4U07A

Atp bound to eukaryotic fic domain containing protein
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
326
structure length
323
Chain Sequence
AALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSINSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Adenosine monophosphate-protein transferase FICD
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
total genus 122
structure length 323
sequence length 326
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u07A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u07A01
2YQ8A 3QOUA 2I6HA 4UQZA 3EDTB 4RG9A 4AM9A 5JFZA 5LCWJ 3JYSA 5C1DA 2FEZA 2Q7FA 4I9EA 3LY8A 2FF4A 4GYWA 4ITRA 2ONDA 3Q47B 3FWVA 3SE5A 4W9RA 4A1SA 1XNFA 4YVOA 1HH8A 4J0UA 1FCHA 2VY3A 3O48A 3Q4AB 2C2LA 2UY1B 5KJKA 2QFCA 4UI9C 3CKBA 3U4TA 3TAXA 4JA9A 3RIBA 4I2ZA 3WXXA 2XCCA 4HORA 3IEGA 4J8EA 2XEVA 1A17A 2VGXB 3GZ2A 3Q49B 5CCLA 3MEKA 3TG5A 4BT8A 4GCNA 4HOQA 3ZFWA 2FO7A 4BTBA 3ZLMA 4LU4A 1TJCA 3QWVA 5JJ7A 4GZ3A 3ASGA 4CGVA 3LCAA 3UUXA 5FTPA 3AS5A 2G03A 3VTXA 4N2SA 4I9CA 2F6SA 5FT9A 4GZ6A 3RJVA 5KJMA 4N3BA 5CHEE 3ASHA 3OXGA 5ARGA 4I1AA 5CGLA 3ASFA 3FFLA 2MHKA 3GYZA 2BUGA 3LY7A 4JHRA 2Y4UA 3VTYA 5HI7A 5CMTA 4UQXA 3CVNA 3GW4A 2UY1A 5HQ8A 2VGYA 2XPIA 2IFUA 2C0LA 2J9QA 5G04C 1QZ2A 3ESKA 3LY9A 3MV2B 1OUVA 2V5FA 2VGXA 4U04A 5JFFA 4WNGA 4N39A 1WAO1 2GW1A 3Q15A 1HZ4A 4N3AA 2PQNA 3BEEA 2WPVA 3CEQA 4UQYA 5D0OD 5G05J 4NQ0A 4CGWA 2LSVA 5EX3A 3RO2A 5FZQA 3MKRA 2YHCA 3CKCA 2Y4TA 1NZNA 3S6AA 4H7XA 3SN9A 3SZ7A 5FZRA 4GCOA 3LETA 1ZBPA 2R5SA 2VSYA 2XGSA 3CVPA 2AVPA 1KT1A 4N67A 4O6FA 5ARFA 4AY5A 2XGOA 2KCKA 4LEUA 2VSNA 1KT0A 2JLBA 2IF4A 3AS8A 3ZCBA 2LSUA 1P5QA 2VQ2A 3URZA 3CV0A 4GZ5A 4KYOB 2P58C 3CK9A 3HYMB 4J8FA 3CVLA 2FI7A 3ZPJA 3E4BA 4U07A 2XCBA 1E96B 2HR2A 4X2EA 3N3UA 4G26A 4H7YA 5M72A 1B89A 5D0QD 4HOTA 2KCVA 4GYYA 4M16A 2XGMA 3TG4A 3U3WA 4KXKB 1YA0A 4WNFA 3S7JA 4JL0A 1NA0A 1NA3A 1Y8MA 2VYIA 3MA5A 4UI9J 4XI9A 4NPSA 1PC2A 3KS2A 4G25A 4ABNA 4AY6A 4N5CA 3RKVA 2UWJG 4HOUA 4BWRA 5LCWC 5CCMA 4BTAA 3RO3A 2L6JA 4YNDA 4Y6CA 3Q5MA 2PQRA 4WUYA 4U0SA 3SHGA 3PDNA 5KJLA 5EU0A 4G1TA 5AYWD 5BNWA 5FJYA 2HYZA 4GPKA 3AS4A 4X2CA 4AIFA 1ELRA 4WNDA 2HO1A 1KLXA 3RU0A 2LNIA 2PZIA 4GA0A 2NC9A 3ULQA 5A7DB 4J8DA 5JJ6A 1W3BA 4HOSA 4G23A 4APOA 3MV3B 4U0ZA 3GZ1A 4GA2A 3N71A 4I17A 3ASDA 5G04J 3KAEA 3K9IA 3QDNA 4I2WA 5A6CA 3UQ3A 4ME2A 3PE4A 4B94A 2DBAA 3ZHEB 3S7DA 4PY3A 5BT1A 3ZN3A 4CDRA 2PL2A 2WQHA 4KBQA 4G24A 3ZC7A 1IYGA 4UI9K 2E2EA 2OOEA 4GYOA 4XI8A 4F3VA 1ZU2A 3OXFA 4WNEA 3ZGQA 5CKLA 3UPVA 4RG6A 3CUCA 2C0MA 2FBNA 3LYAA 4U0UA 3QWWA 5JJTA 1WM5A 3CK8A 3NF1A 3TGOA 5FZSA 5BW8C 3LPZA 4IN3B 1QQEA 4YVQC 3QKYA 5DIZA 3CK7A 2KCLA 3SF4A 5EKQD 5G05C 4N2QA 3PE3A 3S7FA 3QWPA 4XI0A 3S7BA 1IHGA 5EX0A 1HXIA 4X2DA 4JA7A 3R9AB 3FP3A 3ZHEA 4GA1A 4BT9A 4G2VA 2VZAA 1ELWA 2KATA 2KC7A 3KD7A 5KJNA 2JK8A 4Y6WA 4NRHB 4XIFA 3OXLA 4N3CA 4EQFA 3LKUA 5DBKA 3CVQA 4WGJA
chains in the Genus database with same CATH superfamily
2KZTA 2YQ8A 2WXFA 4GTPA 3W9FA 3MKQB 4OYSA 5C1DA 4UWHA 1PY1A 5CBOA 4GMJA 4MBGA 2XRZA 2Q7FA 2NUNA 5AJDA 4GYWA 2DWZA 1N54A 2OV8A 4HNAD 3FU3A 4LG6A 1OCRE 2ONDA 3EUVA 2GRLA 2IO2C 4YVOA 3ZYQA 5T8IA 4LCTA 4ILGA 3UMVA 1TNOA 5FQ7A 2QFCA 2R17C 1UN9A 4UI9C 3CHOA 3CKBA 3ZYLA 4ILHB 1Z3YA 3SNXA 4I2ZA 3WXXA 4FJYA 1WDYA 3TL5A 3UIPC 4RLYA 2RFMA 5FINA 1A17A 3ULEG 3TG5A 3Q73A 3ABLE 4XE0A 1OCCE 3V2XA 1L5JA 5T3RA 1INZA 5JJ7A 3JQ0A 4GZ3A 1OCZE 4PH4B 1UN8A 4GTTA 3TWUA 1O1SA 2LXMA 4Q94A 2G03A 2X6JA 3DPYA 2WQ6A 4HS2A 5BPPA 4CRWA 4DI4A 1E7VA 3DSVA 1YYHA 4O1OA 5CHEE 4I1AA 4K03A 2JEKA 3FFLA 2MHKA 3FULA 2IEJA 2AWIA 2XZDG 4JHRA 4EZKA 3KSLA 3VTYA 4R7LA 1HU3A 3SQVA 1O5MA 4UQXA 1IXVA 3JXJA 3GW4A 2QZAA 2WXHA 4CT0A 2C0LA 3PZ4A 3U66A 4MLPA 1KZPA 4FHKA 4A55A 4DUIA 4TXQA 3ESKA 2A5UA 2XEEA 3L54A 3CLJA 4N39A 4BX8A 2ZISA 1WAO1 3TWXA 3Q15A 1HZ4A 4N3AA 2WXQA 2IJGX 3I3NA 4F7AA 3IKOB 1WY6A 3CEQA 1S63A 3ZRHA 5CMWA 1EYHA 4JD2G 5D0OD 5BV0A 3ZKJA 3RO2A 1OWNA 1JWFA 3D9JA 5ENOD 1EDUA 1TN6A 4PS3A 3TWTA 4URKA 4MS6A 4H7XA 3SZ7A 5EDSA 4TUMA 4JEUA 2P9SG 3LETA 4BY6A 2AVPA 2L0TB 2MYOA 2CG3A 4ACKA 3C3OA 4O6FA 3R7RA 3UM1A 2XGOA 4AY5A 4B89A 4LEUA 5CEAA 1KT0A 2JLBA 3ZCBA 1U2VG 3ULYA 1TEZA 1FVFA 1Z5SC 3HYMB 3CVLA 4U07A 2DYRE 4X2EA 4JW1A 5G2NA 3P1UA 4F6RD 4G26A 5M72A 2PM6A 4QFVA 2R59A 3MKQA 2Y3AA 2WXJA 2KCVA 4L23A 2RKKA 3UM3A 1NA0A 2XPYA 1IQUA 5C2YA 2VYIA 1E90A 1HE8A 2NYJA 4N5CA 2ETAA 2ZGGA 4HOUA 4YDYA 5CCMA 3VLFA 4YNDA 3Q5MA 2PQRA 3OTNA 3SHGA 1UJJA 3PDNA 3Q78A 5KJLA 4TXPA 5EU0A 3PZ1A 5FJYA 1BI8B 3B13A 3T8KA 4FULA 3DEPA 4L2LA 3L08A 2HYZA 5KCMA 4X2CA 3TJPA 4LSZE 4WNDA 1S0PA 4J8YA 3HVEA 5EIDA 3UKUG 2LNIA 2PZIA 4DI3A 4GMRA 4HI8A 1Z3XA 4LNGA 2I2OA 4OVVA 2IOLA 2YHEA 3CGHA 3MV3B 3UTMA 1HX8A 2RG8A 5FIOA 2VTBA 3G2SA 3GZ1A 3ASDA 4BX9A 5A6CA 3FH8A 2WXKA 4TUUA 3FUFA 4ME2A 4B94A 2WMOA 4KVMA 2RD0A 3ZHEB 3EHRA 2WQHA 4GMLA 1OT8A 5LX8A 