2VY3A

Type iv secretion system effector protein bepa
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
291
structure length
291
Chain Sequence
EIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCSHDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMPEMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHPFREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDISNPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYIIGNIDHLPPEQLKILKPGDKITFTAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL FILAMENTATION PROTEIN
publication title Fic Domain Catalyzed Adenylylation: Insight Provided by the Structural Analysis of the Type Iv Secretion System Effector Bepa.
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Cell adhesion
total genus 86
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 2vy3A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vy3A02
4OWWB 4YCVA 3RLFA 5FLMH 4DR3L 1VQNA 3AFPA 2N49A 2R93H 1L1OA 3NEMA 1PH9A 3HKZE 1WJJA 1HR0L 3CCSA 1JB7A 3I4OA 1CKMA 1K3RA 4GKKQ 1EWIA 2YU9H 4GS3A 5AJ3Q 2Z0SA 4QJFA 3LETA 1AH9A 1LTLA 4DR5Q 2WAQE 2Z6KA 4P71A 4GNXC 1HNXL 3SE5A 1E22A 2C35B 1Q8KA 4A3FG 5IP7H 1TWFH 3ULJA 1VQ9A 2MO1A 5C4XG 2NN6I 3ERSX 1IBML 2JA6G 2N8NA 4DUZQ 2K5VA 3IRBA 2E5LL 5GQOA 3H3VH 4IPGA 3FKIH 3T1HQ 4EX5A 3S1QH 4A3GG 4JI1L 5C0XJ 1VQJA 4LFAQ 3PIOA 1O7IA 1YZ6A 1JJ2A 1X56A 3M7NA 1K83H 3OTOQ 2OTJA 4PZ8A 1XMQL 2VUMH 2F3IA 2WP8J 3FP9A 2I5MX 3RR5A 2HHHL 4LNQA 1VQGA 5FLXc 1UE5A 5CMTA 2K5HA 3CCRA 3I2ZA 1N36Q 4OXPA 3W5OA 3ICEA 2JE6I 3S2HH 3PO3G 2JEAI 4A3FH 4A75A 4BY1H 2F6SA 4PZ7A 4KHZA 1X3EA 1IBLQ 2F4VL 4B3TL 1K0RA 3I7FA 4DNIA 1Q1EA 2JA6H 3M4OH 4K0KL 4WJ3M 2HIXA 4DR2Q 1G6PA 1PA6A 2IT1A 2YTVA 5BR8Q 1PH1A 1L1OC 2E8GA 2XTIA 3UDGA 4A3MG 2JQOA 4Y7NH 5LMUL 1Q1BA 2JA7G 3GTJH 4Y52H 5GAEC 3S6AA 3L2PA 4UP7A 2IHFA 4LFCQ 3KDFB 3D31A 4R1JA 4IPHA 1YNXA 3G4SA 2R7ZH 1JMCA 2JJQA 4JI2Q 1VQLA 1YVCA 1IYJB 2Q2TA 2Z6KC 4WJ4A 4L5TA 1XNQQ 4X65L 5JJKA 4DR6L 3TREA 1TWCH 2CCZA 2AKWB 2RHSB 2EIFA 3PUZA 4NPSA 2HQLA 4GOPA 4GKJQ 2I5LX 4X62L 3A74A 1IL2A 5LMNW 1BBWA 2N78A 2ASBA 4POGA 3PSIA 3GTLH 4A3EG 3PF4A 2R7ZG 3ULPA 2JA7H 5JFFA 2UUCL 4IPCA 2PI2A 3LGJA 1SROA 4DR7L 3D0FA 3T1YL 2UXCL 3G71A 1QUQB 2R6GA 3CCEA 3GTGH 1VQ7A 2DUDA 2PMZE 1P8LA 3BZCA 3RN5A 1VS0A 1YITA 1CSQA 2MNAA 1HR0W 3H15A 3NENA 4JYAL 1EOVA 3JC66 1YJ9A 3S15H 4LF4Q 3HOWH 1FL0A 3PUYA 3AFQA 1KAWA 4P73A 5GAHC 5M5YH 1J5EL 2D62A 4YWKA 4AIMA 4U0ZA 5GROA 4A3JG 2ID0A 4APVA 4AYBG 3J80c 4JOIC 2QA4A 2D0OA 4A3IG 1S72A 1HNWL 4X6AH 4IJLA 4IOCA 1H95A 3SN9A 2KBNA 2ZTEA 4A93G 2ES2A 1LUZA 2EQSA 2R92H 1UE1A 4AQYQ 1ASZA 1QZHA 2WFWA 2CWPA 4DV1L 2Q2UA 1N33L 1W3SA 1PFSA 3CW2C 3UDIA 2NN6G 5IE8A 4HJ7A 4M16A 1B8AA 4A76A 4ALPA 4GOPC 1XMOL 4JG2A 4JI1Q 1VQ8A 4JI3Q 4LF8L 1A62A 5M5WH 4TQUS 2XGTA 4XTCS 3TEHB 4IPDA 4LFBQ 1C9OA 2HIVA 1M1KC 4X64Q 3M9BA 1PH3A 2VNUD 4JI5Q 2ZJPA 4A3JH 5IYCG 1Y14B 3BJUA 3STBC 2FXQA 2BH8A 2JA9A 1WCMG 3H0GG 4A3IH 1SLJA 1SE8A 4X2EA 2MFIA 2WB1E 1V1QA 1KL9A 2VS1A 1IZ6A 1JE5A 4H02A 4DV5Q 3S1RH 2UUBL 4A93H 4A3DG 1VQMA 2UXDL 3F8TA 2F4VQ 3GTKH 3CF5A 4K0KQ 2VW9A 1X55A 3VDYA 2E2IH 2I0QA 2UXBQ 2VQEL 4LF9L 4XIGS 3TQYA 3CCLA 2RCNA 1VQKA 1U0LA 1B7YB 4BXXG 4QY7A 4JBJA 4LF7L 4JCVE 3E9HA 5HY6A 1XNRQ 2AMCB 1VQDA 5M3FH 4HIKA 4GN5A 1L1OB 1CKOA 1Q12A 4YY3L 4P75A 4DV2Q 3PF5A 1TWAH 5IYCH 1R9TH 2VL6A 5IWAL 2KHIA 1WCMH 3H0GH 1XJVA 1HZ9A 1G291 4JI6L 4NXML 4DR6Q 1D7QA 4A3DH 2MQHA 4HJ8A 2IX0A 4NB3A 1OXVA 5CKLA 4YHHL 4A3BG 3N3UA 1CUKA 2N3SA 2HT1A 1PHJA 4DR4L 1LM0A 4JV5L 2JEBI 5IT9c 4DV0L 4BXXH 4BY7G 1QVCA 4DV4L 4OX9Q 3S17H 3S1NH 4IFDI 3CCUA 2AWNA 1P16A 1HH2P 1MJCA 1X3GA 2UU9L 3S14H 3S1MH 1QVFA 3A5ZB 2AHOB 4DV6Q 2PI2E 4DV7Q 2B63G 1T9HA 4JI7Q 2YTXA 1KXLA 1VCIA 3ZJYC 4R4IA 3W1GA 3K80C 5M3MG 4OO1I 1OXXK 4DV3Q 2LXJA 1MKHA 3CXCA 3UDXA 4A4IA 3PIPA 3JAMi 4A3BH 3Q8DA 1XPUA 4O2DA 3BZKA 1VQ5A 1E1OA 4RMFA 3GDEA 5C4XH 1V43A 1I94L 4DAMA 1CKNA 1HZAA 2V1CC 2I5HA 1HNZL 5EAYA 1PH2A 1XTDA 4A3GH 1E24A 2K52A 2D0PA 4B3ML 1N33Q 3I56A 4B3SL 4KI0A 3SGIA 1L0WA 1XMOQ 1FJGL 5C4JH 3PO2G 3G48A 4PG3A 4X66Q 3TRZA 3WWVA 3PO3H 1L2FA 4GOPB 1EYGA 4HJ9A 3ZCBA 1VQHA 1TWHH 3K7UC 3EIVA 5E7NA 4JI4L 3J80i 3UE1A 2BA1A 2CKZB 4IO9A 3RNUA 1TXYA 2OQ0A 1VQPA 1NBWA 3CC4A 2B3GA 4U04A 3BU2A 2KCTA 4L5SA 4A3MH 3HOZG 1GO3E 3PCOB 1MIUA 1IBKL 3HKZG 1EQRA 2RHQB 5LMNQ 1N32L 2IHEA 2VQEQ 4LF9Q 3MXNB 2YTYA 4C2MH 3CPFA 1C0AA 3NBHB 2WAQG 2Q2HA 1JJCB 1Q82C 2VY3A 1SN8A 2OCEA 2GVAA 2L15A 3AQQA 4DK3C 2CQOA 4DR3Q 3M4PA 2ZM6L 1N8RC 3HOXG 4YY3Q 3SHGA 4GKKL 1I3QH 5K36G 4LUZA 5JEAG 5AJ3L 2UUAL 1UE7A 1E3PA 1VQCA 3DLLA 2ZJRA 3L7ZC 1HR0Q 4JI6Q 3NELA 2YYZA 1YIJA 4A3EH 1NE3A 5C0XI 3F2CA 3RZOH 3S24A 1FGUA 5JJ7A 4GN4B 3HOUG 4HJ5A 1XPRA 3GO5A 3CMEA 1WFQA 1I6HH 1HNXQ 1SMXA 4DUZL 1J6QA 4DR1L 1PV4A 1NJIC 1VQEA 2AWOA 4JV5Q 3T1HL 1UEBA 1WYDA 1YJWA 1MJEA 1M90C 1IBMQ 5ELNA 2UU9Q 3FHWA 1CSPA 1PH6A 3CD6A 4A3LG 4BBSG 2E5LQ 3S16H 1PVOA 3M3YH 4IFDG 3STBD 2CWAA 2QGQA 1WOCA 3CUCA 3J81c 1G51A 5FJ8G 2E2JH 3HOVG 4R4CA 3J7A5 2NVTH 2PQAA 1YHQA 1XMQQ 1LYLA 2K4KA 2JK8A 1QZGA 1X6OA 5HGQA 3HOUH 2HHHQ 1Y1WG 4U0SA 4O0AA 2RF4A 4GLAC 1KD1C 4OO1G 4JC0A 2KCMA 3J7ZC 1PH8A 3HOYG 2ZJQA 1A63A 5BR8L 1YHBA 4HIDA 3U50C 4DUYL 4B3TQ 4LUOA 1N9WA 4LW1A 3OW2A 3U4ZA 4BBSH 4A3LH 3E9IA 3GTQH 4AH6A 2QEXA 1I50H 1FVIA 4MTNA 1OXTA 4GNXA 3J81j 4U0UA 5LMUQ 1XPOA 1KC8C 4JI2L 5FJ8H 4LF5L 4ITRA 5FLMG 4HIOA 1HJPA 4HIMA 1Q46A 3CPWA 1VQOA 1K8AC 4B3SQ 2E2HH 1N34L 3K0XA 5C3EG 4JI8L 1Y1WH 2IX1A 1RIPA 4GKJL 3W1BA 1OXUA 4R4OA 4X65Q 3KOJA 1E7ZA 3EN2A 4BBRG 1EUJA 1C7YA 3HOYH 1S40A 1SR3A 4QIWE 1YI2A 3M4QA 3CCQA 2EXDA 1BKBA 3F2BA 1AE3A 3U58A 4UPAA 4ME3A 4X62Q 3CMAA 4PY3A 4BA1I 3AEVA 2NZHA 3K7AH 5IYBG 4X2CA 4X2DA 5IP7G 5C44G 2UUCQ 2NVQH 1YBYA 5JJIA 4C3IH 4DR7Q 3T1YQ 3KF8B 2UXCQ 2LSSA 1WI5A 2GN5A 3RN2A 3FKIG 5C3EH 4P72A 4OONA 4JBMA 4L5RC 3A0JA 4LF4L 1PYSB 2H5XA 3KJPA 2YV5A 4R4TA 4BBRH 1PH4A 4BA2I 3L0OA 2ZM6Q 4MZ9A 4OWTB 4GN3B 4EQ5A 2VUMG 4JYAQ 1Z47A 4B3RL 2K75A 1GKHA 3GD7A 2UUAQ 4KHPL 4GLVB 2VQFL 4NXNL 1VQ4A 1X54A 1BVSA 3E0EA 1KIXA 3CCMA 3TS0A 3UE0A 4L5QA 3F2DA 2JA5G 5IYBH 3F1ZA 4BY1G 1J5EQ 3A5UA 1CKNB 3CAMA 4DPGA 4YWLA 5C44H 2BH2A 4BY7H 3RZDH 2OTLA 4AQYL 1Y1VG 5C0XG 1HNWQ 4DR1Q 2OWOA 2B63H 4MNOA 1NTGA 4JI3L 1VQAA 4LU4A 1AE2A 2NVYH 2WB1G 2OQKA 1KRTA 4JBWA 5IP9G 1QVGA 4LWCA 4DV1Q 4A3CG 1JJGA 4U07A 4AYBE 4POFA 4LFBL 5M3MH 4X64L 4OWXB 4JI5L 1UE6A 4LF8Q 2VZAA 2K14A 3UDFA 3CQZH 1PH7A 2A19A 4YCWA 1KHIA 4DV5L 2JA5H 2NVXH 1TWGH 2A1AA 2IY5B 1A8VA 1RL2A 3EBEA 4JI0L 2JA8G 1EQQA 1X3FA 1Y1VH 2CFMA 2UXBL 1GVPA 5J3BA 4R4QA 4LF6L 2UUBQ 1YEZA 2UXDQ 4DUYQ 3KYHC 1EIFA 5IP9H 3H3VI 1JT8A 4A3CH 4N67A 1XNRL 3PUVA 2Y0SE 4JOIA 3OYYA 4J15A 1Q86C 3PO2H 2NZOA 4DV2L 4YWMA 2F52A 3ER0A 1EIYB 3KDFA 3CC2A 4PZ6A 3J81i 4LF5Q 4LF7Q 4QGUA 5CGLA 4PMWA 1YHAA 4IOAA 4GLXA 4A3KG 1YJNA 4P74A 3I55A 4DKAC 2BA0A 2ALYB 1N34Q 4JI8Q 3CCJA 5IWAQ 2KHJA 2JA8H 5JJLA 5GADC 3JAMc 1OXSC 4DR5L 3HOWG 2R7FA 4NXMQ 2ATWA 2K5NA 3I4MG 4KLKA 5IY0A 1K8GA 1Q81C 1EFWA 3HOZH 5JEAJ 4DK6C 3CP0A 3RLNA 3M85A 3ZLMA 4YHHQ 4OX9L 4DR4Q 2ZTDA 3G6EA 1GD7A 4DV0Q 2LXKA 4DV7L 1HZCA 1IXRA 4DV6L 1K9MC 1VQ6A 4DV4Q 4QL5A 4JI7L 2R92G 3GTMH 4UP9A 4WGJA 1QUQA 4DAYB 4LFAL 3TS2A 4A3KH 3OTOL 3HOXH 2G03A 1Z9FA 5H1SE 3B6YA 3KF6B 1KRSA 4C3HH 4C3JH 2PQAB 4DV3L 1U5KA 1N36L 4IJHA 1I5FA 5EU0A 3KF6A 1K73C 3I4MH 1SFOH 2KENA 3ULLA 4B3RQ 3RLOA 1Q7YC 4IFDJ 4RG1A 1UWVA 4KHPQ 4HJAA 1D8LA 2VQFQ 4NXNQ 1IBLL 3I4NG 4UP8A 3CCVA 3CC7A 3PUXA 5IYDG 4DR2L 1GM5A 1X65A 3HFZB 3GTOH 3DM3A 1I94Q 3PGZA 3KFUA 2GVBA 1SRUA 4GNXB 4JBKA 1HNZQ 1NY4A 3AYHB 2MO0A 3U4VA 1BBUA 4LFCL 2ZTCA 1S3OA 1ASYA 1B70B 3K81C 1VQIA 3MEFA 3HKSA 4B3MQ 2A8VA 2DGYA 3HOVH 1XNQL 1HZBA 4X66L 1X9NA 3PUWA 5ELOA 5M3FG 1FJGQ 1VQBA 2R7DA 1NMGA 3I4NH 2R93G 5M5XH 1OTCA 2Y0SG 4LUVA 2B29A 2K50A 4TVAB 3S2DH 3K8AA 4FDBA 1PH5A 5JFZA 5IYDH 1E1TA 1PYBA 5JJ6A 1VQFA 1W2BA 5DLQE 3KLWA 4JI0Q 3ZC7A 3PV0A 4JI4Q 4UY8C 5LMNL 3GTPH 4XI8A 1V9PA 2PNHA 4LF6Q 1A0IA 1DGSA 4YCUA 5GAGC 3KJOA 1IBKQ 1KQSA 2Q2IA 1NMFA 4QQBX 1N32Q
chains in the Genus database with same CATH superfamily
4OWWB 3RLFA 2B2TC 1SJHD 4FXDA 3AFPA 5KNCA 2R93H 1L1OA 2OT2A 4K6DA 1TY0A 3OW7A 1HR0L 1XX8A 1CKMA 1E0BA 4CDCC 4ILWA 1FYCA 1BOSA 2J0TD 2Z0SA 1AH9A 1A15A 3VR4A 2CH4A 2L55A 3ZYYX 5BN4A 5IP7H 1TWHB 5ISRA 4CDEC 1GXDC 1SYCA 5GQOA 3H3VH 2KEDA 5C0XJ 1X56A 1K83H 2OTJA 4PZ8A 2VUMH 3W2DA 2F3IA 3RR5A 5I9PA 2HHHL 5IODA 1VQGA 4LNQA 1FNVA 2R7ZG 5FO7B 3ICEA 3MVVA 3J80E 4A3FH 4A75A 2HQEA 4KHZA 1I3QB 4B3TL 5C0XH 1Q1EA 5I2XA 4WJ3M 5CBEE 1G6PA 2EJFC 2IT1A 4A3EB 2XTIA 5IGDA 2JQOA 1PXUA 1F2LA 4N8FA 4Y7NH 4IUNA 1IW7C 1QE6A 1AW7A 1O78A 4JK1C 2CH4W 2AUJD 3KDFB 4ID6A 2L12A 4I7AA 4IPHA 4LFCQ 3QIAA 2LKVA 4C1NI 3G4SA 1JMCA 4JI2Q 1YVCA 2Q2TA 1XNQQ 5JJKA 3D6WA 3EA6A 5T1IA 2HQLA 4LJZC 4CKEA 3SK8A 4IZ8A 2E2JB 1V1PB 4POGA 2OF1A 4A3EG 3PF4A 3ONAB 1NSNS 2JA7H 1MHWC 2UUCL 1FNWA 1ICWA 3T1YL 1Y8PB 2UXCL 3CCEA 2R6GA 2PMZE 5JVG3 4BBSB 1EOVA 3S15H 1HUNA 1JWSD 1CA5A 3AFQA 3I70A 1KAWA 5JOBA 3EROA 3J7YW 3QO2A 4ODGA 3X3MA 5GROA 2A69D 2ID0A 4JOIC 4X6AH 4IOCA 1H95A 1F2YA 4DXFA 1O7YA 2KA7A 2E76C 3D4DA 1UE1A 2RA4A 1EY6A 2CWPA 1UEAB 2KHSA 3MHBA 3CW2C 5E1FA 2ICIA 4GOPC 4JI3Q 4JG2A 3L3OC 4LF8L 3J7AF 4IPDA 1C9OA 1MSGA 3NTIA 3ERQA 3M9BA 4JI5Q 2ZJPA 1K73C 3STBC 1AP0A 2BH8A 3H0GG 4A3IH 3S1RH 1V1QA 5BN3A 5EKLA 1BCPB 2Z4HA 4H02A 3I91A 2UUBL 4A93H 2F4VQ 3GTKH 2HUGA 2LY7A 2PPBC 4LF9L 1I4GA 3TSSA 2RCNA 1SXTA 4B08A 3RZDB 1XNRQ 3OMCA 5CV5A 3TDQA 4RA8A 2CHBD 2XNAC 2EJMA 4Q5VA 4HIKA 3C2PA 3PF5A 2VL6A 1WCMH 1G291 1AZQA 5M3MB 2F03A 1CUKA 3CQZB 2HT1A 4DR4L 2JA5B 1TWGB 2A6ED 3VR6A 4DV0L 4JV5L 1QVCA 3S1NH 2AWNA 1JWMD 