4U0ZA

Eukaryotic fic domain containing protein with bound apcpp
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
328
structure length
322
Chain Sequence
b'EARAALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine monophosphate-protein transferase FICD
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 116
structure length 322
sequence length 328
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u0zA02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u0zA01
3SZ7A 4WNEA 5G04C 1E96B 3PE4A 2P58C 3WXXA 1KT0A 5EX3A 3PE3A 3CVLA 5G04J 5DIZA 4N5CA 4GPKA 5JJ6A 5G05C 4N67A 3ESKA 3EDTB 3HYMB 1NZNA 3OXLA 4UI9K 4JHRA 2WQHA 5G05J 4N2QA 3Q49B 1P5QA 3KD7A 4G24A 4RG6A 4GA1A 3TAXA 4NPSA 3FFLA 4H7XA 3OXFA 4F3VA 4CDRA 4WNDA 4U0UA 2C2LA 4CGWA 3AS8A 4HORA 5KJLA 3OXGA 4XI0A 5EKQD 3ULQA 3IEGA 4JA9A 5FTPA 3GZ1A 2AVPA 5FZRA 3AS4A 4N3AA 3VTYA 2OOEA 1NA0A 3LPZA 3S7DA 4G2VA 5JFFA 4JA7A 4KBQA 4WGJA 4W9RA 2VGYA 5D0QD 3S6AA 5ARGA 5DBKA 5FT9A 4HOTA 2VGXB 2HR2A 1YA0A 2PL2A 4I1AA 5AYWD 4J0UA 3CVNA 3CK8A 3QWPA 4H7YA 4AIFA 4U0SA 4GCNA 3LCAA 3ZHEB 3ZN3A 2UY1A 1ELRA 1NA3A 4KYOB 2VYIA 3CK9A 3S7BA 2VZAA 2VSNA 3U4TA 4AY6A 5JFZA 3ASFA 5KJNA 1IHGA 3CVPA 2F6SA 1PC2A 3TGOA 5CGLA 2JK8A 4BTAA 5CHEE 4KXKB 5EU0A 2IFUA 5EX0A 3TG4A 3UUXA 4I2WA 3LY9A 2KC7A 4X2CA 5HQ8A 2PZIA 5BW8C 5CCLA 1IYGA 1OUVA 2LSUA 4WUYA 4Y6CA 3CK7A 3Q5MA 2XGSA 2Y4TA 1QZ2A 3ASDA 4ABNA 3K9IA 1HXIA 1HZ4A 5KJMA 4B94A 3CKCA 4J8EA 4N2SA 2L6JA 3MEKA 4GYWA 2YHCA 3LYAA 4M16A 4XIFA 4N3BA 3RU0A 4U04A 2MHKA 3SN9A 3CV0A 3Q15A 5KJKA 4JL0A 4BTBA 3FWVA 4AY5A 2XPIA 3LKUA 2FF4A 4U07A 3MV3B 3TG5A 5FZSA 4G25A 3GZ2A 1ZBPA 5HI7A 3ZGQA 2WPVA 3O48A 3JYSA 3MA5A 4CGVA 2FEZA 3MV2B 3QWWA 5A7DB 3VTXA 5FZQA 5CMTA 4I9EA 4IN3B 4XI8A 3URZA 2XGMA 2VSYA 2C0MA 3CKBA 4U0ZA 3CEQA 3R9AB 2YQ8A 1KT1A 3Q47B 4Y6WA 4NRHB 4RG9A 4YVQC 3ZCBA 5FJYA 5BT1A 3SF4A 4J8FA 2ONDA 2XCCA 4YNDA 4X2EA 4G26A 4EQFA 4HOSA 1FCHA 3LETA 2UWJG 3QWVA 4G23A 1WM5A 5C1DA 2Y4UA 3QOUA 1XNFA 4LEUA 3RKVA 2XGOA 2DBAA 2GW1A 2VY3A 4WNGA 4I17A 3RO3A 2R5SA 3FP3A 4GZ5A 4I9CA 1ZU2A 3Q4AB 1QQEA 3ZPJA 5LCWC 3RO2A 4BWRA 2E2EA 3KS2A 2FBNA 2HO1A 2FO7A 4YVOA 3SE5A 3U3WA 5LCWJ 2UY1B 3GYZA 2VQ2A 1ELWA 4HOQA 1WAO1 1W3BA 4GCOA 4ME2A 3PDNA 3AS5A 4O6FA 3LY8A 2PQNA 3RJVA 4X2DA 4UQZA 4AM9A 4PY3A 3E4BA 4UQYA 2QFCA 2G03A 5JJTA 2VGXA 4N3CA 2V5FA 5CKLA 4GYYA 2I6HA 1Y8MA 3S7FA 4WNFA 2KCLA 4N39A 3BEEA 3KAEA 2Q7FA 1TJCA 3UPVA 5M72A 4UI9C 3ZHEA 4J8DA 2IF4A 2XCBA 4GZ6A 1A17A 4G1TA 3QDNA 4BT8A 4UI9J 5D0OD 4I2ZA 2PQRA 3S7JA 4UQXA 3ASHA 4APOA 2BUGA 2HYZA 2C0LA 4GYOA 3ZFWA 5BNWA 2KATA 3ZLMA 3UQ3A 2KCVA 5A6CA 4ITRA 3LY7A 2LNIA 3NF1A 3MKRA 3ASGA 2JLBA 3ZC7A 5CCMA 3QKYA 4LU4A 2XEVA 4HOUA 3CVQA 4A1SA 3RIBA 3GW4A 4XI9A 1KLXA 3SHGA 4GA0A 1B89A 1HH8A 2J9QA 4BT9A 5JJ7A 4GA2A 3CUCA 4GZ3A 2FI7A 4NQ0A 3N71A 2KCKA 3N3UA 5ARFA 2LSVA 2NC9A
chains in the Genus database with same CATH superfamily
4L2YA 3PREA 4L7TA 3WXXA 2XRYA 2LAHA 4DRXE 3B7SA 4JVSA 5DIZA 3R9MA 4N5CA 2GRLA 3LXUX 4BETA 5G05C 1N4RA 4HRMB 4JZYA 3T5XA 2WXGA 2WQHA 3D9NA 1H0AA 4KMOA 2IO2C 3EHMA 4JPSA 3T8KA 3KD7A 4RG6A 1MX6A 2L9BA 2XZDG 4LERA 3MYVA 4F3VA 2ZGDA 3JCKC 3PZDA 3FHEA 4K03A 5FQ6A 5KJLA 4F1SA 4Z68A 2XS8A 1H2TC 3GZ1A 3FH8A 1NA0A 3T8MA 4G2VA 3FU3A 4JA7A 3Q7AA 5FINA 2JABA 1U3CA 4FLHA 5CBOA 2IU1A 4OVUA 3NZUA 1HO8A 5ARGA 3L6AA 2A5EA 5BV0A 2I9CA 4U8YD 1JCSA 2PL2A 4BSZB 5AYWD 3IV0A 3CK8A 3QWPA 1BLXB 4AIFA 3HRAA 3MZLB 3ZNGA 3LCAA 3JQ1A 2EIME 4U96D 3LJNA 1NA3A 1EDUA 1N9AA 4EBAA 2RD0A 4URKA 3V2XA 5JFZA 3UKUG 1IHGA 3CVPA 1PC2A 3Q79A 3QC1A 1PAQA 3HVEB 4LNUD 3JXIA 2B0OE 2IY0C 4DLQA 3CHPA 3IHYA 4AJWA 3IHVA 5ENRD 3PEUB 1HG5A 3V31A 3FUJA 4X2CA 5HQ8A 3CHSA 4GTPA 5BW8C 5CCLA 4GZCA 2LSUA 1N4PA 2IOLA 3ZU7B 1NFIE 3DPDA 2WXHA 4GMRA 3TWTA 3EHRA 3FTXA 1EF1C 3K9IA 1E7VA 2CHWA 3TXMA 3NQPA 4ANUA 1HXIA 1HZ4A 3UX4A 4BX9A 4J8EA 4WWOA 1MX2A 3UKRG 2J4DA 4QFVA 1TNOA 3PRZA 1H2UA 2GRRB 1X5BA 2NSZA 4A63B 3L16A 3CVUA 2VTBB 1Z3XA 2IOSA 2XZTG 3I5PA 5J08A 2WXOA 4DX5D 2XHEA 5AQBA 2XS1A 4JL0A 2WB2A 1RW2A 4U07A 3TG5A 3GZ2A 3E33A 1ZBPA 2E0IA 5HI7A 2R03A 3D9LA 5JHAA 3Q9UC 4LNBA 2NYJA 3JYSA 3BUAA 4YDYA 1HFAA 4B89A 5A7DB 5CMTA 1OWMA 3Q73A 1YYHA 2VSXE 1WG0A 2R05A 2XGMA 3CKBA 3FEYA 3FTWA 1UOHA 3NOCD 4Y6WA 4NRHB 3D9HA 4E6HA 2CG2A 3ZCBA 5B1BE 4J8FA 4RVBA 4MRUA 3ZYKA 4EQFA 1V54E 4HOSA 1FCHA 2UWJG 3QWVA 3VLFA 1WM5A 4UWHA 3IKOB 3E32A 5ENSD 5AQAA 2YINA 1QYMA 1XNFA 2EIKE 3UXGA 4DI3A 2VY3A 4IULA 3D9OA 2MYOA 4XE0A 2WXMA 4J8YA 3ZPJA 5LCWC 4BWRA 3DSUA 1EYHA 2UY1B 1HU3A 1Z3YA 2VQ2A 1HF8A 4ANVA 2F37A 2L0IA 1ELWA 2WXRA 4HOQA 4EZLA 1WAO1 3B7BA 2QC9A 4J6IA 3DEPA 3PZ4A 1D9SA 3FUIA 3APFA 3QB2A 4GB9A 3LY8A 2PQNA 4HQDA 3RJVA 4AM9A 4PY3A 3TL5A 5EDSA 3MGBA 2QFCA 2VGXA 5T8IA 5IY5E 3FUKA 1U2VG 3CSTA 3DSVA 3LVRE 4GYYA 3CQCB 1N94A 3RRMB 3BEEA 2VJ8A 5M72A 4R7LA 5HKPA 2IF4A 3KEZA 2XRZA 1A17A 1SQMA 3QDNA 4DX1A 4UUCA 4BT8A 3QAQA 4F1PA 4LCTA 3QNKA 4I2ZA 3FTSA 4XZ4A 2HYZA 4TXPA 2C0LA 2ZU6B 3TWSA 4BSXA 2MRIA 5A6CA 4FC8A 5FQ8A 4FULA 4F53A 3Q75A 2LNIA 3D9KA 3Q78A 2AW6A 4RSYA 2ETBA 1FT1A 1HG2A 2CG3A 4LU4A 1YMPA 3RSEG 3ASOE 3CVQA 4A1SA 3RIBA 1Y6IA 4AOFA 4KVMA 4AVXA 3SHGA 5FIOA 1B89A 4HFGA 1NP7A 1NL4A 3UT8A 1N4SA 5AQ9A 4TXQA 2J9QA 3U9WA 4UWGA 5EYPF 4BT9A 4GZ3A 2FI7A 1TN7A 4TRQA 3N71A 3N3UA 3G2VA 5G04C 5CRUA 1E96B 3PE4A 2P58C 1KT0A 3NBNB 3JQ0A 4F6RD 1XGWA 5B3SE 1NH1A 3W9FA 2ZISA 2EINE 4B8CB 4HLLA 4LNGA 1NZNA 1H6OA 4UI9K 4JHRA 5AIJA 3PZ1A 3MCXA 4N2QA 3AG2E 3Q49B 3FFLA 1JUQA 3NZSA 3OXFA 2X6IA 2M63A 4WNDA 2C2LA 4FJYA 1E7UA 5ENPD 1H6KA 4HORA 1S64A 4KZCA 2AXUA 5EKQD 3ULQA 5FTPA 4JB8P 3O4ZA 