3SI5A 4KZCA 4K0RA 2PM7A 1HG2A 4DRXE 1D9SA 4PDXA 3ABME 3B7TA 3ZC7A 1IYGA 1S64A 4XI8A 1ZU2A 4WNEA 1UJKA 3NZSA 5AN8A 2LUHA 3UX4A 4EHMA 4Q96A 1H2VC 3CUCA 2C0MA 2FBNA 4XX5A 3OAWA 2P9NG 5JJTA 2PNNA 1BI7B 2HE0A 3TGOA 4DPRA 2GRRB 4TRQA 3LPZA 5BW8C 3RRNB 3D9IA 2OEVA 4Z68A 3ZU7B 4YVQC 4APFA 2J07A 3QKYA 5DIZA 4JHKA 4HBDA 4B8CB 2KCLA 1OWMA 3ASOE 3T5VA 3PE3A 3S7FA 1O1TA 3UT8A 4D10C 4JA7A 3FP3A 1ELWA 1FVHA 4J7WA 4DX2A 1H0AA 3AAAC 1RW2A 5D66A 4WGJA 3QOUA 4UQZA 3EDTB 4AM9A 5LCWJ 1LD7A 3MX3A 2V4LA 3FHEA 1N95A 3FUIA 4I9EA 3D9HA 3NBNB 4ITRA 3JXIA 3SE5A 4RVBA 1X5BA 3T8MA 1XNFA 2H6GA 1HH8A 2BF0X 2B0OE 2OVFA 3Q4AB 4RSYA 1JCRA 5KJKA 3L6AA 3TAXA 3KSQA 4O60A 3RIBA 1HS6A 1LF8A 2XCCA 5AAOA 1D8EA 2WXRA 4HORA 4J8EA 2DCPA 4JHJA 5CCLA 4BT8A 4C0MA 1BLXB 5CMYA 4GCNA 1FT2A 4BTBA 5BXUA 4A3VA 4AP2A 2WXMA 2KBXA 3ASGA 4CGVA 3LCAA 2V8SE 3RRUA 3APDA 3VTXA 4N2SA 3T5XA 4GTVA 5FT9A 4ANVA 3PRZA 5ARGA 1JWGA 3SO8A 3FUHA 2Y1LE 1TYQG 3FTWA 3D9MA 4I6GA 5CMTA 1BPOA 2VSOE 5ENPD 2EIME 3CVNA 2DZOA 2UY1A 3B7SA 2VGYA 3E30A 2XPIA 3RAUA 4CZ2D 3PUJA 3HDXA 4U8YD 3LY9A 3MV2B 1OUVA 2AXZA 2V5FA 2VGXA 5JFFA 2CFUA 2RFAA 2GW1A 3DSWA 3SFZA 1SA5A 1NH1A 2PQNA 3BEEA 4L1BA 3NOCD 4HQDA 2WXLA 2LAHA 4UQYA 3MCXA 4KZ0A 2LSVA 2GRNB 5ANLA 2L6BA 1MX6A 4TV3A 3MKRA 2YHCA 5AQ7A 4GU5A 3L22A 2Y4TA 3C3QA 3V31A 3Q7AA 3SN9A 4F1PA 1ZBPA 2R5SA 1KT1A 2QY7A 4N67A 3SFXA 5ARFA 1JPLA 2KCKA 1TNBA 3EJNA 2IF4A 3LXUX 1P5QA 2NXPA 5AJLA 3W9GA 3P2BA 4GTQA 3HVEB 2KM4A 5ITZF 4FP7A 2A5EA 1A5EA 1IQRA 2XCBA 5HKPA 4OAVB 3MGBA 4XEIG 2HR2A 3N3UA 4ZHBA 2OVBA 1N4PA 4U7EB 4ANWA 4I43A 4B93B 1B89A 2J4DA 2I1JA 3CSFA 5EN5D 4JB8P 3QC1A 3JUEA 4PS8A 1S70B 4XZ4A 4U8VD 4KXKB 4JL0A 2ETBA 1Y8MA 2VTBB 3PEUB 3B7BA 3L9TA 4I1MA 1E7UA 3FEXA 1PC2A 2UWJG 1XGWA 2EILE 5LCWC 2L6JA 4AV7A 2B6CA 3UM2A 1Y6IA 2LO6A 4LNUD 4WUYA 4U0SA 3L17A 4G11A 3EU9A 1QBQA 1OCOE 1SQMA 3WG7E 1SA4A 5AYWD 3Q9NC 3V30A 3I4GA 1K1AA 3TWRA 4G8LA 3DEOA 3AS4A 3T9KA 1H2TC 2R02A 3EHNA 1ELRA 3MJWA 2R2LA 2J09A 3RU0A 4FJZA 3VLDA 3ZW3A 3ULQA 2VGEA 3FTUA 4J8DA 5JJ6A 4P29A 3AG1E 3CSTA 2IY0C 3CHSA 4OAUC 3HRAA 3RRMB 1JCSA 4U0ZA 3TWSA 2FULA 3FTVA 3FUJA 4KVOA 3CQCB 2XEHA 3N71A 4RQIA 4I1OB 4I2WA 4WAFA 1K1BA 2IOSA 4JZYA 4IRUA 2DBAA 5A23A 1VDYA 5AIJA 3ZXPA 4MRUA 5HRYA 5BT1A 4CDRA 4JC8A 3FH7A 4KBQA 3PNLB 2X6FA 4YDEA 2Y69E 4UI9K 1UW4B 2E2EA 2M63A 4JVSA 2F8XK 4GYOA 2GROB 1N4QA 1H19A 5AENA 1E8WA 3HG0D 4RG6A 3UT7A 4EBAA 3LYAA 2J4BA 3QB2A 5KNGA 2XHEA 3TWWA 1DVPA 1WM5A 4HB5A 3Q79A 4IN3B 1QYMA 2EINE 3CVYA 5BXOA 2X6HA 3SF4A 3AJIA 5EKQD 3ISMC 4FLHA 3LJNA 2OCCE 5EYPF 4FLBA 3HIZA 5T4YA 3DXKG 4GA1A 4G2VA 5FQ6A 1GW6A 2VZAA 3FTZA 3SHFA 2KC7A 3G2VA 3KD7A 4NRHB 4XIFA 2KXPC 4IYPA 3TXMA 1DCQA 4EQFA 3LKUA 1HF8A 2QC9A 2ZIRA 3BG0B 4K5CA 4ATGA 3CVXA 4GTOA 1YCSB 1O1RA 2EIJE 5JFZA 3RSEG 3JYSA 3DXMG 3TWQA 3LS8A 3NOGD 2FEZA 5KNHD 4GTSA 4G8KA 3EIJA 3EHMA 1HO8A 3CHRA 3Q47B 4GZCA 4N5QA 2CFZA 1MX4A 3FWVA 4W9RA 5ENTD 4A1SA 4MKTA 1OWPA 4J0UA 4TXRA 4HRMB 3QNKA 3O48A 4EZJA 2C2LA 2UY1B 3ESLA 4O1PA 3JQ1A 2X38A 4PUCA 3PZ2A 2V4HC 3QAQA 4HI9A 1MX2A 2XS1A 3L16A 2XEVA 2VGXB 3ZNGA 3GZ2A 4KMOA 3Q49B 3HXDA 4HOQA 2FO7A 4AJWA 4LU4A 1TJCA 4IULA 3QWVA 5LOZA 2DVWA 4L7TA 5B3SE 3J5QB 4J6IA 5J08A 5FTPA 1Q2ZA 1E8YA 5H7PA 1LTXA 5AQ9A 3IBEA 1X81A 4WWPA 4I9CA 2F6SA 1OXJA 3Q9UC 4GZ6A 3RJVA 5KJMA 2WXIA 3TWVA 3ASHA 4QQIA 4ATZD 3NZUA 4BSXA 3UKRG 3PS6A 3UT4A 1E8XA 2BUGA 3HXBA 3LY7A 2Y4UA 4FADA 3SGHA 4AXHA 5ENRD 1U3CA 5HQ8A 3AG4E 4HLEA 2WVIA 2X6IA 4UUCA 1H6PA 3ZUVB 3U9WA 1U3DA 3LJ3A 4WNGA 4A1GA 4CDMA 3ONKA 1UOHA 2V5QC 4CDNA 2WPVA 4C0EA 4K5AB 3D3MA 3Q75A 4GAAA 5EYLA 4B8AA 2P9KG 5G05J 4NQ0A 1QNFA 4LERA 5EX3A 1TN7A 3I4RB 5FQ8A 1V55E 4E85A 3UM0A 3CKCA 3NQPA 3DSUA 4CT4A 3S6AA 3CVUA 3LEWA 3FU6A 2WXNA 2FO1E 5FZRA 4XKBA 1G3NB 3C3RA 2XGSA 3CVPA 3HHMA 4V3IA 1HFAA 3D9PA 5CEDB 2AW6A 3PEVB 1N94A 2LSUA 3URZA 2IQCA 3CV0A 4GZ5A 4F53A 4F1SA 2P58C 3E37A 3HXEA 3GZSA 2FI7A 2NSZA 3E4BA 4CYMD 1E96B 2ZU6B 4H7YA 3R7QA 3Q7FA 5CRVA 5D2MC 3E34A 3EIQC 2DZNA 2DIWA 2XGMA 2X3MA 3TG4A 3RK6A 1YA0A 4WNFA 3MA5A 4XI9A 2EQXA 2ZGDA 4NURA 4AY6A 4G25A 5JHAA 4U63A 4M7CA 4BWRA 3CHMA 4BTAA 1SZ9A 3KEZA 2P9IG 3SD5A 3FU0A 2BEDA 3NAWA 3L13A 5AQAA 3DRAA 3CR3A 1SVXA 5BNWA 1ELKA 5FWQA 3SBSA 5IY5E 3FY4A 1PAQA 4DK5A 3I5PA 4A63B 4GPKA 5BUZA 4NIKA 4UWKA 3KEAA 4C9BB 2GRQB 3APCA 3ZYKA 3ZVVA 2J49A 2JABA 1TNZA 1N11A 2HO1A 4DLQA 3E33A 3PREA 2H6HA 3C72A 3CHQA 3AG2E 2XRYA 4GA0A 3UXGA 2P9PG 2NC9A 3JCKC 4HVBA 4AEZC 3QJZA 1UG3A 4U8HA 4BERA 1AP7A 4APOA 2I1KA 3R9MA 1Z6TA 2L0IA 2XZTG 3PVLA 1N52A 3IV0A 4EECA 1HG5A 2WXGA 3PZ3A 3SBTB 4GA2A 4I6EA 3D9KA 5HS0A 4I17A 3KAEA 5G04J 3FUDA 3K9IA 3QDNA 3ZIMA 3DWLG 3UQ3A 2P9UG 3E32A 3APFA 5LFAA 4C48B 1OY3D 2ILRA 3ZEFA 3FTXA 3J5PA 5ENQD 4ACLA 2F37A 5JHBA 3F6QA 1TN8A 4HLLA 3MYVA 4Q69A 3ASNE 1MQSA 2CHXA 2AXVA 3AU4A 3UINC 3ZGQA 5CKLA 3UPVA 3D9NA 1V54E 4U95D 5E75A 1MHQA 3ZXSA 3QWWA 3UIOC 2XS8A 2P9LG 3BUAA 