2VY3A

Type iv secretion system effector protein bepa
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
291
structure length
291
Chain Sequence
EIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCSHDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMPEMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHPFREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDISNPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYIIGNIDHLPPEQLKILKPGDKITFTAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords CELL FILAMENTATION PROTEIN
publication title Fic Domain Catalyzed Adenylylation: Insight Provided by the Structural Analysis of the Type Iv Secretion System Effector Bepa.
pubmed doi rcsb
source organism Bartonella henselae
total genus 86
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 2vy3A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vy3A02
1C9OA 3CAMA 4DK3C 4POFA 4HIDA 1YNXA 4BA2I 3PIPA 5M3FH 3AFPA 2R7DA 1IYJB 3ZLMA 4PMWA 4BBSG 3UE0A 3U4VA 3KJPA 1XMQQ 2WAQG 3CUCA 2C35B 5M5XH 2BH2A 5EU0A 1PYSB 2GVBA 5C0XJ 1Q8KA 4PG3A 1E1OA 2ASBA 1P8LA 1QUQA 3GTQH 4LUVA 4L5SA 5C44H 1SR3A 4JI6L 1K3RA 3L7ZC 1Y1VG 4XIGS 3KF6A 1TXYA 1Y14B 1O7IA 3HOUG 1EQRA 2JQOA 1GM5A 4JBMA 1YHBA 2IY5B 4R4IA 2JEAI 4QY7A 4DR5Q 4GKJQ 1SROA 2UXBQ 3TS0A 1MKHA 1VQDA 4IFDI 1KHIA 2YTVA 3PO3G 3M9BA 1N33Q 2MO1A 4LF6L 3NELA 3UDIA 2UUCL 5IP7G 2B63H 3JC66 3S6AA 3B6YA 3HFZB 5JEAG 3J81i 4JI2L 4ME3A 4JI4L 3CW2C 5ELNA 4A3GG 3L0OA 1E22A 2UUAL 2NZHA 5FJ8G 1KRTA 3D0FA 3E0EA 4PZ7A 1M90C 2QA4A 2MQHA 2Z0SA 3HOXH 1YJWA 2KHIA 3KOJA 1EWIA 1UE7A 1Q12A 3T1HL 4DR4Q 4B3SL 3RLOA 4B3ML 4JI1L 1FVIA 3CPWA 2VQFL 2E5LQ 5JFFA 2CFMA 3H3VH 2UU9Q 4LF4Q 3OTOL 3FKIG 4GNXC 4DR1L 3PO2H 2Q2HA 4A3MH 2PI2A 3HOVH 5HGQA 2ZM6Q 2DGYA 1EIYB 5GAHC 1TWGH 4IPHA 4AYBE 5JJLA 1IL2A 2JA9A 4A3FH 1XPOA 3HKZE 4UP9A 1A63A 2YV5A 3HOWH 2R92H 4JV5L 4JYAQ 1JMCA 3J81j 4X65L 1NY4A 4JOIC 2AKWB 4LF8Q 1B70B 4LUZA 4Y7NH 4DV2L 2VZAA 3PUWA 2JA8G 2R93G 1RL2A 1L2FA 4YHHL 4TQUS 1SFOH 4A3BH 4OWTB 1AH9A 4FDBA 4LNQA 1K83H 1EFWA 2UUBQ 4C3JH 4JI0Q 4GN4B 4XI8A 1UWVA 1L1OC 3CMEA 4DR3Q 1JB7A 1HNWQ 3T1YL 1I50H 1G51A 3EIVA 2K14A 4KLKA 5GADC 3PUYA 3CCRA 1YJNA 1KRSA 3Q8DA 4IJHA 5FLXc 4DR2Q 2UXDQ 4DR7Q 1XTDA 5M3MH 2CKZB 2I5MX 1Q81C 2LXJA 4U0UA 3D31A 4PZ8A 4QQBX 5BR8L 1PH5A 2PQAB 1VQ7A 4YWKA 3W1GA 5IYCG 1U0LA 3STBC 4HJ5A 1VQHA 2WFWA 4LFAL 2E8GA 3CCUA 2VY3A 4DV6Q 1XMOL 2I5HA 1A62A 4OONA 5CKLA 3GD7A 3JAMi 3GO5A 4LFCQ 2N8NA 1VQ9A 4NPSA 1X55A 1UE1A 1X3FA 1QVCA 4A3KG 1PH6A 4NXML 3GDEA 1HNWL 4DAMA 3H15A 2Y0SG 5IYDG 4HJ9A 2E2HH 4JI3Q 2JA6H 2F4VQ 2K5VA 4JG2A 4R4TA 4C3HH 3AQQA 4R4CA 5IYBH 3KJOA 4HIMA 2WAQE 2Q2IA 3NENA 1K73C 1I94Q 4LW1A 1QUQB 3RNUA 1G6PA 1S3OA 1XMQL 4DV7L 3FP9A 3KF6B 2KCTA 2K52A 3J80i 3UDXA 1QVFA 4EX5A 4XTCS 3S1QH 1PH1A 2HHHL 1EOVA 1VQ5A 4A4IA 1TWCH 3MXNB 1IBML 4WGJA 3KF8B 4YWMA 5C44G 3ULPA 3J81c 4BY1H 4OX9L 1X9NA 4OXPA 3UDGA 3UDFA 3K7AH 4DR5L 5C3EG 4GKKL 4BY7G 4A3LH 2ZTCA 3I4MG 4B3RQ 2UXBL 4MZ9A 1Q7YC 4DKAC 3GTJH 3BJUA 5E7NA 3CCEA 1C0AA 1GD7A 1S72A 2F3IA 4U0SA 1Q82C 1A0IA 1WYDA 1V1QA 5CMTA 4QL5A 3AFQA 2N49A 1SLJA 4P71A 1K0RA 1VS0A 1N36Q 3W5OA 4IOAA 1YITA 1PHJA 3AEVA 3ZC7A 1CKNA 3U58A 1GO3E 1MIUA 1XPUA 2D0PA 3J7A5 1H95A 5CGLA 1YI2A 2BA1A 2GVAA 5H1SE 4B3TQ 3E9IA 1BBUA 1PH2A 2AWOA 1B8AA 5JJKA 3S15H 4RG1A 4JBWA 1N32Q 4UY8C 1KAWA 1Q1BA 4A3JG 3F1ZA 4A3DH 4K0KQ 2ZM6L 3E9HA 3L2PA 1PFSA 4N67A 4YCVA 1IBKQ 1GKHA 5HY6A 2K50A 3A0JA 2QGQA 4HJ8A 1WCMG 3PO2G 4DAYB 4KHPQ 4A3EH 3A5ZB 2MNAA 1NJIC 2JA5H 1GVPA 1PYBA 1XJVA 5FLMH 1SRUA 4GOPA 3AYHB 2N3SA 4BBRH 3H0GH 2Q2UA 3LGJA 1CSPA 2K75A 2VQEQ 1KQSA 4LFBQ 1HZAA 1X3EA 3PIOA 4DUYL 1Z47A 4HJ7A 1W3SA 4AQYQ 1HNXQ 1HR0L 4BXXH 1JJ2A 1OXUA 5LMNL 5IP9H 3G4SA 1IBLQ 4JI8Q 3CC2A 2Z6KC 3DM3A 4QIWE 4POGA 1XNQQ 2JA7H 3F8TA 1V9PA 4A3BG 2OTJA 1SMXA 1VQJA 1Y1WH 1KD1C 1NTGA 2WB1G 4X6AH 3VDYA 2DUDA 3LETA 3BZKA 4L5QA 3ULJA 4DV4L 1J6QA 2CWPA 2XGTA 5IWAL 1HNZL 2MO0A 2OTLA 1YHQA 2K5HA 3S17H 4GN5A 1R9TH 4BBSH 2IHFA 3ICEA 2F6SA 4X62Q 4MNOA 2EXDA 4DNIA 4MTNA 4UPAA 3JAMc 3F2CA 3GTMH 2ZTEA 4IPCA 2E2JH 1KXLA 2RCNA 2I5LX 3ZJYC 3KDFB 4JI5Q 5C4JH 1N34L 2NVXH 2JJQA 4EQ5A 3UE1A 1V43A 3CCJA 2NVTH 4A3CG 1VQFA 2D62A 4H02A 1AE2A 4LFCL 1Q86C 2R7ZH 5JJIA 3CXCA 2Y0SE 1QZHA 4JI6Q 4C2MH 1BKBA 3PF5A 1PH7A 2K4KA 2CWAA 4JI3L 2NZOA 3OW2A 1IZ6A 1YJ9A 1NBWA 3I56A 3J80c 1WFQA 3M4PA 3M4QA 4DPGA 4DV3Q 1I94L 3I4NG 4NXNL 5IP7H 4DV0L 2JA6G 5LMUL 4A3GH 2NVYH 3RN2A 3ZCBA 3NBHB 4GLXA 1X54A 4JI7L 1FJGQ 5FJ8H 1RIPA 2NVQH 1B7YB 2UUCQ 2PNHA 1VQIA 5IT9c 1D7QA 3CC7A 5IE8A 4JI2Q 4OWXB 1X6OA 2KENA 4X64L 2KHJA 4LF7Q 3RZDH 4P74A 5GQOA 2UUAQ 4Y52H 4R4QA 5AJ3L 4DV1L 4RMFA 1UE5A 1VQ4A 1OXXK 4IFDJ 1QVGA 4OWWB 4JBJA 5JEAJ 2H5XA 3FKIH 2UXCQ 1OXVA 3STBD 3OYYA 3KDFA 3T1HQ 2NN6I 1PH4A 4B3SQ 4BY1G 5C0XI 1JE5A 4B3MQ 4P72A 2A8VA 2NN6G 1N8RC 1K8AC 4A3LG 5C0XG 4L5TA 4KI0A 2JK8A 3I2ZA 5DLQE 3K7UC 3OTOQ 3CPFA 2PMZE 4DR1Q 1CKNB 4JCVE 3PV0A 4IOCA 3EN2A 5GAEC 4YWLA 4LF9Q 1X65A 3S1NH 1Z9FA 4DR6Q 1N9WA 3F2BA 2VUMG 4UP7A 4X66Q 4IFDG 2B3GA 1VQOA 4LF5Q 3CP0A 2F52A 4AYBG 3CQZH 1HH2P 2A19A 1Q46A 2HIXA 5M3FG 4JV5Q 4WJ3M 1LYLA 3TQYA 2QEXA 2ES2A 4B3TL 2R93H 4X65Q 1I5FA 1E24A 1MJCA 2OCEA 3IRBA 4KHZA 2V1CC 3HOZH 1IBKL 1JJCB 1VQAA 2ALYB 3M85A 3DLLA 4DUZQ 4GOPB 3HOYH 2HQLA 2KBNA 1T9HA 4KHPL 1YZ6A 4GKJL 2AWNA 2ZJPA 1XNRQ 1XPRA 1N33L 1DGSA 4ITRA 3SN9A 3S2DH 4X2EA 4JBKA 3I7FA 3TEHB 3T1YQ 1CUKA 2L15A 1WI5A 3WWVA 1HZCA 3G71A 4A3EG 1HR0W 5JJ7A 4O0AA 2VQEL 4A3IH 2JA5G 5LMNW 4LFBL 5FLMG 2ZJQA 2B63G 1VQEA 4AQYL 4DV5Q 2IHEA 4BBRG 3SHGA 3CCQA 4R4OA 1KIXA 1SN8A 3CCMA 1XNQL 3CF5A 2WB1E 4PZ6A 5ELOA 4IPDA 4DR4L 2ID0A 2OWOA 4C3IH 4BXXG 5C4XH 3J7ZC 1TWHH 2E5LL 1L0WA 4BA1I 2N78A 1VQ6A 4GKKQ 4A3KH 3HOXG 2UU9L 4LF4L 2JA7G 2HT1A 2OQKA 3H3VI 1Y1WG 1EUJA 3GTGH 2FXQA 3EBEA 3TREA 4NXMQ 4A93H 3KYHC 3FHWA 4LUOA 4A3MG 1VQBA 3HOVG 4LU4A 4TVAB 1PV4A 4M16A 1HJPA 4JYAL 4A75A 1LM0A 4JI5L 4JOIA 3U50C 3G6EA 4A3FG 1MJEA 1E1TA 1G291 1QZGA 1K9MC 1VQGA 2R7FA 4DV7Q 2I0QA 3PF4A 4LWCA 4LF8L 3HOWG 3CCVA 2R92G 1AE3A 4YY3Q 4APVA 4IJLA 1PH8A 2UUBL 2YTXA 3RZOH 4JI0L 1L1OA 2HHHQ 1NMFA 3BU2A 2JEBI 3M3YH 1IBMQ 5C3EH 4BY7H 4DR3L 1YIJA 4HJAA 2CQOA 3I4MH 2R7ZG 4DV3L 2EIFA 3CMAA 1YVCA 1ASZA 4J15A 4OX9Q 4DR2L 1YEZA 1VQNA 1A8VA 1FJGL 3I55A 3W1BA 4DK6C 3TRZA 4DR7L 3ER0A 1W2BA 2UXDL 1PH9A 3PUXA 2BA0A 2RHQB 1J5EQ 2LXKA 5K36G 4LF7L 1YHAA 2A1AA 1KC8C 4JC0A 5M3MG 2MFIA 1OXTA 3CC4A 3K0XA 3PUZA 5J3BA 3U4ZA 4ALPA 4DV6L 1C7YA 1PVOA 1WJJA 3KLWA 2UXCL 1NE3A 1Y1VH 2IT1A 3KFUA 2K5NA 1VQLA 4HIOA 4A3JH 3HOUH 1S40A 2LSSA 4P75A 3S14H 3SE5A 4AIMA 1WCMH 4U04A 1WOCA 2RHSB 3K81C 4LF9L 1SE8A 4DR6L 4WJ4A 2F4VL 3PO3H 3CD6A 5M5WH 2RF4A 2YTYA 4X66L 1KL9A 3PCOB 3SGIA 1E7ZA 2IX1A 4LF5L 3RLFA 1BVSA 5GROA 5IYBG 3S24A 4U07A 1U5KA 1I3QH 1HZBA 1CKMA 4LF6Q 3PSIA 4JI4Q 4R1JA 4GOPC 1LUZA 4OO1I 1X3GA 1FGUA 1YBYA 1IXRA 4X2DA 4DUYQ 3K8AA 3GTOH 4OO1G 2VNUD 1HR0Q 4O2DA 4DUZL 3M4OH 5LMNQ 3PUVA 4GLAC 4AH6A 1XNRL 3N3UA 3HOZG 4B3RL 2ZTDA 1VQPA 1TWFH 2AMCB 2D0OA 1CKOA 4YCUA 3HOYG 4JI1Q 3PGZA 2VQFQ 3CCLA 2PI2E 4DV4Q 2BH8A 5GAGC 5IWAQ 3A5UA 1HNZQ 2G03A 1VQKA 1NMGA 3A74A 4L5RC 4DV5L 1M1KC 1N36L 4PY3A 1UE6A 5M5YH 4A3IG 4NB3A 1CSQA 4GNXB 3GTKH 2ATWA 1PA6A 1UEBA 4A3CH 4GN3B 1JJGA 2EQSA 3HKSA 3RR5A 3HKZG 1VCIA 3ERSX 3ULLA 4A76A 2JA8H 2HIVA 3CCSA 1N34Q 1VQMA 1N32L 4HIKA 1K8GA 2KCMA 2GN5A 4K0KL 4U0ZA 3RLNA 4DV2Q 3I4OA 5C4XG 1ASYA 1PH3A 1JT8A 4YHHQ 4X2CA 3S16H 2VW9A 2XTIA 5IY0A 3I4NH 3K80C 4GLVB 5JFZA 3M7NA 3TS2A 4A3DG 1D8LA 5EAYA 1HZ9A 2E2IH 2OQ0A 4A93G 4NXNQ 3GTPH 4P73A 2IX0A 4DV0Q 2B29A 5LMUQ 3NEMA 4QGUA 5JJ6A 4JI7Q 1BBWA 4QJFA 1L1OB 5IYCH 1P16A 4YY3L 1HNXL 2VL6A 1OTCA 1EQQA 2CCZA 3H0GG 3G48A 1Q1EA 2Z6KA 5BR8Q 1IBLL 2JE6I 4JI8L 4X64Q 1EIFA 2YU9H 3RN5A 1X56A 2ZJRA 1I6HH 1OXSC 3MEFA 1TWAH 2PQAA 4LFAQ 1EYGA 5AJ3Q 4DV1Q 4UP8A 1LTLA 1VQCA 2YYZA 4GNXA 5IP9G 3S1RH 1XMOQ 2VS1A 4YCWA 3F2DA 1FL0A 5IYDH 3GTLH 3S1MH 2AHOB 3BZCA 3S2HH 2R6GA 4GS3A 1J5EL 4IPGA 4IO9A 4X62L 2VUMH 1E3PA 1VQ8A 2Q2TA 2WP8J
chains in the Genus database with same CATH superfamily
1C9OA 4DK3C 2XRQD 2F0NA 3AFPA 4BBSG 1LABA 2E2DC 2WAQG 3CUCA 2BH2A 2JA5B 2GVBA 4PG3A 4PV1C 1AN8A 1SR3A 5C44H 4JI6L 3VYRA 3KF6A 3EFXD 1EQRA 5T1GA 1V1OA 4HMJA 1K28A 3MXNA 4QY7A 1K3BC 1GXDC 3MWYW 1MKHA 4IFDI 1I4QA 2RDGA 3UDIA 5C4HA 4IFDG 3J81i 3HFZB 4A3GG 5J39A 4EQOA 1K8MA 2QDLA 2UUAL 1CT1D 1S5BD 5AFWA 3E0EA 3HOVB 3DEOA 2MQHA 4A3FB 2KHIA 3KOJA 2B2UA 1UE7A 4DR4Q 4IUNA 2E2JB 3KBXA 5EGTA 1KDBA 2TSSA 4YIJA 4U68A 3CPWA 2QKIC 4LF4Q 1BQQT 3NP8A 4DR1L 2Q2HA 3OWFA 2ZM6Q 2DGYA 3MA2B 5GAHC 1TWGH 3T13A 1IL2A 2JA9A 1XPOA 4OIJA 2HDMA 2YV5A 2Z1CA 5C5MA 4G57A 3J81j 2PZUA 2K05A 1NY4A 1ENFA 4DV2L 1T5EA 2R93G 1D7QA 2JA8G 2F0TA 5D3DA 4YHHL 2F1MA 4JI0Q 1UWVA 1L1OC 4DR3Q 1G51A 2K14A 1KRSA 1CZGA 1XTDA 4K2KA 1ZYRC 3KBGA 3I73A 5BR8L 1PH5A 1VQ7A 2F0IA 2N55A 2C9OA 3HEJA 1VQHA 1CA5A 4C3HB 1CA6A 3NTHA 2VY3A 1XMOL 4FXGC 1A62A 1BCPF 2EYHA 3GD7A 3L9AX 4RGTA 3GO5A 3SE0A 2N8NA 1F9PA 1X3FA 1ENCA 4A3KG 1ET9A 2K33A 4DAMA 5IYDG 2E2HH 2JA6H 1EFID 1KTKA 2K5VA 4JG2A 2F4VQ 2A73B 3RNUA 1S3OA 4DV7L 3AU7A 1EQVA 3FMCA 1F9SA 5JJZA 1EYCA 4XTCS 1PH1A 2HHHL 1EOVA 1IBML 3IFTA 1H9RA 4WGJA 4YWMA 3MVVA 1JCKB 4V190 3HKZB 4OX9L 3UDGA 2AQ1B 2NN6H 4GKKL 3TP8A 4MZ9A 3LNNA 1WD0A 5E7NA 1C0AA 1Q82C 2O5IC 1BDOA 4OIKA 4QL5A 1D5ZC 3A55A 2N49A 1LO5D 3H09A 4IOAA 5J1ZA 4KD3A 3J7A5 2DNEA 2GVAA 2LKVA 5H1SE 3OPOA 3E9IA 5CMDA 3Q22A 2JXMB 3RMHA 1B8AA 1PZJD 1SNCA 1N32Q 1KLGD 4A3JG 3F1ZA 4A3DH 2ZM6L 3MC0B 4YCVA 1IBKQ 5HY6A 4CDDC 2QGQA 3PO2G 4KHPQ 3GQBA 3M3YB 2MNAA 1PYBA 2F3WA 2LMCB 2JA7B 1O7ZA 4N8X1 5C5LA 2A5HA 3DUZA 2FINB 3LGJA 