5KBAA 1LD8A 3LPZA 3S7DA 3CHRA 5KWDA 2OVBA 4K0RA 1FT2A 1HE8A 2VSOE 2QY7A 2DCPA 3MKQB 2F0YA 3PZ2A 1N52A 1EPUA 4AP2A 2H6IA 5DBKA 4FHJA 2P9IG 2AXVA 2J8SD 3ULYA 4J0UA 4MLPA 1OT8A 3D9IA 4H7YA 2PM6A 4EZJA 3RK6A 1UJKA 4U0SA 2HM8A 1G3NB 4YDWA 1UG3A 3P2BA 1ELRA 2VYIA 1N11A 4OAUC 3U4TA 4ATGA 1IXVA 3TGOA 1N0RA 4O1OA 3UT4A 3U64A 3LS8A 1V55E 3ONLA 5ITZF 1Z5SC 3FDHA 1LF8A 2NUNA 3L08A 1SA5A 3LY9A 2P9PG 3QK0A 3WG7E 2KC7A 2DYSE 3U66A 2J4BA 3LEWA 2GRQB 4Y6CA 1OCOE 4JXTA 4JHKA 1DNPA 1QZ2A 3ASDA 1RZ4A 3MX3A 1MZCA 4FU3A 3FU6A 4CZ2D 1L5JA 3DSWA 1BD8A 3C3RA 3L82A 3MEKA 4JC8A 5FWQA 4XEIG 2YHCA 1OCZE 3CHOA 3NOGD 2KZTA 4N3BA 3B7RL 1SA4A 3SN9A 3CV0A 4AY5A 3BG0B 2XPIA 3FH5A 2WXLA 4UWLA 2LXMA 1LTXA 2VGEA 2P2CP 3SBTB 5BPPA 4DK5A 3MA5A 4CGVA 3HXCA 2FEZA 3MV2B 5BV1A 3EUVA 5CRVA 5FZQA 5EILA 4HB5A 1WDYA 4IN3B 4XI8A 3URZA 5BXUA 4CT0A 3G2TA 3VLEA 4U0ZA 4NURA 4FADA 2YQ8A 5H7PA 2DZNA 4F7AA 4RG9A 3FUFA 2CHXA 2FO1E 4GTQA 3TWWA 1O1TA 2ONDA 2WXNA 2ZXWE 3ZEFA 4EBAG 4G26A 1BU9A 3FUEA 4B93B 1OWLA 2Y4UA 1TYQG 1E8YA 3SHFA 1QBQA 2EIJE 2R5SA 3FP3A 4GZ5A 4I9CA 5EIDA 3L17A 3FUNA 3KS2A 3ZXSA 4BY6A 4YVOA 5ANLA 3FULA 3U3WA 3D9JA 3UINC 1TNYA 4IRUA 4CCAA 2R02A 3SI5A 1K8KG 2DYRE 1W3BA 4ME2A 1SZAA 1UW4B 3R7RA 3SBSA 3BQOA 4GTMA 4X2DA 4UQZA 2QYUA 1OXJA 3NAWA 2FULA 3E4BA 4UQYA 5AENA 4G8KA 4EECA 3S2AA 1Y8MA 4N39A 2LXLA 4GAAA 2EQXA 4DLOA 3ZHEA 4J8DA 2XCBA 2WM9A 4UI9J 2QZAA 2HE0A 2GRMA 3BG1B 4GYOA 3TWXA 2X6HA 3ZLMA 3G2WA 2WXJA 2ZGGA 2WVIA 2ZIRA 3LY7A 3AG1E 4HI9A 3NF1A 4GMJA 2JLBA 3ZC7A 3G2SA 4J8SA 2GGFA 5CCMA 2V8SE 5ENNA 3V79K 3TWUA 1MX4A 1TN8A 5CECB 4I43A 4V3IA 5E76A 3CIAA 1O1SA 5EIBE 4XI9A 3C98A 4RQIA 4I1MA 4JEHA 4GA0A 2P9KG 4E85A 3D3MA 4DX7D 4Q96A 4NQ0A 3EU9A 3EJNA 3UM0A 2IEJA 2BKGA 3SZ7A 1MJ0A 3CSFA 5EX3A 1Z6TA 4ANXA 3CVLA 1QNFA 3Q9NC 3FU0A 3C3QA 3FTUA 3QJZA 1SVXA 1YCSB 4N67A 5KNHD 4KZ0A 3BU8A 4PS8A 4WAFA 4C0EA 4U8VD 1OY3D 3PUKA 5G05J 4I1OB 4G24A 4M3OA 3TAXA 1JWFA 2I2OA 4PDXA 1INZA 4CDRA 3CVYA 3EU5A 3SFZA 4CGWA 3AS8A 5CMWA 4U8HA 3ENEA 4TV3A 4HRLA 2DZOA 2CFUA 3OXGA 2X6FA 2R59A 3IEGA 3L22A 2WXFA 3ZIMA 4N3AA 3VTYA 4FLBA 3HXDA 2X6KA 2Y1LE 4A3VA 4WGJA 4BESA 3SFXA 1UN8A 4W9RA 2VGYA 5D0QD 1JCRA 2KXPC 5LOZA 4P29A 3HXBA 2H6FA 5T3RA 5T4YA 5FT9A 1IQRA 1DVPA 2VGXB 4I6EA 4L9PA 4U7EB 1DCEA 4PS3A 3CVVA 1YA0A 1E90A 3SY2A 2WMNA 1IQUA 3Q7FA 3ZW3A 5EYLA 4EPZA 4GTOA 4GCNA 4B0ZA 2F8XK 3G2UA 4XKBA 1N95A 3ZN3A 2AXZA 3FUHA 3S7BA 3SGHA 4WWNA 3L9TA 4EHMA 3CVWA 2IQCA 3ASFA 5LX8A 2F6SA 2A5UA 5CGLA 2JK8A 5KCMA 5CHEE 4KXKB 3FTVA 5EU0A 4OYSA 3V2OA 3TG4A 3UUXA 2AJAA 1OWOA 1KZPA 5JMND 2J49A 5AJLA 3B95A 4JD2G 1IYGA 3PEVB 1OUVA 3ZYLA 5A23A 3ZRHA 1O1RA 4PH4B 3Q5MA 2XGSA 2Y4TA 3P1UA 4DJAA 4HVBA 2IJGX 2ETAA 2BEDA 4CEMA 2WXKA 2ETCA 1E8ZA 5KJMA 3CKCA 2B6CA 2Y69E 4L23A 4N2SA 4ZFHA 5CEDB 5JA4D 3DWLG 2NXPA 3J5QB 4CYMD 2IONA 4XIFA 4GPMA 3IXEA 3CGHA 3RU0A 4C48B 4PS7A 4U04A 3TWRA 4A55A 4O60A 2WXQA 4LRZA 1AWCB 2OEVA 4BTBA 1S63A 2FF4A 4BX8A 5AQ7A 3ONKA 4EZKA 4HBDA 2GRNB 4M7CA 3O48A 3JUEA 3QWWA 3MJWA 3VTXA 2LO6A 1H19A 3E37A 3TXNA 4I9EA 2P9UG 3ULEG 4I6GA 4DX2A 2BF0X 2VSYA 4O1PA 4TUUA 4ANWA 2C0MA 3PVLA 1X81A 3F6QA 1KZOA 2XPYA 2WXPA 3Q47B 3L54A 2V4HC 4OAVB 4YVQC 2A4ZA 1DC2A 5FJYA 4I6JA 4KVOA 1UN9A 4QQIA 1TR4A 2XCCA 2CHZA 4X2EA 3TJPA 4CDNA 4UWFA 4Q69A 3LETA 5LFAA 1A5EA 3PNLB 3AAAC 5C1DA 2I1JA 3EIQC 4ACLA 4CRWA 4GTRA 3RKVA 3I3NA 5AN8A 5EN5D 2XQ0A 2DBAA 2R17C 2X3MA 4KT6B 4J7WA 4ZHBA 3E30A 4TXRA 3DXMG 2E2EA 3ABLE 1H6PA 2CFZA 3PUJA 2HO1A 2FO7A 5BUZA 3ESLA 5LCWJ 1H2VC 2F8YA 2BKKB 2QYJA 1D8DA 3PH0C 2DIWA 1K3ZD 4GCOA 5AJDA 5CBNA 2YHEA 1TJFA 3CLJA 3PDNA 5J90A 5JHBA 3AS5A 4O6FA 3APDA 4ILHB 3FTYA 3C3OA 2G03A 2V5FA 2MOWA 5CKLA 2I6HA 4WNFA 5ENTD 1K1BA 3CHMA 1TJCA 3UPVA 5KNGA 2LAIA 2H6HA 4G1TA 3UMVA 5E75A 5D0OD 2PNNA 3FH7A 4B8AA 3ASNE 3ASHA 4UQXA 4APOA 4G11A 2BUGA 4A1GA 3HVEA 1WY6A 3RRUA 4LSZE 3ZFWA 2Y0BG 2OVFA 5BNWA 3R7QA 3LVQE 3NB2A 4ITRA 2KZTB 5FQ7A 3RAUA 1HS6A 3MKRA 4DUIA 2DWZA 5HRYA 1TNBA 3ZVVA 1FVFA 4JEUA 3CVXA 3JUIA 4HOUA 3DRAA 3LJ3A 3GW4A 3TWVA 5FQ4A 3FUMA 1OWNA 4OVVA 3UIPC 1HX8A 3KEAA 3B7TA 3FUDA 4DI4A 2IO3C 3SNXA 1MHQA 1JPLA 3CUCA 3OTNA 1GW6A 3ZKJA 1E8WA 5HS0A 5ARFA 3IBEA 2NC9A 4WNEA 4K5BA 1TEZA 3CHQA 3UM1A 5C2YA 2VTBA 3PE3A 5G04J 2V4LA 4AXHA 2KBXA 4GPKA 5JJ6A 1UJJA 1JCQA 3B7UX 2V5QC 3ESKA 3EDTB 3HYMB 4FP7A 1FPPA 3OXLA 1P5QA 3ABKE 2OEWA 4GA1A 4NPSA 1FVHA 2X38A 4H7XA 3PZ3A 4U0UA 2XEEA 3DSXA 5ENQD 5CMYA 2P9LG 1N0QA 3RRNB 2Y3AA 1OCCE 5AAOA 4XI0A 4JA9A 2AVPA 5FZRA 3AS4A 3UM2A 3FEXA 2OOEA 5D2MC 3UTMA 5JFFA 3ZYQA 3ZXPA 4KBQA 2KM4A 2X6JA 3DSSA 4ATZD 3APCA 4LG6A 3S6AA 5B1AE 2RFAA 1SW6A 4HOTA 3DPYA 1S70B 2HR2A 4AEZC 1E8XA 4I1AA 2PM7A 3KSLA 4N5QA 3FTZA 3CVNA 5D66A 1TNUA 4HI8A 2XENA 3EHQA 3HDXA 3ZHEB 2UY1A 4YDOA 4KYOB 3CK9A 3JXJA 2WMOA 2VZAA 4BERA 2VSNA 4AY6A 5KJNA 1K1AA 4PUCA 4ACKA 4BEPA 4BTAA 2J07A 4A3TA 2IFUA 5EX0A 2YNQA 1OCRE 4I2WA 2XEHA 3DBSA 3PS6A 4U95D 3QARA 2WQ6A 1O5MA 4WWPA 1BI8B 4GU5A 2PZIA 3V30A 4WUYA 3CK7A 4FJZA 4HLEA 4ABNA 2JEKA 1TNZA 3AG3E 4B94A 3SFYA 3ML9A 3TWQA 3T9KA 3CQGB 4GZDA 2L6JA 4AV7A 2OCCE 4GYWA 3ZYMA 3AJIA 1U3DA 1Q2ZA 4LUNU 2R2LA 3LYAA 3J5PA 4M16A 4XX5A 3ZUVB 2V0PA 2MHKA 3Q15A 5LP0A 2P9SG 3HXFA 5KJKA 3FWVA 3LKUA 5ENOD 3DEOA 3MV3B 5FZSA 4G25A 3HIZA 3ZGQA 2EILE 2WPVA 4L2LA 3AG4E 2H6GA 4C0MA 5ANRA 3KSQA 4HS2A 2L6BA 2AWIA 2XPZA 1MYOA 2RG8A 3HHMA 3CEQA 3R9AB 4UWKA 4GTVA 4XKCA 1KT1A 3E34A 5CERB 3CR3A 4HXIA 1ELKA 1IKND 3T5VA 2OV8A 4HRNA 3AU4A 5BT1A 3SF4A 4NIKA 4K5CA 4YNDA 2WQ7A 4G23A 5AARA 3UT7A 3EIJA 4L1BA 1N54A 5CEAA 3UIOC 3QOUA 4LEUA 4DPRA 3D9PA 3ISMC 2XGOA 4IYPA 2GW1A 4WNGA 1DCQA 1IHBA 1N4QA 2J09A 4FHKA 4I17A 2I1KA 3RO3A 1PY1A 3SD5A 1ZU2A 3D9MA 1VDYA 3Q4AB 1QQEA 1BPOA 3RO2A 3OAWA 4HNAD 3I4RB 2FBNA 3LDZA 3SE5A 1S0PA 3GYZA 3FY4A 3X2QE 3SQVA 4D10C 3FU5A 1AP7A 3UI2A 5BXOA 3MKQA 4YDEA 3L13A 2NUDA 3C72A 2P9NG 4NACA 3HXEA 5JJTA 4ILIA 4N3CA 4TUMA 4CT4A 3ML8A 1ZB1A 3SO8A 1KPSB 3S7FA 3PNTB 2KCLA 3KAEA 2Q7FA 2DVWA 3VLDA 1OWPA 2BTDA 1TN6A 3GZSA 4UI9C 2GRPB 4GZ6A 4DX6D 4G8LA 4U63A 3ABME 1D8EA 4MBGA 3UM3A 3EHNA 3C5RA 2PQRA 4GTSA 2WXIA 3S7JA 2LUHA 2KATA 4X8QA 1JWGA 3UQ3A 2KCVA 4ILGA 4MKTA 4APFA 1LD7A 3HG0D 3ASGA 4Q94A 3B13A 4GMLA 2L0TB 2RFMA 3QKYA 4K5AB 2GROB 4FA6A 4GTTA 4BFRA 4C9BB 2XEVA 3DSTA 4JW1A 1KLXA 4MS6A 1SZ9A 2J08A 2ILRA 1HH8A 4JHJA 3DXKG 5JJ7A 4GA2A 1MQSA 5G55A 2KCKA 2RKKA 3I4GA 4RLYA 1BI7B 1NI1A 2LSVA 3W9GA 3AU5A 5G2NA 4CDMA
