2VY3A

Type iv secretion system effector protein bepa
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
291
structure length
291
Chain Sequence
EIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCSHDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMPEMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHPFREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDISNPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYIIGNIDHLPPEQLKILKPGDKITFTAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL FILAMENTATION PROTEIN
publication title Fic Domain Catalyzed Adenylylation: Insight Provided by the Structural Analysis of the Type Iv Secretion System Effector Bepa.
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Cell adhesion
total genus 86
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 2vy3A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vy3A02
5JJ6A 3PIPA 2YV5A 4DR5Q 1XMQL 4JI7Q 2B63G 2IX0A 2E5LL 2EIFA 2NZHA 4AQYQ 3A0JA 5C44H 5IP7G 4X62L 1Y1WG 1XNRQ 5JJ7A 1X3GA 2PQAA 4DV4L 4AIMA 1Q1BA 4U0ZA 1TXYA 4P73A 5JEAJ 1QVGA 3HFZB 4ITRA 1TWFH 2Z6KC 3FKIG 3ULPA 2VQFL 5LMNL 1PYSB 4LF4Q 4AH6A 3CCVA 4TVAB 2K14A 1TWAH 1J5EL 3HOZG 2GN5A 3M7NA 1WYDA 2R7DA 4B3TQ 1NMGA 4PZ8A 2Q2HA 2B29A 2L15A 3EN2A 1X3EA 4JCVE 4A93G 1X55A 3L7ZC 3T1HQ 2JA5H 4L5TA 4UY8C 2EQSA 3H0GG 3ICEA 3J81c 2FXQA 4AYBE 4BXXG 5ELOA 3S15H 3E9IA 2F52A 3TREA 2LSSA 4R4QA 1YJNA 2YU9H 4LF5Q 2IY5B 1YHBA 3DM3A 1G6PA 3ERSX 2HT1A 1E24A 4QY7A 4ME3A 2BH8A 4NPSA 1FGUA 4XIGS 2AMCB 4HIMA 2NZOA 4POGA 1P8LA 4JBKA 4A3IH 1PH5A 1VQFA 1E7ZA 2IX1A 2WB1E 4OX9Q 1L2FA 1UE1A 1XTDA 3K81C 4OONA 5FLMH 1K8AC 3G4SA 4YWLA 1I5FA 3PUVA 3OTOL 2ES2A 3HOYG 2PNHA 2UXDL 2F4VL 1YNXA 1N36Q 1LYLA 1Q46A 4U07A 3CW2C 3GTGH 1RIPA 3KDFB 5C0XI 4GN4B 3PUZA 2JA8G 1KRSA 3HOXG 4LWCA 1EIYB 4DV7L 1FJGL 4JYAL 3U4ZA 4GNXB 1Q86C 1GVPA 4LFBL 3STBD 1YI2A 2YTVA 4JI4L 3ZCBA 3PGZA 2MNAA 4KLKA 1A63A 1PH8A 4NXNL 1VQ9A 5C44G 1VCIA 5FJ8H 4R4IA 4DR2Q 4IOCA 2BA1A 2R92H 4DUZL 4LF9Q 3J80c 4OXPA 1L1OC 1XMOL 1KC8C 2GVAA 4PY3A 3KDFA 2ZJPA 2E5LQ 4L5RC 1N9WA 4IJHA 3ULLA 4LFCL 1QVFA 4DV3L 4X2DA 3GTKH 4DV1Q 1X9NA 4GNXA 1YIJA 1U5KA 4IFDJ 3HKSA 4JI5Q 2A8VA 4GOPC 2VQFQ 5LMNQ 2JJQA 4QIWE 4A3CH 5JEAG 4Y52H 3BJUA 3RNUA 1I3QH 2F3IA 1HNZL 4P71A 1A62A 4JI1L 3PO2H 3K80C 3M85A 4DV6L 1E1OA 1PH4A 1I6HH 3WWVA 2EXDA 3S14H 4YHHL 4A3LH 2MQHA 4LU4A 3CCUA 4B3ML 3SHGA 5EAYA 4KI0A 5GADC 3TS2A 4X66L 5FLMG 4LF6L 2ATWA 5BR8L 3PF4A 1VQIA 4JC0A 3JAMi 4LFAL 4EQ5A 5GAHC 1KAWA 4C3IH 1EIFA 4OWTB 4HIKA 2ZJQA 4OO1G 5E7NA 5M5XH 1JT8A 2VZAA 1VQJA 3STBC 3M9BA 4R4CA 1JJCB 2IHFA 2NVXH 1A0IA 1YEZA 2IHEA 2YYZA 1E3PA 2WP8J 1OXSC 4WGJA 4RG1A 4H02A 3UDXA 3LETA 3F2DA 1ASZA 2F4VQ 4O0AA 2LXJA 5C4XH 3CMAA 1GO3E 3CMEA 2HHHL 3CP0A 1C0AA 1C9OA 5GAEC 2R93G 2ASBA 1DGSA 2NN6G 3I2ZA 3S1QH 4A75A 5FJ8G 4IPDA 3HOUH 4JOIA 4DV7Q 4U04A 4JYAQ 1OTCA 4LFBQ 2UU9L 3L2PA 1X6OA 4GLVB 2HIXA 4O2DA 4NXNQ 4OWXB 1HZAA 2UUCL 3SN9A 1VQMA 3F2CA 4HJ5A 2KBNA 1E22A 1OXXK 1VS0A 3KF6B 1UEBA 4QL5A 2JA6H 3LGJA 1KXLA 2UXCQ 4DR6L 4APVA 4A3EG 4DR3L 3GTLH 4LFCQ 5C0XJ 3F2BA 4JBMA 1NBWA 2N3SA 1KQSA 3S24A 3K7UC 2AWOA 3RR5A 3AEVA 1EQRA 1NY4A 3HOVG 1SLJA 2AKWB 5M3FH 4K0KL 1LM0A 2VQEL 2R7ZG 4A3FG 1YHQA 4LNQA 1WCMG 3GTOH 3G71A 4IFDG 3PO2G 1B70B 2OCEA 3KF6A 3RLNA 3M4PA 4DV2L 1XPRA 1N8RC 1H95A 1IYJB 4A3GH 2E2JH 4BY1H 4A3LG 3W1BA 4DUYL 1HNZQ 2HQLA 4JI1Q 3TS0A 1TWGH 2KHIA 5GROA 3ZC7A 2A1AA 3ULJA 4DV6Q 1VQ4A 4LF7Q 5IE8A 1EOVA 4MNOA 2CWAA 2K5VA 5IYCH 1X3FA 3PF5A 2ZTEA 2F6SA 5IT9c 2A19A 4UP7A 4B3MQ 2RF4A 5CKLA 2UUBQ 5BR8Q 1QZGA 4B3RL 1AH9A 1U0LA 4BY7H 4LFAQ 4HJ9A 5HY6A 3E0EA 3GTJH 4RMFA 4X65L 3D31A 2JQOA 1VQPA 1CKOA 3J81j 1PFSA 3UDGA 2CFMA 3S2DH 4A3JH 2QEXA 2CWPA 1N34L 1FVIA 3CPWA 3TQYA 5JFZA 4JI6L 2HIVA 4QJFA 2Q2UA 3CCEA 3HOUG 5CGLA 4BA1I 2OQKA 1D8LA 1P16A 2KENA 4XTCS 1EWIA 4UP9A 3ZJYC 2RHSB 2K50A 3S2HH 5C3EH 4X64L 4KHPQ 4GN3B 5M5YH 4JI8L 4GNXC 4PMWA 2UU9Q 1I94L 3PO3H 4Y7NH 4B3SQ 1KD1C 5J3BA 4NXMQ 4R1JA 1IBMQ 5H1SE 1K73C 1JJGA 4IPHA 4JBJA 3CCMA 2KCMA 4HJ7A 4A3KH 5JJLA 2ZTCA 2WAQG 3GTQH 4GKKL 2JK8A 1XMQQ 5M3FG 1SE8A 3PUWA 3BZCA 1VQOA 4N67A 5M3MH 4JV5L 1HJPA 3CXCA 2QA4A 4X62Q 3I4MH 5CMTA 1PH9A 4DV4Q 1VQNA 4LF8L 3MEFA 4R4OA 2I5HA 5HGQA 4BA2I 3GTMH 2D0PA 1VQLA 4A3GG 4GN5A 4DV5L 4BY1G 2NVYH 1R9TH 4K0KQ 1O7IA 5IP9H 1HZCA 2NVTH 3S1RH 5C0XG 2VQEQ 2JA5G 1NJIC 1RL2A 1PHJA 3I4OA 1J5EQ 4DV2Q 4C3HH 4LUVA 5IYCG 5C4JH 2MO0A 1JJ2A 1L1OB 5ELNA 4DR5L 2BH2A 1HNWL 3RN2A 3G48A 3H3VH 4DK6C 1HZ9A 4LUZA 1UE7A 1YBYA 2H5XA 4AQYL 1XNRL 1CSQA 4IOAA 2K5HA 1S3OA 3CC2A 4IPCA 2JEBI 2WFWA 4YY3L 4PG3A 4A3IG 2JEAI 4GKJL 3KYHC 3ER0A 1SROA 5IYDH 2OQ0A 1PV4A 3S1NH 4DR1L 2D0OA 3NELA 4A3JG 1HNXL 1Y1WH 1K0RA 1M90C 2N8NA 3CPFA 3S17H 1UWVA 4NB3A 3RLOA 4X65Q 4DV0L 1L1OA 2Q2TA 1LTLA 4JI0L 1JB7A 2K4KA 1HR0W 3FKIH 3OYYA 3RLFA 4HIOA 1N34Q 4YCUA 4LUOA 5C3EG 4JI6Q 2NN6I 3OTOQ 4P74A 1VQHA 2AWNA 2YTYA 1IXRA 2UXDQ 1Q8KA 3HOWH 4LF5L 2MFIA 1JMCA 1N32L 4X6AH 1KRTA 1X54A 3PSIA 3PO3G 4A3DH 3HKZE 3IRBA 3RZDH 3OW2A 1PVOA 1M1KC 3F8TA 3S16H 1SR3A 4X64Q 2R92G 1FJGQ 3E9HA 2VL6A 1XNQL 1X65A 2RHQB 4P75A 1QZHA 3S6AA 1MKHA 1V9PA 4JI4Q 3TEHB 5M3MG 3CC7A 2VUMH 1XPOA 3I4NH 3A74A 1I50H 1PH1A 2UUAL 1OXTA 3I4MG 3NENA 1MJEA 3TRZA 3VDYA 2AHOB 3KFUA 3PV0A 1EYGA 4DUZQ 1YJ9A 1VQBA 5DLQE 4GKKQ 1XMOQ 1AE3A 1N36L 2GVBA 2ZM6L 1BBUA 1S40A 5IP9G 4JV5Q 2V1CC 1NMFA 1X56A 3MXNB 4DV3Q 3CCQA 5LMUL 4U0SA 3SE5A 4LF8Q 1CUKA 3CF5A 1GM5A 2E2IH 4A3CG 4BBRH 1W2BA 5AJ3L 1QUQB 1E1TA 1UE5A 4DV5Q 1D7QA 2WAQE 4JBWA 2JA7H 4U0UA 3PUYA 2OWOA 2PMZE 4YCWA 5IWAL 2JA8H 4GLAC 2OTJA 3HOXH 1S72A 3K8AA 3NEMA 3FHWA 3J7ZC 2IT1A 4R4TA 3B6YA 5FLXc 4HJAA 4MTNA 5IYBH 5IYDG 4LF9L 3AYHB 3L0OA 1GD7A 1Q12A 3Q8DA 4P72A 1OXVA 1QVCA 3EIVA 4C2MH 3GD7A 3BU2A 3KJOA 2UXBL 2K5NA 1QUQA 4YY3Q 4DV1L 1IBKL 4YHHQ 4GKJQ 4DR7L 1HR0L 1JE5A 1G291 3CCLA 4JI5L 4UPAA 2CQOA 4DR4L 4DR1Q 1IBLL 1HNXQ 4X66Q 3G6EA 2E2HH 1EQQA 4LF6Q 4QQBX 1MJCA 1Z9FA 3HKZG 1T9HA 2C35B 3HOWG 4DV0Q 5C4XG 4IO9A 5JJKA 4A3DG 4JI0Q 3U50C 1K83H 3CQZH 1CSPA 4L5SA 2K75A 1A8VA 1SRUA 3KF8B 3CUCA 2LXKA 3J7A5 3FP9A 1Q1EA 2HHHQ 2Z6KA 1N32Q 2PI2E 1SFOH 2VUMG 1VQ8A 3I4NG 1VQDA 1W3SA 1YITA 2CCZA 1VQ5A 1Y14B 1C7YA 3EBEA 4YCVA 2KCTA 1IL2A 2JA6G 4JI2L 1XNQQ 1WFQA 3J81i 3S1MH 3M4OH 2G03A 2DGYA 1VQ6A 2Y0SG 2N49A 1IZ6A 3K7AH 3I55A 2UUAQ 4A3BH 1PYBA 2UUCQ 4POFA 3H15A 2ID0A 3M4QA 1VQAA 4DPGA 2PI2A 3K0XA 4BBRG 4MZ9A 3PIOA 4X2CA 1ASYA 2JA7G 2ZM6Q 2I0QA 3UDIA 4DR6Q 4DR3Q 2MO1A 3CD6A 4XI8A 1SMXA 5LMUQ 4BBSH 3ZLMA 1WJJA 3UDFA 1YHAA 2VY3A 2K52A 4YWMA 3BZKA 3T1YL 1Q7YC 3CC4A 5AJ3Q 3CCJA 4A3MH 1OXUA 2CKZB 1N33L 5IYBG 3GTPH 2VNUD 4KHZA 1PA6A 4X2EA 1TWCH 1YVCA 4DNIA 4OWWB 3F1ZA 2R93H 4WJ3M 3I7FA 5IWAQ 3M3YH 4UP8A 1B8AA 1VQ7A 4A4IA 3CCRA 1K8GA 3PUXA 4JI3L 3NBHB 1K9MC 1K3RA 4PZ6A 4JI7L 1AE2A 4DUYQ 1G51A 2UXCL 3PCOB 3JAMc 1Y1VH 2R6GA 4J15A 3RZOH 1YZ6A 4BY7G 2UXBQ 4WJ4A 2R7FA 1IBKQ 2RCNA 3U58A 4DR7Q 3GDEA 2DUDA 1HR0Q 2B63H 4OO1I 1MIUA 3RN5A 4GOPB 4GLXA 5M5WH 3N3UA 3J80i 1XPUA 3KOJA 4DR4Q 1IBLQ 4A3EH 4C3JH 4AYBG 1WI5A 1CKNB 2VS1A 3A5ZB 3GO5A 5IP7H 4HIDA 1EUJA 4LF4L 4B3RQ 4PZ7A 2Z0SA 3SGIA 4JOIC 4L5QA 1Z47A 4B3TL 3HOVH 1V1QA 3I56A 1HZBA 1TWHH 1VQCA 4IJLA 3T1HL 1BBWA 4GS3A 1L0WA 3CAMA 4TQUS 3DLLA 5LMNW 1WCMH 4A3FH 1Q82C 2R7ZH 3HOZH 2JE6I 3AFPA 5K36G 4IPGA 5GAGC 2WB1G 4DK3C 4LF7L 4DAMA 4GOPA 1EFWA 1NE3A 4FDBA 1KIXA 3CCSA 4A76A 4ALPA 4A93H 1CKNA 1V43A 5JJIA 5JFFA 3KLWA 3UE0A 1VQGA 1PH7A 4A3BG 2Q2IA 4QGUA 4A3KG 4M16A 2BA0A 3H0GH 2UUBL 3W5OA 4BXXH 4JI2Q 1KL9A 4JI8Q 3KJPA 1YJWA 1SN8A 2D62A 2E8GA 3AFQA 2ALYB 1PH6A 1I94Q 3UE1A 3U4VA 4OX9L 1UE6A 4LW1A 1CKMA 4BBSG 2NVQH 3W1GA 2N78A 4EX5A 2XTIA 1KHIA 2I5MX 1BKBA 4A3MG 2B3GA 4YWKA 2ZJRA 2OTLA 4DKAC 1VQKA 1B7YB 1BVSA 3H3VI 1NTGA 3D0FA 2Y0SE 2ZTDA 3T1YQ 4IFDI 3HOYH 3JC66 2JA9A 2KHJA 2PQAB 2VW9A 2QGQA 4KHPL 4JG2A 1PH3A 1GKHA 5IY0A 2YTXA 1N33Q 4DAYB 1PH2A 1HH2P 4HJ8A 4B3SL 1J6QA 1LUZA 1IBML 4NXML 1XJVA 2XGTA 1Y1VG 5GQOA 1VQEA 1Q81C 3AQQA 2I5LX 4DR2L 4JI3Q 5EU0A 1WOCA 3A5UA 1FL0A 1HNWQ
chains in the Genus database with same CATH superfamily
5JJ6A 2B63G 2XNAC 4DR5Q 2E5LL 2NZHA 1G8ZD 5C44H 1Y1WG 2B2YC 5JJ7A 5J1ZA 3KLRA 5C44B 4P73A 1TXYA 3HFZB 3FKIG 5I2YA 5CV5A 2E2HB 4TVAB 1TWAH 1IW7C 1WYDA 5CV6A 5I9PA 3EN2A 4NP5A 3L7ZC 2JA5H 1UUPA 2SDFA 3H0GG 3T56B 5COYA 4BXXG 2PZUA 4X3TA 3S15H 2F52A 3SK4A 4R4QA 1YJNA 1YHBA 1IYUA 3DM3A 4P2CB 3S15B 4CKBA 1SFOB 5A2QL 2KOLA 2L12A 2NZOA 4H44C 2WB1E 2OT2A 3M4OB 1XTDA 3ND8A 3K7AB 3G4SA 3TMEA 1KDCA 1B3QA 2C9OA 2UXDL 5I6YA 3R2IA 1LYLA 1Q46A 1WD1A 1H9MA 4IN3A 1O78A 1RIPA 3K5NA 3KDFB 5C0XI 4GN4B 2EJFC 1C48A 1EIYB 4JYAL 3U4ZA 4LFBL 1SYCA 1DXMA 3MXPA 3PGZA 3GTPB 4KLKA 4NXNL 1VCIA 3EQLC 1K8MA 1RCVD 4DUZL 2ZJPA 1MSGA 4IJHA 1S5FD 4RCOA 1PZID 4DV1Q 4IFDJ 4JI5Q 4RAUC 3R93A 2J4XA 5LMNQ 4CJ2C 4XQNA 4ID6A 4XXEA 2F0KA 1A62A 4RKBA 4KD3A 3PO2H 3FDTA 3K80C 4UAIA 1E1OA 1PH4A 1I6HH 3WWVA 2R7ZB 3K5MA 4YHHL 3MA2B 3HOZB 3PO2B 1I6HB 5FK9C 3TS2A 5FLMG 4I7ZC 4EQ5A 1KAWA 1STYA 5E7NA 1JT8A 5FLXL 1VQJA 2F0LA 4R4CA 1TS5A 3EROA 3X3NA 1E3PA 3DWPA 4F87A 4U68A 1QNKA 1GO3E 2CH4W 2BDNA 4PMBA 1J9OA 3I2ZA 1G2SA 1ZEQX 4IPDA 2F1MA 2B2UA 5CC4A 4K2KA 1X6OA 4ZCKA 4RGMA 1LACA 3DMUA 2F4IA 5D3DA 1OXXK 1PRTD 1UEBA 3LGJA 1KXLA 4HAEA 2UXCQ 4DR6L 1EY5A 4DR3L 4LFCQ 4KY6A 2KCCA 3F2BA 4JBMA 1NBWA 3Q0AA 2AWOA 1NY4A 2O5JC 1LM0A 5LHY1 1RF2D 2LS01 4A3FG 1YHQA 4R8NA 1WCMG 4F8MA 4OGQC 3G71A 4U673 1TIID 1B70B 3RLNA 3M4PA 4WORA 1XPRA 5KYLA 1IYJB 3MAQA 2E2JH 4A3LG 5C5LA 1MHWC 3MXNA 2E2JB 2CH4A 3QIAA 4HR7B 3VYRA 5IE8A 2K5DA 4MNOA 2K5VA 1X3FA 2R3ZA 3PF5A 5IT9c 4B3MQ 1I4GA 4LMQD 1QZGA 4V190 5G3LD 4X65L 3NP8A 3J81j 1PFSA 