2VY3A

Type iv secretion system effector protein bepa
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
291
structure length
291
Chain Sequence
EIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCSHDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMPEMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHPFREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDISNPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYIIGNIDHLPPEQLKILKPGDKITFTAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fic Domain Catalyzed Adenylylation: Insight Provided by the Structural Analysis of the Type Iv Secretion System Effector Bepa.
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Cell adhesion
molecule keywords CELL FILAMENTATION PROTEIN
total genus 86
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 2vy3A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vy3A02
4WJ3M 3NENA 2PI2A 2RHSB 4DR5L 1WI5A 1KQSA 4B3TQ 4A3FH 1YZ6A 4A3FG 2KHIA 1HZAA 1XMQL 1QVGA 4A3JG 1SE8A 4P75A 2Z6KA 3F2CA 1I94Q 5FLMH 4LFBL 1GM5A 2JE6I 4HIDA 3UDGA 5IT9c 3GTPH 3STBD 4A3CH 4A3CG 4WGJA 4OXPA 3HOUH 3CAMA 3WWVA 4JI2Q 3N3UA 2HIXA 4DR2L 2E2IH 3EN2A 3HOYG 2NVQH 2R92H 2AWOA 1S3OA 2WAQE 1EIFA 5GAEC 5IWAQ 2UUAQ 1Y14B 4EX5A 4R4CA 1EIYB 1N34Q 4LUZA 4B3RQ 4JBMA 2LXJA 1SN8A 3SHGA 3K7AH 1YIJA 3BZCA 4A3IH 1CUKA 2K52A 3PO3H 1B7YB 5IYCH 4DV2L 2CWAA 5IYCG 2NN6I 4MZ9A 5IYDH 2FXQA 2JA9A 5C0XJ 4YY3L 2UUCQ 4LF7L 3ULPA 3OW2A 2N78A 3NBHB 3CC7A 3ULJA 4DV0L 3GTOH 2DGYA 3PUWA 4JI8Q 3J81i 2KCTA 3W1BA 3H0GG 1XMOL 1HNZQ 1Q8KA 2A1AA 1UE5A 2NZHA 4DAMA 4OWTB 1VCIA 4L5TA 3T1YL 1X55A 3I4NG 4AYBE 2WP8J 2NVXH 2DUDA 4A3EH 1E3PA 1X6OA 4A3EG 5LMUL 4X6AH 3L7ZC 3ICEA 4GS3A 2JA8H 3GTKH 1X9NA 1EQQA 4JI1Q 2UUCL 2YU9H 2AKWB 4A3KG 4JBWA 2AHOB 4DUZL 4OWXB 2GVBA 1WOCA 2R92G 4ITRA 1W2BA 4LWCA 1L0WA 2JA7H 4JV5L 4Y52H 2ES2A 4C3IH 1HNZL 1A8VA 5C44H 4A4IA 1PH6A 4DR6Q 2K4KA 3PIOA 4LFAQ 1J5EQ 3RLOA 3UE0A 4APVA 1N36L 4A93G 2JEAI 5JJLA 4DR7Q 1LYLA 4JC0A 4JI0Q 4JI5Q 5LMNQ 1PV4A 3I55A 1XNQL 3CCJA 4JI4L 3IRBA 3AQQA 1YHQA 4KI0A 4NXML 1AE3A 1N8RC 2JK8A 3PUXA 4JI3L 4IOAA 1SMXA 3KLWA 2G03A 4FDBA 1H95A 5M5XH 2HHHQ 4GN4B 1N33Q 3CCSA 3K8AA 1X3FA 3STBC 3ZC7A 1D7QA 3I7FA 4AQYL 1XPOA 2B63H 3S2DH 4GKJQ 1UE7A 3D31A 1IBLL 3PUVA 4K0KQ 1L1OB 4A3LH 1VQ5A 1N32L 2A19A 2UUAL 1C0AA 2UXCQ 1O7IA 2D0PA 1I6HH 1E22A 4XIGS 4X65Q 4A3BG 1OXXK 1EUJA 2I5HA 2JA8G 1C7YA 4LW1A 4BY7G 1QZHA 2EXDA 2VL6A 4UY8C 4GOPB 1FGUA 1TXYA 1I94L 1K83H 5C44G 4A3DG 1IYJB 2R7FA 4JG2A 4HIOA 4IFDG 2NN6G 3I56A 5CMTA 4GKKL 2VZAA 3GTGH 2E5LL 2IHEA 3H3VH 4X2EA 5M3FH 2Z0SA 4B3TL 1YHAA 1JJCB 1NMGA 4C3HH 4UPAA 3H0GH 4POGA 1OXSC 5IP7H 3AFQA 2IX1A 3J81j 3SE5A 2WAQG 1VQAA 4X64Q 2OCEA 3BJUA 4DR1L 2ALYB 5DLQE 5C3EH 1KIXA 2R7ZH 5C3EG 5AJ3Q 4DV5L 1L1OC 4OO1G 2F6SA 4QIWE 5JFZA 2UU9L 5GROA 3KF6A 4GKKQ 2XTIA 2VY3A 1TWGH 5FLMG 3TS2A 2ZTDA 3GTLH 1TWAH 4AQYQ 1Q46A 2LSSA 4U04A 2YYZA 1VQEA 1L2FA 4IPDA 1PH3A 1IZ6A 3RN2A 1S40A 1PYBA 4GOPC 4JI8L 4ME3A 1RIPA 5IP9G 4UP9A 2IY5B 1CKNA 1HJPA 4R4OA 1U0LA 4A93H 5IYBG 4DV2Q 3NEMA 4GNXA 3M7NA 2C35B 3U4VA 4A3JH 1MIUA 2PQAB 2ZJRA 3HOXG 4DR3L 1HNXL 2Q2HA 3S1RH 4B3SL 4U0UA 2VNUD 3PUZA 1Q81C 1I5FA 2QGQA 4HJAA 2MO1A 4A3MG 1BKBA 3B6YA 4UP8A 1VQ8A 3HOVG 2YV5A 3CCUA 5JFFA 1E7ZA 5C4JH 1X54A 4OONA 2I5MX 3SGIA 4GN5A 1PH5A 1OXTA 3DM3A 1FJGL 2R7ZG 4BXXG 1EYGA 2R93G 3J7ZC 3L0OA 2E8GA 2QA4A 4DV7Q 1FL0A 1N36Q 3OTOQ 4A3LG 4DV4Q 1EQRA 4QL5A 5JEAJ 5H1SE 3GTJH 5IY0A 4LFBQ 2UXBL 4DUYL 2UUBL 3LETA 1GO3E 3W1GA 1LM0A 3CPFA 4JI4Q 4B3SQ 1Y1VH 3EIVA 4LF5Q 4DAYB 4O2DA 2ID0A 1BBUA 5BR8Q 4YWLA 4RMFA 2NVYH 2JA7G 4LUOA 5IP9H 1N9WA 1XMOQ 4O0AA 3BZKA 1VQJA 3A0JA 4DV4L 1CKMA 4PZ8A 1EWIA 2QEXA 4KHZA 4GKJL 1D8LA 1UEBA 1YNXA 1PH2A 1K8GA 1PH7A 2OWOA 4N67A 2VW9A 3FKIH 1G6PA 4ALPA 1XPRA 2K14A 3MEFA 5ELNA 4LF8L 2K5VA 4NPSA 2PI2E 1Q82C 1IL2A 1VQDA 4LF9Q 1VQ6A 4AH6A 4IJLA 1FVIA 3M85A 4YCUA 4JI6Q 3PO3G 5J3BA 2VQEL 1VQBA 4WJ4A 1NBWA 3ERSX 5EU0A 1M90C 1G291 4DR4Q 1W3SA 3EBEA 4U07A 1AE2A 3I4OA 2Q2IA 4P74A 2GN5A 2JQOA 2JA6G 2I0QA 1VQIA 5C4XG 4JBJA 4B3RL 5CKLA 2E2JH 1X3GA 2BH8A 1YJNA 3BU2A 4JI6L 1I3QH 4GLXA 3U50C 4A3BH 4BBRG 3T1HQ 3CF5A 3HKZG 2WB1G 1OTCA 1HNWL 4IFDI 2A8VA 1E1OA 5FLXc 4X64L 2HT1A 1K9MC 3PSIA 2MQHA 3PO2H 4IO9A 5K36G 3HOWG 3M4PA 3TQYA 2UU9Q 2BA1A 2Z6KC 3FHWA 5FJ8H 4GNXB 4A3GH 3PV0A 1TWCH 3I4NH 3K7UC 2UXDQ 4DR2Q 2R6GA 2N8NA 2YTVA 3F8TA 5M5YH 4MNOA 3F2BA 3T1YQ 1N32Q 5LMNW 4YWKA 5HGQA 1UE1A 4MTNA 5EAYA 2OQ0A 2AMCB 3E0EA 2R93H 4DV1L 2UXBQ 3J7A5 4A3KH 4DUYQ 2UUBQ 2Y0SE 4DR5Q 2HQLA 2KENA 1CKOA 3KDFB 3KJOA 4JI3Q 5JJIA 3JAMi 4JI7Q 1VQHA 3AFPA 3CP0A 1KC8C 1IBLQ 3MXNB 2WFWA 5M3MH 5C4XH 4YHHQ 1IBKQ 1EOVA 3CCEA 5GQOA 5C0XG 2ATWA 4LU4A 4BY1H 1L1OA 4DR7L 1Z9FA 5GAGC 2JEBI 4P71A 1Q1EA 4X62Q 4BBRH 3H3VI 1X56A 5IYBH 1VQOA 1AH9A 1WCMH 3TS0A 3T1HL 1HNWQ 1PH8A 1KL9A 1BBWA 4AIMA 3CD6A 1SFOH 3HOWH 1YEZA 4GOPA 4JI7L 3RZOH 3PCOB 3G71A 2CCZA 4R1JA 4OX9Q 2B29A 1QUQB 1YJWA 2CWPA 4P73A 1IBKL 3AEVA 5BR8L 1P16A 4U0SA 2N3SA 2JJQA 4LF5L 1LTLA 4DNIA 2VQFQ 3K81C 4QJFA 2YTXA 4DV0Q 2EQSA 4TVAB 2KHJA 1J5EL 1NTGA 4BXXH 4HJ9A 3CCRA 1MKHA 4XI8A 3PF5A 1Y1WG 1HR0W 1B70B 1B8AA 4P72A 4X65L 1VQMA 1JMCA 4X66L 4BBSG 4JV5Q 1JT8A 3K80C 4Y7NH 3ZLMA 1KD1C 3E9IA 5M3FG 2F4VL 1YJ9A 1Z47A 1VQGA 1WYDA 2JA5G 1VQFA 4GLAC 3PIPA 3NELA 3J80i 1NJIC 3A5ZB 2I5LX 4X62L 4DV3Q 2E5LQ 2R7DA 3G4SA 3AYHB 1NMFA 5IWAL 2ZTEA 1RL2A 3KFUA 4NXMQ 4RG1A 1EFWA 1VQ4A 4DPGA 1PH9A 4HJ5A 4HIMA 4EQ5A 4DK6C 2HHHL 4JI5L 4JI0L 1V1QA 1VQCA 3KF6B 3S1MH 1SRUA 1QVFA 3HOYH 2MNAA 2OTJA 3HKZE 4L5RC 1UWVA 1YVCA 2CKZB 4YY3Q 4LNQA 4DR6L 1NE3A 1KRSA 4DK3C 2ZJQA 5CGLA 4HJ8A 1R9TH 4OWWB 4NXNL 3CQZH 4B3MQ 2RF4A 4JI2L 1N34L 3HFZB 4IFDJ 4JCVE 2L15A 4X2CA 3RR5A 2CQOA 3GDEA 4BBSH 3TEHB 1KAWA 1GD7A 1HNXQ 2BH2A 3A5UA 2E2HH 4XTCS 3S14H 4A3MH 3HOZH 3CMEA 4DUZQ 1T9HA 4C3JH 1TWFH 4JI1L 3D0FA 2VUMG 1IBMQ 3PO2G 1Q12A 4R4QA 2V1CC 2XGTA 3CMAA 1Y1VG 4DV3L 1U5KA 3RNUA 1WFQA 3UDIA 1M1KC 1VQLA 4A75A 1JE5A 2IX0A 4LFAL 2JA6H 3ZCBA 4PZ6A 2B3GA 2BA0A 3CW2C 1FJGQ 4J15A 1PFSA 3OYYA 4BA1I 3J80c 4DV6L 1SR3A 4DV7L 2NVTH 3J81c 1E24A 4KHPQ 1K0RA 2MFIA 3PGZA 4L5SA 3RLNA 1QUQA 4M16A 1HZBA 1OXUA 1XJVA 5JEAG 3KF8B 3ER0A 4U0ZA 3JAMc 4X66Q 2AWNA 3CCQA 4A3IG 2ASBA 3S15H 5LMUQ 1ASZA 1LUZA 1PH4A 2RCNA 1KRTA 3ZJYC 1HZCA 1NY4A 2ZM6L 2OTLA 1XNRL 3GTQH 4DKAC 2F3IA 3UDFA 4DV6Q 4NXNQ 1V43A 1V9PA 1QZGA 5JJ7A 4YCVA 4LFCQ 1YITA 1J6QA 1TWHH 3KOJA 1JJ2A 3TRZA 3S1QH 3TREA 1XPUA 1X3EA 1X65A 2D62A 3GO5A 2IHFA 4PZ7A 1CSQA 2K75A 4LUVA 4R4TA 1HZ9A 4PMWA 4AYBG 3Q8DA 2Q2UA 3I2ZA 3M3YH 2UXCL 4PG3A 1VS0A 3S24A 5C0XI 3CC4A 4LF6Q 3M4OH 2ZTCA 1VQKA 4DV1Q 3HOZG 3W5OA 4LF9L 4C2MH 4TQUS 4LF8Q 2H5XA 3GTMH 2VUMH 1C9OA 1G51A 5IE8A 2F52A 1Q1BA 2KBNA 1MJCA 4IPHA 1MJEA 4H02A 1PA6A 1KHIA 5M3MG 3JC66 2KCMA 2VQEQ 1E1TA 2IT1A 2K5NA 3LGJA 2B63G 2NZOA 1K8AC 3I4MH 3I4MG 4JOIC 3GD7A 4YCWA 3S2HH 4QGUA 1N33L 2F4VQ 3KYHC 4GN3B 3S1NH 1SLJA 1QVCA 2Y0SG 2YTYA 3RLFA 1GKHA 1VQPA 5HY6A 4IPGA 3UDXA 1XMQQ 1KXLA 4R4IA 2RHQB 5AJ3L 1OXVA 4DV5Q 3RN5A 1HR0L 2MO0A 2ZJPA 2PMZE 4LFCL 3F2DA 1I50H 3HOUG 4JBKA 3CC2A 5FJ8G 4A3GG 2N49A 2ZM6Q 1XNRQ 1YHBA 3HOVH 4LF4Q 1VQ7A 3K0XA 2D0OA 4NB3A 4QY7A 4YWMA 2OQKA 2JA5H 5IP7G 3CXCA 2PQAA 3PF4A 2UXDL 4DR4L 1CSPA 1VQNA 4LF6L 4X2DA 3L2PA 4L5QA 1GVPA 3DLLA 3OTOL 4IOCA 4DR1Q 1PVOA 1A63A 4HJ7A 4QQBX 4BY1G 3HKSA 1A0IA 2K50A 3KJPA 2EIFA 2VS1A 4PY3A 4DR3Q 1Q7YC 1VQ9A 5IYDG 2LXKA 1HH2P 3G48A 3CCVA 4OX9L 3S17H 4JYAL 1WCMG 4LF7Q 3U4ZA 3KDFA 5JJKA 2CFMA 3HOXH 4B3ML 4JOIA 4YHHL 1UE6A 4A76A 2GVAA 5LMNL 3H15A 3CPWA 3RZDH 1XNQQ 5ELOA 5JJ6A 2K5HA 1JJGA 1BVSA 1P8LA 4POFA 3CCMA 1CKNB 3UE1A 1PHJA 3A74A 1PYSB 3FKIG 4JYAQ 3PUYA 4UP7A 4HIKA 1JB7A 1HR0Q 3S16H 3FP9A 1S72A 4BY7H 5GAHC 3G6EA 4K0KL 3CCLA 2Q2TA 1PH1A 1YBYA 1IBML 1ASYA 4GNXC 3S6AA 4LF4L 1Q86C 4IJHA 4KHPL 1IXRA 1SROA 1XTDA 3M4QA 5GADC 4A3DH 5E7NA 3ULLA 3E9HA 4KLKA 3CUCA 2PNHA 4BA2I 3U58A 3M9BA 1A62A 2WB1E 3VDYA 1YI2A 1WJJA 3F1ZA 4OO1I 3SN9A 1DGSA 2HIVA 4IPCA 1K73C 1Y1WH 1K3RA 5M5WH 2VQFL 4GLVB
chains in the Genus database with same CATH superfamily
4B3TQ 3NP8A 2KHIA 3ND8A 1LTID 1TWGB 4A3JG 3D4DA 3N52A 1SNPA 2LFNA 4A3CH 1F9SA 5DNFA 4A3CG 5HURA 4QF4A 3N3UA 2WACA 3HOYG 2OF1A 3EN2A 1PTOC 4O42A 4NW2A 5IWAQ 1LTBD 1Y14B 4B3RQ 1ICFB 3I8ZA 5JVG3 1L0XB 1YIJA 4JK1C 3M4OB 5FKAC 1WD1A 4MZ9A 1IW7D 4N9TA 3ULPA 5CV5A 3OW2A 3NBHB 4RFBA 1XWEA 3W1BA 2SNSA 1XMOL 2E75C 1Q8KA 4FO2A 2B2YA 4BY1B 3C1EA 1BCPF 2DUDA 1E3PA 1X6OA 4X6AH 2JP1A 1X9NA 2WINB 4A3KG 1YNNC 2GVBA 4PMBA 1EY7A 2ES2A 1PRTC 1S5BD 1HNZL 3ONAB 2F3WA 1A3UA 5C44H 4CDCC 2K4KA 3PIOA 4LFAQ 3R8BA 1J5EQ 1N36L 2FJ2A 1I4HA 4JC0A 4ZKBB 1PRTF 4H7BA 2R7ZB 1U4LA 4ZUIA 4JI4L 3IRBA 1EYCA 3IFTA 1TY0A 1SMXA 3KLWA 2G03A 3SVMA 4FDBA 3NXWA 1CQVA 4RGNA 3CCSA 2PZTA 3STBC 3I7FA 2RBMA 3S2DH 1ESFA 3D31A 3A54A 3GV6A 2K6AA 2XNAC 1N32L 1MSHA 1B53A 5BN5A 2ICIA 1I6HH 4XIGS 1EUJA 2JA8G 3S17B 3PMFA 3CRKC 3J7AV 1C7YA 4U68A 2FINB 1HQMC 2B8FA 1I94L 3O13A 1K83H 4I7ZC 1EYDA 5CMTA 1JWSD 2F0LA 2Z0SA 3TP8A 1NMGA 4C3HH 1EU4A 2CH4W 2K5QA 3VR6A 4DR1L 2EJMA 4OO1G 4KKTA 5AJ3Q 4DV5L 2G9DA 4KD3A 2F6SA 3EQLC 5F2DA 4QCLA 1Y1VB 2Z4IA 1ONLA 1TWGH 2F0KA 4IUPA 3S14B 2ZTDA 5IGEA 2LSSA 4U04A 5IODA 1PYBA 4N8FA 4JI8L 2AQ2B 1SEBD 3JAME 1HA5A 3SR1A 1BUVT 4A93H 4GNXA 3M7NA 3BS1A 1X32A 3HRZC 3KK7A 1EWHA 1JR0D 4I65A 1NH1A 4DAYA 1Q81C 2NVQB 2QGQA 1SNCA 2MO1A 1BKBA 3B6YA 4B9WA 1VQ8A 1SJED 1R4QB 4DF7A 5M3FB 2R7ZG 3D4RA 2QA4A 3QG1A 4DV7Q 3MEHA 3NTHA 4QL5A 5C3XA 4C3JG 3W1GA 1YNND 3V2TA 4Y7NB 4B3SQ 4HMIA 3SEBA 1WTOA 4LF5Q 2B2WA 4C1NK 4YWLA 2DJFC 2JN4A 2NVYH 4KN7C 1LTGD 4LUOA 4WORA 5IP9H 1DOMA 4O0AA 5KYIA 4PZ8A 