2VY3A

Type iv secretion system effector protein bepa
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
291
structure length
291
Chain Sequence
b'EIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCSHDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMPEMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHPFREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDISNPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYIIGNIDHLPPEQLKILKPGDKITFTAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL FILAMENTATION PROTEIN
publication title Fic Domain Catalyzed Adenylylation: Insight Provided by the Structural Analysis of the Type Iv Secretion System Effector Bepa.
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Cell adhesion
total genus 86
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 2vy3A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vy3A02
1J6QA 2LSSA 1HR0Q 2OTJA 3CCQA 4JI8Q 5FLMH 5LMNQ 1UWVA 1VQMA 2JA6G 2QA4A 4DAMA 2UU9L 2UXBQ 4P73A 2E2HH 3TREA 3JC66 2UUAL 2UUCQ 4NXNQ 2BH8A 1OTCA 3HOUG 2NZOA 4FDBA 2I5LX 4BBRH 4QGUA 1Y1VH 3ULJA 1PH8A 1PYSB 3UDIA 3PCOB 2E2IH 2I5HA 3HKSA 4HIKA 1CSQA 5IP7H 4IPHA 3ZJYC 4JBJA 4C3JH 4GNXB 3CD6A 1HR0W 4IOAA 2C35B 1G6PA 3RLNA 4LFCL 5LMNW 1MJEA 1JB7A 1PFSA 3K80C 4WGJA 4LFBQ 2MNAA 5JJLA 1HJPA 2IX1A 1YITA 1JE5A 1XNQQ 4X64Q 1VQOA 1L2FA 1R9TH 2A1AA 3CC7A 4LFAL 5JJKA 4C2MH 3S2HH 4A3FH 1N34Q 3KJOA 2I0QA 4DV2L 3CC4A 2NVXH 1VQBA 4HJ9A 1IBKL 4A3GG 1A0IA 1E1TA 3F8TA 3KOJA 4YHHQ 4P72A 4JI7L 1HNXQ 2K52A 4GOPB 1A63A 3HOYH 4DR7L 3S6AA 1W3SA 2Y0SE 1GO3E 1RL2A 2H5XA 4TQUS 1XNRQ 4DV4Q 3W1BA 5C0XI 3UE0A 5C4XH 1JJCB 5C0XJ 2N49A 1D8LA 1L0WA 4DV1Q 3HKZE 4P71A 4BBSG 4IJLA 3D0FA 3T1YL 4GKKL 1TWFH 1K83H 5M3MG 1HR0L 1UEBA 1HNWL 4U0UA 4JI8L 5LMNL 4WJ3M 4DK3C 4OXPA 3J80c 1NJIC 4YWMA 3S16H 1QVCA 1TWHH 4DK6C 1VQIA 3M9BA 4NXNL 2UUCL 2KHIA 2JA9A 5DLQE 2XTIA 5HGQA 1U0LA 2AMCB 3I4MH 3L2PA 2KCMA 1X3FA 2WB1E 4H02A 1PH7A 4JBKA 1VS0A 4NB3A 2ZJRA 4A4IA 3A5UA 4EQ5A 2JA7G 2IY5B 1YVCA 4A3JH 3I2ZA 4X2EA 5FLMG 3ERSX 3M85A 2FXQA 5GAEC 3F2CA 1YJNA 1C0AA 4BXXH 3U4VA 5BR8Q 2EQSA 1VQEA 2D0PA 1B7YB 3NELA 1I3QH 4DV7L 5AJ3Q 1VQCA 2UXCL 1WI5A 4MTNA 5GADC 5LMUL 1P8LA 4BBRG 1NTGA 1Y1VG 4A3EH 1JT8A 4GLAC 1A8VA 3I7FA 1XNQL 1BBUA 1FJGL 4X64L 2ZJQA 2AWNA 5C0XG 3I56A 3BU2A 5IP7G 1YZ6A 2I5MX 4M16A 1N34L 5JJ6A 4OO1I 1SROA 3G4SA 3CCMA 1UE1A 1BBWA 3W1GA 3CC2A 1KHIA 1KL9A 4YCVA 1PH6A 2Q2TA 1VQKA 4YHHL 4LF5L 4X65L 4B3SL 1HNXL 2OCEA 1EWIA 2E8GA 3MXNB 5GQOA 2F52A 2HIXA 1WYDA 1XNRL 2JEAI 1S40A 3A74A 1PVOA 3KF6B 5M5XH 3I55A 3TS2A 4A3FG 4PZ7A 3FKIH 2R7FA 1CKMA 3E9HA 1SFOH 2YYZA 4DV1L 3BZCA 4A3LH 1YJWA 5K36G 1GD7A 1E1OA 1VQLA 1Y1WH 1XPUA 3PUZA 3Q8DA 5IP9H 3J81j 2L15A 4ALPA 1P16A 3HOYG 4JV5Q 2ZTCA 3EN2A 1YJ9A 1Q8KA 3LGJA 1C7YA 4JCVE 4KHPQ 2K4KA 4DUZQ 1N32L 4JI4L 5EU0A 5C4XG 4C3HH 5IYDH 4GN3B 4IFDI 3GO5A 2DUDA 1KIXA 1KXLA 4GNXC 3H0GG 3PUXA 2ES2A 4GNXA 3GTMH 3AYHB 3DM3A 3CCUA 4NPSA 1CKNA 1KC8C 2CWPA 1YIJA 2CCZA 2K5VA 3F2DA 4OO1G 4LUZA 1EIFA 2RHQB 3DLLA 1GM5A 5M5YH 3ULLA 5BR8L 1K73C 2E2JH 2VNUD 5AJ3L 2MFIA 4YCWA 4GKKQ 3GDEA 2R6GA 4AQYQ 2VS1A 4QY7A 4LWCA 3GTKH 1SMXA 3S24A 3M4QA 1HNWQ 1K8AC 4R4QA 4IOCA 3A0JA 3HOVG 2KENA 1W2BA 4A3IH 1V1QA 2VQEL 3EIVA 3K0XA 4BY7H 4BXXG 4HJAA 2N3SA 3M4PA 1SR3A 2QEXA 4A3BH 3BZKA 4POFA 3HOWH 2N8NA 3VDYA 3E9IA 3AQQA 2ID0A 4X2CA 3PUWA 4KI0A 3PO3H 4L5SA 2OQ0A 3GD7A 4R1JA 2R7DA 4A3MH 3JAMi 3HOXG 1VQ8A 3B6YA 4DR6L 1PH9A 1TXYA 4L5TA 4R4TA 4B3TL 4LF4Q 3WWVA 4DV7Q 2UXCQ 4IFDG 1BVSA 5GAHC 1PH2A 5LMUQ 4UP9A 4MNOA 1FL0A 5IYBG 4A76A 1YI2A 1PA6A 1M90C 3K7UC 2JA8H 3I4NG 3GTJH 3CMAA 4HIDA 1FJGQ 3KYHC 4JBMA 4JI6Q 5M3FH 2VL6A 2DGYA 4JC0A 3CCJA 2F3IA 2MO0A 1XMOQ 1XPRA 4POGA 2Z0SA 4JV5L 3HOZG 3EBEA 4KHPL 3CCRA 4U0ZA 4DUZL 1K8GA 4A3KH 3W5OA 4U04A 1L1OB 4BY1G 3FKIG 4XTCS 4LF9Q 3K8AA 4A3CG 4LF5Q 4X65Q 4B3SQ 4X62Q 3ER0A 1Q81C 1Y1WG 2PNHA 2IHEA 4LW1A 5CGLA 1KRSA 1V43A 4AH6A 1VQ6A 1QUQB 3RLOA 4PG3A 1WJJA 2BA0A 3S1RH 2JEBI 4L5RC 4JI5L 3UDGA 2R92G 4AQYL 4U0SA 4A75A 4AYBE 2ATWA 1XTDA 3G71A 1O7IA 2V1CC 1DGSA 1IBLQ 2GVBA 1PYBA 2BH2A 1EYGA 3AEVA 2MQHA 2ZJPA 1N32Q 2B29A 4JI4Q 1VQHA 2VUMH 4LFCQ 2UXDL 1EUJA 1PH5A 3KDFB 1GVPA 1GKHA 1X65A 4APVA 4LUOA 3FHWA 2UUBL 4IPGA 2ZTDA 2QGQA 4A3DG 1VQGA 1QZHA 3KF6A 3J81i 1VQDA 2CFMA 5IYCH 1CUKA 2PI2E 4PZ6A 1VQPA 1EIYB 4P75A 4QQBX 4A3IG 3OTOQ 4DR1L 4O2DA 4LF4L 1ASZA 4IPDA 1WFQA 3PGZA 3CF5A 4BY7G 4JOIA 3PSIA 2YV5A 3GTQH 3NEMA 4A3BG 1YHQA 3PUYA 1S72A 5FJ8H 2B63H 1VQ9A 3ZC7A 1E22A 3ZCBA 1FGUA 5IWAL 4JI6L 1XMOL 1FVIA 4L5QA 4GLXA 3N3UA 1RIPA 2G03A 2VQEQ 4DV0Q 4A3MG 2HHHQ 4MZ9A 1YNXA 1VQAA 3KLWA 2NN6I 1J5EQ 4X2DA 4J15A 4GKJL 2VY3A 3S2DH 2JA6H 1I5FA 4LF9L 1IBML 4K0KL 4DR3Q 3PF5A 2ALYB 2R93H 1V9PA 2VQFQ 3BJUA 2IT1A 1Z47A 3HOUH 1VCIA 2GVAA 4X62L 2NZHA 1XPOA 5M3FG 4UY8C 4DR6Q 2HQLA 4B3RL 4AYBG 4KLKA 1VQ5A 4B3TQ 1LYLA 2VZAA 4YY3Q 2F6SA 1Q12A 2B3GA 1IL2A 1H95A 5FLXc 2EXDA 4XI8A 3CPFA 2A8VA 3U58A 1Q86C 5JEAG 1M1KC 2NVQH 2Q2HA 2R7ZH 4Y7NH 2LXKA 3G48A 2KBNA 1TWCH 4DR2Q 1IBLL 4QIWE 3M7NA 4AIMA 3ICEA 3E0EA 4PMWA 3STBD 1X3EA 1QZGA 4B3MQ 5JFZA 3AFQA 4JI1Q 1U5KA 1NMFA 4IO9A 1TWGH 2GN5A 1PV4A 4PZ8A 2RCNA 1NBWA 4IFDJ 4BA2I 3S1QH 4NXMQ 2YTYA 2ZM6Q 1WOCA 3UDXA 3LETA 2F4VQ 3S1NH 1D7QA 3FP9A 2CWAA 2RF4A 1UE7A 1T9HA 2NN6G 4GN5A 3CUCA 5ELNA 3OTOL 2VUMG 4JI5Q 2CKZB 3I4MG 1MKHA 2D0OA 1AE2A 1OXTA 1TWAH 1X54A 2JK8A 2BA1A 3S1MH 1AH9A 4HJ5A 4DV6Q 4BBSH 4A3JG 2NVYH 1L1OA 4GLVB 4R4IA 2LXJA 3A5ZB 5IYCG 4DV0L 2HHHL 1YHBA 4DNIA 2PMZE 4GOPC 4JI0L 4OX9L 4GOPA 2K14A 4JI2L 2UXDQ 1J5EL 2A19A 1QVFA 4GN4B 4R4CA 4JG2A 3H3VH 2UUBQ 1MJCA 1PH1A 2Z6KC 2Z6KA 4DR3L 4A3EG 1N8RC 2HT1A 2VQFL 3GTGH 3UDFA 3GTLH 1QUQA 4EX5A 4DV5Q 5ELOA 3IRBA 1B8AA 2IHFA 3KF8B 4DR5Q 3L0OA 4DR1Q 1I6HH 5HY6A 3RN2A 1E7ZA 4YY3L 4JYAQ 2JA7H 2WP8J 3PUVA 2E5LQ 1I50H 4YCUA 3L7ZC 1SRUA 2OWOA 4TVAB 5JJIA 2YTVA 2ZTEA 3F2BA 1X56A 5JFFA 3CAMA 4LNQA 4HJ8A 3ULPA 1HNZQ 5IWAQ 2R93G 1PH3A 3SE5A 4DR2L 4LF7L 3ZLMA 4LF8L 3S17H 4R4OA 1X6OA 1OXVA 3KDFA 4DPGA 4B3ML 4GKJQ 4UP8A 1K3RA 4JI1L 5J3BA 1SN8A 3TQYA 1KD1C 1IBMQ 4K0KQ 4QJFA 3M3YH 2EIFA 4A3LG 2PQAB 5IY0A 1JMCA 5GAGC 2ZM6L 1OXXK 4NXML 3H3VI 2R7ZG 3T1HQ 2F4VL 3TS0A 1NY4A 1QVGA 3CQZH 4N67A 1CKNB 4UP7A 5IP9G 3JAMc 4B3RQ 5IT9c 3M4OH 1EOVA 3PIOA 1VQFA 1N36Q 4DKAC 1NE3A 1Y14B 1X9NA 2OTLA 5IYDG 3PF4A 3PIPA 2AHOB 2K50A 1MIUA 3RLFA 3J80i 1HZBA 5H1SE 3SHGA 1LTLA 4YWKA 3G6EA 1VQ7A 2KHJA 4DV6L 4PY3A 3I4OA 1PHJA 3RN5A 1EFWA 2AKWB 4OWTB 4X66Q 3PO2H 1IYJB 4DR4Q 1XMQQ 4DUYL 2JA5H 4WJ4A 1K9MC 2Q2UA 3S15H 1N9WA 4RG1A 4HIOA 1HZ9A 4UPAA 3STBC 4HIMA 1SLJA 5C3EH 5JEAJ 3F1ZA 1UE6A 2HIVA 4DV5L 4RMFA 1LUZA 1IZ6A 1VQNA 4LF6Q 4DR5L 4HJ7A 5C44H 2K5HA 1N33L 3H0GH 4DAYB 1EQQA 1JJ2A 1CSPA 3K7AH 4JYAL 4JOIC 2E5LL 1E24A 3RZDH 2JJQA 3OW2A 1Q82C 2UXBL 3HOWG 2N78A 1KQSA 2OQKA 3NBHB 1VQ4A 1HNZL 5CMTA 5JJ7A 3PO3G 3TEHB 3CPWA 4JI3Q 2KCTA 1WCMH 1X55A 3AFPA 1KRTA 3SN9A 4LUVA 2VW9A 4JI0Q 4JI2Q 4OX9Q 2D62A 1YHAA 4ME3A 2CQOA 3RNUA 3HOVH 1B70B 2WAQE 4DV3Q 4BA1I 2JA8G 3K81C 3HFZB 3T1HL 1I94Q 1JJGA 3J81c 3H15A 1UE5A 4P74A 2AWOA 4LU4A 3CCVA 4KHZA 4LFBL 1N36L 5C4JH 4ITRA 1SE8A 4OWXB 4A3KG 1G51A 3CP0A 3RR5A 3HOXH 2NVTH 2UU9Q 3D31A 1CKOA 5M5WH 3UE1A 2ASBA 3J7A5 1Z9FA 2WFWA 3CW2C 2JQOA 2UUAQ 1S3OA 4QL5A 2Y0SG 3CXCA 4LF7Q 4LF8Q 1YBYA 4OWWB 3SGIA 4A93H 5IYBH 3U4ZA 3I4NH 1C9OA 1PH4A 5IE8A 1KAWA 3CCLA 4X66L 3OYYA 1ASYA 4DR4L 3HKZG 1XMQL 1HH2P 3KJPA 1XJVA 1LM0A 3HOZH 3GTOH 4JBWA 5CKLA 3MEFA 4DV4L 4X6AH 3PV0A 2RHSB 3NENA 4O0AA 4BY1H 1YEZA 5EAYA 1IXRA 4C3IH 1X3GA 3CCEA 3S14H 4A3CH 4A3GH 3U50C 4LF6L 1E3PA 1G291 1AE3A 1OXUA 3PO2G 2JA5G 2Q2IA 4LFAQ 4XIGS 1OXSC 1Q1EA 2WB1G 1EQRA 1NMGA 1A62A 3TRZA 3RZOH 4A93G 1BKBA 4DV2Q 5C3EG 2PI2A 1HZAA 1VQJA 1L1OC 2WAQG 1IBKQ 2R92H 1Q1BA 1HZCA 4JI3L 4JI7Q 4GS3A 2K75A 3CCSA 5M3MH 5C44G 4DUYQ 2PQAA 4DR7Q 1K0RA 4IPCA 3KFUA 2IX0A 2K5NA 4YWLA 3J7ZC 1Q7YC 4DV3L 2JE6I 3GTPH 4OONA 5FJ8G 4IJHA 3CMEA 2B63G 5E7NA 1Q46A 1I94L 2YU9H 2XGTA 2MO1A 4U07A 5GROA 1N33Q 2YTXA 3T1YQ 4Y52H 4A3DH 1WCMG
chains in the Genus database with same CATH superfamily
1J6QA 2CQAA 5KNDA 1ET6A 4JI8Q 5C4HA 5LMNQ 3A8JE 2JA6G 1SE4A 4DAMA 4FF2A 1EEFD 2E2HH 3TREA 2UUCQ 2BH8A 3HOUG 2F0HA 4QGUA 1FD7D 1CA6A 3ULJA 2E2IH 3PCOB 5D14A 4ZQ3A 2D2CC 1CFMA 1PZID 4IPHA 5FLXL 4JBJA 4GNXB 4IOAA 1G6PA 3VR4A 5HURA 4DAYA 5LMNW 1ZKOA 2F0MA 1HJPA 1LTTD 5LL6S 3T13A 4X64Q 2XIWA 4RKBA 2A1AA 5D3IB 5JJKA 1DD2A 5CV6A 2Q8IB 3K57A 3S2HH 2RDGA 5EKIA 1DCZA 3J7AF 2B8FA 1E1TA 4YHHQ 1S5FD 4P72A 1K0SA 2K52A 1A63A 3WOEA 1W3SA 2LFNA 1SJED 1LT5D 2H5XA 3KLSA 1QILA 4J8QA 1D8LA 4KJOA 1L0WA 3HKZE 4P71A 1AFPA 4BBSG 1MHWC 3D0FA 5CORA 1DOLA 1TWFH 3P7JA 1HNWL 4U0UA 4WJ3M 4DK3C 3S16H 4G7ZC 4DK6C 3NPPA 4WORA 1EU3A 1R4QB 5HGQA 2AMCB 2CVRA 1FGBD 2WB1E 1PH7A 4JBKA 5I4DA 2JA7G 1YVCA 4H0LC 3M85A 4FP5D 5GAEC 2HUGA 4Y7NB 3F2CA 4Q5VA 1TWCB 4BXXH 3U4VA 4C56C 4DV7L 1I3QH 5AJ3Q 4JK1C 2UXCL 2NUCA 4B9WA 2NUDA 3KBXA 4IUVA 4MTNA 5GADC 4A3EH 2EJGC 1TVXA 3I7FA 2ZXRA 3S1QB 3FRPB 3HZXA 1YZ6A 2DY7A 3T4AC 4M16A 5JJ6A 4OO1I 2BE5D 3G4SA 5IGCA 1PDQA 3W1GA 4G7HC 2LMCB 4YCVA 1PH6A 3CC2A 4BS9A 1VQKA 4QF4A 4X65L 1HNXL 2OCEA 3H94A 3TZDA 1D5MC 1WYDA 1D1IA 1XNRL 2JEAI 1S40A 3KF6B 3E9HA 4DV1L 1YJWA 3E5SA 3MTSA 2F0GA 3EN2A 3OWEB 3I3CA 2HCCA 1YJ9A 2K4KA 4JI4L 3MFGA 1CQVA 3R93A 2K5QA 1I6HB 1KIXA 2HDLA 4ZLTF 3G7LA 3H0GG 3GTMH 1ZYRD 2CWPA 1YIJA 4K5VA 3K6OA 1GM5A 3E6ZX 5BR8L 1K73C 2KCNA 1G2TA 1GXDC 1XX8A 1AP0A 2NZ1D 4LWCA 1SMXA 1K8AC 3BYTB 4DA2A 3A0JA 3HOVG 1W2BA 2Y0SB 4LAAA 2VQEL 3KLRA 3EIVA 3CQZB 2NUNA 4BY7H 4BXXG 1SR3A 3A8IE 4JVZA 3HOWH 2PNRC 3AQQA 2ID0A 1E0BA 2B2YA 3MWYW 3GD7A 1QJOA 3HOXG 