1CSPA 2K75A 4FF4A 4LFBQ 2CVRA 4HJ7A 1HNXQ 1JJ2A 1EQTA 5LMNL 4BBSB 3CC2A 4IURA 3DM3A 1XNQQ 2WAQB 3BDCA 1U4PA 3GTMB 4A3BG 4KD4A 2XRSD 3VDYA 1NNXA 3NE5B 5IWAL 2MO0A 1U4RA 3K5MA 2F6SA 2NTSA 4UPAA 5BN4A 1QB5D 2ZTEA 1LTGD 2RCNA 2J4XA 4PMCA 4JI5Q 5C4JH 1SNMA 2NVXH 3UE1A 4A3GB 1Q86C 1AE2A 2R7ZH 5EPJA 4C2MH 3PF5A 4J8QA 2CWAA 4KY7A 1YJ9A 2EJMA 4Z9CB 2IX3A 3I56A 4IUPA 3MZ5A 3M4PA 4DV3Q 3GTOB 4IALA 1DYQA 4NXNL 3M4OB 1TS5A 1LTAD 2NVYH 3CKIB 1X54A 5EKKA 2NVQH 2Z6BA 4MN3A 4JI2Q 2KENA 1VDZA 1VMPA 1FGBD 4P74A 1KDCA 2M2LA 2F0PA 5FK9C 1D1KA 2E75C 1VQ4A 2O5JC 2NBFA 1JORA 1QVGA 1EU4A 2RA4A 2QDBA 4KJNA 5IGEA 3OYYA 1Q90A 3T1HQ 4B3SQ 1JE5A 4TKOB 2R93B 2A6EC 4KKUA 2F4IA 1K8AC 4BS9A 4A3LG 1SJHD 2JK8A 3K7UC 3MXUA 2B8GA 4OHJA 4YWLA 1X65A 2VUMG 3F2BA 2LY7A 3S16B 2B3GA 5EKLA 1VQOA 1A6XA 4LF5Q 3CP0A 5M3FG 1LYLA 3TQYA 1A15A 3S2DB 1I5FA 2KECA 2OCEA 4KHZA 4N9PA 2V1CC 1B4OA 3IKJA 1NCVA 3NTIA 1IBKL 1C48A 1T9HA 4KHPL 2AWNA 4BWGB 5CBEE 2ZJPA 1XPRA 2K01A 5IGFA 1UAPA 1X3PA 4X2EA 2QEJC 1PTOC 4A3EG 1AW7A 4A3KB 4K2LA 5LMNW 4LFBL 5FLMG 1SNOA 2B63G 1SE3A 2IHEA 4BBRG 4RH6A 5E1FA 1XNQL 5DEHA 1NR2A 5C4XH 2XN9C 1L0WA 2N78A 1VQ6A 5L37A 3H3VI 3ONAB 3URYA 4FF3A 2FXQA 3EBEA 4NXMQ 4A93H 1XXGA 5D14A 3FHWA 4LUOA 1MSGA 3VA7A 4A3MG 3OWEB 3RZOB 4M16A 1Y8NB 5CYUA 2XNAC 4JYAL 1LM0A 4JI5L 1VQGA 4LF8L 3HOWG 3CCVA 1IYVA 2MGSA 1WTXA 4F88A 2UUBL 1L1OA 5C3EH 4P2CB 2CW0D 3K6OA 4DV3L 5KEEA 4ZKBB 4C3JG 1I4XA 5FKAC 4DR2L 4HR7B 1VQNA 3TRZA 3I55A 3W1BA 4DR7L 2UXDL 2RCFA 3ER0A 3GP7A 1W2BA 4A3JB 3HOUB 1PH9A 1JOOA 2BA0A 3NBIA 4KK7A 1KC8C 3PO2B 5M3MG 1OXTA 5J3BA 1PVOA 1RODA 1IHZA 1WVLA 2EVBA 1PFMA 1NE3A 1D6EC 2IT1A 3KFUA 2K5NA 3VR6A 4IUTA 3TSSA 2WV6D 4P75A 4FO2A 1JC7A 3K81C 4IN3A 4NKLA 3PO3H 5M5WH 1QNUA 3FPPA 5ELCA 1K83B 4WJWA 4LF5L 1ICFB 4G7HC 5IYBG 1NAPA 1I3QH 4G7OC 4JI4Q 4R1JA 4GOPC 3SEBA 2SDFA 4K6LA 4X2DA 4DUYQ 1IKLA 2VNUD 1HR0Q 2F0FA 4RA8A 3A54A 4GLAC 5M5YB 3W3AA 3HOZG 4FVMA 1TWFH 1CKOA 1V8QA 2VQFQ 4DV4Q 4S3SA 1HNZQ 4DNTB 2I46A 1EIGA 5HURA 4IZ8A 4A3IG 5CV5A 1UEBA 1FNWA 3NQIA 4A3CH 1JJGA 3K0YA 5CR3A 3WOEA 2GN5A 1PMRA 2IW3A 3I3CA 3I8ZA 4K0KL 4CJ0B 2OF1A 1MGSA 5JFZA 3M7NA 3TS2A 2YU9B 2MJ8A 2E2IH 1I6HB 1NSNS 4OGQC 4P73A 5LMUQ 4ABNA 4JI7Q 4QJFA 3GTLB 1EQQA 4Q0FA 1RJTA 2CQAA 4JI8L 2VUMB 3TP6A 3RN5A 1TWAH 3A8KE 5M3FB 1VQCA 1EU3A 5IP9G 3S1RH 1AFPA 2PZWA 3N6RA 3F2DA 5C0XH 1PRTD 2AHOB 1CK1A 1Y8PB 4IPGA 2KEDA 4IO9A 1E3PA 1YNXA 3PIPA 3BDLA 2IPKD 1PXUA 3ZLMA 1SYCA 3UE0A 1XMQQ 5M5XH 2C35B 4A3EB 5EU0A 3PMFA 1E1OA 1SNQA 1P8LA 4KKTA 4LUVA 2B63B 3KLSA 1EL0A 1FD7D 1B3QA 1K3RA 4BBRB 1F2ZA 1Y1VG 1TXYA 1Y14B 1O7IA 1GM5A 4JBMA 1GUGA 1YNNC 1EY0A 4R4IA 4DR5Q 3TP7A 5CV6A 1U4LA 1N33Q 2MO1A 5IP7G 4ZCKA 4JI4L 3S6AA 3B6YA 4CKBA 4ME3A 5ELNA 3L0OA 3SXHA 1JQYD 5FJ8G 1EOTA 1KRTA 4A3MB 5LHY1 5F2DA 4PZ7A 1RF2D 2QA4A 2RSOA 2P5ZX 3K57A 1YJWA 4L6TB 4HSVA 3HOWB 1G91A 1FVIA 5KGUA 2EYOA 2VQFL 5JFFA 2E5LQ 3OIPA 2HCIA 3FKIG 3D6WA 3HOVH 1Z7TA 4I7AA 1WTWA 1EIYB 4A3FH 2A68C 4IUUA 4C3JB 1A63A 1JMCA 2A6HC 5D3IB 1L0YB 4JOIC 1PZKD 2BE5D 4L63B 5EPKA 2VZAA 3NWTA 4HTHA 1RL2A 4TQUS 4F7XA 1B50A 4FDBA 1YNJD 3E6ZX 5M3MB 5IODA 4CKCA 3RZDB 3CMEA 1EY8A 2KHSA 1JB7A 2E74C 2PCFB 1I50H 3PUYA 4RKLA 4RFBA 1JOQA 1EY5A 1BUVT 3S9WA 1ILQA 3DWAA 1Q81C 4QQBX 5EBCA 3W1GA 3E3XA 1GHKA 2WFWA 1IW7D 3DWQA 3DWPA 5IOCA 3CCUA 4DV6Q 4K5VA 1C8CA 4PNYA 5CKLA 2O2LD 1AZPA 4LFCQ 5IGDA 2FMMA 3KK7A 4NPSA 1X55A 1UE1A 3TMEA 3GDEA 3H15A 3S1QB 3BVMA 4JI3Q 3FVQA 4C3HH 3KJOA 4HIMA 3NENA 2F0LA 4QIWB 1XMQL 4ID6A 1FYCA 3K7AB 3KF6B 2KCTA 3NWSA 4ZQ3A 1X3QA 2F0EA 3MXNB 4A3IB 2DJFC 5C44G 3ULPA 1QJOA 2RVLA 4DR5L 2WKDA 1BXTA 4XDXA 2ZTCA 4BY7G 4B3RQ 3A7AB 5E3FA 4DKAC 1Q7YC 3BJUA 3J80E 5JVG3 5DAUA 1GD7A 2F3IA 2OEOA 1TWHB 3SK4A 4XXEA 1QOHA 3OMGA 4HSPA 3VYSA 4DK1A 1GHJA 2NYZD 4PQXA 5CMTA 4P71A 1SLJA 1K0RA 3OHXC 1VS0A 1N36Q 3AB9A 3TP5A 1YITA 1STYA 3ZC7A 4HCEA 1XPUA 2D0PA 4B3TQ 1BBUA 5JJKA 4HN7A 4JBWA 2K5WA 3NHHA 2B2VC 4N9TA 3A0JA 3J7YW 1WCMG 1LLRD 3A5ZB 1NJIC 1GVPA 2K5DA 1B1ZA 3QG1A 4ZRZA 4CGYB 1XJVA 4TRDA 4GOPA 1EY9A 3W2DA 2Q2UA 2FFKB 1KQSA 1BOSA 3R3OA 1Z47A 2H1EA 1W3SA 4AQYQ 2B2TC 4BXXH 3U9OA 2R61A 1IBLQ 1Y8OB 3U9SA 2KQ3A 3Q6SA 4QIWE 4POGA 2JA7H 3F8TA 1EEFD 1VQJA 1Y1WH 2EYLA 4X6AH 4L5QA 1BO0A 1Y1VB 1PRTB 1YHQA 2QILA 1BBXC 1STHA 1R9TH 3E0JA 4BBSH 1SMYC 2EXDA 4DNIA 3JAMc 3GTMH 1EWCA 4IPCA 2I5LX 3KDFB 1N34L 5CV7A 4EQ5A 2NVTH 3CCJA 5CV9A 4LFCL 1ILPA 2XSCA 3HRZC 3C1EA 4JI3L 1PZID 4DFAA 1IZ6A 2B2WC 3J80c 3M4QA 1QG7A 4DPGA 4IFDH 4DV0L 2JA6G 4A3GH 5K36H 3RN2A 4GLXA 3Q24A 1RIPA 3FKIB 5FLXL 1B7YB 2F0OA 2UUCQ 2EYPA 4X64L 4J1MA 4B08A 4R4QA 5KNDA 3S1NB 1ZYRD 4DV1L 4OWWB 4JBJA 5JEAJ 4FNFA 1OXVA 3GTKB 1KNEA 2EZVA 3KDFA 4R8IA 2NN6I 4B3MQ 1SDFA 2WINB 2A8VA 1JWMD 2NN6G 1TY0A 3OTOQ 3CPFA 2PMZE 3J7AF 1UNSA 4LJZC 3PV0A 3EN2A 3I90A 3K5LA 1VF7A 1Z9FA 1N9WA 3NQTA 1M8AA 3VR2A 4UP7A 4X66Q 3CQZH 2PZTA 1F77A 4JV5Q 4B3TL 2R93H 4X65Q 1E24A 4N8FA 4RAUC 1AP0A 4L8JA 2A69C 4DU9A 2F03A 2KUMA 3DLLA 3FRPB 4QF4A 3HOYH 3J81L 2KBNA 5I2XA 1YZ6A 3SDZA 2K1BA 2AUJD 3S2DH 1XX8A 2AQ2B 3I7FA 3T1YQ 2L15A 1OO9B 4ZLTF 4O0AA 3BYTB 3SR1A 4AQYL 2O4XA 3GTGB 1HFNA 4PZ6A 1IYUA 4DR4L 4ILWA 5CV8A 3RUZA 2QW7A 1DOKA 3HOXG 4A3KH 1TY2A 3K58A 4LF4L 1G6ZA 1LACA 4C1NI 4DK0A 5C44B 3C2PA 2ICEC 4ODGA 4TVAB 1HJPA 4BY7B 4QUFA 3H6MA 4A75A 4JOIA 3G6EA 1MJEA 1E1TA 1G291 1K9MC 3PF4A 4LWCA 2R92G 5G3LD 4OEMB 3RZOH 4JI0L 2JEBI 4DR3L 2R7ZG 4HJAA 3CMAA 4HEDA 4EQNA 4JK1C 4RGOS 1BCPC 2KCNA 1YEZA 1G8ZD 2VB3X 2KCCA 3PUXA 2RHQB 2F0HA 4ZAIA 3S14B 1YHAA 3RD4A 1WCMB 1LV9A 4JC0A 2Q8RE 3CC4A 1C7YA 1TWGB 5ELDA 1B3AA 4A3JH 3HOUH 1TT2A 4AIMA 4ZK9B 1DJRD 1WOCA 2F4VL 4JVZA 2NB0A 2YTYA 4X66L 5JEAH 1KL9A 3TZUA 1E7ZA 1JICA 1LTSD 1BVSA 4QMGA 1BF4A 3S24A 2KJXA 3FEWX 1HZBA 1CKMA 3R2TA 4LF6Q 1LUZA 5IT9L 2EY6A 4OO1I 1SJED 1ICWA 1ZKOA 4DAVA 4OO1G 1E2ZA 4O2DA 3I72A 3MAQA 2JYOA 1A3VA 3PUVA 4AH6A 3N3UA 3SK5A 2AMCB 1ET6A 3H91A 3PGZA 2JA8B 3CCLA 3R2IA 2PI2E 1SBBB 3OMCA 3SVMA 5GAGC 3A5UA 2G03A 1NMGA 3V2TA 1M1KC 2A6ED 4PY3A 4FXKC 5M5YH 4NB3A 1CSQA 5KYIA 2JA6B 2PPBC 1H9MA 2ENBA 2EQSA 3RR5A 1VCIA 3ERSX 3FDTA 3CCSA 1HFGA 1VQMA 3GTPB 2B2VA 1N32L 2L1BA 3CHBD 1K8GA 1JT8A 5C4XG 2M9VA 1PH3A 1GUNA 1HXYD 2VXWA 2RQXA 1KABA 4A93G 1QE6A 1XYIA 3Q23A 5JPMC 2B2TA 1BBWA 5IYCH 1L1OB 3NXWA 3PQIA 1HNXL 4CJ2C 1OTCA 2CCZA 1KNAA 1DCZA 2RDFA 3H0GG 1PTOD 1Q1EA 1CQVA 4J6HA 5BN5A 1EIFA 2YU9H 1X56A 4CBVA 1I6HH 3MEFA 2PQAA 4LFAQ 5AJ3Q 4EQPA 1LTLA 3A56A 2A74C 5E4WC 3GTLH 5HGTA 4H0LC 3BZCA 4KKSA 1D5XC 3GTQB 3X3NA 3P7JA 2VUMH 1HNWQ 2DJGC 5FLXE 4POFA 4HIDA 4BA2I 5M3FH 3T4AC 2QF7A 1PDQA 1IYJB 4PMWA 3C3LA 4X3SA 2L0CA 5COYA 3U4VA 4EVOA 1PYSB 3F2UA 2G9DA 5C0XJ 2ASBA 1QUQA 4L5SA 3D6CA 2B2WA 3L7ZC 2NTTA 3LX0A 4XQNA 5KRUA 1HUMA 2JQOA 1YHBA 1J8IA 1AEXA 1TS2A 2F0UA 4KTAA 3KF8A 3TZDA 2F0SA 4GKJQ 3HOXB 2UXBQ 1KHIA 3PO3G 1CTMA 3BDOA 3M9BA 4LF6L 2B63H 3JC66 4JI2L 1X32A 4M1UB 5C3WA 4K6DA 2D9UA 2F0MA 4KJOA 2FMCA 1EWIA 1STBA 1FNUA 1Q12A 3T1HL 4B3SL 3RLOA 1EEID 2B39A 2R92B 3J81E 3H3VH 2CFMA 5C4JB 3OIQA 2UU9Q 1H9SB 5JPNC 4GNXC 1WD1A 4A3MH 5HGQA 2Z9HA 4CKEA 2R7ZB 4A3BB 4IPHA 1MSHA 5TSSA 1Z6HA 4C56C 1JWSD 1VF5C 3HOWH 1PRTF 4DAYA 4IUVA 4H13C 5IGGA 2F0KA 2NVYB 4Y7NH 3PUWA 1L2FA 5ISRA 1SFOH 1AH9A 3HS0C 4OWTB 4LNQA 4ZUJA 1EFWA 1EZ8A 4C3JH 1LTTD 5NUCA 3UI2A 3BVZA 4KLKA 3PIO3 5GADC 1CQFA 3CCRA 1YJNA 1EZ6A 4IJHA 5FLXc 5M3MH 2CKZB 1WTPA 4U0UA 1H9SA 3X3MA 5IIFA 3M4YA 2L5TA 4YWKA 3LWUA 4KMUC 4WORA 5ELEA 1U0LA 3STBC 4HJ5A 1ZXTA 3A8IE 1CZWA 2ZXOA 4LFAL 1CHQD 2D5DA 5A35A 2I5HA 2F0GA 1RHPA 2SEBD 4OONA 1QCBD 4O42A 4C3IG 3WOFA 5LL6X 4G7ZC 1VQ9A 4NXML 1PH6A 1QVCA 3A8JE 1XWEA 1HNWL 1STAA 4HJ9A 5KNCA 1U4MA 4R4TA 2J0TD 5IYBH 3AQQA 4R4CA 3HGBA 1I94Q 1K73C 4LW1A 2KVMA 1B53A 4RGNA 2F0VA 1ESFA 4X3TA 3GTJB 1QVFA 2CH4W 4EX5A 1JWUD 3NBHA 4WFN3 3S1QH 1VQ5A 1TWCH 4Q5VA 3D8GA 3J81c 4BY1H 1X9NA 3UDFA 3K7AH 1V1PA 2UXBL 3T51B 3I4MG 3G7LA 5D65A 1S5FD 5J22A 3CCEA 1B44D 1S72A 4U0SA 1ML0D 1A0IA 1WYDA 3S15B 1V1QA 2NUNA 3K5NA 2L12A 1H9JA 5IT9E 4A93B 4C1NK 1PHJA 3AEVA 1CKNA 3U58A 1H95A 2L11A 3MHBA 4E6IA 1TR5A 2AWOA 3V96A 3H0GB 4CJ1B 4RG1A 1QNKA 1PFNA 4UY8C 1Q1BA 3L2PA 1PFSA 4N67A 4HJ8A 3TDQA 2JA5H 4JPBW 1SRUA 1EIHA 4DXGA 3AYHB 1S5DD 2MHVA 1YNND 2VQEQ 4QUCA 1DZ1A 4DUYL 5ELFA 1HR0L 3S17B 1SNDA 1PTOB 5IP9H 3G4SA 2X6LA 5CC4A 2M00A 2Z6KC 1HHVA 1V9PA 2RSNA 1SMXA 1NTGA 4NMZA 2DUDA 3LETA 3ULJA 4DV4L 2CWPA 2XGTA 1HNZL 2K5HA 3T56B 4F87A 3ICEA 4X62Q 4MNOA 4MTNA 1WTQA 5I2YA 3I91A 4M8AA 1KXLA 2E2JH 3ZJYC 3PO3B 5M5WB 2IWHA 3J7AV 2A68D 1LTBD 5CBAE 5JJIA 3CXCA 2A6HD 2Y0SE 3DHQA 3NSWA 4JI6Q 1VMCA 3PIP3 1PH7A 2K4KA 2NZOA 1WTRA 1FNVA 1NBWA 1I94L 3I4NG 1JOKA 5IP7H 4KN7C 5LMUL 1EY6A 4JI7L 1FJGQ 5FJ8H 2VB2X 2PNHA 5IT9c 3MFGA 3CC7A 4OWXB 2KHJA 2NWGA 1EY4A 3EQLC 2UUAQ 2XWJB 4LF7Q 3C46A 4K5WA 1UE5A 3T16A 1QILA 4IFDJ 4DN4M 2H5XA 3FKIH 2UXCQ 2C5CA 4TSSA 4FF1A 1BR9A 4GZYC 4RKBA 1R4PB 1N8RC 4L5TA 4KI0A 3I2ZA 4DR1Q 4HMIA 5LL6S 1WTOA 3S1NH 4LF9Q 3HOZB 2KOLA 2NUCA 1TQOA 3QO2A 2Z8LA 4RHRA 4AYBG 2R3ZA 1HH2P 1QWYA 2EDGA 2HIXA 4PMBA 5EKIA 2ES2A 5IGBA 2QEXA 2J7ZA 2E2IB 2X6GA 3IRBA 4DNRB 4UAIA 2ALYB 3M85A 4DUZQ 4GOPB 1NR4A 1T5XD 1O7YA 1B2TA 1HRJA 1N33L 4ITRA 1E2VA 1TWAB 4C3IB 3TEHB 1HR0W 3G71A 2VQEL 4K8IA 3CCQA 4MHEA 1GUOA 2Z4IA 4R4OA 5E4XA 1KIXA 1SN8A 3MXGA 4CHTB 2WB1E 1K8OA 4BXXG 3J7ZC 2E5LL 1GOZA 5FO7B 3ND8A 3V05A 1CM9A 2JA7G 2HT1A 2OQKA 1Y1WG 1EUJA 3GTGH 3TREA 3BZDB 2WACA 4LU4A 3I4MB 5I9OA 1RTNA 3DEPA 1O7LA 2MPMA 2I0QA 4DV7Q 2EE1A 3P20A 4YY3Q 4APVA 5FO9B 4V0BA 1PH8A 2YTXA 2PMZB 2HHHQ 3BU2A 3M3YH 5DM73 1IBMQ 4BY7H 1YIJA 2EYFA 4QCLA 1YVCA 1ASZA 4OX9Q 4GKKQ 1FJGL 4DK6C 3QWNA 2RBMA 1J5EQ 1EYDA 5K36G 4LF7L 2EY1A 2F0JA 2EYMA 