4U0ZA

Eukaryotic fic domain containing protein with bound apcpp
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
328
structure length
322
Chain Sequence
EARAALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Adenosine monophosphate-protein transferase FICD
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 322
sequence length 328
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u0zA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u0zA01
4NPSA 5C1DA 3Q47B 3CVLA 3Q15A 3ULQA 2VQ2A 3KS2A 2XGOA 3U3WA 2LNIA 3SE5A 4XI0A 3IEGA 4UI9K 5BT1A 3AS8A 4N39A 4GZ5A 4Y6WA 3RKVA 1ELRA 4J0UA 3VTXA 5FT9A 3S7BA 3AS4A 3JYSA 2V5FA 4F3VA 4WNFA 1IYGA 3KAEA 3LCAA 4O6FA 2VYIA 3AS5A 3TG5A 5CKLA 2BUGA 2Y4TA 5BW8C 4HOTA 2MHKA 3BEEA 5JJTA 5ARFA 5FZRA 4UQXA 3MA5A 5DIZA 4J8EA 1ELWA 4G26A 3ZLMA 4GPKA 4IN3B 1W3BA 5FZQA 2UWJG 2FEZA 2HO1A 4N3AA 1OUVA 2UY1B 5JJ6A 3MV2B 4G24A 4WUYA 1FCHA 5AYWD 1NZNA 1QZ2A 3URZA 2VGYA 3ASGA 1ZU2A 5G05C 4JHRA 4ITRA 4WNEA 2FF4A 2F6SA 2R5SA 3SHGA 3RIBA 5KJMA 5M72A 3E4BA 2VZAA 4HOUA 3MKRA 2KCVA 4HOQA 3Q49B 4GYYA 1A17A 4I9EA 3FWVA 4X2CA 3CEQA 3RJVA 2G03A 3QWVA 3ZC7A 2JK8A 3CKCA 4GCOA 2PL2A 4WGJA 1NA3A 2KCKA 3ASFA 3SN9A 5FZSA 3N3UA 4EQFA 3O48A 4GZ3A 4I2WA 1ZBPA 3ZHEA 3UQ3A 2PQNA 4RG6A 5DBKA 3Q5MA 2FBNA 1IHGA 3QDNA 5HQ8A 3GZ1A 3FP3A 5ARGA 4U0SA 1YA0A 4LU4A 5JJ7A 4AIFA 5JFZA 3CKBA 3LKUA 5FJYA 4G1TA 4CDRA 4UQZA 1B89A 4B94A 3RU0A 4G2VA 4GYOA 4NQ0A 2IFUA 4LEUA 3LY8A 5A7DB 3ZN3A 5EX3A 3S7DA 3UPVA 4A1SA 3CVPA 4ME2A 5D0QD 4U0UA 2FO7A 2LSVA 2JLBA 4H7YA 2WQHA 5EX0A 3LPZA 5CCMA 3RO3A 1Y8MA 2VGXB 4N3BA 5CGLA 2I6HA 3QOUA 1KT0A 5CMTA 3Q4AB 3ZGQA 2XGMA 4BT8A 4GA1A 3S6AA 4JA7A 2QFCA 5KJLA 4YVOA 4BTBA 2KCLA 4G25A 5G05J 4J8FA 4UI9J 2PQRA 4U07A 2KATA 2NC9A 2LSUA 5LCWC 4UI9C 3MV3B 4J8DA 4BWRA 5G04C 4U0ZA 3TG4A 3EDTB 3LY9A 4CGWA 3S7FA 4X2EA 2XGSA 4XI9A 3K9IA 3FFLA 3S7JA 4KXKB 4AM9A 5CHEE 3VTYA 3SZ7A 3WXXA 3R9AB 2FI7A 3TGOA 5BNWA 4H7XA 2YHCA 2VY3A 1KT1A 1P5QA 4NRHB 3MEKA 3OXGA 4G23A 4I17A 3HYMB 1PC2A 4JL0A 3ESKA 4HOSA 4XI8A 4W9RA 4Y6CA 4YVQC 3OXLA 4YNDA 2OOEA 3CVQA 3UUXA 3GZ2A 3CVNA 2Y4UA 1E96B 4AY6A 4U04A 4BTAA 2XCBA 4N5CA 1WM5A 3OXFA 1NA0A 5HI7A 4APOA 3PE4A 5A6CA 4KBQA 3CK9A 2HR2A 4I9CA 3CUCA 2C0LA 3GW4A 3PDNA 3CK8A 4GZ6A 2WPVA 4GYWA 3ASHA 2PZIA 3QWWA 2L6JA 2HYZA 5EU0A 5D0OD 1HZ4A 3LETA 3LYAA 4PY3A 4WNDA 4ABNA 3RO2A 4N67A 4CGVA 1QQEA 3PE3A 4N2SA 3ZCBA 4I2ZA 3QKYA 2P58C 4KYOB 3ZPJA 1HXIA 2J9QA 5LCWJ 3N71A 4HORA 5KJKA 4AY5A 5G04J 3QWPA 3NF1A 1WAO1 2AVPA 3ZHEB 4GCNA 2ONDA 1XNFA 3ASDA 2KC7A 2DBAA 1HH8A 1KLXA 4UQYA 3TAXA 4RG9A 2IF4A 2XEVA 2E2EA 4JA9A 3CK7A 5CCLA 2VSYA 4GA0A 2VSNA 3KD7A 5JFFA 1TJCA 2C2LA 2GW1A 5EKQD 4GA2A 3LY7A 3ZFWA 2XCCA 5FTPA 3GYZA 4N2QA 2XPIA 4X2DA 4I1AA 4XIFA 4BT9A 4M16A 3U4TA 2VGXA 2Q7FA 3CV0A 3SF4A 4N3CA 4WNGA 2C0MA 2YQ8A 5KJNA 2UY1A
chains in the Genus database with same CATH superfamily
4B8CB 3Q47B 3Q15A 5G2NA 2AW6A 4OVUA 4WWPA 2WVIA 2XZTG 3AS8A 2KZTA 3HG0D 4GZ5A 1ELRA 4J0UA 4ANVA 2WM9A 1OCZE 1TNOA 3C72A 3JYSA 4HB5A 2XHEA 4CZ2D 4DJAA 1IYGA 5EIDA 3MKQB 3AS5A 4F1SA 2L6BA 4LERA 4JXTA 1OY3D 3DPYA 3ZKJA 2R17C 5LFAA 5FZRA 3TWWA 4YDOA 3FY4A 2H6GA 3UIPC 1ELWA 4G26A 4FP7A 2XS1A 4OAVB 5E76A 1E8ZA 3FEXA 2UWJG 4FU3A 2HO1A 3Q73A 4B8AA 1QBQA 1OT8A 2UY1B 2YINA 3CHQA 3T8KA 2CHXA 4APFA 1HG5A 3MV2B 4G24A 2MRIA 4WUYA 3U64A 2ILRA 1FCHA 4ANWA 2WXHA 3URZA 3ASGA 2CG2A 2NYJA 4GMRA 5G05C 3PNTB 3FDHA 4ITRA 4K03A 2F6SA 2BEDA 3HIZA 1E7VA 1MQSA 2L0TB 3QK0A 4NIKA 1N11A 2XQ0A 2VZAA 4HOUA 3FTSA 2EIME 4HOQA 1NH1A 4I9EA 1FT1A 3FUNA 4IRUA 5ANLA 3ASNE 5CBNA 2I2OA 1EYHA 3TWXA 3EHRA 2IO2C 3CKCA 4GCOA 3ABKE 2KCKA 3ASFA 2I9CA 5ENPD 3UQ3A 2PQNA 3ISMC 5DBKA 2V0PA 2FBNA 3QDNA 1MHQA 3GZ1A 5LP0A 1UN9A 4AIFA 3CKBA 1Z6TA 2LXLA 3LKUA 5FJYA 3AG4E 3PNLB 5C2YA 3DXMG 1B89A 5H7PA 2DVWA 3L17A 1O1SA 3LY8A 5FQ7A 3S7DA 1E7UA 3UPVA 1BI7B 3CVPA 4ME2A 3DSWA 5D0QD 3FHEA 3CVWA 2FO7A 2QYUA 3LVQE 3I3NA 4LNGA 4TUUA 3X2QE 2QYJA 3PVLA 3VLFA 2JABA 2NUNA 2VGXB 4IULA 4EBAA 5ITZF 4HVBA 3NQPA 5CMTA 4XZ4A 5BXOA 3PEUB 3S6AA 4JA7A 4OYSA 2ZGGA 5KJLA 2FULA 2WQ7A 4KZCA 4YVOA 5AARA 3UKUG 1BI8B 4HS2A 1TNBA 1YYHA 4HRMB 3J5PA 4CDNA 1NL4A 2NC9A 4DUIA 3L54A 4UI9C 1NFIE 1HO8A 4U0ZA 3IHYA 2XPZA 5B1AE 3G2SA 3LEWA 4J6IA 4X8QA 3ZYQA 4KXKB 1MJ0A 2P9NG 3VTYA 4JC8A 3FTYA 3R9AB 3ULEG 2YHCA 2VY3A 4AP2A 4NRHB 3MEKA 4G23A 4L7TA 3D9OA 3HYMB 3UM2A 3AJIA 1E8YA 2DCPA 3UM1A 4W9RA 4YNDA 4J8SA 3L13A 2OEVA 3FTXA 3CQGB 4AY6A 2IJGX 2EILE 4UUCA 4A63B 1TJFA 5CRVA 2GRRB 1O1TA 4BSZB 5IY5E 4BTAA 3OXFA 3U9WA 3UT8A 1NA0A 4AOFA 3HXDA 1H19A 5BXUA 2V5QC 2HR2A 2EIKE 3FH5A 4A3VA 4HQDA 1VDYA 2WPVA 2PNNA 2P9SG 3V2OA 2L6JA 3W9GA 3MCXA 5KNHD 4JEUA 5EDSA 1N95A 4KT6B 4PH4B 4PY3A 4WNDA 5EN5D 1FPPA 3FH7A 4N67A 1FVHA 1QQEA 3KSLA 3FUJA 1AWCB 2P9KG 3D3MA 3V2XA 1JCQA 1HXIA 3JQ1A 2J9QA 2F0YA 2VTBA 3DRAA 4CT0A 5G04J 3NF1A 3HXCA 4BERA 4GPMA 4B93B 2WXQA 1OWPA 4IYPA 2MYOA 3UINC 3CSFA 3TWUA 4HRLA 4K0RA 2EINE 2OCCE 3ZFWA 3SHFA 3AG2E 4I1AA 4GTMA 2BKGA 2KBXA 4V3IA 3SNXA 4K5AB 4GTTA 2Q7FA 3U66A 4ILIA 4AV7A 4WNGA 2C0MA 3EIQC 2QZAA 2GRNB 2RFAA 3ONKA 1S70B 4HLLA 2YQ8A 5KJNA 1IHBA 1H6KA 3ULQA 2VQ2A 2XRZA 4DPRA 2XGOA 2LUHA 3SE5A 1ZB1A 4U96D 2LXMA 2KXPC 3DBSA 3RKVA 3LVRE 2P9PG 5FT9A 4FJYA 4F3VA 1LD8A 3W9FA 5FIOA 1NI1A 2VYIA 3DSVA 3VLEA 3CHOA 5HS0A 1MYOA 3CVUA 1N52A 4HOTA 3NZUA 2MHKA 3JCKC 4UWLA 3ABME 5ARFA 3CR3A 3MA5A 4PS7A 2OVFA 2J49A 5DIZA 3ZLMA 4RLYA 5CECB 3SBSA 4GPKA 1W3BA 2F8YA 2DZOA 2FEZA 4DLOA 4N3AA 1OUVA 1RW2A 3LXUX 4ILHB 3TJPA 3FUDA 5AJDA 4TV3A 4BESA 3LDZA 4DX1A 2FF4A 5D66A 2R5SA 1X81A 5FINA 3FTWA 3UM0A 