1P16A 1HH2P 1X3GA 1BCPD 5IGBA 3S14H 3S1MH 4XYOA 4NW2A 3SR1A 1VMCA 2PI2E 2WB1B 2EPBA 1VCIA 3GTJB 1IL8A 2R61A 1S5DD 5M3MG 3K80C 3PO2B 3PIPA 1O7LA 4FF4A 5CV7A 5C6AA 2IX3A 3Q8DA 4TRDA 2XRQD 1TQOA 1LV9A 2B2VA 2B39A 2DY8A 3GDEA 4JW0A 4DAMA 2I5HA 3D4RA 3E0JA 1SNPA 1ML0D 1ILPA 1E24A 2K52A 1N33Q 2NTTA 4KI0A 1XMOQ 3PO2G 2H4OA 3DUZA 1JR0D 2WACA 3WWVA 1L2FA 3J81L 1VQHA 1TWHH 3K7UC 5JVH3 2CKZB 1SYGA 2B3GA 1SFOB 1ZEQX 4L5SA 2G5DA 1B3QA 2L11A 4K6LA 2Z6BA 1C48A 2VQEQ 2EE1A 1ZYRC 2M2LA 1C0AA 1RDPD 3NBHB 1JJCB 3NBHA 2OCEA 4ZAIA 4DR3Q 3SHGA 1I3QH 4LUZA 3TP7A 4CKBA 1VQCA 2HD3A 2ZJRA 3L7ZC 5DNFA 3HOVB 2IW3A 3NELA 2G9HD 4A3EH 4K2LA 3S24A 5IT9E 3I4NB 1GUGA 2F0JA 4HCSA 1I4XA 1VQEA 1WYDA 1YJWA 1MJEA 4MTKA 1SJED 1IBMQ 3CD6A 1PH6A 1STAA 2WKCA 3VYSA 1PVOA 1JCKB 1M8AA 5C5LA 2E2JH 2EDGA 2L4NA 3BYYB 3HOVG 2PQAA 4NP5A 1QZGA 4MIUA 4RH6A 2VXWA 1Y1WG 1NR2A 3HRZC 4OO1G 1PH8A 3FMCA 4H13C 4DUYL 2F0OA 4FNFA 4LW1A 5NUCA 1YNJC 3U4ZA 4BBSH 4A3LH 2B2WA 1FVIA 4UAIA 3J81j 4OIJA 1KC8C 4JI2L 2OXPA 1TWFB 1LTSD 5FLMG 1HJPA 3CPWA 2H1EA 1PZJD 1N34L 4JI8L 1RIPA 4X65Q 4R4OA 3KOJA 3IL8A 4KN4C 1C7YA 3M4QA 1AE3A 4UPAA 4X62Q 4BA1I 3S2HB 2MUYA 3MFGA 3QOJA 4X2CA 1SNDA 5JJIA 3V96A 5I9OA 3KF8B 3OIQA 5G3LD 5LHY1 1WI5A 3FKIG 4KTAA 4P72A 4OONA 4JBMA 3A54A 3A0JA 1PYSB 2ENBA 3KJPA 2YV5A 4R4TA 1EQTA 1XTCD 4CJ0B 2ZM6Q 4N9PA 4FYDA 1Z47A 4XQQA 2UUAQ 4KHPL 4K8IA 4K5WA 3PQIA 1BVSA 2F0FA 3CCMA 3TS0A 3UE0A 4L5QA 3F2DA 5IYBH 3DEPA 4YWLA 2CW0D 3RZDH 1Y1VG 1RODA 3GP7A 4CJ2C 2OWOA 4MNOA 2Z1CA 4JI3L 1ICFB 2EY1A 1G91A 3CHBD 2NB0A 5M3MH 1B53A 4JI5L 4R8NA 1CQVA 3CQZH 2JA5H 1TWGH 1EIHA 1JC7A 1RL2A 3EBEA 4JI0L 5A2QE 1LO5D 1E2VA 1B3AA 2UXDQ 3Q22A 2PZTA 2SNSA 1BCPF 1XNRL 1EU3A 3PO2H 3ER0A 3CC2A 2R92B 4DNRB 2B2VC 4GLXA 1YJNA 1QNUA 4P74A 4DKAC 2BA0A 4IUVA 4C3HG 3GQBA 1HA6A 1RTOA 2KHJA 4FF1A 2K5NA 4OIKA 5IY0A 2KOLA 1Q81C 4QB4A 5K5PA 3M85A 2RBMA 2NZ1D 4WORA 1GUNA 2LXKA 1IXRA 2R92G 4WGJA 4DAYB 2K6AA 4LFAL 4DXGA 2G03A 3FPUB 3KF6B 3G6JB 4G7ZC 1I5FA 3KF6A 1STEA 1SFOH 4B3RQ 1SE3A 3RLOA 3FDTA 1EY0A 4ZUIA 2VQFQ 4NXNQ 2Y0SB 4IUPA 3TP8A 3UI2A 4DR2L 1X65A 4DF7A 4A3DB 1U9RA 1KDBA 3Q6SA 1SRUA 4JBKA 1HNZQ 2A6HD 3AYHB 1BBUA 5D14A 1S3OA 3MEFA 2C9OA 3HKSA 1DOKA 2B2UA 3HOVH 2QDLA 4CDFC 5ELOA 3MC0B 1FJGQ 2AQ3B 5CV9A 3LWEA 3I4NH 2R93G 2Y0SG 4LUVA 4TVAB 1PH5A 4FDBA 1H9SA 2P5ZX 1E1TA 1KDCA 1MSHA 5DLQE 5KNDA 4P2CB 3ND8A 4A3BB 3HGBA 4RHSA 2Q2IA 1EYAA 3NUCA 1A3TA 4XT3B 4QQBX 4YCVA 5FLMH 1LT3D 4DR3L 1LABA 1EEFD 1STGA 5CGKA 1HHVA 1ENCA 1EL0A 1WJJA 1H9MA 1JB7A 3I4OA 4KKTA 4K5VA 4GS3A 5C4JB 4DR5Q 5C4ZA 4A3FG 1CZWA 4OELB 1TWFH 1MI2A 3ULJA 2MO1A 1VQ9A 1IBML 3WDNA 4DA2A 5A35A 1H9KA 3FKIH 3NHHA 2J7ZA 4A3GG 4H44C 1TS4A 1Q90A 1O7IA 1LACA 4KN7C 3OTOQ 1QB5D 4G4KA 2WP8J 3K58A 1UE5A 2OEOA 2K5HA 3CCRA 2N55A 3S2HH 1D1KA 1S5BD 2B2YC 2JEAI 3PO3G 1MD2D 2ZXRA 2F6SA 1IW7D 4FVMA 4GZYC 1FD7D 4K0KL 1ENFA 2JSOA 3OIPA 2HIXA 3C3LA 1KTKA 3J80L 1PH1A 2E8GA 5JPNC 2JA7G 3HKZB 4HSPA 1CQFA 2F0NA 2IPKD 3K0YA 3IFDA 2Z6KC 4L5TA 4X65L 4DR6L 2E74C 2AKWB 4CJ1B 2EIFA 4GOPA 4GKJQ 1B9NA 4X62L 1IL2A 1WTWA 3TBIB 5E4WC 5HURA 2RKSA 3ULPA 5JFFA 3HOUB 4IPCA 2PI2A 1D5ZC 1SROA 3QJYA 3D0FA 5C4HA 3G71A 1QUQB 1K3BC 1HUMA 1VQ7A 5EPLA 3BZCA 3MXNA 4OHJA 1YITA 2MNAA 1HR0W 1EIGA 3CU7A 1YJ9A 3A56A 4LF4Q 5I2YA 5GAHC 3OWFA 1ONLA 2D62A 1TS2A 4AYBG 2F0MA 4A3IG 2D0OA 1S72A 2KUMA 4IJLA 3IAYA 2EZVA 3HOYB 3SN9A 4A93G 1LUZA 2R92H 1W3SA 2K7VA 5DEHA 3NBIA 5KYLA 4HJ7A 4JI1Q 1BF4A 4TQUS 4XTCS 4C3IB 4LFBQ 2HIVA 3Q24A 1PH3A 1CTMA 4F88A 4DK1A 1WCMG 1SLJA 1SE8A 2VS1A 4BBRB 1IZ6A 5FLXL 4XT1B 2UXDL 2F3WA 2HDMA 2VW9A 1X55A 3HZXA 3VDYA 1J9OA 2QKIC 3A8JE 3NP8A 3CCLA 3K5LA 5EBDA 1VQKA 3DXJC 4BY7B 4C3IG 3E9HA 1VQDA 3RUZA 2C5CA 1L1OB 1CKOA 4YY3L 3SK6A 3SVMA 2VB2X 5IYCH 1I4RA 4KD3A 1HZ9A 4JI6L 3A7AB 3OPOA 4A3DH 2F0VA 4HJ8A 2Z8LA 1UNSA 1PRTB 5EPJA 5JJZA 2NVXB 2B2UC 3DWPA 4BXXH 4BY7G 3P1HA 1Y69U 4RHRA 3MZ5A 2UU9L 2FFKB 1T9HA 1KXLA 2YTXA 1ZKOA 3D6CA 1W6KA 3ZJYC 3W1GA 5LL6S 1NUCA 1OXXK 4DFAA 2LXJA 3UDXA 3JAMi 4A3BH 1SYEA 1XPUA 2FMMA 2PQEA 1VQ5A 1E1OA 4FF2A 2JA8B 1CKNA 2V1CC 2EOTA 1I4QA 1HNZL 5EAYA 2ZT9C 3HOZB 3H3VC 4A3GH 1PRTD 5C3WA 3I56A 4IURA 4LAAA 1L0WA 2BOSA 5C4JH 1FJGL 3G48A 2M9VA 2F0KA 2WAQB 1PFBA 3PO3H 1IYVA 4RGMA 4DK0A 4A3KB 2IX1A 4IO9A 1NBWA 3CC4A 1D5XC 1AFPA 2I07B 4U04A 3HOZG 3C46A 4S3SA 3MAQA 5LMNQ 2IHEA 1D5MC 2WAQG 2Q2HA 3NTKA 1X3PA 2VY3A 1F2ZA 1SN8A 2B8FA 4K14A 3PIO3 2GVAA 4DK3C 2K33A 2CQOA 4J6HA 3M4PA 1B2TA 1RTNA 4KY5A 3H6MA 1PMRA 3DLLA 1K28A 3GV3A 2SNMA 2YYZA 1NE3A 5JJ7A 4GN4B 1SNMA 1XPRA 2PCFB 2XRSD 4ZQ3A 3C1FA 1SMXA 3RMHA 4DR1L 3S2DB 1M4VA 4BS9A 1SMYC 5ELNA 5IT9L 3FHWA 1CSPA 3I73A 4A3LG 1O80A 4BBSG 1BQQT 3M3YH 1B44D 1X32A 4O42A 4R4CA 1LYLA 2K4KA 2CVRA 3HOUH 2PNRC 1EEID 4O0AA 2NTSA 1KD1C 4JC0A 2KCMA 3J7ZC 1A63A 2L9HA 3BG3A 4HIDA 3E5SA 3U50C 2QEXA 5HGTA 5LMUQ 5FJ8H 4LF5L 4HIOA 3K5MA 5ELEA 4B3SQ 1VQOA 2Q8IB 4GKJL 3W1BA 1OXUA 1E7ZA 2FMCA 1EUJA 3HOYH 4QIWE 1BUVT 3A7LA 3TMEA 4RFBA 2NUCA 3AEVA 2NZHA 3K7AH 5IYBG 4BY1B 4X2DA 2DJFC 2JXMB 1RKNA 5C4XB 2EYOA 3RD4A 4C3IH 1HFNA 2JA6B 5JAVA 2GN5A 3N52A 3RN2A 3R2TA 3V2TA 4LF4L 4BBRH 1PH4A 4L8JA 1PDQA 4GN3B 4JYAQ 1U4MA 3G7LA 1X54A 1KIXA 1BDOA 2JA5G 3F1ZA 4BY1G 4WFN3 4Z9CB 3CAMA 2BH2A 5C5MA 4L6TB 4BY7H 2OTLA 1HNWQ 2J4XA 3GTLB 4A3MB 1AE2A 2WB1G 4CBVA 4JBWA 3O13A 4LWCA 4AYBE 3CKIB 4LFBL 1ESRA 1T5XD 2BDOA 2VZAA 1PH7A 1GUOA 1KHIA 2NVXH 1ILQA 3ND9A 4M8AA 1EQQA 1TY2A 1Q8IA 1GVPA 4LF6L 1HQRD 4IUUA 3VR2A 5M5YB 1CZGA 3KYHC 1PTOB 3T51B 5A2QL 3K5NA 5EBCA 2AQ2B 2RCFA 3PMFA 2F52A 3OMGA 1UAPA 2EYPA 3M7GA 1F9SA 3WOEA 1B9MA 1D6EC 2QF7A 2ALYB 2NUDA 2JA8H 1OXSC 2MPMA 1WTRA 2DNEA 1EFWA 3HOZH 3KBXA 4DK6C 3ZLMA 2WKDA 4KKSA 4A3JB 2Z9HA 2MP1A 3G6EA 1YNND 2F1MA 1HZCA 2XVSA 4ABNA 1PRTF 3Q0AA 4QCLA 4QL5A 5KEEA 3D8GA 4A3KH 2E2IB 4PV1C 2PQAB 2R3ZA 4X3KA 1PTOD 1IYUA 1ESFA 3QB3A 3NK9A 1G8ZD 1EY8A 2A68D 1UWVA 4HJAA 1D8LA 1TWAB 1R9TB 3I4NG 4UP8A 3CC7A 2IJ0A 5C3XA 1BNZA 2BDNA 2DY7A 1JQYD 1GM5A 3HFZB 3DM3A 2GVBA 2A69C 4LFCL 1RF2D 5D3DA 1SBBB 4J8QA 3I4LA 4B3MQ 2BE5C 3R93A 3S17B 1XNQL 1X9NA 1S4ZA 4FXKC 2K03A 2R7DA 1NMGA 2F0HA 4FF3A 1IKLA 1OTCA 1D2BA 2B29A 3E6ZX 3NE5B 4R8IA 2FINB 3S2DH 5JFZA 3TP5A 5JJ6A 1W2BA 3ZC7A 5LMNL 2MGSA 4XI8A 2PNHA 1A0IA 2B2YA 4YCUA 4H0LC 1IBKQ 1STYA 4EQPA 1N32Q 3Q23A 5EPKA 1EWCA 1AZPA 1VQNA 2N49A 2RDGA 2IL8A 3I3CA 1G2TA 3NEMA 4IUQA 1IHZA 5DAUA 2WIIB 3JAME 1JOQA 1K3RA 4HTHA 4GKKQ 1CFMA 2PO4A 1K0SA 2EXZA 1HFGA 1LTLA 2WAQE 1GOZA 1UUPA 2Z6KA 3SE5A 1E22A 2C35B 1Q8KA 1R4QB 1ET9A 4F8MA 2NN6I 2XN9C 4DUZQ 5KGUA 4IPGA 3T1HQ 4EX5A 1K8MA 2M00A 3PIOA 1YZ6A 4TKOB 1BCPC 5FK9C 2I5MX 4C2MB 1Y8OB 5FLXc 1N36Q 3I2ZA 4OXPA 3W5OA 3MFYA 3BZDB 4RKBA 4HSVA 3SHLA 4BY1H 4PZ7A 1X3EA 1DYQA 1IBLQ 2F4VL 3VYTA 2JA6H 2K32A 2QW7A 2YTVA 3A55A 3TZDA 5BR8Q 4ZCKA 4CDDC 3UDGA 5LMUL 1Q1BA 3GTJH 1KLUD 2FJ2A 3S6AA 3L2PA 1I6HB 2IHFA 1YNXA 2EYHA 4I7ZC 3T16A 3F2UA 1VQLA 1IYJB 4H7BA 1HPCA 4YIJA 1GUWA 2D9UA 3TREA 4NPSA 3FRPB 3W3AA 2EY2A 1BBWA 1CK1A 2EY5A 1SNQA 3P7JA 5CC4A 3PSIA 3GTLH 2KQ3A 2RDHA 1DM0B 2KVMA 3LGJA 3H94A 2EJGC 2DUDA 4CHTB 1P8LA 1QNKA 5JPMC 3RN5A 1VS0A 2NUNA 1CSQA 3NENA 3GTQB 1EYCA 4JYAL 3JC66 1WVLA 2X6LA 3PUYA 2N88A 2HCCA 4RKLA 5M5YH 4YWKA 4U0ZA 4APVA 1PTOH 2QA4A 1HNWL 2E2DC 3MXPA 1Z6HA 2ES2A 1EU4A 4G7OC 1ASZA 1ENAA 1QZHA 2Q2UA 1N33L 1QILA 2D5DA 2Q8RE 1PFSA 3UDIA 5IE8A 4ALPA 1XMOL 1BO0A 1B8AA 4A76A 3TRZA 1VQ8A 3NQTA 2NVQB 1V1OA 5I6YA 5KIXA 2XGTA 3TEHB 1M1KC 4X64Q 4A3JH 5IYCG 3BJUA 1H9SB 5C3EB 2JA9A 2WB1E 3BVGA 1KL9A 1JE5A 1STNA 3BDLA 2PMZB 4A3DG 2EYFA 3M4YA 1VQMA 1KLGD 1L0YB 3CF5A 2E2IH 2I0QA 2UXBQ 4QMGA 2VQEL 4XIGS 2NN6H 3L9AX 5C44B 4BXXG 5E3FA 4B9WA 4RGOS 4UDUC 4DV2Q 1DOMA 1Q12A 4P75A 2SEBD 3K5OA 2B63B 1TWAH 1R9TH 1PTOF 1C8CA 2KHIA 2KEEA 1QJOA 2MQHA 2XSCA 1Q3LA 2VB3X 4EVOA 4A3BG 3N3UA 2N3SA 1PHJA 1A3VA 5L37A 1LM0A 2F0IA 2NWGA 5IT9c 1F9PA 3VR3A 1CM9A 3S17H 1K8OA 3WOFA 3CCUA 2L1BA 2WINB 4IFDI 1F9RA 2DN8A 1MJCA 1SYFA 2K05A 4JVZA 1QVFA 3I72A 4DV7Q 4ZK9B 2B63G 4JI7Q 5EQ0A 1HA5A 4R4IA 3CXCA 1MKHA 4A4IA 1I6VC 1XXGA 3TN2A 1Y8NB 2X69A 3D3RA 1GHKA 3QOLA 1G2SA 1V43A 1BBXC 3S9WA 1WD0A 5KRUA 1PH2A 1VF5C 1SDFA 3BVZA 2D0PA 4B3ML 4OEMB 3SGIA 1C4QA 3GTMB 4X66Q 4KHVA 4ZYSA 5KYIA 4KKUA 4GOPB 3URYA 5CORA 3HOXB 4KJOA 2AUKA 1EQVA 3EIVA 4O1NA 5E7NA 1X3QA 2BA1A 3VA5A 4C3JB 2OQ0A 1JWUD 3I4MB 3BU2A 2KCTA 1CI3M 3PCOB 3MTSA 3HKZG 5CYUA 1IBKL 1EQRA 2FHTA 2K5WA 2RHQB 3EVQA 1N32L 3I8ZA 3R8BA 4LF9Q 3MXNB 4C2MH 2XIWA 3P20A 1Q82C 5CR3A 2K1BA 4IUTA 2L15A 3QG1A 2ZM6L 1II3A 3HOXG 4GKKL 3CRKC 4C3JG 2UUAL 4BWGB 1UE7A 4WJWA 5F2DA 1YIJA 5C0XI 1LTTD 3HOUG 2HDLA 1VF7A 5D3IB 3GO5A 3CMEA 1I6HH 1HNXQ 1QCBD 2JN4A 4DUZL 1J6QA 1DJRD 1GUTA 3ITPA 4JV5Q 2F0GA 3IKJA 3T1HL 1BR9A 4WRDA 1M90C 3GTPB 2E5LQ 3DWAA 5K36H 3STBD 2CWAA 3U9OA 4EGVA 4U68A 5JEAH 3A8KE 1HQMC 1KDAA 1G51A 1TS3A 5FJ8G 3J81c 3J7A5 1WD1A 1LTID 1EYDA 3H91A 1XMQQ 1YHQA 3NQIA 4EQOA 5CBAE 2KCCA 1DOLA 2NBFA 2RF4A 4GLAC 1HRJA 3HOYG 2ZJQA 5EGTA 5BR8L 1YHBA 1B4OA 3GV6A 4KK7A 2YU9B 1WTQA 4HAEA 4LUOA 3OW2A 1PFNA 3GTQH 4MTNA 1EZ8A 4GNXA 3H09A 4U0UA 3MA2B 1VMPA 3S1NB 4ITRA 1PLFA 4Q0FA 4HIMA 4K8JA 4F87A 2A6HC 2JP1A 3S1MB 3K0XA 1LLRD 3S1QB 3EN2A 4BBRG 1SR3A 2EXDA 1BKBA 4ME3A 2ZXOA 3CMAA 4PY3A 1RJTA 4DGZA 1WTXA 2AQ1B 3CRLC 2NVQH 3AU7A 1YBYA 1WTVA 4DR7Q 1CHPD 1LT4D 3M4OB 1LTGD 1SNOA 2LSSA 5I4DA 5C3EH 1A3UA 2MJ8A 2H5XA 4BA2I 3L0OA 4MZ9A 4B3RL 3GD7A 2R7ZB 2VQFL 4NXNL 3E0EA 1J5EQ 2G9DA 1TWCB 1SYDA 1CKNB 4DPGA 5J22A 5C44H 3A5UA 1B50A 2K28A 1DZ1A 2B63H 1VQAA 1FNUA 4DV1Q 1JJGA 4X64L 5IGEA 4OWXB 3GTGB 2K14A 1DXMA 5DM63 3UDFA 1IKMA 1PZID 1PYWD 2JA8G 2TMPA 3HP3A 1ZYRD 3HOWB 2CFMA 4KY7A 2UXBL 5J3BA 4R4QA 1S5ED 1YEZA 