A;  3QO2 A;  2K5V A;  3SK5 A;  1JB7 A;  3M7G A;  5C3E B;  1Q8I A;  4QJF A;  1SNP A;  3TS0 A;  1L2F A;  5IGF A;  1DOM A;  3CMA A;  5IGB A;  1LAB A;  3BZK A;  4R4T A;  1SYB A;  2FJ2 A;  1OXV A;  4FVM A;  1SMY D;  1XMQ L;  1L0X B;  1VQB A;  4A3E G;  4C3J G;  4ZAI A;  3VA7 A;  4LF6 L;  1SN8 A;  3OIP A;  1PH3 A;  4ZRZ A;  4R4O A;  1QZH A;  3D3R A;  3T51 B;  3S14 H;  4P74 A;  5IGG A;  3KFU A;  5IP7 G;  2KHI A;  3CF5 A;  3GTL H;  1G8Z D;  3PCO B;  4DV1 Q;  1CQV A;  3FKI H;  2EY1 A;  4KJN A;  4QUF A;  1H95 A;  4A3M H;  2D0O A;  3HKZ E;  4X2E A;  1NMF A;  5C4J H;  4XTC S;  2NVQ H;  4PV1 C;  2MJ8 A;  2F03 A;  3AQQ A;  2QGQ A;  1BBW A;  1KXL A;  2Y0S G;  3PO3 B;  5ELO A;  1GO3 E;  2YTX A;  4K5X A;  5JEA J;  4HN7 A;  1PDQ A;  5JJZ A;  4JI5 L;  2EYP A;  1BVS A;  5CBA E;  1CKO A;  1IXR A;  1ASY A;  1Q1B A;  5FOB B;  4V19 0;  1D1K A;  2E2J B;  2R92 G;  1VQC A;  1UE6 A;  3CW2 C;  1Y69 U;  4FF1 A;  2Q8R E;  1JWU D;  1HNW L;  2KCM A;  4L5T A;  2B2V C;  4F7X A;  2CH4 A;  3IFT A;  3OPO A;  4A3B B;  1SSO A;  1VDZ A;  2NUN A;  1HHV A;  5CBE E;  2IX3 A;  1VCI A;  3CQZ B;  4G4K A; 
#chains in the Genus database with same CATH homology
 1KQS A;  3PF5 A;  3CCQ A;  2I0Q A;  1IBL Q;  4X2D A;  4X64 L;  4X65 L;  1HJP A;  1PH8 A;  4DAY B;  3CD6 A;  3OTO L;  2Z0S A;  1HR0 L;  3UE1 A;  3D0F A;  4UP9 A;  4JI4 L;  4IPC A;  3H3V H;  4KHZ A;  4X2C A;  5AJ3 L;  1YIJ A;  2VL6 A;  3J7A 5;  4APV A;  2N3S A;  4YWM A;  4K0K L;  1Q82 C;  3PO3 H;  3J81 i;  4KLK A;  3S24 A;  4DK3 C;  4L5S A;  3G48 A;  3FP9 A;  3PIP A;  3BU2 A;  1PV4 A;  2UXB Q;  4LUZ A;  2UUC Q;  2WAQ E;  5JJI A;  1A8V A;  2Q2T A;  4DV5 L;  5JJK A;  2EQS A;  3GTO H;  4DV4 Q;  4AQY L;  5IWA L;  4JBW A;  3TRZ A;  2B29 A;  3AFP A;  3ZC7 A;  4UPA A;  3SGI A;  4A3K H;  3ERS X;  2E2J H;  3STB C;  4KI0 A;  4DR2 Q;  2E2H H;  3HOU G;  1A0I A;  5HGQ A;  1R9T H;  2OCE A;  3PIO A;  2Z6K A;  4YHH L;  2N78 A;  4BXX G;  4JI0 L;  5GRO A;  3F1Z A;  4GN3 B;  1WCM H;  5FLM G;  3EN2 A;  1X56 A;  3F8T A;  5M3M G;  3ULP A;  2ZJQ A;  3KLW A;  4JI3 Q;  4A3L G;  3BJU A;  4A3B H;  2GVA A;  1YJW A;  1CUK A;  4LF4 L;  3K8A A;  3ZJY C;  1UE1 A;  1S3O A;  3HOZ H;  1YHB A;  2PI2 E;  3CQZ H;  2MQH A;  3KDF A;  4OON A;  2NN6 I;  4A4I A;  3J7Z C;  2I5L X;  1K9M C;  1HNX Q;  5GQO A;  2UXD L;  5IYC G;  3HOX H;  4O2D