2MFIA 1ZEQX 3K0XA 3PUZA 4ALPA 4DV6L 1SMYD 1SEBD 1WJJA 3ZYYX 2UXCL 2BCOA 2EYJA 2MUYA 1VQLA 1SYFA 2WIIB 2EY2A 2F0DA 2QCPX 3S14H 3SE5A 1WCMH 1J9OA 2HUGA 3L3OC 1L0XB 2EJFC 2RHSB 4LF9L 2V4DA 3IFDA 1SSOA 4B9WA 3CD6A 1JR0D 3P75A 4RCNA 3PCOB 3SGIA 1KLUD 3RLFA 4ME5A 1GUWA 4U07A 1K0SA 1U5KA 1I50B 1FGUA 1D1IA 1YBYA 1IXRA 3GTOH 1II3A 4DUZL 3M4OH 5LMNQ 2EJGC 4B3RL 4XQQA 2ZTDA 2D0OA 4YCUA 1UUPA 4OL7A 2L9HA 2CHBD 5G3LF 3HOYG 4JI1Q 3TBIB 5IWAQ 5JVH3 4L5RC 3DXJC 3O13A 4O1NA 2HQEA 1N36L 2E76C 2OT2A 3I4NB 2SOBA 3NTKA 1PA6A 4GN3B 3HKSA 1A3TA 1AZQA 4A76A 4UDUC 2JA8H 1KDAA 4DA2A 4XQJA 4ZUIA 1S5ED 4HIKA 2KCMA 2ICIA 1DOMA 1STEA 3S16H 2VW9A 3BVGA 2A69D 3K80C 5I6YA 2MP1A 4A3DG 2B2YC 3LWEA 3N52A 2OQ0A 5I9PA 4NXNQ 1RD9D 3GTPH 2B29A 3NEMA 4QGUA 1STNA 3VR3A 1HA5A 3VR5A 1P16A 4YY3L 3QR8A 3S1MB 2IL8A 3S2HB 2Z6KA 1IBLL 3I70A 3EJIA 5DM63 2ZJRA 1OXSC 4AYBB 4G4KA 1EYGA 2VS1A 4YCWA 1FL0A 5IYDH 1RTOA 1LT5D 4GS3A 5I4DA 3SK8A 1J5EL 1CI3M 1HTLD 3Q0AA 2XIWA 3CAMA 2R7DA 2PNRC 3KJPA 1EYAA 1DOLA 1I4RA 4KV6A 1Q8KA 3GTQH 1PYWD 5IGCA 4U673 3P1HA 2KA7A 4XIGS 3HOUG 2DY7A 4NDXA 2K28A 3VA5A 3EVQA 3K5OA 2IY5B 2D2CC 2NUDA 2JEAI 1SROA 3TS0A 1VQDA 2YTVA 1G2TA 3NELA 1HQMC 1Y1WB 1SXTA 2UUCL 1S5CD 5JEAG 2XVSA 3CW2C 1BCPD 1WTVA 1IKMA 1E22A 2NZHA 2K7VA 3ERQA 3D0FA 3OSOA 1M90C 1R9TB 2Z0SA 2DNCA 3HOXH 2JN4A 4MIUA 3GV3A 2N88A 3D4DA 3AMUA 4B3ML 4JI1L 4I7ZC 5KYLA 1PTOF 3OTOL 2NVTB 3PO2H 5C4ZA 4NW2A 2PI2A 4K8JA 2HD3A 3KLRA 3VYUA 4AYBE 5JJLA 1O80A 3EA6A 3HKZE 4UP9A 2R92H 4JV5L 5JAVA 4JYAQ 1RDPD 4X65L 3BG3A 2Z4HA 1RCVD 2AKWB 1GJXA 4LF8Q 3MEHA 1B70B 4LUZA 5EQ0A 3K59A 4A3BH 4WRDA 1K83H 2UUBQ 1LTRD 1WTHA 4GN4B 3ITPA 1MD2D 4XI8A 3G6JB 2I07B 3T1YL 1TVXA 3EIVA 5FO8B 1NH1A 4DR2Q 3Q8DA 2UXDQ 2NZ1D 2K5QA 4DR7Q 1A2TA 2F3VA 3OOCA 2I5MX 2LXJA 3D31A 4PZ8A 2PQAB 4ZYSA 2DN8A 5IYCG 2E2HB 1RKNA 2ZXRA 2E8GA 3T53B 3JAMi 2WKCA 3CU7A 3CQZB 2G5DA 3R8BA 1A3UA 3DMUA 3M7GA 2Y0SG 4IQZA 1DONA 3EROA 2WAQE 1E0BA 2Q2IA 2ZXPA 1QUQB 3HOYB 1G6PA 4RCOA 1STGA 3FP9A 2K52A 3J80i 3UDXA 4OO1H 1F2LA 4DGZA 4A4IA 2B8FA 1I4GA 3KF8B 3MTSA 3QOJA 3H3VC 4OXPA 5C3EG 4A3LH 4IUQA 1LT4D 3GTJH 1LTID 4K5XA 4KHVA 1Y69U 2AQ3B 1FR3A 3QJYA 1B9NA 2HCCA 3AFQA 4A3DB 1HPCA 3W5OA 1SE2A 3DM1A 3E5SA 1H9KA 2KEEA 1HTPA 1F9RA 1GO3E 1MIUA 5M9OA 5CGLA 1W6KA 1YI2A 2BA1A 2DY8A 2K32A 1PH2A 1HCZA 4JW0A 3S15H 1E2WA 3IAYA 1KAWA 4K0KQ 3E9HA 1LT6D 5K5PA 1GKHA 2K50A 3QB3A 1TIID 4B9XA 4DAYB 4A3EH 4OELB 5CV4A 2SNMA 4CDEC 4F8MA 5FLMH 3SK6A 1CHPD 2N3SA 3CRLC 3CRKC 3H0GH 4BBRH 4FXDA 1I4PA 2CW0C 1HZAA 1X3EA 3PIOA 4FYDA 4ZKCB 4RGMA 1OXUA 4JI8Q 2XWBB 3MFYA 2OTJA 4ULLA 3R93A 1KD1C 2WB1G 3WDNA 3BZKA 4DXFA 2NVXB 1J6QA 3KLSX 5BN3A 2OTLA 4QB4A 3S17H 1Q3LA 3NPPA 4GN5A 1PTOH 2IHFA 4C2MB 2JP1A 3F2CA 3JAML 1O78A 2PYKA 2L55A 3D3RA 1HQRD 2JJQA 5A2QL 1V43A 3D4RA 5DNFA 2PQEA 4A3CG 1VQFA 2D62A 4H02A 2EXZA 2NVQB 1QZHA 1TS3A 4I65A 1BKBA 2B2YA 4KN4C 3OW2A 5KNBA 1WFQA 4RHSA 3J80L 3ZCBA 3QOLA 3NBHB 4KY6A 2RDHA 1HA6A 1W6JA 1VQIA 5IE8A 1X6OA 1BCPB 3RZDH 5GQOA 4Y52H 2K6AA 1V1PB 2BDOA 5AJ3L 4RMFA 1OXXK 2X69A 1Q8IA 1MI2A 3STBD 1PH4A 4BY1G 5C0XI 4P72A 2B2UC 4H7BA 5C0XG 5DLQE 2BOSA 1PLFA 3MXPA 1CKNB 4JCVE 4CDCC 2IJ0A 5GAEC 4IOCA 4DR6Q 3QIAA 1ESRA 2PW5A 4K14A 2F52A 4WJ3M 2A19A 1Q46A 1TS4A 3OW7A 4MTKA 3HZXA 1MJCA 5CORA 5ELBA 3HOZH 3SHLA 2G9HD 1JJCB 1VQAA 2TMPA 1KAAA 2HQLA 5T1IA 5EPLA 4GKJL 1XNRQ 1I4HA 1DGSA 3SN9A 4LMQD 4JBKA 5C4XB 4HAEA 1CUKA 1WI5A 3WWVA 1HZCA 2JA5G 5JJ7A 1DM0B 4A3IH 2FJ2A 2Y0SB 2ZJQA 1VQEA 4DV5Q 3SHGA 3CCMA 2ZT9C 3CF5A 1PRTC 5ELOA 4IPDA 2ID0A 2OWOA 4C3IH 3IL8A 4X3UA 1TWHH 1NUCA 4BA1I 2UU9L 2GA4B 1BNZA 2K03A 1PFBA 1SYGA 2L4NA 1SAPA 2PO4A 3KYHC 4FF2A 1VQBA 3HOVG 1PV4A 5C3EB 5I6WA 3BS1A 1D2BA 1SNPA 3U50C 5CGKA 4A3FG 1QZGA 2R7FA 1AE3A 1F9QA 4IJLA 1IL8A 1NMFA 2F0QA 1XTCD 2K04A 3I4MH 3NUCA 1D5MC 2CQOA 2EIFA 1C4QA 2F0WA 1M4VA 4LAAA 4J15A 5FOBB 4XT3B 4NP5A 1A8VA 5C3XA 1F2MA 4R9WA 2LXKA 1DXMA 2A1AA 4XYQA 2HDLA 5EJWA 1DD2A 3U4ZA 3KLWA 2EOTA 1ENAA 1SYEA 2SNSA 1Y1VH 1SE4A 2AUKA 4HIOA 2Q8IB 1S40A 2LSSA 3VYTA 2CH4A 1I3QB 1LT3D 2LS01 1U9RA 1EWHA 4UHVA 4U04A 5C6AA 4WJ4A 1SE8A 2EPBA 4Y7NB 4DR6L 1TU2B 1SFOB 1JB3A 2RF4A 2WB1B 2IX1A 4DF7A 1GUSA 4H44C 5GROA 2BE5C 4C3HG 2PW7A 1TWFB 3GV6A 3PSIA 1YNJC 2H4OA 3A7LA 1X3GA 2OXPA 3VR4A 3K8AA 3ND9A 3C1FA 1XNRL 1VQPA 1SYDA 2EY5A 1HUNA 2BH8A 1MBYA 1UEAB 4X3KA 1VQKA 3A74A 4DV5L 5JOBA 1IW7C 1UE6A 4XT1B 3FPUB 4GNXB 3GTKH 2ATWA 1JE4A 5KIXA 3HKZG 5EBDA 3ULLA 2HIVA 1N34Q 2JSOA 1A2UA 3BYYB 2LFNA 4U0ZA 3RLNA 4DV2Q 3I4OA 1ASYA 1ONLA 4YHHQ 4XYOA 4X2CA 2XTIA 5IY0A 3I4NH 1GUTA 1MHWC 4GLVB 4FP5D 1TWCB 3HP3A 1D8LA 4HCSA 5EAYA 1HZ9A 2BDNA 1CFMA 2IX0A 4DV0Q 4BY1B 3S1RB 5JJ6A 4KY5A 3JAME 4LK1C 2VL6A 4EGVA 5A2QE 3G48A 3TN2A 5BR8Q 4DAPA 2JE6I 4X64Q 3NK9A 3D4WA 1G2SA 1SYBA 3HG9A 3KUPA 4UP8A 2FHTA 2YYZA 1F2YA 4DV1Q 3I4LA 4GNXA 1XMOQ 1B9MA 1EY7A 5M5XB 3S1MH 4RWSC 3S2HH 3H94A 2R6GA 1R4QB 4CDFC 4R8NA 4X62L 1I6VC 2Q8TA 1S4ZA 1VQ8A 2Q2TA 2WP8J 2RKSA 1TKWB
chains in the Genus database with same CATH topology
1C9OA 3CAMA 4DK3C 4POFA 4HIDA 1YNXA 4BA2I 3PIPA 5M3FH 3AFPA 2R7DA 1IYJB 3ZLMA 4PMWA 4BBSG 3UE0A 3U4VA 3KJPA 1XMQQ 2WAQG 3CUCA 2C35B 5M5XH 2BH2A 5EU0A 1PYSB 2GVBA 5C0XJ 1Q8KA 4PG3A 1E1OA 2ASBA 1P8LA 1QUQA 3GTQH 4LUVA 4L5SA 5C44H 1SR3A 4JI6L 1K3RA 3L7ZC 1Y1VG 4XIGS 3KF6A 1TXYA 1Y14B 1O7IA 3HOUG 1EQRA 2JQOA 1GM5A 4JBMA 1YHBA 2IY5B 4R4IA 2JEAI 4QY7A 4DR5Q 4GKJQ 1SROA 2UXBQ 3TS0A 1MKHA 1VQDA 4IFDI 1KHIA 2YTVA 3PO3G 3M9BA 1N33Q 2MO1A 4LF6L 3NELA 3UDIA 2UUCL 5IP7G 2B63H 3JC66 3S6AA 3B6YA 3HFZB 5JEAG 3J81i 4JI2L 4ME3A 4JI4L 3CW2C 5ELNA 4A3GG 3L0OA 1E22A 2UUAL 2NZHA 5FJ8G 1KRTA 3D0FA 3E0EA 4PZ7A 1M90C 2QA4A 2MQHA 2Z0SA 3HOXH 1YJWA 2KHIA 3KOJA 1EWIA 1UE7A 1Q12A 3T1HL 4DR4Q 4B3SL 3RLOA 4B3ML 4JI1L 1FVIA 3CPWA 2VQFL 2E5LQ 5JFFA 2CFMA 3H3VH 2UU9Q 4LF4Q 3OTOL 3FKIG 4GNXC 4DR1L 3PO2H 2Q2HA 4A3MH 2PI2A 3HOVH 5HGQA 2ZM6Q 2DGYA 1EIYB 5GAHC 1TWGH 4IPHA 4AYBE 5JJLA 1IL2A 2JA9A 4A3FH 1XPOA 3HKZE 4UP9A 1A63A 2YV5A 3HOWH 2R92H 4JV5L 4JYAQ 1JMCA 3J81j 4X65L 1NY4A 4JOIC 2AKWB 4LF8Q 1B70B 4LUZA 4Y7NH 4DV2L 2VZAA 3PUWA 2JA8G 2R93G 1RL2A 1L2FA 4YHHL 4TQUS 1SFOH 4A3BH 4OWTB 1AH9A 4FDBA 4LNQA 1K83H 1EFWA 2UUBQ 4C3JH 4JI0Q 4GN4B 4XI8A 1UWVA 1L1OC 3CMEA 4DR3Q 1JB7A 1HNWQ 3T1YL 1I50H 1G51A 3EIVA 2K14A 4KLKA 5GADC 3PUYA 3CCRA 1YJNA 1KRSA 3Q8DA 4IJHA 5FLXc 4DR2Q 2UXDQ 4DR7Q 1XTDA 5M3MH 2CKZB 2I5MX 1Q81C 2LXJA 4U0UA 3D31A 4PZ8A 4QQBX 5BR8L 1PH5A 2PQAB 1VQ7A 4YWKA 3W1GA 5IYCG 1U0LA 3STBC 4HJ5A 1VQHA 2WFWA 4LFAL 2E8GA 3CCUA 2VY3A 4DV6Q 1XMOL 2I5HA 1A62A 4OONA 5CKLA 3GD7A 3JAMi 3GO5A 4LFCQ 2N8NA 1VQ9A 4NPSA 1X55A 1UE1A 1X3FA 1QVCA 4A3KG 1PH6A 4NXML 3GDEA 1HNWL 4DAMA 3H15A 2Y0SG 5IYDG 4HJ9A 2E2HH 4JI3Q 2JA6H 2F4VQ 2K5VA 4JG2A 4R4TA 4C3HH 3AQQA 4R4CA 5IYBH 3KJOA 4HIMA 2WAQE 2Q2IA 3NENA 1K73C 1I94Q 4LW1A 1QUQB 3RNUA 1G6PA 1S3OA 1XMQL 4DV7L 3FP9A 3KF6B 2KCTA 2K52A 3J80i 3UDXA 1QVFA 4EX5A 4XTCS 3S1QH 1PH1A 2HHHL 1EOVA 1VQ5A 4A4IA 1TWCH 3MXNB 1IBML 4WGJA 3KF8B 4YWMA 5C44G 3ULPA 3J81c 4BY1H 4OX9L 1X9NA 4OXPA 3UDGA 3UDFA 3K7AH 4DR5L 5C3EG 4GKKL 4BY7G 4A3LH 2ZTCA 3I4MG 4B3RQ 2UXBL 4MZ9A 1Q7YC 4DKAC 3GTJH 3BJUA 5E7NA 3CCEA 1C0AA 1GD7A 1S72A 2F3IA 4U0SA 1Q82C 1A0IA 1WYDA 1V1QA 5CMTA 4QL5A 3AFQA 2N49A 1SLJA 4P71A 1K0RA 1VS0A 1N36Q 3W5OA 4IOAA 1YITA 1PHJA 3AEVA 3ZC7A 1CKNA 3U58A 1GO3E 1MIUA 1XPUA 2D0PA 3J7A5 1H95A 5CGLA 1YI2A 2BA1A 2GVAA 5H1SE 4B3TQ 3E9IA 1BBUA 1PH2A 2AWOA 1B8AA 5JJKA 3S15H 4RG1A 4JBWA 1N32Q 4UY8C 1KAWA 1Q1BA 4A3JG 3F1ZA 4A3DH 4K0KQ 2ZM6L 3E9HA 3L2PA 1PFSA 4N67A 4YCVA 1IBKQ 1GKHA 5HY6A 2K50A 3A0JA 2QGQA 4HJ8A 1WCMG 3PO2G 4DAYB 4KHPQ 4A3EH 3A5ZB 2MNAA 1NJIC 2JA5H 1GVPA 1PYBA 1XJVA 5FLMH 1SRUA 4GOPA 3AYHB 2N3SA 4BBRH 3H0GH 2Q2UA 3LGJA 1CSPA 2K75A 2VQEQ 1KQSA 4LFBQ 1HZAA 1X3EA 3PIOA 4DUYL 1Z47A 4HJ7A 1W3SA 4AQYQ 1HNXQ 1HR0L 4BXXH 1JJ2A 1OXUA 5LMNL 5IP9H 3G4SA 1IBLQ 4JI8Q 3CC2A 2Z6KC 3DM3A 4QIWE 4POGA 1XNQQ 2JA7H 3F8TA 1V9PA 4A3BG 2OTJA 1SMXA 1VQJA 1Y1WH 1KD1C 1NTGA 2WB1G 4X6AH 3VDYA 2DUDA 3LETA 3BZKA 4L5QA 3ULJA 4DV4L 1J6QA 2CWPA 2XGTA 5IWAL 1HNZL 2MO0A 2OTLA 1YHQA 2K5HA 3S17H 4GN5A 1R9TH 4BBSH 2IHFA 3ICEA 2F6SA 4X62Q 4MNOA 2EXDA 4DNIA 4MTNA 4UPAA 3JAMc 3F2CA 3GTMH 2ZTEA 4IPCA 2E2JH 1KXLA 2RCNA 2I5LX 3ZJYC 3KDFB 4JI5Q 5C4JH 1N34L 2NVXH 2JJQA 4EQ5A 3UE1A 1V43A 3CCJA 2NVTH 4A3CG 1VQFA 2D62A 4H02A 1AE2A 4LFCL 1Q86C 2R7ZH 5JJIA 3CXCA 2Y0SE 1QZHA 4JI6Q 4C2MH 1BKBA 3PF5A 1PH7A 2K4KA 2CWAA 4JI3L 2NZOA 3OW2A 1IZ6A 1YJ9A 1NBWA 3I56A 3J80c 1WFQA 3M4PA 3M4QA 4DPGA 4DV3Q 1I94L 3I4NG 4NXNL 5IP7H 4DV0L 2JA6G 5LMUL 4A3GH 2NVYH 3RN2A 3ZCBA 3NBHB 4GLXA 1X54A 4JI7L 1FJGQ 5FJ8H 1RIPA 2NVQH 1B7YB 2UUCQ 2PNHA 1VQIA 5IT9c 1D7QA 3CC7A 5IE8A 4JI2Q 4OWXB 1X6OA 2KENA 4X64L 2KHJA 4LF7Q 3RZDH 4P74A 5GQOA 2UUAQ 4Y52H 4R4QA 5AJ3L 4DV1L 4RMFA 1UE5A 1VQ4A 1OXXK 4IFDJ 1QVGA 4OWWB 4JBJA 5JEAJ 2H5XA 3FKIH 2UXCQ 1OXVA 3STBD 3OYYA 3KDFA 3T1HQ 2NN6I 1PH4A 4B3SQ 4BY1G 5C0XI 1JE5A 4B3MQ 4P72A 2A8VA 2NN6G 1N8RC 1K8AC 4A3LG 5C0XG 4L5TA 4KI0A 2JK8A 3I2ZA 5DLQE 3K7UC 3OTOQ 3CPFA 2PMZE 4DR1Q 1CKNB 4JCVE 3PV0A 4IOCA 3EN2A 5GAEC 4YWLA 4LF9Q 1X65A 3S1NH 1Z9FA 4DR6Q 1N9WA 3F2BA 2VUMG 4UP7A 4X66Q 4IFDG 2B3GA 1VQOA 4LF5Q 3CP0A 2F52A 4AYBG 3CQZH 1HH2P 2A19A 1Q46A 2HIXA 5M3FG 4JV5Q 4WJ3M 1LYLA 3TQYA 2QEXA 2ES2A 4B3TL 2R93H 4X65Q 1I5FA 1E24A 1MJCA 2OCEA 3IRBA 4KHZA 2V1CC 3HOZH 1IBKL 1JJCB 1VQAA 2ALYB 3M85A 3DLLA 4DUZQ 4GOPB 3HOYH 2HQLA 2KBNA 1T9HA 4KHPL 1YZ6A 4GKJL 2AWNA 2ZJPA 1XNRQ 1XPRA 1N33L 1DGSA 4ITRA 3SN9A 3S2DH 4X2EA 4JBKA 3I7FA 3TEHB 3T1YQ 1CUKA 2L15A 1WI5A 3WWVA 1HZCA 3G71A 4A3EG 1HR0W 5JJ7A 4O0AA 2VQEL 4A3IH 2JA5G 5LMNW 4LFBL 5FLMG 2ZJQA 2B63G 1VQEA 4AQYL 