4B9XA 4DUYQ 1EIFA 5IP9H 1JT8A 1NAPA 1V8QA 4A3CH 4N67A 3PUVA 2Y0SE 4FO2A 2NZOA 4DV2L 2PW7A 1EIYB 4NDXA 3KDFA 3J81i 4LF7Q 5CGLA 4PMWA 4A3KG 1N34Q 3NWTA 4JI8Q 2E75C 5IWAQ 5JJLA 4QUCA 5GADC 3HOWG 4DR5L 4NXMQ 4DN4M 1NR4A 5M5WB 3AB9A 2ATWA 4KLKA 3SEBA 1V1PA 3RLNA 4YHHQ 2L0CA 2DNCA 4NMZA 2ZTDA 5AFWA 3V05A 4DV7L 1VQ6A 3GTMH 4DV4Q 4JI7L 4UP9A 4OL7A 3TS2A 4ZRZA 3OTOL 3HOXH 4JPBW 4C3JH 1U5KA 4PNYA 4IJHA 5EU0A 1GUSA 4XXEA 3I4MH 2MHVA 1SEBD 2KENA 3ULLA 5M3FB 1Q7YC 4RG1A 1PFMA 1YNJD 5E4XA 4QUFA 3DHQA 4KHPQ 3H0GB 4K5XA 3PUXA 1STBA 1JICA 2BE5D 1I94Q 3PGZA 2RSOA 1R4PB 3KFUA 3X3NA 3U4VA 4KJNA 2ZTCA 1SE4A 1B70B 2A8VA 1AEXA 1HTLD 5FLXE 4X66L 5M3FG 2NYZD 1TR5A 5IYDH 1TT2A 1VQFA 2F0PA 1DONA 4JI0Q 2QDBA 4JI4Q 1JOOA 3PV0A 3GTPH 1V9PA 5I6WA 1TVXA 1EY4A 1DGSA 5GAGC 1ZXTA 4L63B 1KQSA 2A5HA 2F0UA 5DM73 3HEJA 1PH9A 3HKZE 3CCSA 1EWIA 2YU9H 1XYIA 1PZKD 5AJ3Q 4QJFA 3LETA 1HNXL 4P71A 4GNXC 2LS01 3JAML 3E3XA 3DMUA 5C4XG 3BYTB 3ERSX 2QEJC 2JA6G 2N8NA 2K5VA 3IRBA 3EQLC 2E5LL 3OSOA 1J8IA 1FGBD 3S1QH 1HXYD 3A8IE 4OGQC 1T5EA 4JI1L 1VQJA 3OHXC 5J1ZA 4LFAQ 5IGGA 1JJ2A 3M7NA 1XMQL 3FP9A 1U4RA 3HS0C 5CMTA 1A6XA 2JE6I 2RVLA 2KECA 1WTPA 4E6IA 5CV6A 1K0RA 3I7FA 4DNIA 1EY9A 3M4OH 3KBGA 1HTPA 3LNNA 4DR2Q 1PA6A 1RD9D 1L1OC 4A3MG 3FEWX 3IFTA 3RZOB 1LTRD 4Y52H 4I65A 4G57A 5GAEC 4UP7A 4X3UA 3D31A 4R1JA 1XWEA 2R7ZH 2JJQA 4WJ4A 2RDFA 1PRTC 1TWCH 2CCZA 3S16B 2RHSB 3PUZA 2I5LX 3A74A 3KLRA 5LMNW 4IN3A 3BDOA 2N78A 5M9OA 2ASBA 5LL6X 2NVTB 4DU9A 1I4PA 1B1ZA 2F0WA 4DR7L 3HG9A 3GTGH 3NWSA 4RAUC 3H15A 1I50B 3NXWA 4PQXA 3HOWH 2ZXPA 5ELCA 1FL0A 4P73A 1U4LA 1J5EL 3SK4A 4AIMA 2E2HB 1JORA 4A3JG 3J80c 1Y1WB 1GJXA 2KBNA 2ZTEA 4XQNA 2CQAA 2EQSA 1U4PA 5J39A 4AQYQ 3MXUA 2WFWA 4DV1L 2NN6G 4M16A 2SOBA 1A62A 5M5WH 2PZUA 2VNUD 4QF4A 2KJXA 1Y14B 2FXQA 2K04A 5COYA 2MFIA 4X2EA 4DV5Q 5FO8B 1A2UA 1F77A 1LT5D 4RGTA 3F8TA 1GHJA 3KLSX 4K0KQ 4CGYB 3TQYA 5CV8A 1TIID 1U0LA 1B7YB 1EOTA 4QY7A 4JBJA 4LF7L 4JCVE 5HY6A 3VR5A 2AMCB 5M3FH 4GN5A 3FKIB 5IWAL 4UHVA 2NVYB 3H0GH 1XJVA 4X3TA 4DR6Q 2ICEC 4XDXA 4NXML 1D7QA 2D2CC 1D1IA 2IX0A 4NB3A 1OXVA 5CKLA 4YHHL 2QILA 3MWYW 3T53B 4U673 2JEBI 3AMUA 5D65A 4DV4L 4OX9Q 2O5IC 1Y1VB 1RCVD 3T4AC 1EWHA 2HCIA 2AHOB 3A5ZB 4DV6Q 3R2IA 2A6EC 3KF8A 3LX0A 1OO9B 1L0XB 4EQNA 4OO1I 1SSOA 2F0QA 4DV3Q 2EVBA 2F0SA 3KK7A 3VYRA 4O2DA 3BZKA 3I90A 4FXGC 2PYKA 3DWQA 4RMFA 5C4XH 1I94L 1CT1D 1HZAA 1XTDA 3C1EA 1SAPA 3BS1A 2TSSA 1SE2A 1S5CD 3J81E 4X3SA 4B3SL 4PMBA 4PG3A 3K57A 2I46A 5IOCA 4RCNA 4IALA 4KV6A 1EYGA 1BXTA 4HJ9A 3ZCBA 2PW5A 4C3HB 4JI4L 3J80i 3UE1A 2F0LA 1VQPA 3RNUA 1TXYA 4A3MH 1GO3E 1MIUA 3N6RA 3DEOA 2A74C 3NSWA 3VA7A 2YTYA 3CPFA 3MEHA 3GTOB 4RGNA 1EFID 2XWJB 3AQQA 1N8RC 4YY3Q 1E2ZA 3FVQA 5K36G 1H9RA 5JEAG 5AJ3L 3T13A 1E3PA 3OWEB 2F0EA 4JI6Q 2O4XA 1HR0Q 1FR3A 3F2CA 3RZOH 1FGUA 1LT6D 4HJ5A 1Z7TA 2F4IA 3QWNA 5M5XB 1WFQA 2IWHA 4XYQA 1SNCA 1TKWB 4LK1C 1PV4A 2AWOA 1NJIC 1UEBA 3NTHA 2UU9Q 5CV4A 3S16H 4F7XA 4DAYA 1NNXA 4IFDG 3TP6A 1VDZA 2QGQA 1WOCA 3CUCA 1YNNC 5ELDA 2NVTH 2B2TA 2JK8A 3OOCA 1E2WA 1LTAD 1X6OA 4FP5D 2A73B 5HGQA 2HHHQ 4U0SA 2R93B 1A2TA 1PTOC 3K6OA 1W6JA 4B3TQ 1N9WA 2A68C 4C1NK 3E9IA 3TZUA 4AH6A 1I50H 1OXTA 4C56C 5CMDA 4HCEA 1XPOA 4HN7A 1QG7A 1Q46A 1EY5A 4K2KA 1K8AC 4KD4A 2E2HH 1JE4A 3T56B 5FOBB 3U9SA 1KNEA 4MHEA 3D4WA 5C3EG 1Y1WH 4DAVA 4OO1H 5ELFA 1S40A 1K83B 2B8GA 3EJIA 3CCQA 1YI2A 2VUMB 2XWBB 3F2BA 3U58A 4DAPA 4HEDA 3VYUA 5IIFA 3QR8A 4RCOA 4A3FB 1CHQD 5IP7G 5C44G 1NH1A 4N9TA 2UUCQ 5EJWA 2O2LD 1F9QA 1H9JA 2QCPX 3T1YQ 2UXCQ 3BVMA 3EFXD 3J7AV 1MGSA 4Y7NB 4L5RC 4A3GB 1WTHA 4N8X1 2DJGC 2O5JC 4TSSA 1CA6A 1KABA 1S5FD 1QWYA 1O7ZA 1LTBD 2EYJA 4OWTB 4EQ5A 2VUMG 1DD2A 2K75A 1GKHA 4HMJA 1TS5A 5BN5A 1RHPA 2B2WC 4GLVB 1VQ4A 4LMQD 3PO3B 1EZ6A 5EKIA 1SYBA 1EY7A 3NPPA 4PMCA 4AQYL 5C0XG 1HCZA 4KMUC 2WV6D 4ZKBB 4DR1Q 3KLSA 1NTGA 2EYMA 2GA4B 4LU4A 1KRTA 2NVYH 2JA7B 2OQKA 2K01A 3KUPA 4DNTB 5IP9G 1QVGA 2CW0C 4A3CG 3R3OA 4U07A 4QIWB 4POFA 1I4HA 3LWUA 2F3VA 5ELBA 2JYOA 1UE6A 4G7HC 4LF8Q 2A19A 4YCWA 4DV5L 2IY5B 4ME5A 2A1AA 1A8VA 4XQJA 1QOHA 1X3FA 2F0TA 1Y1VH 3S15B 5KNBA 1WTOA 4ULLA 2UUBQ 1JB3A 3H3VI 2EYLA 5G3LF 4JOIA 3OYYA 4J15A 3SK5A 1Q86C 4YWMA 4MN3A 4PZ6A 4J1MA 4LF5Q 4QGUA 2K5DA 4CKCA 2BCOA 1YHAA 4ZLTF 4IOAA 5FO9B 1ET6A 4M1UB 3I55A 4IQZA 3M3YB 2SDFA 1KNAA 2Q8TA 3CCJA 5FKAC 3JAMc 3SDZA 1NCVA 3PIP3 2R7FA 3I4MG 1K8GA 1SMYD 2Z4IA 4ZKCB 5JEAJ 3CP0A 4OX9L 4AYBB 4A3IB 3S1RB 4V190 4DR4Q 3BDCA 1GD7A 3K59A 4DV0Q 1K9MC 4A93B 4DV6L 1MBYA 1QUQA 3FPPA 3GTKB 2V4DA 1Z9FA 5H1SE 3B6YA 1KRSA 4C3HH 2EY6A 4DV3L 3SXHA 1N36L 2X6GA 4IFDJ 4NKLA 4KY6A 1IBLL 3CCVA 1WCMB 4HMIA 1TU2B 1F2MA 5IYDG 3SE0A 3GTOH 2RSNA 2PZWA 2KCNA 4V0BA 1STHA 4HR7B 1DCZA 4GNXB 1NY4A 2MO0A 5IGCA 4IFDH 3K7AB 1ASYA 3K81C 1VQIA 2LFNA 2DGYA 1KAAA 1HZBA 3PUWA 2F0DA 1VQBA 3DM1A 3S14B 2RQXA 4RWSC 1G6ZA 5M5XH 2LMCB 2K50A 3P75A 5EKKA 3K8AA 4ZUJA 1JOKA 1PYBA 4R9WA 1AN8A 3MXGA 3KLWA 5T1GA 4UY8C 2L5TA 4LF6Q 5IGFA 3KJOA 5TSSA 2K5QA 1NMFA
chains in the Genus database with same CATH topology
4OWWB 4YCVA 3RLFA 5FLMH 4DR3L 1VQNA 3AFPA 2N49A 2R93H 1L1OA 3NEMA 1PH9A 3HKZE 1WJJA 1HR0L 3CCSA 1JB7A 3I4OA 1CKMA 1K3RA 4GKKQ 1EWIA 2YU9H 4GS3A 5AJ3Q 2Z0SA 4QJFA 3LETA 1AH9A 1LTLA 4DR5Q 2WAQE 2Z6KA 4P71A 4GNXC 1HNXL 3SE5A 1E22A 2C35B 1Q8KA 4A3FG 5IP7H 1TWFH 3ULJA 1VQ9A 2MO1A 5C4XG 2NN6I 3ERSX 1IBML 2JA6G 2N8NA 4DUZQ 2K5VA 3IRBA 2E5LL 5GQOA 3H3VH 4IPGA 3FKIH 3T1HQ 4EX5A 3S1QH 4A3GG 4JI1L 5C0XJ 1VQJA 4LFAQ 3PIOA 1O7IA 1YZ6A 1JJ2A 1X56A 3M7NA 1K83H 3OTOQ 2OTJA 4PZ8A 1XMQL 2VUMH 2F3IA 2WP8J 3FP9A 2I5MX 3RR5A 2HHHL 4LNQA 1VQGA 5FLXc 1UE5A 5CMTA 2K5HA 3CCRA 3I2ZA 1N36Q 4OXPA 3W5OA 3ICEA 2JE6I 3S2HH 3PO3G 2JEAI 4A3FH 4A75A 4BY1H 2F6SA 4PZ7A 4KHZA 1X3EA 1IBLQ 2F4VL 4B3TL 1K0RA 3I7FA 4DNIA 1Q1EA 2JA6H 3M4OH 4K0KL 4WJ3M 2HIXA 4DR2Q 1G6PA 1PA6A 2IT1A 2YTVA 5BR8Q 1PH1A 1L1OC 2E8GA 2XTIA 3UDGA 4A3MG 2JQOA 4Y7NH 5LMUL 1Q1BA 2JA7G 3GTJH 4Y52H 5GAEC 3S6AA 3L2PA 4UP7A 2IHFA 4LFCQ 3KDFB 3D31A 4R1JA 4IPHA 1YNXA 3G4SA 2R7ZH 1JMCA 2JJQA 4JI2Q 1VQLA 1YVCA 1IYJB 2Q2TA 2Z6KC 4WJ4A 4L5TA 1XNQQ 4X65L 5JJKA 4DR6L 3TREA 1TWCH 2CCZA 2AKWB 2RHSB 2EIFA 3PUZA 4NPSA 2HQLA 4GOPA 4GKJQ 2I5LX 4X62L 3A74A 1IL2A 5LMNW 1BBWA 2N78A 2ASBA 4POGA 3PSIA 3GTLH 4A3EG 3PF4A 2R7ZG 3ULPA 2JA7H 5JFFA 2UUCL 4IPCA 2PI2A 3LGJA 1SROA 4DR7L 3D0FA 3T1YL 2UXCL 3G71A 1QUQB 2R6GA 3CCEA 3GTGH 1VQ7A 2DUDA 2PMZE 1P8LA 3BZCA 3RN5A 1VS0A 1YITA 1CSQA 2MNAA 1HR0W 3H15A 3NENA 4JYAL 1EOVA 3JC66 1YJ9A 3S15H 4LF4Q 3HOWH 1FL0A 3PUYA 3AFQA 1KAWA 4P73A 5GAHC 5M5YH 1J5EL 2D62A 4YWKA 4AIMA 4U0ZA 5GROA 4A3JG 2ID0A 4APVA 4AYBG 3J80c 4JOIC 2QA4A 2D0OA 4A3IG 1S72A 1HNWL 4X6AH 4IJLA 4IOCA 1H95A 3SN9A 2KBNA 2ZTEA 4A93G 2ES2A 1LUZA 2EQSA 2R92H 1UE1A 4AQYQ 1ASZA 1QZHA 2WFWA 2CWPA 4DV1L 2Q2UA 1N33L 1W3SA 1PFSA 3CW2C 3UDIA 2NN6G 5IE8A 4HJ7A 4M16A 1B8AA 4A76A 4ALPA 4GOPC 1XMOL 4JG2A 4JI1Q 1VQ8A 4JI3Q 4LF8L 1A62A 5M5WH 4TQUS 2XGTA 4XTCS 3TEHB 4IPDA 4LFBQ 1C9OA 2HIVA 1M1KC 4X64Q 3M9BA 1PH3A 2VNUD 4JI5Q 2ZJPA 4A3JH 5IYCG 1Y14B 3BJUA 3STBC 2FXQA 2BH8A 2JA9A 1WCMG 3H0GG 4A3IH 1SLJA 1SE8A 4X2EA 2MFIA 2WB1E 1V1QA 1KL9A 2VS1A 1IZ6A 1JE5A 4H02A 4DV5Q 3S1RH 2UUBL 4A93H 4A3DG 1VQMA 2UXDL 3F8TA 2F4VQ 3GTKH 3CF5A 4K0KQ 2VW9A 1X55A 3VDYA 2E2IH 2I0QA 2UXBQ 2VQEL 4LF9L 4XIGS 3TQYA 3CCLA 2RCNA 1VQKA 1U0LA 1B7YB 4BXXG 4QY7A 4JBJA 4LF7L 4JCVE 3E9HA 5HY6A 1XNRQ 2AMCB 1VQDA 5M3FH 4HIKA 4GN5A 1L1OB 1CKOA 1Q12A 4YY3L 4P75A 4DV2Q 3PF5A 1TWAH 5IYCH 1R9TH 2VL6A 5IWAL 2KHIA 1WCMH 3H0GH 1XJVA 1HZ9A 1G291 4JI6L 4NXML 4DR6Q 1D7QA 4A3DH 2MQHA 4HJ8A 2IX0A 4NB3A 1OXVA 5CKLA 4YHHL 4A3BG 3N3UA 1CUKA 2N3SA 2HT1A 1PHJA 4DR4L 1LM0A 4JV5L 2JEBI 5IT9c 4DV0L 4BXXH 4BY7G 1QVCA 4DV4L 4OX9Q 3S17H 3S1NH 4IFDI 3CCUA 2AWNA 1P16A 1HH2P 1MJCA 1X3GA 2UU9L 3S14H 3S1MH 1QVFA 3A5ZB 2AHOB 4DV6Q 2PI2E 4DV7Q 2B63G 1T9HA 4JI7Q 2YTXA 1KXLA 1VCIA 3ZJYC 4R4IA 3W1GA 3K80C 5M3MG 4OO1I 1OXXK 4DV3Q 2LXJA 1MKHA 3CXCA 3UDXA 4A4IA 3PIPA 3JAMi 4A3BH 3Q8DA 1XPUA 4O2DA 3BZKA 1VQ5A 1E1OA 4RMFA 3GDEA 5C4XH 1V43A 1I94L 4DAMA 1CKNA 1HZAA 2V1CC 2I5HA 1HNZL 5EAYA 1PH2A 1XTDA 4A3GH 1E24A 2K52A 2D0PA 4B3ML 1N33Q 3I56A 4B3SL 4KI0A 3SGIA 1L0WA 1XMOQ 1FJGL 5C4JH 3PO2G 3G48A 4PG3A 4X66Q 3TRZA 3WWVA 3PO3H 1L2FA 4GOPB 1EYGA 4HJ9A 3ZCBA 1VQHA 1TWHH 3K7UC 3EIVA 5E7NA 4JI4L 3J80i 3UE1A 2BA1A 2CKZB 4IO9A 3RNUA 1TXYA 2OQ0A 1VQPA 1NBWA 3CC4A 2B3GA 4U04A 3BU2A 2KCTA 4L5SA 4A3MH 3HOZG 1GO3E 3PCOB 1MIUA 1IBKL 3HKZG 1EQRA 2RHQB 5LMNQ 1N32L 2IHEA 2VQEQ 4LF9Q 3MXNB 2YTYA 4C2MH 3CPFA 1C0AA 3NBHB 2WAQG 2Q2HA 1JJCB 1Q82C 2VY3A 1SN8A 2OCEA 2GVAA 2L15A 3AQQA 4DK3C 2CQOA 4DR3Q 3M4PA 2ZM6L 1N8RC 3HOXG 4YY3Q 3SHGA 4GKKL 1I3QH 5K36G 4LUZA 5JEAG 5AJ3L 2UUAL 1UE7A 1E3PA 1VQCA 3DLLA 2ZJRA 3L7ZC 1HR0Q 4JI6Q 3NELA 2YYZA 1YIJA 4A3EH 1NE3A 5C0XI 3F2CA 3RZOH 3S24A 1FGUA 5JJ7A 4GN4B 3HOUG 4HJ5A 1XPRA 3GO5A 3CMEA 1WFQA 1I6HH 1HNXQ 1SMXA 4DUZL 1J6QA 4DR1L 1PV4A 1NJIC 1VQEA 2AWOA 4JV5Q 3T1HL 1UEBA 1WYDA 1YJWA 1MJEA 1M90C 1IBMQ 5ELNA 2UU9Q 3FHWA 1CSPA 1PH6A 3CD6A 4A3LG 4BBSG 2E5LQ 3S16H 1PVOA 3M3YH 4IFDG 3STBD 2CWAA 2QGQA 1WOCA 3CUCA 3J81c 1G51A 5FJ8G 2E2JH 3HOVG 4R4CA 3J7A5 2NVTH 2PQAA 1YHQA 1XMQQ 1LYLA 2K4KA 2JK8A 1QZGA 1X6OA 5HGQA 3HOUH 2HHHQ 1Y1WG 4U0SA 4O0AA 2RF4A 4GLAC 1KD1C 4OO1G 4JC0A 2KCMA 3J7ZC 1PH8A 3HOYG 2ZJQA 1A63A 5BR8L 1YHBA 4HIDA 3U50C 4DUYL 4B3TQ 4LUOA 1N9WA 4LW1A 3OW2A 3U4ZA 4BBSH 4A3LH 3E9IA 3GTQH 4AH6A 2QEXA 1I50H 1FVIA 4MTNA 1OXTA 4GNXA 3J81j 4U0UA 5LMUQ 1XPOA 1KC8C 4JI2L 5FJ8H 4LF5L 4ITRA 5FLMG 4HIOA 1HJPA 4HIMA 1Q46A 3CPWA 1VQOA 1K8AC 4B3SQ 2E2HH 1N34L 3K0XA 5C3EG 4JI8L 1Y1WH 2IX1A 1RIPA 4GKJL 3W1BA 1OXUA 4R4OA 4X65Q 3KOJA 1E7ZA 3EN2A 4BBRG 1EUJA 