1FT2A 1ELKA 1GW6A 1Z3XA 3E4BA 4CCAA 4U8VD 3DXKG 3Q49B 2BTDA 4GB9A 4UWGA 3FWVA 3FTUA 3CEQA 3B7RL 3RJVA 3ZC7A 4Q96A 4GMLA 2FO1E 3FU3A 2DYSE 3HXFA 5E75A 2PL2A 4WGJA 3UXGA 4EZLA 2X6HA 3CLJA 4YDWA 3N3UA 1EF1C 3O48A 4I2WA 1ZBPA 3ZHEA 1BU9A 2WXFA 2RFMA 1BD8A 1IHGA 5HQ8A 4K5CA 2Y3AA 3FP3A 5ARGA 3HVEA 2WMNA 4O1PA 1YA0A 4U0SA 4JPSA 4LU4A 4D10C 4GTSA 5KCMA 4DX2A 3ZUVB 4Q69A 2GRLA 4B94A 4DX7D 4EBAG 3CVVA 3P1UA 4LEUA 4CDMA 2VSOE 5EX3A 5BV1A 3BG1B 4G8LA 4GZCA 4JHKA 3D9LA 4CYMD 4A1SA 2WXNA 2LSVA 2WXOA 3L82A 4G11A 4L23A 2JLBA 3APDA 3DSUA 4AXHA 3EUVA 2I1JA 3VLDA 5CCMA 2I6HA 3SY2A 3Q9NC 3UT4A 4LG6A 4QFVA 3ENEA 3NZSA 4GMJA 1JCSA 2KCLA 4J8FA 4FHJA 3TWSA 2H6HA 2OV8A 2V4HC 3ONLA 3L08A 4XKBA 4UWKA 4DRXE 5BV0A 1JCRA 5G04C 4WWOA 4ATZD 2ETAA 1UOHA 2KZTB 3TG4A 1H6OA 3BG0B 2XEEA 3L16A 1SA4A 3K9IA 3PZ3A 3QB2A 2RKKA 4TXRA 3ZEFA 4AM9A 3SZ7A 3T9KA 1V55E 5ENRD 3TWVA 3PREA 3DSSA 3CIAA 3OXGA 4I17A 1OCRE 1H6PA 3ZXPA 1Z3YA 4TXPA 1QYMA 4N5QA 4YVQC 3OXLA 4RSYA 3NBNB 3GZ2A 2LAHA 4LSZE 3CGHA 3ULYA 2J09A 4XE0A 3D9PA 4FULA 1LF8A 4N5CA 1WM5A 4APOA 2GGFA 3PE4A 3AU4A 4KBQA 5AQ9A 2ZGDA 1WG0A 3CK8A 3PZDA 4GAAA 4GYWA 2GRQB 2PZIA 3ASHA 3QWWA 4LRZA 3AU5A 3B7UX 1UW4B 1N4QA 3FUFA 2CG3A 3DPDA 3KEZA 1HU3A 1IKND 4BX9A 5AAOA 2I1KA 1UJJA 2AXUA 3T5XA 4CGVA 5AQAA 1HF8A 3PE3A 4JZYA 2OEWA 1N4PA 2X38A 3ZCBA 4I2ZA 3QKYA 4ACLA 3V30A 4DK5A 3APCA 4TXQA 5LCWJ 3UMVA 3KSQA 5EIBE 2P2CP 1WAO1 2AVPA 2P9LG 1HG2A 4JEHA 2BKKB 3R7QA 3BU8A 4J7WA 1XNFA 3ASDA 1PY1A 4TRQA 2R02A 2DBAA 2P9UG 3D9MA 4UQYA 2LO6A 3TAXA 2VSXE 4RG9A 4YDEA 4MBGA 3UIOC 5CCLA 4URKA 1TNZA 5AIJA 1U2VG 3EHNA 3KD7A 5JFFA 1SZAA 2HE0A 2GW1A 3HHMA 2QC9A 3T5VA 4N2QA 2B0OE 2XPIA 4G8KA 4M16A 3U4TA 3D9JA 3IBEA 4A3TA 2J4BA 3ZIMA 4N3CA 3D9IA 5ENTD 5CERB 1OWNA 4MKTA 1QNFA 1N94A 5EYPF 3PEVB 4NPSA 5C1DA 2L9BA 3FUEA 2EQXA 4GTQA 5AQBA 2IU1A 4O60A 4CEMA 3U3WA 2LNIA 5BT1A 5CMWA 2XRYA 5ENQD 1DNPA 1YCSB 4N39A 4Y6WA 2J8SD 3VTXA 3O4ZA 3AG3E 3AS4A 1JWGA 4BX8A 3Q9UC 4WNFA 1TN7A 3KAEA 2EIJE 3LCAA 3OTNA 4O6FA 2XS8A 3L9TA 2CFZA 4MRUA 5CKLA 3FUIA 3IKOB 5BW8C 3PZ2A 1IQRA 3E37A 3DSXA 2F37A 1U3DA 5JJTA 3ZYMA 2QY7A 3FU6A 4YDYA 4BEPA 3B7TA 3V79K 4MS6A 4EPZA 4PS8A 5AJLA 2F8XK 3OAWA 3SFYA 5CBOA 5JJ6A 5BUZA 5ENNA 4DX6D 5AYWD 1H0AA 1G3NB 3FEYA 5FQ8A 3SBTB 1V54E 3QARA 2CHZA 2M63A 4WNEA 4ILGA 1MX2A 3L6AA 5KJMA 4HI8A 4JW1A 5M72A 4L9PA 3HXEA 1RZ4A 3MKRA 5HKPA 2B6CA 2AWIA 5KNGA 4WWNA 1XGWA 4X2CA 3RRUA 2VJ8A 1SVXA 1YMPA 2X6IA 1N54A 2G03A 2JK8A 5CEDB 3ZYLA 4BSXA 1NA3A 2WXRA 3SN9A 2V8SE 3C5RA 3PRZA 5A23A 1OCCE 1TR4A 3Q5MA 2VTBB 1U3CA 4OVVA 3G2UA 2XEHA 3DWLG 5JJ7A 3ML8A 5JFZA 1JPLA 3B95A 3JQ0A 3JXJA 4G1TA 4CDRA 4EZJA 4LNUD 1DVPA 2Y69E 4GTOA 2DZNA 3G2VA 4PUCA 4NQ0A 2IFUA 4L2YA 2H6FA 3ZN3A 1KZOA 5LOZA 2WXGA 2BF0X 2X6FA 2VGEA 4I43A 4H7YA 3LS8A 2WQHA 2A5UA 1D8DA 2IONA 4KVMA 2J4DA 4M3OA 3RO3A 1LTXA 4N3BA 5CGLA 4U7EB 3B7SA 4O1OA 1KT0A 2IO3C 1BLXB 4LNBA 2XGMA 4BT8A 3C3RA 3CVYA 4I6EA 4F1PA 3ABLE 4G25A 2JEKA 1LD7A 2WXLA 4UI9J 3R7RA 2KATA 2R03A 2WXKA 4M7CA 1K3ZD 2L0IA 4XX5A 1TYQG 3APFA 4K5BA 5LCWC 1TN6A 3ZU7B 2ZXWE 4LCTA 3FTZA 4CGWA 3S7FA 3FULA 2XGSA 4BETA 3FFLA 3S2AA 3S7JA 1N4RA 3TXMA 4F6RD 4U8YD 4U8HA 4I1OB 5CHEE 2ZU6B 3WXXA 3EHQA 3I5PA 5BNWA 3ZRHA 3DEPA 3D9KA 3Q7FA 3V31A 4HOSA 1PAQA 5AQ7A 3PUKA 3FUKA 3PUJA 4XI8A 4C9BB 3CVXA 4Z68A 2OOEA 4C48B 4CT4A 3CVNA 2ZISA 1INZA 1E96B 3JUIA 5JMND 3Q75A 4U04A 1HFAA 1KZPA 3ASOE 4UWFA 4BFRA 3C3OA 2X3MA 2LAIA 4F7AA 3CK9A 4I9CA 3CUCA 5ENSD 3EU9A 3GW4A 3IV0A 4GZ6A 4KMOA 3SI5A 3CHRA 3ESLA 5EU0A 4JHJA 5D0OD 1S64A 3HDXA 2R2LA 3RK6A 3L22A 4FLBA 2WXMA 3LYAA 1WDYA 3AAAC 5LX8A 3FUMA 4ABNA 3EHMA 5HRYA 2E0IA 1HE8A 4N2SA 3RAUA 1E8WA 2J07A 2NUDA 4KYOB 3ZPJA 3UTMA 5KJKA 1H2VC 3QWPA 2WB2A 4EZKA 3ZHEB 4GCNA 1S63A 1L5JA 1DCQA 5FWQA 3HVEB 1K1AA 3MYVA 4HXIA 1KLXA 3FU0A 3PZ1A 1SZ9A 1SA5A 2IF4A 2XEVA 2E2EA 4JA9A 4Q94A 5AN8A 5G55A 4GA0A 2VSNA 2XENA 1TJCA 5KWDA 2DIWA 2C2LA 3LY7A 3GYZA 4GTRA 4XIFA 4C0MA 2A5EA 1A5EA 3Q7AA 5EYLA 2VGXA 3R9MA 3FU5A 2H6IA 4RQIA 3FH8A 1N4SA 4JB8P 4GZDA 1E8XA 4AEZC 4PDXA 2AJAA 3DSTA 5ENOD 3ZXSA 3CVLA 2RG8A 3KS2A 4E6HA 5CRUA 3QJZA 1UN8A 1MX6A 3J5QB 3IEGA 4UI9K 4XI0A 3MJWA 2YNQA 4A55A 4FC8A 1TNYA 4GTVA 3SQVA 2RD0A 3QNKA 2GRPB 3HXBA 3NAWA 3S7BA 4GU5A 2NXPA 3B7BA 1UJKA 5J90A 2V5FA 1SW6A 1EDUA 2R59A 1D9SA 4DI4A 3TG5A 4F53A 2BUGA 1D8EA 2Y4TA 2R05A 3BEEA 3B13A 1FVFA 4U63A 4UQXA 3G2WA 4J8EA 3AG1E 3SFXA 1E90A 4IN3B 3SD5A 5FZQA 4QQIA 5FQ6A 2Y0BG 3TL5A 3C3QA 1NZNA 1QZ2A 3G2TA 2VGYA 5CEAA 1ZU2A 1H2TC 4JHRA 4FJZA 3KEAA 5ANRA 3EJNA 1Y6IA 4EHMA 4I6GA 5T4YA 3SHGA 3RIBA 2WXIA 4UWHA 3TXNA 2KCVA 4GYYA 1A17A 4L1BA 3BQOA 3BUAA 1IXVA 3SO8A 3PZ4A 4NACA 3E32A 1DC2A 3QWVA 3RRMB 3TWQA 4KZ0A 2WXPA 2X6JA 1K8KG 5FZSA 3CHSA 4EQFA 4GZ3A 4DI3A 2OVBA 4B89A 3Q79A 4RG6A 4HI9A 5B3SE 3TWRA 3NB2A 3ZYKA 4PS3A 3QC1A 3DEOA 5T8IA 4JVSA 4JD2G 3UM3A 2PM7A 5FQ4A 1JUQA 4UQZA 1S0PA 3FTVA 3RU0A 4G2VA 4GYOA 3CHPA 2PM6A 5A7DB 3QAQA 1MX4A 1DCEA 4ACKA 3GZSA 4C0EA 3MZLB 4U0UA 1O1RA 5T3RA 2IOSA 3IXEA 3FUHA 5EILA 1KPSB 5JHAA 5KBAA 5EX0A 3RSEG 4AJWA 3LPZA 2AXVA 2WMOA 1IQUA 1Y8MA 4DX5D 3QOUA 2ZIRA 3Q4AB 1N0QA 2MOWA 3E30A 3TWTA 2AXZA 3ZGQA 4I1MA 5CMYA 4GA1A 2QFCA 2DYRE 2WXJA 4FHKA 4XEIG 1MZCA 4BTBA 1OWLA 3CQCB 1OCOE 5G05J 3UX4A 3NOCD 5JHBA 3P2BA 2PQRA 4U07A 2KM4A 5J08A 2XZDG 2LSUA 4A1GA 3T8MA 3D9NA 3C98A 3MV3B 4J8DA 4BY6A 2ETBA 4HFGA 4BWRA 3EDTB 3LY9A 4CRWA 4X2EA 4I6JA 4XI9A 4U95D 2CFUA 5JA4D 2CHWA 1NP7A 1TNUA 3MX3A 1JWFA 1HX8A 2P9IG 3EIJA 2FI7A 3ZVVA 3IHVA 1HS6A 3TGOA 4H7XA 1KT1A 1N9AA 1P5QA 4HLEA 2WQ6A 1PC2A 4JL0A 3ESKA 1TEZA 4Y6CA 1OWOA 3CVQA 2A4ZA 3E34A 3UUXA 3E33A 3NOGD 3ZNGA 2Y4UA 4J8YA 2IEJA 2IY0C 2XCBA 4HRNA 1OXJA 5HI7A 4AVXA 3I4GA 4HNAD 4HBDA 2Y1LE 5A6CA 3UKRG 4GTPA 2C0LA 2GROB 3MGBA 3PDNA 3UI2A 3LJ3A 1Q2ZA 1AP7A 4WAFA 3ML9A 2GRMA 2HYZA 3PH0C 1HZ4A 1EPUA 4OAUC 2X6KA 3LETA 4NURA 1TN8A 3EU5A 2J08A 1BPOA 4B0ZA 1OWMA 4ATGA 3RO2A 2HM8A 4DLQA 4RVBA 2ETCA 1X5BA 3SGHA 3PS6A 4L2LA 4FLHA 2IOLA 5BPPA 2P58C 2YHEA 3Q78A 4ZHBA 1K1BA 4HORA 3N71A 3WG7E 4TUMA 1N0RA 3D9HA 4AY5A 2V4LA 4XKCA 4E85A 1O5MA 3SFZA 3ZW3A 4EECA 5AENA 4KVOA 2ONDA 4LUNU 3RRNB 1H2UA 4ANUA 3HRAA 2KC7A 3CHMA 4P29A 1HH8A 1SQMA 3MKQA 3I4RB 3JXIA 2NSZA 5B1BE 3CK7A 3LJNA 3F6QA 2VSYA 4FADA 4ZFHA 5EKQD 4GA2A 3CSTA 2XCCA 5FTPA 1WY6A 4X2DA 4MLPA 4ANXA 4BT9A 3UT7A 4R7LA 3CV0A 3JUEA 3SF4A 2IQCA 5D2MC 2XPYA 4FA6A 1Z5SC 1UG3A 2DWZA 2UY1A