4KHZA 2EOTA 1MI2A 1PH2A 1IKMA 4N67A 5ELNA 5FLXL 2K5VA 1VQ6A 1VQDA 2DY7A 4AH6A 3M85A 1FVIA 3VYUA 4CJ2C 4YCUA 1PTOD 2IL8A 2A6HC 4DA2A 4KJNA 2VQEL 4WJ4A 1TS5A 1HTPA 2PMZB 1G291 2Z9HA 1PFMA 1V8QA 1SNDA 4U07A 1AE2A 2F0OA 2Q2IA 3QJYA 5I2XA 5ELDA 4QUCA 4WRDA 1VQIA 1LTSD 4JBJA 2E2JH 5CMDA 3BU2A 4JI6L 2EJFC 3U50C 5CBAE 3CF5A 1OTCA 2B2WC 4IFDI 1E1OA 3MXPA 5FLXc 3EROA 3MXUA 1TR5A 5LL6S 1D2BA 2JA6B 4K14A 3PV0A 1TWCH 1S5ED 2R6GA 2YTVA 4MNOA 1R4PB 1WTXA 4C3HB 3QOJA 2PCFB 5HGQA 4MTNA 5EAYA 2OQ0A 3E0EA 2HD3A 3NHHA 2KENA 3KDFB 5JJIA 3GTGB 3AFPA 1KC8C 5J39A 1H9MA 5GQOA 2QILA 1W6JA 5GAGC 2CQAA 2JEBI 1Q1EA 4KHVA 4ZAIA 5IYBH 2HDMA 1PH8A 2YU9B 1DONA 1GUWA 2F0TA 5K36H 3M7GA 1SFOH 1LT3D 1YEZA 4GOPA 2CCZA 4OX9Q 2B29A 5D3IB 1QUQB 3EFXD 3AEVA 2H1EA 1B1ZA 1P16A 2E74C 4K2KA 2YTXA 4TVAB 3HGBA 1O7ZA 1NTGA 1J5EL 3HZXA 4BXXH 2A5HA 3K5MA 1G6ZA 1H9SB 1MKHA 1JMCA 1RKNA 4BBSG 2H4OA 3VR5A 1JT8A 5ELCA 3SXHA 4HR7B 4Y7NH 1LACA 5M3FG 2F4VL 4BS9A 2AQ3B 4X62L 2E5LQ 2N88A 2EXZA 5IWAL 1NR4A 1RL2A 1JB3A 2G9HD 4RG1A 1EFWA 4FF4A 1VQ4A 4H13C 4LMQD 2RDHA 3S1MH 1VQCA 4U673 1IKLA 1SRUA 3HOYH 1YVCA 2MJ8A 4LNQA 1NE3A 5CGLA 4HJ8A 4OWWB 4IURA 1B50A 4B3MQ 1N34L 3HFZB 2O5IC 3FKIB 2NTTA 2XRSD 1DOKA 3GDEA 1KAWA 5DM63 5I2YA 5IGBA 3LWUA 3W2DA 1BXTA 2VUMG 3PO2G 1Q12A 3BVZA 1Y8OB 1WFQA 3RNUA 1M1KC 4LFAL 1DJRD 4A75A 3A8KE 2JA6H 2RDFA 2BA0A 1PFSA 3OYYA 4BA1I 3J80c 2R92B 1I3QB 1PRTD 1EFID 1EIHA 4KHPQ 3K0YA 5JEAG 4X66Q 3CCQA 4A3IG 2OEOA 3S15H 2RCNA 1KRTA 1HZCA 3GTQH 4YCVA 1ENFA 1J6QA 1TWHH 3KOJA 1YITA 1BBXC 1TS2A 2ICEC 2C5CA 2IHFA 1CK1A 1S5FD 4AYBG 3Q8DA 4RHSA 3M3YH 3MXGA 3HOZG 4RAUC 4LF9L 4C2MH 4TQUS 5HGTA 4LF8Q 3OHXC 1NR2A 3IL8A 2HUGA 5IE8A 1PA6A 3JC66 2KCMA 2K5NA 2A69C 1GUTA 4FF3A 1GUSA 3SHLA 3KYHC 4GN3B 4CKEA 1XTCD 1NSNS 3E0JA 3DEOA 5IOCA 3RLFA 2X6GA 1XMQQ 3TMEA 2JA8B 5AJ3L 2RHQB 4XXEA 4DV5Q 3BVGA 2MO0A 4LFCL 3HOUG 1I50H 1JE4A 1EQTA 1KTKA 3HOVH 3M4YA 3OWEB 3RD4A 4YWMA 4QY7A 2JA5H 2OQKA 2QF7A 2Z6BA 1S5DD 4HN7A 3OTOL 3CHBD 3MHBA 3HKSA 2K50A 4FF1A 4PY3A 4FVMA 4F88A 4TSSA 1HH2P 4OX9L 1LT6D 4YHHL 1CHQD 2J7ZA 1CA5A 1JCKB 1XNQQ 2RSNA 5ELOA 2K5HA 1AN8A 3NK9A 3SK8A 4POFA 1IYVA 4HIKA 1HR0Q 4PV1C 3G6EA 2B39A 4QB4A 1PH1A 1YBYA 1MBYA 2MPMA 4OIKA 3VR3A 3M4QA 3ULLA 3CUCA 5BN4A 2PNHA 2WB1E 1YI2A 2B2YC 4IPCA 1K73C 1Y1WH 1EZ8A 1K3RA 3K5LA 3TP5A 3BYYB 2PI2A 1WI5A 2EYOA 4UDUC 1QVGA 2EPBA 1XMQL 1TWFB 4KMUC 1QNKA 2Z6KA 4P75A 3F2CA 1PTOF 1SMYC 1GM5A 1SNMA 3STBD 1EEFD 4XT3B 3CAMA 3OW7A 3GTQB 1S3OA 3L9AX 4JPBW 1EIFA 3W3AA 3A7AB 1SN8A 4RWSC 3M3YB 3SHGA 2RKSA 3F2UA 1D6EC 3PO3H 1CQFA 1UNSA 2NZ1D 1ZXTA 1L0YB 5IYCH 4DV2L 2JA9A 2N78A 3CC7A 3ULJA 3HEJA 2JXMB 2WB1B 1KDCA 1HNZQ 5E3FA 2A1AA 3QWNA 4NP5A 4EVOA 4R8IA 3J80E 3OOCA 3PQIA 1T5EA 3A8IE 2FMMA 3I4NG 4ZCKA 2NVXH 1VMCA 5EKKA 1SBBB 5KGUA 1H9KA 1PYWD 5TSSA 2O2LD 3ICEA 2JA8H 4JI1Q 1K83B 4JBWA 2AHOB 4OWXB 2AUKA 2R92G 4JV5L 4Y52H 4LWCA 1L0WA 1FNVA 1I4QA 1PH6A 3RLOA 1LYLA 2BE5D 5LMNQ 3CCJA 3U9OA 4WFN3 3C46A 3AQQA 1YHQA 2ZT9C 2IJ0A 3PUXA 1WTRA 1ENCA 1HUNA 1HHVA 2HHHQ 4GN4B 1KLUD 4F7XA 2EY2A 3ZC7A 1D7QA 1EL0A 5IIFA 3Q6SA 1RTNA 5JJZA 3LWEA 1ZYRC 1UE7A 4J1MA 3I4NB 1C0AA 5M5YB 1PFBA 5L37A 1AW7A 3TSSA 4LK1C 1QZHA 2EXDA 2VL6A 3VYTA 4UY8C 1FGUA 1TXYA 2GA4B 5C44G 2R7FA 3E5SA 4IFDG 4GKKL 3OMCA 2JA7B 2VZAA 2E5LL 2IHEA 3H3VH 4X2EA 5M3FH 4ILWA 3FDTA 1YHAA 4B3TL 4UPAA 3H0GH 4POGA 4FXKC 5IP7H 4KY5A 3J81j 2WAQG 1VQAA 4X64Q 2ALYB 3T56B 5C3EG 4QIWE 2UU9L 3KBGA 4XYOA 4DAVA 2JYOA 2HDLA 5JPMC 4C56C 2NVYB 1LLRD 1S40A 3G6JB 3IAYA 3J81E 1VMPA 3ERQA 4ME3A 1RIPA 2EYJA 1HJPA 1SYDA 3L3OC 4DK1A 5IYBG 3I91A 5KNCA 1MIUA 3R2TA 2ZJRA 4X3TA 1A2TA 2B2UA 1IYUA 1TIID 4B3SL 2XWJB 3NPPA 2EZVA 5CV7A 2YV5A 4ID6A 5JFFA 4J8QA 3DWAA 1NCVA 2KVMA 4GN5A 4OIJA 4BXXG 1EYGA 4BY7B 3L0OA 1U9RA 1GJXA 1F77A 1FL0A 3OIQA 1N36Q 3OTOQ 4DV4Q 5JEAJ 2UXBL 3P20A 1LM0A 2PNRC 1CI3M 4JI4Q 1ILPA 3I70A 5JEAH 1SAPA 3RMHA 4RMFA 2JA7G 4FXGC 1N9WA 4X3UA 1KDBA 1M4VA 2PW7A 1D8LA 1UEBA 1YNXA 3UI2A 4FYDA 3S1NB 3GV3A 3K5NA 1G6PA 5C3WA 1HQRD 4ALPA 2K14A 4KV6A 4LF8L 3E6ZX 2PI2E 5CORA 4LF9Q 4XQJA 1B44D 4A3DB 5J3BA 1VQBA 3T4AC 1GUGA 1NBWA 2RQXA 5EU0A 1M90C 3I4OA 4P74A 5DEHA 5CKLA 1FD7D 2BH8A 4J6HA 2OT2A 5DM73 4BWGB 2XRQD 3T1HQ 3HKZG 5J22A 2KOLA 1DXMA 1CZGA 3BYTB 4DXGA 1K9MC 1JWUD 2MQHA 3PO2H 2M2LA 3TQYA 3FHWA 2NB0A 2Q8RE 2KECA 3T1YQ 5D14A 1C48A 2B2TA 3K5OA 1F2LA 3K7AB 1JOOA 3BDOA 5K5PA 1LO5D 4KN4C 4DV1L 3H91A 4A3KH 5E1FA 3E3XA 5FO9B 2NTSA 4DR5Q 1LT4D 2HQLA 3SE0A 1WTWA 3GTOB 1TT2A 3MXNB 5M3MH 1JOQA 5C4XH 4YHHQ 1EOVA 1V1PA 2ATWA 4CKCA 4P71A 1EEID 2F03A 3H3VI 3CD6A 3HOYB 3HOWH 1ENAA 4JI7L 1O78A 5JOBA 3RZOH 2RCFA 1I4GA 3G71A 4R1JA 2C9OA 3DM1A 3NSWA 2CWPA 1IBKL 5FLXE 1C4QA 5CR3A 2BDOA 2N3SA 2JJQA 1WVLA 1EWCA 1F9QA 4LF5L 3K81C 2EQSA 4ZUJA 4C1NI 2NWGA 4BY7H 1K8OA 1HR0W 1B70B 4P72A 1VQMA 1PDQA 1I4PA 1VDZA 4JV5Q 4DNRB 2QDLA 2IW3A 5CV6A 1FNUA 1KAAA 1KD1C 3E9IA 1YJ9A 4GLAC 1SYBA 4G57A 2I5LX 5CC4A 2PW5A 4ZYSA 3RUZA 1A6XA 2EJGC 2ZTEA 2O4XA 4RKBA 4BBRB 1VF7A 2EYMA 1HTLD 2A74C 4HIMA 3EVQA 2HHHL 4JI0L 1V1QA 3VYSA 3U9SA 5EKIA 3D3RA 1KRSA 1S4ZA 1A15A 2ZJQA 5DAUA 1R9TH 2VXWA 5C44B 4JI2L 3NQIA 4IFDJ 4UAIA 5T1GA 1JOKA 2L15A 4X2CA 1Y8NB 3RR5A 2CQOA 2F1MA 1EOTA 3H6MA 3QO2A 4HAEA 4H0LC 1G91A 4B08A 3A5UA 2E2HH 3HOZH 1DD2A 4A3MH 3KLSA 1T9HA 4C3JH 4JI1L 3SK6A 3D0FA 1IBMQ 4R4QA 2V1CC 2XGTA 2A68C 1U5KA 1U4RA 3HS0C 1VQLA 5FO7B 4PZ6A 3CW2C 1FJGQ 4J15A 5I9OA 3S2DB 3TN2A 4DV6L 4CDDC 4ZLTF 3PIP3 4RGTA 3TBIB 4L5SA 2CH4A 4M16A 1OXUA 1XJVA 3JAMc 3KF8B 3S1RB 5CV9A 4E6IA 1BNZA 5LMUQ 2ZM6L 1XNRL 2OTLA 1FGBD 1PMRA 3DXJC 3TRZA 3S1QH 3FVQA 1X3EA 4M1UB 4PZ7A 2K75A 1FYCA 5C5MA 2Q2UA 1HZ9A 3K59A 3I2ZA 4PG3A 1VS0A 5C0XI 3P1HA 2P5ZX 4QIWB 1Q3LA 1JORA 1HFGA 3QR8A 2BOSA 1Q1BA 1TQOA 1MJCA 1KHIA 5M3MG 2IT1A 1K8AC 3I4MG 3GD7A 4C3IB 2F4VQ 3H3VC 2Y0SG 4A93B 3J7YW 1KXLA 4R4IA 5IGFA 4IZ8A 2XN9C 4L6TB 4K6LA 2ZJPA 5FK9C 1SE4A 3CC2A 5G3LF 1PTOH 4O1NA 4LF4Q 2F0WA 4DU9A 1CZWA 1QB5D 4NB3A 4IUQA 3CXCA 2PQAA 1ZEQX 2L12A 3FRPB 2B2VA 3L2PA 5D3DA 1Y1WB 4EQPA 4Q5VA 1A63A 5J1ZA 2VS1A 2ZXOA 5EPKA 1Q7YC 4JYAL 3VA5A 3GTMB 4RA8A 1WCMG 5JJKA 4B3ML 2VB3X 4JOIA 5M9OA 4ZK9B 1CT1D 1YNJC 2PYKA 3SK4A 1BVSA 1R9TB 3A74A 5KIXA 3HG9A 1DOLA 2J0TD 1IHZA 4K0KL 5A2QL 5T1IA 1IXRA 3WOFA 4KHPL 1B3AA 2B2UC 5E7NA 1OO9B 4C3JB 1CTMA 2R61A 3KLSX 3VDYA 3F1ZA 2QEJC 4OO1I 1SYFA 1N8RC 2VQFL 4GLVB 2NVXB 4WJ3M 1BF4A 2F0HA 2RHSB 4DR5L 1KQSA 4A3FH 1YZ6A 4A3FG 1HZAA 5CGKA 1SYCA 1LT5D 1QE6A 1TWAB 5IT9c 3GTPH 3I90A 1U4MA 4ZRZA 4JI2Q 2HIXA 4N8X1 2L0CA 5I4DA 1UAPA 2R92H 2PQEA 4MIUA 1QCBD 4H44C 2UUAQ 4R4CA 1RTOA 1EIYB 1EQVA 1N34Q 2MHVA 3V05A 4A3JB 1CUKA 2K52A 3FPPA 2LY7A 4I7AA 2PPBC 1J9OA 1GOZA 2CWAA 1QJOA 2NN6I 5IYDH 4YY3L 4LF7L 1MHWC 2K05A 3EA6A 2AQ1B 2F0MA 1GUNA 2NZHA 1UE5A 4DAMA 4OWTB 3T1YL 4KKSA 2WP8J 4AYBE 3J80L 4A3EH 4A3EG 5LMUL 2FHTA 2LMCB 2A68D 3FMCA 1EQQA 2UUCL 2YU9H 1SFOB 1W2BA 2JA7H 1PTOB 2X6LA 4OL7A 1A8VA 1DZ1A 4A4IA 3H0GB 1WTPA 1E0BA 1H9RA 1BOSA 3NTKA 3UE0A 4A93G 5JJLA 2JEAI 2M00A 4EQNA 1Q8IA 4JI0Q 1G2TA 3D4WA 4IUTA 1XNQL 1E2ZA 1YNJD 4K5XA 4NXML 2JK8A 4A3BB 4JI3L 1G2SA 2DN8A 1X3FA 5I6WA 4AQYL 1XPOA 1LABA 4GKJQ 2L5TA 3PUVA 1L1OB 1TS3A 1VQ5A 2A19A 2UUAL 2UXCQ 1O7IA 4A3BG 1STGA 2I5HA 2B8GA 4BY7G 3S1MB 3I3CA 1GXDC 2EYFA 4A3DG 1IYJB 3I56A 1QNUA 4TKOB 2EYPA 4OHJA 1OXSC 4G7OC 3NWSA 1QWYA 3SE5A 2R93B 3BJUA 4KY6A 1O7YA 1L1OC 5JFZA 2A6EC 3P7JA 4IQZA 4N9PA 4A3FB 1A3VA 2XTIA 5FLMG 1TWAH 1Q46A 1FR3A 2BDNA 3I4MB 4IPDA 4V0BA 1IZ6A 3RN2A 2K5WA 3ITPA 2B2VC 5ELFA 4CHTB 1CKNA 4R4OA 3X3NA 1U0LA 1BCPB 4DN4M 4DV2Q 5KNDA 1WCMB 1KLGD 3NEMA 3U4VA 4A3JH 4XDXA 4V190 4DR3L 2Q2HA 4XQNA 1CHPD 4IFDH 4U0UA 3S15B 2VNUD 3PUZA 2WV6D 4A3MG 4UP8A 4K2LA 3CCUA 2G5DA 1I4XA 3P75A 1E7ZA 4OONA 2SOBA 3SGIA 1I6VC 1PH5A 3DM3A 1FJGL 1LTAD 1EY0A 2R93G 3J7ZC 2E8GA 3NBHA 5H1SE 5EPJA 5C3EB 4KTAA 4DUYL 4A3EB 1STEA 2XWBB 4CBVA 3MTSA 4R8NA 2ID0A 1BBUA 5BR8Q 4HCEA 1XMOQ 3BZKA 3A0JA 1CKMA 3KLRA 3TP7A 3S16B 2KQ3A 3A7LA 1XPRA 4NPSA 3A8JE 1Q82C 3MA2B 4GZYC 2TSSA 4JI6Q 3PO3G 5IGGA 1PFNA 1T5XD 1I50B 2R3ZA 4DR4Q 1HPCA 4UHVA 3EBEA 2JA5B 3Q22A 2GN5A 2JQOA 2JA6G 5C4XG 4HSPA 1O7LA 3I72A 5C0XH 2FMCA 1YJNA 4PQXA 3KBXA 3GTJB 3J81L 1HNWL 1BCPD 4X3SA 2LKVA 3T13A 2A8VA 3VA7A 4X64L 2HT1A 3RZOB 5FO8B 3HOWG 2UU9Q 4GNXB 5KRUA 4A3GH 1SMYD 1KNAA 1V1PB 3I4NH 4RHRA 5M5YH 4HTHA 4JVZA 3F2BA 1N32Q 5LMNW 4YWKA 2R93H 2Z1CA 3DUZA 1JC7A 3IKJA 3J7AF 4DUYQ 1SNOA 2Y0SE 1WTHA 3KJOA 2KCCA 4JI7Q 2D5DA 3CP0A 2WFWA 1S5CD 2EDGA 1IBKQ 3CCEA 2F0JA 1QG7A 4BY1H 2X69A 4DR7L 1M8AA 5CV8A 3Q23A 2BCOA 1GHKA 4BBRH 4ZKCB 4XT1B 1AH9A 1LTTD 1WCMH 1TVXA 2KJXA 3D8GA 3T1HL 2Y0SB 3FEWX 4FXDA 1CA6A 1DCZA 2SEBD 1YJWA 3VR2A 2L11A 2KCNA 1MGSA 2M9VA 1F9PA 1LTLA 4DNIA 2VQFQ 1KNEA 1JQYD 2KA7A 1ET6A 2L9HA 4HJ9A 4Q0FA 1II3A 4KKUA 1Z7TA 3CCRA 3PF5A 1SDFA 4X65L 4X66L 3HOZB 2E2HB 3MWYW 3NBIA 5CYUA 3K80C 3ZLMA 3VR4A 1Z47A 1VQGA 1WYDA 3PIPA 1DYQA 3NELA 1B4OA 4PMCA 4DV3Q 2R7DA 1J8IA 1I6HB 1EY4A 4NXMQ 4ME5A 2ZXPA 1ZYRD 4DPGA 4HJ5A 5G3LD 5ELBA 4DK6C 3NQTA 4JI5L 1WD0A 3KF6B 2OTJA 4L5RC 1WTQA 4YY3Q 3MAQA 4DR6L 4DK3C 4NXNL 3CQZH 4B9XA 2RF4A 4K5VA 2WKCA 3LX0A 2PZWA 4RCNA 1EIGA 4WJWA 3AU7A 3TEHB 5M5WB 4NDXA 1HNXQ 2WIIB 1QOHA 1HUMA 4XTCS 3S14H 2E76C 2F3VA 3VYRA 1GHJA 2A6ED 2F0EA 4EQOA 3S9WA 1Y1VG 4QUFA 2K03A 5JVH3 1JE5A 3ZCBA 2EE1A 3A56A 2EYLA 3TDQA 2NVTH 3DEPA 1K0RA 2MFIA 2VB2X 3PGZA 3RLNA 2TMPA 1QUQA 1HZBA 1U4PA 2CW0D 1RJTA 2WKDA 2AWNA 1E2WA 3MC0B 1PH4A 3ZJYC 4HCSA 5JPNC 4DKAC 2F3IA 1V43A 1QZGA 5JJ7A 1EY9A 1EZ6A 5A2QE 3TREA 1B9NA 3GO5A 4R4TA 4LUVA 1EU3A 4PMWA 2UXCL 1JJGA 3T51B 4LF6Q 1XX8A 4A3IB 1H9SA 1SYGA 1Y69U 1VQKA 3W5OA 3ND9A 4BBSB 1NNXA 4OELB 5C5LA 3GTMH 1C9OA 