1C7YA 3HOYH 1S40A 1SR3A 4QIWE 1YI2A 3M4QA 3CCQA 2EXDA 1BKBA 3F2BA 1AE3A 3U58A 4UPAA 4ME3A 4X62Q 3CMAA 4PY3A 4BA1I 3AEVA 2NZHA 3K7AH 5IYBG 4X2CA 4X2DA 5IP7G 5C44G 2UUCQ 2NVQH 1YBYA 5JJIA 4C3IH 4DR7Q 3T1YQ 3KF8B 2UXCQ 2LSSA 1WI5A 2GN5A 3RN2A 3FKIG 5C3EH 4P72A 4OONA 4JBMA 4L5RC 3A0JA 4LF4L 1PYSB 2H5XA 3KJPA 2YV5A 4R4TA 4BBRH 1PH4A 4BA2I 3L0OA 2ZM6Q 4MZ9A 4OWTB 4GN3B 4EQ5A 2VUMG 4JYAQ 1Z47A 4B3RL 2K75A 1GKHA 3GD7A 2UUAQ 4KHPL 4GLVB 2VQFL 4NXNL 1VQ4A 1X54A 1BVSA 3E0EA 1KIXA 3CCMA 3TS0A 3UE0A 4L5QA 3F2DA 2JA5G 5IYBH 3F1ZA 4BY1G 1J5EQ 3A5UA 1CKNB 3CAMA 4DPGA 4YWLA 5C44H 2BH2A 4BY7H 3RZDH 2OTLA 4AQYL 1Y1VG 5C0XG 1HNWQ 4DR1Q 2OWOA 2B63H 4MNOA 1NTGA 4JI3L 1VQAA 4LU4A 1AE2A 2NVYH 2WB1G 2OQKA 1KRTA 4JBWA 5IP9G 1QVGA 4LWCA 4DV1Q 4A3CG 1JJGA 4U07A 4AYBE 4POFA 4LFBL 5M3MH 4X64L 4OWXB 4JI5L 1UE6A 4LF8Q 2VZAA 2K14A 3UDFA 3CQZH 1PH7A 2A19A 4YCWA 1KHIA 4DV5L 2JA5H 2NVXH 1TWGH 2A1AA 2IY5B 1A8VA 1RL2A 3EBEA 4JI0L 2JA8G 1EQQA 1X3FA 1Y1VH 2CFMA 2UXBL 1GVPA 5J3BA 4R4QA 4LF6L 2UUBQ 1YEZA 2UXDQ 4DUYQ 3KYHC 1EIFA 5IP9H 3H3VI 1JT8A 4A3CH 4N67A 1XNRL 3PUVA 2Y0SE 4JOIA 3OYYA 4J15A 1Q86C 3PO2H 2NZOA 4DV2L 4YWMA 2F52A 3ER0A 1EIYB 3KDFA 3CC2A 4PZ6A 3J81i 4LF5Q 4LF7Q 4QGUA 5CGLA 4PMWA 1YHAA 4IOAA 4GLXA 4A3KG 1YJNA 4P74A 3I55A 4DKAC 2BA0A 2ALYB 1N34Q 4JI8Q 3CCJA 5IWAQ 2KHJA 2JA8H 5JJLA 5GADC 3JAMc 1OXSC 4DR5L 3HOWG 2R7FA 4NXMQ 2ATWA 2K5NA 3I4MG 4KLKA 5IY0A 1K8GA 1Q81C 1EFWA 3HOZH 5JEAJ 4DK6C 3CP0A 3RLNA 3M85A 3ZLMA 4YHHQ 4OX9L 4DR4Q 2ZTDA 3G6EA 1GD7A 4DV0Q 2LXKA 4DV7L 1HZCA 1IXRA 4DV6L 1K9MC 1VQ6A 4DV4Q 4QL5A 4JI7L 2R92G 3GTMH 4UP9A 4WGJA 1QUQA 4DAYB 4LFAL 3TS2A 4A3KH 3OTOL 3HOXH 2G03A 1Z9FA 5H1SE 3B6YA 3KF6B 1KRSA 4C3HH 4C3JH 2PQAB 4DV3L 1U5KA 1N36L 4IJHA 1I5FA 5EU0A 3KF6A 1K73C 3I4MH 1SFOH 2KENA 3ULLA 4B3RQ 3RLOA 1Q7YC 4IFDJ 4RG1A 1UWVA 4KHPQ 4HJAA 1D8LA 2VQFQ 4NXNQ 1IBLL 3I4NG 4UP8A 3CCVA 3CC7A 3PUXA 5IYDG 4DR2L 1GM5A 1X65A 3HFZB 3GTOH 3DM3A 1I94Q 3PGZA 3KFUA 2GVBA 1SRUA 4GNXB 4JBKA 1HNZQ 1NY4A 3AYHB 2MO0A 3U4VA 1BBUA 4LFCL 2ZTCA 1S3OA 1ASYA 1B70B 3K81C 1VQIA 3MEFA 3HKSA 4B3MQ 2A8VA 2DGYA 3HOVH 1XNQL 1HZBA 4X66L 1X9NA 3PUWA 5ELOA 5M3FG 1FJGQ 1VQBA 2R7DA 1NMGA 3I4NH 2R93G 5M5XH 1OTCA 2Y0SG 4LUVA 2B29A 2K50A 4TVAB 3S2DH 3K8AA 4FDBA 1PH5A 5JFZA 5IYDH 1E1TA 1PYBA 5JJ6A 1VQFA 1W2BA 5DLQE 3KLWA 4JI0Q 3ZC7A 3PV0A 4JI4Q 4UY8C 5LMNL 3GTPH 4XI8A 1V9PA 2PNHA 4LF6Q 1A0IA 1DGSA 4YCUA 5GAGC 3KJOA 1IBKQ 1KQSA 2Q2IA 1NMFA 4QQBX 1N32Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OWW B;  4YCV A;  3RLF A;  5FLM H;  4DR3 L;  1VQN A;  3AFP A;  2N49 A;  2R93 H;  1L1O A;  3NEM A;  1PH9 A;  3HKZ E;  1WJJ A;  1HR0 L;  3CCS A;  1JB7 A;  3I4O A;  1CKM A;  1K3R A;  4GKK Q;  1EWI A;  2YU9 H;  4GS3 A;  5AJ3 Q;  2Z0S A;  4QJF A;  3LET A;  1AH9 A;  1LTL A;  4DR5 Q;  2WAQ E;  2Z6K A;  4P71 A;  4GNX C;  1HNX L;  3SE5 A;  1E22 A;  2C35 B;  1Q8K A;  4A3F G;  5IP7 H;  1TWF H;  3ULJ A;  1VQ9 A;  2MO1 A;  5C4X G;  2NN6 I;  3ERS X;  1IBM L;  2JA6 G;  2N8N A;  4DUZ Q;  2K5V A;  3IRB A;  2E5L L;  5GQO A;  3H3V H;  4IPG A;  3FKI H;  3T1H Q;  4EX5 A;  3S1Q H;  4A3G G;  4JI1 L;  5C0X J;  1VQJ A;  4LFA Q;  3PIO A;  1O7I A;  1YZ6 A;  1JJ2 A;  1X56 A;  3M7N A;  1K83 H;  3OTO Q;  2OTJ A;  4PZ8 A;  1XMQ L;  2VUM H;  2F3I A;  2WP8 J;  3FP9 A;  2I5M X;  3RR5 A;  2HHH L;  4LNQ A;  1VQG A;  5FLX c;  1UE5 A;  5CMT A;  2K5H A;  3CCR A;  3I2Z A;  1N36 Q;  4OXP A;  3W5O A;  3ICE A;  2JE6 I;  3S2H H;  3PO3 G;  2JEA I;  4A3F H;  4A75 A;  4BY1 H;  2F6S A;  4PZ7 A;  4KHZ A;  1X3E A;  1IBL Q;  2F4V L;  4B3T L;  1K0R A;  3I7F A;  4DNI A;  1Q1E A;  2JA6 H;  3M4O H;  4K0K L;  4WJ3 M;  2HIX A;  4DR2 Q;  1G6P A;  1PA6 A;  2IT1 A;  2YTV A;  5BR8 Q;  1PH1 A;  1L1O C;  2E8G A;  2XTI A;  3UDG A;  4A3M G;  2JQO A;  4Y7N H;  5LMU L;  1Q1B A;  2JA7 G;  3GTJ H;  4Y52 H;  5GAE C;  3S6A A;  3L2P A;  4UP7 A;  2IHF A;  4LFC Q;  3KDF B;  3D31 A;  4R1J A;  4IPH A;  1YNX A;  3G4S A;  2R7Z H;  1JMC A;  2JJQ A;  4JI2 Q;  1VQL A;  1YVC A;  1IYJ B;  2Q2T A;  2Z6K C;  4WJ4 A;  4L5T A;  1XNQ Q;  4X65 L;  5JJK A;  4DR6 L;  3TRE A;  1TWC H;  2CCZ A;  2AKW B;  2RHS B;  2EIF A;  3PUZ A;  4NPS A;  2HQL A;  4GOP A;  4GKJ Q;  2I5L X;  4X62 L;  3A74 A;  1IL2 A;  5LMN W;  1BBW A;  2N78 A;  2ASB A;  4POG A;  3PSI A;  3GTL H;  4A3E G;  3PF4 A;  2R7Z G;  3ULP A;  2JA7 H;  5JFF A;  2UUC L;  4IPC A;  2PI2 A;  3LGJ A;  1SRO A;  4DR7 L;  3D0F A;  3T1Y L;  2UXC L;  3G71 A;  1QUQ B;  2R6G A;  3CCE A;  3GTG H;  1VQ7 A;  2DUD A;  2PMZ E;  1P8L A;  3BZC A;  3RN5 A;  1VS0 A;  1YIT A;  1CSQ A;  2MNA A;  1HR0 W;  3H15 A;  3NEN A;  4JYA L;  1EOV A;  3JC6 6;  1YJ9 A;  3S15 H;  4LF4 Q;  3HOW H;  1FL0 A;  3PUY A;  3AFQ A;  1KAW A;  4P73 A;  5GAH C;  5M5Y H;  1J5E L;  2D62 A;  4YWK A;  4AIM A;  4U0Z A;  5GRO A;  4A3J G;  2ID0 A;  4APV A;  4AYB G;  3J80 c;  4JOI C;  2QA4 A;  2D0O A;  4A3I G;  1S72 A;  1HNW L;  4X6A H;  4IJL A;  4IOC A;  1H95 A;  3SN9 A;  2KBN A;  2ZTE A;  4A93 G;  2ES2 A;  1LUZ A;  2EQS A;  2R92 H;  1UE1 A;  4AQY Q;  1ASZ A;  1QZH A;  2WFW A;  2CWP A;  4DV1 L;  2Q2U A;  1N33 L;  1W3S A;  1PFS A;  3CW2 C;  3UDI A;  2NN6 G;  5IE8 A;  4HJ7 A;  4M16 A;  1B8A A;  4A76 A;  4ALP A;  4GOP C;  1XMO L;  4JG2 A;  4JI1 Q;  1VQ8 A;  4JI3 Q;  4LF8 L;  1A62 A;  5M5W H;  4TQU S;  2XGT A;  4XTC S;  3TEH B;  4IPD A;  4LFB Q;  1C9O A;  2HIV A;  1M1K C;  4X64 Q;  3M9B A;  1PH3 A;  2VNU D;  4JI5 Q;  2ZJP A;  4A3J H;  5IYC G;  1Y14 B;  3BJU A;  3STB C;  2FXQ A;  2BH8 A;  2JA9 A;  1WCM G;  3H0G G;  4A3I H;  1SLJ A;  1SE8 A;  4X2E A;  2MFI A;  2WB1 E;  1V1Q A;  1KL9 A;  2VS1 A;  1IZ6 A;  1JE5 A;  4H02 A;  4DV5 Q;  3S1R H;  2UUB L;  4A93 H;  4A3D G;  1VQM A;  2UXD L;  3F8T A;  2F4V Q;  3GTK H;  3CF5 A;  4K0K Q;  2VW9 A;  1X55 A;  3VDY A;  2E2I H;  2I0Q A;  2UXB Q;  2VQE L;  4LF9 L;  4XIG S;  3TQY A;  3CCL A;  2RCN A;  1VQK A;  1U0L A;  1B7Y B;  4BXX G;  4QY7 A;  4JBJ A;  4LF7 L;  4JCV E;  3E9H A;  5HY6 A;  1XNR Q;  2AMC B;  1VQD A;  5M3F H;  4HIK A;  4GN5 A;  1L1O B;  1CKO A;  1Q12 A;  4YY3 L;  4P75 A;  4DV2 Q;  3PF5 A;  1TWA H;  5IYC H;  1R9T H;  2VL6 A;  5IWA L;  2KHI A;  1WCM H;  3H0G H;  1XJV A;  1HZ9 A;  1G29 1;  4JI6 L;  4NXM L;  4DR6 Q;  1D7Q A;  4A3D H;  2MQH A;  4HJ8 A;  2IX0 A;  4NB3 A;  1OXV A;  5CKL A;  4YHH L;  4A3B G;  3N3U A;  1CUK A;  2N3S A;  2HT1 A;  1PHJ A;  4DR4 L;  1LM0 A;  4JV5 L;  2JEB I;  5IT9 c;  4DV0 L;  4BXX H;  4BY7 G;  1QVC A;  4DV4 L;  4OX9 Q;  3S17 H;  3S1N H;  4IFD I;  3CCU A;  2AWN A;  1P16 A;  1HH2 P;  1MJC A;  1X3G A;  2UU9 L;  3S14 H;  3S1M H;  1QVF A;  3A5Z B;  2AHO B;  4DV6 Q;  2PI2 E;  4DV7 Q;  2B63 G;  1T9H A;  4JI7 Q;  2YTX A;  1KXL A;  1VCI A;  3ZJY C;  4R4I A;  3W1G A;  3K80 C;  5M3M G;  4OO1 I;  1OXX K;  4DV3 Q;  2LXJ A;  1MKH A;  3CXC A;  3UDX A;  4A4I A;  3PIP A;  3JAM i;  4A3B H;  3Q8D A;  1XPU A;  4O2D A;  3BZK A;  1VQ5 A;  1E1O A;  4RMF A;  3GDE A;  5C4X H;  1V43 A;  1I94 L;  4DAM A;  1CKN A;  1HZA A;  2V1C C;  2I5H A;  1HNZ L;  5EAY A;  1PH2 A;  1XTD A;  4A3G H;  1E24 A;  2K52 A;  2D0P A;  4B3M L;  1N33 Q;  3I56 A;  4B3S L;  4KI0 A;  3SGI A;  1L0W A;  1XMO Q;  1FJG L;  5C4J H;  3PO2 G;  3G48 A;  4PG3 A;  4X66 Q;  3TRZ A;  3WWV A;  3PO3 H;  1L2F A;  4GOP B;  1EYG A;  4HJ9 A;  3ZCB A;  1VQH A;  1TWH H;  3K7U C;  3EIV A;  5E7N A;  4JI4 L;  3J80 i;  3UE1 A;  2BA1 A;  2CKZ B;  4IO9 A;  3RNU A;  1TXY A;  2OQ0 A;  1VQP A;  1NBW A;  3CC4 A;  2B3G A;  4U04 A;  3BU2 A;  2KCT A;  4L5S A;  4A3M H;  3HOZ G;  1GO3 E;  3PCO B;  1MIU A;  1IBK L;  3HKZ G;  1EQR A;  2RHQ B;  5LMN Q;  1N32 L;  2IHE A;  2VQE Q;  4LF9 Q;  3MXN B;  2YTY A;  4C2M H;  3CPF A;  1C0A A;  3NBH B;  2WAQ G;  2Q2H A;  1JJC B;  1Q82 C;  2VY3 A;  1SN8 A;  2OCE A;  2GVA A;  2L15 A;  3AQQ A;  4DK3 C;  2CQO A;  4DR3 Q;  3M4P A;  2ZM6 L;  1N8R C;  3HOX G;  4YY3 Q;  3SHG A;  4GKK L;  1I3Q H;  5K36 G;  4LUZ A;  5JEA G;  5AJ3 L;  2UUA L;  1UE7 A;  1E3P A;  1VQC A;  3DLL A;  2ZJR A;  3L7Z C;  1HR0 Q;  4JI6 Q;  3NEL A;  2YYZ A;  1YIJ A;  4A3E H;  1NE3 A;  5C0X I;  3F2C A;  3RZO H;  3S24 A;  1FGU A;  5JJ7 A;  4GN4 B;  3HOU G;  4HJ5 A;  1XPR A;  3GO5 A;  3CME A;  1WFQ A;  1I6H H;  1HNX Q;  1SMX A;  4DUZ L;  1J6Q A;  4DR1 L;  1PV4 A;  1NJI C;  1VQE A;  2AWO A;  4JV5 Q;  3T1H L;  1UEB A;  1WYD A;  1YJW A;  1MJE A;  1M90 C;  1IBM Q;  5ELN A;  2UU9 Q;  3FHW A;  1CSP A;  1PH6 A;  3CD6 A;  4A3L G;  4BBS G;  2E5L Q;  3S16 H;  1PVO A;  3M3Y H;  4IFD G;  3STB D;  2CWA A;  2QGQ A;  1WOC A;  3CUC A;  3J81 c;  1G51 A;  5FJ8 G;  2E2J H;  3HOV G;  4R4C A;  3J7A 5;  2NVT H;  2PQA A;  1YHQ A;  1XMQ Q;  1LYL A;  2K4K A;  2JK8 A;  1QZG A;  1X6O A;  5HGQ A;  3HOU H;  2HHH Q;  1Y1W G;  4U0S A;  4O0A A;  2RF4 A;  4GLA C;  1KD1 C;  4OO1 G;  4JC0 A;  2KCM A;  3J7Z C;  1PH8 A;  3HOY G;  2ZJQ A;  1A63 A;  5BR8 L;  1YHB A;  4HID A;  3U50 C;  4DUY L;  4B3T Q;  4LUO A;  1N9W A;  4LW1 A;  3OW2 A;  3U4Z A;  4BBS H;  4A3L H;  3E9I A;  3GTQ H;  4AH6 A;  2QEX A;  1I50 H;  1FVI A;  4MTN A;  1OXT A;  4GNX A;  3J81 j;  4U0U A;  5LMU Q;  1XPO A;  1KC8 C;  4JI2 L;  5FJ8 H;  4LF5 L;  4ITR A;  5FLM G;  4HIO A;  1HJP A;  4HIM A;  1Q46 A;  3CPW A;  1VQO A;  1K8A C;  4B3S Q;  2E2H H;  1N34 L;  3K0X A;  5C3E G;  4JI8 L;  1Y1W H;  2IX1 A;  1RIP A;  4GKJ L;  3W1B A;  1OXU A;  4R4O A;  4X65 Q;  3KOJ A;  1E7Z A;  3EN2 A;  4BBR G;  1EUJ A;  1C7Y A;  3HOY H;  1S40 A;  1SR3 A;  4QIW E;  1YI2 A;  3M4Q A;  3CCQ A;  2EXD A;  1BKB A;  3F2B A;  1AE3 A;  3U58 A;  4UPA A;  4ME3 A;  4X62 Q;  3CMA A;  4PY3 A;  4BA1 I;  3AEV A;  