1VQ8A 4DR6L 4ULLA 1SYFA 4IFDG 1PH2A 1CHQD 1SXTA 5IYBG 3A56A 1XYIA 2JA8H 1V1PB 3K5NA 4JI6Q 2ATWA 2VL6A 3CCJA 3X3MA 2MO0A 1XPRA 1U9RA 4HTHA 1W6JA 4FF1A 1U4LA 4LF5Q 3KUPA 3I91A 4X62Q 4P2CB 2BE5C 4IUTA 1ML0D 1V43A 1JCKB 1QUQB 4M1UB 3MC0B 1WJJA 3I70A 4XT1B 4JI5L 2R92G 4U0SA 4XXEA 2HQEA 3G71A 2Z4HA 2EYHA 3BDOA 3LX0A 2GVBA 1PZKD 4NW2A 3AEVA 2ZJPA 5CV7A 1PH5A 3KDFB 1X65A 5TSSA 3MXNA 4IPGA 5C4JB 2QGQA 1JR0D 1VQGA 3LNNA 4FF4A 4H44C 4RH6A 4PZ6A 2DY8A 4LF4L 3PGZA 2VXWA 4BY7G 1ZYRC 3PSIA 5C3XA 3ZC7A 1E22A 1FGUA 4GLXA 2G03A 1GUWA 1EEID 1VF7A 1KABA 4MHEA 4BY1B 4GKJL 3J7YW 4CKEA 1IBML 4K0KL 2VQFQ 1Y1WB 2K33A 4KN4C 3KBGA 3GV3A 4ILWA 3FDTA 4CDDC 1VQ5A 1F2MA 1R4PB 2EXDA 5D65A 3SK5A 3U58A 1Q86C 4RWSC 1M1KC 2NVQH 2R7ZH 2GA4B 1WTRA 2KBNA 1IBLL 1G91A 3ICEA 3QJYA 5COYA 4PMWA 1X3EA 1QZGA 4IO9A 2GN5A 4A3DB 1V1OA 4NXMQ 2PZWA 3MZ5A 2CWAA 2E2HB 2MUYA 1FYCA 5ELNA 2XVSA 1EZ6A 3I4MG 3MHBA 1HRJA 3K5LA 1MKHA 1OXTA 3PIP3 4HCEA 1TWAH 2BA1A 2JK8A 4KKSA 1CZGA 4XDXA 2EY5A 1XWEA 4A3JG 3KK7A 1EOTA 3R2TA 4DV0L 2EVBA 4IUQA 5EBDA 3H3VH 1BO0A 1TS4A 4DR3L 2HT1A 3GTGH 2KEDA 4EX5A 4DV5Q 4AYBB 1MSHA 5ELOA 3S2HB 3L0OA 5HY6A 3RN2A 4IALA 2RSOA 2B2UA 5JJIA 4TVAB 2YTVA 2ZTEA 3SVMA 1X56A 5JFFA 1LTBD 2I07B 3CAMA 5KYIA 3ULPA 5IWAQ 2EJMA 3SE5A 4ODGA 4CKBA 4LF8L 3OPOA 1OXVA 4DPGA 4B3ML 1MI2A 1RODA 1B3AA 2XRSD 1EU4A 3IFDA 3AU7A 1TWFB 4IUPA 2PQAB 4A3LG 2ZM6L 1OXXK 2M00A 2R7ZG 2F4VL 1QVGA 3MXPA 3S16B 3M4OH 1EOVA 2XNAC 1VQFA 3EJIA 1B3QA 1NE3A 1WTHA 2OTLA 1CT1D 5IYDG 3PF4A 4C3HG 3BVMA 3RLFA 1HZBA 5H1SE 3SHGA 2Z4IA 3NBIA 2EXZA 3G6EA 4DV6L 4PY3A 1I3QB 1IYJB 3TP8A 4DUYL 4XT3B 4PNYA 4WRDA 4DXFA 2K1BA 4A3EB 3S15H 2L12A 4HIOA 4HIMA 3VYRA 5JEAJ 4RMFA 1IZ6A 2KCCA 2ICIA 4JYAL 4JOIC 2CW0D 3NXWA 1Q82C 4OO1H 2QF7A 2UXBL 4ZAIA 1HNZL 1WCMH 1KRTA 3SN9A 4OX9Q 2VW9A 2CQOA 1B70B 2B2TC 2X6GA 3HFZB 4ZYSA 3J81c 1UE5A 4BWGB 1ENFA 2K05A 2AWOA 4LU4A 3CCVA 4LFBL 1N36L 5JOBA 3CP0A 2L55A 2FINB 2NVTH 5M5WH 2ASBA 3J7A5 2AQ2B 3CW2C 1VDZA 2JQOA 3GTMB 3J80E 1S3OA 3O13A 4QL5A 4A93H 3U4ZA 1H9MA 2QDLA 3I4NH 1C9OA 2BDNA 5IE8A 1EL0A 3FVQA 4X66L 1ASYA 4DR4L 4RCOA 1XJVA 3PV0A 4C3IH 4A3GH 2OXPA 3U50C 4LF6L 1E3PA 1LT3D 1PTOD 2KHSA 4BY7B 2Q2IA 1EIHA 3TMEA 3HOWB 4EQOA 1A62A 1FNVA 3TRZA 2SDFA 1EFID 2VB2X 1CM9A 1HZAA 4KY5A 2A6HD 1VQJA 3I8ZA 1HZCA 2SNMA 5M3MH 1BNZA 1EQVA 2LY7A 2JA8B 3DM1A 3T53B 3J7ZC 3SXHA 2JE6I 4UDUC 4CDFC 4CJ2C 1I94L 3M7GA 2BCOA 4U07A 5GROA 3VR3A 4EGVA 2DNEA 5I6WA 1WCMG 2FHTA 3KLSX 3CCQA 5FLMH 1UWVA 1VQMA 2QA4A 1PMRA 1I4RA 4P73A 2UUAL 4TSSA 2L9HA 4RCNA 2F0LA 2CW0C 3A55A 4BBRH 4RHSA 1PH8A 1HFNA 1PRTB 3M4YA 4UHVA 1CQFA 1SYGA 1T5XD 1CSQA 5IP7H 1S5BD 2EY2A 2C35B 2F0WA 2K04A 1MJEA 1JB7A 3K80C 3G6JB 2IX1A 1JE5A 4NKLA 4DXGA 1VQOA 4JPBW 5KNBA 4LFAL 1L0XB 4C2MH 3R8BA 4A3FH 2WAQB 4DV2L 4CJ1B 4A3GG 3F8TA 3KOJA 1ONLA 1HNXQ 1EY4A 1A15A 3DUZA 1XNRQ 4DV4Q 5A2QL 2N49A 4OGQC 3AB9A 4DV1Q 2OEOA 5M3MG 3P1HA 5IOCA 5DM63 4U673 1O7LA 3J80c 1NJIC 1QVCA 1PTOC 1IW7D 1VQIA 4QB4A 1QWYA 1HUMA 1MSGA 3L2PA 3A8KE 3OOCA 4NMZA 4NB3A 1UAPA 5G3LF 4A4IA 3FEWX 4NP5A 4DK0A 2NVQB 4X2EA 2A6HC 5FLMG 2R7ZB 1HFGA 5BR8Q 3QG1A 1B7YB 3A7AB 2NYZD 5FOBB 1WI5A 4Z9CB 5ELFA 5LMUL 4BBRG 1NTGA 1A8VA 1BBUA 1FJGL 5C0XG 4G4KA 4KN7C 5IP7G 1LTGD 4X3KA 3CCMA 4K5XA 2ICEC 5FO7B 3JAML 1HA6A 3DWPA 5IT9L 1EYAA 5GQOA 2F52A 1TWAB 3KF8A 3MFYA 3A74A 1PVOA 5M5XH 4QUCA 5CC4A 4A3FG 4KKUA 3FKIH 4PZ7A 3TS2A 1XXGA 1SFOH 1E1OA 1Y1WH 3PUZA 5IP9H 3J81j 1P16A 4PMCA 1Q8KA 3SEBA 4JCVE 1J9OA 3GTGB 4QCLA 5EU0A 4V190 2B39A 4GN3B 5EBCA 1D2BA 1KXLA 1GUGA 2ES2A 3N6RA 4M8AA 3AYHB 3DM3A 1DM0B 3HS0C 1CKNA 5CMDA 3F2DA 1SYCA 1PTOH 2RHQB 2DNCA 5C3WA 2F0TA 5E4WC 5EKLA 1G8ZD 4YCWA 4GKKQ 2F0FA 2R6GA 3PQIA 3GP7A 3M4QA 3L3OC 3QOJA 2K32A 3Q22A 3I73A 1NCVA 3NUCA 3D3RA 1I4GA 3M4PA 4X3UA 2QEXA 3M4OB 3K58A 2WACA 3VDYA 4X2CA 3PO3H 2OQ0A 1IW7C 1SAPA 2R7DA 4N9PA 1AEXA 4R1JA 4A3MH 3JAMi 4K2KA 5JPNC 1TXYA 4R4TA 4B3TL 4LF4Q 3WWVA 2F0IA 2SNSA 5GAHC 1A3UA 1BCPB 1EY9A 4XQNA 1YI2A 1FL0A 1PRTD 3SK8A 3GTJH 4C1NI 5M3FH 2DGYA 4JC0A 3S15B 4JV5L 2JYOA 3NSWA 1J8IA 4IUNA 3HG9A 4A3KH 2RBMA 1I4PA 4BY1G 3C2PA 3FKIG 4XTCS 3R3OA 1GUOA 4A3CG 4B3SQ 4QUFA 1Y1WG 2PNHA 1HXYD 4LW1A 5CGLA 1KRSA 2L0CA 3S1RH 4YIJA 1F9PA 1WCMB 3P20A 5CBEE 4A75A 1IBLQ 1U4MA 1F9RA 2NN6H 2J7ZA 2PO4A 1N32Q 3K0YA 4ZCKA 3VR6A 1E2WA 2L11A 2VUMH 5J1ZA 4KD3A 5CR3A 4APVA 3Q0AA 4LUOA 5EQ0A 1X32A 2UUBL 2ZTDA 2F0NA 4A3DG 2V4DA 2NVTB 5FO9B 5M5WB 2CFMA 1SEBD 1CUKA 1EIYB 4P75A 4DR1L 4ME5A 4A93B 1WFQA 3CF5A 2JP1A 3I72A 3I4NB 2YV5A 5L37A 2MPMA 4S3SA 5KIXA 1YHQA 1S72A 5FJ8H 2B63H 1VQ9A 1B1ZA 3ZCBA 1PFBA 1FVIA 1RIPA 1Y8PB 2PZTA 2SEBD 3A7LA 4DV0Q 4A3MG 2N88A 3DEPA 4C3IB 4A3GB 4LF9L 4DFAA 4DR3Q 3PF5A 2ALYB 3BJUA 1MBYA 5M3FG 2VB3X 4B3RL 4AYBG 4KLKA 1SE3A 2VZAA 1Q12A 5E4XA 1E2VA 1H95A 5FLXc 1RTNA 3CPFA 1BOSA 2IWHA 4DU9A 5M3MB 1BQQT 3D4DA 4RGTA 2G9DA 2IL8A 3TP5A 4L63B 5KEEA 4HMIA 1FNWA 4IURA 3E0EA 4B3MQ 3AFQA 1PRTC 1LTRD 1U5KA 1NMFA 4PZ8A 4ZKCB 2A68D 4DGZA 2IJ0A 2YTYA 2ZM6Q 5IIFA 3I90A 5IGBA 2F4VQ 1ICFB 2NN6G 4GN5A 3OTOL 5C5MA 3VA7A 2VUMG 1TS2A 4BBRB 2D0OA 1JORA 1BDOA 1AH9A 4DV6Q 1L1OA 3SE0A 2FMMA 2HHHL 4DNIA 2PPBC 2PMZE 1Y69U 2UXDQ 2K14A 4JI2L 4GN4B 5DNFA 3D6CA 1H9SA 2Z6KA 4A3EG 1N8RC 1KDBA 3UDFA 1HTLD 3IRBA 4C2MB 3KF8B 2JN4A 4A3FB 4N8FA 4JYAQ 3PUVA 3V96A 2PZUA 5I9PA 1SRUA 2SOBA 1S4ZA 2C5CA 1U4PA 1HNZQ 1RKNA 2RSNA 4DR2L 3NTHA 4OEMB 3CHBD 5ELDA 1K8MA 3ZYYX 1BCPD 4QJFA 5A35A 3M3YH 2LS01 2EIFA 1JMCA 1Q3LA 4N67A 1CKNB 1QG7A 3ITPA 4KD4A 3PIOA 1N36Q 1X9NA 3W3AA 1I4HA 3PIPA 2K50A 1MIUA 4CGYB 2WKDA 3PMFA 2KHJA 5K36H 1PHJA 3IFTA 3RN5A 4OWTB 4X66Q 5CV5A 4DR4Q 2JA5H 4WJ4A 1K9MC 3GTQB 1N9WA 1TS3A 3NTKA 4UPAA 5C3EH 1VF5C 5ELEA 4DK1A 2F1MA 1WTVA 4LF6Q 2A68C 4QIWB 1N33L 4DAYB 1ET9A 1CSPA 3HRZC 3K7AH 2E5LL 3H3VC 3S2DB 2JJQA 1LTID 4KTAA 2Q8TA 4RAUC 3HOWG 1RTOA 2K01A 3AFPA 5M5XB 4JI0Q 2QDBA 1YHAA 3FKIB 1SFOB 3MA2B 3RNUA 4HR7B 1QE6A 1Z6HA 2PW5A 1LO5D 4BA1I 2JA8G 1SE2A 2RVLA 3T1HL 1I94Q 3H15A 3FPUB 1TWGB 2A69D 4F87A 4ITRA 1SE8A 5FKAC 3D31A 1CKOA 1M4VA 2PW7A 2K28A 2B8GA 2UUAQ 1TU2B 1EQTA 4LF7Q 1A3VA 4H7BA 3P75A 4G7OC 1PTOB 2ZXPA 3BS1A 2QCPX 2IPKD 1EYDA 3HKZG 1XMQL 1HQMC 3KJPA 1C8CA 1JWUD 3EQLC 3HOZH 4HN7A 1SNDA 3QB3A 4X6AH 3NENA 4O0AA 3S14H 5EAYA 5IODA 5I6YA 3J81E 1BCPC 1A6XA 2JXMB 2EZVA 3PIO3 2JA5G 4LFAQ 4XIGS 2WB1G 1AZQA 1SSOA 5F2DA 3PO3B 4DV2Q 5C3EG 4A3MB 1A2TA 2WAQG 1S5CD 2K75A 3CCSA 1W6KA 5DAUA 1EIGA 3MVVA 3QIAA 2K5NA 4YWLA 1Q7YC 3GTJB 4KY6A 4DV3L 4OONA 5M3FB 3CMEA 4IJHA 1GHKA 3WOFA 2MO1A 2YTXA 1KC8C 4A3KB 2OTJA 2Q8RE 1RCVD 2Z9HA 1OTCA 1B4OA 1STGA 2NZOA 1EY0A 2OF1A 3K5OA 3UDIA 2Z1CA 3S1RB 3HKSA 1NSNS 2EYFA 4HIKA 2O5IC 1F2YA 4C3JH 3MXGA 3RLNA 2EYLA 4LFCL 2F4IA 1EYCA 1PFSA 1ESFA 2PQEA 2MNAA 4UAIA 2VUMB 1YITA 2E76C 1L2FA 3NBHA 1ESRA 3CC7A 1JOOA 2D5DA 2KJXA 4PV1C 2XWJB 3KJOA 4KK7A 2I0QA 2A69C 2NVXH 1VQBA 4HJ9A 2L4NA 5EGTA 4X3TA 2Y0SE 1GO3E 2B63B 2CHBD 1SNOA 3URYA 3SHLA 5C4XH 5C0XJ 4MTKA 3HP3A 4HSPA 4IJLA 4X3SA 3T1YL 2XRQD 1K83H 1LACA 1PRTF 1KDAA 1HR0L 3MAQA 1UEBA 1EZ8A 1G2SA 4OHJA 4OXPA 4YWMA 1TWHH 1GUNA 5CBAE 4NXNL 1SJHD 2KHIA 2JA9A 2QKIC 2XTIA 1U0LA 4OIKA 4V0BA 3DHQA 2KCMA 3A54A 1KAAA 1SDFA 1VS0A 2ZJRA 3T16A 2HDMA 3A5UA 2EYJA 3LWUA 2FXQA 3DEOA 1C0AA 2EYPA 2F03A 2EQSA 1VQEA 1TQOA 1AN8A 4K6LA 4EVOA 1P8LA 2DN8A 3NK9A 1JT8A 1XNQL 2B2WC 3I56A 4EQPA 2I5MX 2CH4W 4C3JG 1N34L 3CRLC 1PYWD 1BBWA 1KHIA 1KL9A 2Q2TA 4FF3A 4RGOS 3OW7A 4LF5L 1GHJA 1Y8OB 5M9OA 4ABNA 1WTPA 1EWIA 2E8GA 3MXNB 5KGUA 2MGSA 3NTIA 2HIXA 1STHA 3I55A 2R7FA 5J39A 1CKMA 2YYZA 5FK9C 1NH1A 4RA8A 4C1NK 1XPUA 2L15A 4JV5Q 1C7YA 3DMUA 3LGJA 5C4ZA 5C4XG 4IFDI 1KLUD 2A73B 1EY8A 2A6ED 3GO5A 4I7AA 2XSCA 3PUXA 1I4XA 2EDGA 4GNXA 2EY6A 3CCUA 2CCZA 2K5VA 4OO1G 1UNSA 2EYMA 2K5DA 3ULLA 2E2JH 3VYSA 3LWEA 2VNUD 4QY7A 5KRUA 3S24A 1HNWQ 4R4QA 1I4QA 4IOCA 2F0OA 5EPLA 3M3YB 1IKMA 1DOKA 3UI2A 4A3IH 5BN5A 3K0XA 1GUTA 4HJAA 2N3SA 2E2DC 4K6DA 3BZKA 1HTPA 3HKZB 3U9SA 1PFMA 4KI0A 3U9OA 3PUWA 2P5ZX 4L5SA 4KJNA 1PH9A 4FNFA 4L5TA 4DV7Q 5DEHA 2UXCQ 5I2XA 3BVZA 2Z6BA 4A76A 4XQJA 4A93G 2NBFA 5A2QE 3K7UC 3I4NG 2JA5B 3CMAA 4U68A 2WB1B 3KYHC 4JBMA 4POGA 2Z0SA 5C3EB 3EBEA 4KHPL 2XN9C 4DUZL 1LT6D 4R9WA 5EKKA 4C3IG 5JEAH 4LF9Q 3GQBA 3K8AA 4X65Q 3K7AB 4JW0A 3ER0A 1Q81C 2IHEA 4OELB 1B2TA 1VQ6A 2K7VA 3RLOA 1UUPA 4PG3A 2WV6D 4PQXA 3NE5B 1HCZA 3UDGA 4AQYL 1IYUA 1C4QA 2KA7A 4AYBE 2V1CC 1A3TA 1DGSA 5JPMC 1LT4D 5C6AA 1EYGA 2MQHA 1SYBA 2B29A 4R8IA 4JI4Q 1SNQA 1JE4A 4RGNA 1GKHA 1MGSA 1BCPF 2K5WA 3WDNA 2F0QA 1KDCA 2DJFC 2WIIB 1X3QA 3KF6A 3D4WA 3HGBA 1VQDA 1RHPA 2PI2E 1IL8A 2A6EC 4A3IG 3OTOQ 4O2DA 2RDHA 1JWSD 4JOIA 1GUSA 3GTQH 3I4LA 1AW7A 5IWAL 3HOZB 1XMOL 4L5QA 3TDQA 3N3UA 2VQEQ 4I65A 2HHHQ 1YNXA 3S14B 4X2DA 4J15A 2G5DA 3S2DH 5E1FA 4FXDA 2JA6H 3FPPA 3VA5A 2B2TA 2R93H 5JVG3 2IT1A 3HOUH 1VCIA 5E3FA 5IGGA 5IGDA 2NZHA 4UY8C 4DR6Q 2HQLA 1LYLA 5D3DA 1NNXA 1Z7TA 3CRKC 1L0YB 5JEAG 2Q2HA 1PLFA 1UEAB 2LXKA 3G48A 2E75C 4DR2Q 1C48A 3R2IA 3STBD 1JWMD 1TWGH 2TSSA 2C9OA 2RCNA 2K03A 4BA2I 4IFDJ 2KVMA 1AZPA 3LETA 1V8QA 4OL7A 3S1NH 3TP6A 2JSOA 4O1NA 3FP9A 1JB3A 1UE7A 1T9HA 3CUCA 1V1PA 4DNTB 4JI5Q 5CV8A 3OSOA 5FLXE 2DJGC 3OMCA 4HAEA 1AE2A 1X54A 4XYOA 3S1MH 4XYQA 4HJ5A 4BBSH 2NVYH 1H9RA 4GLVB 4C3JB 3BG3A 1YHBA 4OX9L 4GOPA 1J5EL 1EY7A 1QVFA 4R4CA 1FNUA 1MJCA 3IKJA 2EJFC 2Z6KC 2B2YC 3W2DA 1BUVT 3GTLH 1QUQA 1WTOA 2M9VA 1QNKA 1IYVA 1B8AA 4L8JA 4XQQA 4FXGC 4YY3L 2JA7H 2WP8J 2E5LQ 2F0KA 2NVXB 1I50H 4YCUA 3F2BA 4LNQA 1WTWA 5J22A 1O78A 5DM73 2R93G 1PH3A 4QMGA 3S17H 1WD0A 4R4OA 2O2LD 3KDFA 3Q24A 5C4XB 4GKJQ 4UP8A 3BDLA 1K3RA 4JI1L 3SK4A 2EYOA 4F7XA 5J3BA 1SN8A 3TQYA 1IBMQ 4K0KQ 2K6AA 1K83B 5IY0A 3H3VI 2LKVA 3T1HQ 