1G51A 2F52A 5M3MB 1MJEA 3LGJA 1RDPD 2O5JC 4JOIC 4YCWA 3D6WA 4MHEA 1N33L 3WOEA 2ENBA 1SLJA 1X3QA 4CJ0B 1EY8A 1VQPA 4IPGA 3HOWB 2XIWA 3RN5A 4NKLA 2PMZE 3F2DA 4JBKA 2NBFA 5FJ8G 2ZM6Q 1XNRQ 3MXNA 3K0XA 2D0OA 3DHQA 2UXDL 1EYAA 4DR4L 5EBDA 1F2YA 4X2DA 2E2JB 4L5QA 1GVPA 2KEEA 1QILA 1PVOA 4DR1Q 3X3MA 1PZKD 1UEAB 4RKLA 3KJPA 1SYEA 3D6CA 5NUCA 3AB9A 4DR3Q 2A69D 4RH6A 2LXKA 3TZUA 3S17H 2VUMB 1I4RA 1D5ZC 1PZID 2F0NA 3NUCA 5EPLA 2CFMA 3U4ZA 5M5XB 4XQQA 2PO4A 1BCPC 3CPWA 3WDNA 1P8LA 4AYBB 2V4DA 3CQZB 1CKNB 3BZDB 3UE1A 1PHJA 1HRJA 1ILQA 3FKIG 1ESRA 3PUYA 4UP7A 3BDCA 2CVRA 5GAHC 5ISRA 2Z4HA 1IBML 1ASYA 4GNXC 3S6AA 4LF4L 3V96A 1XTDA 5GADC 4A3DH 3C3LA 1LV9A 4BA2I 3U58A 1RD9D 1A62A 3SN9A 2HIVA 4DV0L 3OPOA 2RSOA 4DK0A 2HCIA 3NENA 1KABA 2NVTB 4JW0A 1AZQA 3QB3A 5E4WC 1SE8A 4CDFC 1I94Q 3A55A 4M8AA 5FLMH 4LFBL 3NTIA 1DM0B 2JE6I 4HIDA 3UDGA 5LL6X 1NAPA 4WGJA 4OXPA 3HOXB 3HOUH 2LS01 3WWVA 1WTVA 4DR2L 2E2IH 2HCCA 2NVQH 1PRTB 2AWOA 2WAQE 4L8JA 5GAEC 2SDFA 4EX5A 4XYQA 4LUZA 5KEEA 4JBMA 1STYA 2LXJA 4K6DA 4TRDA 3K7AH 3BZCA 4A3IH 4DAPA 1B7YB 4A3KB 5IYCG 1BR9A 1AZPA 2FXQA 2UUCQ 1E2VA 3DWQA 5C0XJ 1F9RA 4LAAA 3S1QB 3GTOH 2DGYA 3PUWA 4JI8Q 3J81i 2KCTA 3H0GG 1FNWA 1STHA 1K28A 5D65A 1VCIA 4L5TA 2DNCA 1X55A 4EGVA 1ML0D 3GTKB 1IL8A 3L7ZC 1A3TA 1A2UA 4GS3A 3JAML 2AKWB 4DUZL 2K1BA 1WOCA 3MZ5A 4ITRA 3GQBA 1D1IA 4NMZA 4C3IH 4DR6Q 1Y8PB 2OXPA 4APVA 2Q8TA 1V1OA 4DR7Q 4C3HG 4JI5Q 2FFKB 4IN3A 3I55A 1PV4A 5AFWA 1KDAA 2D2CC 2QCPX 4S3SA 5CV4A 4KI0A 1AE3A 2F0VA 4IOAA 1CFMA 4CJ1B 1H95A 5M5XH 1N33Q 3K8AA 2PZUA 5IT9L 2B63H 1IBLL 4K0KQ 2F0IA 1TWCB 4A3LH 2D0PA 1E22A 2AUJD 4X65Q 1OXXK 4LW1A 1HCZA 5EKLA 2EY6A 4GOPB 4KY7A 4JG2A 4HIOA 1B9MA 2KUMA 2NN6G 4F87A 2RDGA 3GTGH 4YIJA 1JJCB 3I73A 2QKIC 5ELEA 4F8MA 3AFQA 2IX1A 1RODA 2OCEA 3H09A 5DLQE 5C3EH 2R7ZH 1KIXA 2KHSA 2XSCA 5GROA 3KF6A 4OGQC 4GKKQ 2VY3A 4A3MB 3TS2A 2E2DC 3GTLH 4AQYQ 4OEMB 3DWPA 2YYZA 1VQEA 1L2FA 1PH3A 1X3PA 4GOPC 2QDBA 5IP9G 3QIAA 2L4NA 4UP9A 2IY5B 3FPUB 4G4KA 2C35B 1TU2B 1IW7C 2I46A 2PQAB 4X3KA 1MSGA 3HOXG 3K58A 1HNXL 2F0PA 3S1RH 5JAVA 1HA6A 2JSOA 1XXGA 1I5FA 4HJAA 3HOVG 3R3OA 4CGYB 2EY1A 5C4JH 1SJHD 1X54A 1XYIA 5E4XA 2F0QA 3T16A 2I5MX 1OXTA 1SNQA 1LTRD 5IGDA 2WAQB 4DFAA 3TZDA 4A3LG 1EQRA 5KNBA 4LFBQ 3GTJH 5IY0A 2UUBL 3LETA 1GO3E 2EY5A 3CPFA 2DY8A 1F2MA 3NE5B 1Y1VH 2K33A 3EIVA 4P2CB 1D1KA 4DAYB 4O2DA 4PNYA 4HSVA 4DNTB 1RF2D 1VQJA 2A73B 4DV4L 1BO0A 1G8ZD 4Z9CB 3T53B 1EWIA 1BDOA 1VF5C 2QEXA 4GKJL 2RA4A 1K8GA 3C1FA 1PH7A 3BG3A 2OWOA 2VW9A 3FKIH 2MP1A 1STAA 3MEFA 4QMGA 3SDZA 1ICWA 3AMUA 1IL2A 1TY2A 4IJLA 4ABNA 4ODGA 3ERSX 1W3SA 2ZXRA 4FP5D 2I0QA 1JICA 2B63B 4B3RL 1X3GA 5EBCA 2MGSA 1I3QH 4GLXA 4A3BH 4BBRG 4K5WA 2WB1G 1ET9A 2HQEA 4DXFA 1STNA 3PSIA 4IO9A 5K36G 5EGTA 1HFNA 3K6OA 4G7ZC 3M4PA 3TP6A 4IUNA 2BA1A 2Z6KC 3KF8A 5FJ8H 1B2TA 3MFYA 4KD4A 3K7UC 2UXDQ 4DR2Q 2F0SA 2N8NA 1SSOA 3F8TA 1O80A 2NUNA 5C4HA 1BQQT 2XVSA 3HKZB 1UE1A 3EJIA 3R2IA 4K8JA 1PZJD 2AMCB 4K8IA 4IUUA 2UXBQ 3J7A5 2KEDA 5COYA 2UUBQ 2N55A 1CKOA 4JI3Q 3JAMi 2QW7A 1VQHA 4HMJA 1GUOA 1IBLQ 4CKBA 3OIPA 3GTLB 5C0XG 2NUCA 3BDLA 1AFPA 4LU4A 1ZKOA 1L1OA 3KUPA 1Z9FA 2F4IA 1K8MA 1D5XC 4RGOS 4X62Q 1X56A 1VQOA 5FOBB 3TS0A 1HNWQ 5IT9E 1KL9A 1AEXA 1PXUA 1BBWA 4AIMA 4ULLA 2F0FA 3PCOB 3GTPB 1K3BC 2A6HD 4P73A 3S2HB 5BR8L 3HOVB 4U0SA 5KYLA 2K28A 4DV0Q 2EYHA 4QJFA 5C4JB 2KHJA 3R93A 3DMUA 2BE5C 3ZYYX 1Y1WG 4XI8A 1CM9A 1D5MC 1B8AA 2NUDA 1EY5A 2IWHA 5IGCA 3HP3A 2IX3A 4IALA 2JA5G 1VQFA 1NJIC 5C4ZA 3J80i 2J4XA 3A5ZB 5EJWA 4OO1H 3G4SA 3AYHB 1NMFA 3KFUA 4MTKA 1PH9A 1SE3A 4EQ5A 1C8CA 3OWFA 3OSOA 2EVBA 1QVFA 2MNAA 3HKZE 1UWVA 2CKZB 3RZDB 4KK7A 2CHBD 1Q90A 3CRLC 4JCVE 1RCVD 1STBA 4BBSH 5CBEE 1JWMD 3NWTA 1GD7A 2BH2A 2DNEA 3CMEA 4DUZQ 1TWFH 5I9PA 4L63B 4DV3L 3CMAA 2F0GA 3UDIA 2DJGC 2IX0A 3IFDA 2B3GA 3PIO3 1SR3A 3BVMA 4DV7L 3J81c 1E24A 1Z6HA 5C6AA 1RHPA 2Q8IB 3ER0A 4U0ZA 5I6YA 2ASBA 2RVLA 3URYA 2F0DA 1ASZA 3H94A 3PO3B 1LUZA 2D9UA 3OMGA 5BN3A 4A3GB 1NY4A 3UDFA 4DV6Q 4NXNQ 1V9PA 4LFCQ 1JJ2A 3G7LA 1XPUA 1X65A 2D62A 2L1BA 1CSQA 3S24A 3CC4A 3M4OH 2ZTCA 1K0SA 4DV1Q 5LHY1 2NYZD 1MD2D 1H9JA 2H5XA 1W6KA 2VUMH 4HEDA 2KBNA 4IPHA 4H02A 4RGMA 3CU7A 2VQEQ 1E1TA 3Q24A 2B63G 2NZOA 3I4MH 5A35A 3S2HH 2CW0C 4QGUA 3N6RA 3S1NH 1QVCA 2YTYA 1GKHA 5HY6A 3UDXA 4LJZC 1B3QA 1OXVA 1HR0L 3I4LA 2K32A 1SE2A 2NN6H 3MFGA 4DGZA 2IPKD 4A3GG 2N49A 1YHBA 1NUCA 4CDEC 1VQ7A 4C3IG 5IP7G 3PF4A 1AP0A 1F2ZA 1TWHB 1CSPA 1TKWB 4LF6L 1VQNA 3DLLA 4IOCA 4HJ7A 4QQBX 3GP7A 4BY1G 1A0IA 2EIFA 2Z8LA 2B2TC 2MUYA 1VQ9A 5IYDG 2I07B 2K01A 1PLFA 1UUPA 2K5DA 3LNNA 3G48A 2F0UA 4C2MB 3CCVA 3PO2B 2K04A 4LF7Q 3KDFA 3HOXH 3HOUB 2E2IB 1UE6A 3K57A 4A76A 2GVAA 3CKIB 3H15A 5LMNL 3RZDH 5JJ6A 2L55A 1EY6A 4R9WA 1TS4A 3C2PA 3CCMA 5EQ0A 1PYSB 4JYAQ 1JB7A 3S16H 3FP9A 1S72A 4FNFA 4G7HC 3CCLA 2Q2TA 3Q0AA 3SK5A 1Q86C 4IJHA 4MN3A 1SROA 4IUVA 3QOLA 1SXTA 5C4XB 3E9HA 4KLKA 3MVVA 2K7VA 2SNMA 4KJOA 3M9BA 4ZQ3A 4RCOA 1HXYD 1WJJA 1DGSA 4FF2A 5M5WH 3GTKH
chains in the Genus database with same CATH topology
4WJ3M 3NENA 2PI2A 2RHSB 4DR5L 1WI5A 1KQSA 4B3TQ 4A3FH 1YZ6A 4A3FG 2KHIA 1HZAA 1XMQL 1QVGA 4A3JG 1SE8A 4P75A 2Z6KA 3F2CA 1I94Q 5FLMH 4LFBL 1GM5A 2JE6I 4HIDA 3UDGA 5IT9c 3GTPH 3STBD 4A3CH 4A3CG 4WGJA 4OXPA 3HOUH 3CAMA 3WWVA 4JI2Q 3N3UA 2HIXA 4DR2L 2E2IH 3EN2A 3HOYG 2NVQH 2R92H 2AWOA 1S3OA 2WAQE 1EIFA 5GAEC 5IWAQ 2UUAQ 1Y14B 4EX5A 4R4CA 1EIYB 1N34Q 4LUZA 4B3RQ 4JBMA 2LXJA 1SN8A 3SHGA 3K7AH 1YIJA 3BZCA 4A3IH 1CUKA 2K52A 3PO3H 1B7YB 5IYCH 4DV2L 2CWAA 5IYCG 2NN6I 4MZ9A 5IYDH 2FXQA 2JA9A 5C0XJ 4YY3L 2UUCQ 4LF7L 3ULPA 3OW2A 2N78A 3NBHB 3CC7A 3ULJA 4DV0L 3GTOH 2DGYA 3PUWA 4JI8Q 3J81i 2KCTA 3W1BA 3H0GG 1XMOL 1HNZQ 1Q8KA 2A1AA 1UE5A 2NZHA 4DAMA 4OWTB 1VCIA 4L5TA 3T1YL 1X55A 3I4NG 4AYBE 2WP8J 2NVXH 2DUDA 4A3EH 1E3PA 1X6OA 4A3EG 5LMUL 4X6AH 3L7ZC 3ICEA 4GS3A 2JA8H 3GTKH 1X9NA 1EQQA 4JI1Q 2UUCL 2YU9H 2AKWB 4A3KG 4JBWA 2AHOB 4DUZL 4OWXB 2GVBA 1WOCA 2R92G 4ITRA 1W2BA 4LWCA 1L0WA 2JA7H 4JV5L 4Y52H 2ES2A 4C3IH 1HNZL 1A8VA 5C44H 4A4IA 1PH6A 4DR6Q 2K4KA 3PIOA 4LFAQ 1J5EQ 3RLOA 3UE0A 4APVA 1N36L 4A93G 2JEAI 5JJLA 4DR7Q 1LYLA 4JC0A 4JI0Q 4JI5Q 5LMNQ 1PV4A 3I55A 1XNQL 3CCJA 4JI4L 3IRBA 3AQQA 1YHQA 4KI0A 4NXML 1AE3A 1N8RC 2JK8A 3PUXA 4JI3L 4IOAA 1SMXA 3KLWA 2G03A 4FDBA 1H95A 5M5XH 2HHHQ 4GN4B 1N33Q 3CCSA 3K8AA 1X3FA 3STBC 3ZC7A 1D7QA 3I7FA 4AQYL 1XPOA 2B63H 3S2DH 4GKJQ 1UE7A 3D31A 1IBLL 3PUVA 4K0KQ 1L1OB 4A3LH 1VQ5A 1N32L 2A19A 2UUAL 1C0AA 2UXCQ 1O7IA 2D0PA 1I6HH 1E22A 4XIGS 4X65Q 4A3BG 1OXXK 1EUJA 2I5HA 2JA8G 1C7YA 4LW1A 4BY7G 1QZHA 2EXDA 2VL6A 4UY8C 4GOPB 1FGUA 1TXYA 1I94L 1K83H 5C44G 4A3DG 1IYJB 2R7FA 4JG2A 4HIOA 4IFDG 2NN6G 3I56A 5CMTA 4GKKL 2VZAA 3GTGH 2E5LL 2IHEA 3H3VH 4X2EA 5M3FH 2Z0SA 4B3TL 1YHAA 1JJCB 1NMGA 4C3HH 4UPAA 3H0GH 4POGA 1OXSC 5IP7H 3AFQA 2IX1A 3J81j 3SE5A 2WAQG 1VQAA 4X64Q 2OCEA 3BJUA 4DR1L 2ALYB 5DLQE 5C3EH 1KIXA 2R7ZH 5C3EG 5AJ3Q 4DV5L 1L1OC 4OO1G 2F6SA 4QIWE 5JFZA 2UU9L 5GROA 3KF6A 4GKKQ 2XTIA 2VY3A 1TWGH 5FLMG 3TS2A 2ZTDA 3GTLH 1TWAH 4AQYQ 1Q46A 2LSSA 4U04A 2YYZA 1VQEA 1L2FA 4IPDA 1PH3A 1IZ6A 3RN2A 1S40A 1PYBA 4GOPC 4JI8L 4ME3A 1RIPA 5IP9G 4UP9A 2IY5B 1CKNA 1HJPA 4R4OA 1U0LA 4A93H 5IYBG 4DV2Q 3NEMA 4GNXA 3M7NA 2C35B 3U4VA 4A3JH 1MIUA 2PQAB 2ZJRA 3HOXG 4DR3L 1HNXL 2Q2HA 3S1RH 4B3SL 4U0UA 2VNUD 3PUZA 1Q81C 1I5FA 2QGQA 4HJAA 2MO1A 4A3MG 1BKBA 3B6YA 4UP8A 1VQ8A 3HOVG 2YV5A 3CCUA 5JFFA 1E7ZA 5C4JH 1X54A 4OONA 2I5MX 3SGIA 4GN5A 1PH5A 1OXTA 3DM3A 1FJGL 2R7ZG 4BXXG 1EYGA 2R93G 3J7ZC 3L0OA 2E8GA 2QA4A 4DV7Q 1FL0A 1N36Q 3OTOQ 4A3LG 4DV4Q 1EQRA 4QL5A 5JEAJ 5H1SE 3GTJH 5IY0A 4LFBQ 2UXBL 4DUYL 2UUBL 3LETA 1GO3E 3W1GA 1LM0A 3CPFA 4JI4Q 4B3SQ 1Y1VH 3EIVA 4LF5Q 4DAYB 4O2DA 2ID0A 1BBUA 5BR8Q 4YWLA 4RMFA 2NVYH 2JA7G 4LUOA 5IP9H 1N9WA 1XMOQ 4O0AA 3BZKA 1VQJA 3A0JA 4DV4L 1CKMA 4PZ8A 1EWIA 2QEXA 4KHZA 4GKJL 1D8LA 1UEBA 1YNXA 1PH2A 1K8GA 1PH7A 2OWOA 4N67A 2VW9A 3FKIH 1G6PA 4ALPA 1XPRA 2K14A 3MEFA 5ELNA 4LF8L 2K5VA 4NPSA 2PI2E 1Q82C 1IL2A 1VQDA 4LF9Q 1VQ6A 4AH6A 4IJLA 1FVIA 3M85A 4YCUA 4JI6Q 3PO3G 5J3BA 2VQEL 1VQBA 4WJ4A 1NBWA 3ERSX 5EU0A 1M90C 1G291 4DR4Q 1W3SA 3EBEA 4U07A 1AE2A 3I4OA 2Q2IA 4P74A 2GN5A 2JQOA 2JA6G 2I0QA 1VQIA 5C4XG 4JBJA 4B3RL 5CKLA 2E2JH 1X3GA 2BH8A 1YJNA 3BU2A 4JI6L 1I3QH 4GLXA 3U50C 4A3BH 4BBRG 3T1HQ 3CF5A 3HKZG 2WB1G 1OTCA 1HNWL 4IFDI 2A8VA 1E1OA 5FLXc 4X64L 2HT1A 1K9MC 3PSIA 2MQHA 3PO2H 4IO9A 5K36G 3HOWG 3M4PA 3TQYA 2UU9Q 2BA1A 2Z6KC 3FHWA 5FJ8H 4GNXB 4A3GH 3PV0A 1TWCH 3I4NH 3K7UC 2UXDQ 4DR2Q 2R6GA 2N8NA 2YTVA 3F8TA 5M5YH 4MNOA 3F2BA 3T1YQ 1N32Q 5LMNW 4YWKA 5HGQA 1UE1A 4MTNA 5EAYA 2OQ0A 2AMCB 3E0EA 2R93H 4DV1L 2UXBQ 3J7A5 4A3KH 4DUYQ 2UUBQ 2Y0SE 4DR5Q 2HQLA 2KENA 1CKOA 3KDFB 3KJOA 4JI3Q 5JJIA 3JAMi 4JI7Q 1VQHA 3AFPA 3CP0A 1KC8C 1IBLQ 3MXNB 2WFWA 5M3MH 5C4XH 4YHHQ 1IBKQ 1EOVA 3CCEA 5GQOA 5C0XG 2ATWA 4LU4A 4BY1H 1L1OA 4DR7L 1Z9FA 5GAGC 2JEBI 4P71A 1Q1EA 4X62Q 4BBRH 3H3VI 1X56A 5IYBH 1VQOA 1AH9A 1WCMH 3TS0A 3T1HL 1HNWQ 1PH8A 1KL9A 1BBWA 4AIMA 3CD6A 1SFOH 3HOWH 1YEZA 4GOPA 4JI7L 3RZOH 3PCOB 3G71A 2CCZA 4R1JA 4OX9Q 2B29A 1QUQB 1YJWA 2CWPA 4P73A 1IBKL 3AEVA 5BR8L 1P16A 4U0SA 2N3SA 2JJQA 4LF5L 1LTLA 4DNIA 2VQFQ 3K81C 4QJFA 2YTXA 4DV0Q 2EQSA 4TVAB 2KHJA 1J5EL 1NTGA 4BXXH 4HJ9A 3CCRA 1MKHA 4XI8A 3PF5A 1Y1WG 1HR0W 1B70B 1B8AA 4P72A 4X65L 1VQMA 1JMCA 4X66L 4BBSG 4JV5Q 1JT8A 3K80C 4Y7NH 3ZLMA 1KD1C 3E9IA 5M3FG 2F4VL 1YJ9A 1Z47A 1VQGA 1WYDA 2JA5G 1VQFA 4GLAC 3PIPA 3NELA 3J80i 1NJIC 3A5ZB 2I5LX 4X62L 4DV3Q 2E5LQ 2R7DA 3G4SA 3AYHB 1NMFA 5IWAL 2ZTEA 1RL2A 3KFUA 4NXMQ 4RG1A 1EFWA 1VQ4A 4DPGA 1PH9A 4HJ5A 4HIMA 4EQ5A 4DK6C 2HHHL 4JI5L 4JI0L 1V1QA 1VQCA 3KF6B 3S1MH 1SRUA 1QVFA 3HOYH 2MNAA 