2NZH A;  3K7A H;  5IYB G;  4X2C A;  4X2D A;  5IP7 G;  5C44 G;  2UUC Q;  2NVQ H;  1YBY A;  5JJI A;  4C3I H;  4DR7 Q;  3T1Y Q;  3KF8 B;  2UXC Q;  2LSS A;  1WI5 A;  2GN5 A;  3RN2 A;  3FKI G;  5C3E H;  4P72 A;  4OON A;  4JBM A;  4L5R C;  3A0J A;  4LF4 L;  1PYS B;  2H5X A;  3KJP A;  2YV5 A;  4R4T A;  4BBR H;  1PH4 A;  4BA2 I;  3L0O A;  2ZM6 Q;  4MZ9 A;  4OWT B;  4GN3 B;  4EQ5 A;  2VUM G;  4JYA Q;  1Z47 A;  4B3R L;  2K75 A;  1GKH A;  3GD7 A;  2UUA Q;  4KHP L;  4GLV B;  2VQF L;  4NXN L;  1VQ4 A;  1X54 A;  1BVS A;  3E0E A;  1KIX A;  3CCM A;  3TS0 A;  3UE0 A;  4L5Q A;  3F2D A;  2JA5 G;  5IYB H;  3F1Z A;  4BY1 G;  1J5E Q;  3A5U A;  1CKN B;  3CAM A;  4DPG A;  4YWL A;  5C44 H;  2BH2 A;  4BY7 H;  3RZD H;  2OTL A;  4AQY L;  1Y1V G;  5C0X G;  1HNW Q;  4DR1 Q;  2OWO A;  2B63 H;  4MNO A;  1NTG A;  4JI3 L;  1VQA A;  4LU4 A;  1AE2 A;  2NVY H;  2WB1 G;  2OQK A;  1KRT A;  4JBW A;  5IP9 G;  1QVG A;  4LWC A;  4DV1 Q;  4A3C G;  1JJG A;  4U07 A;  4AYB E;  4POF A;  4LFB L;  5M3M H;  4X64 L;  4OWX B;  4JI5 L;  1UE6 A;  4LF8 Q;  2VZA A;  2K14 A;  3UDF A;  3CQZ H;  1PH7 A;  2A19 A;  4YCW A;  1KHI A;  4DV5 L;  2JA5 H;  2NVX H;  1TWG H;  2A1A A;  2IY5 B;  1A8V A;  1RL2 A;  3EBE A;  4JI0 L;  2JA8 G;  1EQQ A;  1X3F A;  1Y1V H;  2CFM A;  2UXB L;  1GVP A;  5J3B A;  4R4Q A;  4LF6 L;  2UUB Q;  1YEZ A;  2UXD Q;  4DUY Q;  3KYH C;  1EIF A;  5IP9 H;  3H3V I;  1JT8 A;  4A3C H;  4N67 A;  1XNR L;  3PUV A;  2Y0S E;  4JOI A;  3OYY A;  4J15 A;  1Q86 C;  3PO2 H;  2NZO A;  4DV2 L;  4YWM A;  2F52 A;  3ER0 A;  1EIY B;  3KDF A;  3CC2 A;  4PZ6 A;  3J81 i;  4LF5 Q;  4LF7 Q;  4QGU A;  5CGL A;  4PMW A;  1YHA A;  4IOA A;  4GLX A;  4A3K G;  1YJN A;  4P74 A;  3I55 A;  4DKA C;  2BA0 A;  2ALY B;  1N34 Q;  4JI8 Q;  3CCJ A;  5IWA Q;  2KHJ A;  2JA8 H;  5JJL A;  5GAD C;  3JAM c;  1OXS C;  4DR5 L;  3HOW G;  2R7F A;  4NXM Q;  2ATW A;  2K5N A;  3I4M G;  4KLK A;  5IY0 A;  1K8G A;  1Q81 C;  1EFW A;  3HOZ H;  5JEA J;  4DK6 C;  3CP0 A;  3RLN A;  3M85 A;  3ZLM A;  4YHH Q;  4OX9 L;  4DR4 Q;  2ZTD A;  3G6E A;  1GD7 A;  4DV0 Q;  2LXK A;  4DV7 L;  1HZC A;  1IXR A;  4DV6 L;  1K9M C;  1VQ6 A;  4DV4 Q;  4QL5 A;  4JI7 L;  2R92 G;  3GTM H;  4UP9 A;  4WGJ A;  1QUQ A;  4DAY B;  4LFA L;  3TS2 A;  4A3K H;  3OTO L;  3HOX H;  2G03 A;  1Z9F A;  5H1S E;  3B6Y A;  3KF6 B;  1KRS A;  4C3H H;  4C3J H;  2PQA B;  4DV3 L;  1U5K A;  1N36 L;  4IJH A;  1I5F A;  5EU0 A;  3KF6 A;  1K73 C;  3I4M H;  1SFO H;  2KEN A;  3ULL A;  4B3R Q;  3RLO A;  1Q7Y C;  4IFD J;  4RG1 A;  1UWV A;  4KHP Q;  4HJA A;  1D8L A;  2VQF Q;  4NXN Q;  1IBL L;  3I4N G;  4UP8 A;  3CCV A;  3CC7 A;  3PUX A;  5IYD G;  4DR2 L;  1GM5 A;  1X65 A;  3HFZ B;  3GTO H;  3DM3 A;  1I94 Q;  3PGZ A;  3KFU A;  2GVB A;  1SRU A;  4GNX B;  4JBK A;  1HNZ Q;  1NY4 A;  3AYH B;  2MO0 A;  3U4V A;  1BBU A;  4LFC L;  2ZTC A;  1S3O A;  1ASY A;  1B70 B;  3K81 C;  1VQI A;  3MEF A;  3HKS A;  4B3M Q;  2A8V A;  2DGY A;  3HOV H;  1XNQ L;  1HZB A;  4X66 L;  1X9N A;  3PUW A;  5ELO A;  5M3F G;  1FJG Q;  1VQB A;  2R7D A;  1NMG A;  3I4N H;  2R93 G;  5M5X H;  1OTC A;  2Y0S G;  4LUV A;  2B29 A;  2K50 A;  4TVA B;  3S2D H;  3K8A A;  4FDB A;  1PH5 A;  5JFZ A;  5IYD H;  1E1T A;  1PYB A;  5JJ6 A;  1VQF A;  1W2B A;  5DLQ E;  3KLW A;  4JI0 Q;  3ZC7 A;  3PV0 A;  4JI4 Q;  4UY8 C;  5LMN L;  3GTP H;  4XI8 A;  1V9P A;  2PNH A;  4LF6 Q;  1A0I A;  1DGS A;  4YCU A;  5GAG C;  3KJO A;  1IBK Q;  1KQS A;  2Q2I A;  1NMF A;  4QQB X;  1N32 Q; 
#chains in the Genus database with same CATH topology
 4OWW B;  3RLF A;  2B2T C;  1SJH D;  4FXD A;  3AFP A;  5KNC A;  2R93 H;  1L1O A;  2OT2 A;  4K6D A;  1TY0 A;  3OW7 A;  1HR0 L;  1XX8 A;  1CKM A;  1E0B A;  4CDC C;  4ILW A;  1FYC A;  1BOS A;  2J0T D;  2Z0S A;  1AH9 A;  1A15 A;  3VR4 A;  2CH4 A;  2L55 A;  3ZYY X;  5BN4 A;  5IP7 H;  1TWH B;  5ISR A;  4CDE C;  1GXD C;  1SYC A;  5GQO A;  3H3V H;  2KED A;  5C0X J;  1X56 A;  1K83 H;  2OTJ A;  4PZ8 A;  2VUM H;  3W2D A;  2F3I A;  3RR5 A;  5I9P A;  2HHH L;  5IOD A;  1VQG A;  4LNQ A;  1FNV A;  2R7Z G;  5FO7 B;  3ICE A;  3MVV A;  3J80 E;  4A3F H;  4A75 A;  2HQE A;  4KHZ A;  1I3Q B;  4B3T L;  5C0X H;  1Q1E A;  5I2X A;  4WJ3 M;  5CBE E;  1G6P A;  2EJF C;  2IT1 A;  4A3E B;  2XTI A;  5IGD A;  2JQO A;  1PXU A;  1F2L A;  4N8F A;  4Y7N H;  4IUN A;  1IW7 C;  1QE6 A;  1AW7 A;  1O78 A;  4JK1 C;  2CH4 W;  2AUJ D;  3KDF B;  4ID6 A;  2L12 A;  4I7A A;  4IPH A;  4LFC Q;  3QIA A;  2LKV A;  4C1N I;  3G4S A;  1JMC A;  4JI2 Q;  1YVC A;  2Q2T A;  1XNQ Q;  5JJK A;  3D6W A;  3EA6 A;  5T1I A;  2HQL A;  4LJZ C;  4CKE A;  3SK8 A;  4IZ8 A;  2E2J B;  1V1P B;  4POG A;  2OF1 A;  4A3E G;  3PF4 A;  3ONA B;  1NSN S;  2JA7 H;  1MHW C;  2UUC L;  1FNW A;  1ICW A;  3T1Y L;  1Y8P B;  2UXC L;  3CCE A;  2R6G A;  2PMZ E;  5JVG 3;  4BBS B;  1EOV A;  3S15 H;  1HUN A;  1JWS D;  1CA5 A;  3AFQ A;  3I70 A;  1KAW A;  5JOB A;  3ERO A;  3J7Y W;  3QO2 A;  4ODG A;  3X3M A;  5GRO A;  2A69 D;  2ID0 A;  4JOI C;  4X6A H;  4IOC A;  1H95 A;  1F2Y A;  4DXF A;  1O7Y A;  2KA7 A;  2E76 C;  3D4D A;  1UE1 A;  2RA4 A;  1EY6 A;  2CWP A;  1UEA B;  2KHS A;  3MHB A;  3CW2 C;  5E1F A;  2ICI A;  4GOP C;  4JI3 Q;  4JG2 A;  3L3O C;  4LF8 L;  3J7A F;  4IPD A;  1C9O A;  1MSG A;  3NTI A;  3ERQ A;  3M9B A;  4JI5 Q;  2ZJP A;  1K73 C;  3STB C;  1AP0 A;  2BH8 A;  3H0G G;  4A3I H;  3S1R H;  1V1Q A;  5BN3 A;  5EKL A;  1BCP B;  2Z4H A;  4H02 A;  3I91 A;  2UUB L;  4A93 H;  2F4V Q;  3GTK H;  2HUG A;  2LY7 A;  2PPB C;  4LF9 L;  1I4G A;  3TSS A;  2RCN A;  1SXT A;  4B08 A;  3RZD B;  1XNR Q;  3OMC A;  5CV5 A;  3TDQ A;  4RA8 A;  2CHB D;  2XNA C;  2EJM A;  4Q5V A;  4HIK A;  3C2P A;  3PF5 A;  2VL6 A;  1WCM H;  1G29 1;  1AZQ A;  5M3M B;  2F03 A;  1CUK A;  3CQZ B;  2HT1 A;  4DR4 L;  2JA5 B;  1TWG B;  2A6E D;  3VR6 A;  4DV0 L;  4JV5 L;  1QVC A;  3S1N H;  2AWN A;  1JWM D;  1P16 A;  1HH2 P;  1X3G A;  1BCP D;  5IGB A;  3S14 H;  3S1M H;  4XYO A;  4NW2 A;  3SR1 A;  1VMC A;  2PI2 E;  2WB1 B;  2EPB A;  1VCI A;  3GTJ B;  1IL8 A;  2R61 A;  1S5D D;  5M3M G;  3K80 C;  3PO2 B;  3PIP A;  1O7L A;  4FF4 A;  5CV7 A;  5C6A A;  2IX3 A;  3Q8D A;  4TRD A;  2XRQ D;  1TQO A;  1LV9 A;  2B2V A;  2B39 A;  2DY8 A;  3GDE A;  4JW0 A;  4DAM A;  2I5H A;  3D4R A;  3E0J A;  1SNP A;  1ML0 D;  1ILP A;  1E24 A;  2K52 A;  1N33 Q;  2NTT A;  4KI0 A;  1XMO Q;  3PO2 G;  2H4O A;  3DUZ A;  1JR0 D;  2WAC A;  3WWV A;  1L2F A;  3J81 L;  1VQH A;  1TWH H;  3K7U C;  5JVH 3;  2CKZ B;  1SYG A;  2B3G A;  1SFO B;  1ZEQ X;  4L5S A;  2G5D A;  1B3Q A;  2L11 A;  4K6L A;  2Z6B A;  1C48 A;  2VQE Q;  2EE1 A;  1ZYR C;  2M2L A;  1C0A A;  1RDP D;  3NBH B;  1JJC B;  3NBH A;  2OCE A;  4ZAI A;  4DR3 Q;  3SHG A;  1I3Q H;  4LUZ A;  3TP7 A;  4CKB A;  1VQC A;  2HD3 A;  2ZJR A;  3L7Z C;  5DNF A;  3HOV B;  2IW3 A;  3NEL A;  2G9H D;  4A3E H;  4K2L A;  3S24 A;  5IT9 E;  3I4N B;  1GUG A;  2F0J A;  4HCS A;  1I4X A;  1VQE A;  1WYD A;  1YJW A;  1MJE A;  4MTK A;  1SJE D;  1IBM Q;  3CD6 A;  1PH6 A;  1STA A;  2WKC A;  3VYS A;  1PVO A;  1JCK B;  1M8A A;  5C5L A;  2E2J H;  2EDG A;  2L4N A;  3BYY B;  3HOV G;  2PQA A;  4NP5 A;  1QZG A;  4MIU A;  4RH6 A;  2VXW A;  1Y1W G;  1NR2 A;  3HRZ C;  4OO1 G;  1PH8 A;  3FMC A;  4H13 C;  4DUY L;  2F0O A;  4FNF A;  4LW1 A;  5NUC A;  1YNJ C;  3U4Z A;  4BBS H;  4A3L H;  2B2W A;  1FVI A;  4UAI A;  3J81 j;  4OIJ A;  1KC8 C;  4JI2 L;  2OXP A;  1TWF B;  1LTS D;  5FLM G;  1HJP A;  3CPW A;  2H1E A;  1PZJ D;  1N34 L;  4JI8 L;  1RIP A;  4X65 Q;  4R4O A;  3KOJ A;  3IL8 A;  4KN4 C;  1C7Y A;  3M4Q A;  1AE3 A;  4UPA A;  4X62 Q;  4BA1 I;  3S2H B;  2MUY A;  3MFG A;  3QOJ A;  4X2C A;  1SND A;  5JJI A;  3V96 A;  5I9O A;  3KF8 B;  3OIQ A;  5G3L D;  5LHY 1;  1WI5 A;  3FKI G;  4KTA A;  4P72 A;  4OON A;  4JBM A;  3A54 A;  3A0J A;  1PYS B;  2ENB A;  3KJP A;  2YV5 A;  4R4T A;  1EQT A;  1XTC D;  4CJ0 B;  2ZM6 Q;  4N9P A;  4FYD A;  1Z47 A;  4XQQ A;  2UUA Q;  4KHP L;  4K8I A;  4K5W A;  3PQI A;  1BVS A;  2F0F A;  3CCM A;  3TS0 A;  3UE0 A;  4L5Q A;  3F2D A;  5IYB H;  3DEP A;  4YWL A;  2CW0 D;  3RZD H;  1Y1V G;  1ROD A;  3GP7 A;  4CJ2 C;  2OWO A;  4MNO A;  2Z1C A;  4JI3 L;  1ICF B;  2EY1 A;  1G91 A;  3CHB D;  2NB0 A;  5M3M H;  1B53 A;  4JI5 L;  4R8N A;  1CQV A;  3CQZ H;  2JA5 H;  1TWG H;  1EIH A;  1JC7 A;  1RL2 A;  3EBE A;  4JI0 L;  5A2Q E;  1LO5 D;  1E2V A;  1B3A A;  2UXD Q;  3Q22 A;  2PZT A;  2SNS A;  1BCP F;  1XNR L;  1EU3 A;  3PO2 H;  3ER0 A;  3CC2 A;  2R92 B;  4DNR B;  2B2V C;  4GLX A;  1YJN A;  1QNU A;  4P74 A;  4DKA C;  2BA0 A;  4IUV A;  4C3H G;  3GQB A;  1HA6 A;  1RTO A;  2KHJ A;  4FF1 A;  2K5N A;  4OIK A;  5IY0 A;  2KOL A;  1Q81 C;  4QB4 A;  5K5P A;  3M85 A;  2RBM A;  2NZ1 D;  4WOR A;  1GUN A;  2LXK A;  1IXR A;  2R92 G;  4WGJ A;  4DAY B;  2K6A A;  4LFA L;  4DXG A;  2G03 A;  3FPU B;  3KF6 B;  3G6J B;  4G7Z C;  1I5F A;  3KF6 A;  1STE A;  1SFO H;  4B3R Q;  1SE3 A;  3RLO A;  3FDT A;  1EY0 A;  4ZUI A;  2VQF Q;  4NXN Q;  2Y0S B;  4IUP A;  3TP8 A;  3UI2 A;  4DR2 L;  1X65 A;  4DF7 A;  4A3D B;  1U9R A;  1KDB A;  3Q6S A;  1SRU A;  4JBK A;  1HNZ Q;  2A6H D;  3AYH B;  1BBU A;  5D14 A;  1S3O A;  3MEF A;  2C9O A;  3HKS A;  1DOK A;  2B2U A;  3HOV H;  2QDL A;  4CDF C;  5ELO A;  3MC0 B;  1FJG Q;  2AQ3 B;  5CV9 A;  3LWE A;  3I4N H;  2R93 G;  2Y0S G;  4LUV A;  4TVA B;  1PH5 A;  4FDB A;  1H9S A;  2P5Z X;  1E1T A;  1KDC A;  1MSH A;  5DLQ E;  5KND A;  4P2C B;  3ND8 A;  4A3B B;  3HGB A;  4RHS A;  2Q2I A;  1EYA A;  3NUC A;  1A3T A;  4XT3 B;  4QQB X;  4YCV A;  5FLM H;  1LT3 D;  4DR3 L;  1LAB A;  1EEF D;  1STG