chains in the Genus database with same CATH topology
1H6KA 4NPSA 4B8CB 2L9BA 3FUEA 3ZXSA 3Q47B 2EQXA 5C1DA 3CVLA 3Q15A 3ULQA 2VQ2A 2RG8A 2XRZA 4DPRA 2IU1A 4CEMA 3KS2A 5G2NA 2AW6A 2XGOA 3U3WA 4E6HA 2LNIA 4OVUA 4WWPA 3SE5A 2WVIA 3QJZA 1UN8A 4XI0A 3IEGA 4UI9K 3MJWA 2YNQA 3AS8A 2XRYA 4A55A 5BT1A 2KZTA 4FC8A 5CMWA 1DNPA 4N39A 4GZ5A 3DBSA 4Y6WA 3RKVA 2RD0A 3LVRE 3QNKA 1ELRA 4J0UA 4ANVA 3VTXA 3O4ZA 2WM9A 5FT9A 3S7BA 4FJYA 4GU5A 2NXPA 4PDXA 3AS4A 1JWGA 1UJKA 4BX8A 3JYSA 5J90A 2V5FA 4F3VA 1EDUA 2XHEA 4WNFA 4DJAA 1IYGA 2R59A 3KAEA 3OTNA 3LCAA 3MKQB 4O6FA 2VYIA 3AS5A 4DI4A 3TG5A 4F1SA 3VLEA 4F53A 2CFZA 4MRUA 3URZA 5CKLA 2BUGA 3FUIA 3IKOB 4LERA 4JXTA 3CHOA 2Y4TA 3CVUA 5BW8C 1N52A 4HOTA 1IQRA 3NZUA 2MHKA 3BEEA 3JCKC 4UWLA 3B13A 1U3DA 1FVFA 2R17C 5JJTA 5LFAA 5ARFA 5FZRA 3ZYMA 2QY7A 3FU6A 3CR3A 4U63A 4UQXA 3MA5A 4PS7A 3FY4A 2OVFA 3G2WA 2J49A 5DIZA 4J8EA 1ELWA 4G26A 4FP7A 3B7TA 3ZLMA 5E76A 4MS6A 3SBSA 1E90A 4GPKA 4IN3B 1W3BA 4EPZA 1E8ZA 3FEXA 4PS8A 3SD5A 5FZQA 2UWJG 4FU3A 2FEZA 5AJLA 2HO1A 4B8AA 3OAWA 4DLOA 4N3AA 1OUVA 2UY1B 3LXUX 5JJ6A 2YINA 3CHQA 5BUZA 2CHXA 4APFA 1HG5A 3MV2B 4G24A 5ENNA 5FQ6A 2MRIA 4WUYA 3U64A 2ILRA 4ILHB 1FCHA 3TL5A 5AYWD 1H0AA 4ANWA 1NZNA 1QZ2A 2WXHA 2VGYA 2CG2A 1ZU2A 3ASGA 3G2TA 3FEYA 3FUDA 1H2TC 5G05C 4JHRA 4FJZA 5AJDA 4TV3A 3PNTB 5FQ8A 3QARA 3SBTB 5ANRA 3FDHA 2CHZA 2M63A 1Y6IA 3EJNA 4ITRA 4WNEA 4K03A 4ILGA 3LDZA 4I6GA 2FF4A 5T4YA 2F6SA 2R5SA 3SHGA 3HIZA 3RIBA 3L6AA 1E7VA 1MQSA 3FTWA 2WXIA 2L0TB 4UWHA 3QK0A 5KJMA 4JW1A 5M72A 1ELKA 1GW6A 1Z3XA 2XQ0A 3E4BA 2VZAA 4HOUA 3MKRA 3FTSA 3TXNA 4CCAA 2KCVA 4HOQA 3Q49B 4GYYA 2AWIA 1A17A 2BTDA 4I9EA 4L1BA 3FUNA 4GB9A 4IRUA 3FWVA 4UWGA 4WWNA 5ANLA 1XGWA 4X2CA 3FTUA 3RRUA 2VJ8A 3CEQA 2I2OA 1EYHA 2X6IA 3B7RL 1N54A 4NACA 3RJVA 2G03A 3QWVA 3RRMB 3ZC7A 2JK8A 4Q96A 4GMLA 3FU3A 4KZ0A 3CKCA 2WXPA 3ZYLA 5E75A 4GCOA 2PL2A 4WGJA 4BSXA 1NA3A 2KCKA 3ASFA 4EZLA 2X6HA 2WXRA 3CLJA 2I9CA 2X6JA 3SN9A 2V8SE 3PRZA 3N3UA 1EF1C 3CHSA 3O48A 4GZ3A 5FZSA 2OVBA 4DI3A 4EQFA 5A23A 4I2WA 4B89A 1ZBPA 3ZHEA 3UQ3A 2WXFA 2PQNA 4RG6A 5DBKA 2V0PA 3Q5MA 3ZYKA 2FBNA 4PS3A 3QC1A 1IHGA 3QDNA 1MHQA 5HQ8A 2VTBB 3GZ1A 2Y3AA 5LP0A 3FP3A 5ARGA 3HVEA 2WMNA 1U3CA 4U0SA 1YA0A 3G2UA 4LU4A 4JPSA 4OVVA 4D10C 5JJ7A 1UN9A 3ML8A 4AIFA 5JFZA 1JPLA 3CKBA 1Z6TA 4JVSA 5T8IA 3JQ0A 3LKUA 5FJYA 4G1TA 5KCMA 4CDRA 2PM7A 3PNLB 5FQ4A 4EZJA 5C2YA 4Q69A 1JUQA 2GRLA 1DVPA 4UQZA 1B89A 1S0PA 3FTVA 4B94A 3RU0A 4G2VA 3G2VA 3L17A 4GYOA 4PUCA 4EBAG 3CHPA 4NQ0A 3CVVA 2IFUA 2PM6A 3LY8A 3P1UA 4LEUA 4L2YA 5A7DB 4CDMA 2VSOE 3ZN3A 5EX3A 5FQ7A 3S7DA 5BV1A 1E7UA 3UPVA 3BG1B 3QAQA 4GZCA 4JHKA 3D9LA 5LOZA 4ACKA 2WXGA 3GZSA 4A1SA 3CVPA 4ME2A 4C0EA 2BF0X 3MZLB 5D0QD 3FHEA 4U0UA 2WXNA 3CVWA 2FO7A 2LSVA 2X6FA 2WXOA 3LVQE 3I3NA 4TUUA 4G11A 4L23A 5T3RA 2JLBA 4I43A 2IOSA 3FUHA 3PVLA 4H7YA 3APDA 5JHAA 3LS8A 2WQHA 4AXHA 5EX0A 2I1JA 3VLFA 2A5UA 4AJWA 3LPZA 2AXVA 3VLDA 2IONA 5CCMA 4KVMA 2WMOA 2J4DA 1IQUA 4M3OA 1Y8MA 2VGXB 3RO3A 4N3BA 5CGLA 2I6HA 4IULA 4EBAA 3B7SA 3QOUA 4HVBA 1KT0A 3NQPA 5CMTA 3Q4AB 2MOWA 4XZ4A 3UT4A 4QFVA 2AXZA 3ENEA 3ZGQA 4I1MA 5CMYA 2XGMA 4BT8A 4GA1A 3NZSA 3S6AA 3PEUB 4JA7A 4OYSA 2QFCA 5KJLA 3CVYA 2WXJA 4FHKA 2FULA 2WQ7A 4GMJA 4I6EA 4KZCA 4YVOA 4BTBA 1OWLA 2KCLA 4G25A 3CQCB 2JEKA 4HS2A 5G05J 3UX4A 4J8FA 2WXLA 4FHJA 5JHBA 3P2BA 4UI9J 2PQRA 4U07A 4CDNA 2KM4A 3R7RA 2KATA 2OV8A 3ONLA 2WXKA 2NC9A 5J08A 2L0IA 4XX5A 3L08A 4XKBA 3APFA 4UWKA 2LSUA 4A1GA 3L54A 5LCWC 3T8MA 4UI9C 5BV0A 3D9NA 3C98A 3MV3B 4LCTA 4J8DA 4BY6A 1HO8A 4HFGA 5G04C 4WWOA 4BWRA 2KZTB 4U0ZA 3TG4A 3EDTB 3LY9A 3FTZA 3BG0B 4CRWA 4CGWA 3S7FA 4X2EA 4I6JA 3FULA 2XGSA 3L16A 4XI9A 3K9IA 3FFLA 3S2AA 3IHYA 3S7JA 2XPZA 2CFUA 3G2SA 2CHWA 3LEWA 1NP7A 3TXMA 4J6IA 3MX3A 1JWFA 1HX8A 3QB2A 4U8HA 3ZYQA 4KXKB 3ZEFA 4AM9A 3EIJA 4I1OB 2ZU6B 5CHEE 3VTYA 3SZ7A 4JC8A 3WXXA 3FTYA 3R9AB 2FI7A 3I5PA 3ZVVA 3IHVA 1HS6A 3TGOA 3PREA 5BNWA 4H7XA 3ZRHA 2YHCA 2VY3A 1KT1A 1P5QA 4NRHB 4AP2A 3CIAA 3MEKA 3OXGA 4G23A 3D9KA 4I17A 4L7TA 4HLEA 2WQ6A 3D9OA 3HYMB 1PC2A 4JL0A 1E8YA 3ESKA 4HOSA 1Z3YA 1TEZA 1PAQA 3TJPA 3PUKA 3FUKA 3PUJA 4XI8A 4C9BB 3CVXA 2DCPA 4W9RA 4Y6CA 4YVQC 3OXLA 4YNDA 2OOEA 4J8SA 1OWOA 3CVQA 2A4ZA 4RSYA 3UUXA 4CT4A 3GZ2A 3CVNA 2LAHA 3L13A 2Y4UA 3FTXA 3CGHA 3CQGB 1INZA 1E96B 4AY6A 2IJGX 3JUIA 1TJFA 4U04A 2J09A 4XE0A 1HFAA 3D9PA 4FULA 4BTAA 1LF8A 2XCBA 4N5CA 1WM5A 3OXFA 3U9WA 3UT8A 1NA0A 4UWFA 5HI7A 4AOFA 4AVXA 4BFRA 3I4GA 4APOA 1H19A 2GGFA 3PE4A 3AU4A 5A6CA 2X3MA 2LAIA 4F7AA 4KBQA 3CK9A 2HR2A 4I9CA 3CUCA 2C0LA 3FH5A 4A3VA 3MGBA 3GW4A 3PDNA 3CK8A 3IV0A 3PZDA 3LJ3A 4GZ6A 1VDYA 4KMOA 2WPVA 3SI5A 4WAFA 3ML9A 4GAAA 4GYWA 2PZIA 3ASHA 3QWWA 4LRZA 2L6JA 3AU5A 3B7UX 3CHRA 1UW4B 2GRMA 2HYZA 3ESLA 3FUFA 2CG3A 3MCXA 3PH0C 5EU0A 4JHJA 5D0OD 1HZ4A 3DPDA 1EPUA 3HDXA 