4DV5Q 2IHEA 4BBRG 3SHGA 3CCQA 4R4OA 1KIXA 1SN8A 3CCMA 1XNQL 3CF5A 2WB1E 4PZ6A 5ELOA 4IPDA 4DR4L 2ID0A 2OWOA 4C3IH 4BXXG 5C4XH 3J7ZC 1TWHH 2E5LL 1L0WA 4BA1I 2N78A 1VQ6A 4GKKQ 4A3KH 3HOXG 2UU9L 4LF4L 2JA7G 2HT1A 2OQKA 3H3VI 1Y1WG 1EUJA 3GTGH 2FXQA 3EBEA 3TREA 4NXMQ 4A93H 3KYHC 3FHWA 4LUOA 4A3MG 1VQBA 3HOVG 4LU4A 4TVAB 1PV4A 4M16A 1HJPA 4JYAL 4A75A 1LM0A 4JI5L 4JOIA 3U50C 3G6EA 4A3FG 1MJEA 1E1TA 1G291 1QZGA 1K9MC 1VQGA 2R7FA 4DV7Q 2I0QA 3PF4A 4LWCA 4LF8L 3HOWG 3CCVA 2R92G 1AE3A 4YY3Q 4APVA 4IJLA 1PH8A 2UUBL 2YTXA 3RZOH 4JI0L 1L1OA 2HHHQ 1NMFA 3BU2A 2JEBI 3M3YH 1IBMQ 5C3EH 4BY7H 4DR3L 1YIJA 4HJAA 2CQOA 3I4MH 2R7ZG 4DV3L 2EIFA 3CMAA 1YVCA 1ASZA 4J15A 4OX9Q 4DR2L 1YEZA 1VQNA 1A8VA 1FJGL 3I55A 3W1BA 4DK6C 3TRZA 4DR7L 3ER0A 1W2BA 2UXDL 1PH9A 3PUXA 2BA0A 2RHQB 1J5EQ 2LXKA 5K36G 4LF7L 1YHAA 2A1AA 1KC8C 4JC0A 5M3MG 2MFIA 1OXTA 3CC4A 3K0XA 3PUZA 5J3BA 3U4ZA 4ALPA 4DV6L 1C7YA 1PVOA 1WJJA 3KLWA 2UXCL 1NE3A 1Y1VH 2IT1A 3KFUA 2K5NA 1VQLA 4HIOA 4A3JH 3HOUH 1S40A 2LSSA 4P75A 3S14H 3SE5A 4AIMA 1WCMH 4U04A 1WOCA 2RHSB 3K81C 4LF9L 1SE8A 4DR6L 4WJ4A 2F4VL 3PO3H 3CD6A 5M5WH 2RF4A 2YTYA 4X66L 1KL9A 3PCOB 3SGIA 1E7ZA 2IX1A 4LF5L 3RLFA 1BVSA 5GROA 5IYBG 3S24A 4U07A 1U5KA 1I3QH 1HZBA 1CKMA 4LF6Q 3PSIA 4JI4Q 4R1JA 4GOPC 1LUZA 4OO1I 1X3GA 1FGUA 1YBYA 1IXRA 4X2DA 4DUYQ 3K8AA 3GTOH 4OO1G 2VNUD 1HR0Q 4O2DA 4DUZL 3M4OH 5LMNQ 3PUVA 4GLAC 4AH6A 1XNRL 3N3UA 3HOZG 4B3RL 2ZTDA 1VQPA 1TWFH 2AMCB 2D0OA 1CKOA 4YCUA 3HOYG 4JI1Q 3PGZA 2VQFQ 3CCLA 2PI2E 4DV4Q 2BH8A 5GAGC 5IWAQ 3A5UA 1HNZQ 2G03A 1VQKA 1NMGA 3A74A 4L5RC 4DV5L 1M1KC 1N36L 4PY3A 1UE6A 5M5YH 4A3IG 4NB3A 1CSQA 4GNXB 3GTKH 2ATWA 1PA6A 1UEBA 4A3CH 4GN3B 1JJGA 2EQSA 3HKSA 3RR5A 3HKZG 1VCIA 3ERSX 3ULLA 4A76A 2JA8H 2HIVA 3CCSA 1N34Q 1VQMA 1N32L 4HIKA 1K8GA 2KCMA 2GN5A 4K0KL 4U0ZA 3RLNA 4DV2Q 3I4OA 5C4XG 1ASYA 1PH3A 1JT8A 4YHHQ 4X2CA 3S16H 2VW9A 2XTIA 5IY0A 3I4NH 3K80C 4GLVB 5JFZA 3M7NA 3TS2A 4A3DG 1D8LA 5EAYA 1HZ9A 2E2IH 2OQ0A 4A93G 4NXNQ 3GTPH 4P73A 2IX0A 4DV0Q 2B29A 5LMUQ 3NEMA 4QGUA 5JJ6A 4JI7Q 1BBWA 4QJFA 1L1OB 5IYCH 1P16A 4YY3L 1HNXL 2VL6A 1OTCA 1EQQA 2CCZA 3H0GG 3G48A 1Q1EA 2Z6KA 5BR8Q 1IBLL 2JE6I 4JI8L 4X64Q 1EIFA 2YU9H 3RN5A 1X56A 2ZJRA 1I6HH 1OXSC 3MEFA 1TWAH 2PQAA 4LFAQ 1EYGA 5AJ3Q 4DV1Q 4UP8A 1LTLA 1VQCA 2YYZA 4GNXA 5IP9G 3S1RH 1XMOQ 2VS1A 4YCWA 3F2DA 1FL0A 5IYDH 3GTLH 3S1MH 2AHOB 3BZCA 3S2HH 2R6GA 4GS3A 1J5EL 4IPGA 4IO9A 4X62L 2VUMH 1E3PA 1VQ8A 2Q2TA 2WP8J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C9O A;  3CAM A;  4DK3 C;  4POF A;  4HID A;  1YNX A;  4BA2 I;  3PIP A;  5M3F H;  3AFP A;  2R7D A;  1IYJ B;  3ZLM A;  4PMW A;  4BBS G;  3UE0 A;  3U4V A;  3KJP A;  1XMQ Q;  2WAQ G;  3CUC A;  2C35 B;  5M5X H;  2BH2 A;  5EU0 A;  1PYS B;  2GVB A;  5C0X J;  1Q8K A;  4PG3 A;  1E1O A;  2ASB A;  1P8L A;  1QUQ A;  3GTQ H;  4LUV A;  4L5S A;  5C44 H;  1SR3 A;  4JI6 L;  1K3R A;  3L7Z C;  1Y1V G;  4XIG S;  3KF6 A;  1TXY A;  1Y14 B;  1O7I A;  3HOU G;  1EQR A;  2JQO A;  1GM5 A;  4JBM A;  1YHB A;  2IY5 B;  4R4I A;  2JEA I;  4QY7 A;  4DR5 Q;  4GKJ Q;  1SRO A;  2UXB Q;  3TS0 A;  1MKH A;  1VQD A;  4IFD I;  1KHI A;  2YTV A;  3PO3 G;  3M9B A;  1N33 Q;  2MO1 A;  4LF6 L;  3NEL A;  3UDI A;  2UUC L;  5IP7 G;  2B63 H;  3JC6 6;  3S6A A;  3B6Y A;  3HFZ B;  5JEA G;  3J81 i;  4JI2 L;  4ME3 A;  4JI4 L;  3CW2 C;  5ELN A;  4A3G G;  3L0O A;  1E22 A;  2UUA L;  2NZH A;  5FJ8 G;  1KRT A;  3D0F A;  3E0E A;  4PZ7 A;  1M90 C;  2QA4 A;  2MQH A;  2Z0S A;  3HOX H;  1YJW A;  2KHI A;  3KOJ A;  1EWI A;  1UE7 A;  1Q12 A;  3T1H L;  4DR4 Q;  4B3S L;  3RLO A;  4B3M L;  4JI1 L;  1FVI A;  3CPW A;  2VQF L;  2E5L Q;  5JFF A;  2CFM A;  3H3V H;  2UU9 Q;  4LF4 Q;  3OTO L;  3FKI G;  4GNX C;  4DR1 L;  3PO2 H;  2Q2H A;  4A3M H;  2PI2 A;  3HOV H;  5HGQ A;  2ZM6 Q;  2DGY A;  1EIY B;  5GAH C;  1TWG H;  4IPH A;  4AYB E;  5JJL A;  1IL2 A;  2JA9 A;  4A3F H;  1XPO A;  3HKZ E;  4UP9 A;  1A63 A;  2YV5 A;  3HOW H;  2R92 H;  4JV5 L;  4JYA Q;  1JMC A;  3J81 j;  4X65 L;  1NY4 A;  4JOI C;  2AKW B;  4LF8 Q;  1B70 B;  4LUZ A;  4Y7N H;  4DV2 L;  2VZA A;  3PUW A;  2JA8 G;  2R93 G;  1RL2 A;  1L2F A;  4YHH L;  4TQU S;  1SFO H;  4A3B H;  4OWT B;  1AH9 A;  4FDB A;  4LNQ A;  1K83 H;  1EFW A;  2UUB Q;  4C3J H;  4JI0 Q;  4GN4 B;  4XI8 A;  1UWV A;  1L1O C;  3CME A;  4DR3 Q;  1JB7 A;  1HNW Q;  3T1Y L;  1I50 H;  1G51 A;  3EIV A;  2K14 A;  4KLK A;  5GAD C;  3PUY A;  3CCR A;  1YJN A;  1KRS A;  3Q8D A;  4IJH A;  5FLX c;  4DR2 Q;  2UXD Q;  4DR7 Q;  1XTD A;  5M3M H;  2CKZ B;  2I5M X;  1Q81 C;  2LXJ A;  4U0U A;  3D31 A;  4PZ8 A;  4QQB X;  5BR8 L;  1PH5 A;  2PQA B;  1VQ7 A;  4YWK A;  3W1G A;  5IYC G;  1U0L A;  3STB C;  4HJ5 A;  1VQH A;  2WFW A;  4LFA L;  2E8G A;  3CCU A;  2VY3 A;  4DV6 Q;  1XMO L;  2I5H A;  1A62 A;  4OON A;  5CKL A;  3GD7 A;  3JAM i;  3GO5 A;  4LFC Q;  2N8N A;  1VQ9 A;  4NPS A;  1X55 A;  1UE1 A;  1X3F A;  1QVC A;  4A3K G;  1PH6 A;  4NXM L;  3GDE A;  1HNW L;  4DAM A;  3H15 A;  2Y0S G;  5IYD G;  4HJ9 A;  2E2H H;  4JI3 Q;  2JA6 H;  2F4V Q;  2K5V A;  4JG2 A;  4R4T A;  4C3H H;  3AQQ A;  4R4C A;  5IYB H;  3KJO A;  4HIM A;  2WAQ E;  2Q2I A;  3NEN A;  1K73 C;  1I94 Q;  4LW1 A;  1QUQ B;  3RNU A;  1G6P A;  1S3O A;  1XMQ L;  4DV7 L;  3FP9 A;  3KF6 B;  2KCT A;  2K52 A;  3J80 i;  3UDX A;  1QVF A;  4EX5 A;  4XTC S;  3S1Q H;  1PH1 A;  2HHH L;  1EOV A;  1VQ5 A;  4A4I A;  1TWC H;  3MXN B;  1IBM L;  4WGJ A;  3KF8 B;  4YWM A;  5C44 G;  3ULP A;  3J81 c;  4BY1 H;  4OX9 L;  1X9N A;  4OXP A;  3UDG A;  3UDF A;  3K7A H;  4DR5 L;  5C3E G;  4GKK L;  4BY7 G;  4A3L H;  2ZTC A;  3I4M G;  4B3R Q;  2UXB L;  4MZ9 A;  1Q7Y C;  4DKA C;  3GTJ H;  3BJU A;  5E7N A;  3CCE A;  1C0A A;  1GD7 A;  1S72 A;  2F3I A;  4U0S A;  1Q82 C;  1A0I A;  1WYD A;  1V1Q A;  5CMT A;  4QL5 A;  3AFQ A;  2N49 A;  1SLJ A;  4P71 A;  1K0R A;  1VS0 A;  1N36 Q;  3W5O A;  4IOA A;  1YIT A;  1PHJ A;  3AEV A;  3ZC7 A;  1CKN A;  3U58 A;  1GO3 E;  1MIU A;  1XPU A;  2D0P A;  3J7A 5;  1H95 A;  5CGL A;  1YI2 A;  2BA1 A;  2GVA A;  5H1S E;  4B3T Q;  3E9I A;  1BBU A;  1PH2 A;  2AWO A;  1B8A A;  5JJK A;  3S15 H;  4RG1 A;  4JBW A;  1N32 Q;  4UY8 C;  1KAW A;  1Q1B A;  4A3J G;  3F1Z A;  4A3D H;  4K0K Q;  2ZM6 L;  3E9H A;  3L2P A;  1PFS A;  4N67 A;  4YCV A;  1IBK Q;  1GKH A;  5HY6 A;  2K50 A;  3A0J A;  2QGQ A;  4HJ8 A;  1WCM G;  3PO2 G;  4DAY B;  4KHP Q;  4A3E H;  3A5Z B;  2MNA A;  1NJI C;  2JA5 H;  1GVP A;  1PYB A;  1XJV A;  5FLM H;  1SRU A;  4GOP A;  3AYH B;  2N3S A;  4BBR H;  3H0G H;  2Q2U A;  3LGJ A;  1CSP A;  2K75 A;  2VQE Q;  1KQS A;  4LFB Q;  1HZA A;  1X3E A;  3PIO A;  4DUY L;  1Z47 A;  4HJ7 A;  1W3S A;  4AQY Q;  1HNX Q;  1HR0 L;  4BXX H;  1JJ2 A;  1OXU A;  5LMN L;  5IP9 H;  3G4S A;  1IBL Q;  4JI8 Q;  3CC2 A;  2Z6K C;  3DM3 A;  4QIW E;  4POG A;  1XNQ Q;  2JA7 H;  3F8T A;  1V9P A;  4A3B G;  2OTJ A;  1SMX A;  1VQJ A;  1Y1W H;  1KD1 C;  1NTG A;  2WB1 G;  4X6A H;  3VDY A;  2DUD A;  3LET A;  3BZK A;  4L5Q A;  3ULJ A;  4DV4 L;  1J6Q A;  2CWP A;  2XGT A;  5IWA L;  1HNZ L;  2MO0 A;  2OTL A;  1YHQ A;  2K5H A;  3S17 H;  4GN5 A;  1R9T H;  4BBS H;  2IHF A;  3ICE A;  2F6S A;  4X62 Q;  4MNO A;  2EXD A;  4DNI A;  4MTN A;  4UPA A;  3JAM c;  3F2C A;  3GTM H;  2ZTE A;  4IPC A;  2E2J H;  1KXL A;  2RCN A;  2I5L X;  3ZJY C;  3KDF B;  4JI5 Q;  5C4J H;  1N34 L;  2NVX H;  2JJQ A;  4EQ5 A;  3UE1 A;  1V43 A;  3CCJ A;  2NVT H;  4A3C G;  1VQF A;  2D62 A;  4H02 A;  1AE2 A;  4LFC L;  1Q86 C;  2R7Z H;  5JJI A;  3CXC A;  2Y0S E;  1QZH A;  4JI6 Q;  4C2M H;  1BKB A;  3PF5 A;  1PH7 A;  2K4K A;  2CWA A;  4JI3 L;  2NZO A;  3OW2 A;  1IZ6 A;  1YJ9 A;  1NBW A;  3I56 A;  3J80 c;  1WFQ A;  3M4P A;  3M4Q A;  4DPG A;  4DV3 Q;  1I94 L;  3I4N G;  4NXN L;  5IP7 H;  4DV0 L;  2JA6 G;  5LMU L;  4A3G H;  2NVY H;  3RN2 A;  3ZCB A;  3NBH B;  4GLX A;  1X54 A;  4JI7 L;  1FJG Q;  5FJ8 H;  1RIP A;  2NVQ H;  1B7Y B;  2UUC Q;  2PNH A;  1VQI A;  5IT9 c;  1D7Q A;  3CC7 A;  5IE8 A;  4JI2 Q;  4OWX B;  1X6O A;  2KEN A;  4X64 L;  2KHJ A;  4LF7 Q;  3RZD H;  4P74 A;  5GQO A;  2UUA Q;  4Y52 H;  4R4Q A;  5AJ3 L;  4DV1 L;  4RMF A;  1UE5 A;  1VQ4 A;  1OXX K;  4IFD J;  1QVG A;  4OWW B;  4JBJ A;  5JEA J;  2H5X A;  3FKI H;  2UXC Q;  1OXV A;  3STB D;  3OYY A;  3KDF A;  3T1H Q;  2NN6 I;  1PH4 A;  4B3S Q;  4BY1 G;  5C0X I;  1JE5 A;  4B3M Q;  4P72 A;  2A8V A;  2NN6 G;  1N8R C;  1K8A C;  4A3L G;  5C0X G;  4L5T A;  4KI0 A;  2JK8 A;  3I2Z A;  5DLQ E;  3K7U C;  3OTO Q;  3CPF A;  2PMZ E;  4DR1 Q;  1CKN B;  4JCV E;  3PV0 A;  4IOC A;  3EN2 A;  5GAE C;  4YWL A;  4LF9 Q;  1X65 A;  3S1N H;  1Z9F A;  4DR6 Q;  1N9W A;  3F2B A;  2VUM G;  4UP7 A;  4X66 Q;  4IFD G;  2B3G A;  1VQO A;  4LF5 Q;  3CP0 A;  2F52 A;  4AYB G;  3CQZ H;  1HH2 P;  2A19 A;  1Q46 A;  2HIX A;  5M3F G;  4JV5 Q;  4WJ3 M;  1LYL A;  3TQY A;  2QEX A;  2ES2 A;  4B3T L;  2R93 H;  4X65 Q;  1I5F A;  1E24 A;  1MJC A;  2OCE A;  3IRB A;  4KHZ A;  2V1C C;  3HOZ H;  1IBK L;  1JJC B;  1VQA A;  2ALY B;  3M85 A;  3DLL A;  4DUZ Q;  4GOP B;  3HOY H;  2HQL A;  2KBN A;  1T9H A;  4KHP L;  1YZ6 A;  4GKJ L;  2AWN A;  2ZJP A;  1XNR Q;  1XPR A;  1N33 L;  1DGS A;  4ITR A;  3SN9 A;  3S2D H;  4X2E A;  4JBK A;  3I7F A;  3TEH B;  3T1Y Q;  1CUK A;  2L15 A;  1WI5 A;  3WWV A;  1HZC A;  3G71 A;  4A3E G;  1HR0 W;  5JJ7 A;  4O0A A;  2VQE L;  4A3I H;  2JA5 G;  5LMN W;  4LFB L;  5FLM G;  2ZJQ A;  2B63 G;  1VQE A;  4AQY L;  4DV5 Q;  2IHE A;  4BBR G;  3SHG A;  3CCQ A;  4R4O A;  1KIX A;  1SN8 A;  3CCM A;  1XNQ L;  3CF5 A;  2WB1 E;  4PZ6 A;  5ELO A;  4IPD A;  4DR4 L;  2ID0 A;  2OWO A;  4C3I H;  4BXX