2VY3A

Type iv secretion system effector protein bepa
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
291
structure length
291
Chain Sequence
EIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCSHDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMPEMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHPFREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDISNPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYIIGNIDHLPPEQLKILKPGDKITFTAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fic Domain Catalyzed Adenylylation: Insight Provided by the Structural Analysis of the Type Iv Secretion System Effector Bepa.
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Cell adhesion
molecule keywords CELL FILAMENTATION PROTEIN
total genus 86
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 2vy3A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vy3A02
4BXXH 1WI5A 2B63H 3I4NG 1VQ9A 4LFBQ 3E9HA 3J81i 3D0FA 1I50H 4HIOA 1N33L 1YHQA 2GVAA 3CP0A 4LF8L 4A3FH 1A8VA 3RZDH 2BH8A 4LF9L 4RG1A 5IP9H 4ALPA 1PH2A 4JI5Q 3M4PA 4DR5Q 2A8VA 1KQSA 1UE6A 1KRSA 5JJIA 4YWMA 2AHOB 2JA5G 2BH2A 4DUZL 1VQKA 4AQYQ 2E8GA 3AYHB 3STBC 3GTMH 3H0GH 2IY5B 4A4IA 3HOXH 1EUJA 4B3TQ 3M7NA 4YCUA 1K8GA 1XNQQ 2MO0A 1VQEA 1HZBA 1UWVA 4LF7L 4LUVA 4JI4L 1PHJA 1Y1WH 1AE3A 4P72A 3CAMA 2ZJQA 4NXMQ 1I6HH 3SE5A 4B3RQ 4A3BH 3L2PA 1Q7YC 1PV4A 4A3LG 2VQFL 1IBLL 1XPUA 2UXBQ 4HIMA 5JFZA 1I5FA 4B3ML 1SN8A 1WFQA 3PIOA 2I5LX 2IHFA 3EN2A 2IX1A 2Q2UA 1A63A 4B3MQ 3B6YA 1YITA 1JE5A 4MNOA 5C3EG 3CMAA 1UE7A 2VY3A 4DR1L 1S40A 3UE1A 4JI0L 1G6PA 4HJ7A 1N33Q 1JJ2A 4GN3B 2A1AA 3U4ZA 3G4SA 3ZCBA 4O0AA 2RHSB 3BU2A 4YHHQ 4IO9A 1VQ5A 3ICEA 1C7YA 4JBMA 4GNXC 5FJ8H 2VQEL 4B3SQ 1P8LA 2E2HH 1XMQL 2H5XA 4N67A 4YCWA 4POFA 3PIPA 4DUZQ 3HOUG 1VQHA 1X3EA 1Q1EA 2JJQA 5LMUQ 4X64Q 4GKJQ 1NE3A 3RLOA 5FLMH 1YJ9A 4LWCA 1GVPA 5CMTA 4DR3L 5IY0A 5H1SE 1VQCA 1FJGQ 2ID0A 4PZ7A 1YI2A 1YNXA 4IPGA 2MO1A 1N34L 3I7FA 3MXNB 3I56A 4IFDG 4DV1L 2YV5A 4PY3A 2EXDA 2KHJA 2R7FA 1FJGL 4DV0Q 1J6QA 1PYSB 1CKNB 1YHAA 4AYBE 4GOPA 4X2DA 2UXBL 2AMCB 5IWAL 2QEXA 4GOPB 2R92G 3RZOH 4NB3A 1HR0Q 1VQOA 1IBML 5C4XG 1EOVA 2JA5H 1HH2P 4X2CA 3AFPA 1XPRA 1SRUA 4LF6Q 1Z47A 1L1OA 2CKZB 2YYZA 3H0GG 3D31A 1QVCA 4DUYL 1N36Q 1HR0W 1L1OC 4ITRA 4DV3Q 5M3MG 2JA6G 2K5NA 4LUOA 4OWXB 4YHHL 1X9NA 4A3GG 4J15A 4OWTB 4A3JH 1PH3A 4B3TL 1WJJA 2AWOA 2JA7G 4DV4Q 4X6AH 1PVOA 3SHGA 4IPHA 2VZAA 3NELA 3G6EA 5C0XI 1PFSA 1TWAH 3DM3A 2UU9Q 4X66L 1VQJA 2NN6G 1S72A 2VUMG 5CKLA 1XNRL 2CCZA 1WOCA 2KCMA 3M3YH 2IX0A 1PH7A 4PMWA 4BY7G 5IYDH 3F2BA 2JEBI 1OTCA 3TQYA 1CSPA 4GLAC 3JAMc 2CQOA 3S24A 4HJ5A 5FJ8G 4YCVA 1NMGA 2KENA 3FKIG 1G51A 1JJGA 3A0JA 2CWAA 2VQEQ 4AQYL 4JV5L 3KF6B 4A3EH 2WAQG 3S1MH 3S6AA 4LF9Q 4XTCS 5E7NA 1B70B 4DV5Q 4LUZA 1VQDA 5FLMG 2F6SA 1N9WA 2PI2E 3GTLH 2MFIA 2OQ0A 1YEZA 1K0RA 1PH4A 3KDFA 3HOXG 4DR3Q 4KLKA 2E2IH 3HKZG 4L5RC 4YWLA 1IBKL 1M90C 1WCMG 2Z6KA 4DV7Q 3AEVA 2LSSA 4X2EA 4QGUA 4LFAQ 2UUBL 3M4QA 1NTGA 4JI8Q 4LF5Q 4TVAB 3CC2A 4AIMA 2VQFQ 1L2FA 1OXUA 3S1RH 1IBLQ 1GKHA 4XI8A 5HY6A 4JI4Q 1T9HA 1EYGA 3KJPA 5M3FH 2JA9A 4DV6L 3KF6A 1VQ7A 4K0KL 4AYBG 4WGJA 3AQQA 2JA8H 3CC4A 3UDXA 2XGTA 1NBWA 2C35B 3BZCA 4NPSA 1X56A 2LXJA 4IPCA 5IP7H 3CCUA 4DV6Q 1HR0L 4JC0A 4A3DG 1X3GA 5C4JH 3LETA 1XPOA 3HOYH 3BJUA 5ELOA 3N3UA 2E2JH 1EIFA 4DR7Q 4X62Q 3OW2A 4A3GH 2Y0SE 2NVXH 2F3IA 4A93H 4L5QA 1UEBA 4HJ8A 3NENA 4BBSG 1VQLA 2R7ZH 2Y0SG 4YY3Q 2WFWA 3F2CA 2MNAA 1KC8C 4JG2A 2D0OA 3STBD 1EQQA 4JBJA 1PH8A 4KHPQ 1AH9A 5EU0A 4L5SA 2UXDQ 3CPFA 4HJ9A 4X64L 2K14A 3CW2C 5BR8L 4OWWB 1E7ZA 3TRZA 1X54A 4MZ9A 4HIKA 4A75A 1XMQQ 3RN5A 1Q81C 1IL2A 3PO2G 4IPDA 2HHHL 4JI1L 2JK8A 2ZTEA 3FHWA 1L1OB 3A5UA 4GS3A 4JI8L 3PGZA 3CCRA 4BA2I 2KCTA 4JI1Q 3KJOA 1E3PA 3CPWA 3ZLMA 1YIJA 1HNXL 3HOWH 1Q86C 4QQBX 3H3VH 5JEAG 3G71A 3T1YL 3E9IA 3UDGA 1VQPA 3S1NH 4DK3C 4DNIA 4GOPC 3I4NH 1K73C 2BA0A 2EIFA 1XMOQ 4A3IH 1SE8A 2I5MX 3KLWA 1UE5A 4DR5L 4BBRH 1X3FA 4U07A 3HOZG 5JJKA 3J7A5 3J80c 3HOVG 2I5HA 3RLNA 1X6OA 4R4OA 5IP9G 1SLJA 5M3MH 2ZM6Q 4DV4L 3K7UC 4FDBA 2RF4A 4DV3L 1Y1VH 5M5WH 1B7YB 3KYHC 1N8RC 4PG3A 4IFDJ 4U0ZA 1MKHA 1RIPA 2B3GA 5JFFA 2Q2HA 1BBWA 1TWCH 2K5VA 1WYDA 3OYYA 1HZAA 2NVQH 4A3BG 4K0KQ 3H15A 4IOAA 2ATWA 4A3DH 3F2DA 4DV2L 3CD6A 1U5KA 3EBEA 5GROA 5IT9c 4A3LH 4DV1Q 2L15A 1PH9A 3GTGH 3PV0A 4UP8A 5GADC 5C44H 3W1BA 4DR1Q 4A3MH 2QGQA 2HIVA 1RL2A 3SGIA 1QZHA 2K50A 3BZKA 4GKKL 5IYCH 3G48A 3K7AH 3WWVA 2YTYA 2HT1A 5C3EH 4POGA 4DV5L 4BXXG 2JE6I 1LYLA 2R93G 3DLLA 3UDFA 2F4VL 1HZCA 2K52A 3CQZH 1IXRA 5LMNL 1FGUA 4A3CG 2F52A 3A74A 5AJ3Q 2OTLA 2F4VQ 2AWNA 3CCMA 4IOCA 1M1KC 4P75A 3HOWG 1JB7A 4BY1H 2UXCQ 1IBKQ 1W2BA 1Y1VG 4DV7L 4DV0L 4WJ3M 2D0PA 2N78A 1VS0A 3FP9A 1HJPA 5IYBH 1CKMA 3J7ZC 3SN9A 3HOZH 3PUXA 4X62L 1BKBA 3F1ZA 5IE8A 1QZGA 3I4MH 4LFBL 3TEHB 3EIVA 1K8AC 4U04A 5J3BA 4DAYB 2R92H 1NMFA 4PZ6A 4DUYQ 4OX9L 3OTOQ 2HIXA 3LGJA 2VW9A 2I0QA 3S16H 4AH6A 5GQOA 4DR4L 4A93G 1X55A 5CGLA 3PUWA 2ZM6L 3GTPH 4OX9Q 4OONA 4APVA 1PH1A 4LF4L 2R7ZG 1O7IA 3GTQH 2JQOA 2LXKA 4LW1A 3NBHB 5LMNW 3TS2A 1VQNA 1C9OA 2KHIA 2UXDL 1VQ6A 2UU9L 1NJIC 4X66Q 5M5YH 5JJLA 4DV2Q 2E5LL 1KHIA 4WJ4A 2UXCL 1ASZA 1Y14B 2WP8J 1LM0A 3RN2A 3T1YQ 1SMXA 2NVTH 4NXNL 4Y7NH 4DR6Q 4R4CA 3PUZA 2K75A 2OQKA 2NVYH 1YBYA 3MEFA 4KI0A 2RCNA 1HNXQ 1CKNA 1HZ9A 1PH5A 1YZ6A 2D62A 3M85A 2B63G 1NY4A 4JI6Q 1KAWA 4JOIC 1VQBA 4BBRG 4A3CH 1LUZA 1IBMQ 2CFMA 2YTXA 3RNUA 1K9MC 4JI7Q 3Q8DA 1DGSA 2N49A 4C3HH 4QY7A 4OO1I 2ZJRA 4JI3L 4A3EG 4MTNA 1JJCB 1E24A 2Q2IA 1I3QH 2CWPA 1TWFH 4IJLA 4OO1G 2OTJA 1W3SA 3ZC7A 3F8TA 1E1TA 3I55A 4GLXA 3U58A 2XTIA 1TXYA 3PUVA 1PH6A 3CCQA 3PUYA 5LMUL 1E22A 1KIXA 1WCMH 4H02A 4C2MH 3GTJH 2MQHA 2KBNA 4PZ8A 4R4TA 1XNQL 3I2ZA 1QVGA 3CCEA 1FL0A 1N32Q 4R1JA 5C4XH 1SFOH 2DUDA 1XNRQ 4GN5A 3RR5A 5C0XJ 3VDYA 3U4VA 4LU4A 2UUAQ 1Q12A 5IWAQ 3HOYG 1KRTA 4JOIA 1R9TH 1I94Q 4YY3L 1SROA 3ERSX 1XMOL 4GKKQ 2PNHA 3HFZB 4KHPL 4ME3A 2OCEA 5ELNA 4A3JG 5IYDG 2JEAI 1U0LA 4JBKA 4QIWE 4JV5Q 1JT8A 4DR2Q 1V9PA 1IYJB 2PQAB 5EAYA 4JI3Q 3CCJA 3CF5A 1OXSC 1J5EQ 2N8NA 2PQAA 1Q46A 2BA1A 3KDFB 2HHHQ 4BA1I 3S14H 2GN5A 3GO5A 3GDEA 3PSIA 1KXLA 4BY1G 4B3SL 1S3OA 4EX5A 2VUMH 4NXNQ 2NZHA 4LF7Q 5K36G 1VQIA 2ZTCA 3K80C 1D8LA 1MJCA 1G291 4LF5L 2NN6I 2YU9H 2R7DA 1GO3E 1QVFA 1H95A 1ASYA 1PYBA 4DKAC 3CC7A 2UUCL 4LFCQ 1HNWL 5C0XG 4C3JH 1JMCA 3I4MG 3K81C 3L0OA 1SR3A 2HQLA 3I4OA 4LFCL 4O2DA 1N34Q 1HNWQ 4RMFA 3CXCA 1QUQA 4JI7L 4LF8Q 4EQ5A 2UUAL 3W1GA 5GAHC 1A62A 2ASBA 4GN4B 2JA8G 4DR7L 1V43A 4P74A 1X65A 3T1HQ 3PO3G 1BVSA 1LTLA 4U0SA 2JA6H 3K8AA 3ER0A 3S2DH 1OXVA 2ZTDA 4JYAQ 1VQFA 2WB1E 3K0XA 4GNXB 2G03A 5LMNQ 1VQAA 4GLVB 5AJ3L 1E1OA 4GNXA 4JYAL 4U0UA 3RLFA 5BR8Q 1K83H 1PA6A 2DGYA 4DR6L 5JJ7A 2Z6KC 2UUBQ 1EQRA 4LFAL 1VQGA 1XTDA 4JBWA 1YJWA 2E5LQ 2ES2A 5IP7G 4A76A 1Y1WG 3UDIA 2EQSA 2AKWB 5FLXc 4P73A 3TREA 3ULLA 3M9BA 1OXTA 4A3KH 5GAEC 1Q1BA 4JCVE 3UE0A 2IHEA 3GTOH 4BBSH 1B8AA 4BY7H 4UY8C 4QJFA 3TS0A 4B3RL 5IYCG 3AFQA 5DLQE 1HNZL 4C3IH 3OTOL 3PO3H 4LF6L 4DR4Q 1CSQA 2WAQE 3FKIH 3ULJA 1N36L 3W5OA 2R93H 3T1HL 1VQ8A 1KL9A 4A3IG 1EWIA 3JC66 3NEMA 4JI0Q 1XJVA 2VS1A 2VL6A 3CCSA 3GTKH 2A19A 4A3FG 2PI2A 3PO2H 3PCOB 2FXQA 3HOVH 4X65Q 2Q2TA 4JI2L 4IJHA 3S1QH 4OXPA 4TQUS 2K4KA 3HOUH 3KOJA 4DPGA 3J81j 4JI2Q 4X65L 2GVBA 1VCIA 1BBUA 1GD7A 1K3RA 3KFUA 3S15H 4DAMA 2ALYB 2NZOA 1MJEA 5JJ6A 2WB1G 3GD7A 4IFDI 4Y52H 5IYBG 5GAGC 5M3FG 4R4IA 4GKJL 3H3VI 1A0IA 4HJAA 3CUCA 4P71A 3U50C 1FVIA 1I94L 3PF4A 3HKZE 5JEAJ 1QUQB 4HIDA 1AE2A 4UP7A 2N3SA 2QA4A 1N32L 3L7ZC 4QL5A 3IRBA 4XIGS 2RHQB 3CMEA 4LF4Q 4JI6L 1UE1A 1CUKA 1Q8KA 1OXXK 4DR2L 5M5XH 5C44G 3PF5A 1HNZQ 3HKSA 3S2HH 1TWHH 2K5HA 1J5EL 1P16A 4JI5L 3J80i 3ULPA 1Z9FA 2VNUD 1C0AA 4KHZA 2YTVA 1KD1C 4DK6C 1IZ6A 1CKOA 1GM5A 1Q82C 1VQ4A 1YHBA 4L5TA 4UP9A 4YWKA 1YVCA 4R4QA 3JAMi 1EIYB 3CCVA 3CCLA 2V1CC 1TWGH 2PMZE 2JA7H 2R6GA 4UPAA 2ZJPA 2OWOA 1EFWA 4A3KG 3J81c 2B29A 3ZJYC 2UUCQ 5HGQA 3KF8B 1D7QA 3E0EA 4NXML 4M16A 3M4OH 1L0WA 4A3MG 1YJNA 3S17H 3A5ZB 1MIUA 4LNQA 2Z0SA 1V1QA 2IT1A 1VQMA
chains in the Genus database with same CATH superfamily
4BXXH 4XYOA 4LFBQ 1M4VA 4GZYC 1N33L 1YHQA 2R7ZB 2CH4W 4A3FH 1RDPD 5IP9H 4DR5Q 1UE6A 1KRSA 1E0BA 1W6JA 2AHOB 2KECA 2BH2A 3T13A 3SDZA 4IUPA 1EUJA 3E3XA 2NYZD 4EQPA 3M7NA 2IPKD 4LF7L 3M7GA 1X3PA 5CBEE 5FKAC 3L2PA 2AQ2B 1Q7YC 1PV4A 4A3LG 1XPUA 2UXBQ 1LACA 3T56B 4HIMA 3PO3B 2I5LX 1YITA 4FP5D 4MNOA 5C3EG 4DR1L 1UE7A 1S40A 4JI0L 1PZJD 1SNOA 1JJ2A 3A8JE 2F0PA 3KBGA 3G4SA 4O0AA 4YHHQ 3BU2A 3HOVB 4IO9A 4JBMA 4GNXC 2L11A 4PQXA 4RH6A 3HOXB 2ENBA 4LWCA 2QKIC 4FXDA 5CMTA 4J6HA 5H1SE 1YI2A 1YNXA 4WRDA 2MO1A 4RFBA 2N88A 3I7FA 2EYFA 4DV1L 4OIJA 1J6QA 2EXZA 3NK9A 2AMCB 3I91A 2L0CA 5C4XG 4OO1H 4X2CA 4LF6Q 1DM0B 1L1OA 1QVCA 3H3VC 1V1OA 2K5NA 1TY0A 1PTOF 2A6HC 5C3WA 4X6AH 1PVOA 2J4XA 1SMYC 2Q8TA 3NELA 5C0XI 4K14A 3J7AF 3DM3A 3J7AV 5I9OA 3NTHA 1S72A 1EQVA 2R61A 4C3JB 3M3YH 1TIID 3T4AC 4TKOB 4G57A 1PH7A 4BY7G 3F2BA 2JEBI 1OTCA 3TQYA 1CSPA 1SAPA 3JAMc 1ICFB 5JEAH 3D6CA 3FKIG 1PTOB 4FO2A 4ZUIA 3EA6A 4JV5L 1KNEA 2WAQG 3S1MH 1IHZA 5E7NA 1B70B 1GUNA 3I8ZA 4LUZA 1UNSA 3GTLH 2PI2E 5CMDA 2EE1A 3I72A 1SE3A 4KLKA 2M2LA 4ZUJA 4DV7Q 2WACA 2HCIA 4C1NK 1NTGA 1CT1D 4TVAB 4XI8A 3SXHA 4KJNA 2O2LD 3KF6A 4K2LA 4AYBG 3AQQA 3CC4A 5FOBB 2XGTA 2C35B 3BZCA 1HR0L 4A3DG 2EYJA 3PIP3 3BJUA 1LTBD 3N3UA 1WD1A 5HGTA 4A3GH 2F0TA 5C44B 5ELBA 2XVSA 2Y0SG 5IOCA 3H0GB 2D0OA 3LWUA 4ZAIA 1AH9A 1F9PA 5D3IB 3R93A 4L5SA 1QILA 1B9MA 2MPMA 5BR8L 3S15B 1DZ1A 1TWAB 5M5YB 2KJXA 4RGNA 1XMQQ 1Q81C 1SYDA 1IL2A 3VA7A 1UUPA 3FHWA 1L1OB 4GS3A 4CBVA 2TSSA 3NBHA 4IFDH 3DEPA 3S17B 1Q86C 5JEAG 2XWBB 4BBRB 2B2TA 2K04A 