2X6KA 3LETA 4NURA 3KEZA 1HU3A 2J08A 1BPOA 3RK6A 1OWMA 3L22A 4B0ZA 4BX9A 4FLBA 2WXMA 2I1KA 3LYAA 4JEUA 5EDSA 1UJJA 4KT6B 2AXUA 5LX8A 3FUMA 3T5XA 4PH4B 4PY3A 4WNDA 4ATGA 4ABNA 3EHMA 3FH7A 3RO2A 4N67A 2HM8A 4CGVA 1FVHA 1QQEA 4DLQA 3FUJA 4RVBA 1X5BA 2E0IA 1HE8A 1HF8A 3PE3A 4JZYA 4N2SA 3SGHA 1E8WA 3D3MA 3PS6A 4L2LA 2J07A 4FLHA 2X38A 3ZCBA 2IOLA 4I2ZA 5BPPA 3QKYA 4ACLA 2P58C 4KYOB 3ZPJA 2YHEA 1HXIA 4DK5A 3JQ1A 2J9QA 3APCA 5LCWJ 3N71A 2VTBA 3UMVA 4HORA 5KJKA 4AY5A 4CT0A 2V4LA 4XKCA 1H2VC 3QWPA 5G04J 4E85A 3NF1A 2WB2A 1WAO1 2AVPA 4EZKA 3SFZA 3ZW3A 3ZHEB 1HG2A 4EECA 4JEHA 5AENA 4GCNA 4KVOA 2ONDA 4LUNU 1L5JA 3R7QA 3RRNB 1H2UA 2WXQA 4ANUA 5FWQA 1XNFA 1OWPA 4IYPA 3ASDA 1PY1A 3HVEB 3MYVA 4TRQA 2KC7A 2DBAA 3CHMA 3CSFA 4HXIA 4P29A 1HH8A 1KLXA 3D9MA 4UQYA 2LO6A 3FU0A 1SQMA 1SZ9A 3TAXA 2VSXE 3MKQA 4RG9A 3I4RB 2IF4A 2NSZA 2E2EA 2XEVA 4K0RA 4JA9A 4Q94A 3CK7A 5CCLA 4URKA 5AIJA 5G55A 2VSYA 3EHNA 2VSNA 3KD7A 5JFFA 4GA0A 1SZAA 4FADA 1TJCA 2DIWA 2C2LA 2GW1A 5EKQD 4GA2A 3CSTA 3HHMA 3LY7A 3ZFWA 2XCCA 3T5VA 5FTPA 3SHFA 3GYZA 1WY6A 4N2QA 2XPIA 4X2DA 4MLPA 4I1AA 4ANXA 4XIFA 4BT9A 4V3IA 4M16A 3SNXA 3U4TA 4C0MA 3UT7A 3D9JA 2VGXA 3IBEA 4A3TA 3FU5A 2Q7FA 4R7LA 3CV0A 2J4BA 3SF4A 3ZIMA 4ILIA 3U66A 2IQCA 4AV7A 4N3CA 4WNGA 2C0MA 2XPYA 3D9IA 4FA6A 3EIQC 3FH8A 1OWNA 1UG3A 3ONKA 4MKTA 4GZDA 1E8XA 1QNFA 4AEZC 2YQ8A 5KJNA 2UY1A 3PEVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPS A;  5C1D A;  3Q47 B;  3CVL A;  3Q15 A;  3ULQ A;  2VQ2 A;  3KS2 A;  2XGO A;  3U3W A;  2LNI A;  3SE5 A;  4XI0 A;  3IEG A;  4UI9 K;  5BT1 A;  3AS8 A;  4N39 A;  4GZ5 A;  4Y6W A;  3RKV A;  1ELR A;  4J0U A;  3VTX A;  5FT9 A;  3S7B A;  3AS4 A;  3JYS A;  2V5F A;  4F3V A;  4WNF A;  1IYG A;  3KAE A;  3LCA A;  4O6F A;  2VYI A;  3AS5 A;  3TG5 A;  5CKL A;  2BUG A;  2Y4T A;  5BW8 C;  4HOT A;  2MHK A;  3BEE A;  5JJT A;  5ARF A;  5FZR A;  4UQX A;  3MA5 A;  5DIZ A;  4J8E A;  1ELW A;  4G26 A;  3ZLM A;  4GPK A;  4IN3 B;  1W3B A;  5FZQ A;  2UWJ G;  2FEZ A;  2HO1 A;  4N3A A;  1OUV A;  2UY1 B;  5JJ6 A;  3MV2 B;  4G24 A;  4WUY A;  1FCH A;  5AYW D;  1NZN A;  1QZ2 A;  3URZ A;  2VGY A;  3ASG A;  1ZU2 A;  5G05 C;  4JHR A;  4ITR A;  4WNE A;  2FF4 A;  2F6S A;  2R5S A;  3SHG A;  3RIB A;  5KJM A;  5M72 A;  3E4B A;  2VZA A;  4HOU A;  3MKR A;  2KCV A;  4HOQ A;  3Q49 B;  4GYY A;  1A17 A;  4I9E A;  3FWV A;  4X2C A;  3CEQ A;  3RJV A;  2G03 A;  3QWV A;  3ZC7 A;  2JK8 A;  3CKC A;  4GCO A;  2PL2 A;  4WGJ A;  1NA3 A;  2KCK A;  3ASF A;  3SN9 A;  5FZS A;  3N3U A;  4EQF A;  3O48 A;  4GZ3 A;  4I2W A;  1ZBP A;  3ZHE A;  3UQ3 A;  2PQN A;  4RG6 A;  5DBK A;  3Q5M A;  2FBN A;  1IHG A;  3QDN A;  5HQ8 A;  3GZ1 A;  3FP3 A;  5ARG A;  4U0S A;  1YA0 A;  4LU4 A;  5JJ7 A;  4AIF A;  5JFZ A;  3CKB A;  3LKU A;  5FJY A;  4G1T A;  4CDR A;  4UQZ A;  1B89 A;  4B94 A;  3RU0 A;  4G2V A;  4GYO A;  4NQ0 A;  2IFU A;  4LEU A;  3LY8 A;  5A7D B;  3ZN3 A;  5EX3 A;  3S7D A;  3UPV A;  4A1S A;  3CVP A;  4ME2 A;  5D0Q D;  4U0U A;  2FO7 A;  2LSV A;  2JLB A;  4H7Y A;  2WQH A;  5EX0 A;  3LPZ A;  5CCM A;  3RO3 A;  1Y8M A;  2VGX B;  4N3B A;  5CGL A;  2I6H A;  3QOU A;  1KT0 A;  5CMT A;  3Q4A B;  3ZGQ A;  2XGM A;  4BT8 A;  4GA1 A;  3S6A A;  4JA7 A;  2QFC A;  5KJL A;  4YVO A;  4BTB A;  2KCL A;  4G25 A;  5G05 J;  4J8F A;  4UI9 J;  2PQR A;  4U07 A;  2KAT A;  2NC9 A;  2LSU A;  5LCW C;  4UI9 C;  3MV3 B;  4J8D A;  4BWR A;  5G04 C;  4U0Z A;  3TG4 A;  3EDT B;  3LY9 A;  4CGW A;  3S7F A;  4X2E A;  2XGS A;  4XI9 A;  3K9I A;  3FFL A;  3S7J A;  4KXK B;  4AM9 A;  5CHE E;  3VTY A;  3SZ7 A;  3WXX A;  3R9A B;  2FI7 A;  3TGO A;  5BNW A;  4H7X A;  2YHC A;  2VY3 A;  1KT1 A;  1P5Q A;  4NRH B;  3MEK A;  3OXG A;  4G23 A;  4I17 A;  3HYM B;  1PC2 A;  4JL0 A;  3ESK A;  4HOS A;  4XI8 A;  4W9R A;  4Y6C A;  4YVQ C;  3OXL A;  4YND A;  2OOE A;  3CVQ A;  3UUX A;  3GZ2 A;  3CVN A;  2Y4U A;  1E96 B;  4AY6 A;  4U04 A;  4BTA A;  2XCB A;  4N5C A;  1WM5 A;  3OXF A;  1NA0 A;  5HI7 A;  4APO A;  3PE4 A;  5A6C A;  4KBQ A;  3CK9 A;  2HR2 A;  4I9C A;  3CUC A;  2C0L A;  3GW4 A;  3PDN A;  3CK8 A;  4GZ6 A;  2WPV A;  4GYW A;  3ASH A;  2PZI A;  3QWW A;  2L6J A;  2HYZ A;  5EU0 A;  5D0O D;  1HZ4 A;  3LET A;  3LYA A;  4PY3 A;  4WND A;  4ABN A;  3RO2 A;  4N67 A;  4CGV A;  1QQE A;  3PE3 A;  4N2S A;  3ZCB A;  4I2Z A;  3QKY A;  2P58 C;  4KYO B;  3ZPJ A;  1HXI A;  2J9Q A;  5LCW J;  3N71 A;  4HOR A;  5KJK A;  4AY5 A;  5G04 J;  3QWP A;  3NF1 A;  1WAO 1;  2AVP A;  3ZHE B;  4GCN A;  2OND A;  1XNF A;  3ASD A;  2KC7 A;  2DBA A;  1HH8 A;  1KLX A;  4UQY A;  3TAX A;  4RG9 A;  2IF4 A;  2XEV A;  2E2E A;  4JA9 A;  3CK7 A;  5CCL A;  2VSY A;  4GA0 A;  2VSN A;  3KD7 A;  5JFF A;  1TJC A;  2C2L A;  2GW1 A;  5EKQ D;  4GA2 A;  3LY7 A;  3ZFW A;  2XCC A;  5FTP A;  3GYZ A;  4N2Q A;  2XPI A;  4X2D A;  4I1A A;  4XIF A;  4BT9 A;  4M16 A;  3U4T A;  2VGX A;  2Q7F A;  3CV0 A;  3SF4 A;  4N3C A;  4WNG A;  2C0M A;  2YQ8 A;  5KJN A;  2UY1 A; 
#chains in the Genus database with same CATH topology