G;  5C4X H;  3J7Z C;  1TWH H;  2E5L L;  1L0W A;  4BA1 I;  2N78 A;  1VQ6 A;  4GKK Q;  4A3K H;  3HOX G;  2UU9 L;  4LF4 L;  2JA7 G;  2HT1 A;  2OQK A;  3H3V I;  1Y1W G;  1EUJ A;  3GTG H;  2FXQ A;  3EBE A;  3TRE A;  4NXM Q;  4A93 H;  3KYH C;  3FHW A;  4LUO A;  4A3M G;  1VQB A;  3HOV G;  4LU4 A;  4TVA B;  1PV4 A;  4M16 A;  1HJP A;  4JYA L;  4A75 A;  1LM0 A;  4JI5 L;  4JOI A;  3U50 C;  3G6E A;  4A3F G;  1MJE A;  1E1T A;  1G29 1;  1QZG A;  1K9M C;  1VQG A;  2R7F A;  4DV7 Q;  2I0Q A;  3PF4 A;  4LWC A;  4LF8 L;  3HOW G;  3CCV A;  2R92 G;  1AE3 A;  4YY3 Q;  4APV A;  4IJL A;  1PH8 A;  2UUB L;  2YTX A;  3RZO H;  4JI0 L;  1L1O A;  2HHH Q;  1NMF A;  3BU2 A;  2JEB I;  3M3Y H;  1IBM Q;  5C3E H;  4BY7 H;  4DR3 L;  1YIJ A;  4HJA A;  2CQO A;  3I4M H;  2R7Z G;  4DV3 L;  2EIF A;  3CMA A;  1YVC A;  1ASZ A;  4J15 A;  4OX9 Q;  4DR2 L;  1YEZ A;  1VQN A;  1A8V A;  1FJG L;  3I55 A;  3W1B A;  4DK6 C;  3TRZ A;  4DR7 L;  3ER0 A;  1W2B A;  2UXD L;  1PH9 A;  3PUX A;  2BA0 A;  2RHQ B;  1J5E Q;  2LXK A;  5K36 G;  4LF7 L;  1YHA A;  2A1A A;  1KC8 C;  4JC0 A;  5M3M G;  2MFI A;  1OXT A;  3CC4 A;  3K0X A;  3PUZ A;  5J3B A;  3U4Z A;  4ALP A;  4DV6 L;  1C7Y A;  1PVO A;  1WJJ A;  3KLW A;  2UXC L;  1NE3 A;  1Y1V H;  2IT1 A;  3KFU A;  2K5N A;  1VQL A;  4HIO A;  4A3J H;  3HOU H;  1S40 A;  2LSS A;  4P75 A;  3S14 H;  3SE5 A;  4AIM A;  1WCM H;  4U04 A;  1WOC A;  2RHS B;  3K81 C;  4LF9 L;  1SE8 A;  4DR6 L;  4WJ4 A;  2F4V L;  3PO3 H;  3CD6 A;  5M5W H;  2RF4 A;  2YTY A;  4X66 L;  1KL9 A;  3PCO B;  3SGI A;  1E7Z A;  2IX1 A;  4LF5 L;  3RLF A;  1BVS A;  5GRO A;  5IYB G;  3S24 A;  4U07 A;  1U5K A;  1I3Q H;  1HZB A;  1CKM A;  4LF6 Q;  3PSI A;  4JI4 Q;  4R1J A;  4GOP C;  1LUZ A;  4OO1 I;  1X3G A;  1FGU A;  1YBY A;  1IXR A;  4X2D A;  4DUY Q;  3K8A A;  3GTO H;  4OO1 G;  2VNU D;  1HR0 Q;  4O2D A;  4DUZ L;  3M4O H;  5LMN Q;  3PUV A;  4GLA C;  4AH6 A;  1XNR L;  3N3U A;  3HOZ G;  4B3R L;  2ZTD A;  1VQP A;  1TWF H;  2AMC B;  2D0O A;  1CKO A;  4YCU A;  3HOY G;  4JI1 Q;  3PGZ A;  2VQF Q;  3CCL A;  2PI2 E;  4DV4 Q;  2BH8 A;  5GAG C;  5IWA Q;  3A5U A;  1HNZ Q;  2G03 A;  1VQK A;  1NMG A;  3A74 A;  4L5R C;  4DV5 L;  1M1K C;  1N36 L;  4PY3 A;  1UE6 A;  5M5Y H;  4A3I G;  4NB3 A;  1CSQ A;  4GNX B;  3GTK H;  2ATW A;  1PA6 A;  1UEB A;  4A3C H;  4GN3 B;  1JJG A;  2EQS A;  3HKS A;  3RR5 A;  3HKZ G;  1VCI A;  3ERS X;  3ULL A;  4A76 A;  2JA8 H;  2HIV A;  3CCS A;  1N34 Q;  1VQM A;  1N32 L;  4HIK A;  1K8G A;  2KCM A;  2GN5 A;  4K0K L;  4U0Z A;  3RLN A;  4DV2 Q;  3I4O A;  5C4X G;  1ASY A;  1PH3 A;  1JT8 A;  4YHH Q;  4X2C A;  3S16 H;  2VW9 A;  2XTI A;  5IY0 A;  3I4N H;  3K80 C;  4GLV B;  5JFZ A;  3M7N A;  3TS2 A;  4A3D G;  1D8L A;  5EAY A;  1HZ9 A;  2E2I H;  2OQ0 A;  4A93 G;  4NXN Q;  3GTP H;  4P73 A;  2IX0 A;  4DV0 Q;  2B29 A;  5LMU Q;  3NEM A;  4QGU A;  5JJ6 A;  4JI7 Q;  1BBW A;  4QJF A;  1L1O B;  5IYC H;  1P16 A;  4YY3 L;  1HNX L;  2VL6 A;  1OTC A;  1EQQ A;  2CCZ A;  3H0G G;  3G48 A;  1Q1E A;  2Z6K A;  5BR8 Q;  1IBL L;  2JE6 I;  4JI8 L;  4X64 Q;  1EIF A;  2YU9 H;  3RN5 A;  1X56 A;  2ZJR A;  1I6H H;  1OXS C;  3MEF A;  1TWA H;  2PQA A;  4LFA Q;  1EYG A;  5AJ3 Q;  4DV1 Q;  4UP8 A;  1LTL A;  1VQC A;  2YYZ A;  4GNX A;  5IP9 G;  3S1R H;  1XMO Q;  2VS1 A;  4YCW A;  3F2D A;  1FL0 A;  5IYD H;  3GTL H;  3S1M H;  2AHO B;  3BZC A;  3S2H H;  2R6G A;  4GS3 A;  1J5E L;  4IPG A;  4IO9 A;  4X62 L;  2VUM H;  1E3P A;  1VQ8 A;  2Q2T A;  2WP8 J; 
#chains in the Genus database with same CATH topology
 1C9O A;  4DK3 C;  2XRQ D;  2F0N A;  3AFP A;  4BBS G;  1LAB A;  2E2D C;  2WAQ G;  3CUC A;  2BH2 A;  2JA5 B;  2GVB A;  4PG3 A;  4PV1 C;  1AN8 A;  1SR3 A;  5C44 H;  4JI6 L;  3VYR A;  3KF6 A;  3EFX D;  1EQR A;  5T1G A;  1V1O A;  4HMJ A;  1K28 A;  3MXN A;  4QY7 A;  1K3B C;  1GXD C;  3MWY W;  1MKH A;  4IFD I;  1I4Q A;  2RDG A;  3UDI A;  5C4H A;  4IFD G;  3J81 i;  3HFZ B;  4A3G G;  5J39 A;  4EQO A;  1K8M A;  2QDL A;  2UUA L;  1CT1 D;  1S5B D;  5AFW A;  3E0E A;  3HOV B;  3DEO A;  2MQH A;  4A3F B;  2KHI A;  3KOJ A;  2B2U A;  1UE7 A;  4DR4 Q;  4IUN A;  2E2J B;  3KBX A;  5EGT A;  1KDB A;  2TSS A;  4YIJ A;  4U68 A;  3CPW A;  2QKI C;  4LF4 Q;  1BQQ T;  3NP8 A;  4DR1 L;  2Q2H A;  3OWF A;  2ZM6 Q;  2DGY A;  3MA2 B;  5GAH C;  1TWG H;  3T13 A;  1IL2 A;  2JA9 A;  1XPO A;  4OIJ A;  2HDM A;  2YV5 A;  2Z1C A;  5C5M A;  4G57 A;  3J81 j;  2PZU A;  2K05 A;  1NY4 A;  1ENF A;  4DV2 L;  1T5E A;  2R93 G;  1D7Q A;  2JA8 G;  2F0T A;  5D3D A;  4YHH L;  2F1M A;  4JI0 Q;  1UWV A;  1L1O C;  4DR3 Q;  1G51 A;  2K14 A;  1KRS A;  1CZG A;  1XTD A;  4K2K A;  1ZYR C;  3KBG A;  3I73 A;  5BR8 L;  1PH5 A;  1VQ7 A;  2F0I A;  2N55 A;  2C9O A;  3HEJ A;  1VQH A;  1CA5 A;  4C3H B;  1CA6 A;  3NTH A;  2VY3 A;  1XMO L;  4FXG C;  1A62 A;  1BCP F;  2EYH A;  3GD7 A;  3L9A X;  4RGT A;  3GO5 A;  3SE0 A;  2N8N A;  1F9P A;  1X3F A;  1ENC A;  4A3K G;  1ET9 A;  2K33 A;  4DAM A;  5IYD G;  2E2H H;  2JA6 H;  1EFI D;  1KTK A;  2K5V A;  4JG2 A;  2F4V Q;  2A73 B;  3RNU A;  1S3O A;  4DV7 L;  3AU7 A;  1EQV A;  3FMC A;  1F9S A;  5JJZ A;  1EYC A;  4XTC S;  1PH1 A;  2HHH L;  1EOV A;  1IBM L;  3IFT A;  1H9R A;  4WGJ A;  4YWM A;  3MVV A;  1JCK B;  4V19 0;  3HKZ B;  4OX9 L;  3UDG A;  2AQ1 B;  2NN6 H;  4GKK L;  3TP8 A;  4MZ9 A;  3LNN A;  1WD0 A;  5E7N A;  1C0A A;  1Q82 C;  2O5I C;  1BDO A;  4OIK A;  4QL5 A;  1D5Z C;  3A55 A;  2N49 A;  1LO5 D;  3H09 A;  4IOA A;  5J1Z A;  4KD3 A;  3J7A 5;  2DNE A;  2GVA A;  2LKV A;  5H1S E;  3OPO A;  3E9I A;  5CMD A;  3Q22 A;  2JXM B;  3RMH A;  1B8A A;  1PZJ D;  1SNC A;  1N32 Q;  1KLG D;  4A3J G;  3F1Z A;  4A3D H;  2ZM6 L;  3MC0 B;  4YCV A;  1IBK Q;  5HY6 A;  4CDD C;  2QGQ A;  3PO2 G;  4KHP Q;  3GQB A;  3M3Y B;  2MNA A;  1PYB A;  2F3W A;  2LMC B;  2JA7 B;  1O7Z A;  4N8X 1;  5C5L A;  2A5H A;  3DUZ A;  2FIN B;  3LGJ A;  1CSP A;  2K75 A;  4FF4 A;  4LFB Q;  2CVR A;  4HJ7 A;  1HNX Q;  1JJ2 A;  1EQT A;  5LMN L;  4BBS B;  3CC2 A;  4IUR A;  3DM3 A;  1XNQ Q;  2WAQ B;  3BDC A;  1U4P A;  3GTM B;  4A3B G;  4KD4 A;  2XRS D;  3VDY A;  1NNX A;  3NE5 B;  5IWA L;  2MO0 A;  1U4R A;  3K5M A;  2F6S A;  2NTS A;  4UPA A;  5BN4 A;  1QB5 D;  2ZTE A;  1LTG D;  2RCN A;  2J4X A;  4PMC A;  4JI5 Q;  5C4J H;  1SNM A;  2NVX H;  3UE1 A;  4A3G B;  1Q86 C;  1AE2 A;  2R7Z H;  5EPJ A;  4C2M H;  3PF5 A;  4J8Q A;  2CWA A;  4KY7 A;  1YJ9 A;  2EJM A;  4Z9C B;  2IX3 A;  3I56 A;  4IUP A;  3MZ5 A;  3M4P A;  4DV3 Q;  3GTO B;  4IAL A;  1DYQ A;  4NXN L;  3M4O B;  1TS5 A;  1LTA D;  2NVY H;  3CKI B;  1X54 A;  5EKK A;  2NVQ H;  2Z6B A;  4MN3 A;  4JI2 Q;  2KEN A;  1VDZ A;  1VMP A;  1FGB D;  4P74 A;  1KDC A;  2M2L A;  2F0P A;  5FK9 C;  1D1K A;  2E75 C;  1VQ4 A;  2O5J C;  2NBF A;  1JOR A;  1QVG A;  1EU4 A;  2RA4 A;  2QDB A;  4KJN A;  5IGE A;  3OYY A;  1Q90 A;  3T1H Q;  4B3S Q;  1JE5 A;  4TKO B;  2R93 B;  2A6E C;  4KKU A;  2F4I A;  1K8A C;  4BS9 A;  4A3L G;  1SJH D;  2JK8 A;  3K7U C;  3MXU A;  2B8G A;  4OHJ A;  4YWL A;  1X65 A;  2VUM G;  3F2B A;  2LY7 A;  3S16 B;  2B3G A;  5EKL A;  1VQO A;  1A6X A;  4LF5 Q;  3CP0 A;  5M3F G;  1LYL A;  3TQY A;  1A15 A;  3S2D B;  1I5F A;  2KEC A;  2OCE A;  4KHZ A;  4N9P A;  2V1C C;  1B4O A;  3IKJ A;  1NCV A;  3NTI A;  1IBK L;  1C48 A;  1T9H A;  4KHP L;  2AWN A;  4BWG B;  5CBE E;  2ZJP A;  1XPR A;  2K01 A;  5IGF A;  1UAP A;  1X3P A;  4X2E A;  2QEJ C;  1PTO C;  4A3E G;  1AW7 A;  4A3K B;  4K2L A;  5LMN W;  4LFB L;  5FLM G;  1SNO A;  2B63 G;  1SE3 A;  2IHE A;  4BBR G;  4RH6 A;  5E1F A;  1XNQ L;  5DEH A;  1NR2 A;  5C4X H;  2XN9 C;  1L0W A;  2N78 A;  1VQ6 A;  5L37 A;  3H3V I;  3ONA B;  3URY A;  4FF3 A;  2FXQ A;  3EBE A;  4NXM Q;  4A93 H;  1XXG A;  5D14 A;  3FHW A;  4LUO A;  1MSG A;  3VA7 A;  4A3M G;  3OWE B;  3RZO B;  4M16 A;  1Y8N B;  5CYU A;  2XNA C;  4JYA L;  1LM0 A;  4JI5 L;  1VQG A;  4LF8 L;  3HOW G;  3CCV A;  1IYV A;  2MGS A;  1WTX A;  4F88 A;  2UUB L;  1L1O A;  5C3E H;  4P2C B;  2CW0 D;  3K6O A;  4DV3 L;  5KEE A;  4ZKB B;  4C3J G;  1I4X A;  5FKA C;  4DR2 L;  4HR7 B;  1VQN A;  3TRZ A;  3I55 A;  3W1B A;  4DR7 L;  2UXD L;  2RCF A;  3ER0 A;  3GP7 A;  1W2B A;  4A3J B;  3HOU B;  1PH9 A;  1JOO A;  2BA0 A;  3NBI A;  4KK7 A;  1KC8 C;  3PO2 B;  5M3M G;  1OXT A;  5J3B A;  1PVO A;  1ROD A;  1IHZ A;  1WVL A;  2EVB A;  1PFM A;  1NE3 A;  1D6E C;  2IT1 A;  3KFU A;  2K5N A;  3VR6 A;  4IUT A;  3TSS A;  2WV6 D;  4P75 A;  4FO2 A;  1JC7 A;  3K81 C;  4IN3 A;  4NKL A;  3PO3 H;  5M5W H;  1QNU A;  3FPP A;  5ELC A;  1K83 B;  4WJW A;  4LF5 L;  1ICF B;  4G7H C;  5IYB G;  1NAP A;  1I3Q H;  4G7O C;  4JI4 Q;  4R1J A;  4GOP C;  3SEB A;  2SDF A;  4K6L A;  4X2D A;  4DUY Q;  1IKL A;  2VNU D;  1HR0 Q;  2F0F A;  4RA8 A;  3A54 A;  4GLA C;  5M5Y B;  3W3A A;  3HOZ G;  4FVM A;  1TWF H;  1CKO A;  1V8Q A;  2VQF Q;  4DV4 Q;  4S3S A;  1HNZ Q;  4DNT B;  2I46 A;  1EIG A;  5HUR A;  4IZ8 A;  4A3I G;  5CV5 A;  1UEB A;  1FNW A;  3NQI A;  4A3C H;  1JJG A;  3K0Y A;  5CR3 A;  3WOE A;  2GN5 A;  1PMR A;  2IW3 A;  3I3C A;  3I8Z A;  4K0K L;  4CJ0 B;  2OF1 A;  1MGS A;  5JFZ A;  3M7N A;  3TS2 A;  2YU9 B;  2MJ8 A;  2E2I H;  1I6H B;  1NSN S;  4OGQ C;  4P73 A;  5LMU Q;  4ABN A;  4JI7 Q;  4QJF A;  3GTL B;  1EQQ A;  4Q0F A;  1RJT A;  2CQA A;  4JI8 L;  2VUM B;  3TP6 A;  3RN5 A;  1TWA H;  3A8K E;  5M3F B;  1VQC A;  1EU3 A;  5IP9 G;  3S1R H;  1AFP A;  2PZW A;  3N6R A;  3F2D A;  5C0X H;  1PRT D;  2AHO B;  1CK1 A;  1Y8P B;  4IPG A;  2KED A;  4IO9 A;  1E3P A;  1YNX A;  3PIP A;  3BDL A;  2IPK D;  1PXU A;  3ZLM A;  1SYC A;  3UE0 A;  1XMQ Q;  5M5X H;  