A;  5CGK A;  1HHV A;  1ENC A;  1EL0 A;  1WJJ A;  1H9M A;  1JB7 A;  3I4O A;  4KKT A;  4K5V A;  4GS3 A;  5C4J B;  4DR5 Q;  5C4Z A;  4A3F G;  1CZW A;  4OEL B;  1TWF H;  1MI2 A;  3ULJ A;  2MO1 A;  1VQ9 A;  1IBM L;  3WDN A;  4DA2 A;  5A35 A;  1H9K A;  3FKI H;  3NHH A;  2J7Z A;  4A3G G;  4H44 C;  1TS4 A;  1Q90 A;  1O7I A;  1LAC A;  4KN7 C;  3OTO Q;  1QB5 D;  4G4K A;  2WP8 J;  3K58 A;  1UE5 A;  2OEO A;  2K5H A;  3CCR A;  2N55 A;  3S2H H;  1D1K A;  1S5B D;  2B2Y C;  2JEA I;  3PO3 G;  1MD2 D;  2ZXR A;  2F6S A;  1IW7 D;  4FVM A;  4GZY C;  1FD7 D;  4K0K L;  1ENF A;  2JSO A;  3OIP A;  2HIX A;  3C3L A;  1KTK A;  3J80 L;  1PH1 A;  2E8G A;  5JPN C;  2JA7 G;  3HKZ B;  4HSP A;  1CQF A;  2F0N A;  2IPK D;  3K0Y A;  3IFD A;  2Z6K C;  4L5T A;  4X65 L;  4DR6 L;  2E74 C;  2AKW B;  4CJ1 B;  2EIF A;  4GOP A;  4GKJ Q;  1B9N A;  4X62 L;  1IL2 A;  1WTW A;  3TBI B;  5E4W C;  5HUR A;  2RKS A;  3ULP A;  5JFF A;  3HOU B;  4IPC A;  2PI2 A;  1D5Z C;  1SRO A;  3QJY A;  3D0F A;  5C4H A;  3G71 A;  1QUQ B;  1K3B C;  1HUM A;  1VQ7 A;  5EPL A;  3BZC A;  3MXN A;  4OHJ A;  1YIT A;  2MNA A;  1HR0 W;  1EIG A;  3CU7 A;  1YJ9 A;  3A56 A;  4LF4 Q;  5I2Y A;  5GAH C;  3OWF A;  1ONL A;  2D62 A;  1TS2 A;  4AYB G;  2F0M A;  4A3I G;  2D0O A;  1S72 A;  2KUM A;  4IJL A;  3IAY A;  2EZV A;  3HOY B;  3SN9 A;  4A93 G;  1LUZ A;  2R92 H;  1W3S A;  2K7V A;  5DEH A;  3NBI A;  5KYL A;  4HJ7 A;  4JI1 Q;  1BF4 A;  4TQU S;  4XTC S;  4C3I B;  4LFB Q;  2HIV A;  3Q24 A;  1PH3 A;  1CTM A;  4F88 A;  4DK1 A;  1WCM G;  1SLJ A;  1SE8 A;  2VS1 A;  4BBR B;  1IZ6 A;  5FLX L;  4XT1 B;  2UXD L;  2F3W A;  2HDM A;  2VW9 A;  1X55 A;  3HZX A;  3VDY A;  1J9O A;  2QKI C;  3A8J E;  3NP8 A;  3CCL A;  3K5L A;  5EBD A;  1VQK A;  3DXJ C;  4BY7 B;  4C3I G;  3E9H A;  1VQD A;  3RUZ A;  2C5C A;  1L1O B;  1CKO A;  4YY3 L;  3SK6 A;  3SVM A;  2VB2 X;  5IYC H;  1I4R A;  4KD3 A;  1HZ9 A;  4JI6 L;  3A7A B;  3OPO A;  4A3D H;  2F0V A;  4HJ8 A;  2Z8L A;  1UNS A;  1PRT B;  5EPJ A;  5JJZ A;  2NVX B;  2B2U C;  3DWP A;  4BXX H;  4BY7 G;  3P1H A;  1Y69 U;  4RHR A;  3MZ5 A;  2UU9 L;  2FFK B;  1T9H A;  1KXL A;  2YTX A;  1ZKO A;  3D6C A;  1W6K A;  3ZJY C;  3W1G A;  5LL6 S;  1NUC A;  1OXX K;  4DFA A;  2LXJ A;  3UDX A;  3JAM i;  4A3B H;  1SYE A;  1XPU A;  2FMM A;  2PQE A;  1VQ5 A;  1E1O A;  4FF2 A;  2JA8 B;  1CKN A;  2V1C C;  2EOT A;  1I4Q A;  1HNZ L;  5EAY A;  2ZT9 C;  3HOZ B;  3H3V C;  4A3G H;  1PRT D;  5C3W A;  3I56 A;  4IUR A;  4LAA A;  1L0W A;  2BOS A;  5C4J H;  1FJG L;  3G48 A;  2M9V A;  2F0K A;  2WAQ B;  1PFB A;  3PO3 H;  1IYV A;  4RGM A;  4DK0 A;  4A3K B;  2IX1 A;  4IO9 A;  1NBW A;  3CC4 A;  1D5X C;  1AFP A;  2I07 B;  4U04 A;  3HOZ G;  3C46 A;  4S3S A;  3MAQ A;  5LMN Q;  2IHE A;  1D5M C;  2WAQ G;  2Q2H A;  3NTK A;  1X3P A;  2VY3 A;  1F2Z A;  1SN8 A;  2B8F A;  4K14 A;  3PIO 3;  2GVA A;  4DK3 C;  2K33 A;  2CQO A;  4J6H A;  3M4P A;  1B2T A;  1RTN A;  4KY5 A;  3H6M A;  1PMR A;  3DLL A;  1K28 A;  3GV3 A;  2SNM A;  2YYZ A;  1NE3 A;  5JJ7 A;  4GN4 B;  1SNM A;  1XPR A;  2PCF B;  2XRS D;  4ZQ3 A;  3C1F A;  1SMX A;  3RMH A;  4DR1 L;  3S2D B;  1M4V A;  4BS9 A;  1SMY C;  5ELN A;  5IT9 L;  3FHW A;  1CSP A;  3I73 A;  4A3L G;  1O80 A;  4BBS G;  1BQQ T;  3M3Y H;  1B44 D;  1X32 A;  4O42 A;  4R4C A;  1LYL A;  2K4K A;  2CVR A;  3HOU H;  2PNR C;  1EEI D;  4O0A A;  2NTS A;  1KD1 C;  4JC0 A;  2KCM A;  3J7Z C;  1A63 A;  2L9H A;  3BG3 A;  4HID A;  3E5S A;  3U50 C;  2QEX A;  5HGT A;  5LMU Q;  5FJ8 H;  4LF5 L;  4HIO A;  3K5M A;  5ELE A;  4B3S Q;  1VQO A;  2Q8I B;  4GKJ L;  3W1B A;  1OXU A;  1E7Z A;  2FMC A;  1EUJ A;  3HOY H;  4QIW E;  1BUV T;  3A7L A;  3TME A;  4RFB A;  2NUC A;  3AEV A;  2NZH A;  3K7A H;  5IYB G;  4BY1 B;  4X2D A;  2DJF C;  2JXM B;  1RKN A;  5C4X B;  2EYO A;  3RD4 A;  4C3I H;  1HFN A;  2JA6 B;  5JAV A;  2GN5 A;  3N52 A;  3RN2 A;  3R2T A;  3V2T A;  4LF4 L;  4BBR H;  1PH4 A;  4L8J A;  1PDQ A;  4GN3 B;  4JYA Q;  1U4M A;  3G7L A;  1X54 A;  1KIX A;  1BDO A;  2JA5 G;  3F1Z A;  4BY1 G;  4WFN 3;  4Z9C B;  3CAM A;  2BH2 A;  5C5M A;  4L6T B;  4BY7 H;  2OTL A;  1HNW Q;  2J4X A;  3GTL B;  4A3M B;  1AE2 A;  2WB1 G;  4CBV A;  4JBW A;  3O13 A;  4LWC A;  4AYB E;  3CKI B;  4LFB L;  1ESR A;  1T5X D;  2BDO A;  2VZA A;  1PH7 A;  1GUO A;  1KHI A;  2NVX H;  1ILQ A;  3ND9 A;  4M8A A;  1EQQ A;  1TY2 A;  1Q8I A;  1GVP A;  4LF6 L;  1HQR D;  4IUU A;  3VR2 A;  5M5Y B;  1CZG A;  3KYH C;  1PTO B;  3T51 B;  5A2Q L;  3K5N A;  5EBC A;  2AQ2 B;  2RCF A;  3PMF A;  2F52 A;  3OMG A;  1UAP A;  2EYP A;  3M7G A;  1F9S A;  3WOE A;  1B9M A;  1D6E C;  2QF7 A;  2ALY B;  2NUD A;  2JA8 H;  1OXS C;  2MPM A;  1WTR A;  2DNE A;  1EFW A;  3HOZ H;  3KBX A;  4DK6 C;  3ZLM A;  2WKD A;  4KKS A;  4A3J B;  2Z9H A;  2MP1 A;  3G6E A;  1YNN D;  2F1M A;  1HZC A;  2XVS A;  4ABN A;  1PRT F;  3Q0A A;  4QCL A;  4QL5 A;  5KEE A;  3D8G A;  4A3K H;  2E2I B;  4PV1 C;  2PQA B;  2R3Z A;  4X3K A;  1PTO D;  1IYU A;  1ESF A;  3QB3 A;  3NK9 A;  1G8Z D;  1EY8 A;  2A68 D;  1UWV A;  4HJA A;  1D8L A;  1TWA B;  1R9T B;  3I4N G;  4UP8 A;  3CC7 A;  2IJ0 A;  5C3X A;  1BNZ A;  2BDN A;  2DY7 A;  1JQY D;  1GM5 A;  3HFZ B;  3DM3 A;  2GVB A;  2A69 C;  4LFC L;  1RF2 D;  5D3D A;  1SBB B;  4J8Q A;  3I4L A;  4B3M Q;  2BE5 C;  3R93 A;  3S17 B;  1XNQ L;  1X9N A;  1S4Z A;  4FXK C;  2K03 A;  2R7D A;  1NMG A;  2F0H A;  4FF3 A;  1IKL A;  1OTC A;  1D2B A;  2B29 A;  3E6Z X;  3NE5 B;  4R8I A;  2FIN B;  3S2D H;  5JFZ A;  3TP5 A;  5JJ6 A;  1W2B A;  3ZC7 A;  5LMN L;  2MGS A;  4XI8 A;  2PNH A;  1A0I A;  2B2Y A;  4YCU A;  4H0L C;  1IBK Q;  1STY A;  4EQP A;  1N32 Q;  3Q23 A;  5EPK A;  1EWC A;  1AZP A;  1VQN A;  2N49 A;  2RDG A;  2IL8 A;  3I3C A;  1G2T A;  3NEM A;  4IUQ A;  1IHZ A;  5DAU A;  2WII B;  3JAM E;  1JOQ A;  1K3R A;  4HTH A;  4GKK Q;  1CFM A;  2PO4 A;  1K0S A;  2EXZ A;  1HFG A;  1LTL A;  2WAQ E;  1GOZ A;  1UUP A;  2Z6K A;  3SE5 A;  1E22 A;  2C35 B;  1Q8K A;  1R4Q B;  1ET9 A;  4F8M A;  2NN6 I;  2XN9 C;  4DUZ Q;  5KGU A;  4IPG A;  3T1H Q;  4EX5 A;  1K8M A;  2M00 A;  3PIO A;  1YZ6 A;  4TKO B;  1BCP C;  5FK9 C;  2I5M X;  4C2M B;  1Y8O B;  5FLX c;  1N36 Q;  3I2Z A;  4OXP A;  3W5O A;  3MFY A;  3BZD B;  4RKB A;  4HSV A;  3SHL A;  4BY1 H;  4PZ7 A;  1X3E A;  1DYQ A;  1IBL Q;  2F4V L;  3VYT A;  2JA6 H;  2K32 A;  2QW7 A;  2YTV A;  3A55 A;  3TZD A;  5BR8 Q;  4ZCK A;  4CDD C;  3UDG A;  5LMU L;  1Q1B A;  3GTJ H;  1KLU D;  2FJ2 A;  3S6A A;  3L2P A;  1I6H B;  2IHF A;  1YNX A;  2EYH A;  4I7Z C;  3T16 A;  3F2U A;  1VQL A;  1IYJ B;  4H7B A;  1HPC A;  4YIJ A;  1GUW A;  2D9U A;  3TRE A;  4NPS A;  3FRP B;  3W3A A;  2EY2 A;  1BBW A;  1CK1 A;  2EY5 A;  1SNQ A;  3P7J A;  5CC4 A;  3PSI A;  3GTL H;  2KQ3 A;  2RDH A;  1DM0 B;  2KVM A;  3LGJ A;  3H94 A;  2EJG C;  2DUD A;  4CHT B;  1P8L A;  1QNK A;  5JPM C;  3RN5 A;  1VS0 A;  2NUN A;  1CSQ A;  3NEN A;  3GTQ B;  1EYC A;  4JYA L;  3JC6 6;  1WVL A;  2X6L A;  3PUY A;  2N88 A;  2HCC A;  4RKL A;  5M5Y H;  4YWK A;  4U0Z A;  4APV A;  1PTO H;  2QA4 A;  1HNW L;  2E2D C;  3MXP A;  1Z6H A;  2ES2 A;  1EU4 A;  4G7O C;  1ASZ A;  1ENA A;  1QZH A;  2Q2U A;  1N33 L;  1QIL A;  2D5D A;  2Q8R E;  1PFS A;  3UDI A;  5IE8 A;  4ALP A;  1XMO L;  1BO0 A;  1B8A A;  4A76 A;  3TRZ A;  1VQ8 A;  3NQT A;  2NVQ B;  1V1O A;  5I6Y A;  5KIX A;  2XGT A;  3TEH B;  1M1K C;  4X64 Q;  4A3J H;  5IYC G;  3BJU A;  1H9S B;  5C3E B;  2JA9 A;  2WB1 E;  3BVG A;  1KL9 A;  1JE5 A;  1STN A;  3BDL A;  2PMZ B;  4A3D G;  2EYF A;  3M4Y A;  1VQM A;  1KLG D;  1L0Y B;  3CF5 A;  2E2I H;  2I0Q A;  2UXB Q;  4QMG A;  2VQE L;  4XIG S;  2NN6 H;  3L9A X;  5C44 B;  4BXX G;  5E3F A;  4B9W A;  4RGO S;  4UDU C;  4DV2 Q;  1DOM A;  1Q12 A;  4P75 A;  2SEB D;  3K5O A;  2B63 B;  1TWA H;  1R9T H;  1PTO F;  1C8C A;  2KHI A;  2KEE A;  1QJO A;  2MQH A;  2XSC A;  1Q3L A;  2VB3 X;  4EVO A;  4A3B G;  3N3U A;  2N3S A;  1PHJ A;  1A3V A;  5L37 A;  1LM0 A;  2F0I A;  2NWG A;  5IT9 c;  1F9P A;  3VR3 A;  1CM9 A;  3S17 H;  1K8O A;  3WOF A;  3CCU A;  2L1B A;  2WIN B;  4IFD I;  1F9R A;  2DN8 A;  1MJC A;  1SYF A;  2K05 A;  4JVZ A;  1QVF A;  3I72 A;  4DV7 Q;  4ZK9 B;  2B63 G;  4JI7 Q;  5EQ0 A;  1HA5 A;  4R4I A;  3CXC A;  1MKH A;  4A4I A;  1I6V C;  1XXG A;  3TN2 A;  1Y8N B;  2X69 A;  3D3R A;  1GHK A;  3QOL A;  1G2S A;  1V43 A;  1BBX C;  3S9W A;  1WD0 A;  5KRU A;  1PH2 A;  1VF5 C;  1SDF A;  3BVZ A;  2D0P A;  4B3M L;  4OEM B;  3SGI A;  1C4Q A;  3GTM B;  4X66 Q;  4KHV A;  4ZYS A;  5KYI A;  4KKU A;  4GOP B;  3URY A;  5COR A;  3HOX B;  4KJO A;  2AUK A;  1EQV A;  3EIV A;  4O1N A;  5E7N A;  1X3Q A;  2BA1 A;  3VA5 A;  4C3J B;  2OQ0 A;  1JWU D;  3I4M B;  3BU2 A;  2KCT A;  1CI3 M;  3PCO B;  3MTS A;  3HKZ G;  5CYU A;  1IBK L;  1EQR A;  2FHT A;  2K5W A;  2RHQ B;  3EVQ A;  1N32 L;  3I8Z A;  3R8B A;  4LF9 Q;  3MXN B;  4C2M H;  2XIW A;  3P20 A;  1Q82 C;  5CR3 A;  2K1B A;  4IUT A;  2L15 A;  3QG1 A;  2ZM6 L;  1II3 A;  3HOX G;  4GKK L;  3CRK C;  4C3J G;  2UUA L;  4BWG B;  1UE7 A;  4WJW A;  5F2D A;  1YIJ A;  5C0X I;  1LTT D;  3HOU G;  2HDL A;  1VF7 A;  5D3I B;  3GO5 A;  3CME A;  1I6H H;  1HNX Q;  1QCB D;  2JN4 A;  4DUZ L;  1J6Q A;  1DJR D;  1GUT A;  3ITP A;  4JV5 Q;  2F0G A;  3IKJ A;  3T1H L;  1BR9 A;  4WRD A;  1M90 C;  3GTP B;  2E5L Q;  3DWA A;  5K36 H;  3STB D;  2CWA A;  3U9O A;  4EGV A;  4U68 A;  5JEA H;  3A8K E;  1HQM C;  1KDA A;  1G51 A;  1TS3 A;  5FJ8 G;  3J81 c;  3J7A 5;  1WD1 A;  1LTI D;  1EYD A;  3H91 A;  1XMQ Q;  1YHQ A;  3NQI A;  4EQO A;  5CBA E;  2KCC A;  1DOL A;  2NBF A;  2RF4 A;  4GLA C;  1HRJ A;  