2OTJA 3HKZE 4L5RC 1UWVA 1YVCA 2CKZB 4YY3Q 4LNQA 4DR6L 1NE3A 1KRSA 4DK3C 2ZJQA 5CGLA 4HJ8A 1R9TH 4OWWB 4NXNL 3CQZH 4B3MQ 2RF4A 4JI2L 1N34L 3HFZB 4IFDJ 4JCVE 2L15A 4X2CA 3RR5A 2CQOA 3GDEA 4BBSH 3TEHB 1KAWA 1GD7A 1HNXQ 2BH2A 3A5UA 2E2HH 4XTCS 3S14H 4A3MH 3HOZH 3CMEA 4DUZQ 1T9HA 4C3JH 1TWFH 4JI1L 3D0FA 2VUMG 1IBMQ 3PO2G 1Q12A 4R4QA 2V1CC 2XGTA 3CMAA 1Y1VG 4DV3L 1U5KA 3RNUA 1WFQA 3UDIA 1M1KC 1VQLA 4A75A 1JE5A 2IX0A 4LFAL 2JA6H 3ZCBA 4PZ6A 2B3GA 2BA0A 3CW2C 1FJGQ 4J15A 1PFSA 3OYYA 4BA1I 3J80c 4DV6L 1SR3A 4DV7L 2NVTH 3J81c 1E24A 4KHPQ 1K0RA 2MFIA 3PGZA 4L5SA 3RLNA 1QUQA 4M16A 1HZBA 1OXUA 1XJVA 5JEAG 3KF8B 3ER0A 4U0ZA 3JAMc 4X66Q 2AWNA 3CCQA 4A3IG 2ASBA 3S15H 5LMUQ 1ASZA 1LUZA 1PH4A 2RCNA 1KRTA 3ZJYC 1HZCA 1NY4A 2ZM6L 2OTLA 1XNRL 3GTQH 4DKAC 2F3IA 3UDFA 4DV6Q 4NXNQ 1V43A 1V9PA 1QZGA 5JJ7A 4YCVA 4LFCQ 1YITA 1J6QA 1TWHH 3KOJA 1JJ2A 3TRZA 3S1QH 3TREA 1XPUA 1X3EA 1X65A 2D62A 3GO5A 2IHFA 4PZ7A 1CSQA 2K75A 4LUVA 4R4TA 1HZ9A 4PMWA 4AYBG 3Q8DA 2Q2UA 3I2ZA 3M3YH 2UXCL 4PG3A 1VS0A 3S24A 5C0XI 3CC4A 4LF6Q 3M4OH 2ZTCA 1VQKA 4DV1Q 3HOZG 3W5OA 4LF9L 4C2MH 4TQUS 4LF8Q 2H5XA 3GTMH 2VUMH 1C9OA 1G51A 5IE8A 2F52A 1Q1BA 2KBNA 1MJCA 4IPHA 1MJEA 4H02A 1PA6A 1KHIA 5M3MG 3JC66 2KCMA 2VQEQ 1E1TA 2IT1A 2K5NA 3LGJA 2B63G 2NZOA 1K8AC 3I4MH 3I4MG 4JOIC 3GD7A 4YCWA 3S2HH 4QGUA 1N33L 2F4VQ 3KYHC 4GN3B 3S1NH 1SLJA 1QVCA 2Y0SG 2YTYA 3RLFA 1GKHA 1VQPA 5HY6A 4IPGA 3UDXA 1XMQQ 1KXLA 4R4IA 2RHQB 5AJ3L 1OXVA 4DV5Q 3RN5A 1HR0L 2MO0A 2ZJPA 2PMZE 4LFCL 3F2DA 1I50H 3HOUG 4JBKA 3CC2A 5FJ8G 4A3GG 2N49A 2ZM6Q 1XNRQ 1YHBA 3HOVH 4LF4Q 1VQ7A 3K0XA 2D0OA 4NB3A 4QY7A 4YWMA 2OQKA 2JA5H 5IP7G 3CXCA 2PQAA 3PF4A 2UXDL 4DR4L 1CSPA 1VQNA 4LF6L 4X2DA 3L2PA 4L5QA 1GVPA 3DLLA 3OTOL 4IOCA 4DR1Q 1PVOA 1A63A 4HJ7A 4QQBX 4BY1G 3HKSA 1A0IA 2K50A 3KJPA 2EIFA 2VS1A 4PY3A 4DR3Q 1Q7YC 1VQ9A 5IYDG 2LXKA 1HH2P 3G48A 3CCVA 4OX9L 3S17H 4JYAL 1WCMG 4LF7Q 3U4ZA 3KDFA 5JJKA 2CFMA 3HOXH 4B3ML 4JOIA 4YHHL 1UE6A 4A76A 2GVAA 5LMNL 3H15A 3CPWA 3RZDH 1XNQQ 5ELOA 5JJ6A 2K5HA 1JJGA 1BVSA 1P8LA 4POFA 3CCMA 1CKNB 3UE1A 1PHJA 3A74A 1PYSB 3FKIG 4JYAQ 3PUYA 4UP7A 4HIKA 1JB7A 1HR0Q 3S16H 3FP9A 1S72A 4BY7H 5GAHC 3G6EA 4K0KL 3CCLA 2Q2TA 1PH1A 1YBYA 1IBML 1ASYA 4GNXC 3S6AA 4LF4L 1Q86C 4IJHA 4KHPL 1IXRA 1SROA 1XTDA 3M4QA 5GADC 4A3DH 5E7NA 3ULLA 3E9HA 4KLKA 3CUCA 2PNHA 4BA2I 3U58A 3M9BA 1A62A 2WB1E 3VDYA 1YI2A 1WJJA 3F1ZA 4OO1I 3SN9A 1DGSA 2HIVA 4IPCA 1K73C 1Y1WH 1K3RA 5M5WH 2VQFL 4GLVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WJ3 M;  3NEN A;  2PI2 A;  2RHS B;  4DR5 L;  1WI5 A;  1KQS A;  4B3T Q;  4A3F H;  1YZ6 A;  4A3F G;  2KHI A;  1HZA A;  1XMQ L;  1QVG A;  4A3J G;  1SE8 A;  4P75 A;  2Z6K A;  3F2C A;  1I94 Q;  5FLM H;  4LFB L;  1GM5 A;  2JE6 I;  4HID A;  3UDG A;  5IT9 c;  3GTP H;  3STB D;  4A3C H;  4A3C G;  4WGJ A;  4OXP A;  3HOU H;  3CAM A;  3WWV A;  4JI2 Q;  3N3U A;  2HIX A;  4DR2 L;  2E2I H;  3EN2 A;  3HOY G;  2NVQ H;  2R92 H;  2AWO A;  1S3O A;  2WAQ E;  1EIF A;  5GAE C;  5IWA Q;  2UUA Q;  1Y14 B;  4EX5 A;  4R4C A;  1EIY B;  1N34 Q;  4LUZ A;  4B3R Q;  4JBM A;  2LXJ A;  1SN8 A;  3SHG A;  3K7A H;  1YIJ A;  3BZC A;  4A3I H;  1CUK A;  2K52 A;  3PO3 H;  1B7Y B;  5IYC H;  4DV2 L;  2CWA A;  5IYC G;  2NN6 I;  4MZ9 A;  5IYD H;  2FXQ A;  2JA9 A;  5C0X J;  4YY3 L;  2UUC Q;  4LF7 L;  3ULP A;  3OW2 A;  2N78 A;  3NBH B;  3CC7 A;  3ULJ A;  4DV0 L;  3GTO H;  2DGY A;  3PUW A;  4JI8 Q;  3J81 i;  2KCT A;  3W1B A;  3H0G G;  1XMO L;  1HNZ Q;  1Q8K A;  2A1A A;  1UE5 A;  2NZH A;  4DAM A;  4OWT B;  1VCI A;  4L5T A;  3T1Y L;  1X55 A;  3I4N G;  4AYB E;  2WP8 J;  2NVX H;  2DUD A;  4A3E H;  1E3P A;  1X6O A;  4A3E G;  5LMU L;  4X6A H;  3L7Z C;  3ICE A;  4GS3 A;  2JA8 H;  3GTK H;  1X9N A;  1EQQ A;  4JI1 Q;  2UUC L;  2YU9 H;  2AKW B;  4A3K G;  4JBW A;  2AHO B;  4DUZ L;  4OWX B;  2GVB A;  1WOC A;  2R92 G;  4ITR A;  1W2B A;  4LWC A;  1L0W A;  2JA7 H;  4JV5 L;  4Y52 H;  2ES2 A;  4C3I H;  1HNZ L;  1A8V A;  5C44 H;  4A4I A;  1PH6 A;  4DR6 Q;  2K4K A;  3PIO A;  4LFA Q;  1J5E Q;  3RLO A;  3UE0 A;  4APV A;  1N36 L;  4A93 G;  2JEA I;  5JJL A;  4DR7 Q;  1LYL A;  4JC0 A;  4JI0 Q;  4JI5 Q;  5LMN Q;  1PV4 A;  3I55 A;  1XNQ L;  3CCJ A;  4JI4 L;  3IRB A;  3AQQ A;  1YHQ A;  4KI0 A;  4NXM L;  1AE3 A;  1N8R C;  2JK8 A;  3PUX A;  4JI3 L;  4IOA A;  1SMX A;  3KLW A;  2G03 A;  4FDB A;  1H95 A;  5M5X H;  2HHH Q;  4GN4 B;  1N33 Q;  3CCS A;  3K8A A;  1X3F A;  3STB C;  3ZC7 A;  1D7Q A;  3I7F A;  4AQY L;  1XPO A;  2B63 H;  3S2D H;  4GKJ Q;  1UE7 A;  3D31 A;  1IBL L;  3PUV A;  4K0K Q;  1L1O B;  4A3L H;  1VQ5 A;  1N32 L;  2A19 A;  2UUA L;  1C0A A;  2UXC Q;  1O7I A;  2D0P A;  1I6H H;  1E22 A;  4XIG S;  4X65 Q;  4A3B G;  1OXX K;  1EUJ A;  2I5H A;  2JA8 G;  1C7Y A;  4LW1 A;  4BY7 G;  1QZH A;  2EXD A;  2VL6 A;  4UY8 C;  4GOP B;  1FGU A;  1TXY A;  1I94 L;  1K83 H;  5C44 G;  4A3D G;  1IYJ B;  2R7F A;  4JG2 A;  4HIO A;  4IFD G;  2NN6 G;  3I56 A;  5CMT A;  4GKK L;  2VZA A;  3GTG H;  2E5L L;  2IHE A;  3H3V H;  4X2E A;  5M3F H;  2Z0S A;  4B3T L;  1YHA A;  1JJC B;  1NMG A;  4C3H H;  4UPA A;  3H0G H;  4POG A;  1OXS C;  5IP7 H;  3AFQ A;  2IX1 A;  3J81 j;  3SE5 A;  2WAQ G;  1VQA A;  4X64 Q;  2OCE A;  3BJU A;  4DR1 L;  2ALY B;  5DLQ E;  5C3E H;  1KIX A;  2R7Z H;  5C3E G;  5AJ3 Q;  4DV5 L;  1L1O C;  4OO1 G;  2F6S A;  4QIW E;  5JFZ A;  2UU9 L;  5GRO A;  3KF6 A;  4GKK Q;  2XTI A;  2VY3 A;  1TWG H;  5FLM G;  3TS2 A;  2ZTD A;  3GTL H;  1TWA H;  4AQY Q;  1Q46 A;  2LSS A;  4U04 A;  2YYZ A;  1VQE A;  1L2F A;  4IPD A;  1PH3 A;  1IZ6 A;  3RN2 A;  1S40 A;  1PYB A;  4GOP C;  4JI8 L;  4ME3 A;  1RIP A;  5IP9 G;  4UP9 A;  2IY5 B;  1CKN A;  1HJP A;  4R4O A;  1U0L A;  4A93 H;  5IYB G;  4DV2 Q;  3NEM A;  4GNX A;  3M7N A;  2C35 B;  3U4V A;  4A3J H;  1MIU A;  2PQA B;  2ZJR A;  3HOX G;  4DR3 L;  1HNX L;  2Q2H A;  3S1R H;  4B3S L;  4U0U A;  2VNU D;  3PUZ A;  1Q81 C;  1I5F A;  2QGQ A;  4HJA A;  2MO1 A;  4A3M G;  1BKB A;  3B6Y A;  4UP8 A;  1VQ8 A;  3HOV G;  2YV5 A;  3CCU A;  5JFF A;  1E7Z A;  5C4J H;  1X54 A;  4OON A;  2I5M X;  3SGI A;  4GN5 A;  1PH5 A;  1OXT A;  3DM3 A;  1FJG L;  2R7Z G;  4BXX G;  1EYG A;  2R93 G;  3J7Z C;  3L0O A;  2E8G A;  2QA4 A;  4DV7 Q;  1FL0 A;  1N36 Q;  3OTO Q;  4A3L G;  4DV4 Q;  1EQR A;  4QL5 A;  5JEA J;  5H1S E;  3GTJ H;  5IY0 A;  4LFB Q;  2UXB L;  4DUY L;  2UUB L;  3LET A;  1GO3 E;  3W1G A;  1LM0 A;  3CPF A;  4JI4 Q;  4B3S Q;  1Y1V H;  3EIV A;  4LF5 Q;  4DAY B;  4O2D A;  2ID0 A;  1BBU A;  5BR8 Q;  4YWL A;  4RMF A;  2NVY H;  2JA7 G;  4LUO A;  5IP9 H;  1N9W A;  1XMO Q;  4O0A A;  3BZK A;  1VQJ A;  3A0J A;  4DV4 L;  1CKM A;  4PZ8 A;  1EWI A;  2QEX A;  4KHZ A;  4GKJ L;  1D8L A;  1UEB A;  1YNX A;  1PH2 A;  1K8G A;  1PH7 A;  2OWO A;  4N67 A;  2VW9 A;  3FKI H;  1G6P A;  4ALP A;  1XPR A;  2K14 A;  3MEF A;  5ELN A;  4LF8 L;  2K5V A;  4NPS A;  2PI2 E;  1Q82 C;  1IL2 A;  1VQD A;  4LF9 Q;  1VQ6 A;  4AH6 A;  4IJL A;  1FVI A;  3M85 A;  4YCU A;  4JI6 Q;  3PO3 G;  5J3B A;  2VQE L;  1VQB A;  4WJ4 A;  1NBW A;  3ERS X;  5EU0 A;  1M90 C;  1G29 1;  4DR4 Q;  1W3S A;  3EBE A;  4U07 A;  1AE2 A;  3I4O A;  2Q2I A;  4P74 A;  2GN5 A;  2JQO A;  2JA6 G;  2I0Q A;  1VQI A;  5C4X G;  4JBJ A;  4B3R L;  5CKL A;  2E2J H;  1X3G A;  2BH8 A;  1YJN A;  3BU2 A;  4JI6 L;  1I3Q H;  4GLX A;  3U50 C;  4A3B H;  4BBR G;  3T1H Q;  3CF5 A;  3HKZ G;  2WB1 G;  1OTC A;  1HNW L;  4IFD I;  2A8V A;  1E1O A;  5FLX c;  4X64 L;  2HT1 A;  1K9M C;  3PSI A;  2MQH A;  3PO2 H;  4IO9 A;  5K36 G;  3HOW G;  3M4P A;  3TQY A;  2UU9 Q;  2BA1 A;  2Z6K C;  3FHW A;  5FJ8 H;  4GNX B;  4A3G H;  3PV0 A;  1TWC H;  3I4N H;  3K7U C;  2UXD Q;  4DR2 Q;  2R6G A;  2N8N A;  2YTV A;  3F8T A;  5M5Y H;  4MNO A;  3F2B A;  3T1Y Q;  1N32 Q;  5LMN W;  4YWK A;  5HGQ A;  1UE1 A;  4MTN A;  5EAY A;  2OQ0 A;  2AMC B;  3E0E A;  2R93 H;  4DV1 L;  2UXB Q;  3J7A 5;  4A3K H;  4DUY Q;  2UUB Q;  2Y0S E;  4DR5 Q;  2HQL A;  2KEN A;  1CKO A;  3KDF B;  3KJO A;  4JI3 Q;  5JJI A;  3JAM i;  4JI7 Q;  1VQH A;  3AFP A;  3CP0 A;  1KC8 C;  1IBL Q;  3MXN B;  2WFW A;  5M3M H;  5C4X H;  4YHH Q;  1IBK Q;  1EOV A;  3CCE A;  5GQO A;  5C0X G;  2ATW A;  4LU4 A;  4BY1 H;  1L1O A;  4DR7 L;  1Z9F A;  5GAG C;  2JEB I;  4P71 A;  1Q1E A;  4X62 Q;  4BBR H;  3H3V I;  1X56 A;  5IYB H;  1VQO A;  1AH9 A;  1WCM H;  3TS0 A;  3T1H L;  1HNW Q;  1PH8 A;  1KL9 A;  1BBW A;  4AIM A;  3CD6 A;  1SFO H;  3HOW H;  1YEZ A;  4GOP A;  4JI7 L;  3RZO H;  3PCO B;  3G71 A;  2CCZ A;  4R1J A;  4OX9 Q;  2B29 A;  1QUQ B;  1YJW A;  2CWP A;  4P73 A;  1IBK L;  3AEV A;  5BR8 L;  1P16 A;  4U0S A;  2N3S A;  2JJQ A;  4LF5 L;  1LTL A;  4DNI A;  2VQF Q;  3K81 C;  4QJF A;  2YTX A;  4DV0 Q;  2EQS A;  4TVA B;  2KHJ A;  1J5E L;  1NTG A;  4BXX H;  4HJ9 A;  3CCR A;  1MKH A;  4XI8 A;  3PF5 A;  1Y1W G;  1HR0 W;  1B70 B;  1B8A A;  4P72 A;  4X65 L;  1VQM A;  1JMC A;  4X66 L;  4BBS G;  4JV5 Q;  1JT8 A;  3K80 C;  4Y7N H;  3ZLM A;  1KD1 C;  3E9I A;  5M3F G;  2F4V L;  1YJ9 A;  1Z47 A;  1VQG A;  1WYD A;  2JA5 G;  1VQF A;  4GLA C;  3PIP A;  3NEL A;  3J80 i;  1NJI C;  3A5Z B;  2I5L X;  4X62 L;  4DV3 Q;  2E5L Q;  2R7D A;  3G4S A;  3AYH B;  1NMF A;  5IWA L;  2ZTE A;  1RL2 A;  3KFU A;  4NXM Q;  4RG1 A;  1EFW A;  1VQ4 A;  4DPG A;  1PH9 A;  4HJ5 A;  4HIM A;  4EQ5 A;  4DK6 C;  2HHH L;  4JI5 L;  4JI0 L;  1V1Q A;  1VQC A;  3KF6 B;  3S1M H;  1SRU A;  1QVF A;  3HOY H;  2MNA A;  2OTJ A;  3HKZ E;  4L5R C;  1UWV A;  1YVC A;  2CKZ B;  4YY3 Q;  4LNQ A;  4DR6 L;  1NE3 A;  1KRS A;  4DK3 C;  2ZJQ A;  5CGL A;  4HJ8 A;  1R9T H;  4OWW B;  4NXN L;  3CQZ H;  4B3M Q;  