2C35 B;  4A3E B;  5EU0 A;  3PMF A;  1E1O A;  1SNQ A;  1P8L A;  4KKT A;  4LUV A;  2B63 B;  3KLS A;  1EL0 A;  1FD7 D;  1B3Q A;  1K3R A;  4BBR B;  1F2Z A;  1Y1V G;  1TXY A;  1Y14 B;  1O7I A;  1GM5 A;  4JBM A;  1GUG A;  1YNN C;  1EY0 A;  4R4I A;  4DR5 Q;  3TP7 A;  5CV6 A;  1U4L A;  1N33 Q;  2MO1 A;  5IP7 G;  4ZCK A;  4JI4 L;  3S6A A;  3B6Y A;  4CKB A;  4ME3 A;  5ELN A;  3L0O A;  3SXH A;  1JQY D;  5FJ8 G;  1EOT A;  1KRT A;  4A3M B;  5LHY 1;  5F2D A;  4PZ7 A;  1RF2 D;  2QA4 A;  2RSO A;  2P5Z X;  3K57 A;  1YJW A;  4L6T B;  4HSV A;  3HOW B;  1G91 A;  1FVI A;  5KGU A;  2EYO A;  2VQF L;  5JFF A;  2E5L Q;  3OIP A;  2HCI A;  3FKI G;  3D6W A;  3HOV H;  1Z7T A;  4I7A A;  1WTW A;  1EIY B;  4A3F H;  2A68 C;  4IUU A;  4C3J B;  1A63 A;  1JMC A;  2A6H C;  5D3I B;  1L0Y B;  4JOI C;  1PZK D;  2BE5 D;  4L63 B;  5EPK A;  2VZA A;  3NWT A;  4HTH A;  1RL2 A;  4TQU S;  4F7X A;  1B50 A;  4FDB A;  1YNJ D;  3E6Z X;  5M3M B;  5IOD A;  4CKC A;  3RZD B;  3CME A;  1EY8 A;  2KHS A;  1JB7 A;  2E74 C;  2PCF B;  1I50 H;  3PUY A;  4RKL A;  4RFB A;  1JOQ A;  1EY5 A;  1BUV T;  3S9W A;  1ILQ A;  3DWA A;  1Q81 C;  4QQB X;  5EBC A;  3W1G A;  3E3X A;  1GHK A;  2WFW A;  1IW7 D;  3DWQ A;  3DWP A;  5IOC A;  3CCU A;  4DV6 Q;  4K5V A;  1C8C A;  4PNY A;  5CKL A;  2O2L D;  1AZP A;  4LFC Q;  5IGD A;  2FMM A;  3KK7 A;  4NPS A;  1X55 A;  1UE1 A;  3TME A;  3GDE A;  3H15 A;  3S1Q B;  3BVM A;  4JI3 Q;  3FVQ A;  4C3H H;  3KJO A;  4HIM A;  3NEN A;  2F0L A;  4QIW B;  1XMQ L;  4ID6 A;  1FYC A;  3K7A B;  3KF6 B;  2KCT A;  3NWS A;  4ZQ3 A;  1X3Q A;  2F0E A;  3MXN B;  4A3I B;  2DJF C;  5C44 G;  3ULP A;  1QJO A;  2RVL A;  4DR5 L;  2WKD A;  1BXT A;  4XDX A;  2ZTC A;  4BY7 G;  4B3R Q;  3A7A B;  5E3F A;  4DKA C;  1Q7Y C;  3BJU A;  3J80 E;  5JVG 3;  5DAU A;  1GD7 A;  2F3I A;  2OEO A;  1TWH B;  3SK4 A;  4XXE A;  1QOH A;  3OMG A;  4HSP A;  3VYS A;  4DK1 A;  1GHJ A;  2NYZ D;  4PQX A;  5CMT A;  4P71 A;  1SLJ A;  1K0R A;  3OHX C;  1VS0 A;  1N36 Q;  3AB9 A;  3TP5 A;  1YIT A;  1STY A;  3ZC7 A;  4HCE A;  1XPU A;  2D0P A;  4B3T Q;  1BBU A;  5JJK A;  4HN7 A;  4JBW A;  2K5W A;  3NHH A;  2B2V C;  4N9T A;  3A0J A;  3J7Y W;  1WCM G;  1LLR D;  3A5Z B;  1NJI C;  1GVP A;  2K5D A;  1B1Z A;  3QG1 A;  4ZRZ A;  4CGY B;  1XJV A;  4TRD A;  4GOP A;  1EY9 A;  3W2D A;  2Q2U A;  2FFK B;  1KQS A;  1BOS A;  3R3O A;  1Z47 A;  2H1E A;  1W3S A;  4AQY Q;  2B2T C;  4BXX H;  3U9O A;  2R61 A;  1IBL Q;  1Y8O B;  3U9S A;  2KQ3 A;  3Q6S A;  4QIW E;  4POG A;  2JA7 H;  3F8T A;  1EEF D;  1VQJ A;  1Y1W H;  2EYL A;  4X6A H;  4L5Q A;  1BO0 A;  1Y1V B;  1PRT B;  1YHQ A;  2QIL A;  1BBX C;  1STH A;  1R9T H;  3E0J A;  4BBS H;  1SMY C;  2EXD A;  4DNI A;  3JAM c;  3GTM H;  1EWC A;  4IPC A;  2I5L X;  3KDF B;  1N34 L;  5CV7 A;  4EQ5 A;  2NVT H;  3CCJ A;  5CV9 A;  4LFC L;  1ILP A;  2XSC A;  3HRZ C;  3C1E A;  4JI3 L;  1PZI D;  4DFA A;  1IZ6 A;  2B2W C;  3J80 c;  3M4Q A;  1QG7 A;  4DPG A;  4IFD H;  4DV0 L;  2JA6 G;  4A3G H;  5K36 H;  3RN2 A;  4GLX A;  3Q24 A;  1RIP A;  3FKI B;  5FLX L;  1B7Y B;  2F0O A;  2UUC Q;  2EYP A;  4X64 L;  4J1M A;  4B08 A;  4R4Q A;  5KND A;  3S1N B;  1ZYR D;  4DV1 L;  4OWW B;  4JBJ A;  5JEA J;  4FNF A;  1OXV A;  3GTK B;  1KNE A;  2EZV A;  3KDF A;  4R8I A;  2NN6 I;  4B3M Q;  1SDF A;  2WIN B;  2A8V A;  1JWM D;  2NN6 G;  1TY0 A;  3OTO Q;  3CPF A;  2PMZ E;  3J7A F;  1UNS A;  4LJZ C;  3PV0 A;  3EN2 A;  3I90 A;  3K5L A;  1VF7 A;  1Z9F A;  1N9W A;  3NQT A;  1M8A A;  3VR2 A;  4UP7 A;  4X66 Q;  3CQZ H;  2PZT A;  1F77 A;  4JV5 Q;  4B3T L;  2R93 H;  4X65 Q;  1E24 A;  4N8F A;  4RAU C;  1AP0 A;  4L8J A;  2A69 C;  4DU9 A;  2F03 A;  2KUM A;  3DLL A;  3FRP B;  4QF4 A;  3HOY H;  3J81 L;  2KBN A;  5I2X A;  1YZ6 A;  3SDZ A;  2K1B A;  2AUJ D;  3S2D H;  1XX8 A;  2AQ2 B;  3I7F A;  3T1Y Q;  2L15 A;  1OO9 B;  4ZLT F;  4O0A A;  3BYT B;  3SR1 A;  4AQY L;  2O4X A;  3GTG B;  1HFN A;  4PZ6 A;  1IYU A;  4DR4 L;  4ILW A;  5CV8 A;  3RUZ A;  2QW7 A;  1DOK A;  3HOX G;  4A3K H;  1TY2 A;  3K58 A;  4LF4 L;  1G6Z A;  1LAC A;  4C1N I;  4DK0 A;  5C44 B;  3C2P A;  2ICE C;  4ODG A;  4TVA B;  1HJP A;  4BY7 B;  4QUF A;  3H6M A;  4A75 A;  4JOI A;  3G6E A;  1MJE A;  1E1T A;  1G29 1;  1K9M C;  3PF4 A;  4LWC A;  2R92 G;  5G3L D;  4OEM B;  3RZO H;  4JI0 L;  2JEB I;  4DR3 L;  2R7Z G;  4HJA A;  3CMA A;  4HED A;  4EQN A;  4JK1 C;  4RGO S;  1BCP C;  2KCN A;  1YEZ A;  1G8Z D;  2VB3 X;  2KCC A;  3PUX A;  2RHQ B;  2F0H A;  4ZAI A;  3S14 B;  1YHA A;  3RD4 A;  1WCM B;  1LV9 A;  4JC0 A;  2Q8R E;  3CC4 A;  1C7Y A;  1TWG B;  5ELD A;  1B3A A;  4A3J H;  3HOU H;  1TT2 A;  4AIM A;  4ZK9 B;  1DJR D;  1WOC A;  2F4V L;  4JVZ A;  2NB0 A;  2YTY A;  4X66 L;  5JEA H;  1KL9 A;  3TZU A;  1E7Z A;  1JIC A;  1LTS D;  1BVS A;  4QMG A;  1BF4 A;  3S24 A;  2KJX A;  3FEW X;  1HZB A;  1CKM A;  3R2T A;  4LF6 Q;  1LUZ A;  5IT9 L;  2EY6 A;  4OO1 I;  1SJE D;  1ICW A;  1ZKO A;  4DAV A;  4OO1 G;  1E2Z A;  4O2D A;  3I72 A;  3MAQ A;  2JYO A;  1A3V A;  3PUV A;  4AH6 A;  3N3U A;  3SK5 A;  2AMC B;  1ET6 A;  3H91 A;  3PGZ A;  2JA8 B;  3CCL A;  3R2I A;  2PI2 E;  1SBB B;  3OMC A;  3SVM A;  5GAG C;  3A5U A;  2G03 A;  1NMG A;  3V2T A;  1M1K C;  2A6E D;  4PY3 A;  4FXK C;  5M5Y H;  4NB3 A;  1CSQ A;  5KYI A;  2JA6 B;  2PPB C;  1H9M A;  2ENB A;  2EQS A;  3RR5 A;  1VCI A;  3ERS X;  3FDT A;  3CCS A;  1HFG A;  1VQM A;  3GTP B;  2B2V A;  1N32 L;  2L1B A;  3CHB D;  1K8G A;  1JT8 A;  5C4X G;  2M9V A;  1PH3 A;  1GUN A;  1HXY D;  2VXW A;  2RQX A;  1KAB A;  4A93 G;  1QE6 A;  1XYI A;  3Q23 A;  5JPM C;  2B2T A;  1BBW A;  5IYC H;  1L1O B;  3NXW A;  3PQI A;  1HNX L;  4CJ2 C;  1OTC A;  2CCZ A;  1KNA A;  1DCZ A;  2RDF A;  3H0G G;  1PTO D;  1Q1E A;  1CQV A;  4J6H A;  5BN5 A;  1EIF A;  2YU9 H;  1X56 A;  4CBV A;  1I6H H;  3MEF A;  2PQA A;  4LFA Q;  5AJ3 Q;  4EQP A;  1LTL A;  3A56 A;  2A74 C;  5E4W C;  3GTL H;  5HGT A;  4H0L C;  3BZC A;  4KKS A;  1D5X C;  3GTQ B;  3X3N A;  3P7J A;  2VUM H;  1HNW Q;  2DJG C;  5FLX E;  4POF A;  4HID A;  4BA2 I;  5M3F H;  3T4A C;  2QF7 A;  1PDQ A;  1IYJ B;  4PMW A;  3C3L A;  4X3S A;  2L0C A;  5COY A;  3U4V A;  4EVO A;  1PYS B;  3F2U A;  2G9D A;  5C0X J;  2ASB A;  1QUQ A;  4L5S A;  3D6C A;  2B2W A;  3L7Z C;  2NTT A;  3LX0 A;  4XQN A;  5KRU A;  1HUM A;  2JQO A;  1YHB A;  1J8I A;  1AEX A;  1TS2 A;  2F0U A;  4KTA A;  3KF8 A;  3TZD A;  2F0S A;  4GKJ Q;  3HOX B;  2UXB Q;  1KHI A;  3PO3 G;  1CTM A;  3BDO A;  3M9B A;  4LF6 L;  2B63 H;  3JC6 6;  4JI2 L;  1X32 A;  4M1U B;  5C3W A;  4K6D A;  2D9U A;  2F0M A;  4KJO A;  2FMC A;  1EWI A;  1STB A;  1FNU A;  1Q12 A;  3T1H L;  4B3S L;  3RLO A;  1EEI D;  2B39 A;  2R92 B;  3J81 E;  3H3V H;  2CFM A;  5C4J B;  3OIQ A;  2UU9 Q;  1H9S B;  5JPN C;  4GNX C;  1WD1 A;  4A3M H;  5HGQ A;  2Z9H A;  4CKE A;  2R7Z B;  4A3B B;  4IPH A;  1MSH A;  5TSS A;  1Z6H A;  4C56 C;  1JWS D;  1VF5 C;  3HOW H;  1PRT F;  4DAY A;  4IUV A;  4H13 C;  5IGG A;  2F0K A;  2NVY B;  4Y7N H;  3PUW A;  1L2F A;  5ISR A;  1SFO H;  1AH9 A;  3HS0 C;  4OWT B;  4LNQ A;  4ZUJ A;  1EFW A;  1EZ8 A;  4C3J H;  1LTT D;  5NUC A;  3UI2 A;  3BVZ A;  4KLK A;  3PIO 3;  5GAD C;  1CQF A;  3CCR A;  1YJN A;  1EZ6 A;  4IJH A;  5FLX c;  5M3M H;  2CKZ B;  1WTP A;  4U0U A;  1H9S A;  3X3M A;  5IIF A;  3M4Y A;  2L5T A;  4YWK A;  3LWU A;  4KMU C;  4WOR A;  5ELE A;  1U0L A;  3STB C;  4HJ5 A;  1ZXT A;  3A8I E;  1CZW A;  2ZXO A;  4LFA L;  1CHQ D;  2D5D A;  5A35 A;  2I5H A;  2F0G A;  1RHP A;  2SEB D;  4OON A;  1QCB D;  4O42 A;  4C3I G;  3WOF A;  5LL6 X;  4G7Z C;  1VQ9 A;  4NXM L;  1PH6 A;  1QVC A;  3A8J E;  1XWE A;  1HNW L;  1STA A;  4HJ9 A;  5KNC A;  1U4M A;  4R4T A;  2J0T D;  5IYB H;  3AQQ A;  4R4C A;  3HGB A;  1I94 Q;  1K73 C;  4LW1 A;  2KVM A;  1B53 A;  4RGN A;  2F0V A;  1ESF A;  4X3T A;  3GTJ B;  1QVF A;  2CH4 W;  4EX5 A;  1JWU D;  3NBH A;  4WFN 3;  3S1Q H;  1VQ5 A;  1TWC H;  4Q5V A;  3D8G A;  3J81 c;  4BY1 H;  1X9N A;  3UDF A;  3K7A H;  1V1P A;  2UXB L;  3T51 B;  3I4M G;  3G7L A;  5D65 A;  1S5F D;  5J22 A;  3CCE A;  1B44 D;  1S72 A;  4U0S A;  1ML0 D;  1A0I A;  1WYD A;  3S15 B;  1V1Q A;  2NUN A;  3K5N A;  2L12 A;  1H9J A;  5IT9 E;  4A93 B;  4C1N K;  1PHJ A;  3AEV A;  1CKN A;  3U58 A;  1H95 A;  2L11 A;  3MHB A;  4E6I A;  1TR5 A;  2AWO A;  3V96 A;  3H0G B;  4CJ1 B;  4RG1 A;  1QNK A;  1PFN A;  4UY8 C;  1Q1B A;  3L2P A;  1PFS A;  4N67 A;  4HJ8 A;  3TDQ A;  2JA5 H;  4JPB W;  1SRU A;  1EIH A;  4DXG A;  3AYH B;  1S5D D;  2MHV A;  1YNN D;  2VQE Q;  4QUC A;  1DZ1 A;  4DUY L;  5ELF A;  1HR0 L;  3S17 B;  1SND A;  1PTO B;  5IP9 H;  3G4S A;  2X6L A;  5CC4 A;  2M00 A;  2Z6K C;  1HHV A;  1V9P A;  2RSN A;  1SMX A;  1NTG A;  4NMZ A;  2DUD A;  3LET A;  3ULJ A;  4DV4 L;  2CWP A;  2XGT A;  1HNZ L;  2K5H A;  3T56 B;  4F87 A;  3ICE A;  4X62 Q;  4MNO A;  4MTN A;  1WTQ A;  5I2Y A;  3I91 A;  4M8A A;  1KXL A;  2E2J H;  3ZJY C;  3PO3 B;  5M5W B;  2IWH A;  3J7A V;  2A68 D;  1LTB D;  5CBA E;  5JJI A;  3CXC A;  2A6H D;  2Y0S E;  3DHQ A;  3NSW A;  4JI6 Q;  1VMC A;  3PIP 3;  1PH7 A;  2K4K A;  2NZO A;  1WTR A;  1FNV A;  1NBW A;  1I94 L;  3I4N G;  1JOK A;  5IP7 H;  4KN7 C;  5LMU L;  1EY6 A;  4JI7 L;  1FJG Q;  5FJ8 H;  2VB2 X;  2PNH A;  5IT9 c;  3MFG A;  3CC7 A;  4OWX B;  2KHJ A;  2NWG A;  1EY4 A;  3EQL C;  2UUA Q;  2XWJ B;  4LF7 Q;  3C46 A;  4K5W A;  1UE5 A;  3T16 A;  1QIL A;  4IFD J;  4DN4 M;  2H5X A;  3FKI H;  2UXC Q;  2C5C A;  4TSS A;  4FF1 A;  1BR9 A;  4GZY C;  4RKB A;  1R4P B;  1N8R C;  4L5T A;  4KI0 A;  3I2Z A;  4DR1 Q;  4HMI A;  5LL6 S;  1WTO A;  3S1N H;  