chains in the Genus database with same CATH topology
4L2YA 4WNEA 3SZ7A 5G04C 1TEZA 3PREA 1E96B 3CHQA 2P58C 3CSFA 3PE4A 4L7TA 3WXXA 1KT0A 2XRYA 2LAHA 5C2YA 2VTBA 5EX3A 1Z6TA 4ANXA 3PE3A 3CVLA 3B7SA 3JQ0A 4JVSA 5G04J 5DIZA 4N5CA 1QNFA 2GRLA 2V4LA 4AXHA 1XGWA 3LXUX 4GPKA 5JJ6A 3FU0A 1UJJA 3FTUA 3QJZA 5JHBA 3B7UX 5G05C 4B8CB 4N67A 3ESKA 3EDTB 3HYMB 4JZYA 4FP7A 3T5XA 1NZNA 3OXLA 4KZ0A 2WXGA 4UI9K 4JHRA 4WAFA 2WQHA 3D9NA 1H0AA 4KMOA 4PS8A 4C0EA 5AIJA 3PUKA 5G05J 3MCXA 4N2QA 3EHMA 3Q49B 4I1OB 1P5QA 3KD7A 4G24A 4M3OA 4JPSA 4RG6A 4GA1A 3TAXA 4NPSA 1JWFA 2I2OA 3FFLA 4PDXA 2L9BA 4LERA 1INZA 1JUQA 3NZSA 1FVHA 2X38A 4H7XA 3OXFA 3MYVA 4F3VA 2X6IA 2M63A 4CDRA 3CVYA 4WNDA 4U0UA 2C2LA 3SFZA 4FJYA 1E7UA 3JCKC 4CGWA 5CMYA 3AS8A 5CMWA 3PZDA 3FHEA 4K03A 3RRNB 1H6KA 2Y3AA 3ENEA 4U8HA 5FQ6A 4HORA 4TV3A 5KJLA 4KZCA 2CFUA 4F1SA 3OXGA 2X6FA 2R59A 2AXUA 4XI0A 5EKQD 3ULQA 3IEGA 4JA9A 1H2TC 5FTPA 3GZ1A 2AVPA 5FZRA 3AS4A 3L22A 2WXFA 3ZIMA 4N3AA 3VTYA 3FH8A 3FEXA 3O4ZA 2OOEA 4FLBA 1NA0A 3LPZA 3T8MA 3S7DA 3CHRA 2X6KA 4G2VA 5JFFA 3FU3A 4A3VA 4JA7A 3ZYQA 4KBQA 2KM4A 4WGJA 2OVBA 2X6JA 4K0RA 1UN8A 1HE8A 2VSOE 2QY7A 1U3CA 4FLHA 4W9RA 3APCA 2IU1A 4OVUA 2VGYA 2DCPA 3NZUA 5D0QD 3MKQB 3S6AA 5LOZA 4P29A 1HO8A 5ARGA 3L6AA 5BV0A 1N52A 1EPUA 5T3RA 4AP2A 5T4YA 5DBKA 5FT9A 2I9CA 1IQRA 1DVPA 4HOTA 2VGXB 4FHJA 2HR2A 4I6EA 4AEZC 1E8XA 4PS3A 3CVVA 1YA0A 2PL2A 2PM7A 4I1AA 1E90A 2AXVA 3FTZA 5AYWD 4J0UA 2WMNA 4MLPA 3CVNA 3IV0A 3D9IA 1IQUA 3CK8A 3QWPA 4H7YA 3ZW3A 2PM6A 4EZJA 3RK6A 4AIFA 1UJKA 4U0SA 4EPZA 2HM8A 3MZLB 4GCNA 3LCAA 4B0ZA 3HDXA 3JQ1A 1UG3A 3G2UA 4XKBA 3ZHEB 3P2BA 2AXZA 1ELRA 2UY1A 3ZN3A 1NA3A 4KYOB 2VYIA 3CK9A 3FUHA 3S7BA 1EDUA 3SGHA 4WWNA 2RD0A 4EBAA 3CVWA 2WMOA 2VZAA 4URKA 2VSNA 3U4TA 4AY6A 5JFZA 2IQCA 3ASFA 4ATGA 5KJNA 1IHGA 4PUCA 4ACKA 3CVPA 2F6SA 2A5UA 5LX8A 1PC2A 3QC1A 1PAQA 3HVEB 3TGOA 5CGLA 2JK8A 3UT4A 5KCMA 3U64A 4DLQA 4BTAA 5CHEE 3CHPA 3IHYA 3LS8A 4KXKB 3FTVA 2J07A 4A3TA 5EU0A 2IFUA 5EX0A 3ONLA 4OYSA 4AJWA 3IHVA 3FDHA 2YNQA 3TG4A 3PEUB 3UUXA 1LF8A 1HG5A 1OWOA 4I2WA 3L08A 3LY9A 3FUJA 2J49A 3DBSA 3PS6A 2KC7A 3QK0A 3QARA 2WQ6A 4X2CA 5HQ8A 3U66A 2J4BA 4WWPA 5AJLA 3CHSA 4GU5A 2PZIA 5BW8C 5CCLA 1IYGA 3PEVB 4GZCA 1OUVA 3LEWA 2LSUA 3ZYLA 4WUYA 4Y6CA 5A23A 3ZRHA 3CK7A 4JXTA 4PH4B 4JHKA 3Q5MA 2XGSA 2IOLA 2Y4TA 1DNPA 4FJZA 3P1UA 4DJAA 1QZ2A 3DPDA 3ASDA 4HVBA 2WXHA 2IJGX 3MX3A 4HLEA 3FTXA 1EF1C 4ABNA 3K9IA 4CEMA 2WXKA 1E7VA 2CHWA 2JEKA 3NQPA 1E8ZA 4FU3A 3TXMA 1HXIA 1HZ4A 3FU6A 4ANUA 1L5JA 5KJMA 4B94A 3UX4A 4BX9A 3CKCA 3ML9A 4J8EA 4L23A 3CQGB 4GZDA 4WWOA 4N2SA 2L6JA 4AV7A 3MEKA 4JC8A 2J4DA 4GYWA 5FWQA 4QFVA 2YHCA 3ZYMA 3PRZA 3CHOA 1U3DA 1H2UA 4LUNU 1X5BA 2NXPA 2NSZA 3LYAA 2IONA 4M16A 4XX5A 4XIFA 2KZTA 3L16A 3CVUA 3CGHA 2VTBB 4N3BA 3RU0A 2V0PA 4PS7A 1Z3XA 2IOSA 4U04A 3B7RL 2MHKA 4A55A 3I5PA 3SN9A 3CV0A 3Q15A 5LP0A 5J08A 2WXOA 2WXQA 2XHEA 5KJKA 4LRZA 4JL0A 4BTBA 3FWVA 2WB2A 4AY5A 3BG0B 2XPIA 3FH5A 3LKUA 2FF4A 4BX8A 2WXLA 4U07A 3MV3B 4UWLA 5FZSA 3TG5A 4G25A 3HIZA 3GZ2A 1ZBPA 2E0IA 5HI7A 3D9LA 3ZGQA 3ONKA 5JHAA 4EZKA 3SBTB 2WPVA 3O48A 4L2LA 5BPPA 3JYSA 4DK5A 3MA5A 4CGVA 4B89A 1HFAA 2FEZA 3MV2B 3QWWA 3MJWA 5A7DB 3VTXA 4C0MA 2LO6A 5ANRA 1H19A 5BV1A 3TXNA 5FZQA 5CMTA 4I9EA 4HS2A 1OWMA 2AWIA 4I6GA 4IN3B 4XI8A 3URZA 2BF0X 2XPZA 2VSXE 4CT0A 2XGMA 2VSYA 2RG8A 3G2TA 4TUUA 4ANWA 2C0MA 3CKBA 3HHMA 3PVLA 3VLEA 4U0ZA 3CEQA 3FEYA 2YQ8A 4NURA 4UWKA 3FTWA 3R9AB 4XKCA 4FADA 1KT1A 2XPYA 3CR3A 4HXIA 2WXPA 3Q47B 4Y6WA 1ELKA 3L54A 4NRHB 4F7AA 3T5VA 4RG9A 2OV8A 4YVQC 3FUFA 4E6HA 3AU4A 2A4ZA 2CG2A 2CHXA 3ZCBA 5FJYA 4I6JA 5BT1A 3SF4A 4KVOA 1UN9A 4J8FA 2ONDA 2XCCA 2WXNA 4YNDA 3ZEFA 4RVBA 4MRUA 4EBAG 2CHZA 4X2EA 4G26A 3ZYKA 4EQFA 4HOSA 3TJPA 4CDNA 4UWFA 1FCHA 4Q69A 2WQ7A 3LETA 2UWJG 3QWVA 4G23A 1WM5A 3VLFA 3PNLB 5LFAA 4UWHA 3FUEA 5C1DA 3IKOB 3UT7A 3EIJA 2I1JA 4L1BA 1N54A 1OWLA 2Y4UA 3EIQC 2YINA 3QOUA 4ACLA 1E8YA 4CRWA 1XNFA 4LEUA 3RKVA 4DPRA 3I3NA 2XQ0A 3D9PA 2XGOA 4IYPA 2DBAA 2GW1A 3SHFA 4DI3A 2VY3A 3D9OA 2R17C 4I17A 2J09A 4FHKA 4IULA 4WNGA 2I1KA 3RO3A 2X3MA 4KT6B 2R5SA 1PY1A 3FP3A 3SD5A 4GZ5A 4XE0A 4I9CA 1ZU2A 3D9MA 1VDYA 3Q4AB 2WXMA 1QQEA 3ZPJA 5LCWC 1BPOA 3RO2A 4BWRA 3L17A 3FUNA 2E2EA 3KS2A 3ZXSA 4BY6A 3OAWA 2CFZA 3I4RB 2FBNA 2HO1A 3PUJA 2FO7A 3LDZA 4YVOA 5BUZA 5ANLA 3SE5A 3FULA 3ESLA 3U3WA 3D9JA 5LCWJ 1H2VC 2UY1B 1EYHA 1S0PA 1HU3A 3GYZA 1Z3YA 2VQ2A 3FY4A 1HF8A 4IRUA 3PH0C 4CCAA 3SI5A 2DIWA 2L0IA 4ANVA 1ELWA 2WXRA 4HOQA 4EZLA 4D10C 1WAO1 1W3BA 4GCOA 4ME2A 5AJDA 2YHEA 1TJFA 3FU5A 4J6IA 1SZAA 1UW4B 3CLJA 3R7RA 3PDNA 5J90A 3FUIA 3AS5A 3APFA 3L13A 3MKQA 3QB2A 4GB9A 3LY8A 4O6FA 2PQNA 3SBSA 3RJVA 4X2DA 3APDA 4ILHB 3FTYA 4UQZA 4AM9A 4PY3A 3TL5A 2FULA 3E4BA 5EDSA 4NACA 3MGBA 4UQYA 2QFCA 2G03A 5JJTA 2VGXA 5T8IA 4ILIA 4N3CA 