3S1NH 4DNIA 1JOOA 1BOSA 1XMOQ 4KJOA 4DR5L 4BBRH 4U07A 4F7XA 3RLNA 4R4OA 3S16B 1SLJA 5M3MH 3K5MA 4IALA 4KTAA 2ZM6Q 3RUZA 4C3HB 1LT3D 2RF4A 3A7AB 2E75C 3LX0A 5M5WH 3KYHC 3RMHA 5BN4A 4U0ZA 2B3GA 3FPPA 2Q2HA 1BBWA 1SEBD 2K5VA 4DA2A 1EZ6A 3KF8A 3H15A 4IOAA 2ATWA 3AU7A 4DV2L 1JORA 3CD6A 4A3DB 5FO9B 1PH9A 3PV0A 2JN4A 5C44H 4DR1Q 2NZ1D 4A3MH 3BZKA 4GKKL 1HXYD 4HCSA 3I3CA 2IW3A 3WWVA 1U9RA 1PFMA 4DXGA 3S1NB 1K0SA 2R93G 5DM73 2F4VL 3CQZH 1YNJC 3VR5A 2ICIA 1FGUA 3A74A 3HRZC 3DWQA 4IOCA 1M1KC 1EIGA 5E4WC 5J22A 3MFGA 1GXDC 1W2BA 1B3AA 1K83B 1E2WA 1CKMA 3SN9A 2FJ2A 3I90A 1BKBA 5IE8A 4LFBL 3CRLC 4LAAA 3OTOQ 2VW9A 3LGJA 4A93G 4AH6A 5GQOA 2EJMA 1SNQA 1T5EA 1X55A 2ZM6L 1S5FD 3GTPH 2R7ZG 1HRJA 1TKWB 1R4PB 3GTQH 5LMNW 1DYQA 1VQNA 1VQ6A 1KDCA 1NAPA 2UU9L 2B2WC 2DJGC 1O7LA 3GTGB 1ASZA 2WP8J 3UI2A 4A3KB 3DWAA 2VUMB 1SJHD 1AZPA 4R4CA 4DR6Q 3PUZA 3IFDA 3N52A 4M8AA 4KI0A 1XXGA 2DNEA 3M85A 2L4NA 2PZWA 3MHBA 3Q0AA 4N9TA 2HD3A 2LFNA 4A3CH 1LUZA 2CFMA 3RNUA 2KEEA 5F2DA 4OO1I 3EROA 3G6JB 2BDOA 5EPKA 4MTNA 4IJLA 3BZDB 4OO1G 1B2TA 4GLXA 1E1TA 1H9KA 3I55A 3U58A 1TXYA 1G8ZD 3PUVA 1NR2A 3FRPB 3GQBA 1HQRD 4C2MH 1VDZA 3A8KE 1JB3A 4V190 2RBMA 3URYA 5JJZA 1Y1VB 4DGZA 1XNQL 4OEMB 1Q90A 4GN5A 1STHA 3RR5A 5C0XJ 3BS1A 2NUCA 4DK1A 2EY1A 3TMEA 5IT9L 1SROA 4EVOA 2PNHA 4ME3A 5JOBA 2MHVA 4JBKA 4Z9CB 4JV5Q 1JT8A 1IYJB 3IKJA 2QEJC 3S14B 1K8MA 1CZWA 1OXSC 2N8NA 4CDFC 1HA6A 2BA1A 3KDFB 3S14H 3HKZB 4IQZA 4N9PA 1LTGD 1PFNA 4BY1G 4ZQ3A 1BCPD 1D8LA 1Y8NB 1M8AA 4X3TA 1GO3E 1BCPC 2WKDA 4DF7A 1H95A 2RQXA 1PRTD 3NQTA 3VYUA 3SR1A 2B63B 1LTAD 1SR3A 4LK1C 1KDAA 1QE6A 4JI7L 1QUQA 2UUAL 2JA8G 4DR7L 1CFMA 3T1HQ 3K8AA 1FR3A 4RGMA 4GLVB 5FO7B 5AJ3L 4ZYSA 3MAQA 4GNXA 4RCNA 4JYAL 3RLFA 2B39A 5BR8Q 1WTPA 3GTLB 3K57A 2Z6KC 1XTDA 1YJWA 1AW7A 1EY5A 2PW7A 5BN3A 2BOSA 3M9BA 5GAEC 1VMPA 3UE0A 3C3LA 4BBSH 4BY7H 1SNDA 1GUWA 2PNRC 4IUTA 3FKIH 4CDDC 3W5OA 5C4HA 4HN7A 4JI0Q 4K8JA 1HTLD 1JCKB 4R8NA 2PI2A 3PO2H 3PCOB 2Q2TA 4JI2L 1G2SA 5CR3A 2Z8LA 4X65L 1VCIA 1BBUA 1K3RA 3KFUA 2DNCA 1MJEA 5JJ6A 2WB1G 5I9PA 4Y52H 5IYBG 4ULLA 3QWNA 1GOZA 1A0IA 3CUCA 3U50C 1NUCA 3DMUA 3ND9A 3HKZE 4HIDA 2RKSA 3CMEA 4JI6L 1ESRA 1Q8KA 1I3QB 2FHTA 3DEOA 4RGOS 5M5XH 1D5MC 1ENAA 5C44G 1ICWA 1TWHH 2QF7A 1HNZQ 2NTTA 3BDLA 5EGTA 2H1EA 5IGGA 1IKMA 1C48A 1FNUA 4UAIA 4FF3A 1IZ6A 1EIYB 4L5TA 4UP9A 5G3LF 4YWKA 4U673 4BY1B 4A3BH 3CCLA 1NR4A 5IGDA 1CQFA 4LJZC 4WJWA 4XT3B 2I07B 4FF2A 2JA7H 1BQQT 5M5WB 3ZJYC 3IFTA 5HGQA 4UHVA 3E0EA 4NXML 1U4RA 1L0WA 3AB9A 4X3KA 1MIUA 2Z0SA 3D0FA 2A6EC 1VQMA 4XT1B 1X3QA 2B8FA 2B63H 5NUCA 3WOEA 1I6VC 3CP0A 4LF8L 1AP0A 2A8VA 3S2HB 1KQSA 5JJIA 3OOCA 3L3OC 2RCFA 4DUZL 3I73A 3JAME 3STBC 3GTMH 3H0GH 2IY5B 2KHSA 5AFWA 3HOXH 1K8GA 2MO0A 1CK1A 3K59A 1UWVA 1PHJA 4P72A 5DAUA 2IWHA 4XQQA 2ZJQA 2F4IA 3PMFA 4B3RQ 1GHKA 3M4OB 2SDFA 1LTRD 2VQFL 4QF4A 1IBLL 2X6LA 1SN8A 2IHFA 2KA7A 4ABNA 1A63A 3VA5A 2VY3A 2HDLA 1G6PA 4I65A 1MI2A 1T5XD 3U4ZA 2O5JC 2RHSB 1VQ5A 3EVQA 1EYCA 4B3SQ 1ESFA 1JWSD 1P8LA 2CW0D 2A73B 1XMQL 1C8CA 3I70A 2H5XA 5BN5A 5EBDA 1VQHA 4M1UB 2EDGA 1TY2A 4ME5A 5EKLA 3RLOA 5FLMH 1YJ9A 3MXGA 4DR3L 5KYLA 1FJGQ 5CYUA 1HHVA 2ID0A 2WINB 1S5ED 1WTRA 3I56A 1TS3A 4IFDG 2R7FA 2L55A 2EXDA 2KHJA 2LMCB 4DV0Q 2F0WA 2A68D 4GOPA 2UXBL 3KUPA 2QEXA 5T1GA 1K3BC 4RWSC 4NB3A 1HR0Q 3RZOH 1VQOA 1EOVA 2JA5H 2CH4A 1VF5C 1Z47A 4XXEA 3BVMA 1N36Q 3NTIA 4ITRA 2DY8A 1SYFA 4JVZA 4QUFA 1WJJA 2AWOA 2F0MA 1DOMA 1FYCA 2B2YC 4KD3A 3SHGA 1LTSD 1PFSA 2YU9B 4X66L 3E5SA 3MVVA 2VUMG 5JVH3 1STGA 1NH1A 3A56A 4KY7A 4HCEA 4GLAC 5C0XH 4KHVA 1JJGA 3VR4A 2M00A 3A0JA 4HSVA 2A68C 4LF9Q 1E2VA 2G9DA 4FYDA 2MFIA 1EFID 2OQ0A 1YEZA 5T1IA 1PH4A 5A35A 4DR3Q 1LV9A 3HKZG 5KEEA 4YWLA 1BBXC 2Z1CA 1EY0A 3AEVA 4X2EA 4I7ZC 4QGUA 1DONA 2FFKB 4LF5Q 2PCFB 4AIMA 2VQFQ 3S1RH 1D5XC 1IBLQ 1GKHA 5HY6A 4JI4Q 1T9HA 3Q24A 5M3FH 4DV6L 2JA9A 2PYKA 3J80E 2F0UA 4KK7A 1NBWA 3CCUA 4NPSA 2LXJA 5C4JH 3HOYH 1XPOA 3F2UA 5ELOA 1EIFA 1SJED 4MTKA 4DR7Q 1UAPA 2Y0SE 2NVXH 2F3IA 4BBSG 2DN8A 1UEBA 4HJ8A 4OIKA 1VQLA 5I2XA 2F03A 2MNAA 4JG2A 4PMBA 3STBD 1QG7A 2UXDQ 3CPFA 5EQ0A 4HJ9A 1MSGA 4MZ9A 5I6WA 1YNNC 2K6AA 5I6YA 4RHSA 2MJ8A 4JI1L 3P7JA 3C1EA 1Y8OB 4BA2I 2XRSD 2KCTA 2A74C 4QUCA 1AEXA 5FLXL 1SXTA 4IURA 3UDGA 4GOPC 3I4NH 4KKSA 2K5DA 2BA0A 3IAYA 2BCOA 1EU4A 3HOZG 1ET6A 2L12A 4K2KA 3HOVG 1GHJA 4BS9A 2X6GA 3CU7A 4U68A 2A5HA 1NNXA 4DV3L 2FMMA 4TSSA 4IFDJ 1RIPA 1HCZA 1TWCH 2NTSA 1WTQA 1SBBB 2NVQH 1SE4A 2NN6H 2KOLA 4X3SA 3P1HA 3VR3A 4A3LH 2L15A 5GADC 4A93B 2PW5A 2QGQA 1RL2A 4DK0A 1QZHA 2K50A 4CJ1B 5IYCH 2DJFC 3QB3A 5C4XB 3X3MA 1U4PA 2YTYA 4G7ZC 1QJOA 5C3EH 2CVRA 2JE6I 1B9NA 3S1MB 2OTLA 2F4VQ 2AWNA 1JWUD 3HOWG 2UXCQ 1IBKQ 1Y1VG 4DV0L 2D0PA 2XIWA 1VS0A 5COYA 4AYBB 1HJPA 5IYBH 3P75A 4A3MB 1RTOA 3J7ZC 3HOZH 2SNMA 3H94A 2M9VA 3F1ZA 5CGKA 2RVLA 1PTOD 1QCBD 2R92H 3ITPA 4OX9L 2HIXA 1ENFA 2Z4HA 2K05A 4H7BA 3Q22A 2I0QA 3GTOB 4JPBW 1HPCA 5CGLA 1B3QA 3PUWA 3VR6A 1PH1A 2KUMA 3BVGA 4LW1A 2E2IB 3FKIB 4RA8A 1C9OA 2KHIA 3HOUB 4X3UA 1KHIA 4NDXA 1A3TA 1HA5A 1LM0A 3T1YQ 1TS4A 1SMXA 4NXNL 4MHEA 3BVZA 4JI6Q 4JOIC 2WAQB 1MD2D 4JI7Q 3Q8DA 3VYSA 1DGSA 2N49A 4JI3L 4A3EG 1JJCB 4NKLA 2Q2IA 4ZLTF 3D6WA 3DWPA 2JXMB 4FVMA 1KLUD 5C6AA 5A2QL 5EJWA 3V05A 1WCMH 4H02A 3KLSA 3GTJH 1A6XA 2MQHA 4PZ8A 3QOLA 3CCEA 1FL0A 1N32Q 4IN3A 1XNRQ 1S5CD 4LU4A 3J7YW 4ZCKA 1LTID 1R9TH 3ERSX 4KD4A 1ZKOA 3MXPA 3T53B 2D2CC 2F0EA 2OCEA 2DY7A 4K5XA 4QIWE 1V9PA 2PQAB 2A69D 3CCJA 5JVG3 2E2HB 1KNAA 1Q46A 5FLXE 3K58A 3MTSA 3GO5A 2AUKA 5CC4A 4EX5A 2AUJD 5JPMC 4NXNQ 3GV3A 4LF7Q 4V0BA 1VQIA 5K36G 2ZTCA 3WOFA 1MJCA 4LF5L 2PZTA 1S5DD 2F3WA 4DAPA 2R7DA 2YU9H 2E2DC 1ASYA 1GUOA 2E76C 4DKAC 4ZK9B 3CC7A 1F9RA 4LFCQ 1CHPD 1HNWL 4C3JH 5ELFA 3I4MG 3K81C 4QCLA 2HQLA 5DM63 3NPPA 3CXCA 3H91A 2MP1A 4K5VA 4KN4C 5L37A 5G3LD 5IIFA 1BVSA 1LTLA 4H44C 2WV6D 2JA6H 2C9OA 3DM1A 4L6TB 2VB3X 1IKLA 3DUZA 4U0UA 2Z9HA 1IW7C 3D3RA 5JJ7A 2UUBQ 1I4QA 4LFAL 5CORA 1Y1WG 1EIHA 3M3YB 4A3KH 2H4OA 1Q1BA 3ERQA 2KCNA 4UY8C 3CHBD 3M4YA 3TS0A 4B3RL 2F0VA 4C3IH 2G9HD 1QNUA 4LF6L 2O4XA 1CSQA 4NMZA 1N36L 1SYCA 2VS1A 1TVXA 4A3FG 1DOLA 2FXQA 3HOVH 2K4KA 2K01A 4CDCC 4DPGA 3J81j 4JI2Q 1SNMA 1D1IA 4FXKC 3BG3A 2NZOA 2F0QA 4RGTA 1NCVA 1VMCA 1SMYD 4R4IA 3H3VI 1EY9A 1XWEA 4HR7B 2N3SA 4QL5A 2RHQB 3OHXC 4N8FA 4UDUC 4MIUA 3S2HH 1J5EL 4JI5L 4R8IA 2VNUD 2YTVA 2Z6BA 5EKKA 5M3MB 1VQ4A 1YHBA 4R4QA 1G6ZA 3KLSX 1TQOA 2V1CC 5C5MA 1DJRD 2R6GA 3PQIA 1EFWA 4A3KG 2B29A 2UUCQ 3M4OH 1QWYA 3NTKA 3S17H 4LNQA 1V1QA 3PO3G 1Y1VH 2EY2A 2L5TA 1U4MA 1WI5A 3I4NG 1VQ9A 3E9HA 3J81i 3TZDA 3K0YA 4HIOA 1BF4A 1IW7D 1EEFD 2SEBD 2GVAA 4C3IB 5LHY1 3QR8A 4LF9L 4RG1A 2QDLA 1PH2A 3M4PA 1F2ZA 3U9OA 1PTOH 4YWMA 1STNA 3OMCA 4AQYQ 2E8GA 1EY8A 5IODA 1RJTA 2B2WA 2RDGA 2JP1A 1XNQQ 3R3OA 3TSSA 1G91A 4RCOA 3S1RB 4LUVA 3EFXD 4JI4L 3DHQA 1AE3A 1FNWA 4CDEC 4NXMQ 3NWTA 4H0LC 2HQEA 1I50B 1I5FA 1KABA 4B3ML 3PIOA 1O7ZA 1EYDA 5C5LA 3EN2A 2IX1A 2Q8IB 4FF4A 3CMAA 3GTQB 4HJ7A 1N33Q 1BCPF 4GN3B 4OL7A 3GTPB 1JE4A 3ZCBA 2JA5B 2OXPA 3QJYA 3VYRA 5FJ8H 3GTKB 4N67A 4IUQA 4DUZQ 3HOUG 4RKBA 4QIWB 1X3EA 1JC7A 5LMUQ 1X32A 5EKIA 1D6EC 1VF7A 2QCPX 3MWYW 5IY0A 1VQCA 3V2TA 1TS2A 3SK5A 3MXNB 2L9HA 4PY3A 1FJGL 3WDNA 1YHAA 4AYBE 1SFOB 1RF2D 3TZUA 2D5DA 5IWAL 4GOPB 2R92G 3NSWA 1HH2P 3AFPA 5ELEA 4WFN3 1RKNA 1XPRA 1SRUA 1WTVA 2MUYA 2CKZB 3J81E 2YYZA 5IGBA 3D31A 4DUYL 1HR0W 1ZXTA 5E4XA 4OWXB 5EPJA 4YHHL 4A3GG 1EL0A 4J15A 5K5PA 3S1QB 1YNJD 4CKBA 2JA7G 4DV4Q 3HEJA 3T16A 2CQAA 4C56C 4DNRB 1GJXA 2VZAA 4PNYA 5DEHA 1VQJA 2NN6G 3R2TA 4CGYB 3GV6A 1XNRL 2CCZA 1WOCA 2KCMA 4HMIA 2WB1B 4PMWA 1XX8A 1IYUA 1Z7TA 5FJ8G 3FEWX 1LLRD 3D8GA 1TS5A 1Q3LA 4AQYL 2A6ED 4A3EH 2K1BA 2SOBA 2F6SA 1R4QB 4WORA 4QB4A 3KDFA 3HOXG 4DAVA 1HQMC 1HTPA 1M90C 1IBKL 1WCMG 2Z6KA 3D4DA 1PTOC 4LFAQ 2UUBL 3M4QA 4JI8Q 5M3FB 4OGQC 1OXUA 4K0KL 1EYAA 2JA8H 3HG9A 3I4MB 3MC0B 4J1MA 5D65A 3H6MA 3K7AB 2B2TC 3K5NA 3FPUB 1F2LA 3QO2A 1F9SA 1DOKA 3OW2A 5IGEA 1MBYA 4YY3Q 3F2CA 1KC8C 5TSSA 4JBJA 5IGCA 4DNTB 5EU0A 4X64L 1PDQA 5IT9E 3SK6A 3MXUA 4R9WA 1X54A 4A75A 4ZKCB 1IL8A 2EOTA 4IPDA 1A3UA 1HUMA 2Q8RE 3A5UA 3PGZA 1B50A 3KJOA 3CPWA 1E3PA 4QQBX 3ZLMA 5FK9C 3SVMA 5J1ZA 3H3VH 3T1YL 2OT2A 1VQPA 1V1PB 1I4PA 4S3SA 1K73C 1JQYD 1SE8A 3KLWA 4K6DA 1X3FA 3J7A5 3J80c 2I5HA 1TWGB 4DV4L 1L0XB 3K7UC 4G4KA 3PIO3 4PG3A 3TBIB 1MKHA 4JW0A 5JFFA 3TP8A 2IX3A 1E2ZA 5CV8A 1HZAA 2PO4A 5KNBA 4K0KQ 4KKUA 1PRTB 4A3DH 3F2DA 2EYHA 3LWEA 4RKLA 1AZQA 2K28A 1BNZA 3EBEA 5GROA 5CV6A 2E2JB 5IT9c 4DV1Q 3GTGH 4XYQA 2WKCA 4F8MA 3W1BA 2A69C 2NVTB 3SGIA 1B1ZA 5A2QE 4L8JA 3G48A 3K7AH 1EWHA 3K6OA 4ZRZA 3C46A 3VYTA 3E0JA 4FXGC 4BXXG 1ENCA 1S5BD 3UDFA 4N8X1 2EPBA 3I4LA 4A3CG 2F52A 5AJ3Q 3J80L 3CCMA 3TN2A 4P75A 2XN9C 3BYTB 3C2PA 3FP9A 1F2YA 1J8IA 4JK1C 1QZGA 3I4MH 3EIVA 2JA8B 1H9JA 1NMFA 4PZ6A 4K6LA 5D3DA 4NW2A 1HFGA 4OX9Q 4APVA 1O7IA 2JQOA 2LXKA 3NBHB 1F9QA 4OHJA 3A55A 3S2DB 3GTJB 1XTCD 4X66Q 2J0TD 3NBIA 3QG1A 2UXCL 1Y14B 3TP7A 2EYLA 5JAVA 5KIXA 2NVYH 1EQTA 3MEFA 2RCNA 1PYWD 1HZ9A 1HNXQ 1PH5A 2D62A 2NUDA 4F88A 4B9WA 2EVBA 1VQBA 5C4JB 3HOYB 1O80A 1IBMQ 2R3ZA 1S4ZA 3KLRA 4C3HH 4QY7A 1JICA 2ZJRA 1AFPA 1E24A 3OPOA 1I3QH 2CWPA 4RAUC 2OTJA 1W3SA 3ZC7A 4FNFA 3F8TA 3K5LA 1QOHA 5EBCA 3CCQA 3PUYA 2B2VA 5LMUL 3BYYB 2CHBD 4O1NA 1KIXA 1KDBA 2SNSA 4HTHA 3Q6SA 2KBNA 1LTTD 4R4TA 1SNPA 3OIPA 1C4QA 2B2UC 3ND8A 1SNCA 4R1JA 1SFOH 1WTXA 3H09A 3HOYG 1Q12A 5IWAQ 1HUNA 1KRTA 1XMOL 2B8GA 1CTMA 1HFNA 1BUVT 3HFZB 4K5WA 4A3JG 2XNAC 2JEAI 4Q0FA 1PFBA 2J7ZA 4DR2Q 5EAYA 4JI3Q 3CF5A 1J5EQ 3GDEA 3PSIA 2EJGC 1J9OA 2NVQB 2EY5A 1S3OA 3KBXA 2VUMH 2F0JA 2F0FA 4K8IA 5KRUA 3L9AX 1DXMA 1QVFA 2UUCL 1WTOA 5C0XG 1N34Q 4RMFA 2G5DA 4LF8Q 1TT2A 