 4B8C B;  3Q47 B;  3Q15 A;  5G2N A;  2AW6 A;  4OVU A;  4WWP A;  2WVI A;  2XZT G;  3AS8 A;  2KZT A;  3HG0 D;  4GZ5 A;  1ELR A;  4J0U A;  4ANV A;  2WM9 A;  1OCZ E;  1TNO A;  3C72 A;  3JYS A;  4HB5 A;  2XHE A;  4CZ2 D;  4DJA A;  1IYG A;  5EID A;  3MKQ B;  3AS5 A;  4F1S A;  2L6B A;  4LER A;  4JXT A;  1OY3 D;  3DPY A;  3ZKJ A;  2R17 C;  5LFA A;  5FZR A;  3TWW A;  4YDO A;  3FY4 A;  2H6G A;  3UIP C;  1ELW A;  4G26 A;  4FP7 A;  2XS1 A;  4OAV B;  5E76 A;  1E8Z A;  3FEX A;  2UWJ G;  4FU3 A;  2HO1 A;  3Q73 A;  4B8A A;  1QBQ A;  1OT8 A;  2UY1 B;  2YIN A;  3CHQ A;  3T8K A;  2CHX A;  4APF A;  1HG5 A;  3MV2 B;  4G24 A;  2MRI A;  4WUY A;  3U64 A;  2ILR A;  1FCH A;  4ANW A;  2WXH A;  3URZ A;  3ASG A;  2CG2 A;  2NYJ A;  4GMR A;  5G05 C;  3PNT B;  3FDH A;  4ITR A;  4K03 A;  2F6S A;  2BED A;  3HIZ A;  1E7V A;  1MQS A;  2L0T B;  3QK0 A;  4NIK A;  1N11 A;  2XQ0 A;  2VZA A;  4HOU A;  3FTS A;  2EIM E;  4HOQ A;  1NH1 A;  4I9E A;  1FT1 A;  3FUN A;  4IRU A;  5ANL A;  3ASN E;  5CBN A;  2I2O A;  1EYH A;  3TWX A;  3EHR A;  2IO2 C;  3CKC A;  4GCO A;  3ABK E;  2KCK A;  3ASF A;  2I9C A;  5ENP D;  3UQ3 A;  2PQN A;  3ISM C;  5DBK A;  2V0P A;  2FBN A;  3QDN A;  1MHQ A;  3GZ1 A;  5LP0 A;  1UN9 A;  4AIF A;  3CKB A;  1Z6T A;  2LXL A;  3LKU A;  5FJY A;  3AG4 E;  3PNL B;  5C2Y A;  3DXM G;  1B89 A;  5H7P A;  2DVW A;  3L17 A;  1O1S A;  3LY8 A;  5FQ7 A;  3S7D A;  1E7U A;  3UPV A;  1BI7 B;  3CVP A;  4ME2 A;  3DSW A;  5D0Q D;  3FHE A;  3CVW A;  2FO7 A;  2QYU A;  3LVQ E;  3I3N A;  4LNG A;  4TUU A;  3X2Q E;  2QYJ A;  3PVL A;  3VLF A;  2JAB A;  2NUN A;  2VGX B;  4IUL A;  4EBA A;  5ITZ F;  4HVB A;  3NQP A;  5CMT A;  4XZ4 A;  5BXO A;  3PEU B;  3S6A A;  4JA7 A;  4OYS A;  2ZGG A;  5KJL A;  2FUL A;  2WQ7 A;  4KZC A;  4YVO A;  5AAR A;  3UKU G;  1BI8 B;  4HS2 A;  1TNB A;  1YYH A;  4HRM B;  3J5P A;  4CDN A;  1NL4 A;  2NC9 A;  4DUI A;  3L54 A;  4UI9 C;  1NFI E;  1HO8 A;  4U0Z A;  3IHY A;  2XPZ A;  5B1A E;  3G2S A;  3LEW A;  4J6I A;  4X8Q A;  3ZYQ A;  4KXK B;  1MJ0 A;  2P9N G;  3VTY A;  4JC8 A;  3FTY A;  3R9A B;  3ULE G;  2YHC A;  2VY3 A;  4AP2 A;  4NRH B;  3MEK A;  4G23 A;  4L7T A;  3D9O A;  3HYM B;  3UM2 A;  3AJI A;  1E8Y A;  2DCP A;  3UM1 A;  4W9R A;  4YND A;  4J8S A;  3L13 A;  2OEV A;  3FTX A;  3CQG B;  4AY6 A;  2IJG X;  2EIL E;  4UUC A;  4A63 B;  1TJF A;  5CRV A;  2GRR B;  1O1T A;  4BSZ B;  5IY5 E;  4BTA A;  3OXF A;  3U9W A;  3UT8 A;  1NA0 A;  4AOF A;  3HXD A;  1H19 A;  5BXU A;  2V5Q C;  2HR2 A;  2EIK E;  3FH5 A;  4A3V A;  4HQD A;  1VDY A;  2WPV A;  2PNN A;  2P9S G;  3V2O A;  2L6J A;  3W9G A;  3MCX A;  5KNH D;  4JEU A;  5EDS A;  1N95 A;  4KT6 B;  4PH4 B;  4PY3 A;  4WND A;  5EN5 D;  1FPP A;  3FH7 A;  4N67 A;  1FVH A;  1QQE A;  3KSL A;  3FUJ A;  1AWC B;  2P9K G;  3D3M A;  3V2X A;  1JCQ A;  1HXI A;  3JQ1 A;  2J9Q A;  2F0Y A;  2VTB A;  3DRA A;  4CT0 A;  5G04 J;  3NF1 A;  3HXC A;  4BER A;  4GPM A;  4B93 B;  2WXQ A;  1OWP A;  4IYP A;  2MYO A;  3UIN C;  3CSF A;  3TWU A;  4HRL A;  4K0R A;  2EIN E;  2OCC E;  3ZFW A;  3SHF A;  3AG2 E;  4I1A A;  4GTM A;  2BKG A;  2KBX A;  4V3I A;  3SNX A;  4K5A B;  4GTT A;  2Q7F A;  3U66 A;  4ILI A;  4AV7 A;  4WNG A;  2C0M A;  3EIQ C;  2QZA A;  2GRN B;  2RFA A;  3ONK A;  1S70 B;  4HLL A;  2YQ8 A;  5KJN A;  1IHB A;  1H6K A;  3ULQ A;  2VQ2 A;  2XRZ A;  4DPR A;  2XGO A;  2LUH A;  3SE5 A;  1ZB1 A;  4U96 D;  2LXM A;  2KXP C;  3DBS A;  3RKV A;  3LVR E;  2P9P G;  5FT9 A;  4FJY A;  4F3V A;  1LD8 A;  3W9F A;  5FIO A;  1NI1 A;  2VYI A;  3DSV A;  3VLE A;  3CHO A;  5HS0 A;  1MYO A;  3CVU A;  1N52 A;  4HOT A;  3NZU A;  2MHK A;  3JCK C;  4UWL A;  3ABM E;  5ARF A;  3CR3 A;  3MA5 A;  4PS7 A;  2OVF A;  2J49 A;  5DIZ A;  3ZLM A;  4RLY A;  5CEC B;  3SBS A;  4GPK A;  1W3B A;  2F8Y A;  2DZO A;  2FEZ A;  4DLO A;  4N3A A;  1OUV A;  1RW2 A;  3LXU X;  4ILH B;  3TJP A;  3FUD A;  5AJD A;  4TV3 A;  4BES A;  3LDZ A;  4DX1 A;  2FF4 A;  5D66 A;  2R5S A;  1X81 A;  5FIN A;  3FTW A;  3UM0 A;  1FT2 A;  1ELK A;  1GW6 A;  1Z3X A;  3E4B A;  4CCA A;  4U8V D;  3DXK G;  3Q49 B;  2BTD A;  4GB9 A;  4UWG A;  3FWV A;  3FTU A;  3CEQ A;  3B7R L;  3RJV A;  3ZC7 A;  4Q96 A;  4GML A;  2FO1 E;  3FU3 A;  2DYS E;  3HXF A;  5E75 A;  2PL2 A;  4WGJ A;  3UXG A;  4EZL A;  2X6H A;  3CLJ A;  4YDW A;  3N3U A;  1EF1 C;  3O48 A;  4I2W A;  1ZBP A;  3ZHE A;  1BU9 A;  2WXF A;  2RFM A;  1BD8 A;  1IHG A;  5HQ8 A;  4K5C A;  2Y3A A;  3FP3 A;  5ARG A;  3HVE A;  2WMN A;  4O1P A;  1YA0 A;  4U0S A;  4JPS A;  4LU4 A;  4D10 C;  4GTS A;  5KCM A;  4DX2 A;  3ZUV B;  4Q69 A;  2GRL A;  4B94 A;  4DX7 D;  4EBA G;  3CVV A;  3P1U A;  4LEU A;  4CDM A;  2VSO E;  5EX3 A;  5BV1 A;  3BG1 B;  4G8L A;  4GZC A;  4JHK A;  3D9L A;  4CYM D;  4A1S A;  2WXN A;  2LSV A;  2WXO A;  3L82 A;  4G11 A;  4L23 A;  2JLB A;  3APD A;  3DSU A;  4AXH A;  3EUV A;  2I1J A;  3VLD A;  5CCM A;  2I6H A;  3SY2 A;  3Q9N C;  3UT4 A;  4LG6 A;  4QFV A;  3ENE A;  3NZS A;  4GMJ A;  1JCS A;  2KCL A;  4J8F A;  4FHJ A;  3TWS A;  2H6H A;  2OV8 A;  2V4H C;  3ONL A;  3L08 A;  4XKB A;  4UWK A;  4DRX E;  5BV0 A;  1JCR A;  5G04 C;  4WWO A;  4ATZ D;  2ETA A;  1UOH A;  2KZT B;  3TG4 A;  1H6O A;  3BG0 B;  2XEE A;  3L16 A;  1SA4 A;  3K9I A;  3PZ3 A;  3QB2 A;  2RKK A;  4TXR A;  3ZEF A;  4AM9 A;  3SZ7 A;  3T9K A;  1V55 E;  5ENR D;  3TWV A;  3PRE A;  3DSS A;  3CIA A;  3OXG A;  4I17 A;  1OCR E;  1H6P A;  3ZXP A;  1Z3Y A;  4TXP A;  1QYM A;  4N5Q A;  4YVQ C;  3OXL A;  4RSY A;  3NBN B;  3GZ2 A;  2LAH A;  4LSZ E;  3CGH A;  3ULY A;  2J09 A;  4XE0 A;  3D9P A;  4FUL A;  1LF8 A;  4N5C A;  1WM5 A;  4APO A;  2GGF A;  3PE4 A;  3AU4 A;  4KBQ A;  5AQ9 A;  2ZGD A;  1WG0 A;  3CK8 A;  3PZD A;  4GAA A;  4GYW A;  2GRQ B;  2PZI A;  3ASH A;  3QWW A;  4LRZ A;  3AU5 A;  3B7U X;  1UW4 B;  1N4Q A;  3FUF A;  2CG3 A;  3DPD A;  3KEZ A;  1HU3 A;  1IKN D;  4BX9 A;  5AAO A;  2I1K A;  1UJJ A;  2AXU A;  3T5X A;  4CGV A;  5AQA A;  1HF8 A;  3PE3 A;  4JZY A;  2OEW A;  1N4P A;  2X38 A;  3ZCB A;  4I2Z A;  3QKY A;  4ACL A;  3V30 A;  4DK5 A;  3APC A;  4TXQ A;  5LCW J;  3UMV A;  3KSQ A;  5EIB E;  2P2C