4GZYC 4UP7A 5IP9G 3JAMc 1TWHB 5IT9c 2E74C 2EOTA 4DKAC 4MN3A 4Q0FA 3H91A 3EROA 3OIPA 2A5HA 1PFNA 1LTLA 3N52A 3MEHA 4DF7A 1VQ7A 5JJZA 3I4OA 1EFWA 3PO2H 1ENAA 1XMQQ 2WINB 3STBC 1SLJA 4DN4M 2ENBA 3F1ZA 1UE6A 2HIVA 4WFN3 1LUZA 2AQ3B 1VQNA 1H9JA 4HJ7A 4DR5L 2K5HA 3H0GH 1EQQA 1E24A 4CBVA 3RZDH 1O7ZA 4RHRA 2N78A 2OQKA 4NDXA 1VQ4A 5JJ7A 3PO3G 4R8NA 2J4XA 3TEHB 3CPWA 2KCTA 1X55A 1VMPA 3CKIB 3HOVH 2WAQE 4DV3Q 3K81C 1GJXA 3OHXC 4P74A 1WTXA 3V2TA 4TRDA 2ZXOA 4KHZA 4OWXB 2MHVA 5K5PA 1G51A 1KNEA 2D9UA 3HOXH 4A3KG 2WFWA 2WKCA 4HEDA 4B08A 1D6EC 4IFDH 4LF8Q 1YBYA 1D1KA 5IYBH 1ILPA 1TS5A 2AQ1B 3CCLA 2E2JB 3OYYA 1DONA 1EWCA 1U4RA 1LM0A 3GTOH 4JBWA 1JQYD 1NR4A 4DV4L 4LFCQ 2RHSB 1STYA 4K8JA 1IXRA 4A3IB 5ELCA 2B2VA 1OXUA 4CDCC 4CKCA 3SK6A 5CGKA 3PO2G 1ZEQX 1OXSC 4HSVA 3EVQA 1K28A 5LL6X 3RZOH 1HQRD 2X6LA 1HA5A 2PI2A 4ZUIA 1SBBB 2R92H 1Q8IA 2EE1A 1DOMA 4JI3L 1DJRD 4DUYQ 2PQAA 2A74C 1XTCD 3QWNA 3KFUA 5I9OA 1TKWB 3J7AV 2R61A 3GTPH 5FJ8G 2B63G 2TMPA 3T56B 1B50A 2YU9H 4PMBA 2XGTA 3DXJC 4Y52H 3T1YQ 1PTOF 1CA5A 1B9MA 2LSSA 1HR0Q 2B2UC 2RKSA 2UU9L 5T1GA 2UXBQ 1G6ZA 1YNJD 3JC66 3CU7A 4NXNQ 2F0VA 4FDBA 2CH4A 2I5LX 3H6MA 1Y1VH 1PYSB 2I5HA 2O4XA 4EQNA 1JOQA 3ZJYC 3CD6A 1HR0W 1STAA 4WGJA 4LFBQ 1EWHA 3DWAA 5JJLA 5T1IA 1XNQQ 1R9TH 1N34Q 2L1BA 5EPKA 3CC4A 2RCFA 1IBKL 1A0IA 4IN3A 5C44B 4JI7L 4RGMA 4GOPB 5G3LD 3HOYH 4DR7L 3S6AA 3BYYB 4TQUS 1RL2A 3QOLA 3W1BA 1B9NA 5C0XI 3UE0A 1JJCB 3NQTA 5LHY1 4GKKL 1BXTA 2HD3A 2JA6B 3BZDB 4JI8L 5LMNL 2R93B 1BR9A 2PYKA 3HOUB 2H4OA 1K8OA 2UUCL 3M9BA 3ND8A 3NP8A 5DLQE 3OMGA 3I4MH 5JVH3 4H02A 1X3FA 2F0JA 4B9XA 4K8IA 4EQ5A 5KYLA 2IY5B 4A3JH 3I2ZA 3ERSX 1YJNA 1O7YA 2D0PA 1QOHA 3NELA 1SYEA 1F77A 1VQCA 4ZUJA 1JC7A 1Y1VG 2HCIA 4GLAC 2XWBB 1RD9D 4X64L 3NHHA 2ZJQA 2AWNA 4IZ8A 3BU2A 3C1EA 3VYTA 3S1NB 3AMUA 1SROA 3D4RA 4I7ZC 1UE1A 4L6TB 4O42A 4YHHL 2FJ2A 4B3SL 1YNJC 4N9TA 4F8MA 4J1MA 1S5DD 1HUNA 3S1MB 4BBSB 2NVYB 2KOLA 3BZCA 2O5JC 4A3LH 2KECA 5K36G 1GD7A 1D5ZC 1VQLA 3GV6A 2RDFA 3Q8DA 4ALPA 4KHVA 3HOYG 2ZTCA 3GTLB 4KHPQ 4DUZQ 1A2UA 1N32L 1LABA 3SR1A 5IYDH 4C3HH 4LJZC 2DUDA 2JA7B 4GNXC 1F9SA 5ISRA 1I50B 1F2LA 5AFWA 4NPSA 4N8X1 3C1FA 2R3ZA 4HCSA 5CV4A 4LUZA 1EIFA 3DLLA 5M5YH 3S17B 2NB0A 5AJ3L 2MFIA 1O80A 3GDEA 4AQYQ 1JOKA 2VS1A 3GTKH 2E2IB 2FMCA 5IGEA 2QW7A 1IHZA 2KENA 1DYQA 1V1QA 2I46A 1CHPD 1LTSD 1PXUA 5CV9A 2J0TD 4A3BH 1B44D 5NUCA 3VR2A 4IUUA 4POFA 3J81L 2N8NA 3E9IA 1NUCA 1ENCA 2F0UA 1LLRD 4LMQD 4ZKBB 1E2ZA 2BOSA 3B6YA 3NQIA 2QEJC 3OWFA 1BVSA 5LMUQ 4UP9A 4MNOA 3TP7A 1PA6A 1M90C 2N55A 3PO2B 4RKLA 4HIDA 1FJGQ 1BBXC 1XMOQ 3C3LA 1LV9A 2F3IA 3HOZG 1NR2A 1BF4A 3CCRA 4U0ZA 1K8GA 3W5OA 3K5MA 4U04A 2PCFB 1L1OB 3F2UA 1STBA 3H0GB 2MP1A 3T51B 3RZDB 1RF2D 2Z8LA 1H9SB 4LK1C 4AH6A 2BA0A 5IGFA 2JEBI 4L5RC 5JAVA 1T5EA 1XTDA 3HOVB 3VYUA 1O7IA 1M8AA 1PYBA 2BH2A 4IQZA 3RUZA 1K3BC 1VQHA 4K14A 2UXDL 1EUJA 1X3PA 1NAPA 1GVPA 4DAVA 2AUJD 3DWQA 3FHWA 1OO9B 1QZHA 3HOXB 3J81i 3TSSA 3X3NA 5IYCH 1CZWA 3ONAB 1VQPA 4QQBX 3Q23A 1ASZA 4IPDA 5BN3A 2MJ8A 3NEMA 1SMYD 4A3BG 2NTTA 3PUYA 4DNRB 4G57A 3QO2A 4JI6L 3GTOB 4MZ9A 4FVMA 1Q90A 1VQAA 3KLWA 2NN6I 1J5EQ 1D5XC 2VY3A 3H09A 1FR3A 1I5FA 1RJTA 4CDEC 2ZT9C 1V9PA 1Z47A 4X62L 2GVAA 2BDOA 1XPOA 1GOZA 1EY5A 1ZXTA 3RZOB 4B3TQ 4MIUA 2F6SA 3D6WA 4YY3Q 2B3GA 1IL2A 1SNPA 2KUMA 2F0PA 4WJWA 2R92B 4E6IA 4XI8A 2A8VA 4Y7NH 1TWCH 2F3WA 3M7NA 4QIWE 5C5LA 4AIMA 4ZK9B 1CTMA 3NWTA 3GTPB 5JFZA 4JI1Q 2YU9B 1PV4A 4FO2A 1NBWA 3IL8A 3S1QH 1WOCA 3UDXA 2KQ3A 2NWGA 1KTKA 5KNCA 1D7QA 2FFKB 2RF4A 3MXUA 1EY6A 1MD2D 5I2YA 1WD1A 3J80L 2CKZB 1Y1VB 1CK1A 1LTAD 1TY0A 1SNCA 2F3VA 4R4IA 2LXJA 3A5ZB 3RMHA 5IYCG 4JI0L 4GOPC 5ELBA 2A19A 2F0SA 4JG2A 4OIJA 2UUBQ 1Y8NB 1PH1A 1CI3M 1YNND 2VQFL 1R9TB 1F2ZA 4DR5Q 1ILQA 1S5ED 2IHFA 4DR1Q 1I6HH 3V05A 1E7ZA 2L5TA 1WTQA 3L7ZC 2OWOA 2F0DA 5HGTA 4HJ8A 3HOYB 1STNA 3C46A 4K5WA 4ZRZA 1WVLA 4LF7L 3ZLMA 2NTSA 2RA4A 1VMCA 1X6OA 5CYUA 1SMYC 3SDZA 4HMJA 3EFXD 1KD1C 5C0XH 1STEA 3E3XA 1KNAA 4NXML 5GAGC 4CJ0B 1ICWA 4H13C 3TS0A 1NY4A 3TBIB 3CQZH 4B3RQ 1PZJD 1QCBD 5FO8B 1SNMA 4DAPA 4A3DH 2X69A 1Y14B 3I4MB 2QILA 2AHOB 1TIID 1RDPD 3J80i 2EY1A 3QR8A 4A3JB 4YWKA 2AKWB 2IW3A 4J6HA 2H1EA 2Q2UA 4RG1A 1HPCA 1HZ9A 5EJWA 1HHVA 4RFBA 4DV5L 1B53A 3L9AX 3JAME 5C44H 5IT9E 1JJ2A 2RQXA 3K59A 3OW2A 5BN4A 3RD4A 1DXMA 1TY2A 1KQSA 3NBHB 5CMTA 4JI3Q 4LUVA 4JI2Q 3NWSA 2D62A 4ME3A 3OIQA 4F88A 3IAYA 4KY7A 1KLGD 3TZUA 4KV6A 1JJGA 3TN2A 4KMUC 2AUKA 4C3HB 5C4JH 1YNNC 2PMZB 3RR5A 1TT2A 2B2WA 2UU9Q 3UE1A 1Z9FA 2M2LA 1QB5D 2Y0SG 3ND9A 3CXCA 3BDCA 4OWWB 1TR5A 3FMCA 3SGIA 1PH4A 1KAWA 3Q6SA 4K2LA 5M5YB 1HH2P 3E0JA 3GTKB 5CKLA 2EPBA 3MEFA 4FXKC 1YEZA 4BY1H 4ID6A 1X3GA 3CCEA 3BVGA 4A3CH 2B2VC 1G291 1AE3A 4TKOB 3HEJA 1DZ1A 1F9QA 4A3BB 1Q1EA 1EQRA 1NMGA 1BKBA 1SYDA 1QNUA 3EA6A 1IBKQ 1L1OC 2F0EA 4CHTB 1Q1BA 4FYDA 4JI7Q 4GS3A 5C44G 3S9WA 4DR7Q 1K0RA 1JICA 1I6VC 1II3A 4IPCA 2IX0A 3VR5A 2G9HD 3D8GA 2IX3A 4KKTA 1H9KA 5E7NA 1Q46A 5EPJA 2KEEA 2OT2A 1IKLA 1N33Q 3ERQA
chains in the Genus database with same CATH topology
1J6QA 2LSSA 1HR0Q 2OTJA 3CCQA 4JI8Q 5FLMH 5LMNQ 1UWVA 1VQMA 2JA6G 2QA4A 4DAMA 2UU9L 2UXBQ 4P73A 2E2HH 3TREA 3JC66 2UUAL 2UUCQ 4NXNQ 2BH8A 1OTCA 3HOUG 2NZOA 4FDBA 2I5LX 4BBRH 4QGUA 1Y1VH 3ULJA 1PH8A 1PYSB 3UDIA 3PCOB 2E2IH 2I5HA 3HKSA 4HIKA 1CSQA 5IP7H 4IPHA 3ZJYC 4JBJA 4C3JH 4GNXB 3CD6A 1HR0W 4IOAA 2C35B 1G6PA 3RLNA 4LFCL 5LMNW 1MJEA 1JB7A 1PFSA 3K80C 4WGJA 4LFBQ 2MNAA 5JJLA 1HJPA 2IX1A 1YITA 1JE5A 1XNQQ 4X64Q 1VQOA 1L2FA 1R9TH 2A1AA 3CC7A 4LFAL 5JJKA 4C2MH 3S2HH 4A3FH 1N34Q 3KJOA 2I0QA 4DV2L 3CC4A 2NVXH 1VQBA 4HJ9A 1IBKL 4A3GG 1A0IA 1E1TA 3F8TA 3KOJA 4YHHQ 4P72A 4JI7L 1HNXQ 2K52A 4GOPB 1A63A 3HOYH 4DR7L 3S6AA 1W3SA 2Y0SE 1GO3E 1RL2A 2H5XA 4TQUS 1XNRQ 4DV4Q 3W1BA 5C0XI 3UE0A 5C4XH 1JJCB 5C0XJ 2N49A 1D8LA 1L0WA 4DV1Q 3HKZE 4P71A 4BBSG 4IJLA 3D0FA 3T1YL 4GKKL 1TWFH 1K83H 5M3MG 1HR0L 1UEBA 1HNWL 4U0UA 4JI8L 5LMNL 4WJ3M 4DK3C 4OXPA 3J80c 1NJIC 4YWMA 3S16H 1QVCA 1TWHH 4DK6C 1VQIA 3M9BA 4NXNL 2UUCL 2KHIA 2JA9A 5DLQE 2XTIA 5HGQA 1U0LA 2AMCB 3I4MH 3L2PA 2KCMA 1X3FA 2WB1E 4H02A 1PH7A 4JBKA 1VS0A 4NB3A 2ZJRA 4A4IA 3A5UA 4EQ5A 2JA7G 2IY5B 1YVCA 4A3JH 3I2ZA 4X2EA 5FLMG 3ERSX 3M85A 2FXQA 5GAEC 3F2CA 1YJNA 1C0AA 4BXXH 3U4VA 5BR8Q 2EQSA 1VQEA 2D0PA 1B7YB 3NELA 1I3QH 4DV7L 5AJ3Q 1VQCA 2UXCL 1WI5A 4MTNA 5GADC 5LMUL 1P8LA 4BBRG 1NTGA 1Y1VG 4A3EH 1JT8A 4GLAC 1A8VA 3I7FA 1XNQL 1BBUA 1FJGL 4X64L 2ZJQA 2AWNA 5C0XG 3I56A 3BU2A 5IP7G 1YZ6A 2I5MX 4M16A 1N34L 5JJ6A 4OO1I 1SROA 3G4SA 3CCMA 1UE1A 1BBWA 3W1GA 3CC2A 1KHIA 1KL9A 4YCVA 1PH6A 2Q2TA 1VQKA 4YHHL 4LF5L 4X65L 4B3SL 1HNXL 2OCEA 1EWIA 2E8GA 3MXNB 5GQOA 2F52A 2HIXA 1WYDA 1XNRL 2JEAI 1S40A 3A74A 1PVOA 3KF6B 5M5XH 3I55A 3TS2A 4A3FG 4PZ7A 3FKIH 2R7FA 1CKMA 3E9HA 1SFOH 2YYZA 4DV1L 3BZCA 4A3LH 1YJWA 5K36G 1GD7A 1E1OA 1VQLA 1Y1WH 1XPUA 3PUZA 3Q8DA 5IP9H 3J81j 2L15A 4ALPA 1P16A 3HOYG 4JV5Q 2ZTCA 3EN2A 1YJ9A 1Q8KA 3LGJA 1C7YA 4JCVE 4KHPQ 2K4KA 4DUZQ 1N32L 4JI4L 5EU0A 5C4XG 4C3HH 5IYDH 4GN3B 4IFDI 3GO5A 2DUDA 1KIXA 1KXLA 4GNXC 3H0GG 3PUXA 2ES2A 4GNXA 3GTMH 3AYHB 3DM3A 3CCUA 4NPSA 1CKNA 1KC8C 2CWPA 1YIJA 2CCZA 2K5VA 3F2DA 4OO1G 4LUZA 1EIFA 2RHQB 3DLLA 1GM5A 5M5YH 3ULLA 5BR8L 1K73C 2E2JH 2VNUD 5AJ3L 2MFIA 4YCWA 4GKKQ 3GDEA 2R6GA 4AQYQ 2VS1A 4QY7A 4LWCA 3GTKH 1SMXA 3S24A 3M4QA 1HNWQ 1K8AC 4R4QA 4IOCA 3A0JA 3HOVG 2KENA 1W2BA 4A3IH 1V1QA 2VQEL 3EIVA 3K0XA 4BY7H 4BXXG 4HJAA 2N3SA 3M4PA 1SR3A 2QEXA 4A3BH 3BZKA 4POFA 3HOWH 2N8NA 3VDYA 3E9IA 3AQQA 2ID0A 4X2CA 3PUWA 4KI0A 3PO3H 4L5SA 2OQ0A 3GD7A 4R1JA 2R7DA 4A3MH 3JAMi 3HOXG 1VQ8A 3B6YA 4DR6L 1PH9A 1TXYA 4L5TA 4R4TA 4B3TL 4LF4Q 3WWVA 4DV7Q 2UXCQ 4IFDG 1BVSA 5GAHC 1PH2A 5LMUQ 4UP9A 4MNOA 1FL0A 5IYBG 4A76A 1YI2A 1PA6A 1M90C 3K7UC 2JA8H 3I4NG 3GTJH 3CMAA 4HIDA 1FJGQ 3KYHC 4JBMA 4JI6Q 5M3FH 2VL6A 2DGYA 4JC0A 3CCJA 2F3IA 2MO0A 1XMOQ 1XPRA 4POGA 2Z0SA 4JV5L 3HOZG 3EBEA 4KHPL 3CCRA 4U0ZA 4DUZL 1K8GA 4A3KH 3W5OA 4U04A 1L1OB 4BY1G 3FKIG 4XTCS 4LF9Q 3K8AA 4A3CG 4LF5Q 4X65Q 4B3SQ 4X62Q 3ER0A 1Q81C 1Y1WG 2PNHA 2IHEA 4LW1A 5CGLA 1KRSA 1V43A 4AH6A 1VQ6A 1QUQB 3RLOA 4PG3A 1WJJA 2BA0A 3S1RH 2JEBI 4L5RC 4JI5L 3UDGA 2R92G 4AQYL 4U0SA 4A75A 4AYBE 2ATWA 1XTDA 3G71A 1O7IA 2V1CC 1DGSA 1IBLQ 2GVBA 1PYBA 2BH2A 1EYGA 3AEVA 2MQHA 2ZJPA 1N32Q 2B29A 4JI4Q 1VQHA 2VUMH 4LFCQ 2UXDL 1EUJA 1PH5A 3KDFB 1GVPA 1GKHA 1X65A 4APVA 4LUOA 3FHWA 2UUBL 4IPGA 2ZTDA 2QGQA 4A3DG 1VQGA 1QZHA 3KF6A 3J81i 1VQDA 2CFMA 5IYCH 1CUKA 2PI2E 4PZ6A 1VQPA 1EIYB 4P75A 4QQBX 4A3IG 3OTOQ 4DR1L 4O2DA 4LF4L 1ASZA 4IPDA 1WFQA 3PGZA 3CF5A 4BY7G 4JOIA 3PSIA 2YV5A 3GTQH 3NEMA 4A3BG 1YHQA 3PUYA 1S72A 5FJ8H 2B63H 1VQ9A 3ZC7A 1E22A 3ZCBA 1FGUA 5IWAL 4JI6L 1XMOL 1FVIA 4L5QA 4GLXA 3N3UA 1RIPA 2G03A 2VQEQ 4DV0Q 4A3MG 2HHHQ 4MZ9A 1YNXA 1VQAA 3KLWA 2NN6I 1J5EQ 4X2DA 4J15A 4GKJL 2VY3A 3S2DH 2JA6H 1I5FA 4LF9L 1IBML 4K0KL 4DR3Q 3PF5A 2ALYB 2R93H 1V9PA 2VQFQ 3BJUA 2IT1A 1Z47A 3HOUH 1VCIA 2GVAA 4X62L 2NZHA 1XPOA 5M3FG 4UY8C 4DR6Q 2HQLA 4B3RL 4AYBG 4KLKA 1VQ5A 4B3TQ 1LYLA 2VZAA 4YY3Q 2F6SA 1Q12A 2B3GA 1IL2A 1H95A 5FLXc 2EXDA 4XI8A 3CPFA 2A8VA 3U58A 1Q86C 5JEAG 1M1KC 2NVQH 2Q2HA 2R7ZH 4Y7NH 2LXKA 3G48A 2KBNA 1TWCH 4DR2Q 1IBLL 4QIWE 3M7NA 4AIMA 3ICEA 3E0EA 4PMWA 3STBD 1X3EA 1QZGA 4B3MQ 5JFZA 3AFQA 4JI1Q 1U5KA 1NMFA 4IO9A 1TWGH 2GN5A 1PV4A 4PZ8A 2RCNA 1NBWA 4IFDJ 4BA2I 3S1QH 4NXMQ 2YTYA 2ZM6Q 1WOCA 3UDXA 3LETA 2F4VQ 3S1NH 1D7QA 3FP9A 2CWAA 2RF4A 1UE7A 1T9HA 2NN6G 4GN5A 3CUCA 5ELNA 3OTOL 2VUMG 4JI5Q 2CKZB 3I4MG 1MKHA 2D0OA 1AE2A 1OXTA 1TWAH 1X54A 2JK8A 2BA1A 3S1MH 1AH9A 4HJ5A 4DV6Q 4BBSH 4A3JG 2NVYH 1L1OA 4GLVB 4R4IA 2LXJA 3A5ZB 5IYCG 4DV0L 2HHHL 1YHBA 4DNIA 2PMZE 4GOPC 4JI0L 4OX9L 4GOPA 2K14A 