4EQ5A 4P2CB 3CQZB 2P5ZX 3W1GA 4CJ2C 5M9OA 2ASBA 1IYVA 1KTKA 1K28A 1BCPB 4U0SA 3QIAA 1B44D 4TRDA 3S2DH 3ER0A 4JYAQ 3K0XA 4GNXB 5LMNQ 3P20A 1E1OA 5HURA 1U4LA 3R2IA 3HP3A 2O5IC 1RCVD 1K83H 3NHHA 1PA6A 1TWCB 2DGYA 4JBWA 2E5LQ 2ES2A 5IP7G 2EYPA 1CQVA 4A76A 2XRQD 2X69A 5FLXc 4P73A 1ILQA 1OXTA 1F2MA 4JCVE 1STYA 2IHEA 1BDOA 4KY5A 5IYCG 2NVXB 5DLQE 1HNZL 3C1FA 4DR4Q 1F77A 1A2UA 3T1HL 1LT6D 2ZT9C 1EY7A 3NEMA 1XJVA 2VL6A 3CCSA 2K5WA 1ZEQX 2JSOA 3S1QH 1ZYRC 4MN3A 4TQUS 3HOUH 3KOJA 1DCZA 2GVBA 4DAMA 1Y8PB 2ALYB 1H9SB 3GD7A 3U9SA 1Z6HA 4HJAA 1I94L 2QDBA 5EPLA 5JEAJ 1PZID 3EQLC 4UP7A 4IUVA 2QA4A 4DU9A 1STEA 1UE1A 1TWHB 1OXXK 4DR2L 1RD9D 2K5HA 3J80i 2BE5C 1Z9FA 3NQIA 4KHZA 2V4DA 1KD1C 1CKOA 1GM5A 1ONLA 1TWGH 2PMZE 2HDMA 2E74C 2OWOA 4BWGB 3J81L 3KF8B 3OWFA 4M16A 1EOTA 1OO9B 5ISRA 4KKTA 5LL6S 1D2BA 1K8OA 1GUTA 3OMGA 1O7YA 2KCCA 4ODGA 1I50H 1Q8IA 2N55A 4CKEA 4L63B 2ZXPA 1A8VA 1JR0D 3N6RA 3RZDH 2BH8A 1CA5A 2RDHA 4DFAA 4ALPA 4JI5Q 3VR2A 2IJ0A 1D5ZC 2JA5G 1VQKA 3AYHB 5KNCA 4A4IA 1WD0A 4B3TQ 4YCUA 1VQEA 1HZBA 1Y1WH 3NP8A 3HOWB 3CAMA 1ILPA 2F0IA 1I6HH 3SE5A 3CRKC 1MSHA 5JFZA 1WFQA 1V8QA 4RHRA 3FVQA 2Q2UA 4B3MQ 3B6YA 5CV5A 1JE5A 2F1MA 1CI3M 4KV6A 4KY6A 3UE1A 1LT4D 2A1AA 3ICEA 3MXNA 3Q23A 2RDFA 1C7YA 4HSPA 3T51B 2VQEL 3NXWA 1LO5D 2E2HH 4A3EB 2XSCA 1O78A 4YCWA 4POFA 3PIPA 5C4ZA 2JJQA 1Q1EA 4X64Q 4GKJQ 1NE3A 2K32A 5ELCA 1GVPA 4QMGA 1RHPA 1DD2A 4PZ7A 1PRTF 4IPGA 4IZ8A 2NVYB 1N34L 2F0KA 2YV5A 1CHQD 1RTNA 1PYSB 1CKNB 4X2DA 1IBML 3V96A 3BDOA 3DXJC 4A3JB 3H0GG 1ET9A 2Y0SB 1L1OC 2JA6G 4DV3Q 5M3MG 4OELB 5I4DA 4LUOA 5ELDA 1X9NA 4OWTB 1I4RA 4A3JH 1WTWA 1SDFA 1PH3A 4B3TL 2RSOA 2LY7A 3R8BA 5CV7A 1A3VA 1EU3A 4IPHA 3G6EA 4XQJA 1TWAH 2LS01 2UU9Q 1XYIA 2F0NA 4NP5A 4XQNA 5CKLA 1WVLA 4DN4M 2IX0A 1TU2B 5IYDH 5C3XA 1AN8A 2ZXRA 2CQOA 4C3IG 3S24A 4HJ5A 4YCVA 1NMGA 3NWSA 2KENA 1G51A 3KK7A 2CWAA 2VQEQ 4A3FB 5LL6X 3HZXA 3KF6B 3SE0A 1JOQA 3S6AA 4XTCS 4DV5Q 3RZDB 5FLMG 1VQDA 1N9WA 2QILA 1K0RA 2QW7A 2B2YA 4L5RC 2E2IH 1W6KA 3W3AA 2OF1A 3IL8A 4H13C 2LSSA 4G7HC 4C3JG 4J8QA 3CC2A 1L2FA 1PZKD 3HS0C 1I4GA 1EYGA 1L0YB 3FMCA 3KJPA 1CM9A 1VQ7A 4WGJA 2F3VA 3UDXA 5IP7H 1X56A 4DV6Q 4IPCA 3LNNA 4JC0A 2CW0C 1X3GA 3LETA 2E2JH 1LABA 3SK4A 4X62Q 4A93H 4L5QA 3NENA 2PZUA 2F0DA 2R7ZH 2F0LA 2WFWA 5CBAE 2LKVA 1EQQA 1PH8A 4KHPQ 4C1NI 2F0GA 2K14A 3CW2C 4OWWB 1GUGA 2NUNA 1E7ZA 1B53A 3TRZA 4HIKA 2I46A 5IGFA 3RN5A 2EY6A 1B4OA 5CV9A 3PO2G 2HHHL 4PMCA 2JK8A 2ZTEA 4Y7NB 2F0OA 4JI8L 3CCRA 2PPBC 1I6HB 4JI1Q 1I4HA 1YIJA 1HNXL 3HOWH 3SEBA 2KQ3A 3AMUA 3G71A 3RD4A 2PQEA 3E9IA 1R9TB 2B2UA 4ILWA 3OWEB 4DK3C 3JAML 2EIFA 4A3IH 2I5MX 4DAYA 1UE5A 4PV1C 2XWJB 3ZYYX 4CJ0B 1CA6A 2R93B 5JJKA 3G7LA 4BY7B 1TWFB 5J39A 4C3HG 1A15A 1X6OA 2MGSA 5IP9G 4FDBA 1H9MA 1EWCA 3TP6A 1B7YB 1N8RC 3EJIA 1WYDA 3OYYA 4A3BG 5I2YA 1H9RA 2L1BA 1U5KA 1SSOA 1EZ8A 4UP8A 2HIVA 5KNDA 4FF1A 4I7AA 1EY4A 2HT1A 2K5QA 4DV5L 4POGA 5D14A 1LYLA 2VXWA 1GUSA 3DLLA 1HZCA 2K52A 1EY6A 1IXRA 3FDTA 5LMNL 2JA7B 1JB7A 4BY1H 4A3BB 1QNKA 3SK8A 4O42A 4DV7L 4WJ3M 3CKIB 1JWMD 2N78A 3A7LA 1SYBA 2Z4IA 1RODA 2TMPA 3PUXA 4X62L 2R92B 1G2TA 4XDXA 3QOJA 3TEHB 1K8AC 4U04A 5J3BA 4DAYB 4DUYQ 3S16H 5M5XB 4DR4L 2KEDA 1YNND 1I4XA 4YIJA 4HEDA 4OONA 4LF4L 4EQOA 5FO8B 3TS2A 2GA4B 4ID6A 2UXDL 2JA6B 1NJIC 1BO0A 5M5YH 5JJLA 4DV2Q 1MHWC 2E5LL 3S9WA 4WJ4A 1PXUA 3RN2A 2NVTH 4Y7NH 2ICEC 2K75A 2OQKA 1II3A 3MEHA 3GP7A 1YBYA 1CKNA 3ONAB 3A8IE 4DXFA 1YZ6A 2WIIB 2B63G 1NY4A 1KAWA 4B08A 3NUCA 3A54A 4BBSB 4BBRG 5JPNC 2YTXA 1K9MC 5E1FA 4IUUA 4A3GB 3MZ5A 4CKCA 2JYOA 1TWFH 5KGUA 2XTIA 3MA2B 2NBFA 1PH6A 1PMRA 1E22A 5CV4A 5E3FA 2KVMA 2K03A 4B9XA 1KLGD 2PMZB 3I2ZA 1QVGA 2BE5D 5C4XH 2DUDA 3VDYA 3U4VA 3I4NB 4Q5VA 2UUAQ 1I94Q 4JOIA 4YY3L 1TR5A 4GKKQ 4KHPL 1UEAB 5ELNA 1ML0D 5IYDG 1U0LA 1PRTC 1KAAA 1SE2A 5KYIA 2AQ1B 2FMCA 2PQAA 5DNFA 1WCMB 2IL8A 2HHHQ 4BA1I 2GN5A 2HUGA 1Y69U 1KXLA 4B3SL 1BXTA 2NZHA 1FD7D 1ZYRD 3K80C 1G291 3D4RA 3HGBA 2NN6I 2AQ3B 1PYBA 4KMUC 1SYEA 1LT5D 1JMCA 3L0OA 3I4OA 2NB0A 4LFCL 4O2DA 3OSOA 1HNWQ 4EQNA 1CZGA 1A2TA 5GAHC 1A62A 4GN4B 1V43A 4P74A 1X65A 4HMJA 2EJFC 4KN7C 1OXVA 2ZTDA 1VQFA 2WB1E 2G03A 3TDQA 1D1KA 1VQAA 3GTMB 4F87A 1SYGA 4DR6L 3W2DA 1EQRA 1VQGA 1FNVA 1STBA 3UDIA 2EQSA 1PLFA 2AKWB 2F0SA 1QB5D 3O13A 3TREA 2RSNA 3ULLA 3MFYA 2K7VA 3GTOH 1B8AA 1V1PA 2HCCA 4QJFA 3AFQA 3TP5A 3OTOL 4CHTB 3PO3H 3E6ZX 2EZVA 2WAQE 3ULJA 2R93H 1VQ8A 1KL9A 4A3IG 1EWIA 2F0HA 3JC66 3GTKH 4HAEA 2A19A 5K36H 2RA4A 4C2MB 3BDCA 3SHLA 4X65Q 2EYMA 4IJHA 4OXPA 2D9UA 3PO2B 1H9SA 2EYOA 1GD7A 1STAA 3S15H 4IFDI 5GAGC 5M3FG 4GKJL 1FGBD 1EEID 3K5OA 4E6IA 4P71A 1FVIA 5C3EB 3PF4A 3RZOB 1N32L 1QUQB 3HOZB 1AE2A 3NE5B 3OIQA 3L7ZC 4XIGS 3IRBA 1BR9A 1JOKA 4LF4Q 2ZXOA 1CUKA 3PF5A 3OW7A 3HKSA 4G7OC 1P16A 4LMQD 3D4WA 3ULPA 1C0AA 2C5CA 4ZKBB 4A3IB 4DK6C 1Q82C 3X3NA 3JAMi 1YVCA 2FINB 2BDNA 3CCVA 4UPAA 4IUNA 4EGVA 2ZJPA 2B2VC 2OEOA 3J81c 1D7QA 4A3MG 1YJNA 1NSNS 2K33A 2NWGA 3A5ZB 2VB2X 1Y1WB 1MGSA 2IT1A 1WTHA 2A6HD
chains in the Genus database with same CATH topology
4BXXH 1WI5A 2B63H 3I4NG 1VQ9A 4LFBQ 3E9HA 3J81i 3D0FA 1I50H 4HIOA 1N33L 1YHQA 2GVAA 3CP0A 4LF8L 4A3FH 1A8VA 3RZDH 2BH8A 4LF9L 4RG1A 5IP9H 4ALPA 1PH2A 4JI5Q 3M4PA 4DR5Q 2A8VA 1KQSA 1UE6A 1KRSA 5JJIA 4YWMA 2AHOB 2JA5G 2BH2A 4DUZL 1VQKA 4AQYQ 2E8GA 3AYHB 3STBC 3GTMH 3H0GH 2IY5B 4A4IA 3HOXH 1EUJA 4B3TQ 3M7NA 4YCUA 1K8GA 1XNQQ 2MO0A 1VQEA 1HZBA 1UWVA 4LF7L 4LUVA 4JI4L 1PHJA 1Y1WH 1AE3A 4P72A 3CAMA 2ZJQA 4NXMQ 1I6HH 3SE5A 4B3RQ 4A3BH 3L2PA 1Q7YC 1PV4A 4A3LG 2VQFL 1IBLL 1XPUA 2UXBQ 4HIMA 5JFZA 1I5FA 4B3ML 1SN8A 1WFQA 3PIOA 2I5LX 2IHFA 3EN2A 2IX1A 2Q2UA 1A63A 4B3MQ 3B6YA 1YITA 1JE5A 4MNOA 5C3EG 3CMAA 1UE7A 2VY3A 4DR1L 1S40A 3UE1A 4JI0L 1G6PA 4HJ7A 1N33Q 1JJ2A 4GN3B 2A1AA 3U4ZA 3G4SA 3ZCBA 4O0AA 2RHSB 3BU2A 4YHHQ 4IO9A 1VQ5A 3ICEA 1C7YA 4JBMA 4GNXC 5FJ8H 2VQEL 4B3SQ 1P8LA 2E2HH 1XMQL 2H5XA 4N67A 4YCWA 4POFA 3PIPA 4DUZQ 3HOUG 1VQHA 1X3EA 1Q1EA 2JJQA 5LMUQ 4X64Q 4GKJQ 1NE3A 3RLOA 5FLMH 1YJ9A 4LWCA 1GVPA 5CMTA 4DR3L 5IY0A 5H1SE 1VQCA 1FJGQ 2ID0A 4PZ7A 1YI2A 1YNXA 4IPGA 2MO1A 1N34L 3I7FA 3MXNB 3I56A 4IFDG 4DV1L 2YV5A 4PY3A 2EXDA 2KHJA 2R7FA 1FJGL 4DV0Q 1J6QA 1PYSB 1CKNB 1YHAA 4AYBE 4GOPA 4X2DA 2UXBL 2AMCB 5IWAL 2QEXA 4GOPB 2R92G 3RZOH 4NB3A 1HR0Q 1VQOA 1IBML 5C4XG 1EOVA 2JA5H 1HH2P 4X2CA 3AFPA 1XPRA 1SRUA 4LF6Q 1Z47A 1L1OA 2CKZB 2YYZA 3H0GG 3D31A 1QVCA 4DUYL 1N36Q 1HR0W 1L1OC 4ITRA 4DV3Q 5M3MG 2JA6G 2K5NA 4LUOA 4OWXB 4YHHL 1X9NA 4A3GG 4J15A 4OWTB 4A3JH 1PH3A 4B3TL 1WJJA 2AWOA 2JA7G 4DV4Q 4X6AH 1PVOA 3SHGA 4IPHA 2VZAA 3NELA 3G6EA 5C0XI 1PFSA 1TWAH 3DM3A 2UU9Q 4X66L 1VQJA 2NN6G 1S72A 2VUMG 5CKLA 1XNRL 2CCZA 1WOCA 2KCMA 3M3YH 2IX0A 1PH7A 4PMWA 4BY7G 5IYDH 3F2BA 2JEBI 1OTCA 3TQYA 1CSPA 4GLAC 3JAMc 2CQOA 3S24A 4HJ5A 5FJ8G 4YCVA 1NMGA 2KENA 3FKIG 1G51A 1JJGA 3A0JA 2CWAA 2VQEQ 4AQYL 4JV5L 3KF6B 4A3EH 2WAQG 3S1MH 3S6AA 4LF9Q 4XTCS 5E7NA 1B70B 4DV5Q 4LUZA 1VQDA 5FLMG 2F6SA 1N9WA 2PI2E 3GTLH 2MFIA 2OQ0A 1YEZA 1K0RA 1PH4A 3KDFA 3HOXG 4DR3Q 4KLKA 2E2IH 3HKZG 4L5RC 4YWLA 1IBKL 1M90C 1WCMG 2Z6KA 4DV7Q 3AEVA 2LSSA 4X2EA 4QGUA 4LFAQ 2UUBL 3M4QA 1NTGA 4JI8Q 4LF5Q 4TVAB 3CC2A 4AIMA 2VQFQ 1L2FA 1OXUA 3S1RH 1IBLQ 1GKHA 4XI8A 5HY6A 4JI4Q 1T9HA 1EYGA 3KJPA 5M3FH 2JA9A 4DV6L 3KF6A 1VQ7A 4K0KL 4AYBG 4WGJA 3AQQA 2JA8H 3CC4A 3UDXA 2XGTA 1NBWA 2C35B 3BZCA 4NPSA 1X56A 2LXJA 4IPCA 5IP7H 3CCUA 4DV6Q 1HR0L 4JC0A 4A3DG 1X3GA 5C4JH 3LETA 1XPOA 3HOYH 3BJUA 5ELOA 3N3UA 2E2JH 1EIFA 4DR7Q 4X62Q 3OW2A 4A3GH 2Y0SE 2NVXH 2F3IA 4A93H 4L5QA 1UEBA 4HJ8A 3NENA 4BBSG 1VQLA 2R7ZH 2Y0SG 4YY3Q 2WFWA 3F2CA 2MNAA 1KC8C 4JG2A 2D0OA 3STBD 1EQQA 4JBJA 1PH8A 4KHPQ 1AH9A 5EU0A 4L5SA 2UXDQ 3CPFA 4HJ9A 4X64L 2K14A 3CW2C 5BR8L 4OWWB 1E7ZA 3TRZA 1X54A 4MZ9A 4HIKA 4A75A 1XMQQ 3RN5A 1Q81C 1IL2A 3PO2G 4IPDA 2HHHL 4JI1L 2JK8A 2ZTEA 3FHWA 1L1OB 3A5UA 4GS3A 4JI8L 3PGZA 3CCRA 4BA2I 2KCTA 4JI1Q 3KJOA 1E3PA 3CPWA 3ZLMA 1YIJA 1HNXL 3HOWH 1Q86C 4QQBX 3H3VH 5JEAG 3G71A 3T1YL 3E9IA 3UDGA 1VQPA 3S1NH 4DK3C 4DNIA 4GOPC 3I4NH 1K73C 2BA0A 2EIFA 1XMOQ 4A3IH 1SE8A 2I5MX 3KLWA 1UE5A 4DR5L 4BBRH 1X3FA 4U07A 3HOZG 5JJKA 3J7A5 3J80c 3HOVG 2I5HA 3RLNA 1X6OA 4R4OA 5IP9G 1SLJA 5M3MH 2ZM6Q 4DV4L 3K7UC 4FDBA 2RF4A 4DV3L 1Y1VH 5M5WH 1B7YB 3KYHC 1N8RC 4PG3A 4IFDJ 4U0ZA 1MKHA 1RIPA 2B3GA 5JFFA 2Q2HA 1BBWA 1TWCH 2K5VA 1WYDA 3OYYA 1HZAA 2NVQH 4A3BG 4K0KQ 3H15A 4IOAA 2ATWA 4A3DH 3F2DA 4DV2L 3CD6A 1U5KA 3EBEA 5GROA 5IT9c 4A3LH 4DV1Q 2L15A 1PH9A 3GTGH 3PV0A 4UP8A 5GADC 5C44H 3W1BA 4DR1Q 4A3MH 2QGQA 2HIVA 1RL2A 3SGIA 1QZHA 2K50A 3BZKA 4GKKL 5IYCH 3G48A 3K7AH 3WWVA 2YTYA 2HT1A 5C3EH 4POGA 4DV5L 4BXXG 2JE6I 1LYLA 2R93G 3DLLA 3UDFA 2F4VL 1HZCA 2K52A 3CQZH 1IXRA 5LMNL 1FGUA 4A3CG 2F52A 3A74A 5AJ3Q 2OTLA 2F4VQ 2AWNA 3CCMA 4IOCA 1M1KC 4P75A 3HOWG 1JB7A 4BY1H 2UXCQ 1IBKQ 1W2BA 1Y1VG 4DV7L 4DV0L 4WJ3M 2D0PA 2N78A 1VS0A 3FP9A 1HJPA 5IYBH 1CKMA 3J7ZC 3SN9A 3HOZH 3PUXA 4X62L 1BKBA 3F1ZA 5IE8A 1QZGA 3I4MH 4LFBL 3TEHB 3EIVA 1K8AC 4U04A 5J3BA 4DAYB 2R92H 1NMFA 4PZ6A 4DUYQ 4OX9L 3OTOQ 2HIXA 3LGJA 2VW9A 2I0QA 3S16H 4AH6A 5GQOA 4DR4L 4A93G 1X55A 5CGLA 3PUWA 2ZM6L 3GTPH 4OX9Q 4OONA 4APVA 1PH1A 4LF4L 2R7ZG 1O7IA 3GTQH 2JQOA 2LXKA 4LW1A 3NBHB 5LMNW 3TS2A 1VQNA 1C9OA 2KHIA 2UXDL 1VQ6A 2UU9L 1NJIC 4X66Q 5M5YH 5JJLA 4DV2Q 2E5LL 1KHIA 4WJ4A 2UXCL 1ASZA 1Y14B 2WP8J 1LM0A 3RN2A 3T1YQ 1SMXA 2NVTH 4NXNL 4Y7NH 4DR6Q 4R4CA 3PUZA 2K75A 2OQKA 2NVYH 1YBYA 3MEFA 4KI0A 2RCNA 1HNXQ 1CKNA 1HZ9A 1PH5A 1YZ6A 2D62A 3M85A 2B63G 1NY4A 4JI6Q 1KAWA 4JOIC 1VQBA 4BBRG 4A3CH 1LUZA 1IBMQ 2CFMA 2YTXA 3RNUA 1K9MC 4JI7Q 3Q8DA 1DGSA 2N49A 4C3HH 4QY7A 4OO1I 2ZJRA 4JI3L 4A3EG 4MTNA 1JJCB 1E24A 2Q2IA 1I3QH 2CWPA 1TWFH 4IJLA 4OO1G 