P;  1WAO 1;  2AVP A;  2P9L G;  1HG2 A;  4JEH A;  2BKK B;  3R7Q A;  3BU8 A;  4J7W A;  1XNF A;  3ASD A;  1PY1 A;  4TRQ A;  2R02 A;  2DBA A;  2P9U G;  3D9M A;  4UQY A;  2LO6 A;  3TAX A;  2VSX E;  4RG9 A;  4YDE A;  4MBG A;  3UIO C;  5CCL A;  4URK A;  1TNZ A;  5AIJ A;  1U2V G;  3EHN A;  3KD7 A;  5JFF A;  1SZA A;  2HE0 A;  2GW1 A;  3HHM A;  2QC9 A;  3T5V A;  4N2Q A;  2B0O E;  2XPI A;  4G8K A;  4M16 A;  3U4T A;  3D9J A;  3IBE A;  4A3T A;  2J4B A;  3ZIM A;  4N3C A;  3D9I A;  5ENT D;  5CER B;  1OWN A;  4MKT A;  1QNF A;  1N94 A;  5EYP F;  3PEV B;  4NPS A;  5C1D A;  2L9B A;  3FUE A;  2EQX A;  4GTQ A;  5AQB A;  2IU1 A;  4O60 A;  4CEM A;  3U3W A;  2LNI A;  5BT1 A;  5CMW A;  2XRY A;  5ENQ D;  1DNP A;  1YCS B;  4N39 A;  4Y6W A;  2J8S D;  3VTX A;  3O4Z A;  3AG3 E;  3AS4 A;  1JWG A;  4BX8 A;  3Q9U C;  4WNF A;  1TN7 A;  3KAE A;  2EIJ E;  3LCA A;  3OTN A;  4O6F A;  2XS8 A;  3L9T A;  2CFZ A;  4MRU A;  5CKL A;  3FUI A;  3IKO B;  5BW8 C;  3PZ2 A;  1IQR A;  3E37 A;  3DSX A;  2F37 A;  1U3D A;  5JJT A;  3ZYM A;  2QY7 A;  3FU6 A;  4YDY A;  4BEP A;  3B7T A;  3V79 K;  4MS6 A;  4EPZ A;  4PS8 A;  5AJL A;  2F8X K;  3OAW A;  3SFY A;  5CBO A;  5JJ6 A;  5BUZ A;  5ENN A;  4DX6 D;  5AYW D;  1H0A A;  1G3N B;  3FEY A;  5FQ8 A;  3SBT B;  1V54 E;  3QAR A;  2CHZ A;  2M63 A;  4WNE A;  4ILG A;  1MX2 A;  3L6A A;  5KJM A;  4HI8 A;  4JW1 A;  5M72 A;  4L9P A;  3HXE A;  1RZ4 A;  3MKR A;  5HKP A;  2B6C A;  2AWI A;  5KNG A;  4WWN A;  1XGW A;  4X2C A;  3RRU A;  2VJ8 A;  1SVX A;  1YMP A;  2X6I A;  1N54 A;  2G03 A;  2JK8 A;  5CED B;  3ZYL A;  4BSX A;  1NA3 A;  2WXR A;  3SN9 A;  2V8S E;  3C5R A;  3PRZ A;  5A23 A;  1OCC E;  1TR4 A;  3Q5M A;  2VTB B;  1U3C A;  4OVV A;  3G2U A;  2XEH A;  3DWL G;  5JJ7 A;  3ML8 A;  5JFZ A;  1JPL A;  3B95 A;  3JQ0 A;  3JXJ A;  4G1T A;  4CDR A;  4EZJ A;  4LNU D;  1DVP A;  2Y69 E;  4GTO A;  2DZN A;  3G2V A;  4PUC A;  4NQ0 A;  2IFU A;  4L2Y A;  2H6F A;  3ZN3 A;  1KZO A;  5LOZ A;  2WXG A;  2BF0 X;  2X6F A;  2VGE A;  4I43 A;  4H7Y A;  3LS8 A;  2WQH A;  2A5U A;  1D8D A;  2ION A;  4KVM A;  2J4D A;  4M3O A;  3RO3 A;  1LTX A;  4N3B A;  5CGL A;  4U7E B;  3B7S A;  4O1O A;  1KT0 A;  2IO3 C;  1BLX B;  4LNB A;  2XGM A;  4BT8 A;  3C3R A;  3CVY A;  4I6E A;  4F1P A;  3ABL E;  4G25 A;  2JEK A;  1LD7 A;  2WXL A;  4UI9 J;  3R7R A;  2KAT A;  2R03 A;  2WXK A;  4M7C A;  1K3Z D;  2L0I A;  4XX5 A;  1TYQ G;  3APF A;  4K5B A;  5LCW C;  1TN6 A;  3ZU7 B;  2ZXW E;  4LCT A;  3FTZ A;  4CGW A;  3S7F A;  3FUL A;  2XGS A;  4BET A;  3FFL A;  3S2A A;  3S7J A;  1N4R A;  3TXM A;  4F6R D;  4U8Y D;  4U8H A;  4I1O B;  5CHE E;  2ZU6 B;  3WXX A;  3EHQ A;  3I5P A;  5BNW A;  3ZRH A;  3DEP A;  3D9K A;  3Q7F A;  3V31 A;  4HOS A;  1PAQ A;  5AQ7 A;  3PUK A;  3FUK A;  3PUJ A;  4XI8 A;  4C9B B;  3CVX A;  4Z68 A;  2OOE A;  4C48 B;  4CT4 A;  3CVN A;  2ZIS A;  1INZ A;  1E96 B;  3JUI A;  5JMN D;  3Q75 A;  4U04 A;  1HFA A;  1KZP A;  3ASO E;  4UWF A;  4BFR A;  3C3O A;  2X3M A;  2LAI A;  4F7A A;  3CK9 A;  4I9C A;  3CUC A;  5ENS D;  3EU9 A;  3GW4 A;  3IV0 A;  4GZ6 A;  4KMO A;  3SI5 A;  3CHR A;  3ESL A;  5EU0 A;  4JHJ A;  5D0O D;  1S64 A;  3HDX A;  2R2L A;  3RK6 A;  3L22 A;  4FLB A;  2WXM A;  3LYA A;  1WDY A;  3AAA C;  5LX8 A;  3FUM A;  4ABN A;  3EHM A;  5HRY A;  2E0I A;  1HE8 A;  4N2S A;  3RAU A;  1E8W A;  2J07 A;  2NUD A;  4KYO B;  3ZPJ A;  3UTM A;  5KJK A;  1H2V C;  3QWP A;  2WB2 A;  4EZK A;  3ZHE B;  4GCN A;  1S63 A;  1L5J A;  1DCQ A;  5FWQ A;  3HVE B;  1K1A A;  3MYV A;  4HXI A;  1KLX A;  3FU0 A;  3PZ1 A;  1SZ9 A;  1SA5 A;  2IF4 A;  2XEV A;  2E2E A;  4JA9 A;  4Q94 A;  5AN8 A;  5G55 A;  4GA0 A;  2VSN A;  2XEN A;  1TJC A;  5KWD A;  2DIW A;  2C2L A;  3LY7 A;  3GYZ A;  4GTR A;  4XIF A;  4C0M A;  2A5E A;  1A5E A;  3Q7A A;  5EYL A;  2VGX A;  3R9M A;  3FU5 A;  2H6I A;  4RQI A;  3FH8 A;  1N4S A;  4JB8 P;  4GZD A;  1E8X A;  4AEZ C;  4PDX A;  2AJA A;  3DST A;  5ENO D;  3ZXS A;  3CVL A;  2RG8 A;  3KS2 A;  4E6H A;  5CRU A;  3QJZ A;  1UN8 A;  1MX6 A;  3J5Q B;  3IEG A;  4UI9 K;  4XI0 A;  3MJW A;  2YNQ A;  4A55 A;  4FC8 A;  1TNY A;  4GTV A;  3SQV A;  2RD0 A;  3QNK A;  2GRP B;  3HXB A;  3NAW A;  3S7B A;  4GU5 A;  2NXP A;  3B7B A;  1UJK A;  5J90 A;  2V5F A;  1SW6 A;  1EDU A;  2R59 A;  1D9S A;  4DI4 A;  3TG5 A;  4F53 A;  2BUG A;  1D8E A;  2Y4T A;  2R05 A;  3BEE A;  3B13 A;  1FVF A;  4U63 A;  4UQX A;  3G2W A;  4J8E A;  3AG1 E;  3SFX A;  1E90 A;  4IN3 B;  3SD5 A;  5FZQ A;  4QQI A;  5FQ6 A;  2Y0B G;  3TL5 A;  3C3Q A;  1NZN A;  1QZ2 A;  3G2T A;  2VGY A;  5CEA A;  1ZU2 A;  1H2T C;  4JHR A;  4FJZ A;  3KEA A;  5ANR A;  3EJN A;  1Y6I A;  4EHM A;  4I6G A;  5T4Y A;  3SHG A;  3RIB A;  2WXI A;  4UWH A;  3TXN A;  2KCV A;  4GYY A;  1A17 A;  4L1B A;  3BQO A;  3BUA A;  1IXV A;  3SO8 A;  3PZ4 A;  4NAC A;  3E32 A;  1DC2 A;  3QWV A;  3RRM B;  3TWQ A;  4KZ0 A;  2WXP A;  2X6J A;  1K8K G;  5FZS A;  3CHS A;  4EQF A;  4GZ3 A;  4DI3 A;  2OVB A;  4B89 A;  3Q79 A;  4RG6 A;  4HI9 A;  5B3S E;  3TWR A;  3NB2 A;  3ZYK A;  4PS3 A;  3QC1 A;  3DEO A;  5T8I A;  4JVS A;  4JD2 G;  3UM3 A;  2PM7 A;  5FQ4 A;  1JUQ A;  4UQZ A;  1S0P A;  3FTV A;  3RU0 A;  4G2V A;  4GYO A;  3CHP A;  2PM6 A;  5A7D B;  3QAQ A;  1MX4 A;  1DCE A;  4ACK A;  3GZS A;  4C0E A;  3MZL B;  4U0U A;  1O1R A;  5T3R A;  2IOS A;  3IXE A;  3FUH A;  5EIL A;  1KPS B;  5JHA A;  5KBA A;  5EX0 A;  3RSE G;  4AJW A;  3LPZ A;  2AXV A;  2WMO A;  1IQU A;  1Y8M A;  4DX5 D;  3QOU A;  2ZIR A;  3Q4A B;  1N0Q A;  2MOW A;  3E30 A;  3TWT A;  2AXZ A;  3ZGQ A;  4I1M A;  