4LNBA 2E0IA 3FUNA 4ZFHA 3ML9A 5FZSA 1BD8A 3BU8A 2CHWA 1QQEA 4DX6D 2X6KA 1N0RA 2WXOA 3V2OA 1OWLA 4YDOA 3FTSA 4A3TA 2V0PA 4HRLA 5G05C 4N2QA 4HRNA 3QWPA 4XI0A 1IHGA 4X8QA 1HXIA 5EX0A 3DBSA 1TR4A 4X2DA 3R9AB 4BT9A 4UWFA 3CVWA 2GRMA 4JXTA 3SY2A 2HM8A 3OXLA 2EIKE 1MZCA 1N9AA 2CG2A 2A4ZA 2I6HA 4RG9A 4CCAA 2H6FA 4KT6B 5FQ4A 2XQ0A 4HFGA 1JCQA 3LY8A 2FF4A 3JUIA 2GGFA 2QYUA 4DX7D 5CRUA 2AXUA 3PH0C 3UI2A 3ZYMA 3S2AA 1FCHA 5ENSD 4DJAA 2VY3A 1KZOA 5J90A 3FUKA 3U4TA 4FA6A 4JA9A 3FTYA 5KWDA 2IONA 4AVXA 2BKGA 3B95A 3L82A 1H6OA 3IEGA 4JPSA 3D9LA 2CHZA 3MEKA 4OVUA 3DSXA 3ZFWA 3ZLMA 1N0QA 2R03A 4BESA 3DSSA 3CIAA 4GTRA 3UUXA 3FUMA 4U96D 2NUDA 3AS5A 2QYJA 2IU1A 2BKKB 4NACA 4CEMA 3PZDA 4JEHA 4XKCA 4N3BA 3C98A 3OXGA 2MOWA 1LD8A 5CGLA 3ASFA 3LVQE 3GYZA 1H2UA 2L9BA 3B7UX 5HI7A 3QARA 4B0ZA 2IFUA 2F0YA 2J9QA 2WM9A 4DLOA 4GB9A 5G04C 1QZ2A 3O4ZA 4U04A 4WWNA 3BG1B 3QK0A 4UWGA 3AU5A 5BV1A 3DPDA 2VSXE 5ANRA 1FT1A 4CGWA 5LP0A 4HXIA 5FZQA 3D9OA 4L9PA 3G2WA 1NZNA 3SFYA 2LAIA 4PS7A 1SW6A 4GCOA 2VSYA 1N4SA 4UWLA 1DCEA 4FU3A 5JMND 3B7RL 2VSNA 3CHPA 3AS8A 2VQ2A 4BFRA 4KYOB 1AWCB 3CK9A 4J8FA 4BETA 3LDZA 3ZPJA 2ZXWE 5B1BE 5EIBE 1NP7A 3G2UA 3MZLB 1E8ZA 3ENEA 2KZTB 5EILA 4ANXA 4FC8A 5D0QD 4HOTA 4LUNU 3ONLA 3DSTA 4AOFA 4GYYA 4M16A 1BU9A 3U3WA 5E76A 3S7JA 3V79K 1NA3A 4UI9J 2WMNA 4NPSA 3KS2A 4ABNA 4EBAG 3RKVA 1YMPA 3TXNA 3LVRE 3RO3A 5ENNA 4BEPA 3IHYA 4Y6CA 1FPPA 2F8YA 1IKND 2OEWA 1D8DA 4G1TA 3NB2A 1JUQA 2I9CA 5CERB 1SZAA 1IHBA 1KPSB 3FDHA 2MRIA 1TNUA 4ANUA 1EPUA 4AIFA 3EHQA 1KLXA 2YINA 2IO3C 3FUEA 2AJAA 2Y0BG 2R05A 1MJ0A 2XENA 4E6HA 3EU5A 4EPZA 5A7DB 4GPMA 1W3BA 4HOSA 4G23A 4L2YA 3CVVA 1K3ZD 3C5RA 5B1AE 3PUKA 4BSZB 1NL4A 3U64A 5G55A 2VJ8A 3HXCA 3PE4A 1TNYA 3S7DA 4PY3A 3ZN3A 1NI1A 2GRPB 2PL2A 4G24A 2H6IA 4J8SA 4I6JA 1K8KG 1RZ4A 5JA4D 2OOEA 4F3VA 2J8SD 3OXFA 4GTMA 2XPZA 3ML8A 1DNPA 5CBNA 1N4RA 4EZLA 4FHJA 4U0UA 3HXFA 2J08A 3FEYA 4YDWA 4DX1A 3CK8A 3NF1A 4ILIA 2WXPA 4DX5D 1OWOA 2WQ7A 5CECB 1EF1C 4K5BA 3X2QE 2WB2A 2P2CP 3CK7A 3G2TA 2LXLA 3BQOA 3FU5A 3IHVA 3VLEA 4M3OA 2DYSE 5AQBA 3S7BA 1DC2A 4WWOA 1WG0A 4GZDA 3ZHEA 3ABKE 5KBAA 3IXEA 4LRZA 2BTDA 3FH5A 2KATA 5KJNA 1NFIE 2JK8A 4Y6WA 1TJFA 1MYOA 2ETCA 2YNQA 5AARA 4N3CA 1H6KA 5DBKA 3CVQA 3CQGB 3AG3E 1ZB1A 3PNTB
chains in the Genus database with same CATH topology
2KZTA 2YQ8A 3QOUA 2A4ZA 2I6HA 4UQZA 3EDTB 4RG9A 4AM9A 5JFZA 2WXFA 3JYSA 4CCAA 5LCWJ 3MKQB 4KT6B 4OYSA 5FQ4A 5C1DA 4UWHA 2XQ0A 1PY1A 3LS8A 3MX3A 2V4LA 2FEZA 3FHEA 4GMJA 4HFGA 2XRZA 2Q7FA 3FUIA 3EIJA 3LY8A 2FF4A 4I9EA 3EHMA 5AJDA 4GYWA 1HO8A 2OV8A 1N54A 3JUIA 3FU3A 3CHRA 4ITRA 2ONDA 3Q47B 4GZCA 2GGFA 2CFZA 3FWVA 3SE5A 4RVBA 4W9RA 4A1SA 1X5BA 2GRLA 3T8MA 1XNFA 4MKTA 4YVOA 2AXUA 3ZYQA 3PH0C 1HH8A 4LCTA 5T8IA 3ZYMA 1OWPA 4J0UA 3S2AA 1FCHA 2BF0X 3QNKA 4DJAA 2OVFA 2VY3A 3O48A 3Q4AB 4EZJA 2C2LA 2UY1B 3ESLA 4ILGA 4RSYA 3UMVA 5J90A 3JQ1A 3FUKA 5FQ7A 5KJKA 2QFCA 2R17C 1UN9A 2X38A 4UI9C 3CHOA 3CKBA 3L6AA 4PUCA 3TAXA 3U4TA 4FA6A 3ZYLA 3QAQA 4ILHB 3FTYA 4JA9A 3RIBA 2IONA 4AVXA 1Z3YA 1HS6A 1LF8A 4I2ZA 4FJYA 3SNXA 2XCCA 3WXXA 2WXRA 3L16A 3TL5A 4HORA 3IEGA 4JPSA 3D9LA 4J8EA 2XEVA 1A17A 2VGXB 2CHZA 3GZ2A 2DCPA 4KMOA 3Q49B 4JHJA 5CCLA 3MEKA 3TG5A 4BT8A 4C0MA 4OVUA 5CMYA 4GCNA 4HOQA 3ZFWA 2FO7A 4XE0A 4AJWA 4BTBA 3ZLMA 4A3VA 1L5JA 5T3RA 4LU4A 1TJCA 4IULA 3QWVA 4AP2A 2WXMA 1INZA 5LOZA 5JJ7A 3JQ0A 4GZ3A 4L7TA 3ASGA 4PH4B 4CGVA 3CIAA 4J6IA 5J08A 3LCAA 3UUXA 1UN8A 2V8SE 3FUMA 5FTPA 3RRUA 3APDA 1E8YA 4Q94A 3AS5A 2G03A 3IBEA 2IU1A 2X6JA 4NACA 3VTXA 4N2SA 2WQ6A 3T5XA 4WWPA 4HS2A 4I9CA 5BPPA 4CRWA 4CEMA 2F6SA 5FT9A 3PZDA 4ANVA 4JEHA 4GZ6A 4XKCA 3PRZA 3RJVA 5KJMA 2WXIA 4DI4A 1E7VA 3C98A 3ASHA 3OXGA 4N3BA 5CHEE 2MOWA 5ARGA 4I1AA 4K03A 1JWGA 5CGLA 3NZUA 4BSXA 2JEKA 3ASFA 3FUHA 3LVQE 3FFLA 2MHKA 3PS6A 3GYZA 3FULA 3UT4A 1E8XA 2BUGA 3LY7A 2AWIA 1H2UA 3FTWA 3D9MA 4JHRA 2Y4UA 4EZKA 2L9BA 3VTYA 4R7LA 4I6GA 1HU3A 3B7UX 5HI7A 5CMTA 1BPOA 2VSOE 3SGHA 4FADA 3QARA 4AXHA 1U3CA 4UQXA 3CVNA 3GW4A 2UY1A 3B7SA 2VGYA 4B0ZA 4HLEA 2WXHA 2WVIA 2X6IA 2IFUA 2C0LA 2J9QA 2XPIA 4CT0A 3U66A 4MLPA 3PUJA 2WM9A 5HQ8A 4DLOA 3HDXA 4FHKA 4GB9A 4A55A 5G04C 1QZ2A 3ESKA 3O4ZA 3U9WA 3LY9A 1U3DA 3LJ3A 3MV2B 1OUVA 2AXZA 2A5UA 2V5FA 2VGXA 4U04A 5JFFA 2CFUA 4WNGA 4WWNA 3L54A 3BG1B 4A1GA 3CLJA 4N39A 3QK0A 4CDMA 4BX8A 3ONKA 4UWGA 1WAO1 2GW1A 3AU5A 3Q15A 1HZ4A 4N3AA 3SFZA 5BV1A 2WXQA 2PQNA 2IJGX 3I3NA 4F7AA 3IKOB 3BEEA 4CDNA 1WY6A 2WPVA 3DPDA 3CEQA 4C0EA 3ZRHA 2VSXE 4L1BA 5CMWA 3D3MA 2WXLA 4GAAA 4B8AA 5ANRA 2LAHA 4UQYA 1EYHA 3MCXA 4KZ0A 5D0OD 4NQ0A 5G05J 1QNFA 5BV0A 4LERA 3PNTB 4CGWA 5LP0A 2LSVA 5EX3A 3RO2A 4HXIA 1OWNA 3I4RB 5FQ8A 1JWFA 5FZQA 5ANLA 4E85A 3D9JA 4TV3A 1EDUA 3MKRA 3D9OA 2YHCA 3CKCA 4PS3A 4GU5A 3G2WA 3L22A 2Y4TA 3NQPA 1NZNA 4CT4A 3S6AA 4URKA 4MS6A 3CVUA 2LAIA 3LEWA 4H7XA 3FU6A 3SN9A 2WXNA 4PS7A 3SZ7A 5FZRA 4XKBA 4JEUA 5EDSA 4GCOA 3LETA 