2OTJA 1W3SA 3ZC7A 3F8TA 1E1TA 3I55A 4GLXA 3U58A 2XTIA 1TXYA 3PUVA 1PH6A 3CCQA 3PUYA 5LMUL 1E22A 1KIXA 1WCMH 4H02A 4C2MH 3GTJH 2MQHA 2KBNA 4PZ8A 4R4TA 1XNQL 3I2ZA 1QVGA 3CCEA 1FL0A 1N32Q 4R1JA 5C4XH 1SFOH 2DUDA 1XNRQ 4GN5A 3RR5A 5C0XJ 3VDYA 3U4VA 4LU4A 2UUAQ 1Q12A 5IWAQ 3HOYG 1KRTA 4JOIA 1R9TH 1I94Q 4YY3L 1SROA 3ERSX 1XMOL 4GKKQ 2PNHA 3HFZB 4KHPL 4ME3A 2OCEA 5ELNA 4A3JG 5IYDG 2JEAI 1U0LA 4JBKA 4QIWE 4JV5Q 1JT8A 4DR2Q 1V9PA 1IYJB 2PQAB 5EAYA 4JI3Q 3CCJA 3CF5A 1OXSC 1J5EQ 2N8NA 2PQAA 1Q46A 2BA1A 3KDFB 2HHHQ 4BA1I 3S14H 2GN5A 3GO5A 3GDEA 3PSIA 1KXLA 4BY1G 4B3SL 1S3OA 4EX5A 2VUMH 4NXNQ 2NZHA 4LF7Q 5K36G 1VQIA 2ZTCA 3K80C 1D8LA 1MJCA 1G291 4LF5L 2NN6I 2YU9H 2R7DA 1GO3E 1QVFA 1H95A 1ASYA 1PYBA 4DKAC 3CC7A 2UUCL 4LFCQ 1HNWL 5C0XG 4C3JH 1JMCA 3I4MG 3K81C 3L0OA 1SR3A 2HQLA 3I4OA 4LFCL 4O2DA 1N34Q 1HNWQ 4RMFA 3CXCA 1QUQA 4JI7L 4LF8Q 4EQ5A 2UUAL 3W1GA 5GAHC 1A62A 2ASBA 4GN4B 2JA8G 4DR7L 1V43A 4P74A 1X65A 3T1HQ 3PO3G 1BVSA 1LTLA 4U0SA 2JA6H 3K8AA 3ER0A 3S2DH 1OXVA 2ZTDA 4JYAQ 1VQFA 2WB1E 3K0XA 4GNXB 2G03A 5LMNQ 1VQAA 4GLVB 5AJ3L 1E1OA 4GNXA 4JYAL 4U0UA 3RLFA 5BR8Q 1K83H 1PA6A 2DGYA 4DR6L 5JJ7A 2Z6KC 2UUBQ 1EQRA 4LFAL 1VQGA 1XTDA 4JBWA 1YJWA 2E5LQ 2ES2A 5IP7G 4A76A 1Y1WG 3UDIA 2EQSA 2AKWB 5FLXc 4P73A 3TREA 3ULLA 3M9BA 1OXTA 4A3KH 5GAEC 1Q1BA 4JCVE 3UE0A 2IHEA 3GTOH 4BBSH 1B8AA 4BY7H 4UY8C 4QJFA 3TS0A 4B3RL 5IYCG 3AFQA 5DLQE 1HNZL 4C3IH 3OTOL 3PO3H 4LF6L 4DR4Q 1CSQA 2WAQE 3FKIH 3ULJA 1N36L 3W5OA 2R93H 3T1HL 1VQ8A 1KL9A 4A3IG 1EWIA 3JC66 3NEMA 4JI0Q 1XJVA 2VS1A 2VL6A 3CCSA 3GTKH 2A19A 4A3FG 2PI2A 3PO2H 3PCOB 2FXQA 3HOVH 4X65Q 2Q2TA 4JI2L 4IJHA 3S1QH 4OXPA 4TQUS 2K4KA 3HOUH 3KOJA 4DPGA 3J81j 4JI2Q 4X65L 2GVBA 1VCIA 1BBUA 1GD7A 1K3RA 3KFUA 3S15H 4DAMA 2ALYB 2NZOA 1MJEA 5JJ6A 2WB1G 3GD7A 4IFDI 4Y52H 5IYBG 5GAGC 5M3FG 4R4IA 4GKJL 3H3VI 1A0IA 4HJAA 3CUCA 4P71A 3U50C 1FVIA 1I94L 3PF4A 3HKZE 5JEAJ 1QUQB 4HIDA 1AE2A 4UP7A 2N3SA 2QA4A 1N32L 3L7ZC 4QL5A 3IRBA 4XIGS 2RHQB 3CMEA 4LF4Q 4JI6L 1UE1A 1CUKA 1Q8KA 1OXXK 4DR2L 5M5XH 5C44G 3PF5A 1HNZQ 3HKSA 3S2HH 1TWHH 2K5HA 1J5EL 1P16A 4JI5L 3J80i 3ULPA 1Z9FA 2VNUD 1C0AA 4KHZA 2YTVA 1KD1C 4DK6C 1IZ6A 1CKOA 1GM5A 1Q82C 1VQ4A 1YHBA 4L5TA 4UP9A 4YWKA 1YVCA 4R4QA 3JAMi 1EIYB 3CCVA 3CCLA 2V1CC 1TWGH 2PMZE 2JA7H 2R6GA 4UPAA 2ZJPA 2OWOA 1EFWA 4A3KG 3J81c 2B29A 3ZJYC 2UUCQ 5HGQA 3KF8B 1D7QA 3E0EA 4NXML 4M16A 3M4OH 1L0WA 4A3MG 1YJNA 3S17H 3A5ZB 1MIUA 4LNQA 2Z0SA 1V1QA 2IT1A 1VQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXX H;  1WI5 A;  2B63 H;  3I4N G;  1VQ9 A;  4LFB Q;  3E9H A;  3J81 i;  3D0F A;  1I50 H;  4HIO A;  1N33 L;  1YHQ A;  2GVA A;  3CP0 A;  4LF8 L;  4A3F H;  1A8V A;  3RZD H;  2BH8 A;  4LF9 L;  4RG1 A;  5IP9 H;  4ALP A;  1PH2 A;  4JI5 Q;  3M4P A;  4DR5 Q;  2A8V A;  1KQS A;  1UE6 A;  1KRS A;  5JJI A;  4YWM A;  2AHO B;  2JA5 G;  2BH2 A;  4DUZ L;  1VQK A;  4AQY Q;  2E8G A;  3AYH B;  3STB C;  3GTM H;  3H0G H;  2IY5 B;  4A4I A;  3HOX H;  1EUJ A;  4B3T Q;  3M7N A;  4YCU A;  1K8G A;  1XNQ Q;  2MO0 A;  1VQE A;  1HZB A;  1UWV A;  4LF7 L;  4LUV A;  4JI4 L;  1PHJ A;  1Y1W H;  1AE3 A;  4P72 A;  3CAM A;  2ZJQ A;  4NXM Q;  1I6H H;  3SE5 A;  4B3R Q;  4A3B H;  3L2P A;  1Q7Y C;  1PV4 A;  4A3L G;  2VQF L;  1IBL L;  1XPU A;  2UXB Q;  4HIM A;  5JFZ A;  1I5F A;  4B3M L;  1SN8 A;  1WFQ A;  3PIO A;  2I5L X;  2IHF A;  3EN2 A;  2IX1 A;  2Q2U A;  1A63 A;  4B3M Q;  3B6Y A;  1YIT A;  1JE5 A;  4MNO A;  5C3E G;  3CMA A;  1UE7 A;  2VY3 A;  4DR1 L;  1S40 A;  3UE1 A;  4JI0 L;  1G6P A;  4HJ7 A;  1N33 Q;  1JJ2 A;  4GN3 B;  2A1A A;  3U4Z A;  3G4S A;  3ZCB A;  4O0A A;  2RHS B;  3BU2 A;  4YHH Q;  4IO9 A;  1VQ5 A;  3ICE A;  1C7Y A;  4JBM A;  4GNX C;  5FJ8 H;  2VQE L;  4B3S Q;  1P8L A;  2E2H H;  1XMQ L;  2H5X A;  4N67 A;  4YCW A;  4POF A;  3PIP A;  4DUZ Q;  3HOU G;  1VQH A;  1X3E A;  1Q1E A;  2JJQ A;  5LMU Q;  4X64 Q;  4GKJ Q;  1NE3 A;  3RLO A;  5FLM H;  1YJ9 A;  4LWC A;  1GVP A;  5CMT A;  4DR3 L;  5IY0 A;  5H1S E;  1VQC A;  1FJG Q;  2ID0 A;  4PZ7 A;  1YI2 A;  1YNX A;  4IPG A;  2MO1 A;  1N34 L;  3I7F A;  3MXN B;  3I56 A;  4IFD G;  4DV1 L;  2YV5 A;  4PY3 A;  2EXD A;  2KHJ A;  2R7F A;  1FJG L;  4DV0 Q;  1J6Q A;  1PYS B;  1CKN B;  1YHA A;  4AYB E;  4GOP A;  4X2D A;  2UXB L;  2AMC B;  5IWA L;  2QEX A;  4GOP B;  2R92 G;  3RZO H;  4NB3 A;  1HR0 Q;  1VQO A;  1IBM L;  5C4X G;  1EOV A;  2JA5 H;  1HH2 P;  4X2C A;  3AFP A;  1XPR A;  1SRU A;  4LF6 Q;  1Z47 A;  1L1O A;  2CKZ B;  2YYZ A;  3H0G G;  3D31 A;  1QVC A;  4DUY L;  1N36 Q;  1HR0 W;  1L1O C;  4ITR A;  4DV3 Q;  5M3M G;  2JA6 G;  2K5N A;  4LUO A;  4OWX B;  4YHH L;  1X9N A;  4A3G G;  4J15 A;  4OWT B;  4A3J H;  1PH3 A;  4B3T L;  1WJJ A;  2AWO A;  2JA7 G;  4DV4 Q;  4X6A H;  1PVO A;  3SHG A;  4IPH A;  2VZA A;  3NEL A;  3G6E A;  5C0X I;  1PFS A;  1TWA H;  3DM3 A;  2UU9 Q;  4X66 L;  1VQJ A;  2NN6 G;  1S72 A;  2VUM G;  5CKL A;  1XNR L;  2CCZ A;  1WOC A;  2KCM A;  3M3Y H;  2IX0 A;  1PH7 A;  4PMW A;  4BY7 G;  5IYD H;  3F2B A;  2JEB I;  1OTC A;  3TQY A;  1CSP A;  4GLA C;  3JAM c;  2CQO A;  3S24 A;  4HJ5 A;  5FJ8 G;  4YCV A;  1NMG A;  2KEN A;  3FKI G;  1G51 A;  1JJG A;  3A0J A;  2CWA A;  2VQE Q;  4AQY L;  4JV5 L;  3KF6 B;  4A3E H;  2WAQ G;  3S1M H;  3S6A A;  4LF9 Q;  4XTC S;  5E7N A;  1B70 B;  4DV5 Q;  4LUZ A;  1VQD A;  5FLM G;  2F6S A;  1N9W A;  2PI2 E;  3GTL H;  2MFI A;  2OQ0 A;  1YEZ A;  1K0R A;  1PH4 A;  3KDF A;  3HOX G;  4DR3 Q;  4KLK A;  2E2I H;  3HKZ G;  4L5R C;  4YWL A;  1IBK L;  1M90 C;  1WCM G;  2Z6K A;  4DV7 Q;  3AEV A;  2LSS A;  4X2E A;  4QGU A;  4LFA Q;  2UUB L;  3M4Q A;  1NTG A;  4JI8 Q;  4LF5 Q;  4TVA B;  3CC2 A;  4AIM A;  2VQF Q;  1L2F A;  1OXU A;  3S1R H;  1IBL Q;  1GKH A;  4XI8 A;  5HY6 A;  4JI4 Q;  1T9H A;  1EYG A;  3KJP A;  5M3F H;  2JA9 A;  4DV6 L;  3KF6 A;  1VQ7 A;  4K0K L;  4AYB G;  4WGJ A;  3AQQ A;  2JA8 H;  3CC4 A;  3UDX A;  2XGT A;  1NBW A;  2C35 B;  3BZC A;  4NPS A;  1X56 A;  2LXJ A;  4IPC A;  5IP7 H;  3CCU A;  4DV6 Q;  1HR0 L;  4JC0 A;  4A3D G;  1X3G A;  5C4J H;  3LET A;  1XPO A;  3HOY H;  3BJU A;  5ELO A;  3N3U A;  2E2J H;  1EIF A;  4DR7 Q;  4X62 Q;  3OW2 A;  4A3G H;  2Y0S E;  2NVX H;  2F3I A;  4A93 H;  4L5Q A;  1UEB A;  4HJ8 A;  3NEN A;  4BBS G;  1VQL A;  2R7Z H;  2Y0S G;  4YY3 Q;  2WFW A;  3F2C A;  2MNA A;  1KC8 C;  4JG2 A;  2D0O A;  3STB D;  1EQQ A;  4JBJ A;  1PH8 A;  4KHP Q;  1AH9 A;  5EU0 A;  4L5S A;  2UXD Q;  3CPF A;  4HJ9 A;  4X64 L;  2K14 A;  3CW2 C;  5BR8 L;  4OWW B;  1E7Z A;  3TRZ A;  1X54 A;  4MZ9 A;  4HIK A;  4A75 A;  1XMQ Q;  3RN5 A;  1Q81 C;  1IL2 A;  3PO2 G;  4IPD A;  2HHH L;  4JI1 L;  2JK8 A;  2ZTE A;  3FHW A;  1L1O B;  3A5U A;  4GS3 A;  4JI8 L;  3PGZ A;  3CCR A;  4BA2 I;  2KCT A;  4JI1 Q;  3KJO A;  1E3P A;  3CPW A;  3ZLM A;  1YIJ A;  1HNX L;  3HOW H;  1Q86 C;  4QQB X;  3H3V H;  5JEA G;  3G71 A;  3T1Y L;  3E9I A;  3UDG A;  1VQP A;  3S1N H;  4DK3 C;  4DNI A;  4GOP C;  3I4N H;  1K73 C;  2BA0 A;  2EIF A;  1XMO Q;  4A3I H;  1SE8 A;  2I5M X;  3KLW A;  1UE5 A;  4DR5 L;  4BBR H;  1X3F A;  4U07 A;  3HOZ G;  5JJK A;  3J7A 5;  3J80 c;  3HOV G;  2I5H A;  3RLN A;  1X6O A;  4R4O A;  5IP9 G;  1SLJ A;  5M3M H;  2ZM6 Q;  4DV4 L;  3K7U C;  4FDB A;  2RF4 A;  4DV3 L;  1Y1V H;  5M5W H;  1B7Y B;  3KYH C;  1N8R C;  4PG3 A;  4IFD J;  4U0Z A;  1MKH A;  1RIP A;  2B3G A;  5JFF A;  2Q2H A;  1BBW A;  1TWC H;  2K5V A;  1WYD A;  3OYY A;  1HZA A;  2NVQ H;  4A3B G;  4K0K Q;  3H15 A;  4IOA A;  2ATW A;  4A3D H;  3F2D A;  4DV2 L;  3CD6 A;  1U5K A;  3EBE A;  5GRO A;  5IT9 c;  4A3L H;  4DV1 Q;  2L15 A;  1PH9 A;  3GTG H;  3PV0 A;  4UP8 A;  5GAD C;  5C44 H;  3W1B A;  4DR1 Q;  4A3M H;  2QGQ A;  2HIV A;  1RL2 A;  3SGI A;  1QZH A;  2K50 A;  3BZK A;  4GKK L;  5IYC H;  3G48 A;  3K7A H;  3WWV A;  2YTY A;  2HT1 A;  5C3E H;  4POG A;  4DV5 L;  4BXX G;  2JE6 I;  1LYL A;  2R93 G;  3DLL A;  3UDF A;  2F4V L;  1HZC A;  2K52 A;  3CQZ H;  1IXR A;  5LMN L;  1FGU A;  4A3C G;  2F52 A;  3A74 A;  5AJ3 Q;  2OTL A;  2F4V Q;  2AWN A;  3CCM A;  4IOC A;  1M1K C;  4P75 A;  3HOW G;  1JB7 A;  4BY1 H;  2UXC Q;  1IBK Q;  1W2B A;  1Y1V G;  4DV7 L;  4DV0 L;  4WJ3 M;  2D0P A;  2N78 A;  1VS0 A;  3FP9 A;  1HJP A;  5IYB H;  1CKM A;  3J7Z C;  3SN9 A;  3HOZ H;  3PUX A;  4X62 L;  1BKB A;  3F1Z A;  5IE8 A;  1QZG A;  3I4M H;  4LFB L;  3TEH B;  3EIV A;  1K8A C;  4U04 A;  5J3B A;  4DAY B;  2R92 H;  1NMF A;  4PZ6 A;  4DUY Q;  4OX9 L;  3OTO Q;  2HIX A;  3LGJ A;  2VW9 A;  2I0Q A;  3S16 H;  4AH6 A;  5GQO A;  4DR4 L;  4A93 G;  1X55 A;  5CGL A;  3PUW A;  2ZM6 L;  3GTP H;  4OX9 Q;  4OON A;  4APV A;  1PH1 A;  4LF4 L;  2R7Z G;  1O7I A;  3GTQ H;  2JQO A;  2LXK A;  4LW1 A;  3NBH B;  5LMN W;  3TS2 A;  1VQN A;  1C9O A;  2KHI A;  2UXD L;  1VQ6 A;  2UU9 L;  1NJI C;  4X66 Q;  5M5Y H;  5JJL A;  4DV2 Q;  2E5L L;  1KHI A;  4WJ4 A;  2UXC L;  1ASZ A;  1Y14 B;  2WP8 J;  1LM0 A;  3RN2 A;  3T1Y Q;  1SMX A;  2NVT H;  4NXN L;  4Y7N H;  4DR6 Q;  4R4C A;  3PUZ A;  2K75 A;  2OQK A;  2NVY H;  1YBY A;  3MEF A;  4KI0 A;  2RCN A;  1HNX Q;  1CKN A;  1HZ9 A;  1PH5 A;  1YZ6 A;  2D62 A;  3M85 A;  2B63 G;  1NY4 A;  4JI6 Q;  1KAW A;  4JOI C;  1VQB A;  4BBR G;  4A3C H;  1LUZ A;  1IBM Q;  2CFM A;  2YTX A;  3RNU A;  1K9M C;  4JI7 Q;  3Q8D A;  1DGS A;  2N49 A;  4C3H H;  4QY7 A;  4OO1 I;  2ZJR A;  4JI3 L;  4A3E G;  4MTN A;  1JJC B;  1E24 A;  2Q2I A;  1I3Q H;  2CWP A;  1TWF H;  4IJL A;  4OO1 G;  2OTJ A;  1W3S A;  3ZC7 A;  3F8T A;  1E1T A;  3I55 A;  4GLX A;  3U58 A;  2XTI A;  1TXY A;  3PUV A;  1PH6 A;  3CCQ A;  3PUY A;  5LMU L;  1E22 A;  1KIX A;  1WCM H;  4H02 A;  4C2M H;  