2V5FA 3FUKA 3CSTA 4CT4A 3ML8A 5AENA 4EECA 2MOWA 5CKLA 3LVRE 4GYYA 3CQCB 3S2AA 2I6HA 1Y8MA 3S7FA 4WNFA 3RRMB 3CHMA 3PNTB 2KCLA 4N39A 3BEEA 3KAEA 2Q7FA 2VJ8A 1TJCA 4GAAA 3UPVA 3VLDA 1OWPA 2BTDA 2LAIA 5M72A 4R7LA 2EQXA 3GZSA 4UI9C 3ZHEA 4DLOA 4J8DA 2IF4A 2XCBA 3KEZA 4GZ6A 2XRZA 1A17A 1SQMA 4G1TA 3QDNA 3UMVA 4U63A 4BT8A 2WM9A 5E75A 3QAQA 4UI9J 4LCTA 5D0OD 3EHNA 3FH7A 4B8AA 3QNKA 4I2ZA 2PQRA 3FTSA 4XZ4A 3S7JA 2WXIA 2GRMA 3ASHA 4UQXA 4APOA 4G11A 2BUGA 2HYZA 4A1GA 3HVEA 2C0LA 1WY6A 2ZU6B 3RRUA 3BG1B 4GYOA 3ZFWA 2OVFA 4BSXA 2X6HA 2KATA 5BNWA 2MRIA 3ZLMA 1JWGA 3UQ3A 3G2WA 3R7QA 2KCVA 3LVQE 4ILGA 4MKTA 5A6CA 4FC8A 4ITRA 2WXJA 4FULA 5FQ8A 4F53A 2WVIA 4APFA 2KZTB 3LY7A 5FQ7A 1HS6A 2LNIA 3D9KA 3NF1A 3MKRA 3ASGA 4GMJA 2AW6A 3ZC7A 2JLBA 3G2SA 4J8SA 4Q94A 2GGFA 4RSYA 5CCMA 3B13A 4GMLA 2L0TB 2V8SE 3QKYA 5ENNA 3ZVVA 1HG2A 2CG3A 4LU4A 4FA6A 4BFRA 1FVFA 4JEUA 4C9BB 4I43A 2XEVA 4V3IA 3CVXA 5E76A 3JUIA 3CIAA 4HOUA 3CVQA 3LJ3A 4JW1A 4A1SA 3RIBA 1Y6IA 4AOFA 3GW4A 4XI9A 3C98A 5FQ4A 3FUMA 4KVMA 1OWNA 4AVXA 4I1MA 4OVVA 1KLXA 3SHGA 4JEHA 4MS6A 4GA0A 1SZ9A 1B89A 4HFGA 1NP7A 2ILRA 2J08A 3UT8A 1HX8A 3B7TA 4E85A 3FUDA 4DI4A 3D3MA 1HH8A 3SNXA 1MHQA 2J9QA 4UWGA 4JHJA 3U9WA 5JJ7A 4BT9A 1JPLA 3CUCA 4GA2A 2FI7A 1MQSA 4GZ3A 3OTNA 1GW6A 4Q96A 4NQ0A 4TRQA 1E8WA 3N71A 5G55A 2KCKA 3I4GA 3EJNA 3N3UA 5ARFA 2LSVA 3AU5A 3G2VA 5G2NA 3IBEA 2NC9A 4CDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SZ7 A;  4WNE A;  5G04 C;  1E96 B;  3PE4 A;  2P58 C;  3WXX A;  1KT0 A;  5EX3 A;  3PE3 A;  3CVL A;  5G04 J;  5DIZ A;  4N5C A;  4GPK A;  5JJ6 A;  5G05 C;  4N67 A;  3ESK A;  3EDT B;  3HYM B;  1NZN A;  3OXL A;  4UI9 K;  4JHR A;  2WQH A;  5G05 J;  4N2Q A;  3Q49 B;  1P5Q A;  3KD7 A;  4G24 A;  4RG6 A;  4GA1 A;  3TAX A;  4NPS A;  3FFL A;  4H7X A;  3OXF A;  4F3V A;  4CDR A;  4WND A;  4U0U A;  2C2L A;  4CGW A;  3AS8 A;  4HOR A;  5KJL A;  3OXG A;  4XI0 A;  5EKQ D;  3ULQ A;  3IEG A;  4JA9 A;  5FTP A;  3GZ1 A;  2AVP A;  5FZR A;  3AS4 A;  4N3A A;  3VTY A;  2OOE A;  1NA0 A;  3LPZ A;  3S7D A;  4G2V A;  5JFF A;  4JA7 A;  4KBQ A;  4WGJ A;  4W9R A;  2VGY A;  5D0Q D;  3S6A A;  5ARG A;  5DBK A;  5FT9 A;  4HOT A;  2VGX B;  2HR2 A;  1YA0 A;  2PL2 A;  4I1A A;  5AYW D;  4J0U A;  3CVN A;  3CK8 A;  3QWP A;  4H7Y A;  4AIF A;  4U0S A;  4GCN A;  3LCA A;  3ZHE B;  3ZN3 A;  2UY1 A;  1ELR A;  1NA3 A;  4KYO B;  2VYI A;  3CK9 A;  3S7B A;  2VZA A;  2VSN A;  3U4T A;  4AY6 A;  5JFZ A;  3ASF A;  5KJN A;  1IHG A;  3CVP A;  2F6S A;  1PC2 A;  3TGO A;  5CGL A;  2JK8 A;  4BTA A;  5CHE E;  4KXK B;  5EU0 A;  2IFU A;  5EX0 A;  3TG4 A;  3UUX A;  4I2W A;  3LY9 A;  2KC7 A;  4X2C A;  5HQ8 A;  2PZI A;  5BW8 C;  5CCL A;  1IYG A;  1OUV A;  2LSU A;  4WUY A;  4Y6C A;  3CK7 A;  3Q5M A;  2XGS A;  2Y4T A;  1QZ2 A;  3ASD A;  4ABN A;  3K9I A;  1HXI A;  1HZ4 A;  5KJM A;  4B94 A;  3CKC A;  4J8E A;  4N2S A;  2L6J A;  3MEK A;  4GYW A;  2YHC A;  3LYA A;  4M16 A;  4XIF A;  4N3B A;  3RU0 A;  4U04 A;  2MHK A;  3SN9 A;  3CV0 A;  3Q15 A;  5KJK A;  4JL0 A;  4BTB A;  3FWV A;  4AY5 A;  2XPI A;  3LKU A;  2FF4 A;  4U07 A;  3MV3 B;  3TG5 A;  5FZS A;  4G25 A;  3GZ2 A;  1ZBP A;  5HI7 A;  3ZGQ A;  2WPV A;  3O48 A;  3JYS A;  3MA5 A;  4CGV A;  2FEZ A;  3MV2 B;  3QWW A;  5A7D B;  3VTX A;  5FZQ A;  5CMT A;  4I9E A;  4IN3 B;  4XI8 A;  3URZ A;  2XGM A;  2VSY A;  2C0M A;  3CKB A;  4U0Z A;  3CEQ A;  3R9A B;  2YQ8 A;  1KT1 A;  3Q47 B;  4Y6W A;  4NRH B;  4RG9 A;  4YVQ C;  3ZCB A;  5FJY A;  5BT1 A;  3SF4 A;  4J8F A;  2OND A;  2XCC A;  4YND A;  4X2E A;  4G26 A;  4EQF A;  4HOS A;  1FCH A;  3LET A;  2UWJ G;  3QWV A;  4G23 A;  1WM5 A;  5C1D A;  2Y4U A;  3QOU A;  1XNF A;  4LEU A;  3RKV A;  2XGO A;  2DBA A;  2GW1 A;  2VY3 A;  4WNG A;  4I17 A;  3RO3 A;  2R5S A;  3FP3 A;  4GZ5 A;  4I9C A;  1ZU2 A;  3Q4A B;  1QQE A;  3ZPJ A;  5LCW C;  3RO2 A;  4BWR A;  2E2E A;  3KS2 A;  2FBN A;  2HO1 A;  2FO7 A;  4YVO A;  3SE5 A;  3U3W A;  5LCW J;  2UY1 B;  3GYZ A;  2VQ2 A;  1ELW A;  4HOQ A;  1WAO 1;  1W3B A;  4GCO A;  4ME2 A;  3PDN A;  3AS5 A;  4O6F A;  3LY8 A;  2PQN A;  3RJV A;  4X2D A;  4UQZ A;  4AM9 A;  4PY3 A;  3E4B A;  4UQY A;  2QFC A;  2G03 A;  5JJT A;  2VGX A;  4N3C A;  2V5F A;  5CKL A;  4GYY A;  2I6H A;  1Y8M A;  3S7F A;  4WNF A;  2KCL A;  4N39 A;  3BEE A;  3KAE A;  2Q7F A;  1TJC A;  3UPV A;  5M72 A;  4UI9 C;  3ZHE A;  4J8D A;  2IF4 A;  2XCB A;  4GZ6 A;  1A17 A;  4G1T A;  3QDN A;  4BT8 A;  4UI9 J;  5D0O D;  4I2Z A;  2PQR A;  3S7J A;  4UQX A;  3ASH A;  4APO A;  2BUG A;  2HYZ A;  2C0L A;  4GYO A;  3ZFW A;  5BNW A;  2KAT A;  3ZLM A;  3UQ3 A;  2KCV A;  5A6C A;  4ITR A;  3LY7 A;  2LNI A;  3NF1 A;  3MKR A;  3ASG A;  2JLB A;  3ZC7 A;  5CCM A;  3QKY A;  4LU4 A;  2XEV A;  4HOU A;  3CVQ A;  4A1S A;  3RIB A;  3GW4 A;  4XI9 A;  1KLX A;  3SHG A;  4GA0 A;  1B89 A;  1HH8 A;  2J9Q A;  4BT9 A;  5JJ7 A;  4GA2 A;  3CUC A;  4GZ3 A;  2FI7 A;  4NQ0 A;  3N71 A;  2KCK A;  3N3U A;  5ARF A;  2LSV A;  2NC9 A; 
#chains in the Genus database with same CATH topology