5CMY A;  4GA1 A;  2QFC A;  2DYR E;  2WXJ A;  4FHK A;  4XEI G;  1MZC A;  4BTB A;  1OWL A;  3CQC B;  1OCO E;  5G05 J;  3UX4 A;  3NOC D;  5JHB A;  3P2B A;  2PQR A;  4U07 A;  2KM4 A;  5J08 A;  2XZD G;  2LSU A;  4A1G A;  3T8M A;  3D9N A;  3C98 A;  3MV3 B;  4J8D A;  4BY6 A;  2ETB A;  4HFG A;  4BWR A;  3EDT B;  3LY9 A;  4CRW A;  4X2E A;  4I6J A;  4XI9 A;  4U95 D;  2CFU A;  5JA4 D;  2CHW A;  1NP7 A;  1TNU A;  3MX3 A;  1JWF A;  1HX8 A;  2P9I G;  3EIJ A;  2FI7 A;  3ZVV A;  3IHV A;  1HS6 A;  3TGO A;  4H7X A;  1KT1 A;  1N9A A;  1P5Q A;  4HLE A;  2WQ6 A;  1PC2 A;  4JL0 A;  3ESK A;  1TEZ A;  4Y6C A;  1OWO A;  3CVQ A;  2A4Z A;  3E34 A;  3UUX A;  3E33 A;  3NOG D;  3ZNG A;  2Y4U A;  4J8Y A;  2IEJ A;  2IY0 C;  2XCB A;  4HRN A;  1OXJ A;  5HI7 A;  4AVX A;  3I4G A;  4HNA D;  4HBD A;  2Y1L E;  5A6C A;  3UKR G;  4GTP A;  2C0L A;  2GRO B;  3MGB A;  3PDN A;  3UI2 A;  3LJ3 A;  1Q2Z A;  1AP7 A;  4WAF A;  3ML9 A;  2GRM A;  2HYZ A;  3PH0 C;  1HZ4 A;  1EPU A;  4OAU C;  2X6K A;  3LET A;  4NUR A;  1TN8 A;  3EU5 A;  2J08 A;  1BPO A;  4B0Z A;  1OWM A;  4ATG A;  3RO2 A;  2HM8 A;  4DLQ A;  4RVB A;  2ETC A;  1X5B A;  3SGH A;  3PS6 A;  4L2L A;  4FLH A;  2IOL A;  5BPP A;  2P58 C;  2YHE A;  3Q78 A;  4ZHB A;  1K1B A;  4HOR A;  3N71 A;  3WG7 E;  4TUM A;  1N0R A;  3D9H A;  4AY5 A;  2V4L A;  4XKC A;  4E85 A;  1O5M A;  3SFZ A;  3ZW3 A;  4EEC A;  5AEN A;  4KVO A;  2OND A;  4LUN U;  3RRN B;  1H2U A;  4ANU A;  3HRA A;  2KC7 A;  3CHM A;  4P29 A;  1HH8 A;  1SQM A;  3MKQ A;  3I4R B;  3JXI A;  2NSZ A;  5B1B E;  3CK7 A;  3LJN A;  3F6Q A;  2VSY A;  4FAD A;  4ZFH A;  5EKQ D;  4GA2 A;  3CST A;  2XCC A;  5FTP A;  1WY6 A;  4X2D A;  4MLP A;  4ANX A;  4BT9 A;  3UT7 A;  4R7L A;  3CV0 A;  3JUE A;  3SF4 A;  2IQC A;  5D2M C;  2XPY A;  4FA6 A;  1Z5S C;  1UG3 A;  2DWZ A;  2UY1 A; 
#chains in the Genus database with same CATH homology
 1H6K A;  4NPS A;  4B8C B;  2L9B A;  3FUE A;  3ZXS A;  3Q47 B;  2EQX A;  5C1D A;  3CVL A;  3Q15 A;  3ULQ A;  2VQ2 A;  2RG8 A;  2XRZ A;  4DPR A;  2IU1 A;  4CEM A;  3KS2 A;  5G2N A;  2AW6 A;  2XGO A;  3U3W A;  4E6H A;  2LNI A;  4OVU A;  4WWP A;  3SE5 A;  2WVI A;  3QJZ A;  1UN8 A;  4XI0 A;  3IEG A;  4UI9 K;  3MJW A;  2YNQ A;  3AS8 A;  2XRY A;  4A55 A;  5BT1 A;  2KZT A;  4FC8 A;  5CMW A;  1DNP A;  4N39 A;  4GZ5 A;  3DBS A;  4Y6W A;  3RKV A;  2RD0 A;  3LVR E;  3QNK A;  1ELR A;  4J0U A;  4ANV A;  3VTX A;  3O4Z A;  2WM9 A;  5FT9 A;  3S7B A;  4FJY A;  4GU5 A;  2NXP A;  4PDX A;  3AS4 A;  1JWG A;  1UJK A;  4BX8 A;  3JYS A;  5J90 A;  2V5F A;  4F3V A;  1EDU A;  2XHE A;  4WNF A;  4DJA A;  1IYG A;  2R59 A;  3KAE A;  3OTN A;  3LCA A;  3MKQ B;  4O6F A;  2VYI A;  3AS5 A;  4DI4 A;  3TG5 A;  4F1S A;  3VLE A;  4F53 A;  2CFZ A;  4MRU A;  3URZ A;  5CKL A;  2BUG A;  3FUI A;  3IKO B;  4LER A;  4JXT A;  3CHO A;  2Y4T A;  3CVU A;  5BW8 C;  1N52 A;  4HOT A;  1IQR A;  3NZU A;  2MHK A;  3BEE A;  3JCK C;  4UWL A;  3B13 A;  1U3D A;  1FVF A;  2R17 C;  5JJT A;  5LFA A;  5ARF A;  5FZR A;  3ZYM A;  2QY7 A;  3FU6 A;  3CR3 A;  4U63 A;  4UQX A;  3MA5 A;  4PS7 A;  3FY4 A;  2OVF A;  3G2W A;  2J49 A;  5DIZ A;  4J8E A;  1ELW A;  4G26 A;  4FP7 A;  3B7T A;  3ZLM A;  5E76 A;  4MS6 A;  3SBS A;  1E90 A;  4GPK A;  4IN3 B;  1W3B A;  4EPZ A;  1E8Z A;  3FEX A;  4PS8 A;  3SD5 A;  5FZQ A;  2UWJ G;  4FU3 A;  2FEZ A;  5AJL A;  2HO1 A;  4B8A A;  3OAW A;  4DLO A;  4N3A A;  1OUV A;  2UY1 B;  3LXU X;  5JJ6 A;  2YIN A;  3CHQ A;  5BUZ A;  2CHX A;  4APF A;  1HG5 A;  3MV2 B;  4G24 A;  5ENN A;  5FQ6 A;  2MRI A;  4WUY A;  3U64 A;  2ILR A;  4ILH B;  1FCH A;  3TL5 A;  5AYW D;  1H0A A;  4ANW A;  1NZN A;  1QZ2 A;  2WXH A;  2VGY A;  2CG2 A;  1ZU2 A;  3ASG A;  3G2T A;  3FEY A;  3FUD A;  1H2T C;  5G05 C;  4JHR A;  4FJZ A;  5AJD A;  4TV3 A;  3PNT B;  5FQ8 A;  3QAR A;  3SBT B;  5ANR A;  3FDH A;  2CHZ A;  2M63 A;  1Y6I A;  3EJN A;  4ITR A;  4WNE A;  4K03 A;  4ILG A;  3LDZ A;  4I6G A;  2FF4 A;  5T4Y A;  2F6S A;  2R5S A;  3SHG A;  3HIZ A;  3RIB A;  3L6A A;  1E7V A;  1MQS A;  3FTW A;  2WXI A;  2L0T B;  4UWH A;  3QK0 A;  5KJM A;  4JW1 A;  5M72 A;  1ELK A;  1GW6 A;  1Z3X A;  2XQ0 A;  3E4B A;  2VZA A;  4HOU A;  3MKR A;  3FTS A;  3TXN A;  4CCA A;  2KCV A;  4HOQ A;  3Q49 B;  4GYY A;  2AWI A;  1A17 A;  2BTD A;  4I9E A;  4L1B A;  3FUN A;  4GB9 A;  4IRU A;  3FWV A;  4UWG A;  4WWN A;  5ANL A;  1XGW A;  4X2C A;  3FTU A;  3RRU A;  2VJ8 A;  3CEQ A;  2I2O A;  1EYH A;  2X6I A;  3B7R L;  1N54 A;  4NAC A;  3RJV A;  2G03 A;  3QWV A;  3RRM B;  3ZC7 A;  2JK8 A;  4Q96 A;  4GML A;  3FU3 A;  4KZ0 A;  3CKC A;  2WXP A;  3ZYL A;  5E75 A;  4GCO A;  2PL2 A;  4WGJ A;  4BSX A;  1NA3 A;  2KCK A;  3ASF A;  4EZL A;  2X6H A;  2WXR A;  3CLJ A;  2I9C A;  2X6J A;  3SN9 A;  2V8S E;  3PRZ A;  3N3U A;  1EF1 C;  3CHS A;  3O48 A;  4GZ3 A;  5FZS A;  2OVB A;  4DI3 A;  4EQF A;  5A23 A;  4I2W A;  4B89 A;  1ZBP A;  3ZHE A;  3UQ3 A;  2WXF A;  2PQN A;  4RG6 A;  5DBK A;  2V0P A;  3Q5M A;  3ZYK A;  2FBN A;  4PS3 A;  3QC1 A;  1IHG A;  3QDN A;  1MHQ A;  5HQ8 A;  2VTB B;  3GZ1 A;  2Y3A A;  5LP0 A;  3FP3 A;  5ARG A;  3HVE A;  2WMN A;  1U3C A;  4U0S A;  1YA0 A;  3G2U A;  4LU4 A;  4JPS A;  4OVV A;  4D10 C;  5JJ7 A;  1UN9 A;  3ML8 A;  4AIF A;  5JFZ A;  1JPL A;  3CKB A;  1Z6T A;  4JVS A;  5T8I A;  3JQ0 A;  3LKU A;  5FJY A;  4G1T A;  5KCM A;  4CDR A;  2PM7 A;  3PNL B;  5FQ4 A;  4EZJ A;  5C2Y A;  4Q69 A;  1JUQ A;  2GRL A;  1DVP A;  4UQZ A;  1B89 A;  1S0P A;  3FTV A;  4B94 A;  3RU0 A;  4G2V A;  3G2V A;  3L17 A;  4GYO A;  4PUC A;  4EBA G;  3CHP A;  