3GTJ H;  2MQH A;  2KBN A;  4PZ8 A;  4R4T A;  1XNQ L;  3I2Z A;  1QVG A;  3CCE A;  1FL0 A;  1N32 Q;  4R1J A;  5C4X H;  1SFO H;  2DUD A;  1XNR Q;  4GN5 A;  3RR5 A;  5C0X J;  3VDY A;  3U4V A;  4LU4 A;  2UUA Q;  1Q12 A;  5IWA Q;  3HOY G;  1KRT A;  4JOI A;  1R9T H;  1I94 Q;  4YY3 L;  1SRO A;  3ERS X;  1XMO L;  4GKK Q;  2PNH A;  3HFZ B;  4KHP L;  4ME3 A;  2OCE A;  5ELN A;  4A3J G;  5IYD G;  2JEA I;  1U0L A;  4JBK A;  4QIW E;  4JV5 Q;  1JT8 A;  4DR2 Q;  1V9P A;  1IYJ B;  2PQA B;  5EAY A;  4JI3 Q;  3CCJ A;  3CF5 A;  1OXS C;  1J5E Q;  2N8N A;  2PQA A;  1Q46 A;  2BA1 A;  3KDF B;  2HHH Q;  4BA1 I;  3S14 H;  2GN5 A;  3GO5 A;  3GDE A;  3PSI A;  1KXL A;  4BY1 G;  4B3S L;  1S3O A;  4EX5 A;  2VUM H;  4NXN Q;  2NZH A;  4LF7 Q;  5K36 G;  1VQI A;  2ZTC A;  3K80 C;  1D8L A;  1MJC A;  1G29 1;  4LF5 L;  2NN6 I;  2YU9 H;  2R7D A;  1GO3 E;  1QVF A;  1H95 A;  1ASY A;  1PYB A;  4DKA C;  3CC7 A;  2UUC L;  4LFC Q;  1HNW L;  5C0X G;  4C3J H;  1JMC A;  3I4M G;  3K81 C;  3L0O A;  1SR3 A;  2HQL A;  3I4O A;  4LFC L;  4O2D A;  1N34 Q;  1HNW Q;  4RMF A;  3CXC A;  1QUQ A;  4JI7 L;  4LF8 Q;  4EQ5 A;  2UUA L;  3W1G A;  5GAH C;  1A62 A;  2ASB A;  4GN4 B;  2JA8 G;  4DR7 L;  1V43 A;  4P74 A;  1X65 A;  3T1H Q;  3PO3 G;  1BVS A;  1LTL A;  4U0S A;  2JA6 H;  3K8A A;  3ER0 A;  3S2D H;  1OXV A;  2ZTD A;  4JYA Q;  1VQF A;  2WB1 E;  3K0X A;  4GNX B;  2G03 A;  5LMN Q;  1VQA A;  4GLV B;  5AJ3 L;  1E1O A;  4GNX A;  4JYA L;  4U0U A;  3RLF A;  5BR8 Q;  1K83 H;  1PA6 A;  2DGY A;  4DR6 L;  5JJ7 A;  2Z6K C;  2UUB Q;  1EQR A;  4LFA L;  1VQG A;  1XTD A;  4JBW A;  1YJW A;  2E5L Q;  2ES2 A;  5IP7 G;  4A76 A;  1Y1W G;  3UDI A;  2EQS A;  2AKW B;  5FLX c;  4P73 A;  3TRE A;  3ULL A;  3M9B A;  1OXT A;  4A3K H;  5GAE C;  1Q1B A;  4JCV E;  3UE0 A;  2IHE A;  3GTO H;  4BBS H;  1B8A A;  4BY7 H;  4UY8 C;  4QJF A;  3TS0 A;  4B3R L;  5IYC G;  3AFQ A;  5DLQ E;  1HNZ L;  4C3I H;  3OTO L;  3PO3 H;  4LF6 L;  4DR4 Q;  1CSQ A;  2WAQ E;  3FKI H;  3ULJ A;  1N36 L;  3W5O A;  2R93 H;  3T1H L;  1VQ8 A;  1KL9 A;  4A3I G;  1EWI A;  3JC6 6;  3NEM A;  4JI0 Q;  1XJV A;  2VS1 A;  2VL6 A;  3CCS A;  3GTK H;  2A19 A;  4A3F G;  2PI2 A;  3PO2 H;  3PCO B;  2FXQ A;  3HOV H;  4X65 Q;  2Q2T A;  4JI2 L;  4IJH A;  3S1Q H;  4OXP A;  4TQU S;  2K4K A;  3HOU H;  3KOJ A;  4DPG A;  3J81 j;  4JI2 Q;  4X65 L;  2GVB A;  1VCI A;  1BBU A;  1GD7 A;  1K3R A;  3KFU A;  3S15 H;  4DAM A;  2ALY B;  2NZO A;  1MJE A;  5JJ6 A;  2WB1 G;  3GD7 A;  4IFD I;  4Y52 H;  5IYB G;  5GAG C;  5M3F G;  4R4I A;  4GKJ L;  3H3V I;  1A0I A;  4HJA A;  3CUC A;  4P71 A;  3U50 C;  1FVI A;  1I94 L;  3PF4 A;  3HKZ E;  5JEA J;  1QUQ B;  4HID A;  1AE2 A;  4UP7 A;  2N3S A;  2QA4 A;  1N32 L;  3L7Z C;  4QL5 A;  3IRB A;  4XIG S;  2RHQ B;  3CME A;  4LF4 Q;  4JI6 L;  1UE1 A;  1CUK A;  1Q8K A;  1OXX K;  4DR2 L;  5M5X H;  5C44 G;  3PF5 A;  1HNZ Q;  3HKS A;  3S2H H;  1TWH H;  2K5H A;  1J5E L;  1P16 A;  4JI5 L;  3J80 i;  3ULP A;  1Z9F A;  2VNU D;  1C0A A;  4KHZ A;  2YTV A;  1KD1 C;  4DK6 C;  1IZ6 A;  1CKO A;  1GM5 A;  1Q82 C;  1VQ4 A;  1YHB A;  4L5T A;  4UP9 A;  4YWK A;  1YVC A;  4R4Q A;  3JAM i;  1EIY B;  3CCV A;  3CCL A;  2V1C C;  1TWG H;  2PMZ E;  2JA7 H;  2R6G A;  4UPA A;  2ZJP A;  2OWO A;  1EFW A;  4A3K G;  3J81 c;  2B29 A;  3ZJY C;  2UUC Q;  5HGQ A;  3KF8 B;  1D7Q A;  3E0E A;  4NXM L;  4M16 A;  3M4O H;  1L0W A;  4A3M G;  1YJN A;  3S17 H;  3A5Z B;  1MIU A;  4LNQ A;  2Z0S A;  1V1Q A;  2IT1 A;  1VQM A; 
#chains in the Genus database with same CATH topology
 4BXX H;  4XYO A;  4LFB Q;  1M4V A;  4GZY C;  1N33 L;  1YHQ A;  2R7Z B;  2CH4 W;  4A3F H;  1RDP D;  5IP9 H;  4DR5 Q;  1UE6 A;  1KRS A;  1E0B A;  1W6J A;  2AHO B;  2KEC A;  2BH2 A;  3T13 A;  3SDZ A;  4IUP A;  1EUJ A;  3E3X A;  2NYZ D;  4EQP A;  3M7N A;  2IPK D;  4LF7 L;  3M7G A;  1X3P A;  5CBE E;  5FKA C;  3L2P A;  2AQ2 B;  1Q7Y C;  1PV4 A;  4A3L G;  1XPU A;  2UXB Q;  1LAC A;  3T56 B;  4HIM A;  3PO3 B;  2I5L X;  1YIT A;  4FP5 D;  4MNO A;  5C3E G;  4DR1 L;  1UE7 A;  1S40 A;  4JI0 L;  1PZJ D;  1SNO A;  1JJ2 A;  3A8J E;  2F0P A;  3KBG A;  3G4S A;  4O0A A;  4YHH Q;  3BU2 A;  3HOV B;  4IO9 A;  4JBM A;  4GNX C;  2L11 A;  4PQX A;  4RH6 A;  3HOX B;  2ENB A;  4LWC A;  2QKI C;  4FXD A;  5CMT A;  4J6H A;  5H1S E;  1YI2 A;  1YNX A;  4WRD A;  2MO1 A;  4RFB A;  2N88 A;  3I7F A;  2EYF A;  4DV1 L;  4OIJ A;  1J6Q A;  2EXZ A;  3NK9 A;  2AMC B;  3I91 A;  2L0C A;  5C4X G;  4OO1 H;  4X2C A;  4LF6 Q;  1DM0 B;  1L1O A;  1QVC A;  3H3V C;  1V1O A;  2K5N A;  1TY0 A;  1PTO F;  2A6H C;  5C3W A;  4X6A H;  1PVO A;  2J4X A;  1SMY C;  2Q8T A;  3NEL A;  5C0X I;  4K14 A;  3J7A F;  3DM3 A;  3J7A V;  5I9O A;  3NTH A;  1S72 A;  1EQV A;  2R61 A;  4C3J B;  3M3Y H;  1TII D;  3T4A C;  4TKO B;  4G57 A;  1PH7 A;  4BY7 G;  3F2B A;  2JEB I;  1OTC A;  3TQY A;  1CSP A;  1SAP A;  3JAM c;  1ICF B;  5JEA H;  3D6C A;  3FKI G;  1PTO B;  4FO2 A;  4ZUI A;  3EA6 A;  4JV5 L;  1KNE A;  2WAQ G;  3S1M H;  1IHZ A;  5E7N A;  1B70 B;  1GUN A;  3I8Z A;  4LUZ A;  1UNS A;  3GTL H;  2PI2 E;  5CMD A;  2EE1 A;  3I72 A;  1SE3 A;  4KLK A;  2M2L A;  4ZUJ A;  4DV7 Q;  2WAC A;  2HCI A;  4C1N K;  1NTG A;  1CT1 D;  4TVA B;  4XI8 A;  3SXH A;  4KJN A;  2O2L D;  3KF6 A;  4K2L A;  4AYB G;  3AQQ A;  3CC4 A;  5FOB B;  2XGT A;  2C35 B;  3BZC A;  1HR0 L;  4A3D G;  2EYJ A;  3PIP 3;  3BJU A;  1LTB D;  3N3U A;  1WD1 A;  5HGT A;  4A3G H;  2F0T A;  5C44 B;  5ELB A;  2XVS A;  2Y0S G;  5IOC A;  3H0G B;  2D0O A;  3LWU A;  4ZAI A;  1AH9 A;  1F9P A;  5D3I B;  3R93 A;  4L5S A;  1QIL A;  1B9M A;  2MPM A;  5BR8 L;  3S15 B;  1DZ1 A;  1TWA B;  5M5Y B;  2KJX A;  4RGN A;  1XMQ Q;  1Q81 C;  1SYD A;  1IL2 A;  3VA7 A;  1UUP A;  3FHW A;  1L1O B;  4GS3 A;  4CBV A;  2TSS A;  3NBH A;  4IFD H;  3DEP A;  3S17 B;  1Q86 C;  5JEA G;  2XWB B;  4BBR B;  2B2T A;  2K04 A;  3S1N H;  4DNI A;  1JOO A;  1BOS A;  1XMO Q;  4KJO A;  4DR5 L;  4BBR H;  4U07 A;  4F7X A;  3RLN A;  4R4O A;  3S16 B;  1SLJ A;  5M3M H;  3K5M A;  4IAL A;  4KTA A;  2ZM6 Q;  3RUZ A;  4C3H B;  1LT3 D;  2RF4 A;  3A7A B;  2E75 C;  3LX0 A;  5M5W H;  3KYH C;  3RMH A;  5BN4 A;  4U0Z A;  2B3G A;  3FPP A;  2Q2H A;  1BBW A;  1SEB D;  2K5V A;  4DA2 A;  1EZ6 A;  3KF8 A;  3H15 A;  4IOA A;  2ATW A;  3AU7 A;  4DV2 L;  1JOR A;  3CD6 A;  4A3D B;  5FO9 B;  1PH9 A;  3PV0 A;  2JN4 A;  5C44 H;  4DR1 Q;  2NZ1 D;  4A3M H;  3BZK A;  4GKK L;  1HXY D;  4HCS A;  3I3C A;  2IW3 A;  3WWV A;  1U9R A;  1PFM A;  4DXG A;  3S1N B;  1K0S A;  2R93 G;  5DM7 3;  2F4V L;  3CQZ H;  1YNJ C;  3VR5 A;  2ICI A;  1FGU A;  3A74 A;  3HRZ C;  3DWQ A;  4IOC A;  1M1K C;  1EIG A;  5E4W C;  5J22 A;  3MFG A;  1GXD C;  1W2B A;  1B3A A;  1K83 B;  1E2W A;  1CKM A;  3SN9 A;  2FJ2 A;  3I90 A;  1BKB A;  5IE8 A;  4LFB L;  3CRL C;  4LAA A;  3OTO Q;  2VW9 A;  3LGJ A;  4A93 G;  4AH6 A;  5GQO A;  2EJM A;  1SNQ A;  1T5E A;  1X55 A;  2ZM6 L;  1S5F D;  3GTP H;  2R7Z G;  1HRJ A;  1TKW B;  1R4P B;  3GTQ H;  5LMN W;  1DYQ A;  1VQN A;  1VQ6 A;  1KDC A;  1NAP A;  2UU9 L;  2B2W C;  2DJG C;  1O7L A;  3GTG B;  1ASZ A;  2WP8 J;  3UI2 A;  4A3K B;  3DWA A;  2VUM B;  1SJH D;  1AZP A;  4R4C A;  4DR6 Q;  3PUZ A;  3IFD A;  3N52 A;  4M8A A;  4KI0 A;  1XXG A;  2DNE A;  3M85 A;  2L4N A;  2PZW A;  3MHB A;  3Q0A A;  4N9T A;  2HD3 A;  2LFN A;  4A3C H;  1LUZ A;  2CFM A;  3RNU A;  2KEE A;  5F2D A;  4OO1 I;  3ERO A;  3G6J B;  2BDO A;  5EPK A;  4MTN A;  4IJL A;  3BZD B;  4OO1 G;  1B2T A;  4GLX A;  1E1T A;  1H9K A;  3I55 A;  3U58 A;  1TXY A;  1G8Z D;  3PUV A;  1NR2 A;  3FRP B;  3GQB A;  1HQR D;  4C2M H;  1VDZ A;  3A8K E;  1JB3 A;  4V19 0;  2RBM A;  3URY A;  5JJZ A;  1Y1V B;  4DGZ A;  1XNQ L;  4OEM B;  1Q90 A;  4GN5 A;  1STH A;  3RR5 A;  5C0X J;  3BS1 A;  2NUC A;  4DK1 A;  2EY1 A;  3TME A;  5IT9 L;  1SRO A;  4EVO A;  2PNH A;  4ME3 A;  5JOB A;  2MHV A;  4JBK A;  4Z9C B;  4JV5 Q;  1JT8 A;  1IYJ B;  3IKJ A;  2QEJ C;  3S14 B;  1K8M A;  1CZW A;  1OXS C;  2N8N A;  4CDF C;  1HA6 A;  2BA1 A;  3KDF B;  3S14 H;  3HKZ B;  4IQZ A;  4N9P A;  1LTG D;  1PFN A;  4BY1 G;  4ZQ3 A;  1BCP D;  1D8L A;  1Y8N B;  1M8A A;  4X3T A;  1GO3 E;  1BCP C;  2WKD A;  4DF7 A;  1H95 A;  2RQX A;  1PRT D;  3NQT A;  3VYU A;  3SR1 A;  2B63 B;  1LTA D;  1SR3 A;  4LK1 C;  1KDA A;  1QE6 A;  4JI7 L;  1QUQ A;  2UUA L;  2JA8 G;  4DR7 L;  1CFM A;  3T1H Q;  3K8A A;  1FR3 A;  4RGM A;  4GLV B;  5FO7 B;  5AJ3 L;  4ZYS A;  3MAQ A;  4GNX A;  4RCN A;  4JYA L;  3RLF A;  2B39 A;  5BR8 Q;  1WTP A;  3GTL B;  3K57 A;  2Z6K C;  1XTD A;  1YJW A;  1AW7 A;  1EY5 A;  2PW7 A;  5BN3 A;  2BOS A;  3M9B A;  5GAE C;  1VMP A;  3UE0 A;  3C3L A;  4BBS H;  4BY7 H;  1SND A;  1GUW A;  2PNR C;  4IUT A;  3FKI H;  4CDD C;  3W5O A;  5C4H A;  4HN7 A;  4JI0 Q;  4K8J A;  1HTL D;  1JCK B;  4R8N A;  2PI2 A;  3PO2 H;  3PCO B;  2Q2T A;  4JI2 L;  1G2S A;  5CR3 A;  2Z8L A;  4X65 L;  1VCI A;  1BBU A;  1K3R A;  3KFU A;  2DNC A;  1MJE A;  5JJ6 A;  2WB1 G;  5I9P A;  4Y52 H;  5IYB G;  4ULL A;  3QWN A;  1GOZ A;  1A0I A;  3CUC A;  3U50 C;  1NUC A;  3DMU A;  3ND9 A;  3HKZ E;  4HID A;  2RKS A;  3CME A;  4JI6 L;  1ESR A;  1Q8K A;  1I3Q B;  2FHT A;  3DEO A;  4RGO S;  5M5X H;  1D5M C;  1ENA A;  5C44 G;  1ICW A;  1TWH H;  2QF7 A;  1HNZ Q;  2NTT A;  3BDL A;  5EGT A;  2H1E A;  5IGG A;  1IKM A;  1C48 A;  1FNU A;  4UAI A;  4FF3 A;  1IZ6 A;  1EIY B;  4L5T A;  4UP9 A;  5G3L F;  4YWK A;  4U67 3;  4BY1 B;  4A3B H;  3CCL A;  1NR4 A;  5IGD A;  1CQF A;  4LJZ C;  4WJW A;  4XT3 B;  2I07 B;  4FF2 A;  2JA7 H;  1BQQ T;  5M5W B;  3ZJY C;  3IFT A;  5HGQ A;  4UHV A;  3E0E