A;  2ZM6 Q;  1MKH A;  2BH2 A;  4U07 A;  4A3I G;  1N36 L;  3T1H Q;  1XTD A;  1WOC A;  1PVO A;  5C4X H;  1P8L A;  1E3P A;  4JOI A;  1Y1W H;  1IBM L;  2K4K A;  2I5M X;  4O0A A;  1EFW A;  3KYH C;  5CMT A;  3G71 A;  1VQP A;  2HHH Q;  3OW2 A;  2VY3 A;  4GLX A;  3PSI A;  1RL2 A;  2FXQ A;  2Z6K C;  3W5O A;  1Y14 B;  1PFS A;  3HOW G;  4EX5 A;  3GTK H;  2GVB A;  5IE8 A;  1JJ2 A;  1PA6 A;  2F3I A;  3M3Y H;  2F6S A;  5HY6 A;  1PH2 A;  2A8V A;  3A0J A;  1WYD A;  2ASB A;  2YYZ A;  4IOA A;  1K0R A;  2EIF A;  2NZH A;  4BBR G;  4A93 H;  1PH4 A;  4LUO A;  4HJ8 A;  2IX1 A;  2PQA B;  3JAM i;  3FKI G;  4QQB X;  1YIT A;  2MFI A;  2AHO B;  3M4Q A;  1WI5 A;  3L2P A;  1SRO A;  1X6O A;  4LF5 L;  4GKK Q;  2JEA I;  4JOI C;  1IBL L;  1PYS B;  4B3M Q;  3A5Z B;  3PUY A;  5C3E G;  5C44 H;  4A75 A;  2VNU D;  2K5H A;  4DV7 Q;  1KAW A;  1PH5 A;  5ELN A;  4C3H H;  5GAH C;  2BA1 A;  4A3J G;  2JA6 H;  1HNZ Q;  1G6P A;  2ZTC A;  3FHW A;  2NVX H;  1VQJ A;  2K14 A;  1L1O B;  1XMO L;  1VQ6 A;  3KJO A;  4IFD G;  4M16 A;  1P16 A;  1E24 A;  5FJ8 H;  3CCR A;  1Z9F A;  3OYY A;  3HOY G;  2UXB L;  4A3D H;  1VQ8 A;  2UUC L;  4A3G G;  3NEN A;  3UDX A;  4XI8 A;  2VQF Q;  3SN9 A;  5IYD H;  4Y52 H;  4DV4 L;  3GTG H;  2E5L Q;  1X3G A;  3S16 H;  4DR1 L;  2DGY A;  4YWL A;  2JA8 G;  2ID0 A;  2B3G A;  4DR2 L;  4GKJ Q;  3TRE A;  4DR3 Q;  1VQO A;  5K36 G;  2KHJ A;  3I4O A;  3VDY A;  4NB3 A;  2IHE A;  4JBJ A;  3F2C A;  4HIO A;  4HJ7 A;  4DR5 Q;  3S1R H;  2UUA Q;  3CC4 A;  5BR8 Q;  3M9B A;  1N32 Q;  3L7Z C;  5C0X I;  2YV5 A;  1EQR A;  1IBK Q;  3K7U C;  3N3U A;  1UWV A;  1B8A A;  4UP8 A;  1PYB A;  4HJ5 A;  4C3J H;  1SLJ A;  5LMN L;  5M5Y H;  1HNX L;  1VQI A;  2PI2 A;  1XPR A;  1HR0 W;  2UXC Q;  1YJN A;  1X55 A;  5M3F H;  2N49 A;  4FDB A;  2ZM6 L;  4A3C H;  1KRT A;  3H0G H;  4BA1 I;  4YY3 Q;  3T1H L;  4R4I A;  2OQ0 A;  3T1Y L;  2AMC B;  2GN5 A;  2IHF A;  3RZO H;  3PO3 G;  3GTJ H;  1GKH A;  5IP9 G;  1YEZ A;  5C0X J;  1N8R C;  5IP7 H;  1EOV A;  1VQH A;  3G6E A;  1VQK A;  2PQA A;  3AFQ A;  4DV6 Q;  1PH1 A;  1CKM A;  1HZ9 A;  2KCT A;  4GN4 B;  3RN5 A;  4ALP A;  1TWG H;  1QZG A;  1JE5 A;  2JQO A;  3PO2 G;  3RLF A;  4C2M H;  4GOP B;  3MXN B;  5EU0 A;  4JI6 L;  4JG2 A;  4GLV B;  4KHP Q;  4B3R Q;  5IT9 c;  4LU4 A;  5C0X G;  1X3E A;  4BY1 H;  1XNQ L;  1VQ7 A;  1KHI A;  