2RF4 A;  4JI2 L;  1N34 L;  3HFZ B;  4IFD J;  4JCV E;  2L15 A;  4X2C A;  3RR5 A;  2CQO A;  3GDE A;  4BBS H;  3TEH B;  1KAW A;  1GD7 A;  1HNX Q;  2BH2 A;  3A5U A;  2E2H H;  4XTC S;  3S14 H;  4A3M H;  3HOZ H;  3CME A;  4DUZ Q;  1T9H A;  4C3J H;  1TWF H;  4JI1 L;  3D0F A;  2VUM G;  1IBM Q;  3PO2 G;  1Q12 A;  4R4Q A;  2V1C C;  2XGT A;  3CMA A;  1Y1V G;  4DV3 L;  1U5K A;  3RNU A;  1WFQ A;  3UDI A;  1M1K C;  1VQL A;  4A75 A;  1JE5 A;  2IX0 A;  4LFA L;  2JA6 H;  3ZCB A;  4PZ6 A;  2B3G A;  2BA0 A;  3CW2 C;  1FJG Q;  4J15 A;  1PFS A;  3OYY A;  4BA1 I;  3J80 c;  4DV6 L;  1SR3 A;  4DV7 L;  2NVT H;  3J81 c;  1E24 A;  4KHP Q;  1K0R A;  2MFI A;  3PGZ A;  4L5S A;  3RLN A;  1QUQ A;  4M16 A;  1HZB A;  1OXU A;  1XJV A;  5JEA G;  3KF8 B;  3ER0 A;  4U0Z A;  3JAM c;  4X66 Q;  2AWN A;  3CCQ A;  4A3I G;  2ASB A;  3S15 H;  5LMU Q;  1ASZ A;  1LUZ A;  1PH4 A;  2RCN A;  1KRT A;  3ZJY C;  1HZC A;  1NY4 A;  2ZM6 L;  2OTL A;  1XNR L;  3GTQ H;  4DKA C;  2F3I A;  3UDF A;  4DV6 Q;  4NXN Q;  1V43 A;  1V9P A;  1QZG A;  5JJ7 A;  4YCV A;  4LFC Q;  1YIT A;  1J6Q A;  1TWH H;  3KOJ A;  1JJ2 A;  3TRZ A;  3S1Q H;  3TRE A;  1XPU A;  1X3E A;  1X65 A;  2D62 A;  3GO5 A;  2IHF A;  4PZ7 A;  1CSQ A;  2K75 A;  4LUV A;  4R4T A;  1HZ9 A;  4PMW A;  4AYB G;  3Q8D A;  2Q2U A;  3I2Z A;  3M3Y H;  2UXC L;  4PG3 A;  1VS0 A;  3S24 A;  5C0X I;  3CC4 A;  4LF6 Q;  3M4O H;  2ZTC A;  1VQK A;  4DV1 Q;  3HOZ G;  3W5O A;  4LF9 L;  4C2M H;  4TQU S;  4LF8 Q;  2H5X A;  3GTM H;  2VUM H;  1C9O A;  1G51 A;  5IE8 A;  2F52 A;  1Q1B A;  2KBN A;  1MJC A;  4IPH A;  1MJE A;  4H02 A;  1PA6 A;  1KHI A;  5M3M G;  3JC6 6;  2KCM A;  2VQE Q;  1E1T A;  2IT1 A;  2K5N A;  3LGJ A;  2B63 G;  2NZO A;  1K8A C;  3I4M H;  3I4M G;  4JOI C;  3GD7 A;  4YCW A;  3S2H H;  4QGU A;  1N33 L;  2F4V Q;  3KYH C;  4GN3 B;  3S1N H;  1SLJ A;  1QVC A;  2Y0S G;  2YTY A;  3RLF A;  1GKH A;  1VQP A;  5HY6 A;  4IPG A;  3UDX A;  1XMQ Q;  1KXL A;  4R4I A;  2RHQ B;  5AJ3 L;  1OXV A;  4DV5 Q;  3RN5 A;  1HR0 L;  2MO0 A;  2ZJP A;  2PMZ E;  4LFC L;  3F2D A;  1I50 H;  3HOU G;  4JBK A;  3CC2 A;  5FJ8 G;  4A3G G;  2N49 A;  2ZM6 Q;  1XNR Q;  1YHB A;  3HOV H;  4LF4 Q;  1VQ7 A;  3K0X A;  2D0O A;  4NB3 A;  4QY7 A;  4YWM A;  2OQK A;  2JA5 H;  5IP7 G;  3CXC A;  2PQA A;  3PF4 A;  2UXD L;  4DR4 L;  1CSP A;  1VQN A;  4LF6 L;  4X2D A;  3L2P A;  4L5Q A;  1GVP A;  3DLL A;  3OTO L;  4IOC A;  4DR1 Q;  1PVO A;  1A63 A;  4HJ7 A;  4QQB X;  4BY1 G;  3HKS A;  1A0I A;  2K50 A;  3KJP A;  2EIF A;  2VS1 A;  4PY3 A;  4DR3 Q;  1Q7Y C;  1VQ9 A;  5IYD G;  2LXK A;  1HH2 P;  3G48 A;  3CCV A;  4OX9 L;  3S17 H;  4JYA L;  1WCM G;  4LF7 Q;  3U4Z A;  3KDF A;  5JJK A;  2CFM A;  3HOX H;  4B3M L;  4JOI A;  4YHH L;  1UE6 A;  4A76 A;  2GVA A;  5LMN L;  3H15 A;  3CPW A;  3RZD H;  1XNQ Q;  5ELO A;  5JJ6 A;  2K5H A;  1JJG A;  1BVS A;  1P8L A;  4POF A;  3CCM A;  1CKN B;  3UE1 A;  1PHJ A;  3A74 A;  1PYS B;  3FKI G;  4JYA Q;  3PUY A;  4UP7 A;  4HIK A;  1JB7 A;  1HR0 Q;  3S16 H;  3FP9 A;  1S72 A;  4BY7 H;  5GAH C;  3G6E A;  4K0K L;  3CCL A;  2Q2T A;  1PH1 A;  1YBY A;  1IBM L;  1ASY A;  4GNX C;  3S6A A;  4LF4 L;  1Q86 C;  4IJH A;  4KHP L;  1IXR A;  1SRO A;  1XTD A;  3M4Q A;  5GAD C;  4A3D H;  5E7N A;  3ULL A;  3E9H A;  4KLK A;  3CUC A;  2PNH A;  4BA2 I;  3U58 A;  3M9B A;  1A62 A;  2WB1 E;  3VDY A;  1YI2 A;  1WJJ A;  3F1Z A;  4OO1 I;  3SN9 A;  1DGS A;  2HIV A;  4IPC A;  1K73 C;  1Y1W H;  1K3R A;  5M5W H;  2VQF L;  4GLV B; 
#chains in the Genus database with same CATH topology
 4B3T Q;  3NP8 A;  2KHI A;  3ND8 A;  1LTI D;  1TWG B;  4A3J G;  3D4D A;  3N52 A;  1SNP A;  2LFN A;  4A3C H;  1F9S A;  5DNF A;  4A3C G;  5HUR A;  4QF4 A;  3N3U A;  2WAC A;  3HOY G;  2OF1 A;  3EN2 A;  1PTO C;  4O42 A;  4NW2 A;  5IWA Q;  1LTB D;  1Y14 B;  4B3R Q;  1ICF B;  3I8Z A;  5JVG 3;  1L0X B;  1YIJ A;  4JK1 C;  3M4O B;  5FKA C;  1WD1 A;  4MZ9 A;  1IW7 D;  4N9T A;  3ULP A;  5CV5 A;  3OW2 A;  3NBH B;  4RFB A;  1XWE A;  3W1B A;  2SNS A;  1XMO L;  2E75 C;  1Q8K A;  4FO2 A;  2B2Y A;  4BY1 B;  3C1E A;  1BCP F;  2DUD A;  1E3P A;  1X6O A;  4X6A H;  2JP1 A;  1X9N A;  2WIN B;  4A3K G;  1YNN C;  2GVB A;  4PMB A;  1EY7 A;  2ES2 A;  1PRT C;  1S5B D;  1HNZ L;  3ONA B;  2F3W A;  1A3U A;  5C44 H;  4CDC C;  2K4K A;  3PIO A;  4LFA Q;  3R8B A;  1J5E Q;  1N36 L;  2FJ2 A;  1I4H A;  4JC0 A;  4ZKB B;  1PRT F;  4H7B A;  2R7Z B;  1U4L A;  4ZUI A;  4JI4 L;  3IRB A;  1EYC A;  3IFT A;  1TY0 A;  1SMX A;  3KLW A;  2G03 A;  3SVM A;  4FDB A;  3NXW A;  1CQV A;  4RGN A;  3CCS A;  2PZT A;  3STB C;  3I7F A;  2RBM A;  3S2D H;  1ESF A;  3D31 A;  3A54 A;  3GV6 A;  2K6A A;  2XNA C;  1N32 L;  1MSH A;  1B53 A;  5BN5 A;  2ICI A;  1I6H H;  4XIG S;  1EUJ A;  2JA8 G;  3S17 B;  3PMF A;  3CRK C;  3J7A V;  1C7Y A;  4U68 A;  2FIN B;  1HQM C;  2B8F A;  1I94 L;  3O13 A;  1K83 H;  4I7Z C;  1EYD A;  5CMT A;  1JWS D;  2F0L A;  2Z0S A;  3TP8 A;  1NMG A;  4C3H H;  1EU4 A;  2CH4 W;  2K5Q A;  3VR6 A;  4DR1 L;  2EJM A;  4OO1 G;  4KKT A;  5AJ3 Q;  4DV5 L;  2G9D A;  4KD3 A;  2F6S A;  3EQL C;  5F2D A;  4QCL A;  1Y1V B;  2Z4I A;  1ONL A;  1TWG H;  2F0K A;  4IUP A;  3S14 B;  2ZTD A;  5IGE A;  2LSS A;  4U04 A;  5IOD A;  1PYB A;  4N8F A;  4JI8 L;  2AQ2 B;  1SEB D;  3JAM E;  1HA5 A;  3SR1 A;  1BUV T;  4A93 H;  4GNX A;  3M7N A;  3BS1 A;  1X32 A;  3HRZ C;  3KK7 A;  1EWH A;  1JR0 D;  4I65 A;  1NH1 A;  4DAY A;  1Q81 C;  2NVQ B;  2QGQ A;  1SNC A;  2MO1 A;  1BKB A;  3B6Y A;  4B9W A;  1VQ8 A;  1SJE D;  1R4Q B;  4DF7 A;  5M3F B;  2R7Z G;  3D4R A;  2QA4 A;  3QG1 A;  4DV7 Q;  3MEH A;  3NTH A;  4QL5 A;  5C3X A;  4C3J G;  3W1G A;  1YNN D;  3V2T A;  4Y7N B;  4B3S Q;  4HMI A;  3SEB A;  1WTO A;  4LF5 Q;  2B2W A;  4C1N K;  4YWL A;  2DJF C;  2JN4 A;  2NVY H;  4KN7 C;  1LTG D;  4LUO A;  4WOR A;  5IP9 H;  1DOM A;  4O0A A;  5KYI A;  4PZ8 A;  4KHZ A;  2EOT A;  1MI2 A;  1PH2 A;  1IKM A;  4N67 A;  5ELN A;  5FLX L;  2K5V A;  1VQ6 A;  1VQD A;  2DY7 A;  4AH6 A;  3M85 A;  1FVI A;  3VYU A;  4CJ2 C;  4YCU A;  1PTO D;  2IL8 A;  2A6H C;  4DA2 A;  4KJN A;  2VQE L;  4WJ4 A;  1TS5 A;  1HTP A;  2PMZ B;  1G29 1;  2Z9H A;  1PFM A;  1V8Q A;  1SND A;  4U07 A;  1AE2 A;  2F0O A;  2Q2I A;  3QJY A;  5I2X A;  5ELD A;  4QUC A;  4WRD A;  1VQI A;  1LTS D;  4JBJ A;  2E2J H;  5CMD A;  3BU2 A;  4JI6 L;  2EJF C;  3U50 C;  5CBA E;  3CF5 A;  1OTC A;  2B2W C;  4IFD I;  1E1O A;  3MXP A;  5FLX c;  3ERO A;  3MXU A;  1TR5 A;  5LL6 S;  1D2B A;  2JA6 B;  4K14 A;  3PV0 A;  1TWC H;  1S5E D;  2R6G A;  2YTV A;  4MNO A;  1R4P B;  1WTX A;  4C3H B;  3QOJ A;  2PCF B;  5HGQ A;  4MTN A;  5EAY A;  2OQ0 A;  3E0E A;  2HD3 A;  3NHH A;  2KEN A;  3KDF B;  5JJI A;  3GTG B;  3AFP A;  1KC8 C;  5J39 A;  1H9M A;  5GQO A;  2QIL A;  1W6J A;  5GAG C;  2CQA A;  2JEB I;  1Q1E A;  4KHV A;  4ZAI A;  5IYB H;  2HDM A;  1PH8 A;  2YU9 B;  1DON A;  1GUW A;  2F0T A;  5K36 H;  3M7G A;  1SFO H;  1LT3 D;  1YEZ A;  4GOP A;  2CCZ A;  4OX9 Q;  2B29 A;  5D3I B;  1QUQ B;  3EFX D;  3AEV A;  2H1E A;  1B1Z A;  1P16 A;  2E74 C;  4K2K A;  2YTX A;  4TVA B;  3HGB A;  1O7Z A;  1NTG A;  1J5E L;  3HZX A;  4BXX H;  2A5H A;  3K5M A;  1G6Z A;  1H9S B;  1MKH A;  1JMC A;  1RKN A;  4BBS G;  2H4O A;  3VR5 A;  1JT8 A;  5ELC A;  3SXH A;  4HR7 B;  4Y7N H;  1LAC A;  5M3F G;  2F4V L;  4BS9 A;  2AQ3 B;  4X62 L;  2E5L Q;  2N88 A;  2EXZ A;  5IWA L;  1NR4 A;  1RL2 A;  1JB3 A;  2G9H D;  4RG1 A;  1EFW A;  4FF4 A;  1VQ4 A;  4H13 C;  4LMQ D;  2RDH A;  3S1M H;  1VQC A;  4U67 3;  1IKL A;  1SRU A;  3HOY H;  1YVC A;  2MJ8 A;  4LNQ A;  1NE3 A;  5CGL A;  4HJ8 A;  4OWW B;  4IUR A;  1B50 A;  4B3M Q;  1N34 L;  3HFZ B;  2O5I C;  3FKI B;  2NTT A;  2XRS D;  1DOK A;  3GDE A;  1KAW A;  5DM6 3;  5I2Y A;  5IGB A;  3LWU A;  3W2D A;  1BXT A;  2VUM G;  3PO2 G;  1Q12 A;  3BVZ A;  1Y8O B;  1WFQ A;  3RNU A;  1M1K C;  4LFA L;  1DJR D;  4A75 A;  3A8K E;  2JA6 H;  2RDF A;  2BA0 A;  1PFS A;  3OYY A;  4BA1 I;  3J80 c;  2R92 B;  1I3Q B;  1PRT D;  1EFI D;  1EIH A;  4KHP Q;  3K0Y A;  5JEA G;  4X66 Q;  3CCQ A;  4A3I G;  2OEO A;  3S15 H;  2RCN A;  1KRT A;  1HZC A;  3GTQ H;  4YCV A;  1ENF A;  1J6Q A;  1TWH H;  3KOJ A;  1YIT A;  1BBX C;  1TS2 A;  2ICE C;  2C5C A;  2IHF A;  1CK1 A;  1S5F D;  4AYB G;  3Q8D A;  4RHS A;  3M3Y H;  3MXG A;  3HOZ G;  4RAU C;  4LF9 L;  4C2M H;  4TQU S;  5HGT A;  4LF8 Q;  3OHX C;  1NR2 A;  3IL8 A;  2HUG A;  5IE8 A;  1PA6 A;  3JC6 6;  2KCM A;  2K5N A;  2A69 C;  1GUT A;  4FF3 A;  1GUS A;  3SHL A;  3KYH C;  4GN3 B;  4CKE A;  1XTC D;  1NSN S;  3E0J A;  3DEO A;  5IOC A;  3RLF A;  2X6G A;  1XMQ Q;  3TME A;  2JA8 B;  5AJ3 L;  2RHQ B;  4XXE A;  4DV5 Q;  3BVG A;  2MO0 A;  4LFC L;  3HOU G;  1I50 H;  1JE4 A;  1EQT A;  1KTK A;  3HOV H;  3M4Y A;  3OWE B;  3RD4 A;  4YWM A;  4QY7 A;  2JA5 H;  2OQK A;  2QF7 A;  2Z6B A;  1S5D D;  4HN7 A;  3OTO L;  3CHB D;  3MHB A;  3HKS A;  2K50 A;  4FF1 A;  4PY3 A;  4FVM A;  4F88 A;  4TSS A;  1HH2 P;  4OX9 L;  1LT6 D;  4YHH L;  1CHQ D;  2J7Z A;  1CA5 A;  1JCK B;  1XNQ Q;  2RSN A;  5ELO A;  2K5H A;  1AN8 A;  3NK9 A;  3SK8 A;  4POF A;  1IYV A;  4HIK A;  1HR0 Q;  4PV1 C;  3G6E A;  2B39 A;  4QB4 A;  1PH1 A;  1YBY A;  1MBY A;  2MPM A;  4OIK A;  3VR3 A;  3M4Q A;  3ULL A;  3CUC A;  5BN4 A;  2PNH A;  2WB1 E;  1YI2 A;  2B2Y C;  4IPC A;  1K73 C;  1Y1W H;  1EZ8 A;  1K3R A;  3K5L A;  3TP5 A;  3BYY B;  2PI2 A;  1WI5 A;  2EYO A;  4UDU C;  1QVG A;  2EPB A;  1XMQ L;  1TWF B;  4KMU C;  1QNK A;  2Z6K A;  4P75 A;  3F2C A;  1PTO F;  1SMY C;  1GM5 A;  1SNM A;  3STB D;  1EEF D;  4XT3 B;  3CAM A;  3OW7 A;  3GTQ B;  1S3O