4JI2L 2UXDQ 1J5EL 2A19A 1QVFA 4GN4B 4R4CA 4JG2A 3H3VH 2UUBQ 1MJCA 1PH1A 2Z6KC 2Z6KA 4DR3L 4A3EG 1N8RC 2HT1A 2VQFL 3GTGH 3UDFA 3GTLH 1QUQA 4EX5A 4DV5Q 5ELOA 3IRBA 1B8AA 2IHFA 3KF8B 4DR5Q 3L0OA 4DR1Q 1I6HH 5HY6A 3RN2A 1E7ZA 4YY3L 4JYAQ 2JA7H 2WP8J 3PUVA 2E5LQ 1I50H 4YCUA 3L7ZC 1SRUA 2OWOA 4TVAB 5JJIA 2YTVA 2ZTEA 3F2BA 1X56A 5JFFA 3CAMA 4LNQA 4HJ8A 3ULPA 1HNZQ 5IWAQ 2R93G 1PH3A 3SE5A 4DR2L 4LF7L 3ZLMA 4LF8L 3S17H 4R4OA 1X6OA 1OXVA 3KDFA 4DPGA 4B3ML 4GKJQ 4UP8A 1K3RA 4JI1L 5J3BA 1SN8A 3TQYA 1KD1C 1IBMQ 4K0KQ 4QJFA 3M3YH 2EIFA 4A3LG 2PQAB 5IY0A 1JMCA 5GAGC 2ZM6L 1OXXK 4NXML 3H3VI 2R7ZG 3T1HQ 2F4VL 3TS0A 1NY4A 1QVGA 3CQZH 4N67A 1CKNB 4UP7A 5IP9G 3JAMc 4B3RQ 5IT9c 3M4OH 1EOVA 3PIOA 1VQFA 1N36Q 4DKAC 1NE3A 1Y14B 1X9NA 2OTLA 5IYDG 3PF4A 3PIPA 2AHOB 2K50A 1MIUA 3RLFA 3J80i 1HZBA 5H1SE 3SHGA 1LTLA 4YWKA 3G6EA 1VQ7A 2KHJA 4DV6L 4PY3A 3I4OA 1PHJA 3RN5A 1EFWA 2AKWB 4OWTB 4X66Q 3PO2H 1IYJB 4DR4Q 1XMQQ 4DUYL 2JA5H 4WJ4A 1K9MC 2Q2UA 3S15H 1N9WA 4RG1A 4HIOA 1HZ9A 4UPAA 3STBC 4HIMA 1SLJA 5C3EH 5JEAJ 3F1ZA 1UE6A 2HIVA 4DV5L 4RMFA 1LUZA 1IZ6A 1VQNA 4LF6Q 4DR5L 4HJ7A 5C44H 2K5HA 1N33L 3H0GH 4DAYB 1EQQA 1JJ2A 1CSPA 3K7AH 4JYAL 4JOIC 2E5LL 1E24A 3RZDH 2JJQA 3OW2A 1Q82C 2UXBL 3HOWG 2N78A 1KQSA 2OQKA 3NBHB 1VQ4A 1HNZL 5CMTA 5JJ7A 3PO3G 3TEHB 3CPWA 4JI3Q 2KCTA 1WCMH 1X55A 3AFPA 1KRTA 3SN9A 4LUVA 2VW9A 4JI0Q 4JI2Q 4OX9Q 2D62A 1YHAA 4ME3A 2CQOA 3RNUA 3HOVH 1B70B 2WAQE 4DV3Q 4BA1I 2JA8G 3K81C 3HFZB 3T1HL 1I94Q 1JJGA 3J81c 3H15A 1UE5A 4P74A 2AWOA 4LU4A 3CCVA 4KHZA 4LFBL 1N36L 5C4JH 4ITRA 1SE8A 4OWXB 4A3KG 1G51A 3CP0A 3RR5A 3HOXH 2NVTH 2UU9Q 3D31A 1CKOA 5M5WH 3UE1A 2ASBA 3J7A5 1Z9FA 2WFWA 3CW2C 2JQOA 2UUAQ 1S3OA 4QL5A 2Y0SG 3CXCA 4LF7Q 4LF8Q 1YBYA 4OWWB 3SGIA 4A93H 5IYBH 3U4ZA 3I4NH 1C9OA 1PH4A 5IE8A 1KAWA 3CCLA 4X66L 3OYYA 1ASYA 4DR4L 3HKZG 1XMQL 1HH2P 3KJPA 1XJVA 1LM0A 3HOZH 3GTOH 4JBWA 5CKLA 3MEFA 4DV4L 4X6AH 3PV0A 2RHSB 3NENA 4O0AA 4BY1H 1YEZA 5EAYA 1IXRA 4C3IH 1X3GA 3CCEA 3S14H 4A3CH 4A3GH 3U50C 4LF6L 1E3PA 1G291 1AE3A 1OXUA 3PO2G 2JA5G 2Q2IA 4LFAQ 4XIGS 1OXSC 1Q1EA 2WB1G 1EQRA 1NMGA 1A62A 3TRZA 3RZOH 4A93G 1BKBA 4DV2Q 5C3EG 2PI2A 1HZAA 1VQJA 1L1OC 2WAQG 1IBKQ 2R92H 1Q1BA 1HZCA 4JI3L 4JI7Q 4GS3A 2K75A 3CCSA 5M3MH 5C44G 4DUYQ 2PQAA 4DR7Q 1K0RA 4IPCA 3KFUA 2IX0A 2K5NA 4YWLA 3J7ZC 1Q7YC 4DV3L 2JE6I 3GTPH 4OONA 5FJ8G 4IJHA 3CMEA 2B63G 5E7NA 1Q46A 1I94L 2YU9H 2XGTA 2MO1A 4U07A 5GROA 1N33Q 2YTXA 3T1YQ 4Y52H 4A3DH 1WCMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6Q A;  2LSS A;  1HR0 Q;  2OTJ A;  3CCQ A;  4JI8 Q;  5FLM H;  5LMN Q;  1UWV A;  1VQM A;  2JA6 G;  2QA4 A;  4DAM A;  2UU9 L;  2UXB Q;  4P73 A;  2E2H H;  3TRE A;  3JC6 6;  2UUA L;  2UUC Q;  4NXN Q;  2BH8 A;  1OTC A;  3HOU G;  2NZO A;  4FDB A;  2I5L X;  4BBR H;  4QGU A;  1Y1V H;  3ULJ A;  1PH8 A;  1PYS B;  3UDI A;  3PCO B;  2E2I H;  2I5H A;  3HKS A;  4HIK A;  1CSQ A;  5IP7 H;  4IPH A;  3ZJY C;  4JBJ A;  4C3J H;  4GNX B;  3CD6 A;  1HR0 W;  4IOA A;  2C35 B;  1G6P A;  3RLN A;  4LFC L;  5LMN W;  1MJE A;  1JB7 A;  1PFS A;  3K80 C;  4WGJ A;  4LFB Q;  2MNA A;  5JJL A;  1HJP A;  2IX1 A;  1YIT A;  1JE5 A;  1XNQ Q;  4X64 Q;  1VQO A;  1L2F A;  1R9T H;  2A1A A;  3CC7 A;  4LFA L;  5JJK A;  4C2M H;  3S2H H;  4A3F H;  1N34 Q;  3KJO A;  2I0Q A;  4DV2 L;  3CC4 A;  2NVX H;  1VQB A;  4HJ9 A;  1IBK L;  4A3G G;  1A0I A;  1E1T A;  3F8T A;  3KOJ A;  4YHH Q;  4P72 A;  4JI7 L;  1HNX Q;  2K52 A;  4GOP B;  1A63 A;  3HOY H;  4DR7 L;  3S6A A;  1W3S A;  2Y0S E;  1GO3 E;  1RL2 A;  2H5X A;  4TQU S;  1XNR Q;  4DV4 Q;  3W1B A;  5C0X I;  3UE0 A;  5C4X H;  1JJC B;  5C0X J;  2N49 A;  1D8L A;  1L0W A;  4DV1 Q;  3HKZ E;  4P71 A;  4BBS G;  4IJL A;  3D0F A;  3T1Y L;  4GKK L;  1TWF H;  1K83 H;  5M3M G;  1HR0 L;  1UEB A;  1HNW L;  4U0U A;  4JI8 L;  5LMN L;  4WJ3 M;  4DK3 C;  4OXP A;  3J80 c;  1NJI C;  4YWM A;  3S16 H;  1QVC A;  1TWH H;  4DK6 C;  1VQI A;  3M9B A;  4NXN L;  2UUC L;  2KHI A;  2JA9 A;  5DLQ E;  2XTI A;  5HGQ A;  1U0L A;  2AMC B;  3I4M H;  3L2P A;  2KCM A;  1X3F A;  2WB1 E;  4H02 A;  1PH7 A;  4JBK A;  1VS0 A;  4NB3 A;  2ZJR A;  4A4I A;  3A5U A;  4EQ5 A;  2JA7 G;  2IY5 B;  1YVC A;  4A3J H;  3I2Z A;  4X2E A;  5FLM G;  3ERS X;  3M85 A;  2FXQ A;  5GAE C;  3F2C A;  1YJN A;  1C0A A;  4BXX H;  3U4V A;  5BR8 Q;  2EQS A;  1VQE A;  2D0P A;  1B7Y B;  3NEL A;  1I3Q H;  4DV7 L;  5AJ3 Q;  1VQC A;  2UXC L;  1WI5 A;  4MTN A;  5GAD C;  5LMU L;  1P8L A;  4BBR G;  1NTG A;  1Y1V G;  4A3E H;  1JT8 A;  4GLA C;  1A8V A;  3I7F A;  1XNQ L;  1BBU A;  1FJG L;  4X64 L;  2ZJQ A;  2AWN A;  5C0X G;  3I56 A;  3BU2 A;  5IP7 G;  1YZ6 A;  2I5M X;  4M16 A;  1N34 L;  5JJ6 A;  4OO1 I;  1SRO A;  3G4S A;  3CCM A;  1UE1 A;  1BBW A;  3W1G A;  3CC2 A;  1KHI A;  1KL9 A;  4YCV A;  1PH6 A;  2Q2T A;  1VQK A;  4YHH L;  4LF5 L;  4X65 L;  4B3S L;  1HNX L;  2OCE A;  1EWI A;  2E8G A;  3MXN B;  5GQO A;  2F52 A;  2HIX A;  1WYD A;  1XNR L;  2JEA I;  1S40 A;  3A74 A;  1PVO A;  3KF6 B;  5M5X H;  3I55 A;  3TS2 A;  4A3F G;  4PZ7 A;  3FKI H;  2R7F A;  1CKM A;  3E9H A;  1SFO H;  2YYZ A;  4DV1 L;  3BZC A;  4A3L H;  1YJW A;  5K36 G;  1GD7 A;  1E1O A;  1VQL A;  1Y1W H;  1XPU A;  3PUZ A;  3Q8D A;  5IP9 H;  3J81 j;  2L15 A;  4ALP A;  1P16 A;  3HOY G;  4JV5 Q;  2ZTC A;  3EN2 A;  1YJ9 A;  1Q8K A;  3LGJ A;  1C7Y A;  4JCV E;  4KHP Q;  2K4K A;  4DUZ Q;  1N32 L;  4JI4 L;  5EU0 A;  5C4X G;  4C3H H;  5IYD H;  4GN3 B;  4IFD I;  3GO5 A;  2DUD A;  1KIX A;  1KXL A;  4GNX C;  3H0G G;  3PUX A;  2ES2 A;  4GNX A;  3GTM H;  3AYH B;  3DM3 A;  3CCU A;  4NPS A;  1CKN A;  1KC8 C;  2CWP A;  1YIJ A;  2CCZ A;  2K5V A;  3F2D A;  4OO1 G;  4LUZ A;  1EIF A;  2RHQ B;  3DLL A;  1GM5 A;  5M5Y H;  3ULL A;  5BR8 L;  1K73 C;  2E2J H;  2VNU D;  5AJ3 L;  2MFI A;  4YCW A;  4GKK Q;  3GDE A;  2R6G A;  4AQY Q;  2VS1 A;  4QY7 A;  4LWC A;  3GTK H;  1SMX A;  3S24 A;  3M4Q A;  1HNW Q;  1K8A C;  4R4Q A;  4IOC A;  3A0J A;  3HOV G;  2KEN A;  1W2B A;  4A3I H;  1V1Q A;  2VQE L;  3EIV A;  3K0X A;  4BY7 H;  4BXX G;  4HJA A;  2N3S A;  3M4P A;  1SR3 A;  2QEX A;  4A3B H;  3BZK A;  4POF A;  3HOW H;  2N8N A;  3VDY A;  3E9I A;  3AQQ A;  2ID0 A;  4X2C A;  3PUW A;  4KI0 A;  3PO3 H;  4L5S A;  2OQ0 A;  3GD7 A;  4R1J A;  2R7D A;  4A3M H;  3JAM i;  3HOX G;  1VQ8 A;  3B6Y A;  4DR6 L;  1PH9 A;  1TXY A;  4L5T A;  4R4T A;  4B3T L;  4LF4 Q;  3WWV A;  4DV7 Q;  2UXC Q;  4IFD G;  1BVS A;  5GAH C;  1PH2 A;  5LMU Q;  4UP9 A;  4MNO A;  1FL0 A;  5IYB G;  4A76 A;  1YI2 A;  1PA6 A;  1M90 C;  3K7U C;  2JA8 H;  3I4N G;  3GTJ H;  3CMA A;  4HID A;  1FJG Q;  3KYH C;  4JBM A;  4JI6 Q;  5M3F H;  2VL6 A;  2DGY A;  4JC0 A;  3CCJ A;  2F3I A;  2MO0 A;  1XMO Q;  1XPR A;  4POG A;  2Z0S A;  4JV5 L;  3HOZ G;  3EBE A;  4KHP L;  3CCR A;  4U0Z A;  4DUZ L;  1K8G A;  4A3K H;  3W5O A;  4U04 A;  1L1O B;  4BY1 G;  3FKI G;  4XTC S;  4LF9 Q;  3K8A A;  4A3C G;  4LF5 Q;  4X65 Q;  4B3S Q;  4X62 Q;  3ER0 A;  1Q81 C;  1Y1W G;  2PNH A;  2IHE A;  4LW1 A;  5CGL A;  1KRS A;  1V43 A;  4AH6 A;  1VQ6 A;  1QUQ B;  3RLO A;  4PG3 A;  1WJJ A;  2BA0 A;  3S1R H;  2JEB I;  4L5R C;  4JI5 L;  3UDG A;  2R92 G;  4AQY L;  4U0S A;  4A75 A;  4AYB E;  2ATW A;  1XTD A;  3G71 A;  1O7I A;  2V1C C;  1DGS A;  1IBL Q;  2GVB A;  1PYB A;  2BH2 A;  1EYG A;  3AEV A;  2MQH A;  2ZJP A;  1N32 Q;  2B29 A;  4JI4 Q;  1VQH A;  2VUM H;  4LFC Q;  2UXD L;  1EUJ A;  1PH5 A;  3KDF B;  1GVP A;  1GKH A;  1X65 A;  4APV A;  4LUO A;  3FHW A;  2UUB L;  4IPG A;  2ZTD A;  2QGQ A;  4A3D G;  1VQG A;  1QZH A;  3KF6 A;  3J81 i;  1VQD A;  2CFM A;  5IYC H;  1CUK A;  2PI2 E;  4PZ6 A;  1VQP A;  1EIY B;  4P75 A;  4QQB X;  4A3I G;  3OTO Q;  4DR1 L;  4O2D A;  4LF4 L;  1ASZ A;  4IPD A;  1WFQ A;  3PGZ A;  3CF5 A;  4BY7 G;  4JOI A;  3PSI A;  2YV5 A;  3GTQ H;  3NEM A;  4A3B G;  1YHQ A;  3PUY A;  1S72 A;  5FJ8 H;  2B63 H;  1VQ9 A;  3ZC7 A;  1E22 A;  3ZCB A;  1FGU A;  5IWA L;  4JI6 L;  1XMO L;  1FVI A;  4L5Q A;  4GLX A;  3N3U A;  1RIP A;  2G03 A;  2VQE Q;  4DV0 Q;  4A3M G;  2HHH Q;  4MZ9 A;  1YNX A;  1VQA A;  3KLW A;  2NN6 I;  1J5E Q;  4X2D A;  4J15 A;  4GKJ L;  2VY3 A;  3S2D H;  2JA6 H;  1I5F A;  4LF9 L;  1IBM L;  4K0K L;  4DR3 Q;  3PF5 A;  2ALY B;  2R93 H;  1V9P A;  2VQF Q;  3BJU A;  2IT1 A;  1Z47 A;  3HOU H;  1VCI A;  2GVA A;  4X62 L;  2NZH A;  1XPO A;  5M3F G;  4UY8 C;  4DR6 Q;  2HQL A;  4B3R L;  4AYB G;  4KLK A;  1VQ5 A;  4B3T Q;  1LYL A;  2VZA A;  4YY3 Q;  2F6S A;  1Q12 A;  2B3G A;  1IL2 A;  1H95 A;  5FLX c;  2EXD A;  4XI8 A;  3CPF A;  2A8V A;  3U58 A;  1Q86 C;  5JEA G;  1M1K C;  2NVQ H;  2Q2H A;  2R7Z H;  4Y7N H;  2LXK A;  3G48 A;  2KBN A;  1TWC H;  4DR2 Q;  1IBL L;  4QIW E;  3M7N A;  4AIM A;  3ICE A;  3E0E A;  4PMW A;  3STB D;  1X3E A;  1QZG A;  4B3M Q;  5JFZ A;  3AFQ A;  4JI1 Q;  1U5K A;  1NMF A;  4IO9 A;  1TWG H;  2GN5 A;  1PV4 A;  4PZ8 A;  2RCN A;  1NBW A;  4IFD J;  4BA2 I;  3S1Q H;  4NXM Q;  2YTY A;  2ZM6 Q;  1WOC A;  3UDX A;  3LET A;  2F4V Q;  3S1N H;  1D7Q A;  3FP9 A;  2CWA A;  2RF4 A;  1UE7 A;  1T9H A;  2NN6 G;  4GN5 A;  3CUC A;  5ELN A;  3OTO L;  2VUM G;  4JI5 Q;  2CKZ B;  3I4M G;  1MKH A;  2D0O A;  1AE2 A;  1OXT A;  1TWA H;  1X54 A;  2JK8 A;  2BA1 A;  3S1M H;  1AH9 A;  4HJ5 A;  4DV6 Q;  4BBS H;  4A3J G;  2NVY H;  1L1O A;  4GLV B;  4R4I A;  2LXJ A;  3A5Z B;  5IYC G;  4DV0 L;  2HHH L;  1YHB A;  4DNI A;  2PMZ E;  4GOP C;  4JI0 L;  4OX9 L;  4GOP A;  2K14 A;  4JI2 L;  2UXD Q;  1J5E L;  2A19 A;  1QVF A;  4GN4 B;  4R4C A;  4JG2 A;  3H3V H;  2UUB Q;  1MJC A;  1PH1 A;  2Z6K C;  2Z6K A;  4DR3 L;  4A3E G;  1N8R C;  2HT1 A;  2VQF L;  3GTG H;  