A;  4NXM L;  1U4R A;  1L0W A;  3AB9 A;  4X3K A;  1MIU A;  2Z0S A;  3D0F A;  2A6E C;  1VQM A;  4XT1 B;  1X3Q A;  2B8F A;  2B63 H;  5NUC A;  3WOE A;  1I6V C;  3CP0 A;  4LF8 L;  1AP0 A;  2A8V A;  3S2H B;  1KQS A;  5JJI A;  3OOC A;  3L3O C;  2RCF A;  4DUZ L;  3I73 A;  3JAM E;  3STB C;  3GTM H;  3H0G H;  2IY5 B;  2KHS A;  5AFW A;  3HOX H;  1K8G A;  2MO0 A;  1CK1 A;  3K59 A;  1UWV A;  1PHJ A;  4P72 A;  5DAU A;  2IWH A;  4XQQ A;  2ZJQ A;  2F4I A;  3PMF A;  4B3R Q;  1GHK A;  3M4O B;  2SDF A;  1LTR D;  2VQF L;  4QF4 A;  1IBL L;  2X6L A;  1SN8 A;  2IHF A;  2KA7 A;  4ABN A;  1A63 A;  3VA5 A;  2VY3 A;  2HDL A;  1G6P A;  4I65 A;  1MI2 A;  1T5X D;  3U4Z A;  2O5J C;  2RHS B;  1VQ5 A;  3EVQ A;  1EYC A;  4B3S Q;  1ESF A;  1JWS D;  1P8L A;  2CW0 D;  2A73 B;  1XMQ L;  1C8C A;  3I70 A;  2H5X A;  5BN5 A;  5EBD A;  1VQH A;  4M1U B;  2EDG A;  1TY2 A;  4ME5 A;  5EKL A;  3RLO A;  5FLM H;  1YJ9 A;  3MXG A;  4DR3 L;  5KYL A;  1FJG Q;  5CYU A;  1HHV A;  2ID0 A;  2WIN B;  1S5E D;  1WTR A;  3I56 A;  1TS3 A;  4IFD G;  2R7F A;  2L55 A;  2EXD A;  2KHJ A;  2LMC B;  4DV0 Q;  2F0W A;  2A68 D;  4GOP A;  2UXB L;  3KUP A;  2QEX A;  5T1G A;  1K3B C;  4RWS C;  4NB3 A;  1HR0 Q;  3RZO H;  1VQO A;  1EOV A;  2JA5 H;  2CH4 A;  1VF5 C;  1Z47 A;  4XXE A;  3BVM A;  1N36 Q;  3NTI A;  4ITR A;  2DY8 A;  1SYF A;  4JVZ A;  4QUF A;  1WJJ A;  2AWO A;  2F0M A;  1DOM A;  1FYC A;  2B2Y C;  4KD3 A;  3SHG A;  1LTS D;  1PFS A;  2YU9 B;  4X66 L;  3E5S A;  3MVV A;  2VUM G;  5JVH 3;  1STG A;  1NH1 A;  3A56 A;  4KY7 A;  4HCE A;  4GLA C;  5C0X H;  4KHV A;  1JJG A;  3VR4 A;  2M00 A;  3A0J A;  4HSV A;  2A68 C;  4LF9 Q;  1E2V A;  2G9D A;  4FYD A;  2MFI A;  1EFI D;  2OQ0 A;  1YEZ A;  5T1I A;  1PH4 A;  5A35 A;  4DR3 Q;  1LV9 A;  3HKZ G;  5KEE A;  4YWL A;  1BBX C;  2Z1C A;  1EY0 A;  3AEV A;  4X2E A;  4I7Z C;  4QGU A;  1DON A;  2FFK B;  4LF5 Q;  2PCF B;  4AIM A;  2VQF Q;  3S1R H;  1D5X C;  1IBL Q;  1GKH A;  5HY6 A;  4JI4 Q;  1T9H A;  3Q24 A;  5M3F H;  4DV6 L;  2JA9 A;  2PYK A;  3J80 E;  2F0U A;  4KK7 A;  1NBW A;  3CCU A;  4NPS A;  2LXJ A;  5C4J H;  3HOY H;  1XPO A;  3F2U A;  5ELO A;  1EIF A;  1SJE D;  4MTK A;  4DR7 Q;  1UAP A;  2Y0S E;  2NVX H;  2F3I A;  4BBS G;  2DN8 A;  1UEB A;  4HJ8 A;  4OIK A;  1VQL A;  5I2X A;  2F03 A;  2MNA A;  4JG2 A;  4PMB A;  3STB D;  1QG7 A;  2UXD Q;  3CPF A;  5EQ0 A;  4HJ9 A;  1MSG A;  4MZ9 A;  5I6W A;  1YNN C;  2K6A A;  5I6Y A;  4RHS A;  2MJ8 A;  4JI1 L;  3P7J A;  3C1E A;  1Y8O B;  4BA2 I;  2XRS D;  2KCT A;  2A74 C;  4QUC A;  1AEX A;  5FLX L;  1SXT A;  4IUR A;  3UDG A;  4GOP C;  3I4N H;  4KKS A;  2K5D A;  2BA0 A;  3IAY A;  2BCO A;  1EU4 A;  3HOZ G;  1ET6 A;  2L12 A;  4K2K A;  3HOV G;  1GHJ A;  4BS9 A;  2X6G A;  3CU7 A;  4U68 A;  2A5H A;  1NNX A;  4DV3 L;  2FMM A;  4TSS A;  4IFD J;  1RIP A;  1HCZ A;  1TWC H;  2NTS A;  1WTQ A;  1SBB B;  2NVQ H;  1SE4 A;  2NN6 H;  2KOL A;  4X3S A;  3P1H A;  3VR3 A;  4A3L H;  2L15 A;  5GAD C;  4A93 B;  2PW5 A;  2QGQ A;  1RL2 A;  4DK0 A;  1QZH A;  2K50 A;  4CJ1 B;  5IYC H;  2DJF C;  3QB3 A;  5C4X B;  3X3M A;  1U4P A;  2YTY A;  4G7Z C;  1QJO A;  5C3E H;  2CVR A;  2JE6 I;  1B9N A;  3S1M B;  2OTL A;  2F4V Q;  2AWN A;  1JWU D;  3HOW G;  2UXC Q;  1IBK Q;  1Y1V G;  4DV0 L;  2D0P A;  2XIW A;  1VS0 A;  5COY A;  4AYB B;  1HJP A;  5IYB H;  3P75 A;  4A3M B;  1RTO A;  3J7Z C;  3HOZ H;  2SNM A;  3H94 A;  2M9V A;  3F1Z A;  5CGK A;  2RVL A;  1PTO D;  1QCB D;  2R92 H;  3ITP A;  4OX9 L;  2HIX A;  1ENF A;  2Z4H A;  2K05 A;  4H7B A;  3Q22 A;  2I0Q A;  3GTO B;  4JPB W;  1HPC A;  5CGL A;  1B3Q A;  3PUW A;  3VR6 A;  1PH1 A;  2KUM A;  3BVG A;  4LW1 A;  2E2I B;  3FKI B;  4RA8 A;  1C9O A;  2KHI A;  3HOU B;  4X3U A;  1KHI A;  4NDX A;  1A3T A;  1HA5 A;  1LM0 A;  3T1Y Q;  1TS4 A;  1SMX A;  4NXN L;  4MHE A;  3BVZ A;  4JI6 Q;  4JOI C;  2WAQ B;  1MD2 D;  4JI7 Q;  3Q8D A;  3VYS A;  1DGS A;  2N49 A;  4JI3 L;  4A3E G;  1JJC B;  4NKL A;  2Q2I A;  4ZLT F;  3D6W A;  3DWP A;  2JXM B;  4FVM A;  1KLU D;  5C6A A;  5A2Q L;  5EJW A;  3V05 A;  1WCM H;  4H02 A;  3KLS A;  3GTJ H;  1A6X A;  2MQH A;  4PZ8 A;  3QOL A;  3CCE A;  1FL0 A;  1N32 Q;  4IN3 A;  1XNR Q;  1S5C D;  4LU4 A;  3J7Y W;  4ZCK A;  1LTI D;  1R9T H;  3ERS X;  4KD4 A;  1ZKO A;  3MXP A;  3T53 B;  2D2C C;  2F0E A;  2OCE A;  2DY7 A;  4K5X A;  4QIW E;  1V9P A;  2PQA B;  2A69 D;  3CCJ A;  5JVG 3;  2E2H B;  1KNA A;  1Q46 A;  5FLX E;  3K58 A;  3MTS A;  3GO5 A;  2AUK A;  5CC4 A;  4EX5 A;  2AUJ D;  5JPM C;  4NXN Q;  3GV3 A;  4LF7 Q;  4V0B A;  1VQI A;  5K36 G;  2ZTC A;  3WOF A;  1MJC A;  4LF5 L;  2PZT A;  1S5D D;  2F3W A;  4DAP A;  2R7D A;  2YU9 H;  2E2D C;  1ASY A;  1GUO A;  2E76 C;  4DKA C;  4ZK9 B;  3CC7 A;  1F9R A;  4LFC Q;  1CHP D;  1HNW L;  4C3J H;  5ELF A;  3I4M G;  3K81 C;  4QCL A;  2HQL A;  5DM6 3;  3NPP A;  3CXC A;  3H91 A;  2MP1 A;  4K5V A;  4KN4 C;  5L37 A;  5G3L D;  5IIF A;  1BVS A;  1LTL A;  4H44 C;  2WV6 D;  2JA6 H;  2C9O A;  3DM1 A;  4L6T B;  2VB3 X;  1IKL A;  3DUZ A;  4U0U A;  2Z9H A;  1IW7 C;  3D3R A;  5JJ7 A;  2UUB Q;  1I4Q A;  4LFA L;  5COR A;  1Y1W G;  1EIH A;  3M3Y B;  4A3K H;  2H4O A;  1Q1B A;  3ERQ A;  2KCN A;  4UY8 C;  3CHB D;  3M4Y A;  3TS0 A;  4B3R L;  2F0V A;  4C3I H;  2G9H D;  1QNU A;  4LF6 L;  2O4X A;  1CSQ A;  4NMZ A;  1N36 L;  1SYC A;  2VS1 A;  1TVX A;  4A3F G;  1DOL A;  2FXQ A;  3HOV H;  2K4K A;  2K01 A;  4CDC C;  4DPG A;  3J81 j;  4JI2 Q;  1SNM A;  1D1I A;  4FXK C;  3BG3 A;  2NZO A;  2F0Q A;  4RGT A;  1NCV A;  1VMC A;  1SMY D;  4R4I A;  3H3V I;  1EY9 A;  1XWE A;  4HR7 B;  2N3S A;  4QL5 A;  2RHQ B;  3OHX C;  4N8F A;  4UDU C;  4MIU A;  3S2H H;  1J5E L;  4JI5 L;  4R8I A;  2VNU D;  2YTV A;  2Z6B A;  5EKK A;  5M3M B;  1VQ4 A;  1YHB A;  4R4Q A;  1G6Z A;  3KLS X;  1TQO A;  2V1C C;  5C5M A;  1DJR D;  2R6G A;  3PQI A;  1EFW A;  4A3K G;  2B29 A;  2UUC Q;  3M4O H;  1QWY A;  3NTK A;  3S17 H;  4LNQ A;  1V1Q A;  3PO3 G;  1Y1V H;  2EY2 A;  2L5T A;  1U4M A;  1WI5 A;  3I4N G;  1VQ9 A;  3E9H A;  3J81 i;  3TZD A;  3K0Y A;  4HIO A;  1BF4 A;  1IW7 D;  1EEF D;  2SEB D;  2GVA A;  4C3I B;  5LHY 1;  3QR8 A;  4LF9 L;  4RG1 A;  2QDL A;  1PH2 A;  3M4P A;  1F2Z A;  3U9O A;  1PTO H;  4YWM A;  1STN A;  3OMC A;  4AQY Q;  2E8G A;  1EY8 A;  5IOD A;  1RJT A;  2B2W A;  2RDG A;  2JP1 A;  1XNQ Q;  3R3O A;  3TSS A;  1G91 A;  4RCO A;  3S1R B;  4LUV A;  3EFX D;  4JI4 L;  3DHQ A;  1AE3 A;  1FNW A;  4CDE C;  4NXM Q;  3NWT A;  4H0L C;  2HQE A;  1I50 B;  1I5F A;  1KAB A;  4B3M L;  3PIO A;  1O7Z A;  1EYD A;  5C5L A;  3EN2 A;  2IX1 A;  2Q8I B;  4FF4 A;  3CMA A;  3GTQ B;  4HJ7 A;  1N33 Q;  1BCP F;  4GN3 B;  4OL7 A;  3GTP B;  1JE4 A;  3ZCB A;  2JA5 B;  2OXP A;  3QJY A;  3VYR A;  5FJ8 H;  3GTK B;  4N67 A;  4IUQ A;  4DUZ Q;  3HOU G;  4RKB A;  4QIW B;  1X3E A;  1JC7 A;  5LMU Q;  1X32 A;  5EKI A;  1D6E C;  1VF7 A;  2QCP X;  3MWY W;  5IY0 A;  1VQC A;  3V2T A;  1TS2 A;  3SK5 A;  3MXN B;  2L9H A;  4PY3 A;  1FJG L;  3WDN A;  1YHA A;  4AYB E;  1SFO B;  1RF2 D;  3TZU A;  2D5D A;  5IWA L;  4GOP B;  2R92 G;  3NSW A;  1HH2 P;  3AFP A;  5ELE A;  4WFN 3;  1RKN A;  1XPR A;  1SRU A;  1WTV A;  2MUY A;  2CKZ B;  3J81 E;  2YYZ A;  5IGB A;  3D31 A;  4DUY L;  1HR0 W;  1ZXT A;  5E4X A;  4OWX B;  5EPJ A;  4YHH L;  4A3G G;  1EL0 A;  4J15 A;  5K5P A;  3S1Q B;  1YNJ D;  4CKB A;  2JA7 G;  4DV4 Q;  3HEJ A;  3T16 A;  2CQA A;  4C56 C;  4DNR B;  1GJX A;  2VZA A;  4PNY A;  5DEH A;  1VQJ A;  2NN6 G;  3R2T A;  4CGY B;  3GV6 A;  1XNR L;  2CCZ A;  1WOC A;  2KCM A;  4HMI A;  2WB1 B;  4PMW A;  1XX8 A;  1IYU A;  1Z7T A;  5FJ8 G;  3FEW X;  1LLR D;  3D8G A;  1TS5 A;  1Q3L A;  4AQY L;  2A6E D;  4A3E H;  2K1B A;  2SOB A;  2F6S A;  1R4Q B;  4WOR A;  4QB4 A;  3KDF A;  3HOX G;  4DAV A;  1HQM C;  1HTP A;  1M90 C;  1IBK L;  1WCM G;  2Z6K A;  3D4D A;  1PTO C;  4LFA Q;  2UUB L;  3M4Q A;  4JI8 Q;  5M3F B;  4OGQ C;  1OXU A;  4K0K L;  1EYA A;  2JA8 H;  3HG9 A;  3I4M B;  3MC0 B;  4J1M A;  5D65 A;  3H6M A;  3K7A B;  2B2T C;  3K5N A;  3FPU B;  1F2L A;  3QO2 A;  1F9S A;  1DOK A;  3OW2 A;  5IGE A;  1MBY A;  4YY3 Q;  3F2C A;  1KC8 C;  5TSS A;  4JBJ A;  5IGC A;  4DNT B;  5EU0 A;  4X64 L;  1PDQ A;  5IT9 E;  3SK6 A;  3MXU A;  4R9W A;  1X54 A;  4A75 A;  4ZKC B;  1IL8 A;  2EOT A;  4IPD A;  1A3U A;  1HUM A;  2Q8R E;  3A5U A;  3PGZ A;  1B50 A;  3KJO A;  3CPW A;  1E3P A;  4QQB X;  3ZLM A;  5FK9 C;  3SVM A;  5J1Z A;  3H3V H;  3T1Y L;  2OT2 A;  1VQP A;  1V1P B;  1I4P A;  4S3S A;  1K73 C;  1JQY D;  1SE8 A;  3KLW A;  4K6D A;  1X3F A;  3J7A 5;  3J80 c;  2I5H A;  1TWG B;  4DV4 L;  1L0X B;  3K7U C;  4G4K A;  3PIO 3;  4PG3 A;  3TBI B;  1MKH A;  4JW0 A;  5JFF A;  3TP8 A;  2IX3 A;  1E2Z A;  5CV8 A;  1HZA A;  2PO4 A;  5KNB A;  4K0K Q;  4KKU A;  1PRT B;  4A3D H;  3F2D A;  2EYH A;  3LWE A;  4RKL A;  1AZQ A;  2K28 A;  1BNZ A;  3EBE A;  5GRO A;  5CV6 A;  2E2J B;  5IT9 c;  4DV1 Q;  3GTG H;  4XYQ A;  2WKC A;  4F8M A;  3W1B A;  2A69 C;  2NVT B;  3SGI A;  1B1Z A;  5A2Q E;  4L8J A;  3G48 A;  3K7A H;  1EWH A;  3K6O A;  4ZRZ A;  3C46 A;  3VYT A;  3E0J A;  4FXG C;  4BXX G;  1ENC A;  1S5B D;  3UDF A;  4N8X 1;  2EPB A;  3I4L A;  4A3C G;  2F52 A;  5AJ3 Q;  3J80 L;  3CCM A;  3TN2 A;  4P75 A;  2XN9 C;  3BYT B;  3C2P A;  3FP9 A;  1F2Y A;  1J8I A;  4JK1 C;  1QZG A;  3I4M H;  3EIV A;  2JA8 B;  1H9J A;  1NMF A;  4PZ6 A;  4K6L A;  5D3D A;  4NW2 A;  1HFG A;  4OX9 Q;  4APV A;  1O7I A;  2JQO A;  2LXK A;  3NBH B;  1F9Q A;  4OHJ A;  3A55 A;  3S2D B;  3GTJ B;  1XTC D;  4X66 Q;  2J0T D;  3NBI A;  3QG1 A;  2UXC L;  1Y14 B;  3TP7 A;  2EYL A;  