A;  3L9A X;  4JPB W;  1EIF A;  3W3A A;  3A7A B;  1SN8 A;  4RWS C;  3M3Y B;  3SHG A;  2RKS A;  3F2U A;  1D6E C;  3PO3 H;  1CQF A;  1UNS A;  2NZ1 D;  1ZXT A;  1L0Y B;  5IYC H;  4DV2 L;  2JA9 A;  2N78 A;  3CC7 A;  3ULJ A;  3HEJ A;  2JXM B;  2WB1 B;  1KDC A;  1HNZ Q;  5E3F A;  2A1A A;  3QWN A;  4NP5 A;  4EVO A;  4R8I A;  3J80 E;  3OOC A;  3PQI A;  1T5E A;  3A8I E;  2FMM A;  3I4N G;  4ZCK A;  2NVX H;  1VMC A;  5EKK A;  1SBB B;  5KGU A;  1H9K A;  1PYW D;  5TSS A;  2O2L D;  3ICE A;  2JA8 H;  4JI1 Q;  1K83 B;  4JBW A;  2AHO B;  4OWX B;  2AUK A;  2R92 G;  4JV5 L;  4Y52 H;  4LWC A;  1L0W A;  1FNV A;  1I4Q A;  1PH6 A;  3RLO A;  1LYL A;  2BE5 D;  5LMN Q;  3CCJ A;  3U9O A;  4WFN 3;  3C46 A;  3AQQ A;  1YHQ A;  2ZT9 C;  2IJ0 A;  3PUX A;  1WTR A;  1ENC A;  1HUN A;  1HHV A;  2HHH Q;  4GN4 B;  1KLU D;  4F7X A;  2EY2 A;  3ZC7 A;  1D7Q A;  1EL0 A;  5IIF A;  3Q6S A;  1RTN A;  5JJZ A;  3LWE A;  1ZYR C;  1UE7 A;  4J1M A;  3I4N B;  1C0A A;  5M5Y B;  1PFB A;  5L37 A;  1AW7 A;  3TSS A;  4LK1 C;  1QZH A;  2EXD A;  2VL6 A;  3VYT A;  4UY8 C;  1FGU A;  1TXY A;  2GA4 B;  5C44 G;  2R7F A;  3E5S A;  4IFD G;  4GKK L;  3OMC A;  2JA7 B;  2VZA A;  2E5L L;  2IHE A;  3H3V H;  4X2E A;  5M3F H;  4ILW A;  3FDT A;  1YHA A;  4B3T L;  4UPA A;  3H0G H;  4POG A;  4FXK C;  5IP7 H;  4KY5 A;  3J81 j;  2WAQ G;  1VQA A;  4X64 Q;  2ALY B;  3T56 B;  5C3E G;  4QIW E;  2UU9 L;  3KBG A;  4XYO A;  4DAV A;  2JYO A;  2HDL A;  5JPM C;  4C56 C;  2NVY B;  1LLR D;  1S40 A;  3G6J B;  3IAY A;  3J81 E;  1VMP A;  3ERQ A;  4ME3 A;  1RIP A;  2EYJ A;  1HJP A;  1SYD A;  3L3O C;  4DK1 A;  5IYB G;  3I91 A;  5KNC A;  1MIU A;  3R2T A;  2ZJR A;  4X3T A;  1A2T A;  2B2U A;  1IYU A;  1TII D;  4B3S L;  2XWJ B;  3NPP A;  2EZV A;  5CV7 A;  2YV5 A;  4ID6 A;  5JFF A;  4J8Q A;  3DWA A;  1NCV A;  2KVM A;  4GN5 A;  4OIJ A;  4BXX G;  1EYG A;  4BY7 B;  3L0O A;  1U9R A;  1GJX A;  1F77 A;  1FL0 A;  3OIQ A;  1N36 Q;  3OTO Q;  4DV4 Q;  5JEA J;  2UXB L;  3P20 A;  1LM0 A;  2PNR C;  1CI3 M;  4JI4 Q;  1ILP A;  3I70 A;  5JEA H;  1SAP A;  3RMH A;  4RMF A;  2JA7 G;  4FXG C;  1N9W A;  4X3U A;  1KDB A;  1M4V A;  2PW7 A;  1D8L A;  1UEB A;  1YNX A;  3UI2 A;  4FYD A;  3S1N B;  3GV3 A;  3K5N A;  1G6P A;  5C3W A;  1HQR D;  4ALP A;  2K14 A;  4KV6 A;  4LF8 L;  3E6Z X;  2PI2 E;  5COR A;  4LF9 Q;  4XQJ A;  1B44 D;  4A3D B;  5J3B A;  1VQB A;  3T4A C;  1GUG A;  1NBW A;  2RQX A;  5EU0 A;  1M90 C;  3I4O A;  4P74 A;  5DEH A;  5CKL A;  1FD7 D;  2BH8 A;  4J6H A;  2OT2 A;  5DM7 3;  4BWG B;  2XRQ D;  3T1H Q;  3HKZ G;  5J22 A;  2KOL A;  1DXM A;  1CZG A;  3BYT B;  4DXG A;  1K9M C;  1JWU D;  2MQH A;  3PO2 H;  2M2L A;  3TQY A;  3FHW A;  2NB0 A;  2Q8R E;  2KEC A;  3T1Y Q;  5D14 A;  1C48 A;  2B2T A;  3K5O A;  1F2L A;  3K7A B;  1JOO A;  3BDO A;  5K5P A;  1LO5 D;  4KN4 C;  4DV1 L;  3H91 A;  4A3K H;  5E1F A;  3E3X A;  5FO9 B;  2NTS A;  4DR5 Q;  1LT4 D;  2HQL A;  3SE0 A;  1WTW A;  3GTO B;  1TT2 A;  3MXN B;  5M3M H;  1JOQ A;  5C4X H;  4YHH Q;  1EOV A;  1V1P A;  2ATW A;  4CKC A;  4P71 A;  1EEI D;  2F03 A;  3H3V I;  3CD6 A;  3HOY B;  3HOW H;  1ENA A;  4JI7 L;  1O78 A;  5JOB A;  3RZO H;  2RCF A;  1I4G A;  3G71 A;  4R1J A;  2C9O A;  3DM1 A;  3NSW A;  2CWP A;  1IBK L;  5FLX E;  1C4Q A;  5CR3 A;  2BDO A;  2N3S A;  2JJQ A;  1WVL A;  1EWC A;  1F9Q A;  4LF5 L;  3K81 C;  2EQS A;  4ZUJ A;  4C1N I;  2NWG A;  4BY7 H;  1K8O A;  1HR0 W;  1B70 B;  4P72 A;  1VQM A;  1PDQ A;  1I4P A;  1VDZ A;  4JV5 Q;  4DNR B;  2QDL A;  2IW3 A;  5CV6 A;  1FNU A;  1KAA A;  1KD1 C;  3E9I A;  1YJ9 A;  4GLA C;  1SYB A;  4G57 A;  2I5L X;  5CC4 A;  2PW5 A;  4ZYS A;  3RUZ A;  1A6X A;  2EJG C;  2ZTE A;  2O4X A;  4RKB A;  4BBR B;  1VF7 A;  2EYM A;  1HTL D;  2A74 C;  4HIM A;  3EVQ A;  2HHH L;  4JI0 L;  1V1Q A;  3VYS A;  3U9S A;  5EKI A;  3D3R A;  1KRS A;  1S4Z A;  1A15 A;  2ZJQ A;  5DAU A;  1R9T H;  2VXW A;  5C44 B;  4JI2 L;  3NQI A;  4IFD J;  4UAI A;  5T1G A;  1JOK A;  2L15 A;  4X2C A;  1Y8N B;  3RR5 A;  2CQO A;  2F1M A;  1EOT A;  3H6M A;  3QO2 A;  4HAE A;  4H0L C;  1G91 A;  4B08 A;  3A5U A;  2E2H H;  3HOZ H;  1DD2 A;  4A3M H;  3KLS A;  1T9H A;  4C3J H;  4JI1 L;  3SK6 A;  3D0F A;  1IBM Q;  4R4Q A;  2V1C C;  2XGT A;  2A68 C;  1U5K A;  1U4R A;  3HS0 C;  1VQL A;  5FO7 B;  4PZ6 A;  3CW2 C;  1FJG Q;  4J15 A;  5I9O A;  3S2D B;  3TN2 A;  4DV6 L;  4CDD C;  4ZLT F;  3PIP 3;  4RGT A;  3TBI B;  4L5S A;  2CH4 A;  4M16 A;  1OXU A;  1XJV A;  3JAM c;  3KF8 B;  3S1R B;  5CV9 A;  4E6I A;  1BNZ A;  5LMU Q;  2ZM6 L;  1XNR L;  2OTL A;  1FGB D;  1PMR A;  3DXJ C;  3TRZ A;  3S1Q H;  3FVQ A;  1X3E A;  4M1U B;  4PZ7 A;  2K75 A;  1FYC A;  5C5M A;  2Q2U A;  1HZ9 A;  3K59 A;  3I2Z A;  4PG3 A;  1VS0 A;  5C0X I;  3P1H A;  2P5Z X;  4QIW B;  1Q3L A;  1JOR A;  1HFG A;  3QR8 A;  2BOS A;  1Q1B A;  1TQO A;  1MJC A;  1KHI A;  5M3M G;  2IT1 A;  1K8A C;  3I4M G;  3GD7 A;  4C3I B;  2F4V Q;  3H3V C;  2Y0S G;  4A93 B;  3J7Y W;  1KXL A;  4R4I A;  5IGF A;  4IZ8 A;  2XN9 C;  4L6T B;  4K6L A;  2ZJP A;  5FK9 C;  1SE4 A;  3CC2 A;  5G3L F;  1PTO H;  4O1N A;  4LF4 Q;  2F0W A;  4DU9 A;  1CZW A;  1QB5 D;  4NB3 A;  4IUQ A;  3CXC A;  2PQA A;  1ZEQ X;  2L12 A;  3FRP B;  2B2V A;  3L2P A;  5D3D A;  1Y1W B;  4EQP A;  4Q5V A;  1A63 A;  5J1Z A;  2VS1 A;  2ZXO A;  5EPK A;  1Q7Y C;  4JYA L;  3VA5 A;  3GTM B;  4RA8 A;  1WCM G;  5JJK A;  4B3M L;  2VB3 X;  4JOI A;  5M9O A;  4ZK9 B;  1CT1 D;  1YNJ C;  2PYK A;  3SK4 A;  1BVS A;  1R9T B;  3A74 A;  5KIX A;  3HG9 A;  1DOL A;  2J0T D;  1IHZ A;  4K0K L;  5A2Q L;  5T1I A;  1IXR A;  3WOF A;  4KHP L;  1B3A A;  2B2U C;  5E7N A;  1OO9 B;  4C3J B;  1CTM A;  2R61 A;  3KLS X;  3VDY A;  3F1Z A;  2QEJ C;  4OO1 I;  1SYF A;  1N8R C;  2VQF L;  4GLV B;  2NVX B;  4WJ3 M;  1BF4 A;  2F0H A;  2RHS B;  4DR5 L;  1KQS A;  4A3F H;  1YZ6 A;  4A3F G;  1HZA A;  5CGK A;  1SYC A;  1LT5 D;  1QE6 A;  1TWA B;  5IT9 c;  3GTP H;  3I90 A;  1U4M A;  4ZRZ A;  4JI2 Q;  2HIX A;  4N8X 1;  2L0C A;  5I4D A;  1UAP A;  2R92 H;  2PQE A;  4MIU A;  1QCB D;  4H44 C;  2UUA Q;  4R4C A;  1RTO A;  1EIY B;  1EQV A;  1N34 Q;  2MHV A;  3V05 A;  4A3J B;  1CUK A;  2K52 A;  3FPP A;  2LY7 A;  4I7A A;  2PPB C;  1J9O A;  1GOZ A;  2CWA A;  1QJO A;  2NN6 I;  5IYD H;  4YY3 L;  4LF7 L;  1MHW C;  2K05 A;  3EA6 A;  2AQ1 B;  2F0M A;  1GUN A;  2NZH A;  1UE5 A;  4DAM A;  4OWT B;  3T1Y L;  4KKS A;  2WP8 J;  4AYB E;  3J80 L;  4A3E H;  4A3E G;  5LMU L;  2FHT A;  2LMC B;  2A68 D;  3FMC A;  1EQQ A;  2UUC L;  2YU9 H;  1SFO B;  1W2B A;  2JA7 H;  1PTO B;  2X6L A;  4OL7 A;  1A8V A;  1DZ1 A;  4A4I A;  3H0G B;  1WTP A;  1E0B A;  1H9R A;  1BOS A;  3NTK A;  3UE0 A;  4A93 G;  5JJL A;  2JEA I;  2M00 A;  4EQN A;  1Q8I A;  4JI0 Q;  1G2T A;  3D4W A;  4IUT A;  1XNQ L;  1E2Z A;  1YNJ D;  4K5X A;  4NXM L;  2JK8 A;  4A3B B;  4JI3 L;  1G2S A;  2DN8 A;  1X3F A;  5I6W A;  4AQY L;  1XPO A;  1LAB A;  4GKJ Q;  2L5T A;  3PUV A;  1L1O B;  1TS3 A;  1VQ5 A;  2A19 A;  2UUA L;  2UXC Q;  1O7I A;  4A3B G;  1STG A;  2I5H A;  2B8G A;  4BY7 G;  3S1M B;  3I3C A;  1GXD C;  2EYF A;  4A3D G;  1IYJ B;  3I56 A;  1QNU A;  4TKO B;  2EYP A;  4OHJ A;  1OXS C;  4G7O C;  3NWS A;  1QWY A;  3SE5 A;  2R93 B;  3BJU A;  4KY6 A;  1O7Y A;  1L1O C;  5JFZ A;  2A6E C;  3P7J A;  4IQZ A;  4N9P A;  4A3F B;  1A3V A;  2XTI A;  5FLM G;  1TWA H;  1Q46 A;  1FR3 A;  2BDN A;  3I4M B;  4IPD A;  4V0B A;  1IZ6 A;  3RN2 A;  2K5W A;  3ITP A;  2B2V C;  5ELF A;  4CHT B;  1CKN A;  4R4O A;  3X3N A;  1U0L A;  1BCP B;  4DN4 M;  4DV2 Q;  5KND A;  1WCM B;  1KLG D;  3NEM A;  3U4V A;  4A3J H;  4XDX A;  4V19 0;  4DR3 L;  2Q2H A;  4XQN A;  1CHP D;  4IFD H;  4U0U A;  3S15 B;  2VNU D;  3PUZ A;  2WV6 D;  4A3M G;  4UP8 A;  4K2L A;  3CCU A;  2G5D A;  1I4X A;  3P75 A;  1E7Z A;  4OON A;  2SOB A;  3SGI A;  1I6V C;  1PH5 A;  3DM3 A;  1FJG L;  1LTA D;  1EY0 A;  2R93 G;  3J7Z C;  2E8G A;  3NBH A;  5H1S E;  5EPJ A;  5C3E B;  4KTA A;  4DUY L;  4A3E B;  1STE A;  2XWB B;  4CBV A;  3MTS A;  4R8N A;  2ID0 A;  1BBU A;  5BR8 Q;  4HCE A;  1XMO Q;  3BZK A;  3A0J A;  1CKM A;  3KLR A;  3TP7 A;  3S16 B;  2KQ3 A;  3A7L A;  1XPR A;  4NPS A;  3A8J E;  1Q82 C;  3MA2 B;  4GZY C;  2TSS A;  4JI6 Q;  3PO3 G;  5IGG A;  1PFN A;  1T5X D;  1I50 B;  2R3Z A;  4DR4 Q;  1HPC A;  4UHV A;  3EBE A;  2JA5 B;  3Q22 A;  2GN5 A;  2JQO A;  2JA6 G;  5C4X G;  4HSP A;  1O7L A;  3I72 A;  5C0X H;  2FMC A;  1YJN A;  4PQX A;  3KBX A;  3GTJ B;  3J81 L;  1HNW L;  1BCP D;  4X3S A;  2LKV A;  3T13 A;  2A8V A;  3VA7 A;  4X64 L;  2HT1 A;  3RZO B;  5FO8 B;  3HOW G;  2UU9 Q;  4GNX B;  5KRU A;  4A3G H;  1SMY D;  1KNA A;  1V1P B;  3I4N H;  4RHR A;  5M5Y H;  4HTH A;  4JVZ A;  3F2B A;  1N32 Q;  5LMN W;  4YWK A;  2R93 H;  2Z1C A;  3DUZ A;  1JC7 A;  3IKJ A;  3J7A F;  4DUY Q;  1SNO A;  2Y0S E;  1WTH A;  3KJO A;  2KCC A;  4JI7 Q;  2D5D A;  3CP0 A;  2WFW A;  1S5C D;  2EDG A;  1IBK Q;  3CCE A;  2F0J A;  1QG7 A;  4BY1 H;  2X69 A;  4DR7 L;  1M8A A;  5CV8 A;  3Q23 A;  2BCO A;  1GHK A;  4BBR H;  4ZKC B;  4XT1 B;  1AH9 A;  1LTT D;  1WCM H;  1TVX A;  2KJX A;  3D8G A;  3T1H L;  2Y0S B;  3FEW X;  4FXD A;  1CA6 A;  1DCZ A;  2SEB D;  1YJW A;  3VR2 A;  2L11 A;  2KCN A;  1MGS A;  2M9V A;  1F9P A;  1LTL A;  4DNI A;  2VQF Q;  1KNE A;  1JQY D;  2KA7 A;  1ET6 A;  2L9H A;  4HJ9 A;  4Q0F A;  1II3 A;  4KKU A;  1Z7T A;  3CCR A;  3PF5 A;  1SDF A;  4X65 L;  4X66 L;  3HOZ B;  2E2H B;  3MWY W;  3NBI A;  5CYU A;  3K80 C;  3ZLM A;  3VR4 A;  1Z47 A;  1VQG A;  1WYD A;  3PIP A;  1DYQ A;  3NEL A;  1B4O A;  4PMC A;  4DV3 Q;  2R7D A;  1J8I A;  1I6H B;  1EY4 A;  