3UDF A;  3GTL H;  1QUQ A;  4EX5 A;  4DV5 Q;  5ELO A;  3IRB A;  1B8A A;  2IHF A;  3KF8 B;  4DR5 Q;  3L0O A;  4DR1 Q;  1I6H H;  5HY6 A;  3RN2 A;  1E7Z A;  4YY3 L;  4JYA Q;  2JA7 H;  2WP8 J;  3PUV A;  2E5L Q;  1I50 H;  4YCU A;  3L7Z C;  1SRU A;  2OWO A;  4TVA B;  5JJI A;  2YTV A;  2ZTE A;  3F2B A;  1X56 A;  5JFF A;  3CAM A;  4LNQ A;  4HJ8 A;  3ULP A;  1HNZ Q;  5IWA Q;  2R93 G;  1PH3 A;  3SE5 A;  4DR2 L;  4LF7 L;  3ZLM A;  4LF8 L;  3S17 H;  4R4O A;  1X6O A;  1OXV A;  3KDF A;  4DPG A;  4B3M L;  4GKJ Q;  4UP8 A;  1K3R A;  4JI1 L;  5J3B A;  1SN8 A;  3TQY A;  1KD1 C;  1IBM Q;  4K0K Q;  4QJF A;  3M3Y H;  2EIF A;  4A3L G;  2PQA B;  5IY0 A;  1JMC A;  5GAG C;  2ZM6 L;  1OXX K;  4NXM L;  3H3V I;  2R7Z G;  3T1H Q;  2F4V L;  3TS0 A;  1NY4 A;  1QVG A;  3CQZ H;  4N67 A;  1CKN B;  4UP7 A;  5IP9 G;  3JAM c;  4B3R Q;  5IT9 c;  3M4O H;  1EOV A;  3PIO A;  1VQF A;  1N36 Q;  4DKA C;  1NE3 A;  1Y14 B;  1X9N A;  2OTL A;  5IYD G;  3PF4 A;  3PIP A;  2AHO B;  2K50 A;  1MIU A;  3RLF A;  3J80 i;  1HZB A;  5H1S E;  3SHG A;  1LTL A;  4YWK A;  3G6E A;  1VQ7 A;  2KHJ A;  4DV6 L;  4PY3 A;  3I4O A;  1PHJ A;  3RN5 A;  1EFW A;  2AKW B;  4OWT B;  4X66 Q;  3PO2 H;  1IYJ B;  4DR4 Q;  1XMQ Q;  4DUY L;  2JA5 H;  4WJ4 A;  1K9M C;  2Q2U A;  3S15 H;  1N9W A;  4RG1 A;  4HIO A;  1HZ9 A;  4UPA A;  3STB C;  4HIM A;  1SLJ A;  5C3E H;  5JEA J;  3F1Z A;  1UE6 A;  2HIV A;  4DV5 L;  4RMF A;  1LUZ A;  1IZ6 A;  1VQN A;  4LF6 Q;  4DR5 L;  4HJ7 A;  5C44 H;  2K5H A;  1N33 L;  3H0G H;  4DAY B;  1EQQ A;  1JJ2 A;  1CSP A;  3K7A H;  4JYA L;  4JOI C;  2E5L L;  1E24 A;  3RZD H;  2JJQ A;  3OW2 A;  1Q82 C;  2UXB L;  3HOW G;  2N78 A;  1KQS A;  2OQK A;  3NBH B;  1VQ4 A;  1HNZ L;  5CMT A;  5JJ7 A;  3PO3 G;  3TEH B;  3CPW A;  4JI3 Q;  2KCT A;  1WCM H;  1X55 A;  3AFP A;  1KRT A;  3SN9 A;  4LUV A;  2VW9 A;  4JI0 Q;  4JI2 Q;  4OX9 Q;  2D62 A;  1YHA A;  4ME3 A;  2CQO A;  3RNU A;  3HOV H;  1B70 B;  2WAQ E;  4DV3 Q;  4BA1 I;  2JA8 G;  3K81 C;  3HFZ B;  3T1H L;  1I94 Q;  1JJG A;  3J81 c;  3H15 A;  1UE5 A;  4P74 A;  2AWO A;  4LU4 A;  3CCV A;  4KHZ A;  4LFB L;  1N36 L;  5C4J H;  4ITR A;  1SE8 A;  4OWX B;  4A3K G;  1G51 A;  3CP0 A;  3RR5 A;  3HOX H;  2NVT H;  2UU9 Q;  3D31 A;  1CKO A;  5M5W H;  3UE1 A;  2ASB A;  3J7A 5;  1Z9F A;  2WFW A;  3CW2 C;  2JQO A;  2UUA Q;  1S3O A;  4QL5 A;  2Y0S G;  3CXC A;  4LF7 Q;  4LF8 Q;  1YBY A;  4OWW B;  3SGI A;  4A93 H;  5IYB H;  3U4Z A;  3I4N H;  1C9O A;  1PH4 A;  5IE8 A;  1KAW A;  3CCL A;  4X66 L;  3OYY A;  1ASY A;  4DR4 L;  3HKZ G;  1XMQ L;  1HH2 P;  3KJP A;  1XJV A;  1LM0 A;  3HOZ H;  3GTO H;  4JBW A;  5CKL A;  3MEF A;  4DV4 L;  4X6A H;  3PV0 A;  2RHS B;  3NEN A;  4O0A A;  4BY1 H;  1YEZ A;  5EAY A;  1IXR A;  4C3I H;  1X3G A;  3CCE A;  3S14 H;  4A3C H;  4A3G H;  3U50 C;  4LF6 L;  1E3P A;  1G29 1;  1AE3 A;  1OXU A;  3PO2 G;  2JA5 G;  2Q2I A;  4LFA Q;  4XIG S;  1OXS C;  1Q1E A;  2WB1 G;  1EQR A;  1NMG A;  1A62 A;  3TRZ A;  3RZO H;  4A93 G;  1BKB A;  4DV2 Q;  5C3E G;  2PI2 A;  1HZA A;  1VQJ A;  1L1O C;  2WAQ G;  1IBK Q;  2R92 H;  1Q1B A;  1HZC A;  4JI3 L;  4JI7 Q;  4GS3 A;  2K75 A;  3CCS A;  5M3M H;  5C44 G;  4DUY Q;  2PQA A;  4DR7 Q;  1K0R A;  4IPC A;  3KFU A;  2IX0 A;  2K5N A;  4YWL A;  3J7Z C;  1Q7Y C;  4DV3 L;  2JE6 I;  3GTP H;  4OON A;  5FJ8 G;  4IJH A;  3CME A;  2B63 G;  5E7N A;  1Q46 A;  1I94 L;  2YU9 H;  2XGT A;  2MO1 A;  4U07 A;  5GRO A;  1N33 Q;  2YTX A;  3T1Y Q;  4Y52 H;  4A3D H;  1WCM G; 
#chains in the Genus database with same CATH topology
 1J6Q A;  2CQA A;  5KND A;  1ET6 A;  4JI8 Q;  5C4H A;  5LMN Q;  3A8J E;  2JA6 G;  1SE4 A;  4DAM A;  4FF2 A;  1EEF D;  2E2H H;  3TRE A;  2UUC Q;  2BH8 A;  3HOU G;  2F0H A;  4QGU A;  1FD7 D;  1CA6 A;  3ULJ A;  2E2I H;  3PCO B;  5D14 A;  4ZQ3 A;  2D2C C;  1CFM A;  1PZI D;  4IPH A;  5FLX L;  4JBJ A;  4GNX B;  4IOA A;  1G6P A;  3VR4 A;  5HUR A;  4DAY A;  5LMN W;  1ZKO A;  2F0M A;  1HJP A;  1LTT D;  5LL6 S;  3T13 A;  4X64 Q;  2XIW A;  4RKB A;  2A1A A;  5D3I B;  5JJK A;  1DD2 A;  5CV6 A;  2Q8I B;  3K57 A;  3S2H H;  2RDG A;  5EKI A;  1DCZ A;  3J7A F;  2B8F A;  1E1T A;  4YHH Q;  1S5F D;  4P72 A;  1K0S A;  2K52 A;  1A63 A;  3WOE A;  1W3S A;  2LFN A;  1SJE D;  1LT5 D;  2H5X A;  3KLS A;  1QIL A;  4J8Q A;  1D8L A;  4KJO A;  1L0W A;  3HKZ E;  4P71 A;  1AFP A;  4BBS G;  1MHW C;  3D0F A;  5COR A;  1DOL A;  1TWF H;  3P7J A;  1HNW L;  4U0U A;  4WJ3 M;  4DK3 C;  3S16 H;  4G7Z C;  4DK6 C;  3NPP A;  4WOR A;  1EU3 A;  1R4Q B;  5HGQ A;  2AMC B;  2CVR A;  1FGB D;  2WB1 E;  1PH7 A;  4JBK A;  5I4D A;  2JA7 G;  1YVC A;  4H0L C;  3M85 A;  4FP5 D;  5GAE C;  2HUG A;  4Y7N B;  3F2C A;  4Q5V A;  1TWC B;  4BXX H;  3U4V A;  4C56 C;  4DV7 L;  1I3Q H;  5AJ3 Q;  4JK1 C;  2UXC L;  2NUC A;  4B9W A;  2NUD A;  3KBX A;  4IUV A;  4MTN A;  5GAD C;  4A3E H;  2EJG C;  1TVX A;  3I7F A;  2ZXR A;  3S1Q B;  3FRP B;  3HZX A;  1YZ6 A;  2DY7 A;  3T4A C;  4M16 A;  5JJ6 A;  4OO1 I;  2BE5 D;  3G4S A;  5IGC A;  1PDQ A;  3W1G A;  4G7H C;  2LMC B;  4YCV A;  1PH6 A;  3CC2 A;  4BS9 A;  1VQK A;  4QF4 A;  4X65 L;  1HNX L;  2OCE A;  3H94 A;  3TZD A;  1D5M C;  1WYD A;  1D1I A;  1XNR L;  2JEA I;  1S40 A;  3KF6 B;  3E9H A;  4DV1 L;  1YJW A;  3E5S A;  3MTS A;  2F0G A;  3EN2 A;  3OWE B;  3I3C A;  2HCC A;  1YJ9 A;  2K4K A;  4JI4 L;  3MFG A;  1CQV A;  3R93 A;  2K5Q A;  1I6H B;  1KIX A;  2HDL A;  4ZLT F;  3G7L A;  3H0G G;  3GTM H;  1ZYR D;  2CWP A;  1YIJ A;  4K5V A;  3K6O A;  1GM5 A;  3E6Z X;  5BR8 L;  1K73 C;  2KCN A;  1G2T A;  1GXD C;  1XX8 A;  1AP0 A;  2NZ1 D;  4LWC A;  1SMX A;  1K8A C;  3BYT B;  4DA2 A;  3A0J A;  3HOV G;  1W2B A;  2Y0S B;  4LAA A;  2VQE L;  3KLR A;  3EIV A;  3CQZ B;  2NUN A;  4BY7 H;  4BXX G;  1SR3 A;  3A8I E;  4JVZ A;  3HOW H;  2PNR C;  3AQQ A;  2ID0 A;  1E0B A;  2B2Y A;  3MWY W;  3GD7 A;  1QJO A;  3HOX G;  1VQ8 A;  4DR6 L;  4ULL A;  1SYF A;  4IFD G;  1PH2 A;  1CHQ D;  1SXT A;  5IYB G;  3A56 A;  1XYI A;  2JA8 H;  1V1P B;  3K5N A;  4JI6 Q;  2ATW A;  2VL6 A;  3CCJ A;  3X3M A;  2MO0 A;  1XPR A;  1U9R A;  4HTH A;  1W6J A;  4FF1 A;  1U4L A;  4LF5 Q;  3KUP A;  3I91 A;  4X62 Q;  4P2C B;  2BE5 C;  4IUT A;  1ML0 D;  1V43 A;  1JCK B;  1QUQ B;  4M1U B;  3MC0 B;  1WJJ A;  3I70 A;  4XT1 B;  4JI5 L;  2R92 G;  4U0S A;  4XXE A;  2HQE A;  3G71 A;  2Z4H A;  2EYH A;  3BDO A;  3LX0 A;  2GVB A;  1PZK D;  4NW2 A;  3AEV A;  2ZJP A;  5CV7 A;  1PH5 A;  3KDF B;  1X65 A;  5TSS A;  3MXN A;  4IPG A;  5C4J B;  2QGQ A;  1JR0 D;  1VQG A;  3LNN A;  4FF4 A;  4H44 C;  4RH6 A;  4PZ6 A;  2DY8 A;  4LF4 L;  3PGZ A;  2VXW A;  4BY7 G;  1ZYR C;  3PSI A;  5C3X A;  3ZC7 A;  1E22 A;  1FGU A;  4GLX A;  2G03 A;  1GUW A;  1EEI D;  1VF7 A;  1KAB A;  4MHE A;  4BY1 B;  4GKJ L;  3J7Y W;  4CKE A;  1IBM L;  4K0K L;  2VQF Q;  1Y1W B;  2K33 A;  4KN4 C;  3KBG A;  3GV3 A;  4ILW A;  3FDT A;  4CDD C;  1VQ5 A;  1F2M A;  1R4P B;  2EXD A;  5D65 A;  3SK5 A;  3U58 A;  1Q86 C;  4RWS C;  1M1K C;  2NVQ H;  2R7Z H;  2GA4 B;  1WTR A;  2KBN A;  1IBL L;  1G91 A;  3ICE A;  3QJY A;  5COY A;  4PMW A;  1X3E A;  1QZG A;  4IO9 A;  2GN5 A;  4A3D B;  1V1O A;  4NXM Q;  2PZW A;  3MZ5 A;  2CWA A;  2E2H B;  2MUY A;  1FYC A;  5ELN A;  2XVS A;  1EZ6 A;  3I4M G;  3MHB A;  1HRJ A;  3K5L A;  1MKH A;  1OXT A;  3PIP 3;  4HCE A;  1TWA H;  2BA1 A;  2JK8 A;  4KKS A;  1CZG A;  4XDX A;  2EY5 A;  1XWE A;  4A3J G;  3KK7 A;  1EOT A;  3R2T A;  4DV0 L;  2EVB A;  4IUQ A;  5EBD A;  3H3V H;  1BO0 A;  1TS4 A;  4DR3 L;  2HT1 A;  3GTG H;  2KED A;  4EX5 A;  4DV5 Q;  4AYB B;  1MSH A;  5ELO A;  3S2H B;  3L0O A;  5HY6 A;  3RN2 A;  4IAL A;  2RSO A;  2B2U A;  5JJI A;  4TVA B;  2YTV A;  2ZTE A;  3SVM A;  1X56 A;  5JFF A;  1LTB D;  2I07 B;  3CAM A;  5KYI A;  3ULP A;  5IWA Q;  2EJM A;  3SE5 A;  4ODG A;  4CKB A;  4LF8 L;  3OPO A;  1OXV A;  4DPG A;  4B3M L;  1MI2 A;  1ROD A;  1B3A A;  2XRS D;  1EU4 A;  3IFD A;  3AU7 A;  1TWF B;  4IUP A;  2PQA B;  4A3L G;  2ZM6 L;  1OXX K;  2M00 A;  2R7Z G;  2F4V L;  1QVG A;  3MXP A;  3S16 B;  3M4O H;  1EOV A;  2XNA C;  1VQF A;  3EJI A;  1B3Q A;  1NE3 A;  1WTH A;  2OTL A;  1CT1 D;  5IYD G;  3PF4 A;  4C3H G;  3BVM A;  3RLF A;  1HZB A;  5H1S E;  3SHG A;  2Z4I A;  3NBI A;  2EXZ A;  3G6E A;  4DV6 L;  4PY3 A;  1I3Q B;  1IYJ B;  3TP8 A;  4DUY L;  4XT3 B;  4PNY A;  4WRD A;  4DXF A;  2K1B A;  4A3E B;  3S15 H;  2L12 A;  4HIO A;  4HIM A;  3VYR A;  5JEA J;  4RMF A;  1IZ6 A;  2KCC A;  2ICI A;  4JYA L;  4JOI C;  2CW0 D;  3NXW A;  1Q82 C;  4OO1 H;  2QF7 A;  2UXB L;  4ZAI A;  1HNZ L;  1WCM H;  1KRT A;  3SN9 A;  4OX9 Q;  2VW9 A;  2CQO A;  1B70 B;  2B2T C;  2X6G A;  3HFZ B;  4ZYS A;  3J81 c;  1UE5 A;  4BWG B;  1ENF A;  2K05 A;  2AWO A;  4LU4 A;  3CCV A;  4LFB L;  1N36 L;  5JOB A;  3CP0 A;  2L55 A;  2FIN B;  2NVT H;  5M5W H;  2ASB A;  3J7A 5;  2AQ2 B;  3CW2 C;  1VDZ A;  2JQO A;  3GTM B;  3J80 E;  1S3O A;  3O13 A;  4QL5 A;  4A93 H;  3U4Z A;  1H9M A;  2QDL A;  3I4N H;  1C9O A;  2BDN A;  5IE8 A;  1EL0 A;  3FVQ A;  4X66 L;  1ASY A;  4DR4 L;  4RCO A;  1XJV A;  3PV0 A;  4C3I H;  4A3G H;  2OXP A;  3U50 C;  4LF6 L;  1E3P A;  1LT3 D;  1PTO D;  2KHS A;  4BY7 B;  2Q2I A;  1EIH A;  3TME A;  3HOW B;  4EQO A;  1A62 A;  1FNV A;  3TRZ A;  2SDF A;  1EFI D;  2VB2 X;  1CM9 A;  1HZA A;  4KY5 A;  2A6H D;  1VQJ A;  3I8Z A;  1HZC A;  2SNM A;  5M3M H;  1BNZ A;  1EQV A;  2LY7 A;  2JA8 B;  3DM1 A;  3T53 B;  3J7Z C;  3SXH A;  2JE6 I;  4UDU C;  4CDF C;  4CJ2 C;  1I94 L;  3M7G A;  2BCO A;  4U07 A;  5GRO A;  3VR3 A;  4EGV A;  2DNE A;  5I6W A;  1WCM G;  2FHT A;  3KLS X;  3CCQ A;  5FLM H;  1UWV