4C1NK 4IUVA 3C3LA 2EY5A 2QEXA 1F2YA 2F0UA 3JAML 4JI6L 5JFZA 2ZT9C 5M9OA 1D8LA 3K0YA 1PRTC 1EWIA 3ZJYC 1CM9A 2K50A 2J0TD 5C3EH 2PZTA 4KHVA 3H94A 4GN3B 2EYPA 4JI8L 4GNXC 4PMWA 2KQ3A 1BO0A 4Y7NH 1KD1C 4R1JA 4Y7NB 4RGTA 4A3KH 1F77A 3J7YW 2WAQG 3DM1A 3GTQH 4JPBW 1U9RA 2R92B 3BZCA 1NAPA 1WTVA 2OEOA 3I4MH 1PH9A 1LTRD 1KNEA 1VQNA 1LABA 1STBA 1T5XD 2B39A 4R4OA 3I4MB 3GTKB 1CZGA 2RQXA 2NVYH 2NVTH 2JA5G 1K0SA 3D4WA 2NVTB 4IQZA 4LUVA 5ELNA 1LT4D 3G48A 1F9QA 2H5XA 1XNRL 1CSQA 4IOAA 2K5HA 3CC2A 4IPCA 2JEBI 2WKDA 1Y8OB 4K8JA 5J39A 4JW0A 1LLRD 1UNSA 2EYJA 2OQ0A 1PYWD 1PV4A 1NNXA 3LX0A 1H9KA 4A3JG 2PQEA 1GUTA 5CV9A 4KJOA 1IKMA 4M1UB 4C3IB 1JB7A 1HR0W 2UXDQ 2DNCA 3HOWH 3L9AX 1N32L 4X6AH 3PO3G 2K28A 3HOWB 3IRBA 3OW2A 3D4RA 1LT6D 1M1KC 3F8TA 1WTQA 3N52A 1SR3A 4IUNA 4X64Q 1XNQL 3K58A 1V9PA 5IGGA 1QWYA 5ELCA 4IUQA 1GHKA 1PH1A 4FF1A 2M00A 3OMCA 1MJEA 3KFUA 4DUZQ 4KN4C 2K33A 4GKKQ 1MI2A 2ZM6L 1N36L 5IP9G 5K5PA 1I4HA 1CI3M 5LMUL 4U0SA 2MGSA 1F9RA 1Q90A 4BBRH 5AJ3L 4DV5Q 2WAQE 2L9HA 1AW7A 3PUYA 5JJZA 5EPKA 5IWAL 2EPBA 3OMGA 2OTJA 3HOXH 3K8AA 3NEMA 4M8AA 2X6LA 4X3KA 3B6YA 2Z1CA 4LF9L 4MTNA 5IYDG 3AYHB 1Q12A 1AFPA 1Y8PB 3C1FA 2E2DC 4PMCA 1QUQA 4YY3Q 1IBKL 2QEJC 1TWGB 4YHHQ 4RKLA 4GKJQ 1HR0L 1G291 3WOEA 4DR4L 4DR1Q 3G6EA 2F3WA 5J22A 3KLSA 3IKJA 5ELEA 2KJXA 3J80L 5EKKA 2E74C 1CK1A 4L5SA 3P20A 3SE0A 3BG3A 3KF8B 2HUGA 3CRKC 3CUCA 2LXKA 4F88A 1VQDA 1VQ5A 5K36H 1C7YA 1JQYD 2KCTA 2Z8LA 2G03A 4KKSA 4UHVA 3K59A 4J1MA 2KECA 3IFDA 1NCVA 3H15A 3UI2A 3L3OC 1PTOF 1X3QA 3G6JB 1HUNA 3R3OA 1PFNA 4DR6Q 4DR3Q 2MO1A 4XI8A 1PTOH 1WTHA 4RA8A 3T1YL 3CC4A 1SE3A 1Q7YC 4X3SA 2XIWA 3CCJA 4OELB 5IYBG 2IL8A 2EJGC 1WTXA 4X2EA 1R9TB 3F1ZA 2F3VA 1GOZA 4UP8A 3CCRA 4IZ8A 1PFMA 4ZQ3A 2OXPA 4C3HB 1RD9D 4EQOA 1AE2A 1BNZA 3V05A 3RZOH 2UXBQ 2R7FA 1DOKA 3RZOB 4DR7Q 2DUDA 2B63H 3RN5A 5M5WH 1NSNS 4A3EH 4C3JH 2VS1A 1KABA 4HEDA 3S1NB 1B3AA 4IUPA 1QE6A 3SGIA 5JVG3 1Y1WB 1Z47A 2B2UC 3S17B 1HZBA 1S4ZA 1JWUD 4NMZA 1GUWA 1EY0A 4IJLA 3M7GA 3FKIB 5LMNW 1Q82C 4EGVA 1EZ6A 2O2LD 3CCSA 3I70A 1CKNA 1V43A 2QF7A 3KLWA 1BXTA 4A3KG 3RZDB 3H0GH 2UUBL 2K1BA 4XYOA 3IAYA 1CHPD 4DF7A 3W5OA 4BXXH 2KHSA 4JI2Q 4JI8Q 1YJWA 5CV4A 1SN8A 2E8GA 3H0GB 1PH6A 2ALYB 1QOHA 3U4VA 1UE6A 1CKMA 3IL8A 2NVQH 5L37A 2XTIA 4KJNA 4A3MG 2EYOA 4NW2A 1K8OA 1HA5A 1HXYD 3OOCA 1CTMA 1NTGA 2F0JA 2PO4A 2IPKD 1ESRA 1N33Q 2A68D 1PZJD 3I90A 1XMQL 3URYA 2FMMA 2IX0A 2EIFA 1XNRQ 5EPJA 2PQAA 3J7AV 4NDXA 1Q1BA 4BWGB 1TWFH 3ULPA 2TSSA 5LMNL 1J5EL 2R7DA 4PZ8A 2Q2HA 1SYEA 2L15A 3ERQA 1X3EA 4H13C 2XVSA 4L5TA 2EQSA 4N9TA 3J81c 1RJTA 2YU9H 1EEFD 4HMJA 2IWHA 4ME3A 1W6KA 2BH8A 4CGYB 4HIMA 1LTGD 3BDCA 4POGA 1PH5A 4DK0A 1E7ZA 3H6MA 3MFYA 5FLMH 1K8AC 3PUVA 3OTOL 3HOYG 1I4PA 1YNXA 1N36Q 3CW2C 4EQPA 4IUTA 1AP0A 2E76C 1KRSA 4WJWA 3HOXG 4LWCA 1TS2A 2XWBB 3OW7A 1B9MA 3ZCBA 4OL7A 1A63A 2F0WA 3LWEA 1VQ9A 1YNJC 1QNUA 4R4IA 4DR2Q 1JB3A 2BA1A 4LF9Q 4PQXA 1KC8C 4PY3A 1H9SB 4ZUJA 4K8IA 3ULLA 3G7LA 2PCFB 1STAA 4LFCL 1HA6A 3CHBD 4DV3L 3T13A 3H3VC 2A6HD 4GNXA 1YIJA 1HFGA 4QMGA 3MWYW 4GOPC 5HURA 1D2BA 2JP1A 1NUCA 5FKAC 1I4XA 4DNRB 4Y52H 4FF2A 3BJUA 1BCPC 1I3QH 1ENFA 2F3IA 4C56C 3D6CA 1EY4A 1TWHB 1I3QB 1A3UA 4A3FB 4MTKA 1SYBA 1WCMB 4A3LH 5NUCA 1HFNA 2HQEA 2K5QA 3CCUA 4B3ML 3SVMA 3SHGA 1E2VA 3PF4A 3PQIA 3JAMi 3QWNA 4JC0A 5GAHC 4KD4A 1EIFA 2ZJQA 4OO1G 2H1EA 4DAPA 3M9BA 2FFKB 2K7VA 1YEZA 1G2TA 2IHEA 2A69D 2WP8J 1AZPA 3A55A 1SYFA 4RG1A 3UDXA 3LETA 1ASZA 2F4VQ 4B08A 1GJXA 2X6GA 1JOKA 4OEMB 3CP0A 2O4XA 1C9OA 4L8JA 1DGSA 2NN6G 2D9UA 3S1QH 3E5SA 3NQIA 2Q8IB 4A75A 1V1PB 4DV7Q 1EFID 1S5DD 2ZXPA 2BE5C 1HZAA 2UUCL 2I46A 5ELBA 4HJ5A 3NUCA 2JA6H 2WINB 3SDZA 3KF6B 4QL5A 4HCEA 4FO2A 1MSHA 4A3EG 4C3JG 4KY7A 3GTLH 5C0XJ 2D5DA 3GTLB 2N3SA 4IUUA 3S24A 1EIHA 3AEVA 1EQRA 2AKWB 1AN8A 1B50A 2HD3A 3BVZA 4IFDG 2JSOA 1H95A 1GUOA 1N8RC 1TWAB 1CA6A 4L6TB 3BDLA 1HNZQ 4XDXA 1SJHD 2KHIA 2JA5B 2XRQD 3ULJA 1EOVA 1LTTD 2F6SA 2A19A 3NSWA 5CKLA 1SDFA 2UUBQ 5BR8Q 4BY7H 4LFAQ 3MFGA 5EBCA 3S2DH 2MHVA 2EVBA 4A3JH 3VYUA 3TQYA 4ZKCB 2HIVA 4QJFA 4A3JB 3CCEA 2D2CC 3NXWA 2OQKA 2KENA 1PXUA 5LL6X 2B8FA 5DM63 3E3XA 1CQVA 5KNDA 3DEPA 3VR2A 4K5VA 4WFN3 1OO9B 4X64L 2AQ2B 1U4LA 2UU9Q 3PO3H 4ZUIA 1TY0A 5C3XA 5C3WA 3PO3B 4HJ7A 4JVZA 5JJLA 2ZTCA 4GKKL 4QUFA 1XMQQ 5BN5A 1SE8A 5M3FG 1XWEA 3CXCA 1F9PA 5CMTA 1SYGA 3GTMH 2D0PA 1VQLA 1ONLA 4DV5L 4BY1G 4K0KQ 5CV8A 1O7IA 2F0EA 5IP9H 1HZCA 3GTMB 4ZKBB 3SEBA 1RL2A 1J5EQ 3I4OA 1ZXTA 3AMUA 3NTIA 4DV2Q 1EY6A 1Z6HA 2KA7A 5IT9E 1JJ2A 1HNWL 3ZYYX 4K6DA 4PV1C 4DK6C 4LUZA 2RCFA 4AQYL 4QF4A 1SYDA 4YY3L 1PZKD 2JEAI 4GKJL 3ER0A 1SROA 3HRZC 5IYDH 1JORA 5DAUA 1ZYRD 4DR1L 4EVOA 4LK1C 2N8NA 1L1OA 2Q2TA 5E3FA 3TP7A 2K4KA 4CBVA 1VMCA 3Q6SA 1N34Q 4LUOA 2L4NA 5F2DA 2NN6I 3OTOQ 4P74A 1JWSD 1IXRA 4IURA 1KRTA 3PSIA 3HKZE 4RH6A 1PVOA 3P1HA 2KUMA 3KBXA 1X65A 2QW7A 1TVXA 3TEHB 5M3MG 4H7BA 3A74A 1I50H 4XQQA 4ILWA 1OXTA 2R61A 1JOOA 1I50B 3VDYA 1EYGA 1YJ9A 5HGTA 1AE3A 2GVBA 1S40A 1DONA 1BUVT 1NMFA 2M2LA 4DV3Q 2CVRA 3W2DA 2TMPA 5IGBA 4K6LA 5E4XA 4X3UA 1UE5A 1D7QA 2F0HA 4YIJA 4U0UA 3JAME 2OWOA 1E2ZA 2J7ZA 2PMZE 3I91A 4K2LA 1LTID 1PMRA 2JA8H 2SNSA 3E6ZX 3FHWA 3J7ZC 1JICA 2EY6A 3T51B 5FLXc 5IYBH 2RDGA 5JOBA 1LTSD 3LWUA 1MD2D 2UXBL 4OIJA 1D5ZC 2EYHA 2AUKA 1KLGD 5I4DA 3CRLC 1EYCA 1KAAA 4PNYA 4DR7L 3CCLA 2CQOA 1HNXQ 4QQBX 1EQQA 3BVMA 1Z9FA 1T9HA 4DV0Q 2JXMB 4IO9A 5JJKA 1K83H 3CQZH 1CSPA 1MBYA 2K75A 2MJ8A 1SRUA 1E2WA 1Q1EA 5LL6S 4EQNA 4XT1B 1VQ8A 1ET9A 2CCZA 4YCVA 5C3EB 2JA6G 1IL2A 4JI2L 3V2TA 1PRTF 1WFQA 3J81i 3S1MH 1G6ZA 4K5WA 2DGYA 3I55A 3NWSA 1PYBA 3S1MB 2UUCQ 2EYMA 1TT2A 1VQAA 4A3KB 1CFMA 3BS1A 3GTQB 1ASYA 2JA7G 1F2MA 3UDIA 3CD6A 3RD4A 1STGA 2VY3A 5CV7A 3OPOA 2DY8A 5KIXA 2A6ED 1OXUA 4A3MH 1N33L 1TWCH 2NVYB 4OWWB 4QB4A 2R93H 2SOBA 1D1IA 3I7FA 1VQ7A 3PUXA 2CW0D 4PZ6A 1CA5A 1EY7A 3A8JE 1G51A 3JAMc 1CT1D 2AQ3B 4J15A 4BY7G 4WJ4A 1V1OA 1SSOA 3DEOA 2RCNA 3QJYA 3A8IE 1MIUA 1EU4A 3N3UA 3SXHA 3CU7A 3MXUA 1IBLQ 4H0LC 4HIDA 1HRJA 3NBHA 2RDFA 2Z0SA 4L5QA 3HOVH 1FGBD 3I56A 1UEAB 2MPMA 3DLLA 4L5RC 1JCKB 2WKCA 2FINB 3H09A 4DK3C 1RHPA 3MC0B 5E1FA 4Q5VA 4GOPA 4RGNA 4BS9A 1NE3A 4WRDA 2RSOA 4A76A 4ALPA 3NTKA 3UE0A 4A3BG 2Q2IA 4QGUA 4M16A 4FF3A 1E0BA 3KJPA 3I8ZA 2SEBD 1SEBD 4KKUA 1MGSA 4LW1A 4BBSG 2N78A 2F0DA 3EFXD 5A35A 2CW0C 2I5MX 2B3GA 3O13A 2Y0SB 3H3VI 1EY8A 3OSOA 4DFAA 2ZTDA 2M9VA 3HOYH 2JA9A 2KHJA 2VW9A 2QGQA 4KHPL 1ICWA 4BBRB 2YTXA 5IY0A 3HOYB 4B3SL 2NTSA 1QG7A 1IBML 2VB2X 1Y1VG 3HG9A 5CMDA 1Q81C 3AQQA 1DCZA 1SXTA 4DR2L 1FD7D 1WOCA 3HOXB 1FL0A 1HNWQ 2PW5A 3PIPA 2YV5A 5I6WA 1FNUA 4AQYQ 2G9HD 3A0JA 1XX8A 5IP7G 3NHHA 4I65A 1V1PA 4AIMA 1PTOD 4U0ZA 4DAYA 5JEAJ 4CDEC 4ITRA 2Z6KC 4G4KA 4LF4Q 4AH6A 3I72A 3CCVA 2K14A 3HOZG 2GN5A 3M7NA 1SNQA 1NMGA 1FNVA 1QILA 5EPLA 4CHTB 3KBGA 1K3BC 4JCVE 5E4WC 1X55A 4A93G 3T1HQ 4UY8C 1ENAA 3T16A 3ICEA 2FXQA 3E9IA 2QCPX 4JK1C 3ERSX 2DJGC 3GV6A 4NPSA 5CGKA 4XIGS 1SNMA 2K04A 4JBKA 3I4LA 4A3IH 2WB1B 2C5CA 4OX9Q 1TU2B 4FF4A 3D3RA 4OONA 1QCBD 4YWLA 3NWTA 3MVVA 2F4VL 2Z4IA 4OO1H 3BYYB 4DN4M 1GUGA 1TKWB 3GTGH 2B2WC 3PUZA 2JA8G 3GTGB 2PNRC 1PTOB 4DV7L 1TR5A 3KUPA 3AU7A 1GVPA 1Q86C 4GZYC 3STBD 1YI2A 1EWHA 1S5BD 2YTVA 3MZ5A 2MNAA 2NN6H 1GUNA 3VYSA 4S3SA 1LO5D 3GQBA 3OHXC 4LAAA 4IOCA 3T4AC 1HPCA 3J80c 1L1OC 2GVAA 3KDFA 1H9JA 4X2DA 1BR9A 2A8VA 2B63B 2VQFQ 5M5WB 3J81E 4A3EB 4C3JB 4QIWE 1VF7A 3F2UA 4A3CH 4I7AA 1F9SA 1C4QA 3TSSA 2F0SA 3BZDB 1HNZL 4P71A 3OIPA 3WDNA 1STNA 4IFDH 5IGDA 1L0YB 1WTRA 2JYOA 4TRDA 2EXDA 2F0NA 2LFNA 1SMYD 3S14H 5D65A 2MQHA 4LU4A 3S14B 2F0TA 5EAYA 5GADC 4X66L 2ATWA 5BR8L 1LV9A 1YNND 1VQIA 4LFAL 1EL0A 4DGZA 4HIKA 1EWCA 5M5XH 2VZAA 3STBC 1A0IA 2YYZA 5M5XB 3F2DA 2NVQB 1R4PB 4O0AA 5C4XH 3CMAA 2NZ1D 5KNCA 1I6VC 1C0AA 3KLSX 5GAEC 2ASBA 2R93G 5EQ0A 1I4QA 4CDDC 3DHQA 5FJ8G 4JOIA 5FO9B 4U04A 1OTCA 2UU9L 3L2PA 4GLVB 3D6WA 4OWXB 3ITPA 3SN9A 3F2CA 2KBNA 1E22A 1VS0A 4R8IA 4K5XA 3OIQA 4ABNA 3LNNA 4F7XA 1EYAA 2EY1A 3RR5A 3HOVG 2RA4A 1NR2A 4RFBA 5M3FH 4K0KL 1F2LA 1RKNA 3SK5A 1Y69U 1TWFB 3GTOH 1BBXC 2V4DA 3SR1A 4DV2L 2L0CA 4BY1H 3W1BA 4DUYL 4BY1B 1DJRD 4ULLA 4JI1Q 5CR3A 4RHSA 5GROA 4DV6Q 3ZC7A 1VQ4A 2RBMA 4C3IG 1K28A 2ZTEA 2YU9B 4UP7A 2RF4A 3IFTA 1SNCA 3FPUB 4B3RL 1AH9A 4HJ9A 3E0EA 3D31A 2JQOA 1JC7A 1CKOA 1UAPA 3ONAB 1VQPA 3NK9A 2CWPA 1N34L 2Q2UA 2PZWA 3HOUG 5CGLA 3DWAA 4BA1I 2A68C 3TDQA 4XTCS 3NPPA 2PPBC 1B44D 2AQ1B 2XWJB 4KTAA 3BDOA 1BDOA 4KHPQ 1KTKA 5M5YH 4B3SQ 1CZWA 1IBMQ 3K6OA 1ET6A 2KCMA 1TS4A 4ODGA 2JK8A 4MHEA 3PUWA 5M3MH 1HJPA 2QA4A 3FPPA 1D6EC 5M3MB 3ND9A 3MEFA 1HCZA 1B53A 4A3GG 5C4ZA 1G91A 1LT3D 4E6IA 3S1RH 5C0XG 2VQEQ 3J7AF 2B2TC 1NJIC 1PHJA 3S1RB 3D8GA 2ENBA 2BH2A 5IYCG 5C4JH 2MO0A 1DD2A 3H3VH 1UE7A 1YBYA 3VR4A 2ZXOA 1HHVA 2NB0A 1GUSA 2WFWA 4A3IG 3KYHC 1BCPF 5DEHA 2D0OA 3EVQA 1PLFA 1L0XB 1RDPD 1Z7TA 3MEHA 1HNXL 3CPFA 3RLOA 4DV0L 1WD0A 1LTLA 1XYIA 5ELDA 3RLFA 3A7AB 4HIOA 5IGEA 1IHZA 1VQHA 1Q8KA 4LF5L 1JMCA 1X54A 4CDCC 1DOMA 4DXGA 2A6HC 4TKOB 2SNMA 3S1QB 5IGCA 3PMFA 2RHQB 1QZHA 3S6AA 4FXKC 3CC7A 4DK1A 1TS3A 4J6HA 1DZ1A 3NENA 3TRZA 2AHOB 2NUDA 3PV0A 1V8QA 1BBUA 1DM0B 2JA6B 4JV5Q 5A2QE 1GHJA 1X56A 3CCQA 3SE5A 4LF8Q 1WTPA 2E2IH 2O5IC 4A3CG 1W2BA 3HS0C 2WAQB 1QUQB 3BVGA 4JBWA 2JA7H 2E2IB 2VXWA 5CORA 3VA5A 2JA7B 1RTNA 2BOSA 4GLAC 3QO2A 1A3VA 1BQQT 1IKLA 4IALA 1U4RA 4HJAA 1CQFA 3L0OA 1GD7A 3Q8DA 4LJZC 2EDGA 1QVCA 5EKLA 2A69C 3GD7A 3BU2A 3KJOA 4RWSC 4KN7C 1BF4A 1IBLL 2E2HH 4X66Q 1MJCA 2L11A 2NYZD 3HKZG 2C35B 5C4XG 1O7LA 4BY7B 4CKCA 4A3DG 4JI0Q 1H9RA 3C2PA 1D5MC 3S2DB 1A8VA 3H91A 3J7A5 5JEAH 2F0OA 2Z6KA 2L55A 5EKIA 1SFOH 2VUMG 4QUCA 3I4NG 3VR5A 3I3CA 5KEEA 1Y14B 4G7ZC 3EBEA 5ELFA 4FXGC 4CJ0B 5D3IB 3M4OH 1R4QB 