 4L2Y A;  3PRE A;  4L7T A;  3WXX A;  2XRY A;  2LAH A;  4DRX E;  3B7S A;  4JVS A;  5DIZ A;  3R9M A;  4N5C A;  2GRL A;  3LXU X;  4BET A;  5G05 C;  1N4R A;  4HRM B;  4JZY A;  3T5X A;  2WXG A;  2WQH A;  3D9N A;  1H0A A;  4KMO A;  2IO2 C;  3EHM A;  4JPS A;  3T8K A;  3KD7 A;  4RG6 A;  1MX6 A;  2L9B A;  2XZD G;  4LER A;  3MYV A;  4F3V A;  2ZGD A;  3JCK C;  3PZD A;  3FHE A;  4K03 A;  5FQ6 A;  5KJL A;  4F1S A;  4Z68 A;  2XS8 A;  1H2T C;  3GZ1 A;  3FH8 A;  1NA0 A;  3T8M A;  4G2V A;  3FU3 A;  4JA7 A;  3Q7A A;  5FIN A;  2JAB A;  1U3C A;  4FLH A;  5CBO A;  2IU1 A;  4OVU A;  3NZU A;  1HO8 A;  5ARG A;  3L6A A;  2A5E A;  5BV0 A;  2I9C A;  4U8Y D;  1JCS A;  2PL2 A;  4BSZ B;  5AYW D;  3IV0 A;  3CK8 A;  3QWP A;  1BLX B;  4AIF A;  3HRA A;  3MZL B;  3ZNG A;  3LCA A;  3JQ1 A;  2EIM E;  4U96 D;  3LJN A;  1NA3 A;  1EDU A;  1N9A A;  4EBA A;  2RD0 A;  4URK A;  3V2X A;  5JFZ A;  3UKU G;  1IHG A;  3CVP A;  1PC2 A;  3Q79 A;  3QC1 A;  1PAQ A;  3HVE B;  4LNU D;  3JXI A;  2B0O E;  2IY0 C;  4DLQ A;  3CHP A;  3IHY A;  4AJW A;  3IHV A;  5ENR D;  3PEU B;  1HG5 A;  3V31 A;  3FUJ A;  4X2C A;  5HQ8 A;  3CHS A;  4GTP A;  5BW8 C;  5CCL A;  4GZC A;  2LSU A;  1N4P A;  2IOL A;  3ZU7 B;  1NFI E;  3DPD A;  2WXH A;  4GMR A;  3TWT A;  3EHR A;  3FTX A;  1EF1 C;  3K9I A;  1E7V A;  2CHW A;  3TXM A;  3NQP A;  4ANU A;  1HXI A;  1HZ4 A;  3UX4 A;  4BX9 A;  4J8E A;  4WWO A;  1MX2 A;  3UKR G;  2J4D A;  4QFV A;  1TNO A;  3PRZ A;  1H2U A;  2GRR B;  1X5B A;  2NSZ A;  4A63 B;  3L16 A;  3CVU A;  2VTB B;  1Z3X A;  2IOS A;  2XZT G;  3I5P A;  5J08 A;  2WXO A;  4DX5 D;  2XHE A;  5AQB A;  2XS1 A;  4JL0 A;  2WB2 A;  1RW2 A;  4U07 A;  3TG5 A;  3GZ2 A;  3E33 A;  1ZBP A;  2E0I A;  5HI7 A;  2R03 A;  3D9L A;  5JHA A;  3Q9U C;  4LNB A;  2NYJ A;  3JYS A;  3BUA A;  4YDY A;  1HFA A;  4B89 A;  5A7D B;  5CMT A;  1OWM A;  3Q73 A;  1YYH A;  2VSX E;  1WG0 A;  2R05 A;  2XGM A;  3CKB A;  3FEY A;  3FTW A;  1UOH A;  3NOC D;  4Y6W A;  4NRH B;  3D9H A;  4E6H A;  2CG2 A;  3ZCB A;  5B1B E;  4J8F A;  4RVB A;  4MRU A;  3ZYK A;  4EQF A;  1V54 E;  4HOS A;  1FCH A;  2UWJ G;  3QWV A;  3VLF A;  1WM5 A;  4UWH A;  3IKO B;  3E32 A;  5ENS D;  5AQA A;  2YIN A;  1QYM A;  1XNF A;  2EIK E;  3UXG A;  4DI3 A;  2VY3 A;  4IUL A;  3D9O A;  2MYO A;  4XE0 A;  2WXM A;  4J8Y A;  3ZPJ A;  5LCW C;  4BWR A;  3DSU A;  1EYH A;  2UY1 B;  1HU3 A;  1Z3Y A;  2VQ2 A;  1HF8 A;  4ANV A;  2F37 A;  2L0I A;  1ELW A;  2WXR A;  4HOQ A;  4EZL A;  1WAO 1;  3B7B A;  2QC9 A;  4J6I A;  3DEP A;  3PZ4 A;  1D9S A;  3FUI A;  3APF A;  3QB2 A;  4GB9 A;  3LY8 A;  2PQN A;  4HQD A;  3RJV A;  4AM9 A;  4PY3 A;  3TL5 A;  5EDS A;  3MGB A;  2QFC A;  2VGX A;  5T8I A;  5IY5 E;  3FUK A;  1U2V G;  3CST A;  3DSV A;  3LVR E;  4GYY A;  3CQC B;  1N94 A;  3RRM B;  3BEE A;  2VJ8 A;  5M72 A;  4R7L A;  5HKP A;  2IF4 A;  3KEZ A;  2XRZ A;  1A17 A;  1SQM A;  3QDN A;  4DX1 A;  4UUC A;  4BT8 A;  3QAQ A;  4F1P A;  4LCT A;  3QNK A;  4I2Z A;  3FTS A;  4XZ4 A;  2HYZ A;  4TXP A;  2C0L A;  2ZU6 B;  3TWS A;  4BSX A;  2MRI A;  5A6C A;  4FC8 A;  5FQ8 A;  4FUL A;  4F53 A;  3Q75 A;  2LNI A;  3D9K A;  3Q78 A;  2AW6 A;  4RSY A;  2ETB A;  1FT1 A;  1HG2 A;  2CG3 A;  4LU4 A;  1YMP A;  3RSE G;  3ASO E;  3CVQ A;  4A1S A;  3RIB A;  1Y6I A;  4AOF A;  4KVM A;  4AVX A;  3SHG A;  5FIO A;  1B89 A;  4HFG A;  1NP7 A;  1NL4 A;  3UT8 A;  1N4S A;  5AQ9 A;  4TXQ A;  2J9Q A;  3U9W A;  4UWG A;  5EYP F;  4BT9 A;  4GZ3 A;  2FI7 A;  1TN7 A;  4TRQ A;  3N71 A;  3N3U A;  3G2V A;  5G04 C;  5CRU A;  1E96 B;  3PE4 A;  2P58 C;  1KT0 A;  3NBN B;  3JQ0 A;  4F6R D;  1XGW A;  5B3S E;  1NH1 A;  3W9F A;  2ZIS A;  2EIN E;  4B8C B;  4HLL A;  4LNG A;  1NZN A;  1H6O A;  4UI9 K;  4JHR A;  5AIJ A;  3PZ1 A;  3MCX A;  4N2Q A;  3AG2 E;  3Q49 B;  3FFL A;  1JUQ A;  3NZS A;  3OXF A;  2X6I A;  2M63 A;  4WND A;  2C2L A;  4FJY A;  1E7U A;  5ENP D;  1H6K A;  4HOR A;  1S64 A;  4KZC A;  2AXU A;  5EKQ D;  3ULQ A;  5FTP A;  4JB8 P;  3O4Z A;  5KBA A;  1LD8 A;  3LPZ A;  3S7D A;  3CHR A;  5KWD A;  2OVB A;  4K0R A;  1FT2 A;  1HE8 A;  2VSO E;  2QY7 A;  2DCP A;  3MKQ B;  2F0Y A;  3PZ2 A;  1N52 A;  1EPU A;  4AP2 A;  2H6I A;  5DBK A;  4FHJ A;  2P9I G;  2AXV A;  2J8S D;  3ULY A;  4J0U A;  4MLP A;  1OT8 A;  3D9I A;  4H7Y A;  2PM6 A;  4EZJ A;  3RK6 A;  1UJK A;  4U0S A;  2HM8 A;  1G3N B;  4YDW A;  1UG3 A;  3P2B A;  1ELR A;  2VYI A;  1N11 A;  4OAU C;  3U4T A;  4ATG A;  1IXV A;  3TGO A;  1N0R A;  4O1O A;  3UT4 A;  3U64 A;  3LS8 A;  1V55 E;  3ONL A;  5ITZ F;  1Z5S C;  3FDH A;  1LF8 A;  2NUN A;  3L08 A;  1SA5 A;  3LY9 A;  2P9P G;  3QK0 A;  3WG7 E;  2KC7 A;  2DYS E;  3U66 A;  2J4B A;  3LEW A;  2GRQ B;  4Y6C A;  1OCO E;  4JXT A;  4JHK A;  1DNP A;  1QZ2 A;  3ASD A;  1RZ4 A;  3MX3 A;  1MZC A;  4FU3 A;  3FU6 A;  4CZ2 D;  1L5J A;  3DSW A;  1BD8 A;  3C3R A;  3L82 A;  3MEK A;  4JC8 A;  5FWQ A;  4XEI G;  2YHC A;  1OCZ E;  3CHO A;  3NOG D;  2KZT A;  4N3B A;  3B7R L;  1SA4 A;  3SN9 A;  3CV0 A;  4AY5 A;  3BG0 B;  2XPI A;  3FH5 A;  2WXL A;  4UWL A;  2LXM A;  1LTX A;  2VGE A;  2P2C P;  3SBT B;  5BPP A;  4DK5 A;  3MA5 A;  4CGV A;  3HXC A;  2FEZ A;  3MV2 B;  5BV1 A;  3EUV A;  5CRV A;  5FZQ A;  5EIL A;  4HB5 A;  1WDY A;  4IN3 B;  4XI8 A;  3URZ A;  5BXU A;  4CT0 A;  3G2T A;  3VLE A;  4U0Z A;  4NUR A;  4FAD A;  2YQ8 A;  5H7P A;  2DZN A;  4F7A A;  4RG9 A;  3FUF A;  2CHX A;  2FO1 E;  4GTQ A;  3TWW A;  1O1T A;  2OND A;  2WXN A;  2ZXW E;  3ZEF A;  4EBA G;  4G26 A;  1BU9 A;  3FUE A;  4B93 B;  1OWL A;  2Y4U A;  1TYQ G;  1E8Y A;  3SHF A;  1QBQ A;  2EIJ E;  2R5S A;  3FP3 A;  4GZ5 A;  4I9C A;  5EID A;  3L17 A;  3FUN A;  3KS2 A;  3ZXS A;  4BY6 A;  4YVO A;  5ANL A;  3FUL A;  3U3W A;  3D9J A;  3UIN C;  1TNY A;  4IRU A;  4CCA A;  2R02 A;  3SI5 A;  1K8K G;  2DYR E;  1W3B A;  4ME2 A;  1SZA A;  1UW4 B;  3R7R A;  3SBS A;  3BQO A;  4GTM A;  4X2D A;  4UQZ A;  2QYU A;  1OXJ A;  3NAW A;  2FUL A;  3E4B A;  4UQY A;  5AEN A;  4G8K A;  4EEC A;  3S2A A;  1Y8M A;  4N39 A;  2LXL A;  4GAA A;  2EQX A;  4DLO A;  3ZHE A;  4J8D A;  2XCB A;  2WM9 A;  4UI9 J;  2QZA A;  2HE0 A;  2GRM