3HOY G;  2ZJQ A;  5EGT A;  5BR8 L;  1YHB A;  1B4O A;  3GV6 A;  4KK7 A;  2YU9 B;  1WTQ A;  4HAE A;  4LUO A;  3OW2 A;  1PFN A;  3GTQ H;  4MTN A;  1EZ8 A;  4GNX A;  3H09 A;  4U0U A;  3MA2 B;  1VMP A;  3S1N B;  4ITR A;  1PLF A;  4Q0F A;  4HIM A;  4K8J A;  4F87 A;  2A6H C;  2JP1 A;  3S1M B;  3K0X A;  1LLR D;  3S1Q B;  3EN2 A;  4BBR G;  1SR3 A;  2EXD A;  1BKB A;  4ME3 A;  2ZXO A;  3CMA A;  4PY3 A;  1RJT A;  4DGZ A;  1WTX A;  2AQ1 B;  3CRL C;  2NVQ H;  3AU7 A;  1YBY A;  1WTV A;  4DR7 Q;  1CHP D;  1LT4 D;  3M4O B;  1LTG D;  1SNO A;  2LSS A;  5I4D A;  5C3E H;  1A3U A;  2MJ8 A;  2H5X A;  4BA2 I;  3L0O A;  4MZ9 A;  4B3R L;  3GD7 A;  2R7Z B;  2VQF L;  4NXN L;  3E0E A;  1J5E Q;  2G9D A;  1TWC B;  1SYD A;  1CKN B;  4DPG A;  5J22 A;  5C44 H;  3A5U A;  1B50 A;  2K28 A;  1DZ1 A;  2B63 H;  1VQA A;  1FNU A;  4DV1 Q;  1JJG A;  4X64 L;  5IGE A;  4OWX B;  3GTG B;  2K14 A;  1DXM A;  5DM6 3;  3UDF A;  1IKM A;  1PZI D;  1PYW D;  2JA8 G;  2TMP A;  3HP3 A;  1ZYR D;  3HOW B;  2CFM A;  4KY7 A;  2UXB L;  5J3B A;  4R4Q A;  1S5E D;  1YEZ A;  4B9X A;  4DUY Q;  1EIF A;  5IP9 H;  1JT8 A;  1NAP A;  1V8Q A;  4A3C H;  4N67 A;  3PUV A;  2Y0S E;  4FO2 A;  2NZO A;  4DV2 L;  2PW7 A;  1EIY B;  4NDX A;  3KDF A;  3J81 i;  4LF7 Q;  5CGL A;  4PMW A;  4A3K G;  1N34 Q;  3NWT A;  4JI8 Q;  2E75 C;  5IWA Q;  5JJL A;  4QUC A;  5GAD C;  3HOW G;  4DR5 L;  4NXM Q;  4DN4 M;  1NR4 A;  5M5W B;  3AB9 A;  2ATW A;  4KLK A;  3SEB A;  1V1P A;  3RLN A;  4YHH Q;  2L0C A;  2DNC A;  4NMZ A;  2ZTD A;  5AFW A;  3V05 A;  4DV7 L;  1VQ6 A;  3GTM H;  4DV4 Q;  4JI7 L;  4UP9 A;  4OL7 A;  3TS2 A;  4ZRZ A;  3OTO L;  3HOX H;  4JPB W;  4C3J H;  1U5K A;  4PNY A;  4IJH A;  5EU0 A;  1GUS A;  4XXE A;  3I4M H;  2MHV A;  1SEB D;  2KEN A;  3ULL A;  5M3F B;  1Q7Y C;  4RG1 A;  1PFM A;  1YNJ D;  5E4X A;  4QUF A;  3DHQ A;  4KHP Q;  3H0G B;  4K5X A;  3PUX A;  1STB A;  1JIC A;  2BE5 D;  1I94 Q;  3PGZ A;  2RSO A;  1R4P B;  3KFU A;  3X3N A;  3U4V A;  4KJN A;  2ZTC A;  1SE4 A;  1B70 B;  2A8V A;  1AEX A;  1HTL D;  5FLX E;  4X66 L;  5M3F G;  2NYZ D;  1TR5 A;  5IYD H;  1TT2 A;  1VQF A;  2F0P A;  1DON A;  4JI0 Q;  2QDB A;  4JI4 Q;  1JOO A;  3PV0 A;  3GTP H;  1V9P A;  5I6W A;  1TVX A;  1EY4 A;  1DGS A;  5GAG C;  1ZXT A;  4L63 B;  1KQS A;  2A5H A;  2F0U A;  5DM7 3;  3HEJ A;  1PH9 A;  3HKZ E;  3CCS A;  1EWI A;  2YU9 H;  1XYI A;  1PZK D;  5AJ3 Q;  4QJF A;  3LET A;  1HNX L;  4P71 A;  4GNX C;  2LS0 1;  3JAM L;  3E3X A;  3DMU A;  5C4X G;  3BYT B;  3ERS X;  2QEJ C;  2JA6 G;  2N8N A;  2K5V A;  3IRB A;  3EQL C;  2E5L L;  3OSO A;  1J8I A;  1FGB D;  3S1Q H;  1HXY D;  3A8I E;  4OGQ C;  1T5E A;  4JI1 L;  1VQJ A;  3OHX C;  5J1Z A;  4LFA Q;  5IGG A;  1JJ2 A;  3M7N A;  1XMQ L;  3FP9 A;  1U4R A;  3HS0 C;  5CMT A;  1A6X A;  2JE6 I;  2RVL A;  2KEC A;  1WTP A;  4E6I A;  5CV6 A;  1K0R A;  3I7F A;  4DNI A;  1EY9 A;  3M4O H;  3KBG A;  1HTP A;  3LNN A;  4DR2 Q;  1PA6 A;  1RD9 D;  1L1O C;  4A3M G;  3FEW X;  3IFT A;  3RZO B;  1LTR D;  4Y52 H;  4I65 A;  4G57 A;  5GAE C;  4UP7 A;  4X3U A;  3D31 A;  4R1J A;  1XWE A;  2R7Z H;  2JJQ A;  4WJ4 A;  2RDF A;  1PRT C;  1TWC H;  2CCZ A;  3S16 B;  2RHS B;  3PUZ A;  2I5L X;  3A74 A;  3KLR A;  5LMN W;  4IN3 A;  3BDO A;  2N78 A;  5M9O A;  2ASB A;  5LL6 X;  2NVT B;  4DU9 A;  1I4P A;  1B1Z A;  2F0W A;  4DR7 L;  3HG9 A;  3GTG H;  3NWS A;  4RAU C;  3H15 A;  1I50 B;  3NXW A;  4PQX A;  3HOW H;  2ZXP A;  5ELC A;  1FL0 A;  4P73 A;  1U4L A;  1J5E L;  3SK4 A;  4AIM A;  2E2H B;  1JOR A;  4A3J G;  3J80 c;  1Y1W B;  1GJX A;  2KBN A;  2ZTE A;  4XQN A;  2CQA A;  2EQS A;  1U4P A;  5J39 A;  4AQY Q;  3MXU A;  2WFW A;  4DV1 L;  2NN6 G;  4M16 A;  2SOB A;  1A62 A;  5M5W H;  2PZU A;  2VNU D;  4QF4 A;  2KJX A;  1Y14 B;  2FXQ A;  2K04 A;  5COY A;  2MFI A;  4X2E A;  4DV5 Q;  5FO8 B;  1A2U A;  1F77 A;  1LT5 D;  4RGT A;  3F8T A;  1GHJ A;  3KLS X;  4K0K Q;  4CGY B;  3TQY A;  5CV8 A;  1TII D;  1U0L A;  1B7Y B;  1EOT A;  4QY7 A;  4JBJ A;  4LF7 L;  4JCV E;  5HY6 A;  3VR5 A;  2AMC B;  5M3F H;  4GN5 A;  3FKI B;  5IWA L;  4UHV A;  2NVY B;  3H0G H;  1XJV A;  4X3T A;  4DR6 Q;  2ICE C;  4XDX A;  4NXM L;  1D7Q A;  2D2C C;  1D1I A;  2IX0 A;  4NB3 A;  1OXV A;  5CKL A;  4YHH L;  2QIL A;  3MWY W;  3T53 B;  4U67 3;  2JEB I;  3AMU A;  5D65 A;  4DV4 L;  4OX9 Q;  2O5I C;  1Y1V B;  1RCV D;  3T4A C;  1EWH A;  2HCI A;  2AHO B;  3A5Z B;  4DV6 Q;  3R2I A;  2A6E C;  3KF8 A;  3LX0 A;  1OO9 B;  1L0X B;  4EQN A;  4OO1 I;  1SSO A;  2F0Q A;  4DV3 Q;  2EVB A;  2F0S A;  3KK7 A;  3VYR A;  4O2D A;  3BZK A;  3I90 A;  4FXG C;  2PYK A;  3DWQ A;  4RMF A;  5C4X H;  1I94 L;  1CT1 D;  1HZA A;  1XTD A;  3C1E A;  1SAP A;  3BS1 A;  2TSS A;  1SE2 A;  1S5C D;  3J81 E;  4X3S A;  4B3S L;  4PMB A;  4PG3 A;  3K57 A;  2I46 A;  5IOC A;  4RCN A;  4IAL A;  4KV6 A;  1EYG A;  1BXT A;  4HJ9 A;  3ZCB A;  2PW5 A;  4C3H B;  4JI4 L;  3J80 i;  3UE1 A;  2F0L A;  1VQP A;  3RNU A;  1TXY A;  4A3M H;  1GO3 E;  1MIU A;  3N6R A;  3DEO A;  2A74 C;  3NSW A;  3VA7 A;  2YTY A;  3CPF A;  3MEH A;  3GTO B;  4RGN A;  1EFI D;  2XWJ B;  3AQQ A;  1N8R C;  4YY3 Q;  1E2Z A;  3FVQ A;  5K36 G;  1H9R A;  5JEA G;  5AJ3 L;  3T13 A;  1E3P A;  3OWE B;  2F0E A;  4JI6 Q;  2O4X A;  1HR0 Q;  1FR3 A;  3F2C A;  3RZO H;  1FGU A;  1LT6 D;  4HJ5 A;  1Z7T A;  2F4I A;  3QWN A;  5M5X B;  1WFQ A;  2IWH A;  4XYQ A;  1SNC A;  1TKW B;  4LK1 C;  1PV4 A;  2AWO A;  1NJI C;  1UEB A;  3NTH A;  2UU9 Q;  5CV4 A;  3S16 H;  4F7X A;  4DAY A;  1NNX A;  4IFD G;  3TP6 A;  1VDZ A;  2QGQ A;  1WOC A;  3CUC A;  1YNN C;  5ELD A;  2NVT H;  2B2T A;  2JK8 A;  3OOC A;  1E2W A;  1LTA D;  1X6O A;  4FP5 D;  2A73 B;  5HGQ A;  2HHH Q;  4U0S A;  2R93 B;  1A2T A;  1PTO C;  3K6O A;  1W6J A;  4B3T Q;  1N9W A;  2A68 C;  4C1N K;  3E9I A;  3TZU A;  4AH6 A;  1I50 H;  1OXT A;  4C56 C;  5CMD A;  4HCE A;  1XPO A;  4HN7 A;  1QG7 A;  1Q46 A;  1EY5 A;  4K2K A;  1K8A C;  4KD4 A;  2E2H H;  1JE4 A;  3T56 B;  5FOB B;  3U9S A;  1KNE A;  4MHE A;  3D4W A;  5C3E G;  1Y1W H;  4DAV A;  4OO1 H;  5ELF A;  1S40 A;  1K83 B;  2B8G A;  3EJI A;  3CCQ A;  1YI2 A;  2VUM B;  2XWB B;  3F2B A;  3U58 A;  4DAP A;  4HED A;  3VYU A;  5IIF A;  3QR8 A;  4RCO A;  4A3F B;  1CHQ D;  5IP7 G;  5C44 G;  1NH1 A;  4N9T A;  2UUC Q;  5EJW A;  2O2L D;  1F9Q A;  1H9J A;  2QCP X;  3T1Y Q;  2UXC Q;  3BVM A;  3EFX D;  3J7A V;  1MGS A;  4Y7N B;  4L5R C;  4A3G B;  1WTH A;  4N8X 1;  2DJG C;  2O5J C;  4TSS A;  1CA6 A;  1KAB A;  1S5F D;  1QWY A;  1O7Z A;  1LTB D;  2EYJ A;  4OWT B;  4EQ5 A;  2VUM G;  1DD2 A;  2K75 A;  1GKH A;  4HMJ A;  1TS5 A;  5BN5 A;  1RHP A;  2B2W C;  4GLV B;  1VQ4 A;  4LMQ D;  3PO3 B;  1EZ6 A;  5EKI A;  1SYB A;  1EY7 A;  3NPP A;  4PMC A;  4AQY L;  5C0X G;  1HCZ A;  4KMU C;  2WV6 D;  4ZKB B;  4DR1 Q;  3KLS A;  1NTG A;  2EYM A;  2GA4 B;  4LU4 A;  1KRT A;  2NVY H;  2JA7 B;  2OQK A;  2K01 A;  3KUP A;  4DNT B;  5IP9 G;  1QVG A;  2CW0 C;  4A3C G;  3R3O A;  4U07 A;  4QIW B;  4POF A;  1I4H A;  3LWU A;  2F3V A;  5ELB A;  2JYO A;  1UE6 A;  4G7H C;  4LF8 Q;  2A19 A;  4YCW A;  4DV5 L;  2IY5 B;  4ME5 A;  2A1A A;  1A8V A;  4XQJ A;  1QOH A;  1X3F A;  2F0T A;  1Y1V H;  3S15 B;  5KNB A;  1WTO A;  4ULL A;  2UUB Q;  1JB3 A;  3H3V I;  2EYL A;  5G3L F;  4JOI A;  3OYY A;  4J15 A;  3SK5 A;  1Q86 C;  4YWM A;  4MN3 A;  4PZ6 A;  4J1M A;  4LF5 Q;  4QGU A;  2K5D A;  4CKC A;  2BCO A;  1YHA A;  4ZLT F;  4IOA A;  5FO9 B;  1ET6 A;  4M1U B;  3I55 A;  4IQZ A;  3M3Y B;  2SDF A;  1KNA A;  2Q8T A;  3CCJ A;  5FKA C;  3JAM c;  3SDZ A;  1NCV A;  3PIP 3;  2R7F A;  3I4M G;  1K8G A;  1SMY D;  2Z4I A;  4ZKC B;  5JEA J;  3CP0 A;  4OX9 L;  4AYB B;  4A3I B;  3S1R B;  4V19 0;  4DR4 Q;  3BDC A;  1GD7 A;  3K59 A;  4DV0 Q;  1K9M C;  4A93 B;  4DV6 L;  1MBY A;  1QUQ A;  3FPP A;  3GTK B;  2V4D A;  1Z9F A;  5H1S E;  3B6Y A;  1KRS A;  4C3H H;  2EY6 A;  4DV3 L;  3SXH A;  1N36 L;  2X6G A;  4IFD J;  4NKL A;  4KY6 A;  1IBL L;  3CCV A;  1WCM B;  4HMI A;  1TU2 B;  1F2M A;  5IYD G;  3SE0 A;  3GTO H;  2RSN A;  2PZW A;  2KCN A;  4V0B A;  1STH A;  4HR7 B;  1DCZ A;  4GNX B;  1NY4 A;  2MO0 A;  5IGC A;  4IFD H;  3K7A B;  1ASY A;  3K81 C;  1VQI A;  2LFN A;  2DGY A;  1KAA A;  1HZB A;  3PUW A;  2F0D A;  1VQB A;  3DM1 A;  3S14 B;  2RQX A;  4RWS C;  1G6Z A;  5M5X H;  2LMC B;  2K50 A;  3P75 A;  5EKK A;  3K8A A;  4ZUJ A;  1JOK A;  1PYB A;  4R9W A;  1AN8 A;  3MXG A;  3KLW A;  5T1G A;  4UY8 C;  2L5T A;  4LF6 Q;  5IGF A;  3KJO A;  5TSS A;  2K5Q A;  1NMF A; 
#chains in the Genus database with same CATH homology