A;  1VQM A;  2QA4 A;  1PMR A;  1I4R A;  4P73 A;  2UUA L;  4TSS A;  2L9H A;  4RCN A;  2F0L A;  2CW0 C;  3A55 A;  4BBR H;  4RHS A;  1PH8 A;  1HFN A;  1PRT B;  3M4Y A;  4UHV A;  1CQF A;  1SYG A;  1T5X D;  1CSQ A;  5IP7 H;  1S5B D;  2EY2 A;  2C35 B;  2F0W A;  2K04 A;  1MJE A;  1JB7 A;  3K80 C;  3G6J B;  2IX1 A;  1JE5 A;  4NKL A;  4DXG A;  1VQO A;  4JPB W;  5KNB A;  4LFA L;  1L0X B;  4C2M H;  3R8B A;  4A3F H;  2WAQ B;  4DV2 L;  4CJ1 B;  4A3G G;  3F8T A;  3KOJ A;  1ONL A;  1HNX Q;  1EY4 A;  1A15 A;  3DUZ A;  1XNR Q;  4DV4 Q;  5A2Q L;  2N49 A;  4OGQ C;  3AB9 A;  4DV1 Q;  2OEO A;  5M3M G;  3P1H A;  5IOC A;  5DM6 3;  4U67 3;  1O7L A;  3J80 c;  1NJI C;  1QVC A;  1PTO C;  1IW7 D;  1VQI A;  4QB4 A;  1QWY A;  1HUM A;  1MSG A;  3L2P A;  3A8K E;  3OOC A;  4NMZ A;  4NB3 A;  1UAP A;  5G3L F;  4A4I A;  3FEW X;  4NP5 A;  4DK0 A;  2NVQ B;  4X2E A;  2A6H C;  5FLM G;  2R7Z B;  1HFG A;  5BR8 Q;  3QG1 A;  1B7Y B;  3A7A B;  2NYZ D;  5FOB B;  1WI5 A;  4Z9C B;  5ELF A;  5LMU L;  4BBR G;  1NTG A;  1A8V A;  1BBU A;  1FJG L;  5C0X G;  4G4K A;  4KN7 C;  5IP7 G;  1LTG D;  4X3K A;  3CCM A;  4K5X A;  2ICE C;  5FO7 B;  3JAM L;  1HA6 A;  3DWP A;  5IT9 L;  1EYA A;  5GQO A;  2F52 A;  1TWA B;  3KF8 A;  3MFY A;  3A74 A;  1PVO A;  5M5X H;  4QUC A;  5CC4 A;  4A3F G;  4KKU A;  3FKI H;  4PZ7 A;  3TS2 A;  1XXG A;  1SFO H;  1E1O A;  1Y1W H;  3PUZ A;  5IP9 H;  3J81 j;  1P16 A;  4PMC A;  1Q8K A;  3SEB A;  4JCV E;  1J9O A;  3GTG B;  4QCL A;  5EU0 A;  4V19 0;  2B39 A;  4GN3 B;  5EBC A;  1D2B A;  1KXL A;  1GUG A;  2ES2 A;  3N6R A;  4M8A A;  3AYH B;  3DM3 A;  1DM0 B;  3HS0 C;  1CKN A;  5CMD A;  3F2D A;  1SYC A;  1PTO H;  2RHQ B;  2DNC A;  5C3W A;  2F0T A;  5E4W C;  5EKL A;  1G8Z D;  4YCW A;  4GKK Q;  2F0F A;  2R6G A;  3PQI A;  3GP7 A;  3M4Q A;  3L3O C;  3QOJ A;  2K32 A;  3Q22 A;  3I73 A;  1NCV A;  3NUC A;  3D3R A;  1I4G A;  3M4P A;  4X3U A;  2QEX A;  3M4O B;  3K58 A;  2WAC A;  3VDY A;  4X2C A;  3PO3 H;  2OQ0 A;  1IW7 C;  1SAP A;  2R7D A;  4N9P A;  1AEX A;  4R1J A;  4A3M H;  3JAM i;  4K2K A;  5JPN C;  1TXY A;  4R4T A;  4B3T L;  4LF4 Q;  3WWV A;  2F0I A;  2SNS A;  5GAH C;  1A3U A;  1BCP B;  1EY9 A;  4XQN A;  1YI2 A;  1FL0 A;  1PRT D;  3SK8 A;  3GTJ H;  4C1N I;  5M3F H;  2DGY A;  4JC0 A;  3S15 B;  4JV5 L;  2JYO A;  3NSW A;  1J8I A;  4IUN A;  3HG9 A;  4A3K H;  2RBM A;  1I4P A;  4BY1 G;  3C2P A;  3FKI G;  4XTC S;  3R3O A;  1GUO A;  4A3C G;  4B3S Q;  4QUF A;  1Y1W G;  2PNH A;  1HXY D;  4LW1 A;  5CGL A;  1KRS A;  2L0C A;  3S1R H;  4YIJ A;  1F9P A;  1WCM B;  3P20 A;  5CBE E;  4A75 A;  1IBL Q;  1U4M A;  1F9R A;  2NN6 H;  2J7Z A;  2PO4 A;  1N32 Q;  3K0Y A;  4ZCK A;  3VR6 A;  1E2W A;  2L11 A;  2VUM H;  5J1Z A;  4KD3 A;  5CR3 A;  4APV A;  3Q0A A;  4LUO A;  5EQ0 A;  1X32 A;  2UUB L;  2ZTD A;  2F0N A;  4A3D G;  2V4D A;  2NVT B;  5FO9 B;  5M5W B;  2CFM A;  1SEB D;  1CUK A;  1EIY B;  4P75 A;  4DR1 L;  4ME5 A;  4A93 B;  1WFQ A;  3CF5 A;  2JP1 A;  3I72 A;  3I4N B;  2YV5 A;  5L37 A;  2MPM A;  4S3S A;  5KIX A;  1YHQ A;  1S72 A;  5FJ8 H;  2B63 H;  1VQ9 A;  1B1Z A;  3ZCB A;  1PFB A;  1FVI A;  1RIP A;  1Y8P B;  2PZT A;  2SEB D;  3A7L A;  4DV0 Q;  4A3M G;  2N88 A;  3DEP A;  4C3I B;  4A3G B;  4LF9 L;  4DFA A;  4DR3 Q;  3PF5 A;  2ALY B;  3BJU A;  1MBY A;  5M3F G;  2VB3 X;  4B3R L;  4AYB G;  4KLK A;  1SE3 A;  2VZA A;  1Q12 A;  5E4X A;  1E2V A;  1H95 A;  5FLX c;  1RTN A;  3CPF A;  1BOS A;  2IWH A;  4DU9 A;  5M3M B;  1BQQ T;  3D4D A;  4RGT A;  2G9D A;  2IL8 A;  3TP5 A;  4L63 B;  5KEE A;  4HMI A;  1FNW A;  4IUR A;  3E0E A;  4B3M Q;  3AFQ A;  1PRT C;  1LTR D;  1U5K A;  1NMF A;  4PZ8 A;  4ZKC B;  2A68 D;  4DGZ A;  2IJ0 A;  2YTY A;  2ZM6 Q;  5IIF A;  3I90 A;  5IGB A;  2F4V Q;  1ICF B;  2NN6 G;  4GN5 A;  3OTO L;  5C5M A;  3VA7 A;  2VUM G;  1TS2 A;  4BBR B;  2D0O A;  1JOR A;  1BDO A;  1AH9 A;  4DV6 Q;  1L1O A;  3SE0 A;  2FMM A;  2HHH L;  4DNI A;  2PPB C;  2PMZ E;  1Y69 U;  2UXD Q;  2K14 A;  4JI2 L;  4GN4 B;  5DNF A;  3D6C A;  1H9S A;  2Z6K A;  4A3E G;  1N8R C;  1KDB A;  3UDF A;  1HTL D;  3IRB A;  4C2M B;  3KF8 B;  2JN4 A;  4A3F B;  4N8F A;  4JYA Q;  3PUV A;  3V96 A;  2PZU A;  5I9P A;  1SRU A;  2SOB A;  1S4Z A;  2C5C A;  1U4P A;  1HNZ Q;  1RKN A;  2RSN A;  4DR2 L;  3NTH A;  4OEM B;  3CHB D;  5ELD A;  1K8M A;  3ZYY X;  1BCP D;  4QJF A;  5A35 A;  3M3Y H;  2LS0 1;  2EIF A;  1JMC A;  1Q3L A;  4N67 A;  1CKN B;  1QG7 A;  3ITP A;  4KD4 A;  3PIO A;  1N36 Q;  1X9N A;  3W3A A;  1I4H A;  3PIP A;  2K50 A;  1MIU A;  4CGY B;  2WKD A;  3PMF A;  2KHJ A;  5K36 H;  1PHJ A;  3IFT A;  3RN5 A;  4OWT B;  4X66 Q;  5CV5 A;  4DR4 Q;  2JA5 H;  4WJ4 A;  1K9M C;  3GTQ B;  1N9W A;  1TS3 A;  3NTK A;  4UPA A;  5C3E H;  1VF5 C;  5ELE A;  4DK1 A;  2F1M A;  1WTV A;  4LF6 Q;  2A68 C;  4QIW B;  1N33 L;  4DAY B;  1ET9 A;  1CSP A;  3HRZ C;  3K7A H;  2E5L L;  3H3V C;  3S2D B;  2JJQ A;  1LTI D;  4KTA A;  2Q8T A;  4RAU C;  3HOW G;  1RTO A;  2K01 A;  3AFP A;  5M5X B;  4JI0 Q;  2QDB A;  1YHA A;  3FKI B;  1SFO B;  3MA2 B;  3RNU A;  4HR7 B;  1QE6 A;  1Z6H A;  2PW5 A;  1LO5 D;  4BA1 I;  2JA8 G;  1SE2 A;  2RVL A;  3T1H L;  1I94 Q;  3H15 A;  3FPU B;  1TWG B;  2A69 D;  4F87 A;  4ITR A;  1SE8 A;  5FKA C;  3D31 A;  1CKO A;  1M4V A;  2PW7 A;  2K28 A;  2B8G A;  2UUA Q;  1TU2 B;  1EQT A;  4LF7 Q;  1A3V A;  4H7B A;  3P75 A;  4G7O C;  1PTO B;  2ZXP A;  3BS1 A;  2QCP X;  2IPK D;  1EYD A;  3HKZ G;  1XMQ L;  1HQM C;  3KJP A;  1C8C A;  1JWU D;  3EQL C;  3HOZ H;  4HN7 A;  1SND A;  3QB3 A;  4X6A H;  3NEN A;  4O0A A;  3S14 H;  5EAY A;  5IOD A;  5I6Y A;  3J81 E;  1BCP C;  1A6X A;  2JXM B;  2EZV A;  3PIO 3;  2JA5 G;  4LFA Q;  4XIG S;  2WB1 G;  1AZQ A;  1SSO A;  5F2D A;  3PO3 B;  4DV2 Q;  5C3E G;  4A3M B;  1A2T A;  2WAQ G;  1S5C D;  2K75 A;  3CCS A;  1W6K A;  5DAU A;  1EIG A;  3MVV A;  3QIA A;  2K5N A;  4YWL A;  1Q7Y C;  3GTJ B;  4KY6 A;  4DV3 L;  4OON A;  5M3F B;  3CME A;  4IJH A;  1GHK A;  3WOF A;  2MO1 A;  2YTX A;  1KC8 C;  4A3K B;  2OTJ A;  2Q8R E;  1RCV D;  2Z9H A;  1OTC A;  1B4O A;  1STG A;  2NZO A;  1EY0 A;  2OF1 A;  3K5O A;  3UDI A;  2Z1C A;  3S1R B;  3HKS A;  1NSN S;  2EYF A;  4HIK A;  2O5I C;  1F2Y A;  4C3J H;  3MXG A;  3RLN A;  2EYL A;  4LFC L;  2F4I A;  1EYC A;  1PFS A;  1ESF A;  2PQE A;  2MNA A;  4UAI A;  2VUM B;  1YIT A;  2E76 C;  1L2F A;  3NBH A;  1ESR A;  3CC7 A;  1JOO A;  2D5D A;  2KJX A;  4PV1 C;  2XWJ B;  3KJO A;  4KK7 A;  2I0Q A;  2A69 C;  2NVX H;  1VQB A;  4HJ9 A;  2L4N A;  5EGT A;  4X3T A;  2Y0S E;  1GO3 E;  2B63 B;  2CHB D;  1SNO A;  3URY A;  3SHL A;  5C4X H;  5C0X J;  4MTK A;  3HP3 A;  4HSP A;  4IJL A;  4X3S A;  3T1Y L;  2XRQ D;  1K83 H;  1LAC A;  1PRT F;  1KDA A;  1HR0 L;  3MAQ A;  1UEB A;  1EZ8 A;  1G2S A;  4OHJ A;  4OXP A;  4YWM A;  1TWH H;  1GUN A;  5CBA E;  4NXN L;  1SJH D;  2KHI A;  2JA9 A;  2QKI C;  2XTI A;  1U0L A;  4OIK A;  4V0B A;  3DHQ A;  2KCM A;  3A54 A;  1KAA A;  1SDF A;  1VS0 A;  2ZJR A;  3T16 A;  2HDM A;  3A5U A;  2EYJ A;  3LWU A;  2FXQ A;  3DEO A;  1C0A A;  2EYP A;  2F03 A;  2EQS A;  1VQE A;  1TQO A;  1AN8 A;  4K6L A;  4EVO A;  1P8L A;  2DN8 A;  3NK9 A;  1JT8 A;  1XNQ L;  2B2W C;  3I56 A;  4EQP A;  2I5M X;  2CH4 W;  4C3J G;  1N34 L;  3CRL C;  1PYW D;  1BBW A;  1KHI A;  1KL9 A;  2Q2T A;  4FF3 A;  4RGO S;  3OW7 A;  4LF5 L;  1GHJ A;  1Y8O B;  5M9O A;  4ABN A;  1WTP A;  1EWI A;  2E8G A;  3MXN B;  5KGU A;  2MGS A;  3NTI A;  2HIX A;  1STH A;  3I55 A;  2R7F A;  5J39 A;  1CKM A;  2YYZ A;  5FK9 C;  1NH1 A;  4RA8 A;  4C1N K;  1XPU A;  2L15 A;  4JV5 Q;  1C7Y A;  3DMU A;  3LGJ A;  5C4Z A;  5C4X G;  4IFD I;  1KLU D;  2A73 B;  1EY8 A;  2A6E D;  3GO5 A;  4I7A A;  2XSC A;  3PUX A;  1I4X A;  2EDG A;  4GNX A;  2EY6 A;  3CCU A;  2CCZ A;  2K5V A;  4OO1 G;  1UNS A;  2EYM A;  2K5D A;  3ULL A;  2E2J H;  3VYS A;  3LWE A;  2VNU D;  4QY7 A;  5KRU A;  3S24 A;  1HNW Q;  4R4Q A;  1I4Q A;  4IOC A;  2F0O A;  5EPL A;  3M3Y B;  1IKM A;  1DOK A;  3UI2 A;  4A3I H;  5BN5 A;  3K0X A;  1GUT A;  4HJA A;  2N3S A;  2E2D C;  4K6D A;  3BZK A;  1HTP A;  3HKZ B;  3U9S A;  1PFM A;  4KI0 A;  3U9O A;  3PUW A;  2P5Z X;  4L5S A;  4KJN A;  1PH9 A;  4FNF A;  4L5T A;  4DV7 Q;  5DEH A;  2UXC Q;  5I2X A;  3BVZ A;  2Z6B A;  4A76 A;  4XQJ A;  4A93 G;  2NBF A;  5A2Q E;  3K7U C;  3I4N G;  2JA5 B;  3CMA A;  4U68 A;  2WB1 B;  3KYH C;  4JBM A;  4POG A;  2Z0S A;  5C3E B;  3EBE A;  4KHP L;  2XN9 C;  4DUZ L;  1LT6 D;  4R9W A;  5EKK A;  4C3I G;  5JEA H;  4LF9 Q;  3GQB A;  3K8A A;  4X65 Q;  3K7A B;  4JW0 A;  3ER0 A;  1Q81 C;  2IHE A;  4OEL B;  1B2T A;  1VQ6 A;  2K7V A;  3RLO A;  1UUP A;  4PG3 A;  2WV6 D;  4PQX A;  3NE5 B;  1HCZ A;  3UDG A;  4AQY L;  1IYU A;  1C4Q A;  2KA7 A;  4AYB E;  2V1C C;  1A3T A;  1DGS A;  5JPM C;  1LT4 D;  5C6A A;  1EYG A;  2MQH A;  1SYB A;  2B29 A;  4R8I A;  4JI4 Q;  1SNQ A;  1JE4 A;  4RGN A;  1GKH A;  1MGS A;  1BCP F;  2K5W A;  3WDN A;  2F0Q A;  1KDC A;  2DJF C;  2WII B;  1X3Q A;  3KF6 A;  3D4W A;  3HGB A;  1VQD A;  1RHP A;  2PI2 E;  1IL8 A;  2A6E C;  4A3I G;  3OTO Q;  4O2D A;  2RDH A;  1JWS D;  4JOI A;  1GUS A;  3GTQ H;  3I4L A;  1AW7 A;  5IWA L;  3HOZ B;  1XMO L;  4L5Q A;  3TDQ A;  3N3U A;  2VQE Q;  4I65 A;  2HHH Q;  1YNX A;  3S14 B;  4X2D A;  4J15 A;  2G5D A;  3S2D H;  5E1F A;  4FXD A;  2JA6 H;  3FPP A;  3VA5 A;  2B2T A;  2R93 H;  5JVG 3;  2IT1 A;  3HOU H;  1VCI A;  5E3F A;  5IGG A;  5IGD A;  2NZH A;  4UY8 C;  4DR6 Q;  2HQL A;  1LYL A;  5D3D A;  1NNX A;  1Z7T A;  3CRK C;  1L0Y B;  5JEA G;  2Q2H A;  1PLF A;  1UEA B;  2LXK A;  3G48 A;  2E75 C;  4DR2 Q;  1C48 A;  