5JAV A;  5KIX A;  2NVY H;  1EQT A;  3MEF A;  2RCN A;  1PYW D;  1HZ9 A;  1HNX Q;  1PH5 A;  2D62 A;  2NUD A;  4F88 A;  4B9W A;  2EVB A;  1VQB A;  5C4J B;  3HOY B;  1O80 A;  1IBM Q;  2R3Z A;  1S4Z A;  3KLR A;  4C3H H;  4QY7 A;  1JIC A;  2ZJR A;  1AFP A;  1E24 A;  3OPO A;  1I3Q H;  2CWP A;  4RAU C;  2OTJ A;  1W3S A;  3ZC7 A;  4FNF A;  3F8T A;  3K5L A;  1QOH A;  5EBC A;  3CCQ A;  3PUY A;  2B2V A;  5LMU L;  3BYY B;  2CHB D;  4O1N A;  1KIX A;  1KDB A;  2SNS A;  4HTH A;  3Q6S A;  2KBN A;  1LTT D;  4R4T A;  1SNP A;  3OIP A;  1C4Q A;  2B2U C;  3ND8 A;  1SNC A;  4R1J A;  1SFO H;  1WTX A;  3H09 A;  3HOY G;  1Q12 A;  5IWA Q;  1HUN A;  1KRT A;  1XMO L;  2B8G A;  1CTM A;  1HFN A;  1BUV T;  3HFZ B;  4K5W A;  4A3J G;  2XNA C;  2JEA I;  4Q0F A;  1PFB A;  2J7Z A;  4DR2 Q;  5EAY A;  4JI3 Q;  3CF5 A;  1J5E Q;  3GDE A;  3PSI A;  2EJG C;  1J9O A;  2NVQ B;  2EY5 A;  1S3O A;  3KBX A;  2VUM H;  2F0J A;  2F0F A;  4K8I A;  5KRU A;  3L9A X;  1DXM A;  1QVF A;  2UUC L;  1WTO A;  5C0X G;  1N34 Q;  4RMF A;  2G5D A;  4LF8 Q;  1TT2 A;  4EQ5 A;  4P2C B;  3CQZ B;  2P5Z X;  3W1G A;  4CJ2 C;  5M9O A;  2ASB A;  1IYV A;  1KTK A;  1K28 A;  1BCP B;  4U0S A;  3QIA A;  1B44 D;  4TRD A;  3S2D H;  3ER0 A;  4JYA Q;  3K0X A;  4GNX B;  5LMN Q;  3P20 A;  1E1O A;  5HUR A;  1U4L A;  3R2I A;  3HP3 A;  2O5I C;  1RCV D;  1K83 H;  3NHH A;  1PA6 A;  1TWC B;  2DGY A;  4JBW A;  2E5L Q;  2ES2 A;  5IP7 G;  2EYP A;  1CQV A;  4A76 A;  2XRQ D;  2X69 A;  5FLX c;  4P73 A;  1ILQ A;  1OXT A;  1F2M A;  4JCV E;  1STY A;  2IHE A;  1BDO A;  4KY5 A;  5IYC G;  2NVX B;  5DLQ E;  1HNZ L;  3C1F A;  4DR4 Q;  1F77 A;  1A2U A;  3T1H L;  1LT6 D;  2ZT9 C;  1EY7 A;  3NEM A;  1XJV A;  2VL6 A;  3CCS A;  2K5W A;  1ZEQ X;  2JSO A;  3S1Q H;  1ZYR C;  4MN3 A;  4TQU S;  3HOU H;  3KOJ A;  1DCZ A;  2GVB A;  4DAM A;  1Y8P B;  2ALY B;  1H9S B;  3GD7 A;  3U9S A;  1Z6H A;  4HJA A;  1I94 L;  2QDB A;  5EPL A;  5JEA J;  1PZI D;  3EQL C;  4UP7 A;  4IUV A;  2QA4 A;  4DU9 A;  1STE A;  1UE1 A;  1TWH B;  1OXX K;  4DR2 L;  1RD9 D;  2K5H A;  3J80 i;  2BE5 C;  1Z9F A;  3NQI A;  4KHZ A;  2V4D A;  1KD1 C;  1CKO A;  1GM5 A;  1ONL A;  1TWG H;  2PMZ E;  2HDM A;  2E74 C;  2OWO A;  4BWG B;  3J81 L;  3KF8 B;  3OWF A;  4M16 A;  1EOT A;  1OO9 B;  5ISR A;  4KKT A;  5LL6 S;  1D2B A;  1K8O A;  1GUT A;  3OMG A;  1O7Y A;  2KCC A;  4ODG A;  1I50 H;  1Q8I A;  2N55 A;  4CKE A;  4L63 B;  2ZXP A;  1A8V A;  1JR0 D;  3N6R A;  3RZD H;  2BH8 A;  1CA5 A;  2RDH A;  4DFA A;  4ALP A;  4JI5 Q;  3VR2 A;  2IJ0 A;  1D5Z C;  2JA5 G;  1VQK A;  3AYH B;  5KNC A;  4A4I A;  1WD0 A;  4B3T Q;  4YCU A;  1VQE A;  1HZB A;  1Y1W H;  3NP8 A;  3HOW B;  3CAM A;  1ILP A;  2F0I A;  1I6H H;  3SE5 A;  3CRK C;  1MSH A;  5JFZ A;  1WFQ A;  1V8Q A;  4RHR A;  3FVQ A;  2Q2U A;  4B3M Q;  3B6Y A;  5CV5 A;  1JE5 A;  2F1M A;  1CI3 M;  4KV6 A;  4KY6 A;  3UE1 A;  1LT4 D;  2A1A A;  3ICE A;  3MXN A;  3Q23 A;  2RDF A;  1C7Y A;  4HSP A;  3T51 B;  2VQE L;  3NXW A;  1LO5 D;  2E2H H;  4A3E B;  2XSC A;  1O78 A;  4YCW A;  4POF A;  3PIP A;  5C4Z A;  2JJQ A;  1Q1E A;  4X64 Q;  4GKJ Q;  1NE3 A;  2K32 A;  5ELC A;  1GVP A;  4QMG A;  1RHP A;  1DD2 A;  4PZ7 A;  1PRT F;  4IPG A;  4IZ8 A;  2NVY B;  1N34 L;  2F0K A;  2YV5 A;  1CHQ D;  1RTN A;  1PYS B;  1CKN B;  4X2D A;  1IBM L;  3V96 A;  3BDO A;  3DXJ C;  4A3J B;  3H0G G;  1ET9 A;  2Y0S B;  1L1O C;  2JA6 G;  4DV3 Q;  5M3M G;  4OEL B;  5I4D A;  4LUO A;  5ELD A;  1X9N A;  4OWT B;  1I4R A;  4A3J H;  1WTW A;  1SDF A;  1PH3 A;  4B3T L;  2RSO A;  2LY7 A;  3R8B A;  5CV7 A;  1A3V A;  1EU3 A;  4IPH A;  3G6E A;  4XQJ A;  1TWA H;  2LS0 1;  2UU9 Q;  1XYI A;  2F0N A;  4NP5 A;  4XQN A;  5CKL A;  1WVL A;  4DN4 M;  2IX0 A;  1TU2 B;  5IYD H;  5C3X A;  1AN8 A;  2ZXR A;  2CQO A;  4C3I G;  3S24 A;  4HJ5 A;  4YCV A;  1NMG A;  3NWS A;  2KEN A;  1G51 A;  3KK7 A;  2CWA A;  2VQE Q;  4A3F B;  5LL6 X;  3HZX A;  3KF6 B;  3SE0 A;  1JOQ A;  3S6A A;  4XTC S;  4DV5 Q;  3RZD B;  5FLM G;  1VQD A;  1N9W A;  2QIL A;  1K0R A;  2QW7 A;  2B2Y A;  4L5R C;  2E2I H;  1W6K A;  3W3A A;  2OF1 A;  3IL8 A;  4H13 C;  2LSS A;  4G7H C;  4C3J G;  4J8Q A;  3CC2 A;  1L2F A;  1PZK D;  3HS0 C;  1I4G A;  1EYG A;  1L0Y B;  3FMC A;  3KJP A;  1CM9 A;  1VQ7 A;  4WGJ A;  2F3V A;  3UDX A;  5IP7 H;  1X56 A;  4DV6 Q;  4IPC A;  3LNN A;  4JC0 A;  2CW0 C;  1X3G A;  3LET A;  2E2J H;  1LAB A;  3SK4 A;  4X62 Q;  4A93 H;  4L5Q A;  3NEN A;  2PZU A;  2F0D A;  2R7Z H;  2F0L A;  2WFW A;  5CBA E;  2LKV A;  1EQQ A;  1PH8 A;  4KHP Q;  4C1N I;  2F0G A;  2K14 A;  3CW2 C;  4OWW B;  1GUG A;  2NUN A;  1E7Z A;  1B53 A;  3TRZ A;  4HIK A;  2I46 A;  5IGF A;  3RN5 A;  2EY6 A;  1B4O A;  5CV9 A;  3PO2 G;  2HHH L;  4PMC A;  2JK8 A;  2ZTE A;  4Y7N B;  2F0O A;  4JI8 L;  3CCR A;  2PPB C;  1I6H B;  4JI1 Q;  1I4H A;  1YIJ A;  1HNX L;  3HOW H;  3SEB A;  2KQ3 A;  3AMU A;  3G71 A;  3RD4 A;  2PQE A;  3E9I A;  1R9T B;  2B2U A;  4ILW A;  3OWE B;  4DK3 C;  3JAM L;  2EIF A;  4A3I H;  2I5M X;  4DAY A;  1UE5 A;  4PV1 C;  2XWJ B;  3ZYY X;  4CJ0 B;  1CA6 A;  2R93 B;  5JJK A;  3G7L A;  4BY7 B;  1TWF B;  5J39 A;  4C3H G;  1A15 A;  1X6O A;  2MGS A;  5IP9 G;  4FDB A;  1H9M A;  1EWC A;  3TP6 A;  1B7Y B;  1N8R C;  3EJI A;  1WYD A;  3OYY A;  4A3B G;  5I2Y A;  1H9R A;  2L1B A;  1U5K A;  1SSO A;  1EZ8 A;  4UP8 A;  2HIV A;  5KND A;  4FF1 A;  4I7A A;  1EY4 A;  2HT1 A;  2K5Q A;  4DV5 L;  4POG A;  5D14 A;  1LYL A;  2VXW A;  1GUS A;  3DLL A;  1HZC A;  2K52 A;  1EY6 A;  1IXR A;  3FDT A;  5LMN L;  2JA7 B;  1JB7 A;  4BY1 H;  4A3B B;  1QNK A;  3SK8 A;  4O42 A;  4DV7 L;  4WJ3 M;  3CKI B;  1JWM D;  2N78 A;  3A7L A;  1SYB A;  2Z4I A;  1ROD A;  2TMP A;  3PUX A;  4X62 L;  2R92 B;  1G2T A;  4XDX A;  3QOJ A;  3TEH B;  1K8A C;  4U04 A;  5J3B A;  4DAY B;  4DUY Q;  3S16 H;  5M5X B;  4DR4 L;  2KED A;  1YNN D;  1I4X A;  4YIJ A;  4HED A;  4OON A;  4LF4 L;  4EQO A;  5FO8 B;  3TS2 A;  2GA4 B;  4ID6 A;  2UXD L;  2JA6 B;  1NJI C;  1BO0 A;  5M5Y H;  5JJL A;  4DV2 Q;  1MHW C;  2E5L L;  3S9W A;  4WJ4 A;  1PXU A;  3RN2 A;  2NVT H;  4Y7N H;  2ICE C;  2K75 A;  2OQK A;  1II3 A;  3MEH A;  3GP7 A;  1YBY A;  1CKN A;  3ONA B;  3A8I E;  4DXF A;  1YZ6 A;  2WII B;  2B63 G;  1NY4 A;  1KAW A;  4B08 A;  3NUC A;  3A54 A;  4BBS B;  4BBR G;  5JPN C;  2YTX A;  1K9M C;  5E1F A;  4IUU A;  4A3G B;  3MZ5 A;  4CKC A;  2JYO A;  1TWF H;  5KGU A;  2XTI A;  3MA2 B;  2NBF A;  1PH6 A;  1PMR A;  1E22 A;  5CV4 A;  5E3F A;  2KVM A;  2K03 A;  4B9X A;  1KLG D;  2PMZ B;  3I2Z A;  1QVG A;  2BE5 D;  5C4X H;  2DUD A;  3VDY A;  3U4V A;  3I4N B;  4Q5V A;  2UUA Q;  1I94 Q;  4JOI A;  4YY3 L;  1TR5 A;  4GKK Q;  4KHP L;  1UEA B;  5ELN A;  1ML0 D;  5IYD G;  1U0L A;  1PRT C;  1KAA A;  1SE2 A;  5KYI A;  2AQ1 B;  2FMC A;  2PQA A;  5DNF A;  1WCM B;  2IL8 A;  2HHH Q;  4BA1 I;  2GN5 A;  2HUG A;  1Y69 U;  1KXL A;  4B3S L;  1BXT A;  2NZH A;  1FD7 D;  1ZYR D;  3K80 C;  1G29 1;  3D4R A;  3HGB A;  2NN6 I;  2AQ3 B;  1PYB A;  4KMU C;  1SYE A;  1LT5 D;  1JMC A;  3L0O A;  3I4O A;  2NB0 A;  4LFC L;  4O2D A;  3OSO A;  1HNW Q;  4EQN A;  1CZG A;  1A2T A;  5GAH C;  1A62 A;  4GN4 B;  1V43 A;  4P74 A;  1X65 A;  4HMJ A;  2EJF C;  4KN7 C;  1OXV A;  2ZTD A;  1VQF A;  2WB1 E;  2G03 A;  3TDQ A;  1D1K A;  1VQA A;  3GTM B;  4F87 A;  1SYG A;  4DR6 L;  3W2D A;  1EQR A;  1VQG A;  1FNV A;  1STB A;  3UDI A;  2EQS A;  1PLF A;  2AKW B;  2F0S A;  1QB5 D;  3O13 A;  3TRE A;  2RSN A;  3ULL A;  3MFY A;  2K7V A;  3GTO H;  1B8A A;  1V1P A;  2HCC A;  4QJF A;  3AFQ A;  3TP5 A;  3OTO L;  4CHT B;  3PO3 H;  3E6Z X;  2EZV A;  2WAQ E;  3ULJ A;  2R93 H;  1VQ8 A;  1KL9 A;  4A3I G;  1EWI A;  2F0H A;  3JC6 6;  3GTK H;  4HAE A;  2A19 A;  5K36 H;  2RA4 A;  4C2M B;  3BDC A;  3SHL A;  4X65 Q;  2EYM A;  4IJH A;  4OXP A;  2D9U A;  3PO2 B;  1H9S A;  2EYO A;  1GD7 A;  1STA A;  3S15 H;  4IFD I;  5GAG C;  5M3F G;  4GKJ L;  1FGB D;  1EEI D;  3K5O A;  4E6I A;  4P71 A;  1FVI A;  5C3E B;  3PF4 A;  3RZO B;  1N32 L;  1QUQ B;  3HOZ B;  1AE2 A;  3NE5 B;  3OIQ A;  3L7Z C;  4XIG S;  3IRB A;  1BR9 A;  1JOK A;  4LF4 Q;  2ZXO A;  1CUK A;  3PF5 A;  3OW7 A;  3HKS A;  4G7O C;  1P16 A;  4LMQ D;  3D4W A;  3ULP A;  1C0A A;  2C5C A;  4ZKB B;  4A3I B;  4DK6 C;  1Q82 C;  3X3N A;  3JAM i;  1YVC A;  2FIN B;  2BDN A;  3CCV A;  4UPA A;  4IUN A;  4EGV A;  2ZJP A;  2B2V C;  2OEO A;  3J81 c;  1D7Q A;  4A3M G;  1YJN A;  1NSN S;  2K33 A;  2NWG A;  3A5Z B;  2VB2 X;  1Y1W B;  1MGS A;  2IT1 A;  1WTH A;  2A6H D; 
#chains in the Genus database with same CATH homology