4BY6A 1ZBPA 2R5SA 2VSYA 2XGSA 3CVPA 2AVPA 2L0TB 3HHMA 1KT1A 2QY7A 4UWLA 4V3IA 1HFAA 3D9PA 4N67A 2CG3A 4ACKA 4FU3A 4O6FA 5ARFA 1JPLA 3R7RA 2XGOA 2KCKA 4AY5A 4B89A 2AW6A 4LEUA 3PEVB 3B7RL 2VSNA 3EJNA 1KT0A 2JLBA 2IF4A 3CHPA 3AS8A 3ZCBA 3LXUX 2LSUA 1P5QA 2NXPA 2VQ2A 5AJLA 2IQCA 3CV0A 3URZA 4GZ5A 4BFRA 4KYOB 4F53A 3P2BA 4F1SA 1TEZA 2P58C 1FVFA 3CK9A 3HYMB 3HVEB 4J8FA 3CVLA 2KM4A 2FI7A 2NSZA 3GZSA 3LDZA 4FP7A 3E4BA 3ZPJA 4U07A 1NP7A 1IQRA 2XCBA 1E96B 2ZU6B 3G2UA 3MZLB 3MGBA 2HR2A 4X2EA 3N3UA 1E8ZA 4JW1A 5G2NA 2OVBA 3ENEA 3P1UA 4G26A 2KZTB 4H7YA 2PM6A 3R7QA 4ANXA 5M72A 4QFVA 4I43A 4FC8A 2R59A 4ANWA 1B89A 2J4DA 2I1JA 3MKQA 3CSFA 5D0QD 3EIQC 4HOTA 4LUNU 2Y3AA 2WXJA 3ONLA 2DIWA 3QC1A 2KCVA 4L23A 4AOFA 4GYYA 4M16A 2XGMA 4PS8A 4XZ4A 2X3MA 3TG4A 3U3WA 5E76A 4KXKB 1YA0A 4WNFA 3RK6A 3S7JA 4JL0A 1NA0A 2XPYA 1IQUA 1NA3A 1Y8MA 2VYIA 3MA5A 2EQXA 4UI9J 4XI9A 1E90A 3PEUB 5C2YA 2VTBB 4NURA 4I1MA 1E7UA 4NPSA 1HE8A 2WMNA 1PC2A 3FEXA 3KS2A 4G25A 4ABNA 5JHAA 4AY6A 4U63A 4EBAG 4N5CA 3RKVA 2UWJG 1XGWA 4HOUA 4BWRA 3TXNA 3CHMA 5CCMA 3VLFA 5LCWC 3LVRE 4BTAA 3RO3A 1SZ9A 3KEZA 2L6JA 4AV7A 5ENNA 4YNDA 3IHYA 3SD5A 1Y6IA 2LO6A 4Y6CA 3FU0A 3Q5MA 2PQRA 3OTNA 3L13A 4WUYA 4U0SA 3CR3A 3SHGA 1UJJA 3L17A 4G11A 3PDNA 5KJLA 1SQMA 5EU0A 4G1TA 5AYWD 5BNWA 1ELKA 5FWQA 5FJYA 3SBSA 1JUQA 2I9CA 3FY4A 1SZAA 3I4GA 3B13A 4FULA 3FDHA 1PAQA 4L2LA 3L08A 2MRIA 3I5PA 4DK5A 2HYZA 4ANUA 4GPKA 1EPUA 3AS4A 4UWKA 5BUZA 4C9BB 5KCMA 1H2TC 4X2CA 3APCA 3ZYKA 4AIFA 3EHNA 3TJPA 1ELRA 3ZVVA 3MJWA 2J49A 4WNDA 2HO1A 1KLXA 2YINA 1S0PA 4DLQA 3PREA 3HVEA 3FUEA 2J09A 3RU0A 2LNIA 4FJZA 2PZIA 3VLDA 3CHQA 4DI3A 2XRYA 4GA0A 2NC9A 4E6HA 3ZW3A 3JCKC 4EPZA 3ULQA 3CVXA 1Z3XA 3FTUA 4AEZC 4HVBA 5A7DB 4J8DA 3QJZA 1UG3A 5JJ6A 4U8HA 1W3BA 4P29A 2I2OA 4G23A 4APOA 4HOSA 2I1KA 3CSTA 1Z6TA 3CHSA 2L0IA 4OVVA 3RRMB 2IOLA 2YHEA 3CGHA 3MV3B 3PVLA 4L2YA 3CVVA 4U0ZA 1N52A 3IV0A 4EECA 1HX8A 2RG8A 2FULA 3FTVA 3FUJA 4KVOA 3CQCB 3G2SA 3PUKA 1HG5A 2WXGA 3GZ1A 3SBTB 2VTBA 4GA2A 4I6EA 3D9KA 3N71A 4I17A 3ASDA 3KAEA 5G04J 3FUDA 3K9IA 3U64A 4I1OB 5G55A 4BX9A 3QDNA 3ZIMA 4I2WA 5A6CA 3UQ3A 4WAFA 2IOSA 2VJ8A 3FH8A 2WXKA 4JZYA 4IRUA 3FUFA 4TUUA 4ME2A 3APFA 3PE4A 4B94A 2DBAA 5A23A 2WMOA 5LFAA 1VDYA 5AIJA 4KVMA 2ILRA 3ZEFA 2RD0A 3FTXA 3ZHEB 4MRUA 3S7DA 4PY3A 5BT1A 3ZN3A 4CDRA 2PL2A 4JC8A 4ACLA 2WQHA 4GMLA 3FH7A 5LX8A 5JHBA 3SI5A 4KZCA 4KBQA 4G24A 4K0RA 2PM7A 1HG2A 4PDXA 3B7TA 3MYVA 3ZC7A 4J8SA 1IYGA 4Q69A 3PNLB 2X6FA 1MQSA 4I6JA 2CHXA 4UI9K 1UW4B 2E2EA 2M63A 4JVSA 2OOEA 4GYOA 4XI8A 4F3VA 2AXVA 3AU4A 1ZU2A 3OXFA 1UJKA 1H19A 4WNEA 2XPZA 3NZSA 3ML8A 5AENA 3UX4A 1DNPA 1E8WA 3ZGQA 5CKLA 4Q96A 4RG6A 3UPVA 1H2VC 3CUCA 2C0MA 3D9NA 3UT7A 4EZLA 5E75A 1MHQA 4EBAA 4FHJA 2FBNA 3LYAA 4U0UA 4XX5A 2J08A 2J4BA 3OAWA 3ZXSA 3QWWA 3QB2A 5JJTA 2XHEA 1DVPA 3FEYA 1WM5A 3CK8A 2E0IA 3NF1A 4ILIA 2WXPA 3TGOA 3ML9A 5FZSA 1OWOA 2WQ7A 4DPRA 4TRQA 1EF1C 2CHWA 3LPZA 5BW8C 3RRNB 4IN3B 1QQEA 3D9IA 2WB2A 2X6KA 4YVQC 4APFA 2J07A 2WXOA 3QKYA 3CVYA 5DIZA 3CK7A 4JHKA 4B8CB 2KCLA 2X6HA 1OWMA 3G2TA 1OWLA 3SF4A 3FTSA 4A3TA 3FU5A 3IHVA 5EKQD 3T5VA 2V0PA 5G05C 3VLEA 4N2QA 3PE3A 4FLHA 3S7FA 3QWPA 4M3OA 4XI0A 3S7BA 1IHGA 5EX0A 1HXIA 3DBSA 4WWOA 3UT8A 4D10C 4FLBA 4GZDA 3HIZA 4X2DA 4JA7A 5T4YA 3R9AB 3FP3A 3ZHEA 4GA1A 4BT9A 4G2VA 5FQ6A 4LRZA 1GW6A 2VZAA 4UWFA 1ELWA 2BTDA 3FH5A 1FVHA 3CVWA 2KATA 3FTZA 3SHFA 2KC7A 3G2VA 3KD7A 2GRMA 5KJNA 2JK8A 4JXTA 4Y6WA 1H0AA 4NRHB 1TJFA 4XIFA 2HM8A 4IYPA 3OXLA 2YNQA 3TXMA 4N3CA 1H6KA 4EQFA 3LKUA 1HF8A 5DBKA 3CVQA 3CQGB 3BG0B 2CG2A 4ATGA 3FUNA 4WGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQ8 A;  3QOU A;  2I6H A;  4UQZ A;  3EDT B;  4RG9 A;  4AM9 A;  5JFZ A;  5LCW J;  3JYS A;  5C1D A;  2FEZ A;  2Q7F A;  4I9E A;  3LY8 A;  2FF4 A;  4GYW A;  4ITR A;  2OND A;  3Q47 B;  3FWV A;  3SE5 A;  4W9R A;  4A1S A;  1XNF A;  4YVO A;  1HH8 A;  4J0U A;  1FCH A;  2VY3 A;  3O48 A;  3Q4A B;  2C2L A;  2UY1 B;  5KJK A;  2QFC A;  4UI9 C;  3CKB A;  3U4T A;  3TAX A;  4JA9 A;  3RIB A;  4I2Z A;  3WXX A;  2XCC A;  4HOR A;  3IEG A;  4J8E A;  2XEV A;  1A17 A;  2VGX B;  3GZ2 A;  3Q49 B;  5CCL A;  3MEK A;  3TG5 A;  4BT8 A;  4GCN A;  4HOQ A;  3ZFW A;  2FO7 A;  4BTB A;  3ZLM A;  4LU4 A;  1TJC A;  3QWV A;  5JJ7 A;  4GZ3 A;  3ASG A;  4CGV A;  3LCA A;  3UUX A;  5FTP A;  3AS5 A;  2G03 A;  3VTX A;  4N2S A;  4I9C A;  2F6S A;  5FT9 A;  4GZ6 A;  3RJV A;  5KJM A;  4N3B A;  5CHE E;  3ASH A;  3OXG A;  5ARG A;  4I1A A;  5CGL A;  3ASF A;  3FFL A;  2MHK A;  3GYZ A;  2BUG A;  3LY7 A;  4JHR A;  2Y4U A;  3VTY A;  5HI7 A;  5CMT A;  4UQX A;  3CVN A;  3GW4 A;  2UY1 A;  5HQ8 A;  2VGY A;  2XPI A;  2IFU A;  2C0L A;  2J9Q A;  5G04 C;  1QZ2 A;  3ESK A;  3LY9 A;  3MV2 B;  1OUV A;  2V5F A;  2VGX A;  4U04 A;  5JFF A;  4WNG A;  4N39 A;  1WAO 1;  2GW1 A;  3Q15 A;  1HZ4 A;  4N3A A;  2PQN A;  3BEE A;  2WPV A;  3CEQ A;  