A;  3BG1 B;  4GYO A;  3TWX A;  2X6H A;  3ZLM A;  3G2W A;  2WXJ A;  2ZGG A;  2WVI A;  2ZIR A;  3LY7 A;  3AG1 E;  4HI9 A;  3NF1 A;  4GMJ A;  2JLB A;  3ZC7 A;  3G2S A;  4J8S A;  2GGF A;  5CCM A;  2V8S E;  5ENN A;  3V79 K;  3TWU A;  1MX4 A;  1TN8 A;  5CEC B;  4I43 A;  4V3I A;  5E76 A;  3CIA A;  1O1S A;  5EIB E;  4XI9 A;  3C98 A;  4RQI A;  4I1M A;  4JEH A;  4GA0 A;  2P9K G;  4E85 A;  3D3M A;  4DX7 D;  4Q96 A;  4NQ0 A;  3EU9 A;  3EJN A;  3UM0 A;  2IEJ A;  2BKG A;  3SZ7 A;  1MJ0 A;  3CSF A;  5EX3 A;  1Z6T A;  4ANX A;  3CVL A;  1QNF A;  3Q9N C;  3FU0 A;  3C3Q A;  3FTU A;  3QJZ A;  1SVX A;  1YCS B;  4N67 A;  5KNH D;  4KZ0 A;  3BU8 A;  4PS8 A;  4WAF A;  4C0E A;  4U8V D;  1OY3 D;  3PUK A;  5G05 J;  4I1O B;  4G24 A;  4M3O A;  3TAX A;  1JWF A;  2I2O A;  4PDX A;  1INZ A;  4CDR A;  3CVY A;  3EU5 A;  3SFZ A;  4CGW A;  3AS8 A;  5CMW A;  4U8H A;  3ENE A;  4TV3 A;  4HRL A;  2DZO A;  2CFU A;  3OXG A;  2X6F A;  2R59 A;  3IEG A;  3L22 A;  2WXF A;  3ZIM A;  4N3A A;  3VTY A;  4FLB A;  3HXD A;  2X6K A;  2Y1L E;  4A3V A;  4WGJ A;  4BES A;  3SFX A;  1UN8 A;  4W9R A;  2VGY A;  5D0Q D;  1JCR A;  2KXP C;  5LOZ A;  4P29 A;  3HXB A;  2H6F A;  5T3R A;  5T4Y A;  5FT9 A;  1IQR A;  1DVP A;  2VGX B;  4I6E A;  4L9P A;  4U7E B;  1DCE A;  4PS3 A;  3CVV A;  1YA0 A;  1E90 A;  3SY2 A;  2WMN A;  1IQU A;  3Q7F A;  3ZW3 A;  5EYL A;  4EPZ A;  4GTO A;  4GCN A;  4B0Z A;  2F8X K;  3G2U A;  4XKB A;  1N95 A;  3ZN3 A;  2AXZ A;  3FUH A;  3S7B A;  3SGH A;  4WWN A;  3L9T A;  4EHM A;  3CVW A;  2IQC A;  3ASF A;  5LX8 A;  2F6S A;  2A5U A;  5CGL A;  2JK8 A;  5KCM A;  5CHE E;  4KXK B;  3FTV A;  5EU0 A;  4OYS A;  3V2O A;  3TG4 A;  3UUX A;  2AJA A;  1OWO A;  1KZP A;  5JMN D;  2J49 A;  5AJL A;  3B95 A;  4JD2 G;  1IYG A;  3PEV B;  1OUV A;  3ZYL A;  5A23 A;  3ZRH A;  1O1R A;  4PH4 B;  3Q5M A;  2XGS A;  2Y4T A;  3P1U A;  4DJA A;  4HVB A;  2IJG X;  2ETA A;  2BED A;  4CEM A;  2WXK A;  2ETC A;  1E8Z A;  5KJM A;  3CKC A;  2B6C A;  2Y69 E;  4L23 A;  4N2S A;  4ZFH A;  5CED B;  5JA4 D;  3DWL G;  2NXP A;  3J5Q B;  4CYM D;  2ION A;  4XIF A;  4GPM A;  3IXE A;  3CGH A;  3RU0 A;  4C48 B;  4PS7 A;  4U04 A;  3TWR A;  4A55 A;  4O60 A;  2WXQ A;  4LRZ A;  1AWC B;  2OEV A;  4BTB A;  1S63 A;  2FF4 A;  4BX8 A;  5AQ7 A;  3ONK A;  4EZK A;  4HBD A;  2GRN B;  4M7C A;  3O48 A;  3JUE A;  3QWW A;  3MJW A;  3VTX A;  2LO6 A;  1H19 A;  3E37 A;  3TXN A;  4I9E A;  2P9U G;  3ULE G;  4I6G A;  4DX2 A;  2BF0 X;  2VSY A;  4O1P A;  4TUU A;  4ANW A;  2C0M A;  3PVL A;  1X81 A;  3F6Q A;  1KZO A;  2XPY A;  2WXP A;  3Q47 B;  3L54 A;  2V4H C;  4OAV B;  4YVQ C;  2A4Z A;  1DC2 A;  5FJY A;  4I6J A;  4KVO A;  1UN9 A;  4QQI A;  1TR4 A;  2XCC A;  2CHZ A;  4X2E A;  3TJP A;  4CDN A;  4UWF A;  4Q69 A;  3LET A;  5LFA A;  1A5E A;  3PNL B;  3AAA C;  5C1D A;  2I1J A;  3EIQ C;  4ACL A;  4CRW A;  4GTR A;  3RKV A;  3I3N A;  5AN8 A;  5EN5 D;  2XQ0 A;  2DBA A;  2R17 C;  2X3M A;  4KT6 B;  4J7W A;  4ZHB A;  3E30 A;  4TXR A;  3DXM G;  2E2E A;  3ABL E;  1H6P A;  2CFZ A;  3PUJ A;  2HO1 A;  2FO7 A;  5BUZ A;  3ESL A;  5LCW J;  1H2V C;  2F8Y A;  2BKK B;  2QYJ A;  1D8D A;  3PH0 C;  2DIW A;  1K3Z D;  4GCO A;  5AJD A;  5CBN A;  2YHE A;  1TJF A;  3CLJ A;  3PDN A;  5J90 A;  5JHB A;  3AS5 A;  4O6F A;  3APD A;  4ILH B;  3FTY A;  3C3O A;  2G03 A;  2V5F A;  2MOW A;  5CKL A;  2I6H A;  4WNF A;  5ENT D;  1K1B A;  3CHM A;  1TJC A;  3UPV A;  5KNG A;  2LAI A;  2H6H A;  4G1T A;  3UMV A;  5E75 A;  5D0O D;  2PNN A;  3FH7 A;  4B8A A;  3ASN E;  3ASH A;  4UQX A;  4APO A;  4G11 A;  2BUG A;  4A1G A;  3HVE A;  1WY6 A;  3RRU A;  4LSZ E;  3ZFW A;  2Y0B G;  2OVF A;  5BNW A;  3R7Q A;  3LVQ E;  3NB2 A;  4ITR A;  2KZT B;  5FQ7 A;  3RAU A;  1HS6 A;  3MKR A;  4DUI A;  2DWZ A;  5HRY A;  1TNB A;  3ZVV A;  1FVF A;  4JEU A;  3CVX A;  3JUI A;  4HOU A;  3DRA A;  3LJ3 A;  3GW4 A;  3TWV A;  5FQ4 A;  3FUM A;  1OWN A;  4OVV A;  3UIP C;  1HX8 A;  3KEA A;  3B7T A;  3FUD A;  4DI4 A;  2IO3 C;  3SNX A;  1MHQ A;  1JPL A;  3CUC A;  3OTN A;  1GW6 A;  3ZKJ A;  1E8W A;  5HS0 A;  5ARF A;  3IBE A;  2NC9 A;  4WNE A;  4K5B A;  1TEZ A;  3CHQ A;  3UM1 A;  5C2Y A;  2VTB A;  3PE3 A;  5G04 J;  2V4L A;  4AXH A;  2KBX A;  4GPK A;  5JJ6 A;  1UJJ A;  1JCQ A;  3B7U X;  2V5Q C;  3ESK A;  3EDT B;  3HYM B;  4FP7 A;  1FPP A;  3OXL A;  1P5Q A;  3ABK E;  2OEW A;  4GA1 A;  4NPS A;  1FVH A;  2X38 A;  4H7X A;  3PZ3 A;  4U0U A;  2XEE A;  3DSX A;  5ENQ D;  5CMY A;  2P9L G;  1N0Q A;  3RRN B;  2Y3A A;  1OCC E;  5AAO A;  4XI0 A;  4JA9 A;  2AVP A;  5FZR A;  3AS4 A;  3UM2 A;  3FEX A;  2OOE A;  5D2M C;  3UTM A;  5JFF A;  3ZYQ A;  3ZXP A;  4KBQ A;  2KM4 A;  2X6J A;  3DSS A;  4ATZ D;  3APC A;  4LG6 A;  3S6A A;  5B1A E;  2RFA A;  1SW6 A;  4HOT A;  3DPY A;  1S70 B;  2HR2 A;  4AEZ C;  1E8X A;  4I1A A;  2PM7 A;  3KSL A;  4N5Q A;  3FTZ A;  3CVN A;  5D66 A;  1TNU A;  4HI8 A;  2XEN A;  3EHQ A;  3HDX A;  3ZHE B;  2UY1 A;  4YDO A;  4KYO B;  3CK9 A;  3JXJ A;  2WMO A;  2VZA A;  4BER A;  2VSN A;  4AY6 A;  5KJN A;  1K1A A;  4PUC A;  4ACK A;  4BEP A;  4BTA A;  2J07 A;  4A3T A;  2IFU A;  5EX0 A;  2YNQ A;  1OCR E;  4I2W A;  2XEH A;  3DBS A;  3PS6 A;  4U95 D;  3QAR A;  2WQ6 A;  1O5M A;  4WWP A;  1BI8 B;  4GU5 A;  2PZI A;  3V30 A;  4WUY A;  3CK7 A;  4FJZ A;  4HLE A;  4ABN A;  2JEK A;  1TNZ A;  3AG3 E;  4B94 A;  3SFY A;  3ML9 A;  3TWQ A;  3T9K A;  3CQG B;  4GZD A;  2L6J A;  4AV7 A;  2OCC E;  4GYW A;  3ZYM A;  3AJI A;  1U3D A;  1Q2Z A;  4LUN U;  2R2L A;  3LYA A;  3J5P A;  4M16 A;  4XX5 A;  3ZUV B;  2V0P A;  2MHK A;  