3JC6 6;  3S1Q H;  4MNO A;  2VS1 A;  1E1T A;  2AKW B;  2WFW A;  3DM3 A;  4P72 A;  4Y7N H;  3CCE A;  1G51 A;  4A3F G;  1I94 Q;  4BBS H;  2VW9 A;  4JI7 Q;  2VUM G;  3UDG A;  4OX9 Q;  1XMQ Q;  4L5R C;  3HOZ G;  1CSQ A;  2JA7 H;  1N34 Q;  4B3M L;  2D62 A;  2NVT H;  1M1K C;  3I4M H;  1TWA H;  1OXU A;  1WJJ A;  3D31 A;  3CXC A;  3PUW A;  2NZO A;  3CPW A;  4DV7 L;  1E22 A;  5H1S E;  4DV2 Q;  1IYJ B;  2HT1 A;  2R92 H;  4LF9 Q;  3GTQ H;  4BY7 G;  3PGZ A;  1E7Z A;  3U4Z A;  1OTC A;  1OXT A;  2UUB Q;  1X54 A;  1K8A C;  4MZ9 A;  4LF8 Q;  4OO1 I;  2ZTD A;  3PV0 A;  2VQE Q;  4DV1 L;  2JE6 I;  1Y1V H;  3Q8D A;  5IYB G;  4HID A;  4DR7 Q;  2HIX A;  5GAG C;  2YTY A;  3J80 c;  1OXX K;  4X66 Q;  1C0A A;  1YHA A;  2VQF L;  2CQO A;  5M5W H;  4PG3 A;  1D7Q A;  2A19 A;  4HIK A;  4LFB Q;  2E5L L;  4AYB G;  1G29 1;  1L1O C;  3MEF A;  1L0W A;  1YNX A;  2OQK A;  1JT8 A;  2JA5 H;  1FGU A;  2QEX A;  4DR3 L;  4A93 G;  3NBH B;  4X62 L;  5JJL A;  4WJ3 M;  2JJQ A;  2MNA A;  4JI2 Q;  4QGU A;  2EXD A;  1MIU A;  5BR8 L;  4LFC Q;  1N9W A;  3BZC A;  1UE7 A;  1CKN B;  1IBK L;  3I7F A;  1EIF A;  3EBE A;  3TEH B;  1WFQ A;  2R7F A;  2UU9 L;  4IPD A;  2ZJP A;  1LYL A;  1JMC A;  2R7D A;  4R4C A;  4IFD I;  4OO1 G;  2UXC L;  4P71 A;  3S17 H;  3RZD H;  4YCV A;  2IY5 B;  2WB1 G;  3M85 A;  5IY0 A;  4B3S Q;  4GOP A;  4YY3 L;  4TQU S;  4YWK A;  1LTL A;  1VQ4 A;  1QVF A;  2R7Z G;  3HOU H;  2MO1 A;  1FVI A;  2ATW A;  1FJG Q;  4BXX H;  1JJG A;  4UY8 C;  4A3D G;  5FLM H;  1KRS A;  2L15 A;  5E7N A;  1VQG A;  5M3M H;  4DV6 L;  3CCM A;  4A3M G;  1XNQ Q;  3RLO A;  1A63 A;  1J6Q A;  5IYD G;  2KEN A;  2Q2H A;  3G4S A;  2CCZ A;  4JV5 Q;  4P73 A;  3EIV A;  1X65 A;  4IFD J;  2I5H A;  3ER0 A;  4KHP L;  1BBU A;  2H5X A;  3KF6 B;  4X64 Q;  4X65 Q;  1TWC H;  5J3B A;  1A62 A;  1K3R A;  4JCV E;  4YCW A;  3U58 A;  1PH9 A;  2Y0S E;  4H02 A;  3E9H A;  4IJL A;  4DKA C;  1UE5 A;  3I4N H;  3A5U A;  2LSS A;  4HJ9 A;  5CKL A;  3TQY A;  4A3I H;  3HOV G;  1I94 L;  4PZ8 A;  1QUQ B;  3I55 A;  2LXJ A;  4JI7 L;  3RNU A;  3IRB A;  3DLL A;  4GOP C;  4JYA Q;  1VQA A;  2BA0 A;  1HZA A;  3W1G A;  1V9P A;  3JAM c;  1LM0 A;  4RG1 A;  5LMN W;  4JBK A;  1J5E Q;  4QY7 A;  4LW1 A;  2R93 G;  3HOW H;  3CCV A;  3CUC A;  1B7Y B;  3I2Z A;  4DV2 L;  5CGL A;  4AQY Q;  5M5X H;  4IO9 A;  1CSP A;  2Q2I A;  