2NTTA 1VQ6A 2N49A 1IZ6A 3K7AH 2UUAQ 4A3BH 3KF8A 4A3BB 1GXDC 3PIOA 1AZQA 2FJ2A 2Z4HA 2I0QA 2AUJD 3NE5B 2F0MA 3R8BA 4BBSH 1WJJA 5CYUA 3UDFA 2K52A 1IYVA 3BZKA 5FLXE 1FNWA 1NR4A 2KVMA 4BBSB 5D14A 4Z9CB 3GTPH 5IGFA 3D4DA 1M8AA 2N88A 2VB3X 4DNIA 3VA7A 3TP8A 4A4IA 2B2WA 2L1BA 2K32A 4DUYQ 5IIFA 3PCOB 1Y8NB 1D5XC 1Y1VH 4MN3A 1YZ6A 1Y1VB 4FXDA 4OO1I 3K5LA 5I9OA 4GLXA 3J80i 1XPUA 2IY5B 4AYBG 4LF4L 1CKNB 5IP7H 4B3RQ 1FR3A 1EUJA 5FOBB 4QIWB 4PZ7A 5I2XA 3A7LA 4JOIC 4KMUC 1SE4A 1V1QA 2F0PA 3A56A 2K5WA 2QILA 1VQCA 4DA2A 3T1HL 1BBWA 2CHBD 2R7ZH 3CAMA 3HOZH 1PFBA 3AFPA 4IPGA 5GAGC 5T1IA 4LF7L 2H4OA 5T1GA 2RVLA 1KNAA 3K57A 1EFWA 4A93H 2Q8TA 1KDBA 1SE2A 2XSCA 2BA0A 4A93B 1PDQA 3FMCA 4RGOS 3AFQA 1SAPA 2F0VA 2HDLA 3FEWX 4OX9L 3TZUA 4RHRA 5DNFA 4HMIA 4K14A 1JE4A 4NKLA 4YWKA 2OTLA 2EYFA 4DKAC 1B7YB 1BVSA 5IT9L 3D0FA 1O80A 4IFDI 3QB3A 3RMHA 1D1KA 2PQAB 1GKHA 1O7ZA 1PH2A 3TZDA 1HH2P 4HJ8A 1ZYRC 3DUZA 1LUZA 5C6AA 4NXML 4J8QA 4V0BA 5GQOA 2JA8B 4JI3Q 1KHIA 1ESFA 4DNTB 1SNPA 2F03A 4JI7Q 5FO7B 2B8GA 4X62L 5DM73 3P7JA 3SK8A 1X3GA 4DV4L 1QVGA 4O42A 2VQFL 1F2ZA 1PYSB 3GP7A 1B4OA 1SNDA 3EJIA 4B3TQ 5CBAE 2F0FA 1DOLA 2B29A 2RDHA 5C4HA 2EE1A 1K83B 3CQZB 2B2VA 4AYBE 5ELOA 3TREA 4KY5A 4LF5Q 1JR0D 2LSSA 1G6PA 4DAVA 2HT1A 5EGTA 5C5MA 1E24A 4QY7A 2F0IA 1FGUA 1HTLD 1QB5D 2AMCB 1P8LA 1ML0D 1VQFA 4ZK9B 2IX1A 4UDUC 1L2FA 1UE1A 1I4RA 3K81C 3Q22A 4FVMA 3U9SA 1I5FA 4OHJA 2ES2A 2K05A 2PNHA 1PRTB 4XT3B 4U07A 2EY2A 1M4VA 1TQOA 3HEJA 1FJGL 1EIGA 4GNXB 2Z9HA 1A6XA 4JI4L 3WOFA 2NUNA 4B9XA 4A3MB 1PH8A 5TSSA 5C44G 1TWCB 5FJ8H 3SK6A 4C1NI 2R93B 5CBEE 2R92H 5KRUA 3R2TA 4OXPA 1XMOL 2E5LQ 1N9WA 1QVFA 2WIIB 3GTKH 1X9NA 1LTBD 1CHQD 1U5KA 5G3LF 3HKSA 2L5TA 2JJQA 2QKIC 2JN4A 1Q8IA 5JEAG 4G7HC 4N8FA 3RNUA 1H9SA 1S5CD 2Z6BA 1ILQA 3HOVB 2XRSD 3PIO3 4JI1L 3N6RA 3M85A 4DV6L 4ZRZA 3FRPB 1HTPA 4FP5D 5EBDA 2B2TA 4KI0A 4LF6L 4R9WA 4C3IH 4OWTB 2A6EC 3Q23A 2NVXH 2MP1A 1JJCB 2IHFA 2NVXB 1OXSC 4WGJA 3K5OA 4H02A 2LXJA 3CMEA 2HHHL 2Q8RE 3HOUH 3J80E 5JVH3 4JYAQ 4LFBQ 1A3TA 3HOUB 1TY2A 3MTSA 2HIXA 3HZXA 4O2DA 4HN7A 4NXNQ 1RODA 1X32A 3DXJC 1EZ8A 1VQMA 3MHBA 2GA4B 1U4PA 4APVA 2EJMA 2EXZA 1KQSA 3K7UC 1SLJA 5KGUA 2VQEL 2R7ZG 3QG1A 4LNQA 3PO2G 2OCEA 3KF6A 1WTWA 4A3GH 4OIKA 4KV6A 5C0XH 4A3GB 1XXGA 2HQLA 3TS0A 1TWGH 1NH1A 4HSPA 2A1AA 1II3A 4LF7Q 3RUZA 2CWAA 5IYCH 4N8X1 1U0LA 1BOSA 5HY6A 3GTJH 4RMFA 2X69A 2ZXRA 3UDGA 2CFMA 2EYLA 4A3IB 3GTJB 2B2YA 1FVIA 3CPWA 3TN2A 1AEXA 1P16A 4UP9A 2RHSB 2NWGA 3S2HH 1W6JA 5ISRA 4ME5A 3S2HB 2A5HA 1PTOC 2MUYA 4N9PA 2K01A 5BN4A 3Q24A 1HQMC 1I94L 5J3BA 4NXMQ 5H1SE 1K73C 1JJGA 4IPHA 3A8KE 4JBJA 3CCMA 2BDOA 1XTCD 2LY7A 3M4YA 2DNEA 1VQOA 4ZYSA 4N67A 1C8CA 1LTAD 1EQVA 5JPNC 4JV5L 4X62Q 4XQJA 4DV4Q 4LF8L 2PYKA 2LKVA 2I5HA 5HGQA 4ZAIA 4BA2I 3NTHA 4GN5A 2LMCB 3X3MA 1R9TH 5IOCA 1KLUD 3C46A 4C3HH 2HCIA 1L1OB 4DR5L 3RN2A 4RCNA 1HZ9A 1SJED 4L63B 1S3OA 2CQAA 4PG3A 3QR8A 1WTOA 5JPMC 2EZVA 3OWEB 3S1NH 4TSSA 3NELA 1Y1WH 1K0RA 1M90C 3S17H 1UWVA 4NB3A 4X65Q 2WV6D 1VMPA 4JI0L 1O7YA 2IX3A 3FKIH 3OYYA 2PW7A 4YCUA 5C3EG 4JI6Q 2AWNA 2YTYA 3C1EA 2A74C 2MFIA 3HKZB 4A3DH 5C4XB 3RZDH 1T5EA 3P75A 1B1ZA 3E0JA 4A3DB 3EA6A 1HQRD 1KDAA 3S16H 2R92G 1FJGQ 3E9HA 2VL6A 4P75A 1B9NA 3S16B 1MKHA 3TBIB 4JI4Q 2VUMH 1XPOA 3I4NH 2UUAL 1EY9A 3I4MG 3FVQA 3NQTA 2VUMB 3I4NB 1RTOA 3J81L 1VQBA 5DLQE 1XMOQ 5JAVA 2V1CC 3MXNB 2NBFA 1CUKA 1HUMA 3CF5A 1GM5A 1VF5C 2B2VC 4HCSA 3TP6A 1E1TA 1SMYC 1WVLA 1QJOA 4CKEA 2PMZB 5M3FB 2FHTA 3V96A 4YCWA 3GV3A 3U9OA 1YNNC 1S72A 2N55A 3GTOB 2IT1A 4R4TA 5IODA 1EOTA 3VR3A 4P72A 2G9DA 1OXVA 3EIVA 4C2MH 4FYDA 1JOQA 3MXGA 1FYCA 1ICFB 2K5NA 4C2MB 4DV1L 2EOTA 2BCOA 2P5ZX 1U4MA 1JE5A 3W3AA 4MIUA 1VDZA 2F0GA 4HTHA 4UPAA 4JI5L 3OWFA 4LF6Q 1YNJD 1A2TA 5KNBA 3HOWG 5AFWA 4DXFA 1JWMD 3QOJA 3U50C 3PIP3 2OF1A 2QDLA 4QCLA 2FMCA 4AYBB 2IJ0A 3FP9A 2HHHQ 4CJ1B 1SBBB 1N32Q 2PI2E 3NBIA 1EQTA 1W3SA 1YITA 3QOLA 3SHLA 1XNQQ 2KCNA 1BCPD 5M5YB 1STEA 2Y0SG 2I07B 2RKSA 3VYTA 4POFA 2ID0A 4O1NA 3KK7A 3M4QA 2QDBA 4DPGA 2PI2A 3K0XA 2WACA 2DN8A 4MZ9A 4BBRG 4X2CA 1ZKOA 2ZM6Q 2KEDA 2HDMA 1SMXA 2NUCA 5LMUQ 3ZLMA 1YHAA 4YWMA 2RSNA 5AJ3Q 1J8IA 2CKZB 2VNUD 4HSVA 4KHZA 1PA6A 1YVCA 4WJ3M 2A73B 2HCCA 5IWAQ 3M3YH 1B8AA 2K6AA 1K8GA 4JI3L 3NBHB 3M3YB 1K9MC 1K3RA 4JI7L 2UXCL 5C4JB 1S5ED 1Q3LA 5FO8B 2R6GA 4B9WA 4FNFA 1ILPA 1IBKQ 3U58A 4Q0FA 3GDEA 1HR0Q 1EU3A 4GOPB 2IW3A 4DR4Q 3KOJA 2BE5D 1WI5A 3A5ZB 3HGBA 3GO5A 3S9WA 4B3TL 4KK7A 1BCPB 1TWHH 2E75C 4GS3A 3TP5A 1L0WA 4A3FH 2G5DA 4TQUS 5KYIA 1WCMH 5K36G 1ENCA 2JE6I 2DJFC 2KEEA 2WB1G 2ICEC 4G57A 4DAMA 5BN3A 1A15A 4FDBA 1KIXA 1A2UA 5JJIA 5JFFA 1PH7A 1VQGA 3A54A 3HP3A 1IW7D 4ZLTF 3VR6A 1KL9A 2D62A 1I94Q 1B2TA 3T53B 3UE1A 1X3PA 3W1GA 2ICIA 4EX5A 3BYTB 2XN9C 2K03A 1BKBA 4G7OC 4KKTA 2ZJRA 3DWQA 3CKIB 1VQKA 1EEID 4XYQA 3I73A 2Y0SE 4CDFC 3T1YQ 1EYDA 4C3HG 3JC66 5EJWA 1LT5D 3AB9A 4JG2A 1PH3A 4DAYB 1STHA 4DU9A 1IL8A 2DY7A 1DYQA 1J6QA 1SNOA 1XJVA 2XGTA 1VQEA 2F0QA 2I5LX 5EU0A 3A5UA
chains in the Genus database with same CATH topology
5JJ6A 3PIPA 2YV5A 4DR5Q 1XMQL 4JI7Q 2B63G 2IX0A 2E5LL 2EIFA 2NZHA 4AQYQ 3A0JA 5C44H 5IP7G 4X62L 1Y1WG 1XNRQ 5JJ7A 1X3GA 2PQAA 4DV4L 4AIMA 1Q1BA 4U0ZA 1TXYA 4P73A 5JEAJ 1QVGA 3HFZB 4ITRA 1TWFH 2Z6KC 3FKIG 3ULPA 2VQFL 5LMNL 1PYSB 4LF4Q 4AH6A 3CCVA 4TVAB 2K14A 1TWAH 1J5EL 3HOZG 2GN5A 3M7NA 1WYDA 2R7DA 4B3TQ 1NMGA 4PZ8A 2Q2HA 2B29A 2L15A 3EN2A 1X3EA 4JCVE 4A93G 1X55A 3L7ZC 3T1HQ 2JA5H 4L5TA 4UY8C 2EQSA 3H0GG 3ICEA 3J81c 2FXQA 4AYBE 4BXXG 5ELOA 3S15H 3E9IA 2F52A 3TREA 2LSSA 4R4QA 1YJNA 2YU9H 4LF5Q 2IY5B 1YHBA 3DM3A 1G6PA 3ERSX 2HT1A 1E24A 4QY7A 4ME3A 2BH8A 4NPSA 1FGUA 4XIGS 2AMCB 4HIMA 2NZOA 4POGA 1P8LA 4JBKA 4A3IH 1PH5A 1VQFA 1E7ZA 2IX1A 2WB1E 4OX9Q 1L2FA 1UE1A 1XTDA 3K81C 4OONA 5FLMH 1K8AC 3G4SA 4YWLA 1I5FA 3PUVA 3OTOL 2ES2A 3HOYG 2PNHA 2UXDL 2F4VL 1YNXA 1N36Q 1LYLA 1Q46A 4U07A 3CW2C 3GTGH 1RIPA 3KDFB 5C0XI 4GN4B 3PUZA 2JA8G 1KRSA 3HOXG 4LWCA 1EIYB 4DV7L 1FJGL 4JYAL 3U4ZA 4GNXB 1Q86C 1GVPA 4LFBL 3STBD 1YI2A 2YTVA 4JI4L 3ZCBA 3PGZA 2MNAA 4KLKA 1A63A 1PH8A 4NXNL 1VQ9A 5C44G 1VCIA 5FJ8H 4R4IA 4DR2Q 4IOCA 2BA1A 2R92H 4DUZL 4LF9Q 3J80c 4OXPA 1L1OC 1XMOL 1KC8C 2GVAA 4PY3A 3KDFA 2ZJPA 2E5LQ 4L5RC 1N9WA 4IJHA 3ULLA 4LFCL 1QVFA 4DV3L 4X2DA 3GTKH 4DV1Q 1X9NA 4GNXA 1YIJA 1U5KA 4IFDJ 3HKSA 4JI5Q 2A8VA 4GOPC 2VQFQ 5LMNQ 2JJQA 4QIWE 4A3CH 5JEAG 4Y52H 3BJUA 3RNUA 1I3QH 2F3IA 1HNZL 4P71A 1A62A 4JI1L 3PO2H 3K80C 3M85A 4DV6L 1E1OA 1PH4A 1I6HH 3WWVA 2EXDA 3S14H 4YHHL 4A3LH 2MQHA 4LU4A 3CCUA 4B3ML 3SHGA 5EAYA 4KI0A 5GADC 3TS2A 4X66L 5FLMG 4LF6L 2ATWA 5BR8L 3PF4A 1VQIA 4JC0A 3JAMi 4LFAL 4EQ5A 5GAHC 1KAWA 4C3IH 1EIFA 4OWTB 4HIKA 2ZJQA 4OO1G 5E7NA 5M5XH 1JT8A 2VZAA 1VQJA 3STBC 3M9BA 4R4CA 1JJCB 2IHFA 2NVXH 1A0IA 1YEZA 2IHEA 2YYZA 1E3PA 2WP8J 1OXSC 4WGJA 4RG1A 4H02A 3UDXA 3LETA 3F2DA 1ASZA 2F4VQ 4O0AA 2LXJA 5C4XH 3CMAA 1GO3E 3CMEA 2HHHL 3CP0A 1C0AA 1C9OA 5GAEC 2R93G 2ASBA 1DGSA 2NN6G 3I2ZA 3S1QH 4A75A 5FJ8G 4IPDA 3HOUH 4JOIA 4DV7Q 4U04A 4JYAQ 1OTCA 4LFBQ 2UU9L 3L2PA 1X6OA 4GLVB 2HIXA 4O2DA 4NXNQ 4OWXB 1HZAA 2UUCL 3SN9A 1VQMA 3F2CA 4HJ5A 2KBNA 1E22A 1OXXK 1VS0A 3KF6B 1UEBA 4QL5A 2JA6H 3LGJA 1KXLA 2UXCQ 4DR6L 4APVA 4A3EG 4DR3L 3GTLH 4LFCQ 5C0XJ 3F2BA 4JBMA 1NBWA 2N3SA 1KQSA 3S24A 3K7UC 2AWOA 3RR5A 3AEVA 1EQRA 1NY4A 3HOVG 1SLJA 2AKWB 5M3FH 4K0KL 1LM0A 2VQEL 2R7ZG 4A3FG 1YHQA 4LNQA 1WCMG 3GTOH 3G71A 4IFDG 3PO2G 1B70B 2OCEA 3KF6A 3RLNA 3M4PA 4DV2L 1XPRA 1N8RC 1H95A 1IYJB 4A3GH 2E2JH 4BY1H 4A3LG 3W1BA 4DUYL 1HNZQ 2HQLA 4JI1Q 3TS0A 1TWGH 2KHIA 5GROA 3ZC7A 2A1AA 3ULJA 4DV6Q 1VQ4A 4LF7Q 5IE8A 1EOVA 4MNOA 2CWAA 2K5VA 5IYCH 1X3FA 3PF5A 2ZTEA 2F6SA 5IT9c 2A19A 4UP7A 4B3MQ 2RF4A 5CKLA 2UUBQ 5BR8Q 1QZGA 4B3RL 1AH9A 1U0LA 4BY7H 4LFAQ 4HJ9A 5HY6A 3E0EA 3GTJH 4RMFA 4X65L 3D31A 2JQOA 1VQPA 1CKOA 3J81j 1PFSA 3UDGA 2CFMA 3S2DH 4A3JH 2QEXA 2CWPA 1N34L 1FVIA 3CPWA 3TQYA 5JFZA 4JI6L 2HIVA 4QJFA 2Q2UA 3CCEA 3HOUG 5CGLA 4BA1I 2OQKA 1D8LA 1P16A 2KENA 4XTCS 1EWIA 4UP9A 3ZJYC 2RHSB 2K50A 3S2HH 5C3EH 4X64L 4KHPQ 4GN3B 5M5YH 4JI8L 4GNXC 4PMWA 2UU9Q 1I94L 3PO3H 4Y7NH 4B3SQ 1KD1C 5J3BA 4NXMQ 4R1JA 1IBMQ 5H1SE 1K73C 1JJGA 4IPHA 4JBJA 3CCMA 2KCMA 4HJ7A 4A3KH 5JJLA 2ZTCA 2WAQG 3GTQH 4GKKL 2JK8A 1XMQQ 5M3FG 1SE8A 3PUWA 3BZCA 1VQOA 4N67A 5M3MH 4JV5L 1HJPA 3CXCA 2QA4A 4X62Q 3I4MH 5CMTA 1PH9A 4DV4Q 1VQNA 4LF8L 3MEFA 4R4OA 2I5HA 5HGQA 4BA2I 3GTMH 2D0PA 1VQLA 4A3GG 4GN5A 4DV5L 4BY1G 2NVYH 1R9TH 4K0KQ 1O7IA 5IP9H 1HZCA 2NVTH 3S1RH 5C0XG 2VQEQ 2JA5G 1NJIC 1RL2A 1PHJA 3I4OA 1J5EQ 4DV2Q 4C3HH 4LUVA 5IYCG 5C4JH 2MO0A 1JJ2A 1L1OB 5ELNA 4DR5L 2BH2A 1HNWL 3RN2A 3G48A 3H3VH 4DK6C 1HZ9A 4LUZA 1UE7A 1YBYA 2H5XA 4AQYL 1XNRL 1CSQA 4IOAA 2K5HA 1S3OA 3CC2A 4IPCA 2JEBI 2WFWA 4YY3L 4PG3A 4A3IG 2JEAI 4GKJL 3KYHC 3ER0A 1SROA 5IYDH 2OQ0A 1PV4A 3S1NH 4DR1L 2D0OA 3NELA 4A3JG 1HNXL 1Y1WH 1K0RA 1M90C 2N8NA 3CPFA 3S17H 1UWVA 4NB3A 3RLOA 4X65Q 4DV0L 1L1OA 2Q2TA 1LTLA 4JI0L 1JB7A 2K4KA 1HR0W 3FKIH 3OYYA 3RLFA 4HIOA 1N34Q 4YCUA 4LUOA 5C3EG 4JI6Q 2NN6I 3OTOQ 4P74A 1VQHA 2AWNA 2YTYA 1IXRA 2UXDQ 1Q8KA 3HOWH 4LF5L 2MFIA 1JMCA 1N32L 4X6AH 1KRTA 1X54A 3PSIA 3PO3G 4A3DH 3HKZE 3IRBA 3RZDH 3OW2A 1PVOA 1M1KC 3F8TA 3S16H 1SR3A 4X64Q 2R92G 1FJGQ 3E9HA 2VL6A 1XNQL 1X65A 2RHQB 4P75A 1QZHA 3S6AA 1MKHA 1V9PA 4JI4Q 3TEHB 5M3MG 3CC7A 2VUMH 1XPOA 3I4NH 3A74A 1I50H 1PH1A 2UUAL 1OXTA 3I4MG 3NENA 1MJEA 3TRZA 3VDYA 2AHOB 3KFUA 3PV0A 1EYGA 4DUZQ 1YJ9A 1VQBA 5DLQE 4GKKQ 1XMOQ 1AE3A 1N36L 2GVBA 2ZM6L 1BBUA 1S40A 5IP9G 4JV5Q 2V1CC 1NMFA 1X56A 3MXNB 4DV3Q 3CCQA 5LMUL 4U0SA 3SE5A 4LF8Q 1CUKA 3CF5A 1GM5A 2E2IH 4A3CG 4BBRH 1W2BA 5AJ3L 1QUQB 1E1TA 1UE5A 4DV5Q 1D7QA 2WAQE 4JBWA 2JA7H 4U0UA 3PUYA 