4NXM Q;  4ME5 A;  2ZXP A;  1ZYR D;  4DPG A;  4HJ5 A;  5G3L D;  5ELB A;  4DK6 C;  3NQT A;  4JI5 L;  1WD0 A;  3KF6 B;  2OTJ A;  4L5R C;  1WTQ A;  4YY3 Q;  3MAQ A;  4DR6 L;  4DK3 C;  4NXN L;  3CQZ H;  4B9X A;  2RF4 A;  4K5V A;  2WKC A;  3LX0 A;  2PZW A;  4RCN A;  1EIG A;  4WJW A;  3AU7 A;  3TEH B;  5M5W B;  4NDX A;  1HNX Q;  2WII B;  1QOH A;  1HUM A;  4XTC S;  3S14 H;  2E76 C;  2F3V A;  3VYR A;  1GHJ A;  2A6E D;  2F0E A;  4EQO A;  3S9W A;  1Y1V G;  4QUF A;  2K03 A;  5JVH 3;  1JE5 A;  3ZCB A;  2EE1 A;  3A56 A;  2EYL A;  3TDQ A;  2NVT H;  3DEP A;  1K0R A;  2MFI A;  2VB2 X;  3PGZ A;  3RLN A;  2TMP A;  1QUQ A;  1HZB A;  1U4P A;  2CW0 D;  1RJT A;  2WKD A;  2AWN A;  1E2W A;  3MC0 B;  1PH4 A;  3ZJY C;  4HCS A;  5JPN C;  4DKA C;  2F3I A;  1V43 A;  1QZG A;  5JJ7 A;  1EY9 A;  1EZ6 A;  5A2Q E;  3TRE A;  1B9N A;  3GO5 A;  4R4T A;  4LUV A;  1EU3 A;  4PMW A;  2UXC L;  1JJG A;  3T51 B;  4LF6 Q;  1XX8 A;  4A3I B;  1H9S A;  1SYG A;  1Y69 U;  1VQK A;  3W5O A;  3ND9 A;  4BBS B;  1NNX A;  4OEL B;  5C5L A;  3GTM H;  1C9O A;  1G51 A;  2F52 A;  5M3M B;  1MJE A;  3LGJ A;  1RDP D;  2O5J C;  4JOI C;  4YCW A;  3D6W A;  4MHE A;  1N33 L;  3WOE A;  2ENB A;  1SLJ A;  1X3Q A;  4CJ0 B;  1EY8 A;  1VQP A;  4IPG A;  3HOW B;  2XIW A;  3RN5 A;  4NKL A;  2PMZ E;  3F2D A;  4JBK A;  2NBF A;  5FJ8 G;  2ZM6 Q;  1XNR Q;  3MXN A;  3K0X A;  2D0O A;  3DHQ A;  2UXD L;  1EYA A;  4DR4 L;  5EBD A;  1F2Y A;  4X2D A;  2E2J B;  4L5Q A;  1GVP A;  2KEE A;  1QIL A;  1PVO A;  4DR1 Q;  3X3M A;  1PZK D;  1UEA B;  4RKL A;  3KJP A;  1SYE A;  3D6C A;  5NUC A;  3AB9 A;  4DR3 Q;  2A69 D;  4RH6 A;  2LXK A;  3TZU A;  3S17 H;  2VUM B;  1I4R A;  1D5Z C;  1PZI D;  2F0N A;  3NUC A;  5EPL A;  2CFM A;  3U4Z A;  5M5X B;  4XQQ A;  2PO4 A;  1BCP C;  3CPW A;  3WDN A;  1P8L A;  4AYB B;  2V4D A;  3CQZ B;  1CKN B;  3BZD B;  3UE1 A;  1PHJ A;  1HRJ A;  1ILQ A;  3FKI G;  1ESR A;  3PUY A;  4UP7 A;  3BDC A;  2CVR A;  5GAH C;  5ISR A;  2Z4H A;  1IBM L;  1ASY A;  4GNX C;  3S6A A;  4LF4 L;  3V96 A;  1XTD A;  5GAD C;  4A3D H;  3C3L A;  1LV9 A;  4BA2 I;  3U58 A;  1RD9 D;  1A62 A;  3SN9 A;  2HIV A;  4DV0 L;  3OPO A;  2RSO A;  4DK0 A;  2HCI A;  3NEN A;  1KAB A;  2NVT B;  4JW0 A;  1AZQ A;  3QB3 A;  5E4W C;  1SE8 A;  4CDF C;  1I94 Q;  3A55 A;  4M8A A;  5FLM H;  4LFB L;  3NTI A;  1DM0 B;  2JE6 I;  4HID A;  3UDG A;  5LL6 X;  1NAP A;  4WGJ A;  4OXP A;  3HOX B;  3HOU H;  2LS0 1;  3WWV A;  1WTV A;  4DR2 L;  2E2I H;  2HCC A;  2NVQ H;  1PRT B;  2AWO A;  2WAQ E;  4L8J A;  5GAE C;  2SDF A;  4EX5 A;  4XYQ A;  4LUZ A;  5KEE A;  4JBM A;  1STY A;  2LXJ A;  4K6D A;  4TRD A;  3K7A H;  3BZC A;  4A3I H;  4DAP A;  1B7Y B;  4A3K B;  5IYC G;  1BR9 A;  1AZP A;  2FXQ A;  2UUC Q;  1E2V A;  3DWQ A;  5C0X J;  1F9R A;  4LAA A;  3S1Q B;  3GTO H;  2DGY A;  3PUW A;  4JI8 Q;  3J81 i;  2KCT A;  3H0G G;  1FNW A;  1STH A;  1K28 A;  5D65 A;  1VCI A;  4L5T A;  2DNC A;  1X55 A;  4EGV A;  1ML0 D;  3GTK B;  1IL8 A;  3L7Z C;  1A3T A;  1A2U A;  4GS3 A;  3JAM L;  2AKW B;  4DUZ L;  2K1B A;  1WOC A;  3MZ5 A;  4ITR A;  3GQB A;  1D1I A;  4NMZ A;  4C3I H;  4DR6 Q;  1Y8P B;  2OXP A;  4APV A;  2Q8T A;  1V1O A;  4DR7 Q;  4C3H G;  4JI5 Q;  2FFK B;  4IN3 A;  3I55 A;  1PV4 A;  5AFW A;  1KDA A;  2D2C C;  2QCP X;  4S3S A;  5CV4 A;  4KI0 A;  1AE3 A;  2F0V A;  4IOA A;  1CFM A;  4CJ1 B;  1H95 A;  5M5X H;  1N33 Q;  3K8A A;  2PZU A;  5IT9 L;  2B63 H;  1IBL L;  4K0K Q;  2F0I A;  1TWC B;  4A3L H;  2D0P A;  1E22 A;  2AUJ D;  4X65 Q;  1OXX K;  4LW1 A;  1HCZ A;  5EKL A;  2EY6 A;  4GOP B;  4KY7 A;  4JG2 A;  4HIO A;  1B9M A;  2KUM A;  2NN6 G;  4F87 A;  2RDG A;  3GTG H;  4YIJ A;  1JJC B;  3I73 A;  2QKI C;  5ELE A;  4F8M A;  3AFQ A;  2IX1 A;  1ROD A;  2OCE A;  3H09 A;  5DLQ E;  5C3E H;  2R7Z H;  1KIX A;  2KHS A;  2XSC A;  5GRO A;  3KF6 A;  4OGQ C;  4GKK Q;  2VY3 A;  4A3M B;  3TS2 A;  2E2D C;  3GTL H;  4AQY Q;  4OEM B;  3DWP A;  2YYZ A;  1VQE A;  1L2F A;  1PH3 A;  1X3P A;  4GOP C;  2QDB A;  5IP9 G;  3QIA A;  2L4N A;  4UP9 A;  2IY5 B;  3FPU B;  4G4K A;  2C35 B;  1TU2 B;  1IW7 C;  2I46 A;  2PQA B;  4X3K A;  1MSG A;  3HOX G;  3K58 A;  1HNX L;  2F0P A;  3S1R H;  5JAV A;  1HA6 A;  2JSO A;  1XXG A;  1I5F A;  4HJA A;  3HOV G;  3R3O A;  4CGY B;  2EY1 A;  5C4J H;  1SJH D;  1X54 A;  1XYI A;  5E4X A;  2F0Q A;  3T16 A;  2I5M X;  1OXT A;  1SNQ A;  1LTR D;  5IGD A;  2WAQ B;  4DFA A;  3TZD A;  4A3L G;  1EQR A;  5KNB A;  4LFB Q;  3GTJ H;  5IY0 A;  2UUB L;  3LET A;  1GO3 E;  2EY5 A;  3CPF A;  2DY8 A;  1F2M A;  3NE5 B;  1Y1V H;  2K33 A;  3EIV A;  4P2C B;  1D1K A;  4DAY B;  4O2D A;  4PNY A;  4HSV A;  4DNT B;  1RF2 D;  1VQJ A;  2A73 B;  4DV4 L;  1BO0 A;  1G8Z D;  4Z9C B;  3T53 B;  1EWI A;  1BDO A;  1VF5 C;  2QEX A;  4GKJ L;  2RA4 A;  1K8G A;  3C1F A;  1PH7 A;  3BG3 A;  2OWO A;  2VW9 A;  3FKI H;  2MP1 A;  1STA A;  3MEF A;  4QMG A;  3SDZ A;  1ICW A;  3AMU A;  1IL2 A;  1TY2 A;  4IJL A;  4ABN A;  4ODG A;  3ERS X;  1W3S A;  2ZXR A;  4FP5 D;  2I0Q A;  1JIC A;  2B63 B;  4B3R L;  1X3G A;  5EBC A;  2MGS A;  1I3Q H;  4GLX A;  4A3B H;  4BBR G;  4K5W A;  2WB1 G;  1ET9 A;  2HQE A;  4DXF A;  1STN A;  3PSI A;  4IO9 A;  5K36 G;  5EGT A;  1HFN A;  3K6O A;  4G7Z C;  3M4P A;  3TP6 A;  4IUN A;  2BA1 A;  2Z6K C;  3KF8 A;  5FJ8 H;  1B2T A;  3MFY A;  4KD4 A;  3K7U C;  2UXD Q;  4DR2 Q;  2F0S A;  2N8N A;  1SSO A;  3F8T A;  1O80 A;  2NUN A;  5C4H A;  1BQQ T;  2XVS A;  3HKZ B;  1UE1 A;  3EJI A;  3R2I A;  4K8J A;  1PZJ D;  2AMC B;  4K8I A;  4IUU A;  2UXB Q;  3J7A 5;  2KED A;  5COY A;  2UUB Q;  2N55 A;  1CKO A;  4JI3 Q;  3JAM i;  2QW7 A;  1VQH A;  4HMJ A;  1GUO A;  1IBL Q;  4CKB A;  3OIP A;  3GTL B;  5C0X G;  2NUC A;  3BDL A;  1AFP A;  4LU4 A;  1ZKO A;  1L1O A;  3KUP A;  1Z9F A;  2F4I A;  1K8M A;  1D5X C;  4RGO S;  4X62 Q;  1X56 A;  1VQO A;  5FOB B;  3TS0 A;  1HNW Q;  5IT9 E;  1KL9 A;  1AEX A;  1PXU A;  1BBW A;  4AIM A;  4ULL A;  2F0F A;  3PCO B;  3GTP B;  1K3B C;  2A6H D;  4P73 A;  3S2H B;  5BR8 L;  3HOV B;  4U0S A;  5KYL A;  2K28 A;  4DV0 Q;  2EYH A;  4QJF A;  5C4J B;  2KHJ A;  3R93 A;  3DMU A;  2BE5 C;  3ZYY X;  1Y1W G;  4XI8 A;  1CM9 A;  1D5M C;  1B8A A;  2NUD A;  1EY5 A;  2IWH A;  5IGC A;  3HP3 A;  2IX3 A;  4IAL A;  2JA5 G;  1VQF A;  1NJI C;  5C4Z A;  3J80 i;  2J4X A;  3A5Z B;  5EJW A;  4OO1 H;  3G4S A;  3AYH B;  1NMF A;  3KFU A;  4MTK A;  1PH9 A;  1SE3 A;  4EQ5 A;  1C8C A;  3OWF A;  3OSO A;  2EVB A;  1QVF A;  2MNA A;  3HKZ E;  1UWV A;  2CKZ B;  3RZD B;  4KK7 A;  2CHB D;  1Q90 A;  3CRL C;  4JCV E;  1RCV D;  1STB A;  4BBS H;  5CBE E;  1JWM D;  3NWT A;  1GD7 A;  2BH2 A;  2DNE A;  3CME A;  4DUZ Q;  1TWF H;  5I9P A;  4L63 B;  4DV3 L;  3CMA A;  2F0G A;  3UDI A;  2DJG C;  2IX0 A;  3IFD A;  2B3G A;  3PIO 3;  1SR3 A;  3BVM A;  4DV7 L;  3J81 c;  1E24 A;  1Z6H A;  5C6A A;  1RHP A;  2Q8I B;  3ER0 A;  4U0Z A;  5I6Y A;  2ASB A;  2RVL A;  3URY A;  2F0D A;  1ASZ A;  3H94 A;  3PO3 B;  1LUZ A;  2D9U A;  3OMG A;  5BN3 A;  4A3G B;  1NY4 A;  3UDF A;  4DV6 Q;  4NXN Q;  1V9P A;  4LFC Q;  1JJ2 A;  3G7L A;  1XPU A;  1X65 A;  2D62 A;  2L1B A;  1CSQ A;  3S24 A;  3CC4 A;  3M4O H;  2ZTC A;  1K0S A;  4DV1 Q;  5LHY 1;  2NYZ D;  1MD2 D;  1H9J A;  2H5X A;  1W6K A;  2VUM H;  4HED A;  2KBN A;  4IPH A;  4H02 A;  4RGM A;  3CU7 A;  2VQE Q;  1E1T A;  3Q24 A;  2B63 G;  2NZO A;  3I4M H;  5A35 A;  3S2H H;  2CW0 C;  4QGU A;  3N6R A;  3S1N H;  1QVC A;  2YTY A;  1GKH A;  5HY6 A;  3UDX A;  4LJZ C;  1B3Q A;  1OXV A;  1HR0 L;  3I4L A;  2K32 A;  1SE2 A;  2NN6 H;  3MFG A;  4DGZ A;  2IPK D;  4A3G G;  2N49 A;  1YHB A;  1NUC A;  4CDE C;  1VQ7 A;  4C3I G;  5IP7 G;  3PF4 A;  1AP0 A;  1F2Z A;  1TWH B;  1CSP A;  1TKW B;  4LF6 L;  1VQN A;  3DLL A;  4IOC A;  4HJ7 A;  4QQB X;  3GP7 A;  4BY1 G;  1A0I A;  2EIF A;  2Z8L A;  2B2T C;  2MUY A;  1VQ9 A;  5IYD G;  2I07 B;  2K01 A;  1PLF A;  1UUP A;  2K5D A;  3LNN A;  3G48 A;  2F0U A;  4C2M B;  3CCV A;  3PO2 B;  2K04 A;  4LF7 Q;  3KDF A;  3HOX H;  3HOU B;  2E2I B;  1UE6 A;  3K57 A;  4A76 A;  2GVA A;  3CKI B;  3H15 A;  5LMN L;  3RZD H;  5JJ6 A;  2L55 A;  1EY6 A;  4R9W A;  1TS4 A;  3C2P A;  3CCM A;  5EQ0 A;  1PYS B;  4JYA Q;  1JB7 A;  3S16 H;  3FP9 A;  1S72 A;  4FNF A;  4G7H C;  3CCL A;  2Q2T A;  3Q0A A;  3SK5 A;  1Q86 C;  4IJH A;  4MN3 A;  1SRO A;  4IUV A;  3QOL A;  1SXT A;  5C4X B;  3E9H A;  4KLK A;  3MVV A;  2K7V A;  2SNM A;  4KJO A;  3M9B A;  4ZQ3 A;  4RCO A;  1HXY D;  1WJJ A;  1DGS A;  4FF2 A;  5M5W H;  3GTK H; 
#chains in the Genus database with same CATH homology