1YBY A;  1NMG A;  2CWP A;  3K0X A;  3RLN A;  2UUB L;  3GO5 A;  4PMW A;  1KIX A;  3LGJ A;  4LF8 L;  5JFZ A;  2K75 A;  1U0L A;  2VQE L;  4AH6 A;  4JI0 Q;  3ICE A;  4JI3 L;  1YHQ A;  4DR7 L;  3ZLM A;  4DAM A;  2V1C C;  1NJI C;  1AE3 A;  4X66 L;  2R6G A;  4A3E H;  3M4P A;  4NXN Q;  4GLA C;  1PHJ A;  4DUY Q;  2D0P A;  3NEL A;  3PUZ A;  4U0S A;  1Q81 C;  2BH8 A;  3S1M H;  4IPH A;  3GDE A;  4BY1 G;  4DR6 Q;  2K5N A;  2F4V Q;  3SE5 A;  4GNX B;  1TWH H;  4QIW E;  1VQD A;  2OTL A;  3S6A A;  2K50 A;  4ITR A;  4BBS G;  4A3J H;  1EIY B;  3I56 A;  2B63 H;  4LWC A;  4X6A H;  4JI2 L;  4TVA B;  1EUJ A;  1YJ9 A;  2HHH L;  1SFO H;  4DV3 Q;  1K8G A;  1VQ9 A;  1GM5 A;  4DPG A;  2DUD A;  3I4M G;  3KDF B;  3AEV A;  3L0O A;  2G03 A;  3HOY H;  1I3Q H;  2HIV A;  5JJ6 A;  2IX0 A;  3HKZ G;  4A3G H;  1Q12 A;  1YZ6 A;  3HFZ B;  1NE3 A;  3K81 C;  5JEA G;  4A3K G;  3WWV A;  2A1A A;  4J15 A;  4L5Q A;  1SRU A;  4R1J A;  3CCJ A;  4HJA A;  3KF6 A;  1HZC A;  1WCM G;  3K7A H;  4LFA Q;  5JJ7 A;  1N33 Q;  4OXP A;  4EQ5 A;  1FJG L;  4OWW B;  1V1Q A;  3UDI A;  4A3B G;  4PZ6 A;  3RN2 A;  2CFM A;  3KF8 B;  1I6H H;  4WGJ A;  1L1O A;  1NY4 A;  4LF7 Q;  4MTN A;  1V43 A;  3RR5 A;  1QUQ A;  4IOC A;  1BKB A;  1O7I A;  1VQ5 A;  2JK8 A;  3CCL A;  1S40 A;  1HH2 P;  4GKK L;  4GS3 A;  2RHQ B;  4JV5 L;  2HQL A;  2VZA A;  1MJC A;  2MO0 A;  4LF5 Q;  4B3T Q;  3HOX G;  4LF6 Q;  4AYB E;  2QA4 A;  1X3F A;  2JA5 G;  1SMX A;  1HNZ L;  5C4X G;  3TS2 A;  2Q2U A;  1Y1W G;  4POF A;  1C9O A;  1Q7Y C;  4BA2 I;  3KOJ A;  4AIM A;  2ZTE A;  2C35 B;  1FL0 A;  1T9H A;  1XMO Q;  3J80 i;  3NEM A;  4N67 A;  1DGS A;  2JA9 A;  3ZCB A;  2KBN A;  3CPF A;  1X9N A;  5IP9 H;  4JYA L;  1IZ6 A;  3J81 c;  1J5E L;  5DLQ E;  1TXY A;  2AWN A;  5LMU Q;  4DR4 Q;  1QVC A;  4NPS A;  3PO2 H;  1Q8K A;  3UE0 A;  4GKJ L;  2WB1 E;  4JC0 A;  4DR1 Q;  1I50 H;  2N8N A;  2WP8 J;  4DUZ Q;  1EYG A;  3CC7 A;  4C3I H;  4DR5 L;  2XTI A;  4JI8 Q;  4GNX A;  2UUA L;  1B70 B;  4NXM Q;  1N32 L;  4JI5 Q;  3A74 A;  3STB D;  2PNH A;  3F2B A;  2CKZ B;  4A3F H;  1Q46 A;  2RHS B;  3LET A;  1ASZ A;  3S2H H;  2VUM H;  3M7N A;  1E1O A;  2WAQ G;  4NXN L;  1Z47 A;  4RMF A;  4PY3 A;  5C44 G;  3GTM H;  4DUY L;  2CWA A;  1XJV A;  1RIP A;  4LNQ A;  2YTV A;  3CAM A;  1EWI A;  4DV0 Q;  3H15 A;  2K52 A;  5LMN Q;  3F2D A;  2JA6 G;  