4UQY A;  5D0O D;  5G05 J;  4NQ0 A;  4CGW A;  2LSV A;  5EX3 A;  3RO2 A;  5FZQ A;  3MKR A;  2YHC A;  3CKC A;  2Y4T A;  1NZN A;  3S6A A;  4H7X A;  3SN9 A;  3SZ7 A;  5FZR A;  4GCO A;  3LET A;  1ZBP A;  2R5S A;  2VSY A;  2XGS A;  3CVP A;  2AVP A;  1KT1 A;  4N67 A;  4O6F A;  5ARF A;  4AY5 A;  2XGO A;  2KCK A;  4LEU A;  2VSN A;  1KT0 A;  2JLB A;  2IF4 A;  3AS8 A;  3ZCB A;  2LSU A;  1P5Q A;  2VQ2 A;  3URZ A;  3CV0 A;  4GZ5 A;  4KYO B;  2P58 C;  3CK9 A;  3HYM B;  4J8F A;  3CVL A;  2FI7 A;  3ZPJ A;  3E4B A;  4U07 A;  2XCB A;  1E96 B;  2HR2 A;  4X2E A;  3N3U A;  4G26 A;  4H7Y A;  5M72 A;  1B89 A;  5D0Q D;  4HOT A;  2KCV A;  4GYY A;  4M16 A;  2XGM A;  3TG4 A;  3U3W A;  4KXK B;  1YA0 A;  4WNF A;  3S7J A;  4JL0 A;  1NA0 A;  1NA3 A;  1Y8M A;  2VYI A;  3MA5 A;  4UI9 J;  4XI9 A;  4NPS A;  1PC2 A;  3KS2 A;  4G25 A;  4ABN A;  4AY6 A;  4N5C A;  3RKV A;  2UWJ G;  4HOU A;  4BWR A;  5LCW C;  5CCM A;  4BTA A;  3RO3 A;  2L6J A;  4YND A;  4Y6C A;  3Q5M A;  2PQR A;  4WUY A;  4U0S A;  3SHG A;  3PDN A;  5KJL A;  5EU0 A;  4G1T A;  5AYW D;  5BNW A;  5FJY A;  2HYZ A;  4GPK A;  3AS4 A;  4X2C A;  4AIF A;  1ELR A;  4WND A;  2HO1 A;  1KLX A;  3RU0 A;  2LNI A;  2PZI A;  4GA0 A;  2NC9 A;  3ULQ A;  5A7D B;  4J8D A;  5JJ6 A;  1W3B A;  4HOS A;  4G23 A;  4APO A;  3MV3 B;  4U0Z A;  3GZ1 A;  4GA2 A;  3N71 A;  4I17 A;  3ASD A;  5G04 J;  3KAE A;  3K9I A;  3QDN A;  4I2W A;  5A6C A;  3UQ3 A;  4ME2 A;  3PE4 A;  4B94 A;  2DBA A;  3ZHE B;  3S7D A;  4PY3 A;  5BT1 A;  3ZN3 A;  4CDR A;  2PL2 A;  2WQH A;  4KBQ A;  4G24 A;  3ZC7 A;  1IYG A;  4UI9 K;  2E2E A;  2OOE A;  4GYO A;  4XI8 A;  4F3V A;  1ZU2 A;  3OXF A;  4WNE A;  3ZGQ A;  5CKL A;  3UPV A;  4RG6 A;  3CUC A;  2C0M A;  2FBN A;  3LYA A;  4U0U A;  3QWW A;  5JJT A;  1WM5 A;  3CK8 A;  3NF1 A;  3TGO A;  5FZS A;  5BW8 C;  3LPZ A;  4IN3 B;  1QQE A;  4YVQ C;  3QKY A;  5DIZ A;  3CK7 A;  2KCL A;  3SF4 A;  5EKQ D;  5G05 C;  4N2Q A;  3PE3 A;  3S7F A;  3QWP A;  4XI0 A;  3S7B A;  1IHG A;  5EX0 A;  1HXI A;  4X2D A;  4JA7 A;  3R9A B;  3FP3 A;  3ZHE A;  4GA1 A;  4BT9 A;  4G2V A;  2VZA A;  1ELW A;  2KAT A;  2KC7 A;  3KD7 A;  5KJN A;  2JK8 A;  4Y6W A;  4NRH B;  4XIF A;  3OXL A;  4N3C A;  4EQF A;  3LKU A;  5DBK A;  3CVQ A;  4WGJ A; 
#chains in the Genus database with same CATH topology
 2KZT A;  2YQ8 A;  2WXF A;  4GTP A;  3W9F A;  3MKQ B;  4OYS A;  5C1D A;  4UWH A;  1PY1 A;  5CBO A;  4GMJ A;  4MBG A;  2XRZ A;  2Q7F A;  2NUN A;  5AJD A;  4GYW A;  2DWZ A;  1N54 A;  2OV8 A;  4HNA D;  3FU3 A;  4LG6 A;  1OCR E;  2OND A;  3EUV A;  2GRL A;  2IO2 C;  4YVO A;  3ZYQ A;  5T8I A;  4LCT A;  4ILG A;  3UMV A;  1TNO A;  5FQ7 A;  2QFC A;  2R17 C;  1UN9 A;  4UI9 C;  3CHO A;  3CKB A;  3ZYL A;  4ILH B;  1Z3Y A;  3SNX A;  4I2Z A;  3WXX A;  4FJY A;  1WDY A;  3TL5 A;  3UIP C;  4RLY A;  2RFM A;  5FIN A;  1A17 A;  3ULE G;  3TG5 A;  3Q73 A;  3ABL E;  4XE0 A;  1OCC E;  3V2X A;  1L5J A;  5T3R A;  1INZ A;  5JJ7 A;  3JQ0 A;  4GZ3 A;  1OCZ E;  4PH4 B;  1UN8 A;  4GTT A;  3TWU A;  1O1S A;  2LXM A;  4Q94 A;  2G03 A;  2X6J A;  3DPY A;  2WQ6 A;  4HS2 A;  5BPP A;  4CRW A;  4DI4 A;  1E7V A;  3DSV A;  1YYH A;  4O1O A;  5CHE E;  4I1A A;  4K03 A;  2JEK A;  3FFL A;  2MHK A;  3FUL A;  2IEJ A;  2AWI A;  2XZD G;  4JHR A;  4EZK A;  3KSL A;  3VTY A;  4R7L A;  1HU3 A;  3SQV A;  1O5M A;  4UQX A;  1IXV A;  3JXJ A;  3GW4 A;  2QZA A;  2WXH A;  4CT0 A;  2C0L A;  3PZ4 A;  3U66 A;  4MLP A;  1KZP A;  4FHK A;  4A55 A;  4DUI A;  4TXQ A;  3ESK A;  2A5U A;  2XEE A;  3L54 A;  3CLJ A;  4N39 A;  4BX8 A;  2ZIS A;  1WAO 1;  3TWX A;  3Q15 A;  1HZ4 A;  4N3A A;  2WXQ A;  2IJG X;  3I3N A;  4F7A A;  3IKO B;  1WY6 A;  3CEQ A;  1S63 A;  3ZRH A;  5CMW A;  1EYH A;  4JD2 G;  5D0O D;  5BV0 A;  3ZKJ A;  3RO2 A;  1OWN A;  1JWF A;  3D9J A;  5ENO D;  1EDU A;  1TN6 A;  4PS3 A;  3TWT A;  4URK A;  4MS6 A;  4H7X A;  3SZ7 A;  5EDS A;  4TUM A;  4JEU A;  2P9S G;  3LET A;  4BY6 A;  2AVP A;  2L0T B;  2MYO A;  2CG3 A;  4ACK A;  3C3O A;  4O6F A;  3R7R A;  3UM1 A;  2XGO A;  4AY5 A;  4B89 A;  4LEU A;  5CEA A;  1KT0 A;  2JLB A;  3ZCB A;  1U2V G;  3ULY A;  1TEZ A;  1FVF A;  1Z5S C;  3HYM B;  3CVL A;  4U07 A;  2DYR E;  4X2E A;  4JW1 A;  5G2N A;  3P1U A;  4F6R D;  4G26 A;  5M72 A;  2PM6 A;  4QFV A;  2R59 A;  3MKQ A;  2Y3A A;  2WXJ A;  2KCV A;  4L23 A;  2RKK A;  3UM3 A;  1NA0 A;  2XPY A;  1IQU A;  5C2Y A;  2VYI A;  1E90 A;  1HE8 A;  2NYJ A;  4N5C A;  2ETA A;  2ZGG A;  4HOU A;  4YDY A;  5CCM A;  3VLF A;  4YND A;  3Q5M A;  2PQR A;  3OTN A;  3SHG A;  1UJJ A;  3PDN A;  3Q78 A;  5KJL A;  4TXP A;  5EU0 A;  3PZ1 A;  5FJY A;  1BI8 B;  3B13 A;  3T8K A;  4FUL A;  3DEP A;  4L2L A;  3L08 A;  2HYZ A;  5KCM A;  4X2C A;  3TJP A;  4LSZ E;  4WND A;  1S0P A;  4J8Y A;  3HVE A;  5EID A;  3UKU G;  2LNI A;  2PZI A;  4DI3 A;  4GMR A;  4HI8 A;  1Z3X A;  4LNG A;  2I2O A;  