4LF9 Q;  3HOZ B;  2KOL A;  2NUC A;  1TQO A;  3QO2 A;  2Z8L A;  4RHR A;  4AYB G;  2R3Z A;  1HH2 P;  1QWY A;  2EDG A;  2HIX A;  4PMB A;  5EKI A;  2ES2 A;  5IGB A;  2QEX A;  2J7Z A;  2E2I B;  2X6G A;  3IRB A;  4DNR B;  4UAI A;  2ALY B;  3M85 A;  4DUZ Q;  4GOP B;  1NR4 A;  1T5X D;  1O7Y A;  1B2T A;  1HRJ A;  1N33 L;  4ITR A;  1E2V A;  1TWA B;  4C3I B;  3TEH B;  1HR0 W;  3G71 A;  2VQE L;  4K8I A;  3CCQ A;  4MHE A;  1GUO A;  2Z4I A;  4R4O A;  5E4X A;  1KIX A;  1SN8 A;  3MXG A;  4CHT B;  2WB1 E;  1K8O A;  4BXX G;  3J7Z C;  2E5L L;  1GOZ A;  5FO7 B;  3ND8 A;  3V05 A;  1CM9 A;  2JA7 G;  2HT1 A;  2OQK A;  1Y1W G;  1EUJ A;  3GTG H;  3TRE A;  3BZD B;  2WAC A;  4LU4 A;  3I4M B;  5I9O A;  1RTN A;  3DEP A;  1O7L A;  2MPM A;  2I0Q A;  4DV7 Q;  2EE1 A;  3P20 A;  4YY3 Q;  4APV A;  5FO9 B;  4V0B A;  1PH8 A;  2YTX A;  2PMZ B;  2HHH Q;  3BU2 A;  3M3Y H;  5DM7 3;  1IBM Q;  4BY7 H;  1YIJ A;  2EYF A;  4QCL A;  1YVC A;  1ASZ A;  4OX9 Q;  4GKK Q;  1FJG L;  4DK6 C;  3QWN A;  2RBM A;  1J5E Q;  1EYD A;  5K36 G;  4LF7 L;  2EY1 A;  2F0J A;  2EYM A;  2MFI A;  1ZEQ X;  3K0X A;  3PUZ A;  4ALP A;  4DV6 L;  1SMY D;  1SEB D;  1WJJ A;  3ZYY X;  2UXC L;  2BCO A;  2EYJ A;  2MUY A;  1VQL A;  1SYF A;  2WII B;  2EY2 A;  2F0D A;  2QCP X;  3S14 H;  3SE5 A;  1WCM H;  1J9O A;  2HUG A;  3L3O C;  1L0X B;  2EJF C;  2RHS B;  4LF9 L;  2V4D A;  3IFD A;  1SSO A;  4B9W A;  3CD6 A;  1JR0 D;  3P75 A;  4RCN A;  3PCO B;  3SGI A;  1KLU D;  3RLF A;  4ME5 A;  1GUW A;  4U07 A;  1K0S A;  1U5K A;  1I50 B;  1FGU A;  1D1I A;  1YBY A;  1IXR A;  3GTO H;  1II3 A;  4DUZ L;  3M4O H;  5LMN Q;  2EJG C;  4B3R L;  4XQQ A;  2ZTD A;  2D0O A;  4YCU A;  1UUP A;  4OL7 A;  2L9H A;  2CHB D;  5G3L F;  3HOY G;  4JI1 Q;  3TBI B;  5IWA Q;  5JVH 3;  4L5R C;  3DXJ C;  3O13 A;  4O1N A;  2HQE A;  1N36 L;  2E76 C;  2OT2 A;  3I4N B;  2SOB A;  3NTK A;  1PA6 A;  4GN3 B;  3HKS A;  1A3T A;  1AZQ A;  4A76 A;  4UDU C;  2JA8 H;  1KDA A;  4DA2 A;  4XQJ A;  4ZUI A;  1S5E D;  4HIK A;  2KCM A;  2ICI A;  1DOM A;  1STE A;  3S16 H;  2VW9 A;  3BVG A;  2A69 D;  3K80 C;  5I6Y A;  2MP1 A;  4A3D G;  2B2Y C;  3LWE A;  3N52 A;  2OQ0 A;  5I9P A;  4NXN Q;  1RD9 D;  3GTP H;  2B29 A;  3NEM A;  4QGU A;  1STN A;  3VR3 A;  1HA5 A;  3VR5 A;  1P16 A;  4YY3 L;  3QR8 A;  3S1M B;  2IL8 A;  3S2H B;  2Z6K A;  1IBL L;  3I70 A;  3EJI A;  5DM6 3;  2ZJR A;  1OXS C;  4AYB B;  4G4K A;  1EYG A;  2VS1 A;  4YCW A;  1FL0 A;  5IYD H;  1RTO A;  1LT5 D;  4GS3 A;  5I4D A;  3SK8 A;  1J5E L;  1CI3 M;  1HTL D;  3Q0A A;  2XIW A;  3CAM A;  2R7D A;  2PNR C;  3KJP A;  1EYA A;  1DOL A;  1I4R A;  4KV6 A;  1Q8K A;  3GTQ H;  1PYW D;  5IGC A;  4U67 3;  3P1H A;  2KA7 A;  4XIG S;  3HOU G;  2DY7 A;  4NDX A;  2K28 A;  3VA5 A;  3EVQ A;  3K5O A;  2IY5 B;  2D2C C;  2NUD A;  2JEA I;  1SRO A;  3TS0 A;  1VQD A;  2YTV A;  1G2T A;  3NEL A;  1HQM C;  1Y1W B;  1SXT A;  2UUC L;  1S5C D;  5JEA G;  2XVS A;  3CW2 C;  1BCP D;  1WTV A;  1IKM A;  1E22 A;  2NZH A;  2K7V A;  3ERQ A;  3D0F A;  3OSO A;  1M90 C;  1R9T B;  2Z0S A;  2DNC A;  3HOX H;  2JN4 A;  4MIU A;  3GV3 A;  2N88 A;  3D4D A;  3AMU A;  4B3M L;  4JI1 L;  4I7Z C;  5KYL A;  1PTO F;  3OTO L;  2NVT B;  3PO2 H;  5C4Z A;  4NW2 A;  2PI2 A;  4K8J A;  2HD3 A;  3KLR A;  3VYU A;  4AYB E;  5JJL A;  1O80 A;  3EA6 A;  3HKZ E;  4UP9 A;  2R92 H;  4JV5 L;  5JAV A;  4JYA Q;  1RDP D;  4X65 L;  3BG3 A;  2Z4H A;  1RCV D;  2AKW B;  1GJX A;  4LF8 Q;  3MEH A;  1B70 B;  4LUZ A;  5EQ0 A;  3K59 A;  4A3B H;  4WRD A;  1K83 H;  2UUB Q;  1LTR D;  1WTH A;  4GN4 B;  3ITP A;  1MD2 D;  4XI8 A;  3G6J B;  2I07 B;  3T1Y L;  1TVX A;  3EIV A;  5FO8 B;  1NH1 A;  4DR2 Q;  3Q8D A;  2UXD Q;  2NZ1 D;  2K5Q A;  4DR7 Q;  1A2T A;  2F3V A;  3OOC A;  2I5M X;  2LXJ A;  3D31 A;  4PZ8 A;  2PQA B;  4ZYS A;  2DN8 A;  5IYC G;  2E2H B;  1RKN A;  2ZXR A;  2E8G A;  3T53 B;  3JAM i;  2WKC A;  3CU7 A;  3CQZ B;  2G5D A;  3R8B A;  1A3U A;  3DMU A;  3M7G A;  2Y0S G;  4IQZ A;  1DON A;  3ERO A;  2WAQ E;  1E0B A;  2Q2I A;  2ZXP A;  1QUQ B;  3HOY B;  1G6P A;  4RCO A;  1STG A;  3FP9 A;  2K52 A;  3J80 i;  3UDX A;  4OO1 H;  1F2L A;  4DGZ A;  4A4I A;  2B8F A;  1I4G A;  3KF8 B;  3MTS A;  3QOJ A;  3H3V C;  4OXP A;  5C3E G;  4A3L H;  4IUQ A;  1LT4 D;  3GTJ H;  1LTI D;  4K5X A;  4KHV A;  1Y69 U;  2AQ3 B;  1FR3 A;  3QJY A;  1B9N A;  2HCC A;  3AFQ A;  4A3D B;  1HPC A;  3W5O A;  1SE2 A;  3DM1 A;  3E5S A;  1H9K A;  2KEE A;  1HTP A;  1F9R A;  1GO3 E;  1MIU A;  5M9O A;  5CGL A;  1W6K A;  1YI2 A;  2BA1 A;  2DY8 A;  2K32 A;  1PH2 A;  1HCZ A;  4JW0 A;  3S15 H;  1E2W A;  3IAY A;  1KAW A;  4K0K Q;  3E9H A;  1LT6 D;  5K5P A;  1GKH A;  2K50 A;  3QB3 A;  1TII D;  4B9X A;  4DAY B;  4A3E H;  4OEL B;  5CV4 A;  2SNM A;  4CDE C;  4F8M A;  5FLM H;  3SK6 A;  1CHP D;  2N3S A;  3CRL C;  3CRK C;  3H0G H;  4BBR H;  4FXD A;  1I4P A;  2CW0 C;  1HZA A;  1X3E A;  3PIO A;  4FYD A;  4ZKC B;  4RGM A;  1OXU A;  4JI8 Q;  2XWB B;  3MFY A;  2OTJ A;  4ULL A;  3R93 A;  1KD1 C;  2WB1 G;  3WDN A;  3BZK A;  4DXF A;  2NVX B;  1J6Q A;  3KLS X;  5BN3 A;  2OTL A;  4QB4 A;  3S17 H;  1Q3L A;  3NPP A;  4GN5 A;  1PTO H;  2IHF A;  4C2M B;  2JP1 A;  3F2C A;  3JAM L;  1O78 A;  2PYK A;  2L55 A;  3D3R A;  1HQR D;  2JJQ A;  5A2Q L;  1V43 A;  3D4R A;  5DNF A;  2PQE A;  4A3C G;  1VQF A;  2D62 A;  4H02 A;  2EXZ A;  2NVQ B;  1QZH A;  1TS3 A;  4I65 A;  1BKB A;  2B2Y A;  4KN4 C;  3OW2 A;  5KNB A;  1WFQ A;  4RHS A;  3J80 L;  3ZCB A;  3QOL A;  3NBH B;  4KY6 A;  2RDH A;  1HA6 A;  1W6J A;  1VQI A;  5IE8 A;  1X6O A;  1BCP B;  3RZD H;  5GQO A;  4Y52 H;  2K6A A;  1V1P B;  2BDO A;  5AJ3 L;  4RMF A;  1OXX K;  2X69 A;  1Q8I A;  1MI2 A;  3STB D;  1PH4 A;  4BY1 G;  5C0X I;  4P72 A;  2B2U C;  4H7B A;  5C0X G;  5DLQ E;  2BOS A;  1PLF A;  3MXP A;  1CKN B;  4JCV E;  4CDC C;  2IJ0 A;  5GAE C;  4IOC A;  4DR6 Q;  3QIA A;  1ESR A;  2PW5 A;  4K14 A;  2F52 A;  4WJ3 M;  2A19 A;  1Q46 A;  1TS4 A;  3OW7 A;  4MTK A;  3HZX A;  1MJC A;  5COR A;  5ELB A;  3HOZ H;  3SHL A;  2G9H D;  1JJC B;  1VQA A;  2TMP A;  1KAA A;  2HQL A;  5T1I A;  5EPL A;  4GKJ L;  1XNR Q;  1I4H A;  1DGS A;  3SN9 A;  4LMQ D;  4JBK A;  5C4X B;  4HAE A;  1CUK A;  1WI5 A;  3WWV A;  1HZC A;  2JA5 G;  5JJ7 A;  1DM0 B;  4A3I H;  2FJ2 A;  2Y0S B;  2ZJQ A;  1VQE A;  4DV5 Q;  3SHG A;  3CCM A;  2ZT9 C;  3CF5 A;  1PRT C;  5ELO A;  4IPD A;  2ID0 A;  2OWO A;  4C3I H;  3IL8 A;  4X3U A;  1TWH H;  1NUC A;  4BA1 I;  2UU9 L;  2GA4 B;  1BNZ A;  2K03 A;  1PFB A;  1SYG A;  2L4N A;  1SAP A;  2PO4 A;  3KYH C;  4FF2 A;  1VQB A;  3HOV G;  1PV4 A;  5C3E B;  5I6W A;  3BS1 A;  1D2B A;  1SNP A;  3U50 C;  5CGK A;  4A3F G;  1QZG A;  2R7F A;  1AE3 A;  1F9Q A;  4IJL A;  1IL8 A;  1NMF A;  2F0Q A;  1XTC D;  2K04 A;  3I4M H;  3NUC A;  1D5M C;  2CQO A;  2EIF A;  1C4Q A;  2F0W A;  1M4V A;  4LAA A;  4J15 A;  5FOB B;  4XT3 B;  4NP5 A;  1A8V A;  5C3X A;  1F2M A;  4R9W A;  2LXK A;  1DXM A;  2A1A A;  4XYQ A;  2HDL A;  5EJW A;  1DD2 A;  3U4Z A;  3KLW A;  2EOT A;  1ENA A;  1SYE A;  2SNS A;  1Y1V H;  1SE4 A;  2AUK A;  4HIO A;  2Q8I B;  1S40 A;  2LSS A;  3VYT A;  2CH4 A;  1I3Q B;  1LT3 D;  2LS0 1;  1U9R A;  1EWH A;  4UHV A;  4U04 A;  5C6A A;  4WJ4 A;  1SE8 A;  2EPB A;  4Y7N B;  4DR6 L;  1TU2 B;  1SFO B;  1JB3 A;  2RF4 A;  2WB1 B;  2IX1 A;  4DF7 A;  1GUS A;  4H44 C;  5GRO A;  2BE5 C;  4C3H G;  2PW7 A;  1TWF B;  3GV6 A;  3PSI A;  1YNJ C;  2H4O A;  3A7L A;  1X3G A;  2OXP A;  3VR4 A;  3K8A A;  3ND9 A;  3C1F A;  1XNR L;  1VQP A;  1SYD A;  2EY5 A;  1HUN A;  2BH8 A;  1MBY A;  1UEA B;  4X3K A;  1VQK A;  3A74 A;  4DV5 L;  5JOB A;  1IW7 C;  1UE6 A;  4XT1 B;  3FPU B;  4GNX B;  3GTK H;  2ATW A;  1JE4 A;  5KIX A;  3HKZ G;  5EBD A;  3ULL A;  2HIV A;  1N34 Q;  2JSO A;  1A2U A;  3BYY B;  2LFN A;  4U0Z A;  3RLN A;  4DV2 Q;  3I4O A;  1ASY A;  1ONL A;  4YHH Q;  4XYO A;  4X2C A;  2XTI A;  5IY0 A;  3I4N H;  1GUT A;  1MHW C;  4GLV B;  4FP5 D;  1TWC B;  3HP3 A;  1D8L A;  4HCS A;  5EAY A;  1HZ9 A;  2BDN A;  1CFM A;  2IX0 A;  4DV0 Q;  4BY1 B;  3S1R B;  5JJ6 A;  4KY5 A;  3JAM E;  4LK1 C;  2VL6 A;  4EGV A;  5A2Q E;  3G48 A;  3TN2 A;  5BR8 Q;  4DAP A;  2JE6 I;  4X64 Q;  3NK9 A;  3D4W A;  1G2S A;  1SYB A;  3HG9 A;  3KUP A;  4UP8 A;  2FHT A;  2YYZ A;  1F2Y A;  4DV1 Q;  3I4L A;  4GNX A;  1XMO Q;  1B9M A;  1EY7 A;  5M5X B;  3S1M H;  4RWS C;  3S2H H;  3H94 A;  2R6G A;  1R4Q B;  4CDF C;  4R8N A;  4X62 L;  1I6V C;  2Q8T A;  1S4Z A;  1VQ8 A;  2Q2T A;  2WP8 J;  2RKS A;  1TKW B; 
#chains in the Genus database with same CATH homology