3Q15 A;  5LP0 A;  2P9S G;  3HXF A;  5KJK A;  3FWV A;  3LKU A;  5ENO D;  3DEO A;  3MV3 B;  5FZS A;  4G25 A;  3HIZ A;  3ZGQ A;  2EIL E;  2WPV A;  4L2L A;  3AG4 E;  2H6G A;  4C0M A;  5ANR A;  3KSQ A;  4HS2 A;  2L6B A;  2AWI A;  2XPZ A;  1MYO A;  2RG8 A;  3HHM A;  3CEQ A;  3R9A B;  4UWK A;  4GTV A;  4XKC A;  1KT1 A;  3E34 A;  5CER B;  3CR3 A;  4HXI A;  1ELK A;  1IKN D;  3T5V A;  2OV8 A;  4HRN A;  3AU4 A;  5BT1 A;  3SF4 A;  4NIK A;  4K5C A;  4YND A;  2WQ7 A;  4G23 A;  5AAR A;  3UT7 A;  3EIJ A;  4L1B A;  1N54 A;  5CEA A;  3UIO C;  3QOU A;  4LEU A;  4DPR A;  3D9P A;  3ISM C;  2XGO A;  4IYP A;  2GW1 A;  4WNG A;  1DCQ A;  1IHB A;  1N4Q A;  2J09 A;  4FHK A;  4I17 A;  2I1K A;  3RO3 A;  1PY1 A;  3SD5 A;  1ZU2 A;  3D9M A;  1VDY A;  3Q4A B;  1QQE A;  1BPO A;  3RO2 A;  3OAW A;  4HNA D;  3I4R B;  2FBN A;  3LDZ A;  3SE5 A;  1S0P A;  3GYZ A;  3FY4 A;  3X2Q E;  3SQV A;  4D10 C;  3FU5 A;  1AP7 A;  3UI2 A;  5BXO A;  3MKQ A;  4YDE A;  3L13 A;  2NUD A;  3C72 A;  2P9N G;  4NAC A;  3HXE A;  5JJT A;  4ILI A;  4N3C A;  4TUM A;  4CT4 A;  3ML8 A;  1ZB1 A;  3SO8 A;  1KPS B;  3S7F A;  3PNT B;  2KCL A;  3KAE A;  2Q7F A;  2DVW A;  3VLD A;  1OWP A;  2BTD A;  1TN6 A;  3GZS A;  4UI9 C;  2GRP B;  4GZ6 A;  4DX6 D;  4G8L A;  4U63 A;  3ABM E;  1D8E A;  4MBG A;  3UM3 A;  3EHN A;  3C5R A;  2PQR A;  4GTS A;  2WXI A;  3S7J A;  2LUH A;  2KAT A;  4X8Q A;  1JWG A;  3UQ3 A;  2KCV A;  4ILG A;  4MKT A;  4APF A;  1LD7 A;  3HG0 D;  3ASG A;  4Q94 A;  3B13 A;  4GML A;  2L0T B;  2RFM A;  3QKY A;  4K5A B;  2GRO B;  4FA6 A;  4GTT A;  4BFR A;  4C9B B;  2XEV A;  3DST A;  4JW1 A;  1KLX A;  4MS6 A;  1SZ9 A;  2J08 A;  2ILR A;  1HH8 A;  4JHJ A;  3DXK G;  5JJ7 A;  4GA2 A;  1MQS A;  5G55 A;  2KCK A;  2RKK A;  3I4G A;  4RLY A;  1BI7 B;  1NI1 A;  2LSV A;  3W9G A;  3AU5 A;  5G2N A;  4CDM A; 
#chains in the Genus database with same CATH homology
 4L2Y A;  4WNE A;  3SZ7 A;  5G04 C;  1TEZ A;  3PRE A;  1E96 B;  3CHQ A;  2P58 C;  3CSF A;  3PE4 A;  4L7T A;  3WXX A;  1KT0 A;  2XRY A;  2LAH A;  5C2Y A;  2VTB A;  5EX3 A;  1Z6T A;  4ANX A;  3PE3 A;  3CVL A;  3B7S A;  3JQ0 A;  4JVS A;  5G04 J;  5DIZ A;  4N5C A;  1QNF A;  2GRL A;  2V4L A;  4AXH A;  1XGW A;  3LXU X;  4GPK A;  5JJ6 A;  3FU0 A;  1UJJ A;  3FTU A;  3QJZ A;  5JHB A;  3B7U X;  5G05 C;  4B8C B;  4N67 A;  3ESK A;  3EDT B;  3HYM B;  4JZY A;  4FP7 A;  3T5X A;  1NZN A;  3OXL A;  4KZ0 A;  2WXG A;  4UI9 K;  4JHR A;  4WAF A;  2WQH A;  3D9N A;  1H0A A;  4KMO A;  4PS8 A;  4C0E A;  5AIJ A;  3PUK A;  5G05 J;  3MCX A;  4N2Q A;  3EHM A;  3Q49 B;  4I1O B;  1P5Q A;  3KD7 A;  4G24 A;  4M3O A;  4JPS A;  4RG6 A;  4GA1 A;  3TAX A;  4NPS A;  1JWF A;  2I2O A;  3FFL A;  4PDX A;  2L9B A;  4LER A;  1INZ A;  1JUQ A;  3NZS A;  1FVH A;  2X38 A;  4H7X A;  3OXF A;  3MYV A;  4F3V A;  2X6I A;  2M63 A;  4CDR A;  3CVY A;  4WND A;  4U0U A;  2C2L A;  3SFZ A;  4FJY A;  1E7U A;  3JCK C;  4CGW A;  5CMY A;  3AS8 A;  5CMW A;  3PZD A;  3FHE A;  4K03 A;  3RRN B;  1H6K A;  2Y3A A;  3ENE A;  4U8H A;  5FQ6 A;  4HOR A;  4TV3 A;  5KJL A;  4KZC A;  2CFU A;  4F1S A;  3OXG A;  2X6F A;  2R59 A;  2AXU A;  4XI0 A;  5EKQ D;  3ULQ A;  3IEG A;  4JA9 A;  1H2T C;  5FTP A;  3GZ1 A;  2AVP A;  5FZR A;  3AS4 A;  3L22 A;  2WXF A;  3ZIM A;  4N3A A;  3VTY A;  3FH8 A;  3FEX A;  3O4Z A;  2OOE A;  4FLB A;  1NA0 A;  3LPZ A;  3T8M A;  3S7D A;  3CHR A;  2X6K A;  4G2V A;  5JFF A;  3FU3 A;  4A3V A;  4JA7 A;  3ZYQ A;  4KBQ A;  2KM4 A;  4WGJ A;  2OVB A;  2X6J A;  4K0R A;  1UN8 A;  1HE8 A;  2VSO E;  2QY7 A;  1U3C A;  4FLH A;  4W9R A;  3APC A;  2IU1 A;  4OVU A;  2VGY A;  2DCP A;  3NZU A;  5D0Q D;  3MKQ B;  3S6A A;  5LOZ A;  4P29 A;  1HO8 A;  5ARG A;  3L6A A;  5BV0 A;  1N52 A;  1EPU A;  5T3R A;  4AP2 A;  5T4Y A;  5DBK A;  5FT9 A;  2I9C A;  1IQR A;  1DVP A;  4HOT A;  2VGX B;  4FHJ A;  2HR2 A;  4I6E A;  4AEZ C;  1E8X A;  4PS3 A;  3CVV A;  1YA0 A;  2PL2 A;  2PM7 A;  4I1A A;  1E90 A;  2AXV A;  3FTZ A;  5AYW D;  4J0U A;  2WMN A;  4MLP A;  3CVN A;  3IV0 A;  3D9I A;  1IQU A;  3CK8 A;  3QWP A;  4H7Y A;  3ZW3 A;  2PM6 A;  4EZJ A;  3RK6 A;  4AIF A;  1UJK A;  4U0S A;  4EPZ A;  2HM8 A;  3MZL B;  4GCN A;  3LCA A;  4B0Z A;  3HDX A;  3JQ1 A;  1UG3 A;  3G2U A;  4XKB A;  3ZHE B;  3P2B A;  2AXZ A;  1ELR A;  2UY1 A;  3ZN3 A;  1NA3 A;  4KYO B;  2VYI A;  3CK9 A;  3FUH A;  3S7B A;  1EDU A;  3SGH A;  4WWN A;  2RD0 A;  4EBA A;  3CVW A;  2WMO A;  2VZA A;  4URK A;  2VSN A;  3U4T A;  4AY6 A;  5JFZ A;  2IQC A;  3ASF A;  4ATG A;  5KJN A;  1IHG A;  4PUC A;  4ACK A;  3CVP A;  2F6S A;  2A5U A;  5LX8 A;  1PC2 A;  3QC1 A;  1PAQ A;  3HVE B;  3TGO A;  5CGL A;  2JK8 A;  3UT4 A;  5KCM A;  3U64 A;  4DLQ A;  4BTA A;  5CHE E;  3CHP A;  3IHY A;  3LS8 A;  4KXK B;  3FTV A;  2J07 A;  4A3T A;  5EU0 A;  2IFU A;  5EX0 A;  3ONL A;  4OYS A;  4AJW A;  3IHV A;  3FDH A;  2YNQ A;  3TG4 A;  3PEU B;  3UUX A;  1LF8 A;  1HG5 A;  1OWO A;  4I2W A;  3L08 A;  3LY9 A;  3FUJ A;  2J49 A;  3DBS A;  3PS6 A;  2KC7 A;  3QK0 A;  3QAR A;  2WQ6 A;  4X2C A;  5HQ8 A;  3U66 A;  2J4B A;  4WWP A;  5AJL A;  3CHS A;  4GU5 A;  2PZI A;  5BW8 C;  5CCL A;  1IYG A;  3PEV B;  4GZC A;  1OUV A;  3LEW A;  2LSU A;  3ZYL A;  4WUY A;  4Y6C A;  5A23 A;  3ZRH A;  3CK7 A;  4JXT A;  4PH4 B;  4JHK A;  3Q5M A;  2XGS A;  2IOL A;  2Y4T A;  1DNP A;  4FJZ A;  3P1U A;  4DJA A;  1QZ2 A;  3DPD A;  3ASD A;  4HVB A;  2WXH A;  2IJG X;  3MX3 A;  4HLE A;  3FTX A;  1EF1 C;  4ABN A;  3K9I A;  4CEM A;  2WXK A;  1E7V A;  2CHW A;  2JEK A;  3NQP A;  1E8Z A;  4FU3 A;  3TXM A;  1HXI A;  1HZ4 A;  