4OVV A;  2IOL A;  2YHE A;  3CGH A;  3MV3 B;  3UTM A;  1HX8 A;  2RG8 A;  5FIO A;  2VTB A;  3G2S A;  3GZ1 A;  3ASD A;  4BX9 A;  5A6C A;  3FH8 A;  2WXK A;  4TUU A;  3FUF A;  4ME2 A;  4B94 A;  2WMO A;  4KVM A;  2RD0 A;  3ZHE B;  3EHR A;  2WQH A;  4GML A;  1OT8 A;  5LX8 A;  3SI5 A;  4KZC A;  4K0R A;  2PM7 A;  1HG2 A;  4DRX E;  1D9S A;  4PDX A;  3ABM E;  3B7T A;  3ZC7 A;  1IYG A;  1S64 A;  4XI8 A;  1ZU2 A;  4WNE A;  1UJK A;  3NZS A;  5AN8 A;  2LUH A;  3UX4 A;  4EHM A;  4Q96 A;  1H2V C;  3CUC A;  2C0M A;  2FBN A;  4XX5 A;  3OAW A;  2P9N G;  5JJT A;  2PNN A;  1BI7 B;  2HE0 A;  3TGO A;  4DPR A;  2GRR B;  4TRQ A;  3LPZ A;  5BW8 C;  3RRN B;  3D9I A;  2OEV A;  4Z68 A;  3ZU7 B;  4YVQ C;  4APF A;  2J07 A;  3QKY A;  5DIZ A;  4JHK A;  4HBD A;  4B8C B;  2KCL A;  1OWM A;  3ASO E;  3T5V A;  3PE3 A;  3S7F A;  1O1T A;  3UT8 A;  4D10 C;  4JA7 A;  3FP3 A;  1ELW A;  1FVH A;  4J7W A;  4DX2 A;  1H0A A;  3AAA C;  1RW2 A;  5D66 A;  4WGJ A;  3QOU A;  4UQZ A;  3EDT B;  4AM9 A;  5LCW J;  1LD7 A;  3MX3 A;  2V4L A;  3FHE A;  1N95 A;  3FUI A;  4I9E A;  3D9H A;  3NBN B;  4ITR A;  3JXI A;  3SE5 A;  4RVB A;  1X5B A;  3T8M A;  1XNF A;  2H6G A;  1HH8 A;  2BF0 X;  2B0O E;  2OVF A;  3Q4A B;  4RSY A;  1JCR A;  5KJK A;  3L6A A;  3TAX A;  3KSQ A;  4O60 A;  3RIB A;  1HS6 A;  1LF8 A;  2XCC A;  5AAO A;  1D8E A;  2WXR A;  4HOR A;  4J8E A;  2DCP A;  4JHJ A;  5CCL A;  4BT8 A;  4C0M A;  1BLX B;  5CMY A;  4GCN A;  1FT2 A;  4BTB A;  5BXU A;  4A3V A;  4AP2 A;  2WXM A;  2KBX A;  3ASG A;  4CGV A;  3LCA A;  2V8S E;  3RRU A;  3APD A;  3VTX A;  4N2S A;  3T5X A;  4GTV A;  5FT9 A;  4ANV A;  3PRZ A;  5ARG A;  1JWG A;  3SO8 A;  3FUH A;  2Y1L E;  1TYQ G;  3FTW A;  3D9M A;  4I6G A;  5CMT A;  1BPO A;  2VSO E;  5ENP D;  2EIM E;  3CVN A;  2DZO A;  2UY1 A;  3B7S A;  2VGY A;  3E30 A;  2XPI A;  3RAU A;  4CZ2 D;  3PUJ A;  3HDX A;  4U8Y D;  3LY9 A;  3MV2 B;  1OUV A;  2AXZ A;  2V5F A;  2VGX A;  5JFF A;  2CFU A;  2RFA A;  2GW1 A;  3DSW A;  3SFZ A;  1SA5 A;  1NH1 A;  2PQN A;  3BEE A;  4L1B A;  3NOC D;  4HQD A;  2WXL A;  2LAH A;  4UQY A;  3MCX A;  4KZ0 A;  2LSV A;  2GRN B;  5ANL A;  2L6B A;  1MX6 A;  4TV3 A;  3MKR A;  2YHC A;  5AQ7 A;  4GU5 A;  3L22 A;  2Y4T A;  3C3Q A;  3V31 A;  3Q7A A;  3SN9 A;  4F1P A;  1ZBP A;  2R5S A;  1KT1 A;  2QY7 A;  4N67 A;  3SFX A;  5ARF A;  1JPL A;  2KCK A;  1TNB A;  3EJN A;  2IF4 A;  3LXU X;  1P5Q A;  2NXP A;  5AJL A;  3W9G A;  3P2B A;  4GTQ A;  3HVE B;  2KM4 A;  5ITZ F;  4FP7 A;  2A5E A;  1A5E A;  1IQR A;  2XCB A;  5HKP A;  4OAV B;  3MGB A;  4XEI G;  2HR2 A;  3N3U A;  4ZHB A;  2OVB A;  1N4P A;  4U7E B;  4ANW A;  4I43 A;  4B93 B;  1B89 A;  2J4D A;  2I1J A;  3CSF A;  5EN5 D;  4JB8 P;  3QC1 A;  3JUE A;  4PS8 A;  1S70 B;  4XZ4 A;  4U8V D;  4KXK B;  4JL0 A;  2ETB A;  1Y8M A;  2VTB B;  3PEU B;  3B7B A;  3L9T A;  4I1M A;  1E7U A;  3FEX A;  1PC2 A;  2UWJ G;  1XGW A;  2EIL E;  5LCW C;  2L6J A;  4AV7 A;  2B6C A;  3UM2 A;  1Y6I A;  2LO6 A;  4LNU D;  4WUY A;  4U0S A;  3L17 A;  4G11 A;  3EU9 A;  1QBQ A;  1OCO E;  1SQM A;  3WG7 E;  1SA4 A;  5AYW D;  3Q9N C;  3V30 A;  3I4G A;  1K1A A;  3TWR A;  4G8L A;  3DEO A;  3AS4 A;  3T9K A;  1H2T C;  2R02 A;  3EHN A;  1ELR A;  3MJW A;  2R2L A;  2J09 A;  3RU0 A;  4FJZ A;  3VLD A;  3ZW3 A;  3ULQ A;  2VGE A;  3FTU A;  4J8D A;  5JJ6 A;  4P29 A;  3AG1 E;  3CST A;  2IY0 C;  3CHS A;  4OAU C;  3HRA A;  3RRM B;  1JCS A;  4U0Z A;  3TWS A;  2FUL A;  3FTV A;  3FUJ A;  4KVO A;  3CQC B;  2XEH A;  3N71 A;  4RQI A;  4I1O B;  4I2W A;  4WAF A;  1K1B A;  2IOS A;  4JZY A;  4IRU A;  2DBA A;  5A23 A;  1VDY A;  5AIJ A;  3ZXP A;  4MRU A;  5HRY A;  5BT1 A;  4CDR A;  4JC8 A;  3FH7 A;  4KBQ A;  3PNL B;  2X6F A;  4YDE A;  2Y69 E;  4UI9 K;  1UW4 B;  2E2E A;  2M63 A;  4JVS A;  2F8X K;  4GYO A;  2GRO B;  1N4Q A;  1H19 A;  5AEN A;  1E8W A;  3HG0 D;  4RG6 A;  3UT7 A;  4EBA A;  3LYA A;  2J4B A;  3QB2 A;  5KNG A;  2XHE A;  3TWW A;  1DVP A;  1WM5 A;  4HB5 A;  3Q79 A;  4IN3 B;  1QYM A;  2EIN E;  3CVY A;  5BXO A;  2X6H A;  3SF4 A;  3AJI A;  5EKQ D;  3ISM C;  4FLH A;  3LJN A;  2OCC E;  5EYP F;  4FLB A;  3HIZ A;  5T4Y A;  3DXK G;  4GA1 A;  4G2V A;  5FQ6 A;  1GW6 A;  2VZA A;  3FTZ A;  3SHF A;  2KC7 A;  3G2V A;  3KD7 A;  4NRH B;  4XIF A;  2KXP C;  4IYP A;  3TXM A;  1DCQ A;  4EQF A;  3LKU A;  1HF8 A;  2QC9 A;  2ZIR A;  3BG0 B;  4K5C A;  4ATG A;  3CVX A;  4GTO A;  1YCS B;  1O1R A;  2EIJ E;  5JFZ A;  3RSE G;  3JYS A;  3DXM G;  3TWQ A;  3LS8 A;  3NOG D;  2FEZ A;  5KNH D;  4GTS A;  4G8K A;  3EIJ A;  3EHM A;  1HO8 A;  3CHR A;  3Q47 B;  4GZC A;  4N5Q A;  2CFZ A;  1MX4 A;  3FWV A;  4W9R A;  5ENT D;  4A1S A;  4MKT A;  1OWP A;  4J0U A;  4TXR A;  4HRM B;  3QNK A;  3O48 A;  4EZJ A;  2C2L A;  2UY1 B;  3ESL A;  4O1P A;  3JQ1 A;  2X38 A;  4PUC A;  3PZ2 A;  2V4H C;  3QAQ A;  4HI9 A;  1MX2 A;  2XS1 A;  3L16 A;  