4DR6 L;  1NBW A;  1U5K A;  1KL9 A;  1AH9 A;  2F4V L;  1XNR Q;  3I4N G;  1HNW Q;  1XPO A;  2E8G A;  3HKS A;  2NVY H;  4JI1 Q;  3T1Y Q;  1PH7 A;  2IT1 A;  1I5F A;  4U0Z A;  4HIM A;  4BY7 H;  2OTJ A;  1GD7 A;  4OWX B;  5FJ8 G;  4DV3 L;  1JJC B;  2K5V A;  1JB7 A;  5IYB H;  4A3L H;  3S1N H;  3CCS A;  4IJH A;  4GNX C;  4QJF A;  3U4V A;  4JBM A;  4B3R L;  3UDF A;  1UEB A;  3TS0 A;  1VQM A;  4GN5 A;  4JI6 Q;  1L2F A;  3OTO Q;  3S15 H;  1HR0 Q;  1HZB A;  5IYC H;  3CMA A;  4JI4 Q;  3CP0 A;  2PMZ E;  3J81 j;  4LFA L;  1D8L A;  1N33 L;  1S72 A;  2JEB I;  3BZK A;  5AJ3 Q;  4R4T A;  3H3V I;  2NN6 G;  4POG A;  4K0K Q;  1OXV A;  4LF7 L;  1VQF A;  4OX9 L;  1XMQ L;  2F52 A;  1VQB A;  5GAE C;  4A3E G;  1N34 L;  1LUZ A;  4B3T L;  4DV5 Q;  1C7Y A;  4LF6 L;  1SN8 A;  3E9I A;  5M3F G;  4A3C G;  1YVC A;  3M4O H;  1PH3 A;  1OXS C;  3H0G G;  5IWA Q;  3SHG A;  5EAY A;  4R4O A;  3GD7 A;  1QZH A;  1KC8 C;  1M90 C;  4P74 A;  3PUV A;  1MJE A;  4LF9 L;  4OWT B;  3S14 H;  4UP7 A;  1EQQ A;  2B63 G;  1W2B A;  4YHH Q;  1Q86 C;  2R7Z H;  1K83 H;  4BBR H;  5IP7 G;  2OWO A;  3KFU A;  2KHI A;  4A76 A;  3CF5 A;  4WJ4 A;  3GTL H;  3PCO B;  2RF4 A;  4DV1 Q;  3FKI H;  4U04 A;  1XPU A;  5FLX c;  3PF4 A;  1H95 A;  2LXK A;  1CKN A;  4R4Q A;  4A3M H;  5LMU L;  2D0O A;  3HKZ E;  4X2E A;  1NMF A;  1SE8 A;  4XTC S;  5C4J H;  4DR4 L;  4LFB L;  2NVQ H;  2E2I H;  1GVP A;  1PH6 A;  3AQQ A;  1SR3 A;  5C3E H;  2QGQ A;  4LF4 Q;  3W1B A;  2UXD Q;  1BBW A;  4IPG A;  5GAD C;  1KXL A;  2Y0S G;  1VQE A;  1N36 Q;  1K73 C;  5ELO A;  1GO3 E;  2YTX A;  4DUZ L;  1YI2 A;  1TWF H;  5JEA J;  4X62 Q;  4JI8 L;  4NXM L;  4LFC L;  3KJP A;  2ES2 A;  2ALY B;  3PUX A;  4XIG S;  4JI5 L;  3U50 C;  1KD1 C;  1BVS A;  1IBM Q;  3HOV H;  2RCN A;  1CKO A;  1IXR A;  3K80 C;  1ASY A;  1Q1B A;  1VS0 A;  2JA7 G;  4DNI A;  1IL2 A;  5JFF A;  4QL5 A;  4PZ7 A;  1Q1E A;  2ZJR A;  2UU9 Q;  2AWO A;  4LUV A;  3ULJ A;  1NTG A;  4DV0 L;  4P75 A;  2R92 G;  1VQC A;  3B6Y A;  4B3S L;  1UE6 A;  3CW2 C;  3E0E A;  3AYH B;  1XNR L;  3GTP H;  2R93 H;  3CC2 A;  3ULL A;  1VQL A;  1HNW L;  2KCM A;  4L5T A;  2JA8 H;  2XGT A;  4JI1 L;  2YU9 H;  4YCU A;  1Y1V G;  1QVG A;  4U0U A;  1VQN A;  1W3S A;  4ME3 A;  1AE2 A;  3CME A;  3CCU A;  1VCI A;  3S2D H;  4DK6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...