 4WJ3 M;  3NEN A;  2PI2 A;  2RHS B;  4DR5 L;  1WI5 A;  1KQS A;  4B3T Q;  4A3F H;  1YZ6 A;  4A3F G;  2KHI A;  1HZA A;  1XMQ L;  1QVG A;  4A3J G;  1SE8 A;  4P75 A;  2Z6K A;  3F2C A;  1I94 Q;  5FLM H;  4LFB L;  1GM5 A;  2JE6 I;  4HID A;  3UDG A;  5IT9 c;  3GTP H;  3STB D;  4A3C H;  4A3C G;  4WGJ A;  4OXP A;  3HOU H;  3CAM A;  3WWV A;  4JI2 Q;  3N3U A;  2HIX A;  4DR2 L;  2E2I H;  3EN2 A;  3HOY G;  2NVQ H;  2R92 H;  2AWO A;  1S3O A;  2WAQ E;  1EIF A;  5GAE C;  5IWA Q;  2UUA Q;  1Y14 B;  4EX5 A;  4R4C A;  1EIY B;  1N34 Q;  4LUZ A;  4B3R Q;  4JBM A;  2LXJ A;  1SN8 A;  3SHG A;  3K7A H;  1YIJ A;  3BZC A;  4A3I H;  1CUK A;  2K52 A;  3PO3 H;  1B7Y B;  5IYC H;  4DV2 L;  2CWA A;  5IYC G;  2NN6 I;  4MZ9 A;  5IYD H;  2FXQ A;  2JA9 A;  5C0X J;  4YY3 L;  2UUC Q;  4LF7 L;  3ULP A;  3OW2 A;  2N78 A;  3NBH B;  3CC7 A;  3ULJ A;  4DV0 L;  3GTO H;  2DGY A;  3PUW A;  4JI8 Q;  3J81 i;  2KCT A;  3W1B A;  3H0G G;  1XMO L;  1HNZ Q;  1Q8K A;  2A1A A;  1UE5 A;  2NZH A;  4DAM A;  4OWT B;  1VCI A;  4L5T A;  3T1Y L;  1X55 A;  3I4N G;  4AYB E;  2WP8 J;  2NVX H;  2DUD A;  4A3E H;  1E3P A;  1X6O A;  4A3E G;  5LMU L;  4X6A H;  3L7Z C;  3ICE A;  4GS3 A;  2JA8 H;  3GTK H;  1X9N A;  1EQQ A;  4JI1 Q;  2UUC L;  2YU9 H;  2AKW B;  4A3K G;  4JBW A;  2AHO B;  4DUZ L;  4OWX B;  2GVB A;  1WOC A;  2R92 G;  4ITR A;  1W2B A;  4LWC A;  1L0W A;  2JA7 H;  4JV5 L;  4Y52 H;  2ES2 A;  4C3I H;  1HNZ L;  1A8V A;  5C44 H;  4A4I A;  1PH6 A;  4DR6 Q;  2K4K A;  3PIO A;  4LFA Q;  1J5E Q;  3RLO A;  3UE0 A;  4APV A;  1N36 L;  4A93 G;  2JEA I;  5JJL A;  4DR7 Q;  1LYL A;  4JC0 A;  4JI0 Q;  4JI5 Q;  5LMN Q;  1PV4 A;  3I55 A;  1XNQ L;  3CCJ A;  4JI4 L;  3IRB A;  3AQQ A;  1YHQ A;  4KI0 A;  4NXM L;  1AE3 A;  1N8R C;  2JK8 A;  3PUX A;  4JI3 L;  4IOA A;  1SMX A;  3KLW A;  2G03 A;  4FDB A;  1H95 A;  5M5X H;  2HHH Q;  4GN4 B;  1N33 Q;  3CCS A;  3K8A A;  1X3F A;  3STB C;  3ZC7 A;  1D7Q A;  3I7F A;  4AQY L;  1XPO A;  2B63 H;  3S2D H;  4GKJ Q;  1UE7 A;  3D31 A;  1IBL L;  3PUV A;  4K0K Q;  1L1O B;  4A3L H;  1VQ5 A;  1N32 L;  2A19 A;  2UUA L;  1C0A A;  2UXC Q;  1O7I A;  2D0P A;  1I6H H;  1E22 A;  4XIG S;  4X65 Q;  4A3B G;  1OXX K;  1EUJ A;  2I5H A;  2JA8 G;  1C7Y A;  4LW1 A;  4BY7 G;  1QZH A;  2EXD A;  2VL6 A;  4UY8 C;  4GOP B;  1FGU A;  1TXY A;  1I94 L;  1K83 H;  5C44 G;  4A3D G;  1IYJ B;  2R7F A;  4JG2 A;  4HIO A;  4IFD G;  2NN6 G;  3I56 A;  5CMT A;  4GKK L;  2VZA A;  3GTG H;  2E5L L;  2IHE A;  3H3V H;  4X2E A;  5M3F H;  2Z0S A;  4B3T L;  1YHA A;  1JJC B;  1NMG A;  4C3H H;  4UPA A;  3H0G H;  4POG A;  1OXS C;  5IP7 H;  3AFQ A;  2IX1 A;  3J81 j;  3SE5 A;  2WAQ G;  1VQA A;  4X64 Q;  2OCE A;  3BJU A;  4DR1 L;  2ALY B;  5DLQ E;  5C3E H;  1KIX A;  2R7Z H;  5C3E G;  5AJ3 Q;  4DV5 L;  1L1O C;  4OO1 G;  2F6S A;  4QIW E;  5JFZ A;  2UU9 L;  5GRO A;  3KF6 A;  4GKK Q;  2XTI A;  2VY3 A;  1TWG H;  5FLM G;  3TS2 A;  2ZTD A;  3GTL H;  1TWA H;  4AQY Q;  1Q46 A;  2LSS A;  4U04 A;  2YYZ A;  1VQE A;  1L2F A;  4IPD A;  1PH3 A;  1IZ6 A;  3RN2 A;  1S40 A;  1PYB A;  4GOP C;  4JI8 L;  4ME3 A;  1RIP A;  5IP9 G;  4UP9 A;  2IY5 B;  1CKN A;  1HJP A;  4R4O A;  1U0L A;  4A93 H;  5IYB G;  4DV2 Q;  3NEM A;  4GNX A;  3M7N A;  2C35 B;  3U4V A;  4A3J H;  1MIU A;  2PQA B;  2ZJR A;  3HOX G;  4DR3 L;  1HNX L;  2Q2H A;  3S1R H;  4B3S L;  4U0U A;  2VNU D;  3PUZ A;  1Q81 C;  1I5F A;  2QGQ A;  4HJA A;  2MO1 A;  4A3M G;  1BKB A;  3B6Y A;  4UP8 A;  1VQ8 A;  3HOV G;  2YV5 A;  3CCU A;  5JFF A;  1E7Z A;  5C4J H;  1X54 A;  4OON A;  2I5M X;  3SGI A;  4GN5 A;  1PH5 A;  1OXT A;  3DM3 A;  1FJG L;  2R7Z G;  4BXX G;  1EYG A;  2R93 G;  3J7Z C;  3L0O A;  2E8G A;  2QA4 A;  4DV7 Q;  1FL0 A;  1N36 Q;  3OTO Q;  4A3L G;  4DV4 Q;  1EQR A;  4QL5 A;  5JEA J;  5H1S E;  3GTJ H;  5IY0 A;  4LFB Q;  2UXB L;  4DUY L;  2UUB L;  3LET A;  1GO3 E;  3W1G A;  1LM0 A;  3CPF A;  4JI4 Q;  4B3S Q;  1Y1V H;  3EIV A;  4LF5 Q;  4DAY B;  4O2D A;  2ID0 A;  1BBU A;  5BR8 Q;  4YWL A;  4RMF A;  2NVY H;  2JA7 G;  4LUO A;  5IP9 H;  1N9W A;  1XMO Q;  4O0A A;  3BZK A;  1VQJ A;  3A0J A;  4DV4 L;  1CKM A;  4PZ8 A;  1EWI A;  2QEX A;  4KHZ A;  4GKJ L;  1D8L A;  1UEB A;  1YNX A;  1PH2 A;  1K8G A;  1PH7 A;  2OWO A;  4N67 A;  2VW9 A;  3FKI H;  1G6P A;  4ALP A;  1XPR A;  2K14 A;  3MEF A;  5ELN A;  4LF8 L;  2K5V A;  4NPS A;  2PI2 E;  1Q82 C;  1IL2 A;  1VQD A;  4LF9 Q;  1VQ6 A;  4AH6 A;  4IJL A;  1FVI A;  3M85 A;  4YCU A;  4JI6 Q;  3PO3 G;  5J3B A;  2VQE L;  1VQB A;  4WJ4 A;  1NBW A;  3ERS X;  5EU0 A;  1M90 C;  1G29 1;  4DR4 Q;  1W3S A;  3EBE A;  4U07 A;  1AE2 A;  3I4O A;  2Q2I A;  4P74 A;  2GN5 A;  2JQO A;  2JA6 G;  2I0Q A;  1VQI A;  5C4X G;  4JBJ A;  4B3R L;  5CKL A;  2E2J H;  1X3G A;  2BH8 A;  1YJN A;  3BU2 A;  4JI6 L;  1I3Q H;  4GLX A;  3U50 C;  4A3B H;  4BBR G;  3T1H Q;  3CF5 A;  3HKZ G;  2WB1 G;  1OTC A;  1HNW L;  4IFD I;  2A8V A;  1E1O A;  5FLX c;  4X64 L;  2HT1 A;  1K9M C;  3PSI A;  2MQH A;  3PO2 H;  4IO9 A;  5K36 G;  3HOW G;  3M4P A;  3TQY A;  2UU9 Q;  2BA1 A;  2Z6K C;  3FHW A;  5FJ8 H;  4GNX B;  4A3G H;  3PV0 A;  1TWC H;  3I4N H;  3K7U C;  2UXD Q;  4DR2 Q;  2R6G A;  2N8N A;  2YTV A;  3F8T A;  5M5Y H;  4MNO A;  3F2B A;  3T1Y Q;  1N32 Q;  5LMN W;  4YWK A;  5HGQ A;  1UE1 A;  4MTN A;  5EAY A;  2OQ0 A;  2AMC B;  3E0E A;  2R93 H;  4DV1 L;  2UXB Q;  3J7A 5;  4A3K H;  4DUY Q;  2UUB Q;  2Y0S E;  4DR5 Q;  2HQL A;  2KEN A;  1CKO A;  3KDF B;  3KJO A;  4JI3 Q;  5JJI A;  3JAM i;  4JI7 Q;  1VQH A;  3AFP A;  3CP0 A;  1KC8 C;  1IBL Q;  3MXN B;  2WFW A;  5M3M H;  5C4X H;  4YHH Q;  1IBK Q;  1EOV A;  3CCE A;  5GQO A;  5C0X G;  2ATW A;  4LU4 A;  4BY1 H;  1L1O A;  4DR7 L;  1Z9F A;  5GAG C;  2JEB I;  4P71 A;  1Q1E A;  4X62 Q;  4BBR H;  3H3V I;  1X56 A;  5IYB H;  1VQO A;  1AH9 A;  1WCM H;  3TS0 A;  3T1H L;  1HNW Q;  1PH8 A;  1KL9 A;  1BBW A;  4AIM A;  3CD6 A;  1SFO H;  3HOW H;  1YEZ A;  4GOP A;  4JI7 L;  3RZO H;  3PCO B;  3G71 A;  2CCZ A;  4R1J A;  4OX9 Q;  2B29 A;  1QUQ B;  1YJW A;  2CWP A;  4P73 A;  1IBK L;  3AEV A;  5BR8 L;  1P16 A;  4U0S A;  2N3S A;  2JJQ A;  4LF5 L;  1LTL A;  4DNI A;  2VQF Q;  3K81 C;  4QJF A;  2YTX A;  4DV0 Q;  2EQS A;  4TVA B;  2KHJ A;  1J5E L;  1NTG A;  4BXX H;  4HJ9 A;  3CCR A;  1MKH A;  4XI8 A;  3PF5 A;  1Y1W G;  1HR0 W;  1B70 B;  1B8A A;  4P72 A;  4X65 L;  1VQM A;  1JMC A;  4X66 L;  4BBS G;  4JV5 Q;  1JT8 A;  3K80 C;  4Y7N H;  3ZLM A;  1KD1 C;  3E9I A;  5M3F G;  2F4V L;  1YJ9 A;  1Z47 A;  1VQG A;  1WYD A;  2JA5 G;  1VQF A;  4GLA C;  3PIP A;  3NEL A;  3J80 i;  1NJI C;  3A5Z B;  2I5L X;  4X62 L;  4DV3 Q;  2E5L Q;  2R7D A;  3G4S A;  3AYH B;  1NMF A;  5IWA L;  2ZTE A;  1RL2 A;  3KFU A;  4NXM Q;  4RG1 A;  1EFW A;  1VQ4 A;  4DPG A;  1PH9 A;  4HJ5 A;  4HIM A;  4EQ5 A;  4DK6 C;  2HHH L;  4JI5 L;  4JI0 L;  1V1Q A;  1VQC A;  3KF6 B;  3S1M H;  1SRU A;  1QVF A;  3HOY H;  2MNA A;  2OTJ A;  3HKZ E;  4L5R C;  1UWV A;  1YVC A;  2CKZ B;  4YY3 Q;  4LNQ A;  4DR6 L;  1NE3 A;  1KRS A;  4DK3 C;  2ZJQ A;  5CGL A;  4HJ8 A;  1R9T H;  4OWW B;  4NXN L;  3CQZ H;  4B3M Q;  2RF4 A;  4JI2 L;  1N34 L;  3HFZ B;  4IFD J;  4JCV E;  2L15 A;  4X2C A;  3RR5 A;  2CQO A;  3GDE A;  4BBS H;  3TEH B;  1KAW A;  1GD7 A;  1HNX Q;  2BH2 A;  3A5U A;  2E2H H;  4XTC S;  3S14 H;  4A3M H;  3HOZ H;  3CME A;  4DUZ Q;  1T9H A;  4C3J H;  1TWF H;  4JI1 L;  3D0F A;  2VUM G;  1IBM Q;  3PO2 G;  1Q12 A;  4R4Q A;  2V1C C;  2XGT A;  3CMA A;  1Y1V G;  4DV3 L;  1U5K A;  3RNU A;  1WFQ A;  3UDI A;  1M1K C;  1VQL A;  4A75 A;  1JE5 A;  2IX0 A;  4LFA L;  2JA6 H;  3ZCB A;  4PZ6 A;  2B3G A;  2BA0 A;  3CW2 C;  1FJG Q;  4J15 A;  1PFS A;  3OYY A;  4BA1 I;  3J80 c;  4DV6 L;  1SR3 A;  4DV7 L;  2NVT H;  3J81 c;  1E24 A;  4KHP Q;  1K0R A;  2MFI A;  3PGZ A;  4L5S A;  3RLN A;  1QUQ A;  4M16 A;  1HZB A;  1OXU A;  1XJV A;  5JEA G;  3KF8 B;  3ER0 A;  4U0Z A;  3JAM c;  4X66 Q;  2AWN A;  3CCQ A;  4A3I G;  2ASB A;  3S15 H;  5LMU Q;  1ASZ A;  1LUZ A;  1PH4 A;  2RCN A;  1KRT A;  3ZJY C;  1HZC A;  1NY4 A;  2ZM6 L;  2OTL A;  1XNR L;  3GTQ H;  4DKA C;  2F3I A;  3UDF A;  4DV6 Q;  4NXN Q;  1V43 A;  1V9P A;  1QZG A;  5JJ7 A;  4YCV A;  4LFC Q;  1YIT A;  1J6Q A;  1TWH H;  3KOJ A;  1JJ2 A;  3TRZ A;  3S1Q H;  3TRE A;  1XPU A;  1X3E A;  1X65 A;  2D62 A;  3GO5 A;  2IHF A;  4PZ7 A;  1CSQ A;  2K75 A;  4LUV A;  4R4T A;  1HZ9 A;  4PMW A;  4AYB G;  3Q8D A;  2Q2U A;  3I2Z A;  3M3Y H;  2UXC L;  4PG3 A;  1VS0 A;  3S24 A;  5C0X I;  3CC4 A;  4LF6 Q;  3M4O H;  2ZTC A;  1VQK A;  4DV1 Q;  3HOZ G;  3W5O A;  4LF9 L;  4C2M H;  4TQU S;  4LF8 Q;  2H5X A;  3GTM H;  2VUM H;  1C9O A;  1G51 A;  5IE8 A;  2F52 A;  1Q1B A;  2KBN A;  1MJC A;  4IPH A;  1MJE A;  4H02 A;  1PA6 A;  1KHI A;  5M3M G;  3JC6 6;  2KCM A;  2VQE Q;  1E1T A;  2IT1 A;  2K5N A;  3LGJ A;  2B63 G;  2NZO A;  1K8A C;  3I4M H;  3I4M G;  4JOI C;  3GD7 A;  4YCW A;  3S2H H;  4QGU A;  1N33 L;  2F4V Q;  3KYH C;  4GN3 B;  3S1N H;  1SLJ A;  1QVC A;  2Y0S G;  2YTY A;  3RLF A;  1GKH A;  1VQP A;  5HY6 A;  4IPG A;  3UDX A;  1XMQ Q;  1KXL A;  4R4I A;  2RHQ B;  5AJ3 L;  1OXV A;  4DV5 Q;  3RN5 A;  1HR0 L;  2MO0 A;  2ZJP A;  2PMZ E;  4LFC L;  3F2D A;  1I50 H;  3HOU G;  4JBK A;  3CC2 A;  5FJ8 G;  4A3G G;  2N49 A;  2ZM6 Q;  1XNR Q;  1YHB A;  3HOV H;  4LF4 Q;  1VQ7 A;  3K0X A;  2D0O A;  4NB3 A;  4QY7 A;  4YWM A;  2OQK A;  2JA5 H;  5IP7 G;  3CXC A;  2PQA A;  3PF4 A;  2UXD L;  4DR4 L;  1CSP A;  1VQN A;  4LF6 L;  4X2D A;  3L2P A;  4L5Q A;  1GVP A;  3DLL A;  3OTO L;  4IOC A;  4DR1 Q;  1PVO A;  1A63 A;  4HJ7 A;  4QQB X;  4BY1 G;  3HKS A;  1A0I A;  2K50 A;  3KJP A;  2EIF A;  2VS1 A;  4PY3 A;  4DR3 Q;  1Q7Y C;  1VQ9 A;  5IYD G;  2LXK A;  1HH2 P;  3G48 A;  3CCV A;  4OX9 L;  3S17 H;  4JYA L;  1WCM G;  4LF7 Q;  3U4Z A;  3KDF A;  5JJK A;  2CFM A;  3HOX H;  4B3M L;  4JOI A;  4YHH L;  1UE6 A;  4A76 A;  2GVA A;  5LMN L;  3H15 A;  3CPW A;  3RZD H;  1XNQ Q;  5ELO A;  5JJ6 A;  2K5H A;  1JJG A;  1BVS A;  1P8L A;  4POF A;  3CCM A;  1CKN B;  3UE1 A;  1PHJ A;  3A74 A;  1PYS B;  3FKI G;  4JYA Q;  3PUY A;  4UP7 A;  4HIK A;  1JB7 A;  1HR0 Q;  3S16 H;  3FP9 A;  1S72 A;  4BY7 H;  5GAH C;  3G6E A;  4K0K L;  3CCL A;  2Q2T A;  1PH1 A;  1YBY A;  1IBM L;  1ASY A;  4GNX C;  3S6A A;  4LF4 L;  1Q86 C;  4IJH A;  4KHP L;  1IXR A;  1SRO A;  1XTD A;  3M4Q A;  5GAD C;  4A3D H;  5E7N A;  3ULL A;  3E9H A;  4KLK A;  3CUC A;  2PNH A;  4BA2 I;  3U58 A;  3M9B A;  1A62 A;  2WB1 E;  3VDY A;  1YI2 A;  1WJJ A;  3F1Z A;  4OO1 I;  3SN9 A;  1DGS A;  2HIV A;  4IPC A;  1K73 C;  1Y1W H;  1K3R A;  5M5W H;  2VQF L;  4GLV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...