2XEV A;  2VGX B;  3ZNG A;  3GZ2 A;  4KMO A;  3Q49 B;  3HXD A;  4HOQ A;  2FO7 A;  4AJW A;  4LU4 A;  1TJC A;  4IUL A;  3QWV A;  5LOZ A;  2DVW A;  4L7T A;  5B3S E;  3J5Q B;  4J6I A;  5J08 A;  5FTP A;  1Q2Z A;  1E8Y A;  5H7P A;  1LTX A;  5AQ9 A;  3IBE A;  1X81 A;  4WWP A;  4I9C A;  2F6S A;  1OXJ A;  3Q9U C;  4GZ6 A;  3RJV A;  5KJM A;  2WXI A;  3TWV A;  3ASH A;  4QQI A;  4ATZ D;  3NZU A;  4BSX A;  3UKR G;  3PS6 A;  3UT4 A;  1E8X A;  2BUG A;  3HXB A;  3LY7 A;  2Y4U A;  4FAD A;  3SGH A;  4AXH A;  5ENR D;  1U3C A;  5HQ8 A;  3AG4 E;  4HLE A;  2WVI A;  2X6I A;  4UUC A;  1H6P A;  3ZUV B;  3U9W A;  1U3D A;  3LJ3 A;  4WNG A;  4A1G A;  4CDM A;  3ONK A;  1UOH A;  2V5Q C;  4CDN A;  2WPV A;  4C0E A;  4K5A B;  3D3M A;  3Q75 A;  4GAA A;  5EYL A;  4B8A A;  2P9K G;  5G05 J;  4NQ0 A;  1QNF A;  4LER A;  5EX3 A;  1TN7 A;  3I4R B;  5FQ8 A;  1V55 E;  4E85 A;  3UM0 A;  3CKC A;  3NQP A;  3DSU A;  4CT4 A;  3S6A A;  3CVU A;  3LEW A;  3FU6 A;  2WXN A;  2FO1 E;  5FZR A;  4XKB A;  1G3N B;  3C3R A;  2XGS A;  3CVP A;  3HHM A;  4V3I A;  1HFA A;  3D9P A;  5CED B;  2AW6 A;  3PEV B;  1N94 A;  2LSU A;  3URZ A;  2IQC A;  3CV0 A;  4GZ5 A;  4F53 A;  4F1S A;  2P58 C;  3E37 A;  3HXE A;  3GZS A;  2FI7 A;  2NSZ A;  3E4B A;  4CYM D;  1E96 B;  2ZU6 B;  4H7Y A;  3R7Q A;  3Q7F A;  5CRV A;  5D2M C;  3E34 A;  3EIQ C;  2DZN A;  2DIW A;  2XGM A;  2X3M A;  3TG4 A;  3RK6 A;  1YA0 A;  4WNF A;  3MA5 A;  4XI9 A;  2EQX A;  2ZGD A;  4NUR A;  4AY6 A;  4G25 A;  5JHA A;  4U63 A;  4M7C A;  4BWR A;  3CHM A;  4BTA A;  1SZ9 A;  3KEZ A;  2P9I G;  3SD5 A;  3FU0 A;  2BED A;  3NAW A;  3L13 A;  5AQA A;  3DRA A;  3CR3 A;  1SVX A;  5BNW A;  1ELK A;  5FWQ A;  3SBS A;  5IY5 E;  3FY4 A;  1PAQ A;  4DK5 A;  3I5P A;  4A63 B;  4GPK A;  5BUZ A;  4NIK A;  4UWK A;  3KEA A;  4C9B B;  2GRQ B;  3APC A;  3ZYK A;  3ZVV A;  2J49 A;  2JAB A;  1TNZ A;  1N11 A;  2HO1 A;  4DLQ A;  3E33 A;  3PRE A;  2H6H A;  3C72 A;  3CHQ A;  3AG2 E;  2XRY A;  4GA0 A;  3UXG A;  2P9P G;  2NC9 A;  3JCK C;  4HVB A;  4AEZ C;  3QJZ A;  1UG3 A;  4U8H A;  4BER A;  1AP7 A;  4APO A;  2I1K A;  3R9M A;  1Z6T A;  2L0I A;  2XZT G;  3PVL A;  1N52 A;  3IV0 A;  4EEC A;  1HG5 A;  2WXG A;  3PZ3 A;  3SBT B;  4GA2 A;  4I6E A;  3D9K A;  5HS0 A;  4I17 A;  3KAE A;  5G04 J;  3FUD A;  3K9I A;  3QDN A;  3ZIM A;  3DWL G;  3UQ3 A;  2P9U G;  3E32 A;  3APF A;  5LFA A;  4C48 B;  1OY3 D;  2ILR A;  3ZEF A;  3FTX A;  3J5P A;  5ENQ D;  4ACL A;  2F37 A;  5JHB A;  3F6Q A;  1TN8 A;  4HLL A;  3MYV A;  4Q69 A;  3ASN E;  1MQS A;  2CHX A;  2AXV A;  3AU4 A;  3UIN C;  3ZGQ A;  5CKL A;  3UPV A;  3D9N A;  1V54 E;  4U95 D;  5E75 A;  1MHQ A;  3ZXS A;  3QWW A;  3UIO C;  2XS8 A;  2P9L G;  3BUA A;  4LNB A;  2E0I A;  3FUN A;  4ZFH A;  3ML9 A;  5FZS A;  1BD8 A;  3BU8 A;  2CHW A;  1QQE A;  4DX6 D;  2X6K A;  1N0R A;  2WXO A;  3V2O A;  1OWL A;  4YDO A;  3FTS A;  4A3T A;  2V0P A;  4HRL A;  5G05 C;  4N2Q A;  4HRN A;  3QWP A;  4XI0 A;  1IHG A;  4X8Q A;  1HXI A;  5EX0 A;  3DBS A;  1TR4 A;  4X2D A;  3R9A B;  4BT9 A;  4UWF A;  3CVW A;  2GRM A;  4JXT A;  3SY2 A;  2HM8 A;  3OXL A;  2EIK E;  1MZC A;  1N9A A;  2CG2 A;  2A4Z A;  2I6H A;  4RG9 A;  4CCA A;  2H6F A;  4KT6 B;  5FQ4 A;  2XQ0 A;  4HFG A;  1JCQ A;  3LY8 A;  2FF4 A;  3JUI A;  2GGF A;  2QYU A;  4DX7 D;  5CRU A;  2AXU A;  3PH0 C;  3UI2 A;  3ZYM A;  3S2A A;  1FCH A;  5ENS D;  4DJA A;  2VY3 A;  1KZO A;  5J90 A;  3FUK A;  3U4T A;  4FA6 A;  4JA9 A;  3FTY A;  5KWD A;  2ION A;  4AVX A;  2BKG A;  3B95 A;  3L82 A;  1H6O A;  3IEG A;  4JPS A;  3D9L A;  2CHZ A;  3MEK A;  4OVU A;  3DSX A;  3ZFW A;  3ZLM A;  1N0Q A;  2R03 A;  4BES A;  3DSS A;  3CIA A;  4GTR A;  3UUX A;  3FUM A;  4U96 D;  2NUD A;  3AS5 A;  2QYJ A;  2IU1 A;  2BKK B;  4NAC A;  4CEM A;  3PZD A;  4JEH A;  4XKC A;  4N3B A;  3C98 A;  3OXG A;  2MOW A;  1LD8 A;  5CGL A;  3ASF A;  3LVQ E;  3GYZ A;  1H2U A;  2L9B A;  3B7U X;  5HI7 A;  3QAR A;  4B0Z A;  2IFU A;  2F0Y A;  2J9Q A;  2WM9 A;  4DLO A;  4GB9 A;  5G04 C;  1QZ2 A;  3O4Z A;  4U04 A;  4WWN A;  3BG1 B;  3QK0 A;  4UWG A;  3AU5 A;  5BV1 A;  3DPD A;  2VSX E;  5ANR A;  1FT1 A;  4CGW A;  5LP0 A;  4HXI A;  5FZQ A;  3D9O A;  4L9P A;  3G2W A;  1NZN A;  3SFY A;  2LAI A;  4PS7 A;  1SW6 A;  4GCO A;  2VSY A;  1N4S A;  4UWL A;  1DCE A;  4FU3 A;  5JMN D;  3B7R L;  2VSN A;  3CHP A;  3AS8 A;  2VQ2 A;  4BFR A;  4KYO B;  1AWC B;  3CK9 A;  4J8F A;  4BET A;  3LDZ A;  3ZPJ A;  2ZXW E;  5B1B E;  5EIB E;  1NP7 A;  3G2U A;  3MZL B;  1E8Z A;  3ENE A;  2KZT B;  5EIL A;  4ANX A;  4FC8 A;  5D0Q D;  4HOT A;  4LUN U;  3ONL A;  3DST A;  4AOF A;  4GYY A;  4M16 A;  1BU9 A;  3U3W A;  5E76 A;  3S7J A;  3V79 K;  1NA3 A;  4UI9 J;  2WMN A;  4NPS A;  3KS2 A;  4ABN A;  4EBA G;  3RKV A;  1YMP A;  3TXN A;  3LVR E;  3RO3 A;  5ENN A;  4BEP A;  3IHY A;  4Y6C A;  1FPP A;  2F8Y A;  1IKN D;  2OEW A;  