2OWOA 2PMZE 4YCWA 5IWAL 2JA8H 4GLAC 2OTJA 3HOXH 1S72A 3K8AA 3NEMA 3FHWA 3J7ZC 2IT1A 4R4TA 3B6YA 5FLXc 4HJAA 4MTNA 5IYBH 5IYDG 4LF9L 3AYHB 3L0OA 1GD7A 1Q12A 3Q8DA 4P72A 1OXVA 1QVCA 3EIVA 4C2MH 3GD7A 3BU2A 3KJOA 2UXBL 2K5NA 1QUQA 4YY3Q 4DV1L 1IBKL 4YHHQ 4GKJQ 4DR7L 1HR0L 1JE5A 1G291 3CCLA 4JI5L 4UPAA 2CQOA 4DR4L 4DR1Q 1IBLL 1HNXQ 4X66Q 3G6EA 2E2HH 1EQQA 4LF6Q 4QQBX 1MJCA 1Z9FA 3HKZG 1T9HA 2C35B 3HOWG 4DV0Q 5C4XG 4IO9A 5JJKA 4A3DG 4JI0Q 3U50C 1K83H 3CQZH 1CSPA 4L5SA 2K75A 1A8VA 1SRUA 3KF8B 3CUCA 2LXKA 3J7A5 3FP9A 1Q1EA 2HHHQ 2Z6KA 1N32Q 2PI2E 1SFOH 2VUMG 1VQ8A 3I4NG 1VQDA 1W3SA 1YITA 2CCZA 1VQ5A 1Y14B 1C7YA 3EBEA 4YCVA 2KCTA 1IL2A 2JA6G 4JI2L 1XNQQ 1WFQA 3J81i 3S1MH 3M4OH 2G03A 2DGYA 1VQ6A 2Y0SG 2N49A 1IZ6A 3K7AH 3I55A 2UUAQ 4A3BH 1PYBA 2UUCQ 4POFA 3H15A 2ID0A 3M4QA 1VQAA 4DPGA 2PI2A 3K0XA 4BBRG 4MZ9A 3PIOA 4X2CA 1ASYA 2JA7G 2ZM6Q 2I0QA 3UDIA 4DR6Q 4DR3Q 2MO1A 3CD6A 4XI8A 1SMXA 5LMUQ 4BBSH 3ZLMA 1WJJA 3UDFA 1YHAA 2VY3A 2K52A 4YWMA 3BZKA 3T1YL 1Q7YC 3CC4A 5AJ3Q 3CCJA 4A3MH 1OXUA 2CKZB 1N33L 5IYBG 3GTPH 2VNUD 4KHZA 1PA6A 4X2EA 1TWCH 1YVCA 4DNIA 4OWWB 3F1ZA 2R93H 4WJ3M 3I7FA 5IWAQ 3M3YH 4UP8A 1B8AA 1VQ7A 4A4IA 3CCRA 1K8GA 3PUXA 4JI3L 3NBHB 1K9MC 1K3RA 4PZ6A 4JI7L 1AE2A 4DUYQ 1G51A 2UXCL 3PCOB 3JAMc 1Y1VH 2R6GA 4J15A 3RZOH 1YZ6A 4BY7G 2UXBQ 4WJ4A 2R7FA 1IBKQ 2RCNA 3U58A 4DR7Q 3GDEA 2DUDA 1HR0Q 2B63H 4OO1I 1MIUA 3RN5A 4GOPB 4GLXA 5M5WH 3N3UA 3J80i 1XPUA 3KOJA 4DR4Q 1IBLQ 4A3EH 4C3JH 4AYBG 1WI5A 1CKNB 2VS1A 3A5ZB 3GO5A 5IP7H 4HIDA 1EUJA 4LF4L 4B3RQ 4PZ7A 2Z0SA 3SGIA 4JOIC 4L5QA 1Z47A 4B3TL 3HOVH 1V1QA 3I56A 1HZBA 1TWHH 1VQCA 4IJLA 3T1HL 1BBWA 4GS3A 1L0WA 3CAMA 4TQUS 3DLLA 5LMNW 1WCMH 4A3FH 1Q82C 2R7ZH 3HOZH 2JE6I 3AFPA 5K36G 4IPGA 5GAGC 2WB1G 4DK3C 4LF7L 4DAMA 4GOPA 1EFWA 1NE3A 4FDBA 1KIXA 3CCSA 4A76A 4ALPA 4A93H 1CKNA 1V43A 5JJIA 5JFFA 3KLWA 3UE0A 1VQGA 1PH7A 4A3BG 2Q2IA 4QGUA 4A3KG 4M16A 2BA0A 3H0GH 2UUBL 3W5OA 4BXXH 4JI2Q 1KL9A 4JI8Q 3KJPA 1YJWA 1SN8A 2D62A 2E8GA 3AFQA 2ALYB 1PH6A 1I94Q 3UE1A 3U4VA 4OX9L 1UE6A 4LW1A 1CKMA 4BBSG 2NVQH 3W1GA 2N78A 4EX5A 2XTIA 1KHIA 2I5MX 1BKBA 4A3MG 2B3GA 4YWKA 2ZJRA 2OTLA 4DKAC 1VQKA 1B7YB 1BVSA 3H3VI 1NTGA 3D0FA 2Y0SE 2ZTDA 3T1YQ 4IFDI 3HOYH 3JC66 2JA9A 2KHJA 2PQAB 2VW9A 2QGQA 4KHPL 4JG2A 1PH3A 1GKHA 5IY0A 2YTXA 1N33Q 4DAYB 1PH2A 1HH2P 4HJ8A 4B3SL 1J6QA 1LUZA 1IBML 4NXML 1XJVA 2XGTA 1Y1VG 5GQOA 1VQEA 1Q81C 3AQQA 2I5LX 4DR2L 4JI3Q 5EU0A 1WOCA 3A5UA 1FL0A 1HNWQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJ6 A;  3PIP A;  2YV5 A;  4DR5 Q;  1XMQ L;  4JI7 Q;  2B63 G;  2IX0 A;  2E5L L;  2EIF A;  2NZH A;  4AQY Q;  3A0J A;  5C44 H;  5IP7 G;  4X62 L;  1Y1W G;  1XNR Q;  5JJ7 A;  1X3G A;  2PQA A;  4DV4 L;  4AIM A;  1Q1B A;  4U0Z A;  1TXY A;  4P73 A;  5JEA J;  1QVG A;  3HFZ B;  4ITR A;  1TWF H;  2Z6K C;  3FKI G;  3ULP A;  2VQF L;  5LMN L;  1PYS B;  4LF4 Q;  4AH6 A;  3CCV A;  4TVA B;  2K14 A;  1TWA H;  1J5E L;  3HOZ G;  2GN5 A;  3M7N A;  1WYD A;  2R7D A;  4B3T Q;  1NMG A;  4PZ8 A;  2Q2H A;  2B29 A;  2L15 A;  3EN2 A;  1X3E A;  4JCV E;  4A93 G;  1X55 A;  3L7Z C;  3T1H Q;  2JA5 H;  4L5T A;  4UY8 C;  2EQS A;  3H0G G;  3ICE A;  3J81 c;  2FXQ A;  4AYB E;  4BXX G;  5ELO A;  3S15 H;  3E9I A;  2F52 A;  3TRE A;  2LSS A;  4R4Q A;  1YJN A;  2YU9 H;  4LF5 Q;  2IY5 B;  1YHB A;  3DM3 A;  1G6P A;  3ERS X;  2HT1 A;  1E24 A;  4QY7 A;  4ME3 A;  2BH8 A;  4NPS A;  1FGU A;  4XIG S;  2AMC B;  4HIM A;  2NZO A;  4POG A;  1P8L A;  4JBK A;  4A3I H;  1PH5 A;  1VQF A;  1E7Z A;  2IX1 A;  2WB1 E;  4OX9 Q;  1L2F A;  1UE1 A;  1XTD A;  3K81 C;  4OON A;  5FLM H;  1K8A C;  3G4S A;  4YWL A;  1I5F A;  3PUV A;  3OTO L;  2ES2 A;  3HOY G;  2PNH A;  2UXD L;  2F4V L;  1YNX A;  1N36 Q;  1LYL A;  1Q46 A;  4U07 A;  3CW2 C;  3GTG H;  1RIP A;  3KDF B;  5C0X I;  4GN4 B;  3PUZ A;  2JA8 G;  1KRS A;  3HOX G;  4LWC A;  1EIY B;  4DV7 L;  1FJG L;  4JYA L;  3U4Z A;  4GNX B;  1Q86 C;  1GVP A;  4LFB L;  3STB D;  1YI2 A;  2YTV A;  4JI4 L;  3ZCB A;  3PGZ A;  2MNA A;  4KLK A;  1A63 A;  1PH8 A;  4NXN L;  1VQ9 A;  5C44 G;  1VCI A;  5FJ8 H;  4R4I A;  4DR2 Q;  4IOC A;  2BA1 A;  2R92 H;  4DUZ L;  4LF9 Q;  3J80 c;  4OXP A;  1L1O C;  1XMO L;  1KC8 C;  2GVA A;  4PY3 A;  3KDF A;  2ZJP A;  2E5L Q;  4L5R C;  1N9W A;  4IJH A;  3ULL A;  4LFC L;  1QVF A;  4DV3 L;  4X2D A;  3GTK H;  4DV1 Q;  1X9N A;  4GNX A;  1YIJ A;  1U5K A;  4IFD J;  3HKS A;  4JI5 Q;  2A8V A;  4GOP C;  2VQF Q;  5LMN Q;  2JJQ A;  4QIW E;  4A3C H;  5JEA G;  4Y52 H;  3BJU A;  3RNU A;  1I3Q H;  2F3I A;  1HNZ L;  4P71 A;  1A62 A;  4JI1 L;  3PO2 H;  3K80 C;  3M85 A;  4DV6 L;  1E1O A;  1PH4 A;  1I6H H;  3WWV A;  2EXD A;  3S14 H;  4YHH L;  4A3L H;  2MQH A;  4LU4 A;  3CCU A;  4B3M L;  3SHG A;  5EAY A;  4KI0 A;  5GAD C;  3TS2 A;  4X66 L;  5FLM G;  4LF6 L;  2ATW A;  5BR8 L;  3PF4 A;  1VQI A;  4JC0 A;  3JAM i;  4LFA L;  4EQ5 A;  5GAH C;  1KAW A;  4C3I H;  1EIF A;  4OWT B;  4HIK A;  2ZJQ A;  4OO1 G;  5E7N A;  5M5X H;  1JT8 A;  2VZA A;  1VQJ A;  3STB C;  3M9B A;  4R4C A;  1JJC B;  2IHF A;  2NVX H;  1A0I A;  1YEZ A;  2IHE A;  2YYZ A;  1E3P A;  2WP8 J;  1OXS C;  4WGJ A;  4RG1 A;  4H02 A;  3UDX A;  3LET A;  3F2D A;  1ASZ A;  2F4V Q;  4O0A A;  2LXJ A;  5C4X H;  3CMA A;  1GO3 E;  3CME A;  2HHH L;  3CP0 A;  1C0A A;  1C9O A;  5GAE C;  2R93 G;  2ASB A;  1DGS A;  2NN6 G;  3I2Z A;  3S1Q H;  4A75 A;  5FJ8 G;  4IPD A;  3HOU H;  4JOI A;  4DV7 Q;  4U04 A;  4JYA Q;  1OTC A;  4LFB Q;  2UU9 L;  3L2P A;  1X6O A;  4GLV B;  2HIX A;  4O2D A;  4NXN Q;  4OWX B;  1HZA A;  2UUC L;  3SN9 A;  1VQM A;  3F2C A;  4HJ5 A;  2KBN A;  1E22 A;  1OXX K;  1VS0 A;  3KF6 B;  1UEB A;  4QL5 A;  2JA6 H;  3LGJ A;  1KXL A;  2UXC Q;  4DR6 L;  4APV A;  4A3E G;  4DR3 L;  3GTL H;  4LFC Q;  5C0X J;  3F2B A;  4JBM A;  1NBW A;  2N3S A;  1KQS A;  3S24 A;  3K7U C;  2AWO A;  3RR5 A;  3AEV A;  1EQR A;  1NY4 A;  3HOV G;  1SLJ A;  2AKW B;  5M3F H;  4K0K L;  1LM0 A;  2VQE L;  2R7Z G;  4A3F G;  1YHQ A;  4LNQ A;  1WCM G;  3GTO H;  3G71 A;  4IFD G;  3PO2 G;  1B70 B;  2OCE A;  3KF6 A;  3RLN A;  3M4P A;  4DV2 L;  1XPR A;  1N8R C;  1H95 A;  1IYJ B;  4A3G H;  2E2J H;  4BY1 H;  4A3L G;  3W1B A;  4DUY L;  1HNZ Q;  2HQL A;  4JI1 Q;  3TS0 A;  1TWG H;  2KHI A;  5GRO A;  3ZC7 A;  2A1A A;  3ULJ A;  4DV6 Q;  1VQ4 A;  4LF7 Q;  5IE8 A;  1EOV A;  4MNO A;  2CWA A;  2K5V A;  5IYC H;  1X3F A;  3PF5 A;  2ZTE A;  2F6S A;  5IT9 c;  2A19 A;  4UP7 A;  4B3M Q;  2RF4 A;  5CKL A;  2UUB Q;  5BR8 Q;  1QZG A;  4B3R L;  1AH9 A;  1U0L A;  4BY7 H;  4LFA Q;  4HJ9 A;  5HY6 A;  3E0E A;  3GTJ H;  4RMF A;  4X65 L;  3D31 A;  2JQO A;  1VQP A;  1CKO A;  3J81 j;  1PFS A;  3UDG A;  2CFM A;  3S2D H;  4A3J H;  2QEX A;  2CWP A;  1N34 L;  1FVI A;  3CPW A;  3TQY A;  5JFZ A;  4JI6 L;  2HIV A;  4QJF A;  2Q2U A;  3CCE A;  3HOU G;  5CGL A;  4BA1 I;  2OQK A;  1D8L A;  1P16 A;  2KEN A;  4XTC S;  1EWI A;  4UP9 A;  3ZJY C;  2RHS B;  2K50 A;  3S2H H;  5C3E H;  4X64 L;  4KHP Q;  4GN3 B;  5M5Y H;  4JI8 L;  4GNX C;  4PMW A;  2UU9 Q;  1I94 L;  3PO3 H;  4Y7N H;  4B3S Q;  1KD1 C;  5J3B A;  4NXM Q;  4R1J A;  1IBM Q;  5H1S E;  1K73 C;  1JJG A;  4IPH A;  4JBJ A;  3CCM A;  2KCM A;  4HJ7 A;  4A3K H;  5JJL A;  2ZTC A;  2WAQ G;  3GTQ H;  4GKK L;  2JK8 A;  1XMQ Q;  5M3F G;  1SE8 A;  3PUW A;  3BZC A;  1VQO A;  4N67 A;  5M3M H;  4JV5 L;  1HJP A;  3CXC A;  2QA4 A;  4X62 Q;  3I4M H;  5CMT A;  1PH9 A;  4DV4 Q;  1VQN A;  4LF8 L;  3MEF A;  4R4O A;  2I5H A;  5HGQ A;  4BA2 I;  3GTM H;  2D0P A;  1VQL A;  4A3G G;  4GN5 A;  4DV5 L;  4BY1 G;  2NVY H;  1R9T H;  4K0K Q;  1O7I A;  5IP9 H;  1HZC A;  2NVT H;  3S1R H;  5C0X G;  2VQE Q;  2JA5 G;  1NJI C;  1RL2 A;  1PHJ A;  3I4O A;  1J5E Q;  4DV2 Q;  4C3H H;  4LUV A;  5IYC G;  5C4J H;  2MO0 A;  1JJ2 A;  1L1O B;  5ELN A;  4DR5 L;  2BH2 A;  1HNW L;  3RN2 A;  3G48 A;  3H3V H;  4DK6 C;  1HZ9 A;  4LUZ A;  1UE7 A;  1YBY A;  2H5X A;  4AQY L;  1XNR L;  1CSQ A;  4IOA A;  2K5H A;  1S3O A;  3CC2 A;  4IPC A;  2JEB I;  2WFW A;  4YY3 L;  4PG3 A;  4A3I G;  2JEA I;  4GKJ L;  3KYH C;  3ER0 A;  1SRO A;  5IYD H;  2OQ0 A;  1PV4 A;  3S1N H;  4DR1 L;  2D0O A;  3NEL A;  4A3J G;  1HNX L;  1Y1W H;  1K0R A;  1M90 C;  2N8N A;  3CPF A;  3S17 H;  1UWV A;  4NB3 A;  3RLO A;  4X65 Q;  4DV0 L;  1L1O A;  2Q2T A;  1LTL A;  4JI0 L;  1JB7 A;  2K4K A;  1HR0 W;  3FKI H;  3OYY A;  3RLF A;  4HIO A;  1N34 Q;  4YCU A;  4LUO A;  5C3E G;  4JI6 Q;  2NN6 I;  3OTO Q;  4P74 A;  1VQH A;  2AWN A;  2YTY A;  1IXR A;  2UXD Q;  1Q8K A;  3HOW H;  4LF5 L;  2MFI A;  1JMC A;  1N32 L;  4X6A H;  1KRT A;  1X54 A;  3PSI A;  3PO3 G;  4A3D H;  3HKZ E;  3IRB A;  3RZD H;  3OW2 A;  1PVO A;  1M1K C;  3F8T A;  3S16 H;  1SR3 A;  4X64 Q;  2R92 G;  1FJG Q;  3E9H A;  2VL6 A;  1XNQ L;  1X65 A;  2RHQ B;  4P75 A;  1QZH A;  3S6A A;  1MKH A;  1V9P A;  4JI4 Q;  3TEH B;  5M3M G;  3CC7 A;  2VUM H;  1XPO A;  3I4N H;  3A74 A;  1I50 H;  1PH1 A;  2UUA L;  1OXT A;  3I4M G;  3NEN A;  1MJE A;  3TRZ A;  3VDY A;  2AHO B;  3KFU A;  3PV0 A;  1EYG A;  4DUZ Q;  1YJ9 A;  1VQB A;  5DLQ E;  4GKK Q;  1XMO Q;  1AE3 A;  1N36 L;  2GVB A;  2ZM6 L;  1BBU A;  1S40 A;  5IP9 G;  4JV5 Q;  2V1C C;  1NMF A;  1X56 A;  3MXN B;  4DV3 Q;  3CCQ A;  5LMU L;  4U0S A;  3SE5 A;  4LF8 Q;  1CUK A;  3CF5 A;  1GM5 A;  2E2I H;  4A3C G;  4BBR H;  1W2B A;  5AJ3 L;  1QUQ B;  1E1T A;  1UE5 A;  4DV5 Q;  1D7Q A;  2WAQ E;  4JBW A;  2JA7 H;  4U0U A;  3PUY A;  2OWO A;  2PMZ E;  4YCW A;  5IWA L;  2JA8 H;  4GLA C;  2OTJ A;  3HOX H;  1S72 A;  3K8A A;  3NEM A;  3FHW A;  3J7Z C;  2IT1 A;  4R4T A;  3B6Y A;  5FLX c;  4HJA A;  4MTN A;  5IYB H;  