 4OWW B;  4YCV A;  3RLF A;  5FLM H;  4DR3 L;  1VQN A;  3AFP A;  2N49 A;  2R93 H;  1L1O A;  3NEM A;  1PH9 A;  3HKZ E;  1WJJ A;  1HR0 L;  3CCS A;  1JB7 A;  3I4O A;  1CKM A;  1K3R A;  4GKK Q;  1EWI A;  2YU9 H;  4GS3 A;  5AJ3 Q;  2Z0S A;  4QJF A;  3LET A;  1AH9 A;  1LTL A;  4DR5 Q;  2WAQ E;  2Z6K A;  4P71 A;  4GNX C;  1HNX L;  3SE5 A;  1E22 A;  2C35 B;  1Q8K A;  4A3F G;  5IP7 H;  1TWF H;  3ULJ A;  1VQ9 A;  2MO1 A;  5C4X G;  2NN6 I;  3ERS X;  1IBM L;  2JA6 G;  2N8N A;  4DUZ Q;  2K5V A;  3IRB A;  2E5L L;  5GQO A;  3H3V H;  4IPG A;  3FKI H;  3T1H Q;  4EX5 A;  3S1Q H;  4A3G G;  4JI1 L;  5C0X J;  1VQJ A;  4LFA Q;  3PIO A;  1O7I A;  1YZ6 A;  1JJ2 A;  1X56 A;  3M7N A;  1K83 H;  3OTO Q;  2OTJ A;  4PZ8 A;  1XMQ L;  2VUM H;  2F3I A;  2WP8 J;  3FP9 A;  2I5M X;  3RR5 A;  2HHH L;  4LNQ A;  1VQG A;  5FLX c;  1UE5 A;  5CMT A;  2K5H A;  3CCR A;  3I2Z A;  1N36 Q;  4OXP A;  3W5O A;  3ICE A;  2JE6 I;  3S2H H;  3PO3 G;  2JEA I;  4A3F H;  4A75 A;  4BY1 H;  2F6S A;  4PZ7 A;  4KHZ A;  1X3E A;  1IBL Q;  2F4V L;  4B3T L;  1K0R A;  3I7F A;  4DNI A;  1Q1E A;  2JA6 H;  3M4O H;  4K0K L;  4WJ3 M;  2HIX A;  4DR2 Q;  1G6P A;  1PA6 A;  2IT1 A;  2YTV A;  5BR8 Q;  1PH1 A;  1L1O C;  2E8G A;  2XTI A;  3UDG A;  4A3M G;  2JQO A;  4Y7N H;  5LMU L;  1Q1B A;  2JA7 G;  3GTJ H;  4Y52 H;  5GAE C;  3S6A A;  3L2P A;  4UP7 A;  2IHF A;  4LFC Q;  3KDF B;  3D31 A;  4R1J A;  4IPH A;  1YNX A;  3G4S A;  2R7Z H;  1JMC A;  2JJQ A;  4JI2 Q;  1VQL A;  1YVC A;  1IYJ B;  2Q2T A;  2Z6K C;  4WJ4 A;  4L5T A;  1XNQ Q;  4X65 L;  5JJK A;  4DR6 L;  3TRE A;  1TWC H;  2CCZ A;  2AKW B;  2RHS B;  2EIF A;  3PUZ A;  4NPS A;  2HQL A;  4GOP A;  4GKJ Q;  2I5L X;  4X62 L;  3A74 A;  1IL2 A;  5LMN W;  1BBW A;  2N78 A;  2ASB A;  4POG A;  3PSI A;  3GTL H;  4A3E G;  3PF4 A;  2R7Z G;  3ULP A;  2JA7 H;  5JFF A;  2UUC L;  4IPC A;  2PI2 A;  3LGJ A;  1SRO A;  4DR7 L;  3D0F A;  3T1Y L;  2UXC L;  3G71 A;  1QUQ B;  2R6G A;  3CCE A;  3GTG H;  1VQ7 A;  2DUD A;  2PMZ E;  1P8L A;  3BZC A;  3RN5 A;  1VS0 A;  1YIT A;  1CSQ A;  2MNA A;  1HR0 W;  3H15 A;  3NEN A;  4JYA L;  1EOV A;  3JC6 6;  1YJ9 A;  3S15 H;  4LF4 Q;  3HOW H;  1FL0 A;  3PUY A;  3AFQ A;  1KAW A;  4P73 A;  5GAH C;  5M5Y H;  1J5E L;  2D62 A;  4YWK A;  4AIM A;  4U0Z A;  5GRO A;  4A3J G;  2ID0 A;  4APV A;  4AYB G;  3J80 c;  4JOI C;  2QA4 A;  2D0O A;  4A3I G;  1S72 A;  1HNW L;  4X6A H;  4IJL A;  4IOC A;  1H95 A;  3SN9 A;  2KBN A;  2ZTE A;  4A93 G;  2ES2 A;  1LUZ A;  2EQS A;  2R92 H;  1UE1 A;  4AQY Q;  1ASZ A;  1QZH A;  2WFW A;  2CWP A;  4DV1 L;  2Q2U A;  1N33 L;  1W3S A;  1PFS A;  3CW2 C;  3UDI A;  2NN6 G;  5IE8 A;  4HJ7 A;  4M16 A;  1B8A A;  4A76 A;  4ALP A;  4GOP C;  1XMO L;  4JG2 A;  4JI1 Q;  1VQ8 A;  4JI3 Q;  4LF8 L;  1A62 A;  5M5W H;  4TQU S;  2XGT A;  4XTC S;  3TEH B;  4IPD A;  4LFB Q;  1C9O A;  2HIV A;  1M1K C;  4X64 Q;  3M9B A;  1PH3 A;  2VNU D;  4JI5 Q;  2ZJP A;  4A3J H;  5IYC G;  1Y14 B;  3BJU A;  3STB C;  2FXQ A;  2BH8 A;  2JA9 A;  1WCM G;  3H0G G;  4A3I H;  1SLJ A;  1SE8 A;  4X2E A;  2MFI A;  2WB1 E;  1V1Q A;  1KL9 A;  2VS1 A;  1IZ6 A;  1JE5 A;  4H02 A;  4DV5 Q;  3S1R H;  2UUB L;  4A93 H;  4A3D G;  1VQM A;  2UXD L;  3F8T A;  2F4V Q;  3GTK H;  3CF5 A;  4K0K Q;  2VW9 A;  1X55 A;  3VDY A;  2E2I H;  2I0Q A;  2UXB Q;  2VQE L;  4LF9 L;  4XIG S;  3TQY A;  3CCL A;  2RCN A;  1VQK A;  1U0L A;  1B7Y B;  4BXX G;  4QY7 A;  4JBJ A;  4LF7 L;  4JCV E;  3E9H A;  5HY6 A;  1XNR Q;  2AMC B;  1VQD A;  5M3F H;  4HIK A;  4GN5 A;  1L1O B;  1CKO A;  1Q12 A;  4YY3 L;  4P75 A;  4DV2 Q;  3PF5 A;  1TWA H;  5IYC H;  1R9T H;  2VL6 A;  5IWA L;  2KHI A;  1WCM H;  3H0G H;  1XJV A;  1HZ9 A;  1G29 1;  4JI6 L;  4NXM L;  4DR6 Q;  1D7Q A;  4A3D H;  2MQH A;  4HJ8 A;  2IX0 A;  4NB3 A;  1OXV A;  5CKL A;  4YHH L;  4A3B G;  3N3U A;  1CUK A;  2N3S A;  2HT1 A;  1PHJ A;  4DR4 L;  1LM0 A;  4JV5 L;  2JEB I;  5IT9 c;  4DV0 L;  4BXX H;  4BY7 G;  1QVC A;  4DV4 L;  4OX9 Q;  3S17 H;  3S1N H;  4IFD I;  3CCU A;  2AWN A;  1P16 A;  1HH2 P;  1MJC A;  1X3G A;  2UU9 L;  3S14 H;  3S1M H;  1QVF A;  3A5Z B;  2AHO B;  4DV6 Q;  2PI2 E;  4DV7 Q;  2B63 G;  1T9H A;  4JI7 Q;  2YTX A;  1KXL A;  1VCI A;  3ZJY C;  4R4I A;  3W1G A;  3K80 C;  5M3M G;  4OO1 I;  1OXX K;  4DV3 Q;  2LXJ A;  1MKH A;  3CXC A;  3UDX A;  4A4I A;  3PIP A;  3JAM i;  4A3B H;  3Q8D A;  1XPU A;  4O2D A;  3BZK A;  1VQ5 A;  1E1O A;  4RMF A;  3GDE A;  5C4X H;  1V43 A;  1I94 L;  4DAM A;  1CKN A;  1HZA A;  2V1C C;  2I5H A;  1HNZ L;  5EAY A;  1PH2 A;  1XTD A;  4A3G H;  1E24 A;  2K52 A;  2D0P A;  4B3M L;  1N33 Q;  3I56 A;  4B3S L;  4KI0 A;  3SGI A;  1L0W A;  1XMO Q;  1FJG L;  5C4J H;  3PO2 G;  3G48 A;  4PG3 A;  4X66 Q;  3TRZ A;  3WWV A;  3PO3 H;  1L2F A;  4GOP B;  1EYG A;  4HJ9 A;  3ZCB A;  1VQH A;  1TWH H;  3K7U C;  3EIV A;  5E7N A;  4JI4 L;  3J80 i;  3UE1 A;  2BA1 A;  2CKZ B;  4IO9 A;  3RNU A;  1TXY A;  2OQ0 A;  1VQP A;  1NBW A;  3CC4 A;  2B3G A;  4U04 A;  3BU2 A;  2KCT A;  4L5S A;  4A3M H;  3HOZ G;  1GO3 E;  3PCO B;  1MIU A;  1IBK L;  3HKZ G;  1EQR A;  2RHQ B;  5LMN Q;  1N32 L;  2IHE A;  2VQE Q;  4LF9 Q;  3MXN B;  2YTY A;  4C2M H;  3CPF A;  1C0A A;  3NBH B;  2WAQ G;  2Q2H A;  1JJC B;  1Q82 C;  2VY3 A;  1SN8 A;  2OCE A;  2GVA A;  2L15 A;  3AQQ A;  4DK3 C;  2CQO A;  4DR3 Q;  3M4P A;  2ZM6 L;  1N8R C;  3HOX G;  4YY3 Q;  3SHG A;  4GKK L;  1I3Q H;  5K36 G;  4LUZ A;  5JEA G;  5AJ3 L;  2UUA L;  1UE7 A;  1E3P A;  1VQC A;  3DLL A;  2ZJR A;  3L7Z C;  1HR0 Q;  4JI6 Q;  3NEL A;  2YYZ A;  1YIJ A;  4A3E H;  1NE3 A;  5C0X I;  3F2C A;  3RZO H;  3S24 A;  1FGU A;  5JJ7 A;  4GN4 B;  3HOU G;  4HJ5 A;  1XPR A;  3GO5 A;  3CME A;  1WFQ A;  1I6H H;  1HNX Q;  1SMX A;  4DUZ L;  1J6Q A;  4DR1 L;  1PV4 A;  1NJI C;  1VQE A;  2AWO A;  4JV5 Q;  3T1H L;  1UEB A;  1WYD A;  1YJW A;  1MJE A;  1M90 C;  1IBM Q;  5ELN A;  2UU9 Q;  3FHW A;  1CSP A;  1PH6 A;  3CD6 A;  4A3L G;  4BBS G;  2E5L Q;  3S16 H;  1PVO A;  3M3Y H;  4IFD G;  3STB D;  2CWA A;  2QGQ A;  1WOC A;  3CUC A;  3J81 c;  1G51 A;  5FJ8 G;  2E2J H;  3HOV G;  4R4C A;  3J7A 5;  2NVT H;  2PQA A;  1YHQ A;  1XMQ Q;  1LYL A;  2K4K A;  2JK8 A;  1QZG A;  1X6O A;  5HGQ A;  3HOU H;  2HHH Q;  1Y1W G;  4U0S A;  4O0A A;  2RF4 A;  4GLA C;  1KD1 C;  4OO1 G;  4JC0 A;  2KCM A;  3J7Z C;  1PH8 A;  3HOY G;  2ZJQ A;  1A63 A;  5BR8 L;  1YHB A;  4HID A;  3U50 C;  4DUY L;  4B3T Q;  4LUO A;  1N9W A;  4LW1 A;  3OW2 A;  3U4Z A;  4BBS H;  4A3L H;  3E9I A;  3GTQ H;  4AH6 A;  2QEX A;  1I50 H;  1FVI A;  4MTN A;  1OXT A;  4GNX A;  3J81 j;  4U0U A;  5LMU Q;  1XPO A;  1KC8 C;  4JI2 L;  5FJ8 H;  4LF5 L;  4ITR A;  5FLM G;  4HIO A;  1HJP A;  4HIM A;  1Q46 A;  3CPW A;  1VQO A;  1K8A C;  4B3S Q;  2E2H H;  1N34 L;  3K0X A;  5C3E G;  4JI8 L;  1Y1W H;  2IX1 A;  1RIP A;  4GKJ L;  3W1B A;  1OXU A;  4R4O A;  4X65 Q;  3KOJ A;  1E7Z A;  3EN2 A;  4BBR G;  1EUJ A;  1C7Y A;  3HOY H;  1S40 A;  1SR3 A;  4QIW E;  1YI2 A;  3M4Q A;  3CCQ A;  2EXD A;  1BKB A;  3F2B A;  1AE3 A;  3U58 A;  4UPA A;  4ME3 A;  4X62 Q;  3CMA A;  4PY3 A;  4BA1 I;  3AEV A;  2NZH A;  3K7A H;  5IYB G;  4X2C A;  4X2D A;  5IP7 G;  5C44 G;  2UUC Q;  2NVQ H;  1YBY A;  5JJI A;  4C3I H;  4DR7 Q;  3T1Y Q;  3KF8 B;  2UXC Q;  2LSS A;  1WI5 A;  2GN5 A;  3RN2 A;  3FKI G;  5C3E H;  4P72 A;  4OON A;  4JBM A;  4L5R C;  3A0J A;  4LF4 L;  1PYS B;  2H5X A;  3KJP A;  2YV5 A;  4R4T A;  4BBR H;  1PH4 A;  4BA2 I;  3L0O A;  2ZM6 Q;  4MZ9 A;  4OWT B;  4GN3 B;  4EQ5 A;  2VUM G;  4JYA Q;  1Z47 A;  4B3R L;  2K75 A;  1GKH A;  3GD7 A;  2UUA Q;  4KHP L;  4GLV B;  2VQF L;  4NXN L;  1VQ4 A;  1X54 A;  1BVS A;  3E0E A;  1KIX A;  3CCM A;  3TS0 A;  3UE0 A;  4L5Q A;  3F2D A;  2JA5 G;  5IYB H;  3F1Z A;  4BY1 G;  1J5E Q;  3A5U A;  1CKN B;  3CAM A;  4DPG A;  4YWL A;  5C44 H;  2BH2 A;  4BY7 H;  3RZD H;  2OTL A;  4AQY L;  1Y1V G;  5C0X G;  1HNW Q;  4DR1 Q;  2OWO A;  2B63 H;  4MNO A;  1NTG A;  4JI3 L;  1VQA A;  4LU4 A;  1AE2 A;  2NVY H;  2WB1 G;  2OQK A;  1KRT A;  4JBW A;  5IP9 G;  1QVG A;  4LWC A;  4DV1 Q;  4A3C G;  1JJG A;  4U07 A;  4AYB E;  4POF A;  4LFB L;  5M3M H;  4X64 L;  4OWX B;  4JI5 L;  1UE6 A;  4LF8 Q;  2VZA A;  2K14 A;  3UDF A;  3CQZ H;  1PH7 A;  2A19 A;  4YCW A;  1KHI A;  4DV5 L;  2JA5 H;  2NVX H;  1TWG H;  2A1A A;  2IY5 B;  1A8V A;  1RL2 A;  3EBE A;  4JI0 L;  2JA8 G;  1EQQ A;  1X3F A;  1Y1V H;  2CFM A;  2UXB L;  1GVP A;  5J3B A;  4R4Q A;  4LF6 L;  2UUB Q;  1YEZ A;  2UXD Q;  4DUY Q;  3KYH C;  1EIF A;  5IP9 H;  3H3V I;  1JT8 A;  4A3C H;  4N67 A;  1XNR L;  3PUV A;  2Y0S E;  4JOI A;  3OYY A;  4J15 A;  1Q86 C;  3PO2 H;  2NZO A;  4DV2 L;  4YWM A;  2F52 A;  3ER0 A;  1EIY B;  3KDF A;  3CC2 A;  4PZ6 A;  3J81 i;  4LF5 Q;  4LF7 Q;  4QGU A;  5CGL A;  4PMW A;  1YHA A;  4IOA A;  4GLX A;  4A3K G;  1YJN A;  4P74 A;  3I55 A;  4DKA C;  2BA0 A;  2ALY B;  1N34 Q;  4JI8 Q;  3CCJ A;  5IWA Q;  2KHJ A;  2JA8 H;  5JJL A;  5GAD C;  3JAM c;  1OXS C;  4DR5 L;  3HOW G;  2R7F A;  4NXM Q;  2ATW A;  2K5N A;  3I4M G;  4KLK A;  5IY0 A;  1K8G A;  1Q81 C;  1EFW A;  3HOZ H;  5JEA J;  4DK6 C;  3CP0 A;  3RLN A;  3M85 A;  3ZLM A;  4YHH Q;  4OX9 L;  4DR4 Q;  2ZTD A;  3G6E A;  1GD7 A;  4DV0 Q;  2LXK A;  4DV7 L;  1HZC A;  1IXR A;  4DV6 L;  1K9M C;  1VQ6 A;  4DV4 Q;  4QL5 A;  4JI7 L;  2R92 G;  3GTM H;  4UP9 A;  4WGJ A;  1QUQ A;  4DAY B;  4LFA L;  3TS2 A;  4A3K H;  3OTO L;  3HOX H;  2G03 A;  1Z9F A;  5H1S E;  3B6Y A;  3KF6 B;  1KRS A;  4C3H H;  4C3J H;  2PQA B;  4DV3 L;  1U5K A;  1N36 L;  4IJH A;  1I5F A;  5EU0 A;  3KF6 A;  1K73 C;  3I4M H;  1SFO H;  2KEN A;  3ULL A;  4B3R Q;  3RLO A;  1Q7Y C;  4IFD J;  4RG1 A;  1UWV A;  4KHP Q;  4HJA A;  1D8L A;  2VQF Q;  4NXN Q;  1IBL L;  3I4N G;  4UP8 A;  3CCV A;  3CC7 A;  3PUX A;  5IYD G;  4DR2 L;  1GM5 A;  1X65 A;  3HFZ B;  3GTO H;  3DM3 A;  1I94 Q;  3PGZ A;  3KFU A;  2GVB A;  1SRU A;  4GNX B;  4JBK A;  1HNZ Q;  1NY4 A;  3AYH B;  2MO0 A;  3U4V A;  1BBU A;  4LFC L;  2ZTC A;  1S3O A;  1ASY A;  1B70 B;  3K81 C;  1VQI A;  3MEF A;  3HKS A;  4B3M Q;  2A8V A;  2DGY A;  3HOV H;  1XNQ L;  1HZB A;  4X66 L;  1X9N A;  3PUW A;  5ELO A;  5M3F G;  1FJG Q;  1VQB A;  2R7D A;  1NMG A;  3I4N H;  2R93 G;  5M5X H;  1OTC A;  2Y0S G;  4LUV A;  2B29 A;  2K50 A;  4TVA B;  3S2D H;  3K8A A;  4FDB A;  1PH5 A;  5JFZ A;  5IYD H;  1E1T A;  1PYB A;  5JJ6 A;  1VQF A;  1W2B A;  5DLQ E;  3KLW A;  4JI0 Q;  3ZC7 A;  3PV0 A;  4JI4 Q;  4UY8 C;  5LMN L;  3GTP H;  4XI8 A;  1V9P A;  2PNH A;  4LF6 Q;  1A0I A;  1DGS A;  4YCU A;  5GAG C;  3KJO A;  1IBK Q;  1KQS A;  2Q2I A;  1NMF A;  4QQB X;  1N32 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...