3R2I A;  3STB D;  1JWM D;  1TWG H;  2TSS A;  2C9O A;  2RCN A;  2K03 A;  4BA2 I;  4IFD J;  2KVM A;  1AZP A;  3LET A;  1V8Q A;  4OL7 A;  3S1N H;  3TP6 A;  2JSO A;  4O1N A;  3FP9 A;  1JB3 A;  1UE7 A;  1T9H A;  3CUC A;  1V1P A;  4DNT B;  4JI5 Q;  5CV8 A;  3OSO A;  5FLX E;  2DJG C;  3OMC A;  4HAE A;  1AE2 A;  1X54 A;  4XYO A;  3S1M H;  4XYQ A;  4HJ5 A;  4BBS H;  2NVY H;  1H9R A;  4GLV B;  4C3J B;  3BG3 A;  1YHB A;  4OX9 L;  4GOP A;  1J5E L;  1EY7 A;  1QVF A;  4R4C A;  1FNU A;  1MJC A;  3IKJ A;  2EJF C;  2Z6K C;  2B2Y C;  3W2D A;  1BUV T;  3GTL H;  1QUQ A;  1WTO A;  2M9V A;  1QNK A;  1IYV A;  1B8A A;  4L8J A;  4XQQ A;  4FXG C;  4YY3 L;  2JA7 H;  2WP8 J;  2E5L Q;  2F0K A;  2NVX B;  1I50 H;  4YCU A;  3F2B A;  4LNQ A;  1WTW A;  5J22 A;  1O78 A;  5DM7 3;  2R93 G;  1PH3 A;  4QMG A;  3S17 H;  1WD0 A;  4R4O A;  2O2L D;  3KDF A;  3Q24 A;  5C4X B;  4GKJ Q;  4UP8 A;  3BDL A;  1K3R A;  4JI1 L;  3SK4 A;  2EYO A;  4F7X A;  5J3B A;  1SN8 A;  3TQY A;  1IBM Q;  4K0K Q;  2K6A A;  1K83 B;  5IY0 A;  3H3V I;  2LKV A;  3T1H Q;  4GZY C;  4UP7 A;  5IP9 G;  3JAM c;  1TWH B;  5IT9 c;  2E74 C;  2EOT A;  4DKA C;  4MN3 A;  4Q0F A;  3H91 A;  3ERO A;  3OIP A;  2A5H A;  1PFN A;  1LTL A;  3N52 A;  3MEH A;  4DF7 A;  1VQ7 A;  5JJZ A;  3I4O A;  1EFW A;  3PO2 H;  1ENA A;  1XMQ Q;  2WIN B;  3STB C;  1SLJ A;  4DN4 M;  2ENB A;  3F1Z A;  1UE6 A;  2HIV A;  4WFN 3;  1LUZ A;  2AQ3 B;  1VQN A;  1H9J A;  4HJ7 A;  4DR5 L;  2K5H A;  3H0G H;  1EQQ A;  1E24 A;  4CBV A;  3RZD H;  1O7Z A;  4RHR A;  2N78 A;  2OQK A;  4NDX A;  1VQ4 A;  5JJ7 A;  3PO3 G;  4R8N A;  2J4X A;  3TEH B;  3CPW A;  2KCT A;  1X55 A;  1VMP A;  3CKI B;  3HOV H;  2WAQ E;  4DV3 Q;  3K81 C;  1GJX A;  3OHX C;  4P74 A;  1WTX A;  3V2T A;  4TRD A;  2ZXO A;  4KHZ A;  4OWX B;  2MHV A;  5K5P A;  1G51 A;  1KNE A;  2D9U A;  3HOX H;  4A3K G;  2WFW A;  2WKC A;  4HED A;  4B08 A;  1D6E C;  4IFD H;  4LF8 Q;  1YBY A;  1D1K A;  5IYB H;  1ILP A;  1TS5 A;  2AQ1 B;  3CCL A;  2E2J B;  3OYY A;  1DON A;  1EWC A;  1U4R A;  1LM0 A;  3GTO H;  4JBW A;  1JQY D;  1NR4 A;  4DV4 L;  4LFC Q;  2RHS B;  1STY A;  4K8J A;  1IXR A;  4A3I B;  5ELC A;  2B2V A;  1OXU A;  4CDC C;  4CKC A;  3SK6 A;  5CGK A;  3PO2 G;  1ZEQ X;  1OXS C;  4HSV A;  3EVQ A;  1K28 A;  5LL6 X;  3RZO H;  1HQR D;  2X6L A;  1HA5 A;  2PI2 A;  4ZUI A;  1SBB B;  2R92 H;  1Q8I A;  2EE1 A;  1DOM A;  4JI3 L;  1DJR D;  4DUY Q;  2PQA A;  2A74 C;  1XTC D;  3QWN A;  3KFU A;  5I9O A;  1TKW B;  3J7A V;  2R61 A;  3GTP H;  5FJ8 G;  2B63 G;  2TMP A;  3T56 B;  1B50 A;  2YU9 H;  4PMB A;  2XGT A;  3DXJ C;  4Y52 H;  3T1Y Q;  1PTO F;  1CA5 A;  1B9M A;  2LSS A;  1HR0 Q;  2B2U C;  2RKS A;  2UU9 L;  5T1G A;  2UXB Q;  1G6Z A;  1YNJ D;  3JC6 6;  3CU7 A;  4NXN Q;  2F0V A;  4FDB A;  2CH4 A;  2I5L X;  3H6M A;  1Y1V H;  1PYS B;  2I5H A;  2O4X A;  4EQN A;  1JOQ A;  3ZJY C;  3CD6 A;  1HR0 W;  1STA A;  4WGJ A;  4LFB Q;  1EWH A;  3DWA A;  5JJL A;  5T1I A;  1XNQ Q;  1R9T H;  1N34 Q;  2L1B A;  5EPK A;  3CC4 A;  2RCF A;  1IBK L;  1A0I A;  4IN3 A;  5C44 B;  4JI7 L;  4RGM A;  4GOP B;  5G3L D;  3HOY H;  4DR7 L;  3S6A A;  3BYY B;  4TQU S;  1RL2 A;  3QOL A;  3W1B A;  1B9N A;  5C0X I;  3UE0 A;  1JJC B;  3NQT A;  5LHY 1;  4GKK L;  1BXT A;  2HD3 A;  2JA6 B;  3BZD B;  4JI8 L;  5LMN L;  2R93 B;  1BR9 A;  2PYK A;  3HOU B;  2H4O A;  1K8O A;  2UUC L;  3M9B A;  3ND8 A;  3NP8 A;  5DLQ E;  3OMG A;  3I4M H;  5JVH 3;  4H02 A;  1X3F A;  2F0J A;  4B9X A;  4K8I A;  4EQ5 A;  5KYL A;  2IY5 B;  4A3J H;  3I2Z A;  3ERS X;  1YJN A;  1O7Y A;  2D0P A;  1QOH A;  3NEL A;  1SYE A;  1F77 A;  1VQC A;  4ZUJ A;  1JC7 A;  1Y1V G;  2HCI A;  4GLA C;  2XWB B;  1RD9 D;  4X64 L;  3NHH A;  2ZJQ A;  2AWN A;  4IZ8 A;  3BU2 A;  3C1E A;  3VYT A;  3S1N B;  3AMU A;  1SRO A;  3D4R A;  4I7Z C;  1UE1 A;  4L6T B;  4O42 A;  4YHH L;  2FJ2 A;  4B3S L;  1YNJ C;  4N9T A;  4F8M A;  4J1M A;  1S5D D;  1HUN A;  3S1M B;  4BBS B;  2NVY B;  2KOL A;  3BZC A;  2O5J C;  4A3L H;  2KEC A;  5K36 G;  1GD7 A;  1D5Z C;  1VQL A;  3GV6 A;  2RDF A;  3Q8D A;  4ALP A;  4KHV A;  3HOY G;  2ZTC A;  3GTL B;  4KHP Q;  4DUZ Q;  1A2U A;  1N32 L;  1LAB A;  3SR1 A;  5IYD H;  4C3H H;  4LJZ C;  2DUD A;  2JA7 B;  4GNX C;  1F9S A;  5ISR A;  1I50 B;  1F2L A;  5AFW A;  4NPS A;  4N8X 1;  3C1F A;  2R3Z A;  4HCS A;  5CV4 A;  4LUZ A;  1EIF A;  3DLL A;  5M5Y H;  3S17 B;  2NB0 A;  5AJ3 L;  2MFI A;  1O80 A;  3GDE A;  4AQY Q;  1JOK A;  2VS1 A;  3GTK H;  2E2I B;  2FMC A;  5IGE A;  2QW7 A;  1IHZ A;  2KEN A;  1DYQ A;  1V1Q A;  2I46 A;  1CHP D;  1LTS D;  1PXU A;  5CV9 A;  2J0T D;  4A3B H;  1B44 D;  5NUC A;  3VR2 A;  4IUU A;  4POF A;  3J81 L;  2N8N A;  3E9I A;  1NUC A;  1ENC A;  2F0U A;  1LLR D;  4LMQ D;  4ZKB B;  1E2Z A;  2BOS A;  3B6Y A;  3NQI A;  2QEJ C;  3OWF A;  1BVS A;  5LMU Q;  4UP9 A;  4MNO A;  3TP7 A;  1PA6 A;  1M90 C;  2N55 A;  3PO2 B;  4RKL A;  4HID A;  1FJG Q;  1BBX C;  1XMO Q;  3C3L A;  1LV9 A;  2F3I A;  3HOZ G;  1NR2 A;  1BF4 A;  3CCR A;  4U0Z A;  1K8G A;  3W5O A;  3K5M A;  4U04 A;  2PCF B;  1L1O B;  3F2U A;  1STB A;  3H0G B;  2MP1 A;  3T51 B;  3RZD B;  1RF2 D;  2Z8L A;  1H9S B;  4LK1 C;  4AH6 A;  2BA0 A;  5IGF A;  2JEB I;  4L5R C;  5JAV A;  1T5E A;  1XTD A;  3HOV B;  3VYU A;  1O7I A;  1M8A A;  1PYB A;  2BH2 A;  4IQZ A;  3RUZ A;  1K3B C;  1VQH A;  4K14 A;  2UXD L;  1EUJ A;  1X3P A;  1NAP A;  1GVP A;  4DAV A;  2AUJ D;  3DWQ A;  3FHW A;  1OO9 B;  1QZH A;  3HOX B;  3J81 i;  3TSS A;  3X3N A;  5IYC H;  1CZW A;  3ONA B;  1VQP A;  4QQB X;  3Q23 A;  1ASZ A;  4IPD A;  5BN3 A;  2MJ8 A;  3NEM A;  1SMY D;  4A3B G;  2NTT A;  3PUY A;  4DNR B;  4G57 A;  3QO2 A;  4JI6 L;  3GTO B;  4MZ9 A;  4FVM A;  1Q90 A;  1VQA A;  3KLW A;  2NN6 I;  1J5E Q;  1D5X C;  2VY3 A;  3H09 A;  1FR3 A;  1I5F A;  1RJT A;  4CDE C;  2ZT9 C;  1V9P A;  1Z47 A;  4X62 L;  2GVA A;  2BDO A;  1XPO A;  1GOZ A;  1EY5 A;  1ZXT A;  3RZO B;  4B3T Q;  4MIU A;  2F6S A;  3D6W A;  4YY3 Q;  2B3G A;  1IL2 A;  1SNP A;  2KUM A;  2F0P A;  4WJW A;  2R92 B;  4E6I A;  4XI8 A;  2A8V A;  4Y7N H;  1TWC H;  2F3W A;  3M7N A;  4QIW E;  5C5L A;  4AIM A;  4ZK9 B;  1CTM A;  3NWT A;  3GTP B;  5JFZ A;  4JI1 Q;  2YU9 B;  1PV4 A;  4FO2 A;  1NBW A;  3IL8 A;  3S1Q H;  1WOC A;  3UDX A;  2KQ3 A;  2NWG A;  1KTK A;  5KNC A;  1D7Q A;  2FFK B;  2RF4 A;  3MXU A;  1EY6 A;  1MD2 D;  5I2Y A;  1WD1 A;  3J80 L;  2CKZ B;  1Y1V B;  1CK1 A;  1LTA D;  1TY0 A;  1SNC A;  2F3V A;  4R4I A;  2LXJ A;  3A5Z B;  3RMH A;  5IYC G;  4JI0 L;  4GOP C;  5ELB A;  2A19 A;  2F0S A;  4JG2 A;  4OIJ A;  2UUB Q;  1Y8N B;  1PH1 A;  1CI3 M;  1YNN D;  2VQF L;  1R9T B;  1F2Z A;  4DR5 Q;  1ILQ A;  1S5E D;  2IHF A;  4DR1 Q;  1I6H H;  3V05 A;  1E7Z A;  2L5T A;  1WTQ A;  3L7Z C;  2OWO A;  2F0D A;  5HGT A;  4HJ8 A;  3HOY B;  1STN A;  3C46 A;  4K5W A;  4ZRZ A;  1WVL A;  4LF7 L;  3ZLM A;  2NTS A;  2RA4 A;  1VMC A;  1X6O A;  5CYU A;  1SMY C;  3SDZ A;  4HMJ A;  3EFX D;  1KD1 C;  5C0X H;  1STE A;  3E3X A;  1KNA A;  4NXM L;  5GAG C;  4CJ0 B;  1ICW A;  4H13 C;  3TS0 A;  1NY4 A;  3TBI B;  3CQZ H;  4B3R Q;  1PZJ D;  1QCB D;  5FO8 B;  1SNM A;  4DAP A;  4A3D H;  2X69 A;  1Y14 B;  3I4M B;  2QIL A;  2AHO B;  1TII D;  1RDP D;  3J80 i;  2EY1 A;  3QR8 A;  4A3J B;  4YWK A;  2AKW B;  2IW3 A;  4J6H A;  2H1E A;  2Q2U A;  4RG1 A;  1HPC A;  1HZ9 A;  5EJW A;  1HHV A;  4RFB A;  4DV5 L;  1B53 A;  3L9A X;  3JAM E;  5C44 H;  5IT9 E;  1JJ2 A;  2RQX A;  3K59 A;  3OW2 A;  5BN4 A;  3RD4 A;  1DXM A;  1TY2 A;  1KQS A;  3NBH B;  5CMT A;  4JI3 Q;  4LUV A;  4JI2 Q;  3NWS A;  2D62 A;  4ME3 A;  3OIQ A;  4F88 A;  3IAY A;  4KY7 A;  1KLG D;  3TZU A;  4KV6 A;  1JJG A;  3TN2 A;  4KMU C;  2AUK A;  4C3H B;  5C4J H;  1YNN C;  2PMZ B;  3RR5 A;  1TT2 A;  2B2W A;  2UU9 Q;  3UE1 A;  1Z9F A;  2M2L A;  1QB5 D;  2Y0S G;  3ND9 A;  3CXC A;  3BDC A;  4OWW B;  1TR5 A;  3FMC A;  3SGI A;  1PH4 A;  1KAW A;  3Q6S A;  4K2L A;  5M5Y B;  1HH2 P;  3E0J A;  3GTK B;  5CKL A;  2EPB A;  3MEF A;  4FXK C;  1YEZ A;  4BY1 H;  4ID6 A;  1X3G A;  3CCE A;  3BVG A;  4A3C H;  2B2V C;  1G29 1;  1AE3 A;  4TKO B;  3HEJ A;  1DZ1 A;  1F9Q A;  4A3B B;  1Q1E A;  1EQR A;  1NMG A;  1BKB A;  1SYD A;  1QNU A;  3EA6 A;  1IBK Q;  1L1O C;  2F0E A;  4CHT B;  1Q1B A;  4FYD A;  4JI7 Q;  4GS3 A;  5C44 G;  3S9W A;  4DR7 Q;  1K0R A;  1JIC A;  1I6V C;  1II3 A;  4IPC A;  2IX0 A;  3VR5 A;  2G9H D;  3D8G A;  2IX3 A;  4KKT A;  1H9K A;  5E7N A;  1Q46 A;  5EPJ A;  2KEE A;  2OT2 A;  1IKL A;  1N33 Q;  3ERQ A; 
#chains in the Genus database with same CATH homology