5IYD G;  4LF9 L;  3AYH B;  3L0O A;  1GD7 A;  1Q12 A;  3Q8D A;  4P72 A;  1OXV A;  1QVC A;  3EIV A;  4C2M H;  3GD7 A;  3BU2 A;  3KJO A;  2UXB L;  2K5N A;  1QUQ A;  4YY3 Q;  4DV1 L;  1IBK L;  4YHH Q;  4GKJ Q;  4DR7 L;  1HR0 L;  1JE5 A;  1G29 1;  3CCL A;  4JI5 L;  4UPA A;  2CQO A;  4DR4 L;  4DR1 Q;  1IBL L;  1HNX Q;  4X66 Q;  3G6E A;  2E2H H;  1EQQ A;  4LF6 Q;  4QQB X;  1MJC A;  1Z9F A;  3HKZ G;  1T9H A;  2C35 B;  3HOW G;  4DV0 Q;  5C4X G;  4IO9 A;  5JJK A;  4A3D G;  4JI0 Q;  3U50 C;  1K83 H;  3CQZ H;  1CSP A;  4L5S A;  2K75 A;  1A8V A;  1SRU A;  3KF8 B;  3CUC A;  2LXK A;  3J7A 5;  3FP9 A;  1Q1E A;  2HHH Q;  2Z6K A;  1N32 Q;  2PI2 E;  1SFO H;  2VUM G;  1VQ8 A;  3I4N G;  1VQD A;  1W3S A;  1YIT A;  2CCZ A;  1VQ5 A;  1Y14 B;  1C7Y A;  3EBE A;  4YCV A;  2KCT A;  1IL2 A;  2JA6 G;  4JI2 L;  1XNQ Q;  1WFQ A;  3J81 i;  3S1M H;  3M4O H;  2G03 A;  2DGY A;  1VQ6 A;  2Y0S G;  2N49 A;  1IZ6 A;  3K7A H;  3I55 A;  2UUA Q;  4A3B H;  1PYB A;  2UUC Q;  4POF A;  3H15 A;  2ID0 A;  3M4Q A;  1VQA A;  4DPG A;  2PI2 A;  3K0X A;  4BBR G;  4MZ9 A;  3PIO A;  4X2C A;  1ASY A;  2JA7 G;  2ZM6 Q;  2I0Q A;  3UDI A;  4DR6 Q;  4DR3 Q;  2MO1 A;  3CD6 A;  4XI8 A;  1SMX A;  5LMU Q;  4BBS H;  3ZLM A;  1WJJ A;  3UDF A;  1YHA A;  2VY3 A;  2K52 A;  4YWM A;  3BZK A;  3T1Y L;  1Q7Y C;  3CC4 A;  5AJ3 Q;  3CCJ A;  4A3M H;  1OXU A;  2CKZ B;  1N33 L;  5IYB G;  3GTP H;  2VNU D;  4KHZ A;  1PA6 A;  4X2E A;  1TWC H;  1YVC A;  4DNI A;  4OWW B;  3F1Z A;  2R93 H;  4WJ3 M;  3I7F A;  5IWA Q;  3M3Y H;  4UP8 A;  1B8A A;  1VQ7 A;  4A4I A;  3CCR A;  1K8G A;  3PUX A;  4JI3 L;  3NBH B;  1K9M C;  1K3R A;  4PZ6 A;  4JI7 L;  1AE2 A;  4DUY Q;  1G51 A;  2UXC L;  3PCO B;  3JAM c;  1Y1V H;  2R6G A;  4J15 A;  3RZO H;  1YZ6 A;  4BY7 G;  2UXB Q;  4WJ4 A;  2R7F A;  1IBK Q;  2RCN A;  3U58 A;  4DR7 Q;  3GDE A;  2DUD A;  1HR0 Q;  2B63 H;  4OO1 I;  1MIU A;  3RN5 A;  4GOP B;  4GLX A;  5M5W H;  3N3U A;  3J80 i;  1XPU A;  3KOJ A;  4DR4 Q;  1IBL Q;  4A3E H;  4C3J H;  4AYB G;  1WI5 A;  1CKN B;  2VS1 A;  3A5Z B;  3GO5 A;  5IP7 H;  4HID A;  1EUJ A;  4LF4 L;  4B3R Q;  4PZ7 A;  2Z0S A;  3SGI A;  4JOI C;  4L5Q A;  1Z47 A;  4B3T L;  3HOV H;  1V1Q A;  3I56 A;  1HZB A;  1TWH H;  1VQC A;  4IJL A;  3T1H L;  1BBW A;  4GS3 A;  1L0W A;  3CAM A;  4TQU S;  3DLL A;  5LMN W;  1WCM H;  4A3F H;  1Q82 C;  2R7Z H;  3HOZ H;  2JE6 I;  3AFP A;  5K36 G;  4IPG A;  5GAG C;  2WB1 G;  4DK3 C;  4LF7 L;  4DAM A;  4GOP A;  1EFW A;  1NE3 A;  4FDB A;  1KIX A;  3CCS A;  4A76 A;  4ALP A;  4A93 H;  1CKN A;  1V43 A;  5JJI A;  5JFF A;  3KLW A;  3UE0 A;  1VQG A;  1PH7 A;  4A3B G;  2Q2I A;  4QGU A;  4A3K G;  4M16 A;  2BA0 A;  3H0G H;  2UUB L;  3W5O A;  4BXX H;  4JI2 Q;  1KL9 A;  4JI8 Q;  3KJP A;  1YJW A;  1SN8 A;  2D62 A;  2E8G A;  3AFQ A;  2ALY B;  1PH6 A;  1I94 Q;  3UE1 A;  3U4V A;  4OX9 L;  1UE6 A;  4LW1 A;  1CKM A;  4BBS G;  2NVQ H;  3W1G A;  2N78 A;  4EX5 A;  2XTI A;  1KHI A;  2I5M X;  1BKB A;  4A3M G;  2B3G A;  4YWK A;  2ZJR A;  2OTL A;  4DKA C;  1VQK A;  1B7Y B;  1BVS A;  3H3V I;  1NTG A;  3D0F A;  2Y0S E;  2ZTD A;  3T1Y Q;  4IFD I;  3HOY H;  3JC6 6;  2JA9 A;  2KHJ A;  2PQA B;  2VW9 A;  2QGQ A;  4KHP L;  4JG2 A;  1PH3 A;  1GKH A;  5IY0 A;  2YTX A;  1N33 Q;  4DAY B;  1PH2 A;  1HH2 P;  4HJ8 A;  4B3S L;  1J6Q A;  1LUZ A;  1IBM L;  4NXM L;  1XJV A;  2XGT A;  1Y1V G;  5GQO A;  1VQE A;  1Q81 C;  3AQQ A;  2I5L X;  4DR2 L;  4JI3 Q;  5EU0 A;  1WOC A;  3A5U A;  1FL0 A;  1HNW Q; 
#chains in the Genus database with same CATH topology
 5JJ6 A;  2B63 G;  2XNA C;  4DR5 Q;  2E5L L;  2NZH A;  1G8Z D;  5C44 H;  1Y1W G;  2B2Y C;  5JJ7 A;  5J1Z A;  3KLR A;  5C44 B;  4P73 A;  1TXY A;  3HFZ B;  3FKI G;  5I2Y A;  5CV5 A;  2E2H B;  4TVA B;  1TWA H;  1IW7 C;  1WYD A;  5CV6 A;  5I9P A;  3EN2 A;  4NP5 A;  3L7Z C;  2JA5 H;  1UUP A;  2SDF A;  3H0G G;  3T56 B;  5COY A;  4BXX G;  2PZU A;  4X3T A;  3S15 H;  2F52 A;  3SK4 A;  4R4Q A;  1YJN A;  1YHB A;  1IYU A;  3DM3 A;  4P2C B;  3S15 B;  4CKB A;  1SFO B;  5A2Q L;  2KOL A;  2L12 A;  2NZO A;  4H44 C;  2WB1 E;  2OT2 A;  3M4O B;  1XTD A;  3ND8 A;  3K7A B;  3G4S A;  3TME A;  1KDC A;  1B3Q A;  2C9O A;  2UXD L;  5I6Y A;  3R2I A;  1LYL A;  1Q46 A;  1WD1 A;  1H9M A;  4IN3 A;  1O78 A;  1RIP A;  3K5N A;  3KDF B;  5C0X I;  4GN4 B;  2EJF C;  1C48 A;  1EIY B;  4JYA L;  3U4Z A;  4LFB L;  1SYC A;  1DXM A;  3MXP A;  3PGZ A;  3GTP B;  4KLK A;  4NXN L;  1VCI A;  3EQL C;  1K8M A;  1RCV D;  4DUZ L;  2ZJP A;  1MSG A;  4IJH A;  1S5F D;  4RCO A;  1PZI D;  4DV1 Q;  4IFD J;  4JI5 Q;  4RAU C;  3R93 A;  2J4X A;  5LMN Q;  4CJ2 C;  4XQN A;  4ID6 A;  4XXE A;  2F0K A;  1A62 A;  4RKB A;  4KD3 A;  3PO2 H;  3FDT A;  3K80 C;  4UAI A;  1E1O A;  1PH4 A;  1I6H H;  3WWV A;  2R7Z B;  3K5M A;  4YHH L;  3MA2 B;  3HOZ B;  3PO2 B;  1I6H B;  5FK9 C;  3TS2 A;  5FLM G;  4I7Z C;  4EQ5 A;  1KAW A;  1STY A;  5E7N A;  1JT8 A;  5FLX L;  1VQJ A;  2F0L A;  4R4C A;  1TS5 A;  3ERO A;  3X3N A;  1E3P A;  3DWP A;  4F87 A;  4U68 A;  1QNK A;  1GO3 E;  2CH4 W;  2BDN A;  4PMB A;  1J9O A;  3I2Z A;  1G2S A;  1ZEQ X;  4IPD A;  2F1M A;  2B2U A;  5CC4 A;  4K2K A;  1X6O A;  4ZCK A;  4RGM A;  1LAC A;  3DMU A;  2F4I A;  5D3D A;  1OXX K;  1PRT D;  1UEB A;  3LGJ A;  1KXL A;  4HAE A;  2UXC Q;  4DR6 L;  1EY5 A;  4DR3 L;  4LFC Q;  4KY6 A;  2KCC A;  3F2B A;  4JBM A;  1NBW A;  3Q0A A;  2AWO A;  1NY4 A;  2O5J C;  1LM0 A;  5LHY 1;  1RF2 D;  2LS0 1;  4A3F G;  1YHQ A;  4R8N A;  1WCM G;  4F8M A;  4OGQ C;  3G71 A;  4U67 3;  1TII D;  1B70 B;  3RLN A;  3M4P A;  4WOR A;  1XPR A;  5KYL A;  1IYJ B;  3MAQ A;  2E2J H;  4A3L G;  5C5L A;  1MHW C;  3MXN A;  2E2J B;  2CH4 A;  3QIA A;  4HR7 B;  3VYR A;  5IE8 A;  2K5D A;  4MNO A;  2K5V A;  1X3F A;  2R3Z A;  3PF5 A;  5IT9 c;  4B3M Q;  1I4G A;  4LMQ D;  1QZG A;  4V19 0;  5G3L D;  4X65 L;  3NP8 A;  3J81 j;  1PFS A;  4C1N K;  4IUV A;  3C3L A;  2EY5 A;  2QEX A;  1F2Y A;  2F0U A;  3JAM L;  4JI6 L;  5JFZ A;  2ZT9 C;  5M9O A;  1D8L A;  3K0Y A;  1PRT C;  1EWI A;  3ZJY C;  1CM9 A;  2K50 A;  2J0T D;  5C3E H;  2PZT A;  4KHV A;  3H94 A;  4GN3 B;  2EYP A;  4JI8 L;  4GNX C;  4PMW A;  2KQ3 A;  1BO0 A;  4Y7N H;  1KD1 C;  4R1J A;  4Y7N B;  4RGT A;  4A3K H;  1F77 A;  3J7Y W;  2WAQ G;  3DM1 A;  3GTQ H;  4JPB W;  1U9R A;  2R92 B;  3BZC A;  1NAP A;  1WTV A;  2OEO A;  3I4M H;  1PH9 A;  1LTR D;  1KNE A;  1VQN A;  1LAB A;  1STB A;  1T5X D;  2B39 A;  4R4O A;  3I4M B;  3GTK B;  1CZG A;  2RQX A;  2NVY H;  2NVT H;  2JA5 G;  1K0S A;  3D4W A;  2NVT B;  4IQZ A;  4LUV A;  5ELN A;  1LT4 D;  3G48 A;  1F9Q A;  2H5X A;  1XNR L;  1CSQ A;  4IOA A;  2K5H A;  3CC2 A;  4IPC A;  2JEB I;  2WKD A;  1Y8O B;  4K8J A;  5J39 A;  4JW0 A;  1LLR D;  1UNS A;  2EYJ A;  2OQ0 A;  1PYW D;  1PV4 A;  1NNX A;  3LX0 A;  1H9K A;  4A3J G;  2PQE A;  1GUT A;  5CV9 A;  4KJO A;  1IKM A;  4M1U B;  4C3I B;  1JB7 A;  1HR0 W;  2UXD Q;  2DNC A;  3HOW H;  3L9A X;  1N32 L;  4X6A H;  3PO3 G;  2K28 A;  3HOW B;  3IRB A;  3OW2 A;  3D4R A;  1LT6 D;  1M1K C;  3F8T A;  1WTQ A;  3N52 A;  1SR3 A;  4IUN A;  4X64 Q;  1XNQ L;  3K58 A;  1V9P A;  5IGG A;  1QWY A;  5ELC A;  4IUQ A;  1GHK A;  1PH1 A;  4FF1 A;  2M00 A;  3OMC A;  1MJE A;  3KFU A;  4DUZ Q;  4KN4 C;  2K33 A;  4GKK Q;  1MI2 A;  2ZM6 L;  1N36 L;  5IP9 G;  5K5P A;  1I4H A;  1CI3 M;  5LMU L;  4U0S A;  2MGS A;  1F9R A;  1Q90 A;  4BBR H;  5AJ3 L;  4DV5 Q;  2WAQ E;  2L9H A;  1AW7 A;  3PUY A;  5JJZ A;  5EPK A;  5IWA L;  2EPB A;  3OMG A;  2OTJ A;  3HOX H;  3K8A A;  3NEM A;  4M8A A;  2X6L A;  4X3K A;  3B6Y A;  2Z1C A;  4LF9 L;  4MTN A;  5IYD G;  3AYH B;  1Q12 A;  1AFP A;  1Y8P B;  3C1F A;  2E2D C;  4PMC A;  1QUQ A;  4YY3 Q;  1IBK L;  2QEJ C;  1TWG B;  4YHH Q;  4RKL A;  4GKJ Q;  1HR0 L;  1G29 1;  3WOE A;  4DR4 L;  4DR1 Q;  3G6E A;  2F3W A;  5J22 A;  3KLS A;  3IKJ A;  5ELE A;  2KJX A;  3J80 L;  5EKK A;  2E74 C;  1CK1 A;  4L5S A;  3P20 A;  3SE0 A;  3BG3 A;  3KF8 B;  2HUG A;  3CRK C;  3CUC A;  2LXK A;  4F88 A;  1VQD A;  1VQ5 A;  5K36 H;  1C7Y A;  1JQY D;  2KCT A;  2Z8L A;  2G03 A;  4KKS A;  4UHV A;  3K59 A;  4J1M A;  2KEC A;  3IFD A;  1NCV A;  3H15 A;  3UI2 A;  3L3O C;  1PTO F;  1X3Q A;  3G6J B;  1HUN A;  3R3O A;  1PFN A;  4DR6 Q;  4DR3 Q;  2MO1 A;  4XI8 A;  1PTO H;  1WTH A;  4RA8 A;  3T1Y L;  3CC4 A;  1SE3 A;  1Q7Y C;  4X3S A;  2XIW A;  3CCJ A;  4OEL B;  5IYB G;  2IL8 A;  2EJG C;  1WTX A;  4X2E A;  1R9T B;  3F1Z A;  2F3V A;  1GOZ A;  4UP8 A;  3CCR A;  4IZ8 A;  1PFM A;  4ZQ3 A;  2OXP A;  4C3H B;  1RD9 D;  4EQO A;  1AE2 A;  1BNZ A;  3V05 A;  3RZO H;  2UXB Q;  2R7F A;  1DOK A;  3RZO B;  4DR7 Q;  2DUD A;  2B63 H;  3RN5 A;  5M5W H;  1NSN S;  4A3E H;  4C3J H;  2VS1 A;  1KAB A;  4HED A;  3S1N B;  1B3A A;  4IUP A;  1QE6 A;  3SGI A;  5JVG 3;  1Y1W B;  1Z47 A;  2B2U C;  3S17 B;  1HZB A;  1S4Z A;  1JWU D;  4NMZ A;  1GUW A;  1EY0 A;  4IJL A;  3M7G A;  3FKI B;  5LMN W;  1Q82 C;  4EGV A;  1EZ6 A;  2O2L D;  3CCS A;  3I70 A;  1CKN A;  1V43 A;  2QF7 A;  3KLW A;  1BXT A;  4A3K G;  3RZD B;  3H0G H;  2UUB L;  2K1B A;  4XYO A;  3IAY A;  1CHP D;  4DF7 A;  3W5O A;  4BXX H;  2KHS A;  4JI2 Q;  4JI8 Q;  1YJW A;  5CV4 A;  1SN8 A;  2E8G A;  3H0G B;  1PH6 A;  2ALY B;  1QOH A;  3U4V A;  1UE6 A;  1CKM A;  3IL8 A;  2NVQ H;  5L37 A;  2XTI A;  4KJN A;  4A3M G;  2EYO A;  4NW2 A;  1K8O A;  1HA5 A;  1HXY D;  3OOC A;  1CTM A;  1NTG A;  2F0J A;  2PO4 A;  2IPK D;  1ESR A;  1N33 Q;  2A68 D;  1PZJ D;  3I90 A;  1XMQ L;  3URY A;  2FMM A;  2IX0 A;  2EIF A;  1XNR Q;  5EPJ A;  2PQA A;  3J7A V;  4NDX A;  1Q1B A;  4BWG B;  1TWF H;  3ULP A;  2TSS