 1C9O A;  3CAM A;  4DK3 C;  4POF A;  4HID A;  1YNX A;  4BA2 I;  3PIP A;  5M3F H;  3AFP A;  2R7D A;  1IYJ B;  3ZLM A;  4PMW A;  4BBS G;  3UE0 A;  3U4V A;  3KJP A;  1XMQ Q;  2WAQ G;  3CUC A;  2C35 B;  5M5X H;  2BH2 A;  5EU0 A;  1PYS B;  2GVB A;  5C0X J;  1Q8K A;  4PG3 A;  1E1O A;  2ASB A;  1P8L A;  1QUQ A;  3GTQ H;  4LUV A;  4L5S A;  5C44 H;  1SR3 A;  4JI6 L;  1K3R A;  3L7Z C;  1Y1V G;  4XIG S;  3KF6 A;  1TXY A;  1Y14 B;  1O7I A;  3HOU G;  1EQR A;  2JQO A;  1GM5 A;  4JBM A;  1YHB A;  2IY5 B;  4R4I A;  2JEA I;  4QY7 A;  4DR5 Q;  4GKJ Q;  1SRO A;  2UXB Q;  3TS0 A;  1MKH A;  1VQD A;  4IFD I;  1KHI A;  2YTV A;  3PO3 G;  3M9B A;  1N33 Q;  2MO1 A;  4LF6 L;  3NEL A;  3UDI A;  2UUC L;  5IP7 G;  2B63 H;  3JC6 6;  3S6A A;  3B6Y A;  3HFZ B;  5JEA G;  3J81 i;  4JI2 L;  4ME3 A;  4JI4 L;  3CW2 C;  5ELN A;  4A3G G;  3L0O A;  1E22 A;  2UUA L;  2NZH A;  5FJ8 G;  1KRT A;  3D0F A;  3E0E A;  4PZ7 A;  1M90 C;  2QA4 A;  2MQH A;  2Z0S A;  3HOX H;  1YJW A;  2KHI A;  3KOJ A;  1EWI A;  1UE7 A;  1Q12 A;  3T1H L;  4DR4 Q;  4B3S L;  3RLO A;  4B3M L;  4JI1 L;  1FVI A;  3CPW A;  2VQF L;  2E5L Q;  5JFF A;  2CFM A;  3H3V H;  2UU9 Q;  4LF4 Q;  3OTO L;  3FKI G;  4GNX C;  4DR1 L;  3PO2 H;  2Q2H A;  4A3M H;  2PI2 A;  3HOV H;  5HGQ A;  2ZM6 Q;  2DGY A;  1EIY B;  5GAH C;  1TWG H;  4IPH A;  4AYB E;  5JJL A;  1IL2 A;  2JA9 A;  4A3F H;  1XPO A;  3HKZ E;  4UP9 A;  1A63 A;  2YV5 A;  3HOW H;  2R92 H;  4JV5 L;  4JYA Q;  1JMC A;  3J81 j;  4X65 L;  1NY4 A;  4JOI C;  2AKW B;  4LF8 Q;  1B70 B;  4LUZ A;  4Y7N H;  4DV2 L;  2VZA A;  3PUW A;  2JA8 G;  2R93 G;  1RL2 A;  1L2F A;  4YHH L;  4TQU S;  1SFO H;  4A3B H;  4OWT B;  1AH9 A;  4FDB A;  4LNQ A;  1K83 H;  1EFW A;  2UUB Q;  4C3J H;  4JI0 Q;  4GN4 B;  4XI8 A;  1UWV A;  1L1O C;  3CME A;  4DR3 Q;  1JB7 A;  1HNW Q;  3T1Y L;  1I50 H;  1G51 A;  3EIV A;  2K14 A;  4KLK A;  5GAD C;  3PUY A;  3CCR A;  1YJN A;  1KRS A;  3Q8D A;  4IJH A;  5FLX c;  4DR2 Q;  2UXD Q;  4DR7 Q;  1XTD A;  5M3M H;  2CKZ B;  2I5M X;  1Q81 C;  2LXJ A;  4U0U A;  3D31 A;  4PZ8 A;  4QQB X;  5BR8 L;  1PH5 A;  2PQA B;  1VQ7 A;  4YWK A;  3W1G A;  5IYC G;  1U0L A;  3STB C;  4HJ5 A;  1VQH A;  2WFW A;  4LFA L;  2E8G A;  3CCU A;  2VY3 A;  4DV6 Q;  1XMO L;  2I5H A;  1A62 A;  4OON A;  5CKL A;  3GD7 A;  3JAM i;  3GO5 A;  4LFC Q;  2N8N A;  1VQ9 A;  4NPS A;  1X55 A;  1UE1 A;  1X3F A;  1QVC A;  4A3K G;  1PH6 A;  4NXM L;  3GDE A;  1HNW L;  4DAM A;  3H15 A;  2Y0S G;  5IYD G;  4HJ9 A;  2E2H H;  4JI3 Q;  2JA6 H;  2F4V Q;  2K5V A;  4JG2 A;  4R4T A;  4C3H H;  3AQQ A;  4R4C A;  5IYB H;  3KJO A;  4HIM A;  2WAQ E;  2Q2I A;  3NEN A;  1K73 C;  1I94 Q;  4LW1 A;  1QUQ B;  3RNU A;  1G6P A;  1S3O A;  1XMQ L;  4DV7 L;  3FP9 A;  3KF6 B;  2KCT A;  2K52 A;  3J80 i;  3UDX A;  1QVF A;  4EX5 A;  4XTC S;  3S1Q H;  1PH1 A;  2HHH L;  1EOV A;  1VQ5 A;  4A4I A;  1TWC H;  3MXN B;  1IBM L;  4WGJ A;  3KF8 B;  4YWM A;  5C44 G;  3ULP A;  3J81 c;  4BY1 H;  4OX9 L;  1X9N A;  4OXP A;  3UDG A;  3UDF A;  3K7A H;  4DR5 L;  5C3E G;  4GKK L;  4BY7 G;  4A3L H;  2ZTC A;  3I4M G;  4B3R Q;  2UXB L;  4MZ9 A;  1Q7Y C;  4DKA C;  3GTJ H;  3BJU A;  5E7N A;  3CCE A;  1C0A A;  1GD7 A;  1S72 A;  2F3I A;  4U0S A;  1Q82 C;  1A0I A;  1WYD A;  1V1Q A;  5CMT A;  4QL5 A;  3AFQ A;  2N49 A;  1SLJ A;  4P71 A;  1K0R A;  1VS0 A;  1N36 Q;  3W5O A;  4IOA A;  1YIT A;  1PHJ A;  3AEV A;  3ZC7 A;  1CKN A;  3U58 A;  1GO3 E;  1MIU A;  1XPU A;  2D0P A;  3J7A 5;  1H95 A;  5CGL A;  1YI2 A;  2BA1 A;  2GVA A;  5H1S E;  4B3T Q;  3E9I A;  1BBU A;  1PH2 A;  2AWO A;  1B8A A;  5JJK A;  3S15 H;  4RG1 A;  4JBW A;  1N32 Q;  4UY8 C;  1KAW A;  1Q1B A;  4A3J G;  3F1Z A;  4A3D H;  4K0K Q;  2ZM6 L;  3E9H A;  3L2P A;  1PFS A;  4N67 A;  4YCV A;  1IBK Q;  1GKH A;  5HY6 A;  2K50 A;  3A0J A;  2QGQ A;  4HJ8 A;  1WCM G;  3PO2 G;  4DAY B;  4KHP Q;  4A3E H;  3A5Z B;  2MNA A;  1NJI C;  2JA5 H;  1GVP A;  1PYB A;  1XJV A;  5FLM H;  1SRU A;  4GOP A;  3AYH B;  2N3S A;  4BBR H;  3H0G H;  2Q2U A;  3LGJ A;  1CSP A;  2K75 A;  2VQE Q;  1KQS A;  4LFB Q;  1HZA A;  1X3E A;  3PIO A;  4DUY L;  1Z47 A;  4HJ7 A;  1W3S A;  4AQY Q;  1HNX Q;  1HR0 L;  4BXX H;  1JJ2 A;  1OXU A;  5LMN L;  5IP9 H;  3G4S A;  1IBL Q;  4JI8 Q;  3CC2 A;  2Z6K C;  3DM3 A;  4QIW E;  4POG A;  1XNQ Q;  2JA7 H;  3F8T A;  1V9P A;  4A3B G;  2OTJ A;  1SMX A;  1VQJ A;  1Y1W H;  1KD1 C;  1NTG A;  2WB1 G;  4X6A H;  3VDY A;  2DUD A;  3LET A;  3BZK A;  4L5Q A;  3ULJ A;  4DV4 L;  1J6Q A;  2CWP A;  2XGT A;  5IWA L;  1HNZ L;  2MO0 A;  2OTL A;  1YHQ A;  2K5H A;  3S17 H;  4GN5 A;  1R9T H;  4BBS H;  2IHF A;  3ICE A;  2F6S A;  4X62 Q;  4MNO A;  2EXD A;  4DNI A;  4MTN A;  4UPA A;  3JAM c;  3F2C A;  3GTM H;  2ZTE A;  4IPC A;  2E2J H;  1KXL A;  2RCN A;  2I5L X;  3ZJY C;  3KDF B;  4JI5 Q;  5C4J H;  1N34 L;  2NVX H;  2JJQ A;  4EQ5 A;  3UE1 A;  1V43 A;  3CCJ A;  2NVT H;  4A3C G;  1VQF A;  2D62 A;  4H02 A;  1AE2 A;  4LFC L;  1Q86 C;  2R7Z H;  5JJI A;  3CXC A;  2Y0S E;  1QZH A;  4JI6 Q;  4C2M H;  1BKB A;  3PF5 A;  1PH7 A;  2K4K A;  2CWA A;  4JI3 L;  2NZO A;  3OW2 A;  1IZ6 A;  1YJ9 A;  1NBW A;  3I56 A;  3J80 c;  1WFQ A;  3M4P A;  3M4Q A;  4DPG A;  4DV3 Q;  1I94 L;  3I4N G;  4NXN L;  5IP7 H;  4DV0 L;  2JA6 G;  5LMU L;  4A3G H;  2NVY H;  3RN2 A;  3ZCB A;  3NBH B;  4GLX A;  1X54 A;  4JI7 L;  1FJG Q;  5FJ8 H;  1RIP A;  2NVQ H;  1B7Y B;  2UUC Q;  2PNH A;  1VQI A;  5IT9 c;  1D7Q A;  3CC7 A;  5IE8 A;  4JI2 Q;  4OWX B;  1X6O A;  2KEN A;  4X64 L;  2KHJ A;  4LF7 Q;  3RZD H;  4P74 A;  5GQO A;  2UUA Q;  4Y52 H;  4R4Q A;  5AJ3 L;  4DV1 L;  4RMF A;  1UE5 A;  1VQ4 A;  1OXX K;  4IFD J;  1QVG A;  4OWW B;  4JBJ A;  5JEA J;  2H5X A;  3FKI H;  2UXC Q;  1OXV A;  3STB D;  3OYY A;  3KDF A;  3T1H Q;  2NN6 I;  1PH4 A;  4B3S Q;  4BY1 G;  5C0X I;  1JE5 A;  4B3M Q;  4P72 A;  2A8V A;  2NN6 G;  1N8R C;  1K8A C;  4A3L G;  5C0X G;  4L5T A;  4KI0 A;  2JK8 A;  3I2Z A;  5DLQ E;  3K7U C;  3OTO Q;  3CPF A;  2PMZ E;  4DR1 Q;  1CKN B;  4JCV E;  3PV0 A;  4IOC A;  3EN2 A;  5GAE C;  4YWL A;  4LF9 Q;  1X65 A;  3S1N H;  1Z9F A;  4DR6 Q;  1N9W A;  3F2B A;  2VUM G;  4UP7 A;  4X66 Q;  4IFD G;  2B3G A;  1VQO A;  4LF5 Q;  3CP0 A;  2F52 A;  4AYB G;  3CQZ H;  1HH2 P;  2A19 A;  1Q46 A;  2HIX A;  5M3F G;  4JV5 Q;  4WJ3 M;  1LYL A;  3TQY A;  2QEX A;  2ES2 A;  4B3T L;  2R93 H;  4X65 Q;  1I5F A;  1E24 A;  1MJC A;  2OCE A;  3IRB A;  4KHZ A;  2V1C C;  3HOZ H;  1IBK L;  1JJC B;  1VQA A;  2ALY B;  3M85 A;  3DLL A;  4DUZ Q;  4GOP B;  3HOY H;  2HQL A;  2KBN A;  1T9H A;  4KHP L;  1YZ6 A;  4GKJ L;  2AWN A;  2ZJP A;  1XNR Q;  1XPR A;  1N33 L;  1DGS A;  4ITR A;  3SN9 A;  3S2D H;  4X2E A;  4JBK A;  3I7F A;  3TEH B;  3T1Y Q;  1CUK A;  2L15 A;  1WI5 A;  3WWV A;  1HZC A;  3G71 A;  4A3E G;  1HR0 W;  5JJ7 A;  4O0A A;  2VQE L;  4A3I H;  2JA5 G;  5LMN W;  4LFB L;  5FLM G;  2ZJQ A;  2B63 G;  1VQE A;  4AQY L;  4DV5 Q;  2IHE A;  4BBR G;  3SHG A;  3CCQ A;  4R4O A;  1KIX A;  1SN8 A;  3CCM A;  1XNQ L;  3CF5 A;  2WB1 E;  4PZ6 A;  5ELO A;  4IPD A;  4DR4 L;  2ID0 A;  2OWO A;  4C3I H;  4BXX G;  5C4X H;  3J7Z C;  1TWH H;  2E5L L;  1L0W A;  4BA1 I;  2N78 A;  1VQ6 A;  4GKK Q;  4A3K H;  3HOX G;  2UU9 L;  4LF4 L;  2JA7 G;  2HT1 A;  2OQK A;  3H3V I;  1Y1W G;  1EUJ A;  3GTG H;  2FXQ A;  3EBE A;  3TRE A;  4NXM Q;  4A93 H;  3KYH C;  3FHW A;  4LUO A;  4A3M G;  1VQB A;  3HOV G;  4LU4 A;  4TVA B;  1PV4 A;  4M16 A;  1HJP A;  4JYA L;  4A75 A;  1LM0 A;  4JI5 L;  4JOI A;  3U50 C;  3G6E A;  4A3F G;  1MJE A;  1E1T A;  1G29 1;  1QZG A;  1K9M C;  1VQG A;  2R7F A;  4DV7 Q;  2I0Q A;  3PF4 A;  4LWC A;  4LF8 L;  3HOW G;  3CCV A;  2R92 G;  1AE3 A;  4YY3 Q;  4APV A;  4IJL A;  1PH8 A;  2UUB L;  2YTX A;  3RZO H;  4JI0 L;  1L1O A;  2HHH Q;  1NMF A;  3BU2 A;  2JEB I;  3M3Y H;  1IBM Q;  5C3E H;  4BY7 H;  4DR3 L;  1YIJ A;  4HJA A;  2CQO A;  3I4M H;  2R7Z G;  4DV3 L;  2EIF A;  3CMA A;  1YVC A;  1ASZ A;  4J15 A;  4OX9 Q;  4DR2 L;  1YEZ A;  1VQN A;  1A8V A;  1FJG L;  3I55 A;  3W1B A;  4DK6 C;  3TRZ A;  4DR7 L;  3ER0 A;  1W2B A;  2UXD L;  1PH9 A;  3PUX A;  2BA0 A;  2RHQ B;  1J5E Q;  2LXK A;  5K36 G;  4LF7 L;  1YHA A;  2A1A A;  1KC8 C;  4JC0 A;  5M3M G;  2MFI A;  1OXT A;  3CC4 A;  3K0X A;  3PUZ A;  5J3B A;  3U4Z A;  4ALP A;  4DV6 L;  1C7Y A;  1PVO A;  1WJJ A;  3KLW A;  2UXC L;  1NE3 A;  1Y1V H;  2IT1 A;  3KFU A;  2K5N A;  1VQL A;  4HIO A;  4A3J H;  3HOU H;  1S40 A;  2LSS A;  4P75 A;  3S14 H;  3SE5 A;  4AIM A;  1WCM H;  4U04 A;  1WOC A;  2RHS B;  3K81 C;  4LF9 L;  1SE8 A;  4DR6 L;  4WJ4 A;  2F4V L;  3PO3 H;  3CD6 A;  5M5W H;  2RF4 A;  2YTY A;  4X66 L;  1KL9 A;  3PCO B;  3SGI A;  1E7Z A;  2IX1 A;  4LF5 L;  3RLF A;  1BVS A;  5GRO A;  5IYB G;  3S24 A;  4U07 A;  1U5K A;  1I3Q H;  1HZB A;  1CKM A;  4LF6 Q;  3PSI A;  4JI4 Q;  4R1J A;  4GOP C;  1LUZ A;  4OO1 I;  1X3G A;  1FGU A;  1YBY A;  1IXR A;  4X2D A;  4DUY Q;  3K8A A;  3GTO H;  4OO1 G;  2VNU D;  1HR0 Q;  4O2D A;  4DUZ L;  3M4O H;  5LMN Q;  3PUV A;  4GLA C;  4AH6 A;  1XNR L;  3N3U A;  3HOZ G;  4B3R L;  2ZTD A;  1VQP A;  1TWF H;  2AMC B;  2D0O A;  1CKO A;  4YCU A;  3HOY G;  4JI1 Q;  3PGZ A;  2VQF Q;  3CCL A;  2PI2 E;  4DV4 Q;  2BH8 A;  5GAG C;  5IWA Q;  3A5U A;  1HNZ Q;  2G03 A;  1VQK A;  1NMG A;  3A74 A;  4L5R C;  4DV5 L;  1M1K C;  1N36 L;  4PY3 A;  1UE6 A;  5M5Y H;  4A3I G;  4NB3 A;  1CSQ A;  4GNX B;  3GTK H;  2ATW A;  1PA6 A;  1UEB A;  4A3C H;  4GN3 B;  1JJG A;  2EQS A;  3HKS A;  3RR5 A;  3HKZ G;  1VCI A;  3ERS X;  3ULL A;  4A76 A;  2JA8 H;  2HIV A;  3CCS A;  1N34 Q;  1VQM A;  1N32 L;  4HIK A;  1K8G A;  2KCM A;  2GN5 A;  4K0K L;  4U0Z A;  3RLN A;  4DV2 Q;  3I4O A;  5C4X G;  1ASY A;  1PH3 A;  1JT8 A;  4YHH Q;  4X2C A;  3S16 H;  2VW9 A;  2XTI A;  5IY0 A;  3I4N H;  3K80 C;  4GLV B;  5JFZ A;  3M7N A;  3TS2 A;  4A3D G;  1D8L A;  5EAY A;  1HZ9 A;  2E2I H;  2OQ0 A;  4A93 G;  4NXN Q;  3GTP H;  4P73 A;  2IX0 A;  4DV0 Q;  2B29 A;  5LMU Q;  3NEM A;  4QGU A;  5JJ6 A;  4JI7 Q;  1BBW A;  4QJF A;  1L1O B;  5IYC H;  1P16 A;  4YY3 L;  1HNX L;  2VL6 A;  1OTC A;  1EQQ A;  2CCZ A;  3H0G G;  3G48 A;  1Q1E A;  2Z6K A;  5BR8 Q;  1IBL L;  2JE6 I;  4JI8 L;  4X64 Q;  1EIF A;  2YU9 H;  3RN5 A;  1X56 A;  2ZJR A;  1I6H H;  1OXS C;  3MEF A;  1TWA H;  2PQA A;  4LFA Q;  1EYG A;  5AJ3 Q;  4DV1 Q;  4UP8 A;  1LTL A;  1VQC A;  2YYZ A;  4GNX A;  5IP9 G;  3S1R H;  1XMO Q;  2VS1 A;  4YCW A;  3F2D A;  1FL0 A;  5IYD H;  3GTL H;  3S1M H;  2AHO B;  3BZC A;  3S2H H;  2R6G A;  4GS3 A;  1J5E L;  4IPG A;  4IO9 A;  4X62 L;  2VUM H;  1E3P A;  1VQ8 A;  2Q2T A;  2WP8 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...