4NQ0 A;  3CVV A;  2IFU A;  2PM6 A;  3LY8 A;  3P1U A;  4LEU A;  4L2Y A;  5A7D B;  4CDM A;  2VSO E;  3ZN3 A;  5EX3 A;  5FQ7 A;  3S7D A;  5BV1 A;  1E7U A;  3UPV A;  3BG1 B;  3QAQ A;  4GZC A;  4JHK A;  3D9L A;  5LOZ A;  4ACK A;  2WXG A;  3GZS A;  4A1S A;  3CVP A;  4ME2 A;  4C0E A;  2BF0 X;  3MZL B;  5D0Q D;  3FHE A;  4U0U A;  2WXN A;  3CVW A;  2FO7 A;  2LSV A;  2X6F A;  2WXO A;  3LVQ E;  3I3N A;  4TUU A;  4G11 A;  4L23 A;  5T3R A;  2JLB A;  4I43 A;  2IOS A;  3FUH A;  3PVL A;  4H7Y A;  3APD A;  5JHA A;  3LS8 A;  2WQH A;  4AXH A;  5EX0 A;  2I1J A;  3VLF A;  2A5U A;  4AJW A;  3LPZ A;  2AXV A;  3VLD A;  2ION A;  5CCM A;  4KVM A;  2WMO A;  2J4D A;  1IQU A;  4M3O A;  1Y8M A;  2VGX B;  3RO3 A;  4N3B A;  5CGL A;  2I6H A;  4IUL A;  4EBA A;  3B7S A;  3QOU A;  4HVB A;  1KT0 A;  3NQP A;  5CMT A;  3Q4A B;  2MOW A;  4XZ4 A;  3UT4 A;  4QFV A;  2AXZ A;  3ENE A;  3ZGQ A;  4I1M A;  5CMY A;  2XGM A;  4BT8 A;  4GA1 A;  3NZS A;  3S6A A;  3PEU B;  4JA7 A;  4OYS A;  2QFC A;  5KJL A;  3CVY A;  2WXJ A;  4FHK A;  2FUL A;  2WQ7 A;  4GMJ A;  4I6E A;  4KZC A;  4YVO A;  4BTB A;  1OWL A;  2KCL A;  4G25 A;  3CQC B;  2JEK A;  4HS2 A;  5G05 J;  3UX4 A;  4J8F A;  2WXL A;  4FHJ A;  5JHB A;  3P2B A;  4UI9 J;  2PQR A;  4U07 A;  4CDN A;  2KM4 A;  3R7R A;  2KAT A;  2OV8 A;  3ONL A;  2WXK A;  2NC9 A;  5J08 A;  2L0I A;  4XX5 A;  3L08 A;  4XKB A;  3APF A;  4UWK A;  2LSU A;  4A1G A;  3L54 A;  5LCW C;  3T8M A;  4UI9 C;  5BV0 A;  3D9N A;  3C98 A;  3MV3 B;  4LCT A;  4J8D A;  4BY6 A;  1HO8 A;  4HFG A;  5G04 C;  4WWO A;  4BWR A;  2KZT B;  4U0Z A;  3TG4 A;  3EDT B;  3LY9 A;  3FTZ A;  3BG0 B;  4CRW A;  4CGW A;  3S7F A;  4X2E A;  4I6J A;  3FUL A;  2XGS A;  3L16 A;  4XI9 A;  3K9I A;  3FFL A;  3S2A A;  3IHY A;  3S7J A;  2XPZ A;  2CFU A;  3G2S A;  2CHW A;  3LEW A;  1NP7 A;  3TXM A;  4J6I A;  3MX3 A;  1JWF A;  1HX8 A;  3QB2 A;  4U8H A;  3ZYQ A;  4KXK B;  3ZEF A;  4AM9 A;  3EIJ A;  4I1O B;  2ZU6 B;  5CHE E;  3VTY A;  3SZ7 A;  4JC8 A;  3WXX A;  3FTY A;  3R9A B;  2FI7 A;  3I5P A;  3ZVV A;  3IHV A;  1HS6 A;  3TGO A;  3PRE A;  5BNW A;  4H7X A;  3ZRH A;  2YHC A;  2VY3 A;  1KT1 A;  1P5Q A;  4NRH B;  4AP2 A;  3CIA A;  3MEK A;  3OXG A;  4G23 A;  3D9K A;  4I17 A;  4L7T A;  4HLE A;  2WQ6 A;  3D9O A;  3HYM B;  1PC2 A;  4JL0 A;  1E8Y A;  3ESK A;  4HOS A;  1Z3Y A;  1TEZ A;  1PAQ A;  3TJP A;  3PUK A;  3FUK A;  3PUJ A;  4XI8 A;  4C9B B;  3CVX A;  2DCP A;  4W9R A;  4Y6C A;  4YVQ C;  3OXL A;  4YND A;  2OOE A;  4J8S A;  1OWO A;  3CVQ A;  2A4Z A;  4RSY A;  3UUX A;  4CT4 A;  3GZ2 A;  3CVN A;  2LAH A;  3L13 A;  2Y4U A;  3FTX A;  3CGH A;  3CQG B;  1INZ A;  1E96 B;  4AY6 A;  2IJG X;  3JUI A;  1TJF A;  4U04 A;  2J09 A;  4XE0 A;  1HFA A;  3D9P A;  4FUL A;  4BTA A;  1LF8 A;  2XCB A;  4N5C A;  1WM5 A;  3OXF A;  3U9W A;  3UT8 A;  1NA0 A;  4UWF A;  5HI7 A;  4AOF A;  4AVX A;  4BFR A;  3I4G A;  4APO A;  1H19 A;  2GGF A;  3PE4 A;  3AU4 A;  5A6C A;  2X3M A;  2LAI A;  4F7A A;  4KBQ A;  3CK9 A;  2HR2 A;  4I9C A;  3CUC A;  2C0L A;  3FH5 A;  4A3V A;  3MGB A;  3GW4 A;  3PDN A;  3CK8 A;  3IV0 A;  3PZD A;  3LJ3 A;  4GZ6 A;  1VDY A;  4KMO A;  2WPV A;  3SI5 A;  4WAF A;  3ML9 A;  4GAA A;  4GYW A;  2PZI A;  3ASH A;  3QWW A;  4LRZ A;  2L6J A;  3AU5 A;  3B7U X;  3CHR A;  1UW4 B;  2GRM A;  2HYZ A;  3ESL A;  3FUF A;  2CG3 A;  3MCX A;  3PH0 C;  5EU0 A;  4JHJ A;  5D0O D;  1HZ4 A;  3DPD A;  1EPU A;  3HDX A;  2X6K A;  3LET A;  4NUR A;  3KEZ A;  1HU3 A;  2J08 A;  1BPO A;  3RK6 A;  1OWM A;  3L22 A;  4B0Z A;  4BX9 A;  4FLB A;  2WXM A;  2I1K A;  3LYA A;  4JEU A;  5EDS A;  1UJJ A;  4KT6 B;  2AXU A;  5LX8 A;  3FUM A;  3T5X A;  4PH4 B;  4PY3 A;  4WND A;  4ATG A;  4ABN A;  3EHM A;  3FH7 A;  3RO2 A;  4N67 A;  2HM8 A;  4CGV A;  1FVH A;  1QQE A;  4DLQ A;  3FUJ A;  4RVB A;  1X5B A;  2E0I A;  1HE8 A;  1HF8 A;  3PE3 A;  4JZY A;  4N2S A;  3SGH A;  1E8W A;  3D3M A;  3PS6 A;  4L2L A;  2J07 A;  4FLH A;  2X38 A;  3ZCB A;  2IOL A;  4I2Z A;  5BPP A;  3QKY A;  4ACL A;  2P58 C;  4KYO B;  3ZPJ A;  2YHE A;  1HXI A;  4DK5 A;  3JQ1 A;  2J9Q A;  3APC A;  5LCW J;  3N71 A;  2VTB A;  3UMV A;  4HOR A;  5KJK A;  4AY5 A;  4CT0 A;  2V4L A;  4XKC A;  1H2V C;  3QWP A;  5G04 J;  4E85 A;  3NF1 A;  2WB2 A;  1WAO 1;  2AVP A;  4EZK A;  3SFZ A;  3ZW3 A;  3ZHE B;  1HG2 A;  4EEC A;  4JEH A;  5AEN A;  4GCN A;  4KVO A;  2OND A;  4LUN U;  1L5J A;  3R7Q A;  3RRN B;  1H2U A;  2WXQ A;  4ANU A;  5FWQ A;  1XNF A;  1OWP A;  4IYP A;  3ASD A;  1PY1 A;  3HVE B;  3MYV A;  4TRQ A;  2KC7 A;  2DBA A;  3CHM A;  3CSF A;  4HXI A;  4P29 A;  1HH8 A;  1KLX A;  3D9M A;  4UQY A;  2LO6 A;  3FU0 A;  1SQM A;  1SZ9 A;  3TAX A;  2VSX E;  3MKQ A;  4RG9 A;  3I4R B;  2IF4 A;  2NSZ A;  2E2E A;  2XEV A;  4K0R A;  4JA9 A;  4Q94 A;  3CK7 A;  5CCL A;  4URK A;  5AIJ A;  5G55 A;  2VSY A;  3EHN A;  2VSN A;  3KD7 A;  5JFF A;  4GA0 A;  1SZA A;  4FAD A;  1TJC A;  2DIW A;  2C2L A;  2GW1 A;  5EKQ D;  4GA2 A;  3CST A;  3HHM A;  3LY7 A;  3ZFW A;  2XCC A;  3T5V A;  5FTP A;  3SHF A;  3GYZ A;  1WY6 A;  4N2Q A;  2XPI A;  4X2D A;  4MLP A;  4I1A A;  4ANX A;  4XIF A;  4BT9 A;  4V3I A;  4M16 A;  3SNX A;  3U4T A;  4C0M A;  3UT7 A;  3D9J A;  2VGX A;  3IBE A;  4A3T A;  3FU5 A;  2Q7F A;  4R7L A;  3CV0 A;  2J4B A;  3SF4 A;  3ZIM A;  4ILI A;  3U66 A;  2IQC A;  4AV7 A;  4N3C A;  4WNG A;  2C0M A;  2XPY A;  3D9I A;  4FA6 A;  3EIQ C;  3FH8 A;  1OWN A;  1UG3 A;  3ONK A;  4MKT A;  4GZD A;  1E8X A;  1QNF A;  4AEZ C;  2YQ8 A;  5KJN A;  2UY1 A;  3PEV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...