A;  5LMN L;  1J5E L;  2R7D A;  4PZ8 A;  2Q2H A;  1SYE A;  2L15 A;  3ERQ A;  1X3E A;  4H13 C;  2XVS A;  4L5T A;  2EQS A;  4N9T A;  3J81 c;  1RJT A;  2YU9 H;  1EEF D;  4HMJ A;  2IWH A;  4ME3 A;  1W6K A;  2BH8 A;  4CGY B;  4HIM A;  1LTG D;  3BDC A;  4POG A;  1PH5 A;  4DK0 A;  1E7Z A;  3H6M A;  3MFY A;  5FLM H;  1K8A C;  3PUV A;  3OTO L;  3HOY G;  1I4P A;  1YNX A;  1N36 Q;  3CW2 C;  4EQP A;  4IUT A;  1AP0 A;  2E76 C;  1KRS A;  4WJW A;  3HOX G;  4LWC A;  1TS2 A;  2XWB B;  3OW7 A;  1B9M A;  3ZCB A;  4OL7 A;  1A63 A;  2F0W A;  3LWE A;  1VQ9 A;  1YNJ C;  1QNU A;  4R4I A;  4DR2 Q;  1JB3 A;  2BA1 A;  4LF9 Q;  4PQX A;  1KC8 C;  4PY3 A;  1H9S B;  4ZUJ A;  4K8I A;  3ULL A;  3G7L A;  2PCF B;  1STA A;  4LFC L;  1HA6 A;  3CHB D;  4DV3 L;  3T13 A;  3H3V C;  2A6H D;  4GNX A;  1YIJ A;  1HFG A;  4QMG A;  3MWY W;  4GOP C;  5HUR A;  1D2B A;  2JP1 A;  1NUC A;  5FKA C;  1I4X A;  4DNR B;  4Y52 H;  4FF2 A;  3BJU A;  1BCP C;  1I3Q H;  1ENF A;  2F3I A;  4C56 C;  3D6C A;  1EY4 A;  1TWH B;  1I3Q B;  1A3U A;  4A3F B;  4MTK A;  1SYB A;  1WCM B;  4A3L H;  5NUC A;  1HFN A;  2HQE A;  2K5Q A;  3CCU A;  4B3M L;  3SVM A;  3SHG A;  1E2V A;  3PF4 A;  3PQI A;  3JAM i;  3QWN A;  4JC0 A;  5GAH C;  4KD4 A;  1EIF A;  2ZJQ A;  4OO1 G;  2H1E A;  4DAP A;  3M9B A;  2FFK B;  2K7V A;  1YEZ A;  1G2T A;  2IHE A;  2A69 D;  2WP8 J;  1AZP A;  3A55 A;  1SYF A;  4RG1 A;  3UDX A;  3LET A;  1ASZ A;  2F4V Q;  4B08 A;  1GJX A;  2X6G A;  1JOK A;  4OEM B;  3CP0 A;  2O4X A;  1C9O A;  4L8J A;  1DGS A;  2NN6 G;  2D9U A;  3S1Q H;  3E5S A;  3NQI A;  2Q8I B;  4A75 A;  1V1P B;  4DV7 Q;  1EFI D;  1S5D D;  2ZXP A;  2BE5 C;  1HZA A;  2UUC L;  2I46 A;  5ELB A;  4HJ5 A;  3NUC A;  2JA6 H;  2WIN B;  3SDZ A;  3KF6 B;  4QL5 A;  4HCE A;  4FO2 A;  1MSH A;  4A3E G;  4C3J G;  4KY7 A;  3GTL H;  5C0X J;  2D5D A;  3GTL B;  2N3S A;  4IUU A;  3S24 A;  1EIH A;  3AEV A;  1EQR A;  2AKW B;  1AN8 A;  1B50 A;  2HD3 A;  3BVZ A;  4IFD G;  2JSO A;  1H95 A;  1GUO A;  1N8R C;  1TWA B;  1CA6 A;  4L6T B;  3BDL A;  1HNZ Q;  4XDX A;  1SJH D;  2KHI A;  2JA5 B;  2XRQ D;  3ULJ A;  1EOV A;  1LTT D;  2F6S A;  2A19 A;  3NSW A;  5CKL A;  1SDF A;  2UUB Q;  5BR8 Q;  4BY7 H;  4LFA Q;  3MFG A;  5EBC A;  3S2D H;  2MHV A;  2EVB A;  4A3J H;  3VYU A;  3TQY A;  4ZKC B;  2HIV A;  4QJF A;  4A3J B;  3CCE A;  2D2C C;  3NXW A;  2OQK A;  2KEN A;  1PXU A;  5LL6 X;  2B8F A;  5DM6 3;  3E3X A;  1CQV A;  5KND A;  3DEP A;  3VR2 A;  4K5V A;  4WFN 3;  1OO9 B;  4X64 L;  2AQ2 B;  1U4L A;  2UU9 Q;  3PO3 H;  4ZUI A;  1TY0 A;  5C3X A;  5C3W A;  3PO3 B;  4HJ7 A;  4JVZ A;  5JJL A;  2ZTC A;  4GKK L;  4QUF A;  1XMQ Q;  5BN5 A;  1SE8 A;  5M3F G;  1XWE A;  3CXC A;  1F9P A;  5CMT A;  1SYG A;  3GTM H;  2D0P A;  1VQL A;  1ONL A;  4DV5 L;  4BY1 G;  4K0K Q;  5CV8 A;  1O7I A;  2F0E A;  5IP9 H;  1HZC A;  3GTM B;  4ZKB B;  3SEB A;  1RL2 A;  1J5E Q;  3I4O A;  1ZXT A;  3AMU A;  3NTI A;  4DV2 Q;  1EY6 A;  1Z6H A;  2KA7 A;  5IT9 E;  1JJ2 A;  1HNW L;  3ZYY X;  4K6D A;  4PV1 C;  4DK6 C;  4LUZ A;  2RCF A;  4AQY L;  4QF4 A;  1SYD A;  4YY3 L;  1PZK D;  2JEA I;  4GKJ L;  3ER0 A;  1SRO A;  3HRZ C;  5IYD H;  1JOR A;  5DAU A;  1ZYR D;  4DR1 L;  4EVO A;  4LK1 C;  2N8N A;  1L1O A;  2Q2T A;  5E3F A;  3TP7 A;  2K4K A;  4CBV A;  1VMC A;  3Q6S A;  1N34 Q;  4LUO A;  2L4N A;  5F2D A;  2NN6 I;  3OTO Q;  4P74 A;  1JWS D;  1IXR A;  4IUR A;  1KRT A;  3PSI A;  3HKZ E;  4RH6 A;  1PVO A;  3P1H A;  2KUM A;  3KBX A;  1X65 A;  2QW7 A;  1TVX A;  3TEH B;  5M3M G;  4H7B A;  3A74 A;  1I50 H;  4XQQ A;  4ILW A;  1OXT A;  2R61 A;  1JOO A;  1I50 B;  3VDY A;  1EYG A;  1YJ9 A;  5HGT A;  1AE3 A;  2GVB A;  1S40 A;  1DON A;  1BUV T;  1NMF A;  2M2L A;  4DV3 Q;  2CVR A;  3W2D A;  2TMP A;  5IGB A;  4K6L A;  5E4X A;  4X3U A;  1UE5 A;  1D7Q A;  2F0H A;  4YIJ A;  4U0U A;  3JAM E;  2OWO A;  1E2Z A;  2J7Z A;  2PMZ E;  3I91 A;  4K2L A;  1LTI D;  1PMR A;  2JA8 H;  2SNS A;  3E6Z X;  3FHW A;  3J7Z C;  1JIC A;  2EY6 A;  3T51 B;  5FLX c;  5IYB H;  2RDG A;  5JOB A;  1LTS D;  3LWU A;  1MD2 D;  2UXB L;  4OIJ A;  1D5Z C;  2EYH A;  2AUK A;  1KLG D;  5I4D A;  3CRL C;  1EYC A;  1KAA A;  4PNY A;  4DR7 L;  3CCL A;  2CQO A;  1HNX Q;  4QQB X;  1EQQ A;  3BVM A;  1Z9F A;  1T9H A;  4DV0 Q;  2JXM B;  4IO9 A;  5JJK A;  1K83 H;  3CQZ H;  1CSP A;  1MBY A;  2K75 A;  2MJ8 A;  1SRU A;  1E2W A;  1Q1E A;  5LL6 S;  4EQN A;  4XT1 B;  1VQ8 A;  1ET9 A;  2CCZ A;  4YCV A;  5C3E B;  2JA6 G;  1IL2 A;  4JI2 L;  3V2T A;  1PRT F;  1WFQ A;  3J81 i;  3S1M H;  1G6Z A;  4K5W A;  2DGY A;  3I55 A;  3NWS A;  1PYB A;  3S1M B;  2UUC Q;  2EYM A;  1TT2 A;  1VQA A;  4A3K B;  1CFM A;  3BS1 A;  3GTQ B;  1ASY A;  2JA7 G;  1F2M A;  3UDI A;  3CD6 A;  3RD4 A;  1STG A;  2VY3 A;  5CV7 A;  3OPO A;  2DY8 A;  5KIX A;  2A6E D;  1OXU A;  4A3M H;  1N33 L;  1TWC H;  2NVY B;  4OWW B;  4QB4 A;  2R93 H;  2SOB A;  1D1I A;  3I7F A;  1VQ7 A;  3PUX A;  2CW0 D;  4PZ6 A;  1CA5 A;  1EY7 A;  3A8J E;  1G51 A;  3JAM c;  1CT1 D;  2AQ3 B;  4J15 A;  4BY7 G;  4WJ4 A;  1V1O A;  1SSO A;  3DEO A;  2RCN A;  3QJY A;  3A8I E;  1MIU A;  1EU4 A;  3N3U A;  3SXH A;  3CU7 A;  3MXU A;  1IBL Q;  4H0L C;  4HID A;  1HRJ A;  3NBH A;  2RDF A;  2Z0S A;  4L5Q A;  3HOV H;  1FGB D;  3I56 A;  1UEA B;  2MPM A;  3DLL A;  4L5R C;  1JCK B;  2WKC A;  2FIN B;  3H09 A;  4DK3 C;  1RHP A;  3MC0 B;  5E1F A;  4Q5V A;  4GOP A;  4RGN A;  4BS9 A;  1NE3 A;  4WRD A;  2RSO A;  4A76 A;  4ALP A;  3NTK A;  3UE0 A;  4A3B G;  2Q2I A;  4QGU A;  4M16 A;  4FF3 A;  1E0B A;  3KJP A;  3I8Z A;  2SEB D;  1SEB D;  4KKU A;  1MGS A;  4LW1 A;  4BBS G;  2N78 A;  2F0D A;  3EFX D;  5A35 A;  2CW0 C;  2I5M X;  2B3G A;  3O13 A;  2Y0S B;  3H3V I;  1EY8 A;  3OSO A;  4DFA A;  2ZTD A;  2M9V A;  3HOY H;  2JA9 A;  2KHJ A;  2VW9 A;  2QGQ A;  4KHP L;  1ICW A;  4BBR B;  2YTX A;  5IY0 A;  3HOY B;  4B3S L;  2NTS A;  1QG7 A;  1IBM L;  2VB2 X;  1Y1V G;  3HG9 A;  5CMD A;  1Q81 C;  3AQQ A;  1DCZ A;  1SXT A;  4DR2 L;  1FD7 D;  1WOC A;  3HOX B;  1FL0 A;  1HNW Q;  2PW5 A;  3PIP A;  2YV5 A;  5I6W A;  1FNU A;  4AQY Q;  2G9H D;  3A0J A;  1XX8 A;  5IP7 G;  3NHH A;  4I65 A;  1V1P A;  4AIM A;  1PTO D;  4U0Z A;  4DAY A;  5JEA J;  4CDE C;  4ITR A;  2Z6K C;  4G4K A;  4LF4 Q;  4AH6 A;  3I72 A;  3CCV A;  2K14 A;  3HOZ G;  2GN5 A;  3M7N A;  1SNQ A;  1NMG A;  1FNV A;  1QIL A;  5EPL A;  4CHT B;  3KBG A;  1K3B C;  4JCV E;  5E4W C;  1X55 A;  4A93 G;  3T1H Q;  4UY8 C;  1ENA A;  3T16 A;  3ICE A;  2FXQ A;  3E9I A;  2QCP X;  4JK1 C;  3ERS X;  2DJG C;  3GV6 A;  4NPS A;  5CGK A;  4XIG S;  1SNM A;  2K04 A;  4JBK A;  3I4L A;  4A3I H;  2WB1 B;  2C5C A;  4OX9 Q;  1TU2 B;  4FF4 A;  3D3R A;  4OON A;  1QCB D;  4YWL A;  3NWT A;  3MVV A;  2F4V L;  2Z4I A;  4OO1 H;  3BYY B;  4DN4 M;  1GUG A;  1TKW B;  3GTG H;  2B2W C;  3PUZ A;  2JA8 G;  3GTG B;  2PNR C;  1PTO B;  4DV7 L;  1TR5 A;  3KUP A;  3AU7 A;  1GVP A;  1Q86 C;  4GZY C;  3STB D;  1YI2 A;  1EWH A;  1S5B D;  2YTV A;  3MZ5 A;  2MNA A;  2NN6 H;  1GUN A;  3VYS A;  4S3S A;  1LO5 D;  3GQB A;  3OHX C;  4LAA A;  4IOC A;  3T4A C;  1HPC A;  3J80 c;  1L1O C;  2GVA A;  3KDF A;  1H9J A;  4X2D A;  1BR9 A;  2A8V A;  2B63 B;  2VQF Q;  5M5W B;  3J81 E;  4A3E B;  4C3J B;  4QIW E;  1VF7 A;  3F2U A;  4A3C H;  4I7A A;  1F9S A;  1C4Q A;  3TSS A;  2F0S A;  3BZD B;  1HNZ L;  4P71 A;  3OIP A;  3WDN A;  1STN A;  4IFD H;  5IGD A;  1L0Y B;  1WTR A;  2JYO A;  4TRD A;  2EXD A;  2F0N A;  2LFN A;  1SMY D;  3S14 H;  5D65 A;  2MQH A;  4LU4 A;  3S14 B;  2F0T A;  5EAY A;  5GAD C;  4X66 L;  2ATW A;  5BR8 L;  1LV9 A;  1YNN D;  1VQI A;  4LFA L;  1EL0 A;  4DGZ A;  4HIK A;  1EWC A;  5M5X H;  2VZA A;  3STB C;  1A0I A;  2YYZ A;  5M5X B;  3F2D A;  2NVQ B;  1R4P B;  4O0A A;  5C4X H;  3CMA A;  2NZ1 D;  5KNC A;  1I6V C;  1C0A A;  3KLS X;  5GAE C;  2ASB A;  2R93 G;  5EQ0 A;  1I4Q A;  4CDD C;  3DHQ A;  5FJ8 G;  4JOI A;  5FO9 B;  4U04 A;  1OTC A;  2UU9 L;  3L2P A;  4GLV B;  3D6W A;  4OWX B;  3ITP A;  3SN9 A;  3F2C A;  2KBN A;  1E22 A;  1VS0 A;  4R8I A;  4K5X A;  3OIQ A;  4ABN A;  3LNN A;  4F7X A;  1EYA A;  2EY1 A;  3RR5 A;  3HOV G;  2RA4 A;  1NR2 A;  4RFB A;  5M3F H;  4K0K L;  1F2L A;  1RKN A;  3SK5 A;  1Y69 U;  1TWF B;  3GTO H;  1BBX C;  2V4D A;  3SR1 A;  4DV2 L;  2L0C A;  4BY1 H;  3W1B A;  4DUY L;  4BY1 B;  1DJR D;  4ULL A;  4JI1 Q;  5CR3 A;  4RHS A;  5GRO A;  4DV6 Q;  3ZC7 A;  1VQ4 A;  2RBM A;  4C3I G;  1K28 A;  2ZTE A;  2YU9 B;  4UP7 A;  2RF4 A;  3IFT A;  1SNC A;  3FPU B;  4B3R L;  1AH9 A;  4HJ9 A;  3E0E A;  3D31 A;  2JQO A;  1JC7 A;  1CKO A;  1UAP A;  3ONA B;  1VQP A;  3NK9 A;  2CWP A;  1N34 L;  2Q2U A;  2PZW A;  3HOU G;  5CGL A;  3DWA A;  4BA1 I;  2A68 C;  3TDQ A;  4XTC S;  3NPP A;  2PPB C;  1B44 D;  2AQ1 B;  2XWJ B;  4KTA A;  3BDO A;  1BDO A;  4KHP Q;  1KTK A;  5M5Y H;  4B3S Q;  1CZW A;  1IBM Q;  3K6O A;  1ET6 A;  2KCM A;  1TS4 A;  4ODG A;  2JK8 A;  4MHE A;  3PUW A;  5M3M H;  1HJP A;  2QA4 A;  3FPP A;  1D6E C;  5M3M B;  3ND9 A;  3MEF A;  1HCZ A;  1B53 A;  4A3G G;  5C4Z A;  1G91 A;  1LT3 D;  4E6I A;  3S1R H;  5C0X G;  2VQE Q;  3J7A F;  2B2T C;  1NJI C;  1PHJ A;  3S1R B;  3D8G A;  2ENB A;  2BH2 A;  5IYC G;  5C4J H;  2MO0 A;  1DD2 A;  3H3V H;  1UE7 A;  1YBY A;  3VR4 A;  2ZXO A;  1HHV A;  2NB0 A;  1GUS A;  2WFW A;  4A3I G;  3KYH C;  1BCP F;  5DEH A;  2D0O A;  3EVQ A;  1PLF A;  1L0X B;  1RDP D;  1Z7T A;  3MEH A;  1HNX L;  3CPF A;  3RLO A;  4DV0 L;  1WD0 A;  1LTL A;  1XYI A;  5ELD A;  3RLF A;  3A7A B;  4HIO A;  5IGE A;  1IHZ A;  1VQH A;  1Q8K A;  4LF5 L;  1JMC A;  1X54 A;  4CDC C;  1DOM A;  4DXG A;  