3FU6 A;  4ANU A;  1L5J A;  5KJM A;  4B94 A;  3UX4 A;  4BX9 A;  3CKC A;  3ML9 A;  4J8E A;  4L23 A;  3CQG B;  4GZD A;  4WWO A;  4N2S A;  2L6J A;  4AV7 A;  3MEK A;  4JC8 A;  2J4D A;  4GYW A;  5FWQ A;  4QFV A;  2YHC A;  3ZYM A;  3PRZ A;  3CHO A;  1U3D A;  1H2U A;  4LUN U;  1X5B A;  2NXP A;  2NSZ A;  3LYA A;  2ION A;  4M16 A;  4XX5 A;  4XIF A;  2KZT A;  3L16 A;  3CVU A;  3CGH A;  2VTB B;  4N3B A;  3RU0 A;  2V0P A;  4PS7 A;  1Z3X A;  2IOS A;  4U04 A;  3B7R L;  2MHK A;  4A55 A;  3I5P A;  3SN9 A;  3CV0 A;  3Q15 A;  5LP0 A;  5J08 A;  2WXO A;  2WXQ A;  2XHE A;  5KJK A;  4LRZ A;  4JL0 A;  4BTB A;  3FWV A;  2WB2 A;  4AY5 A;  3BG0 B;  2XPI A;  3FH5 A;  3LKU A;  2FF4 A;  4BX8 A;  2WXL A;  4U07 A;  3MV3 B;  4UWL A;  5FZS A;  3TG5 A;  4G25 A;  3HIZ A;  3GZ2 A;  1ZBP A;  2E0I A;  5HI7 A;  3D9L A;  3ZGQ A;  3ONK A;  5JHA A;  4EZK A;  3SBT B;  2WPV A;  3O48 A;  4L2L A;  5BPP A;  3JYS A;  4DK5 A;  3MA5 A;  4CGV A;  4B89 A;  1HFA A;  2FEZ A;  3MV2 B;  3QWW A;  3MJW A;  5A7D B;  3VTX A;  4C0M A;  2LO6 A;  5ANR A;  1H19 A;  5BV1 A;  3TXN A;  5FZQ A;  5CMT A;  4I9E A;  4HS2 A;  1OWM A;  2AWI A;  4I6G A;  4IN3 B;  4XI8 A;  3URZ A;  2BF0 X;  2XPZ A;  2VSX E;  4CT0 A;  2XGM A;  2VSY A;  2RG8 A;  3G2T A;  4TUU A;  4ANW A;  2C0M A;  3CKB A;  3HHM A;  3PVL A;  3VLE A;  4U0Z A;  3CEQ A;  3FEY A;  2YQ8 A;  4NUR A;  4UWK A;  3FTW A;  3R9A B;  4XKC A;  4FAD A;  1KT1 A;  2XPY A;  3CR3 A;  4HXI A;  2WXP A;  3Q47 B;  4Y6W A;  1ELK A;  3L54 A;  4NRH B;  4F7A A;  3T5V A;  4RG9 A;  2OV8 A;  4YVQ C;  3FUF A;  4E6H A;  3AU4 A;  2A4Z A;  2CG2 A;  2CHX A;  3ZCB A;  5FJY A;  4I6J A;  5BT1 A;  3SF4 A;  4KVO A;  1UN9 A;  4J8F A;  2OND A;  2XCC A;  2WXN A;  4YND A;  3ZEF A;  4RVB A;  4MRU A;  4EBA G;  2CHZ A;  4X2E A;  4G26 A;  3ZYK A;  4EQF A;  4HOS A;  3TJP A;  4CDN A;  4UWF A;  1FCH A;  4Q69 A;  2WQ7 A;  3LET A;  2UWJ G;  3QWV A;  4G23 A;  1WM5 A;  3VLF A;  3PNL B;  5LFA A;  4UWH A;  3FUE A;  5C1D A;  3IKO B;  3UT7 A;  3EIJ A;  2I1J A;  4L1B A;  1N54 A;  1OWL A;  2Y4U A;  3EIQ C;  2YIN A;  3QOU A;  4ACL A;  1E8Y A;  4CRW A;  1XNF A;  4LEU A;  3RKV A;  4DPR A;  3I3N A;  2XQ0 A;  3D9P A;  2XGO A;  4IYP A;  2DBA A;  2GW1 A;  3SHF A;  4DI3 A;  2VY3 A;  3D9O A;  2R17 C;  4I17 A;  2J09 A;  4FHK A;  4IUL A;  4WNG A;  2I1K A;  3RO3 A;  2X3M A;  4KT6 B;  2R5S A;  1PY1 A;  3FP3 A;  3SD5 A;  4GZ5 A;  4XE0 A;  4I9C A;  1ZU2 A;  3D9M A;  1VDY A;  3Q4A B;  2WXM A;  1QQE A;  3ZPJ A;  5LCW C;  1BPO A;  3RO2 A;  4BWR A;  3L17 A;  3FUN A;  2E2E A;  3KS2 A;  3ZXS A;  4BY6 A;  3OAW A;  2CFZ A;  3I4R B;  2FBN A;  2HO1 A;  3PUJ A;  2FO7 A;  3LDZ A;  4YVO A;  5BUZ A;  5ANL A;  3SE5 A;  3FUL A;  3ESL A;  3U3W A;  3D9J A;  5LCW J;  1H2V C;  2UY1 B;  1EYH A;  1S0P A;  1HU3 A;  3GYZ A;  1Z3Y A;  2VQ2 A;  3FY4 A;  1HF8 A;  4IRU A;  3PH0 C;  4CCA A;  3SI5 A;  2DIW A;  2L0I A;  4ANV A;  1ELW A;  2WXR A;  4HOQ A;  4EZL A;  4D10 C;  1WAO 1;  1W3B A;  4GCO A;  4ME2 A;  5AJD A;  2YHE A;  1TJF A;  3FU5 A;  4J6I A;  1SZA A;  1UW4 B;  3CLJ A;  3R7R A;  3PDN A;  5J90 A;  3FUI A;  3AS5 A;  3APF A;  3L13 A;  3MKQ A;  3QB2 A;  4GB9 A;  3LY8 A;  4O6F A;  2PQN A;  3SBS A;  3RJV A;  4X2D A;  3APD A;  4ILH B;  3FTY A;  4UQZ A;  4AM9 A;  4PY3 A;  3TL5 A;  2FUL A;  3E4B A;  5EDS A;  4NAC A;  3MGB A;  4UQY A;  2QFC A;  2G03 A;  5JJT A;  2VGX A;  5T8I A;  4ILI A;  4N3C A;  2V5F A;  3FUK A;  3CST A;  4CT4 A;  3ML8 A;  5AEN A;  4EEC A;  2MOW A;  5CKL A;  3LVR E;  4GYY A;  3CQC B;  3S2A A;  2I6H A;  1Y8M A;  3S7F A;  4WNF A;  3RRM B;  3CHM A;  3PNT B;  2KCL A;  4N39 A;  3BEE A;  3KAE A;  2Q7F A;  2VJ8 A;  1TJC A;  4GAA A;  3UPV A;  3VLD A;  1OWP A;  2BTD A;  2LAI A;  5M72 A;  4R7L A;  2EQX A;  3GZS A;  4UI9 C;  3ZHE A;  4DLO A;  4J8D A;  2IF4 A;  2XCB A;  3KEZ A;  4GZ6 A;  2XRZ A;  1A17 A;  1SQM A;  4G1T A;  3QDN A;  3UMV A;  4U63 A;  4BT8 A;  2WM9 A;  5E75 A;  3QAQ A;  4UI9 J;  4LCT A;  5D0O D;  3EHN A;  3FH7 A;  4B8A A;  3QNK A;  4I2Z A;  2PQR A;  3FTS A;  4XZ4 A;  3S7J A;  2WXI A;  2GRM A;  3ASH A;  4UQX A;  4APO A;  4G11 A;  2BUG A;  2HYZ A;  4A1G A;  3HVE A;  2C0L A;  1WY6 A;  2ZU6 B;  3RRU A;  3BG1 B;  4GYO A;  3ZFW A;  2OVF A;  4BSX A;  2X6H A;  2KAT A;  5BNW A;  2MRI A;  3ZLM A;  1JWG A;  3UQ3 A;  3G2W A;  3R7Q A;  2KCV A;  3LVQ E;  4ILG A;  4MKT A;  5A6C A;  4FC8 A;  4ITR A;  2WXJ A;  4FUL A;  5FQ8 A;  4F53 A;  2WVI A;  4APF A;  2KZT B;  3LY7 A;  5FQ7 A;  1HS6 A;  2LNI A;  3D9K A;  3NF1 A;  3MKR A;  3ASG A;  4GMJ A;  2AW6 A;  3ZC7 A;  2JLB A;  3G2S A;  4J8S A;  4Q94 A;  2GGF A;  4RSY A;  5CCM A;  3B13 A;  4GML A;  2L0T B;  2V8S E;  3QKY A;  5ENN A;  3ZVV A;  1HG2 A;  2CG3 A;  4LU4 A;  4FA6 A;  4BFR A;  1FVF A;  4JEU A;  4C9B B;  4I43 A;  2XEV A;  4V3I A;  3CVX A;  5E76 A;  3JUI A;  3CIA A;  4HOU A;  3CVQ A;  3LJ3 A;  4JW1 A;  4A1S A;  3RIB A;  1Y6I A;  4AOF A;  3GW4 A;  4XI9 A;  3C98 A;  5FQ4 A;  3FUM A;  4KVM A;  1OWN A;  4AVX A;  4I1M A;  4OVV A;  1KLX A;  3SHG A;  4JEH A;  4MS6 A;  4GA0 A;  1SZ9 A;  1B89 A;  4HFG A;  1NP7 A;  2ILR A;  2J08 A;  3UT8 A;  1HX8 A;  3B7T A;  4E85 A;  3FUD A;  4DI4 A;  3D3M A;  1HH8 A;  3SNX A;  1MHQ A;  2J9Q A;  4UWG A;  4JHJ A;  3U9W A;  5JJ7 A;  4BT9 A;  1JPL A;  3CUC A;  4GA2 A;  2FI7 A;  1MQS A;  4GZ3 A;  3OTN A;  1GW6 A;  4Q96 A;  4NQ0 A;  4TRQ A;  1E8W A;  3N71 A;  5G55 A;  2KCK A;  3I4G A;  3EJN A;  3N3U A;  5ARF A;  2LSV A;  3AU5 A;  3G2V A;  5G2N A;  3IBE A;  2NC9 A;  4CDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...