 1J6Q A;  2LSS A;  1HR0 Q;  2OTJ A;  3CCQ A;  4JI8 Q;  5FLM H;  5LMN Q;  1UWV A;  1VQM A;  2JA6 G;  2QA4 A;  4DAM A;  2UU9 L;  2UXB Q;  4P73 A;  2E2H H;  3TRE A;  3JC6 6;  2UUA L;  2UUC Q;  4NXN Q;  2BH8 A;  1OTC A;  3HOU G;  2NZO A;  4FDB A;  2I5L X;  4BBR H;  4QGU A;  1Y1V H;  3ULJ A;  1PH8 A;  1PYS B;  3UDI A;  3PCO B;  2E2I H;  2I5H A;  3HKS A;  4HIK A;  1CSQ A;  5IP7 H;  4IPH A;  3ZJY C;  4JBJ A;  4C3J H;  4GNX B;  3CD6 A;  1HR0 W;  4IOA A;  2C35 B;  1G6P A;  3RLN A;  4LFC L;  5LMN W;  1MJE A;  1JB7 A;  1PFS A;  3K80 C;  4WGJ A;  4LFB Q;  2MNA A;  5JJL A;  1HJP A;  2IX1 A;  1YIT A;  1JE5 A;  1XNQ Q;  4X64 Q;  1VQO A;  1L2F A;  1R9T H;  2A1A A;  3CC7 A;  4LFA L;  5JJK A;  4C2M H;  3S2H H;  4A3F H;  1N34 Q;  3KJO A;  2I0Q A;  4DV2 L;  3CC4 A;  2NVX H;  1VQB A;  4HJ9 A;  1IBK L;  4A3G G;  1A0I A;  1E1T A;  3F8T A;  3KOJ A;  4YHH Q;  4P72 A;  4JI7 L;  1HNX Q;  2K52 A;  4GOP B;  1A63 A;  3HOY H;  4DR7 L;  3S6A A;  1W3S A;  2Y0S E;  1GO3 E;  1RL2 A;  2H5X A;  4TQU S;  1XNR Q;  4DV4 Q;  3W1B A;  5C0X I;  3UE0 A;  5C4X H;  1JJC B;  5C0X J;  2N49 A;  1D8L A;  1L0W A;  4DV1 Q;  3HKZ E;  4P71 A;  4BBS G;  4IJL A;  3D0F A;  3T1Y L;  4GKK L;  1TWF H;  1K83 H;  5M3M G;  1HR0 L;  1UEB A;  1HNW L;  4U0U A;  4JI8 L;  5LMN L;  4WJ3 M;  4DK3 C;  4OXP A;  3J80 c;  1NJI C;  4YWM A;  3S16 H;  1QVC A;  1TWH H;  4DK6 C;  1VQI A;  3M9B A;  4NXN L;  2UUC L;  2KHI A;  2JA9 A;  5DLQ E;  2XTI A;  5HGQ A;  1U0L A;  2AMC B;  3I4M H;  3L2P A;  2KCM A;  1X3F A;  2WB1 E;  4H02 A;  1PH7 A;  4JBK A;  1VS0 A;  4NB3 A;  2ZJR A;  4A4I A;  3A5U A;  4EQ5 A;  2JA7 G;  2IY5 B;  1YVC A;  4A3J H;  3I2Z A;  4X2E A;  5FLM G;  3ERS X;  3M85 A;  2FXQ A;  5GAE C;  3F2C A;  1YJN A;  1C0A A;  4BXX H;  3U4V A;  5BR8 Q;  2EQS A;  1VQE A;  2D0P A;  1B7Y B;  3NEL A;  1I3Q H;  4DV7 L;  5AJ3 Q;  1VQC A;  2UXC L;  1WI5 A;  4MTN A;  5GAD C;  5LMU L;  1P8L A;  4BBR G;  1NTG A;  1Y1V G;  4A3E H;  1JT8 A;  4GLA C;  1A8V A;  3I7F A;  1XNQ L;  1BBU A;  1FJG L;  4X64 L;  2ZJQ A;  2AWN A;  5C0X G;  3I56 A;  3BU2 A;  5IP7 G;  1YZ6 A;  2I5M X;  4M16 A;  1N34 L;  5JJ6 A;  4OO1 I;  1SRO A;  3G4S A;  3CCM A;  1UE1 A;  1BBW A;  3W1G A;  3CC2 A;  1KHI A;  1KL9 A;  4YCV A;  1PH6 A;  2Q2T A;  1VQK A;  4YHH L;  4LF5 L;  4X65 L;  4B3S L;  1HNX L;  2OCE A;  1EWI A;  2E8G A;  3MXN B;  5GQO A;  2F52 A;  2HIX A;  1WYD A;  1XNR L;  2JEA I;  1S40 A;  3A74 A;  1PVO A;  3KF6 B;  5M5X H;  3I55 A;  3TS2 A;  4A3F G;  4PZ7 A;  3FKI H;  2R7F A;  1CKM A;  3E9H A;  1SFO H;  2YYZ A;  4DV1 L;  3BZC A;  4A3L H;  1YJW A;  5K36 G;  1GD7 A;  1E1O A;  1VQL A;  1Y1W H;  1XPU A;  3PUZ A;  3Q8D A;  5IP9 H;  3J81 j;  2L15 A;  4ALP A;  1P16 A;  3HOY G;  4JV5 Q;  2ZTC A;  3EN2 A;  1YJ9 A;  1Q8K A;  3LGJ A;  1C7Y A;  4JCV E;  4KHP Q;  2K4K A;  4DUZ Q;  1N32 L;  4JI4 L;  5EU0 A;  5C4X G;  4C3H H;  5IYD H;  4GN3 B;  4IFD I;  3GO5 A;  2DUD A;  1KIX A;  1KXL A;  4GNX C;  3H0G G;  3PUX A;  2ES2 A;  4GNX A;  3GTM H;  3AYH B;  3DM3 A;  3CCU A;  4NPS A;  1CKN A;  1KC8 C;  2CWP A;  1YIJ A;  2CCZ A;  2K5V A;  3F2D A;  4OO1 G;  4LUZ A;  1EIF A;  2RHQ B;  3DLL A;  1GM5 A;  5M5Y H;  3ULL A;  5BR8 L;  1K73 C;  2E2J H;  2VNU D;  5AJ3 L;  2MFI A;  4YCW A;  4GKK Q;  3GDE A;  2R6G A;  4AQY Q;  2VS1 A;  4QY7 A;  4LWC A;  3GTK H;  1SMX A;  3S24 A;  3M4Q A;  1HNW Q;  1K8A C;  4R4Q A;  4IOC A;  3A0J A;  3HOV G;  2KEN A;  1W2B A;  4A3I H;  1V1Q A;  2VQE L;  3EIV A;  3K0X A;  4BY7 H;  4BXX G;  4HJA A;  2N3S A;  3M4P A;  1SR3 A;  2QEX A;  4A3B H;  3BZK A;  4POF A;  3HOW H;  2N8N A;  3VDY A;  3E9I A;  3AQQ A;  2ID0 A;  4X2C A;  3PUW A;  4KI0 A;  3PO3 H;  4L5S A;  2OQ0 A;  3GD7 A;  4R1J A;  2R7D A;  4A3M H;  3JAM i;  3HOX G;  1VQ8 A;  3B6Y A;  4DR6 L;  1PH9 A;  1TXY A;  4L5T A;  4R4T A;  4B3T L;  4LF4 Q;  3WWV A;  4DV7 Q;  2UXC Q;  4IFD G;  1BVS A;  5GAH C;  1PH2 A;  5LMU Q;  4UP9 A;  4MNO A;  1FL0 A;  5IYB G;  4A76 A;  1YI2 A;  1PA6 A;  1M90 C;  3K7U C;  2JA8 H;  3I4N G;  3GTJ H;  3CMA A;  4HID A;  1FJG Q;  3KYH C;  4JBM A;  4JI6 Q;  5M3F H;  2VL6 A;  2DGY A;  4JC0 A;  3CCJ A;  2F3I A;  2MO0 A;  1XMO Q;  1XPR A;  4POG A;  2Z0S A;  4JV5 L;  3HOZ G;  3EBE A;  4KHP L;  3CCR A;  4U0Z A;  4DUZ L;  1K8G A;  4A3K H;  3W5O A;  4U04 A;  1L1O B;  4BY1 G;  3FKI G;  4XTC S;  4LF9 Q;  3K8A A;  4A3C G;  4LF5 Q;  4X65 Q;  4B3S Q;  4X62 Q;  3ER0 A;  1Q81 C;  1Y1W G;  2PNH A;  2IHE A;  4LW1 A;  5CGL A;  1KRS A;  1V43 A;  4AH6 A;  1VQ6 A;  1QUQ B;  3RLO A;  4PG3 A;  1WJJ A;  2BA0 A;  3S1R H;  2JEB I;  4L5R C;  4JI5 L;  3UDG A;  2R92 G;  4AQY L;  4U0S A;  4A75 A;  4AYB E;  2ATW A;  1XTD A;  3G71 A;  1O7I A;  2V1C C;  1DGS A;  1IBL Q;  2GVB A;  1PYB A;  2BH2 A;  1EYG A;  3AEV A;  2MQH A;  2ZJP A;  1N32 Q;  2B29 A;  4JI4 Q;  1VQH A;  2VUM H;  4LFC Q;  2UXD L;  1EUJ A;  1PH5 A;  3KDF B;  1GVP A;  1GKH A;  1X65 A;  4APV A;  4LUO A;  3FHW A;  2UUB L;  4IPG A;  2ZTD A;  2QGQ A;  4A3D G;  1VQG A;  1QZH A;  3KF6 A;  3J81 i;  1VQD A;  2CFM A;  5IYC H;  1CUK A;  2PI2 E;  4PZ6 A;  1VQP A;  1EIY B;  4P75 A;  4QQB X;  4A3I G;  3OTO Q;  4DR1 L;  4O2D A;  4LF4 L;  1ASZ A;  4IPD A;  1WFQ A;  3PGZ A;  3CF5 A;  4BY7 G;  4JOI A;  3PSI A;  2YV5 A;  3GTQ H;  3NEM A;  4A3B G;  1YHQ A;  3PUY A;  1S72 A;  5FJ8 H;  2B63 H;  1VQ9 A;  3ZC7 A;  1E22 A;  3ZCB A;  1FGU A;  5IWA L;  4JI6 L;  1XMO L;  1FVI A;  4L5Q A;  4GLX A;  3N3U A;  1RIP A;  2G03 A;  2VQE Q;  4DV0 Q;  4A3M G;  2HHH Q;  4MZ9 A;  1YNX A;  1VQA A;  3KLW A;  2NN6 I;  1J5E Q;  4X2D A;  4J15 A;  4GKJ L;  2VY3 A;  3S2D H;  2JA6 H;  1I5F A;  4LF9 L;  1IBM L;  4K0K L;  4DR3 Q;  3PF5 A;  2ALY B;  2R93 H;  1V9P A;  2VQF Q;  3BJU A;  2IT1 A;  1Z47 A;  3HOU H;  1VCI A;  2GVA A;  4X62 L;  2NZH A;  1XPO A;  5M3F G;  4UY8 C;  4DR6 Q;  2HQL A;  4B3R L;  4AYB G;  4KLK A;  1VQ5 A;  4B3T Q;  1LYL A;  2VZA A;  4YY3 Q;  2F6S A;  1Q12 A;  2B3G A;  1IL2 A;  1H95 A;  5FLX c;  2EXD A;  4XI8 A;  3CPF A;  2A8V A;  3U58 A;  1Q86 C;  5JEA G;  1M1K C;  2NVQ H;  2Q2H A;  2R7Z H;  4Y7N H;  2LXK A;  3G48 A;  2KBN A;  1TWC H;  4DR2 Q;  1IBL L;  4QIW E;  3M7N A;  4AIM A;  3ICE A;  3E0E A;  4PMW A;  3STB D;  1X3E A;  1QZG A;  4B3M Q;  5JFZ A;  3AFQ A;  4JI1 Q;  1U5K A;  1NMF A;  4IO9 A;  1TWG H;  2GN5 A;  1PV4 A;  4PZ8 A;  2RCN A;  1NBW A;  4IFD J;  4BA2 I;  3S1Q H;  4NXM Q;  2YTY A;  2ZM6 Q;  1WOC A;  3UDX A;  3LET A;  2F4V Q;  3S1N H;  1D7Q A;  3FP9 A;  2CWA A;  2RF4 A;  1UE7 A;  1T9H A;  2NN6 G;  4GN5 A;  3CUC A;  5ELN A;  3OTO L;  2VUM G;  4JI5 Q;  2CKZ B;  3I4M G;  1MKH A;  2D0O A;  1AE2 A;  1OXT A;  1TWA H;  1X54 A;  2JK8 A;  2BA1 A;  3S1M H;  1AH9 A;  4HJ5 A;  4DV6 Q;  4BBS H;  4A3J G;  2NVY H;  1L1O A;  4GLV B;  4R4I A;  2LXJ A;  3A5Z B;  5IYC G;  4DV0 L;  2HHH L;  1YHB A;  4DNI A;  2PMZ E;  4GOP C;  4JI0 L;  4OX9 L;  4GOP A;  2K14 A;  4JI2 L;  2UXD Q;  1J5E L;  2A19 A;  1QVF A;  4GN4 B;  4R4C A;  4JG2 A;  3H3V H;  2UUB Q;  1MJC A;  1PH1 A;  2Z6K C;  2Z6K A;  4DR3 L;  4A3E G;  1N8R C;  2HT1 A;  2VQF L;  3GTG H;  3UDF A;  3GTL H;  1QUQ A;  4EX5 A;  4DV5 Q;  5ELO A;  3IRB A;  1B8A A;  2IHF A;  3KF8 B;  4DR5 Q;  3L0O A;  4DR1 Q;  1I6H H;  5HY6 A;  3RN2 A;  1E7Z A;  4YY3 L;  4JYA Q;  2JA7 H;  2WP8 J;  3PUV A;  2E5L Q;  1I50 H;  4YCU A;  3L7Z C;  1SRU A;  2OWO A;  4TVA B;  5JJI A;  2YTV A;  2ZTE A;  3F2B A;  1X56 A;  5JFF A;  3CAM A;  4LNQ A;  4HJ8 A;  3ULP A;  1HNZ Q;  5IWA Q;  2R93 G;  1PH3 A;  3SE5 A;  4DR2 L;  4LF7 L;  3ZLM A;  4LF8 L;  3S17 H;  4R4O A;  1X6O A;  1OXV A;  3KDF A;  4DPG A;  4B3M L;  4GKJ Q;  4UP8 A;  1K3R A;  4JI1 L;  5J3B A;  1SN8 A;  3TQY A;  1KD1 C;  1IBM Q;  4K0K Q;  4QJF A;  3M3Y H;  2EIF A;  4A3L G;  2PQA B;  5IY0 A;  1JMC A;  5GAG C;  2ZM6 L;  1OXX K;  4NXM L;  3H3V I;  2R7Z G;  3T1H Q;  2F4V L;  3TS0 A;  1NY4 A;  1QVG A;  3CQZ H;  4N67 A;  1CKN B;  4UP7 A;  5IP9 G;  3JAM c;  4B3R Q;  5IT9 c;  3M4O H;  1EOV A;  3PIO A;  1VQF A;  1N36 Q;  4DKA C;  1NE3 A;  1Y14 B;  1X9N A;  2OTL A;  5IYD G;  3PF4 A;  3PIP A;  2AHO B;  2K50 A;  1MIU A;  3RLF A;  3J80 i;  1HZB A;  5H1S E;  3SHG A;  1LTL A;  4YWK A;  3G6E A;  1VQ7 A;  2KHJ A;  4DV6 L;  4PY3 A;  3I4O A;  1PHJ A;  3RN5 A;  1EFW A;  2AKW B;  4OWT B;  4X66 Q;  3PO2 H;  1IYJ B;  4DR4 Q;  1XMQ Q;  4DUY L;  2JA5 H;  4WJ4 A;  1K9M C;  2Q2U A;  3S15 H;  1N9W A;  4RG1 A;  4HIO A;  1HZ9 A;  4UPA A;  3STB C;  4HIM A;  1SLJ A;  5C3E H;  5JEA J;  3F1Z A;  1UE6 A;  2HIV A;  4DV5 L;  4RMF A;  1LUZ A;  1IZ6 A;  1VQN A;  4LF6 Q;  4DR5 L;  4HJ7 A;  5C44 H;  2K5H A;  1N33 L;  3H0G H;  4DAY B;  1EQQ A;  1JJ2 A;  1CSP A;  3K7A H;  4JYA L;  4JOI C;  2E5L L;  1E24 A;  3RZD H;  2JJQ A;  3OW2 A;  1Q82 C;  2UXB L;  3HOW G;  2N78 A;  1KQS A;  2OQK A;  3NBH B;  1VQ4 A;  1HNZ L;  5CMT A;  5JJ7 A;  3PO3 G;  3TEH B;  3CPW A;  4JI3 Q;  2KCT A;  1WCM H;  1X55 A;  3AFP A;  1KRT A;  3SN9 A;  4LUV A;  2VW9 A;  4JI0 Q;  4JI2 Q;  4OX9 Q;  2D62 A;  1YHA A;  4ME3 A;  2CQO A;  3RNU A;  3HOV H;  1B70 B;  2WAQ E;  4DV3 Q;  4BA1 I;  2JA8 G;  3K81 C;  3HFZ B;  3T1H L;  1I94 Q;  1JJG A;  3J81 c;  3H15 A;  1UE5 A;  4P74 A;  2AWO A;  4LU4 A;  3CCV A;  4KHZ A;  4LFB L;  1N36 L;  5C4J H;  4ITR A;  1SE8 A;  4OWX B;  4A3K G;  1G51 A;  3CP0 A;  3RR5 A;  3HOX H;  2NVT H;  2UU9 Q;  3D31 A;  1CKO A;  5M5W H;  3UE1 A;  2ASB A;  3J7A 5;  1Z9F A;  2WFW A;  3CW2 C;  2JQO A;  2UUA Q;  1S3O A;  4QL5 A;  2Y0S G;  3CXC A;  4LF7 Q;  4LF8 Q;  1YBY A;  4OWW B;  3SGI A;  4A93 H;  5IYB H;  3U4Z A;  3I4N H;  1C9O A;  1PH4 A;  5IE8 A;  1KAW A;  3CCL A;  4X66 L;  3OYY A;  1ASY A;  4DR4 L;  3HKZ G;  1XMQ L;  1HH2 P;  3KJP A;  1XJV A;  1LM0 A;  3HOZ H;  3GTO H;  4JBW A;  5CKL A;  3MEF A;  4DV4 L;  4X6A H;  3PV0 A;  2RHS B;  3NEN A;  4O0A A;  4BY1 H;  1YEZ A;  5EAY A;  1IXR A;  4C3I H;  1X3G A;  3CCE A;  3S14 H;  4A3C H;  4A3G H;  3U50 C;  4LF6 L;  1E3P A;  1G29 1;  1AE3 A;  1OXU A;  3PO2 G;  2JA5 G;  2Q2I A;  4LFA Q;  4XIG S;  1OXS C;  1Q1E A;  2WB1 G;  1EQR A;  1NMG A;  1A62 A;  3TRZ A;  3RZO H;  4A93 G;  1BKB A;  4DV2 Q;  5C3E G;  2PI2 A;  1HZA A;  1VQJ A;  1L1O C;  2WAQ G;  1IBK Q;  2R92 H;  1Q1B A;  1HZC A;  4JI3 L;  4JI7 Q;  4GS3 A;  2K75 A;  3CCS A;  5M3M H;  5C44 G;  4DUY Q;  2PQA A;  4DR7 Q;  1K0R A;  4IPC A;  3KFU A;  2IX0 A;  2K5N A;  4YWL A;  3J7Z C;  1Q7Y C;  4DV3 L;  2JE6 I;  3GTP H;  4OON A;  5FJ8 G;  4IJH A;  3CME A;  2B63 G;  5E7N A;  1Q46 A;  1I94 L;  2YU9 H;  2XGT A;  2MO1 A;  4U07 A;  5GRO A;  1N33 Q;  2YTX A;  3T1Y Q;  4Y52 H;  4A3D H;  1WCM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...