2A6H C;  4TKO B;  2SNM A;  3S1Q B;  5IGC A;  3PMF A;  2RHQ B;  1QZH A;  3S6A A;  4FXK C;  3CC7 A;  4DK1 A;  1TS3 A;  4J6H A;  1DZ1 A;  3NEN A;  3TRZ A;  2AHO B;  2NUD A;  3PV0 A;  1V8Q A;  1BBU A;  1DM0 B;  2JA6 B;  4JV5 Q;  5A2Q E;  1GHJ A;  1X56 A;  3CCQ A;  3SE5 A;  4LF8 Q;  1WTP A;  2E2I H;  2O5I C;  4A3C G;  1W2B A;  3HS0 C;  2WAQ B;  1QUQ B;  3BVG A;  4JBW A;  2JA7 H;  2E2I B;  2VXW A;  5COR A;  3VA5 A;  2JA7 B;  1RTN A;  2BOS A;  4GLA C;  3QO2 A;  1A3V A;  1BQQ T;  1IKL A;  4IAL A;  1U4R A;  4HJA A;  1CQF A;  3L0O A;  1GD7 A;  3Q8D A;  4LJZ C;  2EDG A;  1QVC A;  5EKL A;  2A69 C;  3GD7 A;  3BU2 A;  3KJO A;  4RWS C;  4KN7 C;  1BF4 A;  1IBL L;  2E2H H;  4X66 Q;  1MJC A;  2L11 A;  2NYZ D;  3HKZ G;  2C35 B;  5C4X G;  1O7L A;  4BY7 B;  4CKC A;  4A3D G;  4JI0 Q;  1H9R A;  3C2P A;  1D5M C;  3S2D B;  1A8V A;  3H91 A;  3J7A 5;  5JEA H;  2F0O A;  2Z6K A;  2L55 A;  5EKI A;  1SFO H;  2VUM G;  4QUC A;  3I4N G;  3VR5 A;  3I3C A;  5KEE A;  1Y14 B;  4G7Z C;  3EBE A;  5ELF A;  4FXG C;  4CJ0 B;  5D3I B;  3M4O H;  1R4Q B;  2NTT A;  1VQ6 A;  2N49 A;  1IZ6 A;  3K7A H;  2UUA Q;  4A3B H;  3KF8 A;  4A3B B;  1GXD C;  3PIO A;  1AZQ A;  2FJ2 A;  2Z4H A;  2I0Q A;  2AUJ D;  3NE5 B;  2F0M A;  3R8B A;  4BBS H;  1WJJ A;  5CYU A;  3UDF A;  2K52 A;  1IYV A;  3BZK A;  5FLX E;  1FNW A;  1NR4 A;  2KVM A;  4BBS B;  5D14 A;  4Z9C B;  3GTP H;  5IGF A;  3D4D A;  1M8A A;  2N88 A;  2VB3 X;  4DNI A;  3VA7 A;  3TP8 A;  4A4I A;  2B2W A;  2L1B A;  2K32 A;  4DUY Q;  5IIF A;  3PCO B;  1Y8N B;  1D5X C;  1Y1V H;  4MN3 A;  1YZ6 A;  1Y1V B;  4FXD A;  4OO1 I;  3K5L A;  5I9O A;  4GLX A;  3J80 i;  1XPU A;  2IY5 B;  4AYB G;  4LF4 L;  1CKN B;  5IP7 H;  4B3R Q;  1FR3 A;  1EUJ A;  5FOB B;  4QIW B;  4PZ7 A;  5I2X A;  3A7L A;  4JOI C;  4KMU C;  1SE4 A;  1V1Q A;  2F0P A;  3A56 A;  2K5W A;  2QIL A;  1VQC A;  4DA2 A;  3T1H L;  1BBW A;  2CHB D;  2R7Z H;  3CAM A;  3HOZ H;  1PFB A;  3AFP A;  4IPG A;  5GAG C;  5T1I A;  4LF7 L;  2H4O A;  5T1G A;  2RVL A;  1KNA A;  3K57 A;  1EFW A;  4A93 H;  2Q8T A;  1KDB A;  1SE2 A;  2XSC A;  2BA0 A;  4A93 B;  1PDQ A;  3FMC A;  4RGO S;  3AFQ A;  1SAP A;  2F0V A;  2HDL A;  3FEW X;  4OX9 L;  3TZU A;  4RHR A;  5DNF A;  4HMI A;  4K14 A;  1JE4 A;  4NKL A;  4YWK A;  2OTL A;  2EYF A;  4DKA C;  1B7Y B;  1BVS A;  5IT9 L;  3D0F A;  1O80 A;  4IFD I;  3QB3 A;  3RMH A;  1D1K A;  2PQA B;  1GKH A;  1O7Z A;  1PH2 A;  3TZD A;  1HH2 P;  4HJ8 A;  1ZYR C;  3DUZ A;  1LUZ A;  5C6A A;  4NXM L;  4J8Q A;  4V0B A;  5GQO A;  2JA8 B;  4JI3 Q;  1KHI A;  1ESF A;  4DNT B;  1SNP A;  2F03 A;  4JI7 Q;  5FO7 B;  2B8G A;  4X62 L;  5DM7 3;  3P7J A;  3SK8 A;  1X3G A;  4DV4 L;  1QVG A;  4O42 A;  2VQF L;  1F2Z A;  1PYS B;  3GP7 A;  1B4O A;  1SND A;  3EJI A;  4B3T Q;  5CBA E;  2F0F A;  1DOL A;  2B29 A;  2RDH A;  5C4H A;  2EE1 A;  1K83 B;  3CQZ B;  2B2V A;  4AYB E;  5ELO A;  3TRE A;  4KY5 A;  4LF5 Q;  1JR0 D;  2LSS A;  1G6P A;  4DAV A;  2HT1 A;  5EGT A;  5C5M A;  1E24 A;  4QY7 A;  2F0I A;  1FGU A;  1HTL D;  1QB5 D;  2AMC B;  1P8L A;  1ML0 D;  1VQF A;  4ZK9 B;  2IX1 A;  4UDU C;  1L2F A;  1UE1 A;  1I4R A;  3K81 C;  3Q22 A;  4FVM A;  3U9S A;  1I5F A;  4OHJ A;  2ES2 A;  2K05 A;  2PNH A;  1PRT B;  4XT3 B;  4U07 A;  2EY2 A;  1M4V A;  1TQO A;  3HEJ A;  1FJG L;  1EIG A;  4GNX B;  2Z9H A;  1A6X A;  4JI4 L;  3WOF A;  2NUN A;  4B9X A;  4A3M B;  1PH8 A;  5TSS A;  5C44 G;  1TWC B;  5FJ8 H;  3SK6 A;  4C1N I;  2R93 B;  5CBE E;  2R92 H;  5KRU A;  3R2T A;  4OXP A;  1XMO L;  2E5L Q;  1N9W A;  1QVF A;  2WII B;  3GTK H;  1X9N A;  1LTB D;  1CHQ D;  1U5K A;  5G3L F;  3HKS A;  2L5T A;  2JJQ A;  2QKI C;  2JN4 A;  1Q8I A;  5JEA G;  4G7H C;  4N8F A;  3RNU A;  1H9S A;  1S5C D;  2Z6B A;  1ILQ A;  3HOV B;  2XRS D;  3PIO 3;  4JI1 L;  3N6R A;  3M85 A;  4DV6 L;  4ZRZ A;  3FRP B;  1HTP A;  4FP5 D;  5EBD A;  2B2T A;  4KI0 A;  4LF6 L;  4R9W A;  4C3I H;  4OWT B;  2A6E C;  3Q23 A;  2NVX H;  2MP1 A;  1JJC B;  2IHF A;  2NVX B;  1OXS C;  4WGJ A;  3K5O A;  4H02 A;  2LXJ A;  3CME A;  2HHH L;  2Q8R E;  3HOU H;  3J80 E;  5JVH 3;  4JYA Q;  4LFB Q;  1A3T A;  3HOU B;  1TY2 A;  3MTS A;  2HIX A;  3HZX A;  4O2D A;  4HN7 A;  4NXN Q;  1ROD A;  1X32 A;  3DXJ C;  1EZ8 A;  1VQM A;  3MHB A;  2GA4 B;  1U4P A;  4APV A;  2EJM A;  2EXZ A;  1KQS A;  3K7U C;  1SLJ A;  5KGU A;  2VQE L;  2R7Z G;  3QG1 A;  4LNQ A;  3PO2 G;  2OCE A;  3KF6 A;  1WTW A;  4A3G H;  4OIK A;  4KV6 A;  5C0X H;  4A3G B;  1XXG A;  2HQL A;  3TS0 A;  1TWG H;  1NH1 A;  4HSP A;  2A1A A;  1II3 A;  4LF7 Q;  3RUZ A;  2CWA A;  5IYC H;  4N8X 1;  1U0L A;  1BOS A;  5HY6 A;  3GTJ H;  4RMF A;  2X69 A;  2ZXR A;  3UDG A;  2CFM A;  2EYL A;  4A3I B;  3GTJ B;  2B2Y A;  1FVI A;  3CPW A;  3TN2 A;  1AEX A;  1P16 A;  4UP9 A;  2RHS B;  2NWG A;  3S2H H;  1W6J A;  5ISR A;  4ME5 A;  3S2H B;  2A5H A;  1PTO C;  2MUY A;  4N9P A;  2K01 A;  5BN4 A;  3Q24 A;  1HQM C;  1I94 L;  5J3B A;  4NXM Q;  5H1S E;  1K73 C;  1JJG A;  4IPH A;  3A8K E;  4JBJ A;  3CCM A;  2BDO A;  1XTC D;  2LY7 A;  3M4Y A;  2DNE A;  1VQO A;  4ZYS A;  4N67 A;  1C8C A;  1LTA D;  1EQV A;  5JPN C;  4JV5 L;  4X62 Q;  4XQJ A;  4DV4 Q;  4LF8 L;  2PYK A;  2LKV A;  2I5H A;  5HGQ A;  4ZAI A;  4BA2 I;  3NTH A;  4GN5 A;  2LMC B;  3X3M A;  1R9T H;  5IOC A;  1KLU D;  3C46 A;  4C3H H;  2HCI A;  1L1O B;  4DR5 L;  3RN2 A;  4RCN A;  1HZ9 A;  1SJE D;  4L63 B;  1S3O A;  2CQA A;  4PG3 A;  3QR8 A;  1WTO A;  5JPM C;  2EZV A;  3OWE B;  3S1N H;  4TSS A;  3NEL A;  1Y1W H;  1K0R A;  1M90 C;  3S17 H;  1UWV A;  4NB3 A;  4X65 Q;  2WV6 D;  1VMP A;  4JI0 L;  1O7Y A;  2IX3 A;  3FKI H;  3OYY A;  2PW7 A;  4YCU A;  5C3E G;  4JI6 Q;  2AWN A;  2YTY A;  3C1E A;  2A74 C;  2MFI A;  3HKZ B;  4A3D H;  5C4X B;  3RZD H;  1T5E A;  3P75 A;  1B1Z A;  3E0J A;  4A3D B;  3EA6 A;  1HQR D;  1KDA A;  3S16 H;  2R92 G;  1FJG Q;  3E9H A;  2VL6 A;  4P75 A;  1B9N A;  3S16 B;  1MKH A;  3TBI B;  4JI4 Q;  2VUM H;  1XPO A;  3I4N H;  2UUA L;  1EY9 A;  3I4M G;  3FVQ A;  3NQT A;  2VUM B;  3I4N B;  1RTO A;  3J81 L;  1VQB A;  5DLQ E;  1XMO Q;  5JAV A;  2V1C C;  3MXN B;  2NBF A;  1CUK A;  1HUM A;  3CF5 A;  1GM5 A;  1VF5 C;  2B2V C;  4HCS A;  3TP6 A;  1E1T A;  1SMY C;  1WVL A;  1QJO A;  4CKE A;  2PMZ B;  5M3F B;  2FHT A;  3V96 A;  4YCW A;  3GV3 A;  3U9O A;  1YNN C;  1S72 A;  2N55 A;  3GTO B;  2IT1 A;  4R4T A;  5IOD A;  1EOT A;  3VR3 A;  4P72 A;  2G9D A;  1OXV A;  3EIV A;  4C2M H;  4FYD A;  1JOQ A;  3MXG A;  1FYC A;  1ICF B;  2K5N A;  4C2M B;  4DV1 L;  2EOT A;  2BCO A;  2P5Z X;  1U4M A;  1JE5 A;  3W3A A;  4MIU A;  1VDZ A;  2F0G A;  4HTH A;  4UPA A;  4JI5 L;  3OWF A;  4LF6 Q;  1YNJ D;  1A2T A;  5KNB A;  3HOW G;  5AFW A;  4DXF A;  1JWM D;  3QOJ A;  3U50 C;  3PIP 3;  2OF1 A;  2QDL A;  4QCL A;  2FMC A;  4AYB B;  2IJ0 A;  3FP9 A;  2HHH Q;  4CJ1 B;  1SBB B;  1N32 Q;  2PI2 E;  3NBI A;  1EQT A;  1W3S A;  1YIT A;  3QOL A;  3SHL A;  1XNQ Q;  2KCN A;  1BCP D;  5M5Y B;  1STE A;  2Y0S G;  2I07 B;  2RKS A;  3VYT A;  4POF A;  2ID0 A;  4O1N A;  3KK7 A;  3M4Q A;  2QDB A;  4DPG A;  2PI2 A;  3K0X A;  2WAC A;  2DN8 A;  4MZ9 A;  4BBR G;  4X2C A;  1ZKO A;  2ZM6 Q;  2KED A;  2HDM A;  1SMX A;  2NUC A;  5LMU Q;  3ZLM A;  1YHA A;  4YWM A;  2RSN A;  5AJ3 Q;  1J8I A;  2CKZ B;  2VNU D;  4HSV A;  4KHZ A;  1PA6 A;  1YVC A;  4WJ3 M;  2A73 B;  2HCC A;  5IWA Q;  3M3Y H;  1B8A A;  2K6A A;  1K8G A;  4JI3 L;  3NBH B;  3M3Y B;  1K9M C;  1K3R A;  4JI7 L;  2UXC L;  5C4J B;  1S5E D;  1Q3L A;  5FO8 B;  2R6G A;  4B9W A;  4FNF A;  1ILP A;  1IBK Q;  3U58 A;  4Q0F A;  3GDE A;  1HR0 Q;  1EU3 A;  4GOP B;  2IW3 A;  4DR4 Q;  3KOJ A;  2BE5 D;  1WI5 A;  3A5Z B;  3HGB A;  3GO5 A;  3S9W A;  4B3T L;  4KK7 A;  1BCP B;  1TWH H;  2E75 C;  4GS3 A;  3TP5 A;  1L0W A;  4A3F H;  2G5D A;  4TQU S;  5KYI A;  1WCM H;  5K36 G;  1ENC A;  2JE6 I;  2DJF C;  2KEE A;  2WB1 G;  2ICE C;  4G57 A;  4DAM A;  5BN3 A;  1A15 A;  4FDB A;  1KIX A;  1A2U A;  5JJI A;  5JFF A;  1PH7 A;  1VQG A;  3A54 A;  3HP3 A;  1IW7 D;  4ZLT F;  3VR6 A;  1KL9 A;  2D62 A;  1I94 Q;  1B2T A;  3T53 B;  3UE1 A;  1X3P A;  3W1G A;  2ICI A;  4EX5 A;  3BYT B;  2XN9 C;  2K03 A;  1BKB A;  4G7O C;  4KKT A;  2ZJR A;  3DWQ A;  3CKI B;  1VQK A;  1EEI D;  4XYQ A;  3I73 A;  2Y0S E;  4CDF C;  3T1Y Q;  1EYD A;  4C3H G;  3JC6 6;  5EJW A;  1LT5 D;  3AB9 A;  4JG2 A;  1PH3 A;  4DAY B;  1STH A;  4DU9 A;  1IL8 A;  2DY7 A;  1DYQ A;  1J6Q A;  1SNO A;  1XJV A;  2XGT A;  1VQE A;  2F0Q A;  2I5L X;  5EU0 A;  3A5U A; 
#chains in the Genus database with same CATH homology