 4BXX H;  1WI5 A;  2B63 H;  3I4N G;  1VQ9 A;  4LFB Q;  3E9H A;  3J81 i;  3D0F A;  1I50 H;  4HIO A;  1N33 L;  1YHQ A;  2GVA A;  3CP0 A;  4LF8 L;  4A3F H;  1A8V A;  3RZD H;  2BH8 A;  4LF9 L;  4RG1 A;  5IP9 H;  4ALP A;  1PH2 A;  4JI5 Q;  3M4P A;  4DR5 Q;  2A8V A;  1KQS A;  1UE6 A;  1KRS A;  5JJI A;  4YWM A;  2AHO B;  2JA5 G;  2BH2 A;  4DUZ L;  1VQK A;  4AQY Q;  2E8G A;  3AYH B;  3STB C;  3GTM H;  3H0G H;  2IY5 B;  4A4I A;  3HOX H;  1EUJ A;  4B3T Q;  3M7N A;  4YCU A;  1K8G A;  1XNQ Q;  2MO0 A;  1VQE A;  1HZB A;  1UWV A;  4LF7 L;  4LUV A;  4JI4 L;  1PHJ A;  1Y1W H;  1AE3 A;  4P72 A;  3CAM A;  2ZJQ A;  4NXM Q;  1I6H H;  3SE5 A;  4B3R Q;  4A3B H;  3L2P A;  1Q7Y C;  1PV4 A;  4A3L G;  2VQF L;  1IBL L;  1XPU A;  2UXB Q;  4HIM A;  5JFZ A;  1I5F A;  4B3M L;  1SN8 A;  1WFQ A;  3PIO A;  2I5L X;  2IHF A;  3EN2 A;  2IX1 A;  2Q2U A;  1A63 A;  4B3M Q;  3B6Y A;  1YIT A;  1JE5 A;  4MNO A;  5C3E G;  3CMA A;  1UE7 A;  2VY3 A;  4DR1 L;  1S40 A;  3UE1 A;  4JI0 L;  1G6P A;  4HJ7 A;  1N33 Q;  1JJ2 A;  4GN3 B;  2A1A A;  3U4Z A;  3G4S A;  3ZCB A;  4O0A A;  2RHS B;  3BU2 A;  4YHH Q;  4IO9 A;  1VQ5 A;  3ICE A;  1C7Y A;  4JBM A;  4GNX C;  5FJ8 H;  2VQE L;  4B3S Q;  1P8L A;  2E2H H;  1XMQ L;  2H5X A;  4N67 A;  4YCW A;  4POF A;  3PIP A;  4DUZ Q;  3HOU G;  1VQH A;  1X3E A;  1Q1E A;  2JJQ A;  5LMU Q;  4X64 Q;  4GKJ Q;  1NE3 A;  3RLO A;  5FLM H;  1YJ9 A;  4LWC A;  1GVP A;  5CMT A;  4DR3 L;  5IY0 A;  5H1S E;  1VQC A;  1FJG Q;  2ID0 A;  4PZ7 A;  1YI2 A;  1YNX A;  4IPG A;  2MO1 A;  1N34 L;  3I7F A;  3MXN B;  3I56 A;  4IFD G;  4DV1 L;  2YV5 A;  4PY3 A;  2EXD A;  2KHJ A;  2R7F A;  1FJG L;  4DV0 Q;  1J6Q A;  1PYS B;  1CKN B;  1YHA A;  4AYB E;  4GOP A;  4X2D A;  2UXB L;  2AMC B;  5IWA L;  2QEX A;  4GOP B;  2R92 G;  3RZO H;  4NB3 A;  1HR0 Q;  1VQO A;  1IBM L;  5C4X G;  1EOV A;  2JA5 H;  1HH2 P;  4X2C A;  3AFP A;  1XPR A;  1SRU A;  4LF6 Q;  1Z47 A;  1L1O A;  2CKZ B;  2YYZ A;  3H0G G;  3D31 A;  1QVC A;  4DUY L;  1N36 Q;  1HR0 W;  1L1O C;  4ITR A;  4DV3 Q;  5M3M G;  2JA6 G;  2K5N A;  4LUO A;  4OWX B;  4YHH L;  1X9N A;  4A3G G;  4J15 A;  4OWT B;  4A3J H;  1PH3 A;  4B3T L;  1WJJ A;  2AWO A;  2JA7 G;  4DV4 Q;  4X6A H;  1PVO A;  3SHG A;  4IPH A;  2VZA A;  3NEL A;  3G6E A;  5C0X I;  1PFS A;  1TWA H;  3DM3 A;  2UU9 Q;  4X66 L;  1VQJ A;  2NN6 G;  1S72 A;  2VUM G;  5CKL A;  1XNR L;  2CCZ A;  1WOC A;  2KCM A;  3M3Y H;  2IX0 A;  1PH7 A;  4PMW A;  4BY7 G;  5IYD H;  3F2B A;  2JEB I;  1OTC A;  3TQY A;  1CSP A;  4GLA C;  3JAM c;  2CQO A;  3S24 A;  4HJ5 A;  5FJ8 G;  4YCV A;  1NMG A;  2KEN A;  3FKI G;  1G51 A;  1JJG A;  3A0J A;  2CWA A;  2VQE Q;  4AQY L;  4JV5 L;  3KF6 B;  4A3E H;  2WAQ G;  3S1M H;  3S6A A;  4LF9 Q;  4XTC S;  5E7N A;  1B70 B;  4DV5 Q;  4LUZ A;  1VQD A;  5FLM G;  2F6S A;  1N9W A;  2PI2 E;  3GTL H;  2MFI A;  2OQ0 A;  1YEZ A;  1K0R A;  1PH4 A;  3KDF A;  3HOX G;  4DR3 Q;  4KLK A;  2E2I H;  3HKZ G;  4L5R C;  4YWL A;  1IBK L;  1M90 C;  1WCM G;  2Z6K A;  4DV7 Q;  3AEV A;  2LSS A;  4X2E A;  4QGU A;  4LFA Q;  2UUB L;  3M4Q A;  1NTG A;  4JI8 Q;  4LF5 Q;  4TVA B;  3CC2 A;  4AIM A;  2VQF Q;  1L2F A;  1OXU A;  3S1R H;  1IBL Q;  1GKH A;  4XI8 A;  5HY6 A;  4JI4 Q;  1T9H A;  1EYG A;  3KJP A;  5M3F H;  2JA9 A;  4DV6 L;  3KF6 A;  1VQ7 A;  4K0K L;  4AYB G;  4WGJ A;  3AQQ A;  2JA8 H;  3CC4 A;  3UDX A;  2XGT A;  1NBW A;  2C35 B;  3BZC A;  4NPS A;  1X56 A;  2LXJ A;  4IPC A;  5IP7 H;  3CCU A;  4DV6 Q;  1HR0 L;  4JC0 A;  4A3D G;  1X3G A;  5C4J H;  3LET A;  1XPO A;  3HOY H;  3BJU A;  5ELO A;  3N3U A;  2E2J H;  1EIF A;  4DR7 Q;  4X62 Q;  3OW2 A;  4A3G H;  2Y0S E;  2NVX H;  2F3I A;  4A93 H;  4L5Q A;  1UEB A;  4HJ8 A;  3NEN A;  4BBS G;  1VQL A;  2R7Z H;  2Y0S G;  4YY3 Q;  2WFW A;  3F2C A;  2MNA A;  1KC8 C;  4JG2 A;  2D0O A;  3STB D;  1EQQ A;  4JBJ A;  1PH8 A;  4KHP Q;  1AH9 A;  5EU0 A;  4L5S A;  2UXD Q;  3CPF A;  4HJ9 A;  4X64 L;  2K14 A;  3CW2 C;  5BR8 L;  4OWW B;  1E7Z A;  3TRZ A;  1X54 A;  4MZ9 A;  4HIK A;  4A75 A;  1XMQ Q;  3RN5 A;  1Q81 C;  1IL2 A;  3PO2 G;  4IPD A;  2HHH L;  4JI1 L;  2JK8 A;  2ZTE A;  3FHW A;  1L1O B;  3A5U A;  4GS3 A;  4JI8 L;  3PGZ A;  3CCR A;  4BA2 I;  2KCT A;  4JI1 Q;  3KJO A;  1E3P A;  3CPW A;  3ZLM A;  1YIJ A;  1HNX L;  3HOW H;  1Q86 C;  4QQB X;  3H3V H;  5JEA G;  3G71 A;  3T1Y L;  3E9I A;  3UDG A;  1VQP A;  3S1N H;  4DK3 C;  4DNI A;  4GOP C;  3I4N H;  1K73 C;  2BA0 A;  2EIF A;  1XMO Q;  4A3I H;  1SE8 A;  2I5M X;  3KLW A;  1UE5 A;  4DR5 L;  4BBR H;  1X3F A;  4U07 A;  3HOZ G;  5JJK A;  3J7A 5;  3J80 c;  3HOV G;  2I5H A;  3RLN A;  1X6O A;  4R4O A;  5IP9 G;  1SLJ A;  5M3M H;  2ZM6 Q;  4DV4 L;  3K7U C;  4FDB A;  2RF4 A;  4DV3 L;  1Y1V H;  5M5W H;  1B7Y B;  3KYH C;  1N8R C;  4PG3 A;  4IFD J;  4U0Z A;  1MKH A;  1RIP A;  2B3G A;  5JFF A;  2Q2H A;  1BBW A;  1TWC H;  2K5V A;  1WYD A;  3OYY A;  1HZA A;  2NVQ H;  4A3B G;  4K0K Q;  3H15 A;  4IOA A;  2ATW A;  4A3D H;  3F2D A;  4DV2 L;  3CD6 A;  1U5K A;  3EBE A;  5GRO A;  5IT9 c;  4A3L H;  4DV1 Q;  2L15 A;  1PH9 A;  3GTG H;  3PV0 A;  4UP8 A;  5GAD C;  5C44 H;  3W1B A;  4DR1 Q;  4A3M H;  2QGQ A;  2HIV A;  1RL2 A;  3SGI A;  1QZH A;  2K50 A;  3BZK A;  4GKK L;  5IYC H;  3G48 A;  3K7A H;  3WWV A;  2YTY A;  2HT1 A;  5C3E H;  4POG A;  4DV5 L;  4BXX G;  2JE6 I;  1LYL A;  2R93 G;  3DLL A;  3UDF A;  2F4V L;  1HZC A;  2K52 A;  3CQZ H;  1IXR A;  5LMN L;  1FGU A;  4A3C G;  2F52 A;  3A74 A;  5AJ3 Q;  2OTL A;  2F4V Q;  2AWN A;  3CCM A;  4IOC A;  1M1K C;  4P75 A;  3HOW G;  1JB7 A;  4BY1 H;  2UXC Q;  1IBK Q;  1W2B A;  1Y1V G;  4DV7 L;  4DV0 L;  4WJ3 M;  2D0P A;  2N78 A;  1VS0 A;  3FP9 A;  1HJP A;  5IYB H;  1CKM A;  3J7Z C;  3SN9 A;  3HOZ H;  3PUX A;  4X62 L;  1BKB A;  3F1Z A;  5IE8 A;  1QZG A;  3I4M H;  4LFB L;  3TEH B;  3EIV A;  1K8A C;  4U04 A;  5J3B A;  4DAY B;  2R92 H;  1NMF A;  4PZ6 A;  4DUY Q;  4OX9 L;  3OTO Q;  2HIX A;  3LGJ A;  2VW9 A;  2I0Q A;  3S16 H;  4AH6 A;  5GQO A;  4DR4 L;  4A93 G;  1X55 A;  5CGL A;  3PUW A;  2ZM6 L;  3GTP H;  4OX9 Q;  4OON A;  4APV A;  1PH1 A;  4LF4 L;  2R7Z G;  1O7I A;  3GTQ H;  2JQO A;  2LXK A;  4LW1 A;  3NBH B;  5LMN W;  3TS2 A;  1VQN A;  1C9O A;  2KHI A;  2UXD L;  1VQ6 A;  2UU9 L;  1NJI C;  4X66 Q;  5M5Y H;  5JJL A;  4DV2 Q;  2E5L L;  1KHI A;  4WJ4 A;  2UXC L;  1ASZ A;  1Y14 B;  2WP8 J;  1LM0 A;  3RN2 A;  3T1Y Q;  1SMX A;  2NVT H;  4NXN L;  4Y7N H;  4DR6 Q;  4R4C A;  3PUZ A;  2K75 A;  2OQK A;  2NVY H;  1YBY A;  3MEF A;  4KI0 A;  2RCN A;  1HNX Q;  1CKN A;  1HZ9 A;  1PH5 A;  1YZ6 A;  2D62 A;  3M85 A;  2B63 G;  1NY4 A;  4JI6 Q;  1KAW A;  4JOI C;  1VQB A;  4BBR G;  4A3C H;  1LUZ A;  1IBM Q;  2CFM A;  2YTX A;  3RNU A;  1K9M C;  4JI7 Q;  3Q8D A;  1DGS A;  2N49 A;  4C3H H;  4QY7 A;  4OO1 I;  2ZJR A;  4JI3 L;  4A3E G;  4MTN A;  1JJC B;  1E24 A;  2Q2I A;  1I3Q H;  2CWP A;  1TWF H;  4IJL A;  4OO1 G;  2OTJ A;  1W3S A;  3ZC7 A;  3F8T A;  1E1T A;  3I55 A;  4GLX A;  3U58 A;  2XTI A;  1TXY A;  3PUV A;  1PH6 A;  3CCQ A;  3PUY A;  5LMU L;  1E22 A;  1KIX A;  1WCM H;  4H02 A;  4C2M H;  3GTJ H;  2MQH A;  2KBN A;  4PZ8 A;  4R4T A;  1XNQ L;  3I2Z A;  1QVG A;  3CCE A;  1FL0 A;  1N32 Q;  4R1J A;  5C4X H;  1SFO H;  2DUD A;  1XNR Q;  4GN5 A;  3RR5 A;  5C0X J;  3VDY A;  3U4V A;  4LU4 A;  2UUA Q;  1Q12 A;  5IWA Q;  3HOY G;  1KRT A;  4JOI A;  1R9T H;  1I94 Q;  4YY3 L;  1SRO A;  3ERS X;  1XMO L;  4GKK Q;  2PNH A;  3HFZ B;  4KHP L;  4ME3 A;  2OCE A;  5ELN A;  4A3J G;  5IYD G;  2JEA I;  1U0L A;  4JBK A;  4QIW E;  4JV5 Q;  1JT8 A;  4DR2 Q;  1V9P A;  1IYJ B;  2PQA B;  5EAY A;  4JI3 Q;  3CCJ A;  3CF5 A;  1OXS C;  1J5E Q;  2N8N A;  2PQA A;  1Q46 A;  2BA1 A;  3KDF B;  2HHH Q;  4BA1 I;  3S14 H;  2GN5 A;  3GO5 A;  3GDE A;  3PSI A;  1KXL A;  4BY1 G;  4B3S L;  1S3O A;  4EX5 A;  2VUM H;  4NXN Q;  2NZH A;  4LF7 Q;  5K36 G;  1VQI A;  2ZTC A;  3K80 C;  1D8L A;  1MJC A;  1G29 1;  4LF5 L;  2NN6 I;  2YU9 H;  2R7D A;  1GO3 E;  1QVF A;  1H95 A;  1ASY A;  1PYB A;  4DKA C;  3CC7 A;  2UUC L;  4LFC Q;  1HNW L;  5C0X G;  4C3J H;  1JMC A;  3I4M G;  3K81 C;  3L0O A;  1SR3 A;  2HQL A;  3I4O A;  4LFC L;  4O2D A;  1N34 Q;  1HNW Q;  4RMF A;  3CXC A;  1QUQ A;  4JI7 L;  4LF8 Q;  4EQ5 A;  2UUA L;  3W1G A;  5GAH C;  1A62 A;  2ASB A;  4GN4 B;  2JA8 G;  4DR7 L;  1V43 A;  4P74 A;  1X65 A;  3T1H Q;  3PO3 G;  1BVS A;  1LTL A;  4U0S A;  2JA6 H;  3K8A A;  3ER0 A;  3S2D H;  1OXV A;  2ZTD A;  4JYA Q;  1VQF A;  2WB1 E;  3K0X A;  4GNX B;  2G03 A;  5LMN Q;  1VQA A;  4GLV B;  5AJ3 L;  1E1O A;  4GNX A;  4JYA L;  4U0U A;  3RLF A;  5BR8 Q;  1K83 H;  1PA6 A;  2DGY A;  4DR6 L;  5JJ7 A;  2Z6K C;  2UUB Q;  1EQR A;  4LFA L;  1VQG A;  1XTD A;  4JBW A;  1YJW A;  2E5L Q;  2ES2 A;  5IP7 G;  4A76 A;  1Y1W G;  3UDI A;  2EQS A;  2AKW B;  5FLX c;  4P73 A;  3TRE A;  3ULL A;  3M9B A;  1OXT A;  4A3K H;  5GAE C;  1Q1B A;  4JCV E;  3UE0 A;  2IHE A;  3GTO H;  4BBS H;  1B8A A;  4BY7 H;  4UY8 C;  4QJF A;  3TS0 A;  4B3R L;  5IYC G;  3AFQ A;  5DLQ E;  1HNZ L;  4C3I H;  3OTO L;  3PO3 H;  4LF6 L;  4DR4 Q;  1CSQ A;  2WAQ E;  3FKI H;  3ULJ A;  1N36 L;  3W5O A;  2R93 H;  3T1H L;  1VQ8 A;  1KL9 A;  4A3I G;  1EWI A;  3JC6 6;  3NEM A;  4JI0 Q;  1XJV A;  2VS1 A;  2VL6 A;  3CCS A;  3GTK H;  2A19 A;  4A3F G;  2PI2 A;  3PO2 H;  3PCO B;  2FXQ A;  3HOV H;  4X65 Q;  2Q2T A;  4JI2 L;  4IJH A;  3S1Q H;  4OXP A;  4TQU S;  2K4K A;  3HOU H;  3KOJ A;  4DPG A;  3J81 j;  4JI2 Q;  4X65 L;  2GVB A;  1VCI A;  1BBU A;  1GD7 A;  1K3R A;  3KFU A;  3S15 H;  4DAM A;  2ALY B;  2NZO A;  1MJE A;  5JJ6 A;  2WB1 G;  3GD7 A;  4IFD I;  4Y52 H;  5IYB G;  5GAG C;  5M3F G;  4R4I A;  4GKJ L;  3H3V I;  1A0I A;  4HJA A;  3CUC A;  4P71 A;  3U50 C;  1FVI A;  1I94 L;  3PF4 A;  3HKZ E;  5JEA J;  1QUQ B;  4HID A;  1AE2 A;  4UP7 A;  2N3S A;  2QA4 A;  1N32 L;  3L7Z C;  4QL5 A;  3IRB A;  4XIG S;  2RHQ B;  3CME A;  4LF4 Q;  4JI6 L;  1UE1 A;  1CUK A;  1Q8K A;  1OXX K;  4DR2 L;  5M5X H;  5C44 G;  3PF5 A;  1HNZ Q;  3HKS A;  3S2H H;  1TWH H;  2K5H A;  1J5E L;  1P16 A;  4JI5 L;  3J80 i;  3ULP A;  1Z9F A;  2VNU D;  1C0A A;  4KHZ A;  2YTV A;  1KD1 C;  4DK6 C;  1IZ6 A;  1CKO A;  1GM5 A;  1Q82 C;  1VQ4 A;  1YHB A;  4L5T A;  4UP9 A;  4YWK A;  1YVC A;  4R4Q A;  3JAM i;  1EIY B;  3CCV A;  3CCL A;  2V1C C;  1TWG H;  2PMZ E;  2JA7 H;  2R6G A;  4UPA A;  2ZJP A;  2OWO A;  1EFW A;  4A3K G;  3J81 c;  2B29 A;  3ZJY C;  2UUC Q;  5HGQ A;  3KF8 B;  1D7Q A;  3E0E A;  4NXM L;  4M16 A;  3M4O H;  1L0W A;  4A3M G;  1YJN A;  3S17 H;  3A5Z B;  1MIU A;  4LNQ A;  2Z0S A;  1V1Q A;  2IT1 A;  1VQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...