 5JJ6 A;  3PIP A;  2YV5 A;  4DR5 Q;  1XMQ L;  4JI7 Q;  2B63 G;  2IX0 A;  2E5L L;  2EIF A;  2NZH A;  4AQY Q;  3A0J A;  5C44 H;  5IP7 G;  4X62 L;  1Y1W G;  1XNR Q;  5JJ7 A;  1X3G A;  2PQA A;  4DV4 L;  4AIM A;  1Q1B A;  4U0Z A;  1TXY A;  4P73 A;  5JEA J;  1QVG A;  3HFZ B;  4ITR A;  1TWF H;  2Z6K C;  3FKI G;  3ULP A;  2VQF L;  5LMN L;  1PYS B;  4LF4 Q;  4AH6 A;  3CCV A;  4TVA B;  2K14 A;  1TWA H;  1J5E L;  3HOZ G;  2GN5 A;  3M7N A;  1WYD A;  2R7D A;  4B3T Q;  1NMG A;  4PZ8 A;  2Q2H A;  2B29 A;  2L15 A;  3EN2 A;  1X3E A;  4JCV E;  4A93 G;  1X55 A;  3L7Z C;  3T1H Q;  2JA5 H;  4L5T A;  4UY8 C;  2EQS A;  3H0G G;  3ICE A;  3J81 c;  2FXQ A;  4AYB E;  4BXX G;  5ELO A;  3S15 H;  3E9I A;  2F52 A;  3TRE A;  2LSS A;  4R4Q A;  1YJN A;  2YU9 H;  4LF5 Q;  2IY5 B;  1YHB A;  3DM3 A;  1G6P A;  3ERS X;  2HT1 A;  1E24 A;  4QY7 A;  4ME3 A;  2BH8 A;  4NPS A;  1FGU A;  4XIG S;  2AMC B;  4HIM A;  2NZO A;  4POG A;  1P8L A;  4JBK A;  4A3I H;  1PH5 A;  1VQF A;  1E7Z A;  2IX1 A;  2WB1 E;  4OX9 Q;  1L2F A;  1UE1 A;  1XTD A;  3K81 C;  4OON A;  5FLM H;  1K8A C;  3G4S A;  4YWL A;  1I5F A;  3PUV A;  3OTO L;  2ES2 A;  3HOY G;  2PNH A;  2UXD L;  2F4V L;  1YNX A;  1N36 Q;  1LYL A;  1Q46 A;  4U07 A;  3CW2 C;  3GTG H;  1RIP A;  3KDF B;  5C0X I;  4GN4 B;  3PUZ A;  2JA8 G;  1KRS A;  3HOX G;  4LWC A;  1EIY B;  4DV7 L;  1FJG L;  4JYA L;  3U4Z A;  4GNX B;  1Q86 C;  1GVP A;  4LFB L;  3STB D;  1YI2 A;  2YTV A;  4JI4 L;  3ZCB A;  3PGZ A;  2MNA A;  4KLK A;  1A63 A;  1PH8 A;  4NXN L;  1VQ9 A;  5C44 G;  1VCI A;  5FJ8 H;  4R4I A;  4DR2 Q;  4IOC A;  2BA1 A;  2R92 H;  4DUZ L;  4LF9 Q;  3J80 c;  4OXP A;  1L1O C;  1XMO L;  1KC8 C;  2GVA A;  4PY3 A;  3KDF A;  2ZJP A;  2E5L Q;  4L5R C;  1N9W A;  4IJH A;  3ULL A;  4LFC L;  1QVF A;  4DV3 L;  4X2D A;  3GTK H;  4DV1 Q;  1X9N A;  4GNX A;  1YIJ A;  1U5K A;  4IFD J;  3HKS A;  4JI5 Q;  2A8V A;  4GOP C;  2VQF Q;  5LMN Q;  2JJQ A;  4QIW E;  4A3C H;  5JEA G;  4Y52 H;  3BJU A;  3RNU A;  1I3Q H;  2F3I A;  1HNZ L;  4P71 A;  1A62 A;  4JI1 L;  3PO2 H;  3K80 C;  3M85 A;  4DV6 L;  1E1O A;  1PH4 A;  1I6H H;  3WWV A;  2EXD A;  3S14 H;  4YHH L;  4A3L H;  2MQH A;  4LU4 A;  3CCU A;  4B3M L;  3SHG A;  5EAY A;  4KI0 A;  5GAD C;  3TS2 A;  4X66 L;  5FLM G;  4LF6 L;  2ATW A;  5BR8 L;  3PF4 A;  1VQI A;  4JC0 A;  3JAM i;  4LFA L;  4EQ5 A;  5GAH C;  1KAW A;  4C3I H;  1EIF A;  4OWT B;  4HIK A;  2ZJQ A;  4OO1 G;  5E7N A;  5M5X H;  1JT8 A;  2VZA A;  1VQJ A;  3STB C;  3M9B A;  4R4C A;  1JJC B;  2IHF A;  2NVX H;  1A0I A;  1YEZ A;  2IHE A;  2YYZ A;  1E3P A;  2WP8 J;  1OXS C;  4WGJ A;  4RG1 A;  4H02 A;  3UDX A;  3LET A;  3F2D A;  1ASZ A;  2F4V Q;  4O0A A;  2LXJ A;  5C4X H;  3CMA A;  1GO3 E;  3CME A;  2HHH L;  3CP0 A;  1C0A A;  1C9O A;  5GAE C;  2R93 G;  2ASB A;  1DGS A;  2NN6 G;  3I2Z A;  3S1Q H;  4A75 A;  5FJ8 G;  4IPD A;  3HOU H;  4JOI A;  4DV7 Q;  4U04 A;  4JYA Q;  1OTC A;  4LFB Q;  2UU9 L;  3L2P A;  1X6O A;  4GLV B;  2HIX A;  4O2D A;  4NXN Q;  4OWX B;  1HZA A;  2UUC L;  3SN9 A;  1VQM A;  3F2C A;  4HJ5 A;  2KBN A;  1E22 A;  1OXX K;  1VS0 A;  3KF6 B;  1UEB A;  4QL5 A;  2JA6 H;  3LGJ A;  1KXL A;  2UXC Q;  4DR6 L;  4APV A;  4A3E G;  4DR3 L;  3GTL H;  4LFC Q;  5C0X J;  3F2B A;  4JBM A;  1NBW A;  2N3S A;  1KQS A;  3S24 A;  3K7U C;  2AWO A;  3RR5 A;  3AEV A;  1EQR A;  1NY4 A;  3HOV G;  1SLJ A;  2AKW B;  5M3F H;  4K0K L;  1LM0 A;  2VQE L;  2R7Z G;  4A3F G;  1YHQ A;  4LNQ A;  1WCM G;  3GTO H;  3G71 A;  4IFD G;  3PO2 G;  1B70 B;  2OCE A;  3KF6 A;  3RLN A;  3M4P A;  4DV2 L;  1XPR A;  1N8R C;  1H95 A;  1IYJ B;  4A3G H;  2E2J H;  4BY1 H;  4A3L G;  3W1B A;  4DUY L;  1HNZ Q;  2HQL A;  4JI1 Q;  3TS0 A;  1TWG H;  2KHI A;  5GRO A;  3ZC7 A;  2A1A A;  3ULJ A;  4DV6 Q;  1VQ4 A;  4LF7 Q;  5IE8 A;  1EOV A;  4MNO A;  2CWA A;  2K5V A;  5IYC H;  1X3F A;  3PF5 A;  2ZTE A;  2F6S A;  5IT9 c;  2A19 A;  4UP7 A;  4B3M Q;  2RF4 A;  5CKL A;  2UUB Q;  5BR8 Q;  1QZG A;  4B3R L;  1AH9 A;  1U0L A;  4BY7 H;  4LFA Q;  4HJ9 A;  5HY6 A;  3E0E A;  3GTJ H;  4RMF A;  4X65 L;  3D31 A;  2JQO A;  1VQP A;  1CKO A;  3J81 j;  1PFS A;  3UDG A;  2CFM A;  3S2D H;  4A3J H;  2QEX A;  2CWP A;  1N34 L;  1FVI A;  3CPW A;  3TQY A;  5JFZ A;  4JI6 L;  2HIV A;  4QJF A;  2Q2U A;  3CCE A;  3HOU G;  5CGL A;  4BA1 I;  2OQK A;  1D8L A;  1P16 A;  2KEN A;  4XTC S;  1EWI A;  4UP9 A;  3ZJY C;  2RHS B;  2K50 A;  3S2H H;  5C3E H;  4X64 L;  4KHP Q;  4GN3 B;  5M5Y H;  4JI8 L;  4GNX C;  4PMW A;  2UU9 Q;  1I94 L;  3PO3 H;  4Y7N H;  4B3S Q;  1KD1 C;  5J3B A;  4NXM Q;  4R1J A;  1IBM Q;  5H1S E;  1K73 C;  1JJG A;  4IPH A;  4JBJ A;  3CCM A;  2KCM A;  4HJ7 A;  4A3K H;  5JJL A;  2ZTC A;  2WAQ G;  3GTQ H;  4GKK L;  2JK8 A;  1XMQ Q;  5M3F G;  1SE8 A;  3PUW A;  3BZC A;  1VQO A;  4N67 A;  5M3M H;  4JV5 L;  1HJP A;  3CXC A;  2QA4 A;  4X62 Q;  3I4M H;  5CMT A;  1PH9 A;  4DV4 Q;  1VQN A;  4LF8 L;  3MEF A;  4R4O A;  2I5H A;  5HGQ A;  4BA2 I;  3GTM H;  2D0P A;  1VQL A;  4A3G G;  4GN5 A;  4DV5 L;  4BY1 G;  2NVY H;  1R9T H;  4K0K Q;  1O7I A;  5IP9 H;  1HZC A;  2NVT H;  3S1R H;  5C0X G;  2VQE Q;  2JA5 G;  1NJI C;  1RL2 A;  1PHJ A;  3I4O A;  1J5E Q;  4DV2 Q;  4C3H H;  4LUV A;  5IYC G;  5C4J H;  2MO0 A;  1JJ2 A;  1L1O B;  5ELN A;  4DR5 L;  2BH2 A;  1HNW L;  3RN2 A;  3G48 A;  3H3V H;  4DK6 C;  1HZ9 A;  4LUZ A;  1UE7 A;  1YBY A;  2H5X A;  4AQY L;  1XNR L;  1CSQ A;  4IOA A;  2K5H A;  1S3O A;  3CC2 A;  4IPC A;  2JEB I;  2WFW A;  4YY3 L;  4PG3 A;  4A3I G;  2JEA I;  4GKJ L;  3KYH C;  3ER0 A;  1SRO A;  5IYD H;  2OQ0 A;  1PV4 A;  3S1N H;  4DR1 L;  2D0O A;  3NEL A;  4A3J G;  1HNX L;  1Y1W H;  1K0R A;  1M90 C;  2N8N A;  3CPF A;  3S17 H;  1UWV A;  4NB3 A;  3RLO A;  4X65 Q;  4DV0 L;  1L1O A;  2Q2T A;  1LTL A;  4JI0 L;  1JB7 A;  2K4K A;  1HR0 W;  3FKI H;  3OYY A;  3RLF A;  4HIO A;  1N34 Q;  4YCU A;  4LUO A;  5C3E G;  4JI6 Q;  2NN6 I;  3OTO Q;  4P74 A;  1VQH A;  2AWN A;  2YTY A;  1IXR A;  2UXD Q;  1Q8K A;  3HOW H;  4LF5 L;  2MFI A;  1JMC A;  1N32 L;  4X6A H;  1KRT A;  1X54 A;  3PSI A;  3PO3 G;  4A3D H;  3HKZ E;  3IRB A;  3RZD H;  3OW2 A;  1PVO A;  1M1K C;  3F8T A;  3S16 H;  1SR3 A;  4X64 Q;  2R92 G;  1FJG Q;  3E9H A;  2VL6 A;  1XNQ L;  1X65 A;  2RHQ B;  4P75 A;  1QZH A;  3S6A A;  1MKH A;  1V9P A;  4JI4 Q;  3TEH B;  5M3M G;  3CC7 A;  2VUM H;  1XPO A;  3I4N H;  3A74 A;  1I50 H;  1PH1 A;  2UUA L;  1OXT A;  3I4M G;  3NEN A;  1MJE A;  3TRZ A;  3VDY A;  2AHO B;  3KFU A;  3PV0 A;  1EYG A;  4DUZ Q;  1YJ9 A;  1VQB A;  5DLQ E;  4GKK Q;  1XMO Q;  1AE3 A;  1N36 L;  2GVB A;  2ZM6 L;  1BBU A;  1S40 A;  5IP9 G;  4JV5 Q;  2V1C C;  1NMF A;  1X56 A;  3MXN B;  4DV3 Q;  3CCQ A;  5LMU L;  4U0S A;  3SE5 A;  4LF8 Q;  1CUK A;  3CF5 A;  1GM5 A;  2E2I H;  4A3C G;  4BBR H;  1W2B A;  5AJ3 L;  1QUQ B;  1E1T A;  1UE5 A;  4DV5 Q;  1D7Q A;  2WAQ E;  4JBW A;  2JA7 H;  4U0U A;  3PUY A;  2OWO A;  2PMZ E;  4YCW A;  5IWA L;  2JA8 H;  4GLA C;  2OTJ A;  3HOX H;  1S72 A;  3K8A A;  3NEM A;  3FHW A;  3J7Z C;  2IT1 A;  4R4T A;  3B6Y A;  5FLX c;  4HJA A;  4MTN A;  5IYB H;  5IYD G;  4LF9 L;  3AYH B;  3L0O A;  1GD7 A;  1Q12 A;  3Q8D A;  4P72 A;  1OXV A;  1QVC A;  3EIV A;  4C2M H;  3GD7 A;  3BU2 A;  3KJO A;  2UXB L;  2K5N A;  1QUQ A;  4YY3 Q;  4DV1 L;  1IBK L;  4YHH Q;  4GKJ Q;  4DR7 L;  1HR0 L;  1JE5 A;  1G29 1;  3CCL A;  4JI5 L;  4UPA A;  2CQO A;  4DR4 L;  4DR1 Q;  1IBL L;  1HNX Q;  4X66 Q;  3G6E A;  2E2H H;  1EQQ A;  4LF6 Q;  4QQB X;  1MJC A;  1Z9F A;  3HKZ G;  1T9H A;  2C35 B;  3HOW G;  4DV0 Q;  5C4X G;  4IO9 A;  5JJK A;  4A3D G;  4JI0 Q;  3U50 C;  1K83 H;  3CQZ H;  1CSP A;  4L5S A;  2K75 A;  1A8V A;  1SRU A;  3KF8 B;  3CUC A;  2LXK A;  3J7A 5;  3FP9 A;  1Q1E A;  2HHH Q;  2Z6K A;  1N32 Q;  2PI2 E;  1SFO H;  2VUM G;  1VQ8 A;  3I4N G;  1VQD A;  1W3S A;  1YIT A;  2CCZ A;  1VQ5 A;  1Y14 B;  1C7Y A;  3EBE A;  4YCV A;  2KCT A;  1IL2 A;  2JA6 G;  4JI2 L;  1XNQ Q;  1WFQ A;  3J81 i;  3S1M H;  3M4O H;  2G03 A;  2DGY A;  1VQ6 A;  2Y0S G;  2N49 A;  1IZ6 A;  3K7A H;  3I55 A;  2UUA Q;  4A3B H;  1PYB A;  2UUC Q;  4POF A;  3H15 A;  2ID0 A;  3M4Q A;  1VQA A;  4DPG A;  2PI2 A;  3K0X A;  4BBR G;  4MZ9 A;  3PIO A;  4X2C A;  1ASY A;  2JA7 G;  2ZM6 Q;  2I0Q A;  3UDI A;  4DR6 Q;  4DR3 Q;  2MO1 A;  3CD6 A;  4XI8 A;  1SMX A;  5LMU Q;  4BBS H;  3ZLM A;  1WJJ A;  3UDF A;  1YHA A;  2VY3 A;  2K52 A;  4YWM A;  3BZK A;  3T1Y L;  1Q7Y C;  3CC4 A;  5AJ3 Q;  3CCJ A;  4A3M H;  1OXU A;  2CKZ B;  1N33 L;  5IYB G;  3GTP H;  2VNU D;  4KHZ A;  1PA6 A;  4X2E A;  1TWC H;  1YVC A;  4DNI A;  4OWW B;  3F1Z A;  2R93 H;  4WJ3 M;  3I7F A;  5IWA Q;  3M3Y H;  4UP8 A;  1B8A A;  1VQ7 A;  4A4I A;  3CCR A;  1K8G A;  3PUX A;  4JI3 L;  3NBH B;  1K9M C;  1K3R A;  4PZ6 A;  4JI7 L;  1AE2 A;  4DUY Q;  1G51 A;  2UXC L;  3PCO B;  3JAM c;  1Y1V H;  2R6G A;  4J15 A;  3RZO H;  1YZ6 A;  4BY7 G;  2UXB Q;  4WJ4 A;  2R7F A;  1IBK Q;  2RCN A;  3U58 A;  4DR7 Q;  3GDE A;  2DUD A;  1HR0 Q;  2B63 H;  4OO1 I;  1MIU A;  3RN5 A;  4GOP B;  4GLX A;  5M5W H;  3N3U A;  3J80 i;  1XPU A;  3KOJ A;  4DR4 Q;  1IBL Q;  4A3E H;  4C3J H;  4AYB G;  1WI5 A;  1CKN B;  2VS1 A;  3A5Z B;  3GO5 A;  5IP7 H;  4HID A;  1EUJ A;  4LF4 L;  4B3R Q;  4PZ7 A;  2Z0S A;  3SGI A;  4JOI C;  4L5Q A;  1Z47 A;  4B3T L;  3HOV H;  1V1Q A;  3I56 A;  1HZB A;  1TWH H;  1VQC A;  4IJL A;  3T1H L;  1BBW A;  4GS3 A;  1L0W A;  3CAM A;  4TQU S;  3DLL A;  5LMN W;  1WCM H;  4A3F H;  1Q82 C;  2R7Z H;  3HOZ H;  2JE6 I;  3AFP A;  5K36 G;  4IPG A;  5GAG C;  2WB1 G;  4DK3 C;  4LF7 L;  4DAM A;  4GOP A;  1EFW A;  1NE3 A;  4FDB A;  1KIX A;  3CCS A;  4A76 A;  4ALP A;  4A93 H;  1CKN A;  1V43 A;  5JJI A;  5JFF A;  3KLW A;  3UE0 A;  1VQG A;  1PH7 A;  4A3B G;  2Q2I A;  4QGU A;  4A3K G;  4M16 A;  2BA0 A;  3H0G H;  2UUB L;  3W5O A;  4BXX H;  4JI2 Q;  1KL9 A;  4JI8 Q;  3KJP A;  1YJW A;  1SN8 A;  2D62 A;  2E8G A;  3AFQ A;  2ALY B;  1PH6 A;  1I94 Q;  3UE1 A;  3U4V A;  4OX9 L;  1UE6 A;  4LW1 A;  1CKM A;  4BBS G;  2NVQ H;  3W1G A;  2N78 A;  4EX5 A;  2XTI A;  1KHI A;  2I5M X;  1BKB A;  4A3M G;  2B3G A;  4YWK A;  2ZJR A;  2OTL A;  4DKA C;  1VQK A;  1B7Y B;  1BVS A;  3H3V I;  1NTG A;  3D0F A;  2Y0S E;  2ZTD A;  3T1Y Q;  4IFD I;  3HOY H;  3JC6 6;  2JA9 A;  2KHJ A;  2PQA B;  2VW9 A;  2QGQ A;  4KHP L;  4JG2 A;  1PH3 A;  1GKH A;  5IY0 A;  2YTX A;  1N33 Q;  4DAY B;  1PH2 A;  1HH2 P;  4HJ8 A;  4B3S L;  1J6Q A;  1LUZ A;  1IBM L;  4NXM L;  1XJV A;  2XGT A;  1Y1V G;  5GQO A;  1VQE A;  1Q81 C;  3AQQ A;  2I5L X;  4DR2 L;  4JI3 Q;  5EU0 A;  1WOC A;  3A5U A;  1FL0 A;  1HNW Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...