1D8D A;  4G1T A;  3NB2 A;  1JUQ A;  2I9C A;  5CER B;  1SZA A;  1IHB A;  1KPS B;  3FDH A;  2MRI A;  1TNU A;  4ANU A;  1EPU A;  4AIF A;  3EHQ A;  1KLX A;  2YIN A;  2IO3 C;  3FUE A;  2AJA A;  2Y0B G;  2R05 A;  1MJ0 A;  2XEN A;  4E6H A;  3EU5 A;  4EPZ A;  5A7D B;  4GPM A;  1W3B A;  4HOS A;  4G23 A;  4L2Y A;  3CVV A;  1K3Z D;  3C5R A;  5B1A E;  3PUK A;  4BSZ B;  1NL4 A;  3U64 A;  5G55 A;  2VJ8 A;  3HXC A;  3PE4 A;  1TNY A;  3S7D A;  4PY3 A;  3ZN3 A;  1NI1 A;  2GRP B;  2PL2 A;  4G24 A;  2H6I A;  4J8S A;  4I6J A;  1K8K G;  1RZ4 A;  5JA4 D;  2OOE A;  4F3V A;  2J8S D;  3OXF A;  4GTM A;  2XPZ A;  3ML8 A;  1DNP A;  5CBN A;  1N4R A;  4EZL A;  4FHJ A;  4U0U A;  3HXF A;  2J08 A;  3FEY A;  4YDW A;  4DX1 A;  3CK8 A;  3NF1 A;  4ILI A;  2WXP A;  4DX5 D;  1OWO A;  2WQ7 A;  5CEC B;  1EF1 C;  4K5B A;  3X2Q E;  2WB2 A;  2P2C P;  3CK7 A;  3G2T A;  2LXL A;  3BQO A;  3FU5 A;  3IHV A;  3VLE A;  4M3O A;  2DYS E;  5AQB A;  3S7B A;  1DC2 A;  4WWO A;  1WG0 A;  4GZD A;  3ZHE A;  3ABK E;  5KBA A;  3IXE A;  4LRZ A;  2BTD A;  3FH5 A;  2KAT A;  5KJN A;  1NFI E;  2JK8 A;  4Y6W A;  1TJF A;  1MYO A;  2ETC A;  2YNQ A;  5AAR A;  4N3C A;  1H6K A;  5DBK A;  3CVQ A;  3CQG B;  3AG3 E;  1ZB1 A;  3PNT B; 
#chains in the Genus database with same CATH homology
 2KZT A;  2YQ8 A;  3QOU A;  2A4Z A;  2I6H A;  4UQZ A;  3EDT B;  4RG9 A;  4AM9 A;  5JFZ A;  2WXF A;  3JYS A;  4CCA A;  5LCW J;  3MKQ B;  4KT6 B;  4OYS A;  5FQ4 A;  5C1D A;  4UWH A;  2XQ0 A;  1PY1 A;  3LS8 A;  3MX3 A;  2V4L A;  2FEZ A;  3FHE A;  4GMJ A;  4HFG A;  2XRZ A;  2Q7F A;  3FUI A;  3EIJ A;  3LY8 A;  2FF4 A;  4I9E A;  3EHM A;  5AJD A;  4GYW A;  1HO8 A;  2OV8 A;  1N54 A;  3JUI A;  3FU3 A;  3CHR A;  4ITR A;  2OND A;  3Q47 B;  4GZC A;  2GGF A;  2CFZ A;  3FWV A;  3SE5 A;  4RVB A;  4W9R A;  4A1S A;  1X5B A;  2GRL A;  3T8M A;  1XNF A;  4MKT A;  4YVO A;  2AXU A;  3ZYQ A;  3PH0 C;  1HH8 A;  4LCT A;  5T8I A;  3ZYM A;  1OWP A;  4J0U A;  3S2A A;  1FCH A;  2BF0 X;  3QNK A;  4DJA A;  2OVF A;  2VY3 A;  3O48 A;  3Q4A B;  4EZJ A;  2C2L A;  2UY1 B;  3ESL A;  4ILG A;  4RSY A;  3UMV A;  5J90 A;  3JQ1 A;  3FUK A;  5FQ7 A;  5KJK A;  2QFC A;  2R17 C;  1UN9 A;  2X38 A;  4UI9 C;  3CHO A;  3CKB A;  3L6A A;  4PUC A;  3TAX A;  3U4T A;  4FA6 A;  3ZYL A;  3QAQ A;  4ILH B;  3FTY A;  4JA9 A;  3RIB A;  2ION A;  4AVX A;  1Z3Y A;  1HS6 A;  1LF8 A;  4I2Z A;  4FJY A;  3SNX A;  2XCC A;  3WXX A;  2WXR A;  3L16 A;  3TL5 A;  4HOR A;  3IEG A;  4JPS A;  3D9L A;  4J8E A;  2XEV A;  1A17 A;  2VGX B;  2CHZ A;  3GZ2 A;  2DCP A;  4KMO A;  3Q49 B;  4JHJ A;  5CCL A;  3MEK A;  3TG5 A;  4BT8 A;  4C0M A;  4OVU A;  5CMY A;  4GCN A;  4HOQ A;  3ZFW A;  2FO7 A;  4XE0 A;  4AJW A;  4BTB A;  3ZLM A;  4A3V A;  1L5J A;  5T3R A;  4LU4 A;  1TJC A;  4IUL A;  3QWV A;  4AP2 A;  2WXM A;  1INZ A;  5LOZ A;  5JJ7 A;  3JQ0 A;  4GZ3 A;  4L7T A;  3ASG A;  4PH4 B;  4CGV A;  3CIA A;  4J6I A;  5J08 A;  3LCA A;  3UUX A;  1UN8 A;  2V8S E;  3FUM A;  5FTP A;  3RRU A;  3APD A;  1E8Y A;  4Q94 A;  3AS5 A;  2G03 A;  3IBE A;  2IU1 A;  2X6J A;  4NAC A;  3VTX A;  4N2S A;  2WQ6 A;  3T5X A;  4WWP A;  4HS2 A;  4I9C A;  5BPP A;  4CRW A;  4CEM A;  2F6S A;  5FT9 A;  3PZD A;  4ANV A;  4JEH A;  4GZ6 A;  4XKC A;  3PRZ A;  3RJV A;  5KJM A;  2WXI A;  4DI4 A;  1E7V A;  3C98 A;  3ASH A;  3OXG A;  4N3B A;  5CHE E;  2MOW A;  5ARG A;  4I1A A;  4K03 A;  1JWG A;  5CGL A;  3NZU A;  4BSX A;  2JEK A;  3ASF A;  3FUH A;  3LVQ E;  3FFL A;  2MHK A;  3PS6 A;  3GYZ A;  3FUL A;  3UT4 A;  1E8X A;  2BUG A;  3LY7 A;  2AWI A;  1H2U A;  3FTW A;  3D9M A;  4JHR A;  2Y4U A;  4EZK A;  2L9B A;  3VTY A;  4R7L A;  4I6G A;  1HU3 A;  3B7U X;  5HI7 A;  5CMT A;  1BPO A;  2VSO E;  3SGH A;  4FAD A;  3QAR A;  4AXH A;  1U3C A;  4UQX A;  3CVN A;  3GW4 A;  2UY1 A;  3B7S A;  2VGY A;  4B0Z A;  4HLE A;  2WXH A;  2WVI A;  2X6I A;  2IFU A;  2C0L A;  2J9Q A;  2XPI A;  4CT0 A;  3U66 A;  4MLP A;  3PUJ A;  2WM9 A;  5HQ8 A;  4DLO A;  3HDX A;  4FHK A;  4GB9 A;  4A55 A;  5G04 C;  1QZ2 A;  3ESK A;  3O4Z A;  3U9W A;  3LY9 A;  1U3D A;  3LJ3 A;  3MV2 B;  1OUV A;  2AXZ A;  2A5U A;  2V5F A;  2VGX A;  4U04 A;  5JFF A;  2CFU A;  4WNG A;  4WWN A;  3L54 A;  3BG1 B;  4A1G A;  3CLJ A;  4N39 A;  3QK0 A;  4CDM A;  4BX8 A;  3ONK A;  4UWG A;  1WAO 1;  2GW1 A;  3AU5 A;  3Q15 A;  1HZ4 A;  4N3A A;  3SFZ A;  5BV1 A;  2WXQ A;  2PQN A;  2IJG X;  3I3N A;  4F7A A;  3IKO B;  3BEE A;  4CDN A;  1WY6 A;  2WPV A;  3DPD A;  3CEQ A;  4C0E A;  3ZRH A;  2VSX E;  4L1B A;  5CMW A;  3D3M A;  2WXL A;  4GAA A;  4B8A A;  5ANR A;  2LAH A;  4UQY A;  1EYH A;  3MCX A;  4KZ0 A;  5D0O D;  4NQ0 A;  5G05 J;  1QNF A;  5BV0 A;  4LER A;  3PNT B;  4CGW A;  5LP0 A;  2LSV A;  5EX3 A;  3RO2 A;  4HXI A;  1OWN A;  3I4R B;  5FQ8 A;  1JWF A;  5FZQ A;  5ANL A;  4E85 A;  3D9J A;  4TV3 A;  1EDU A;  3MKR A;  3D9O A;  2YHC A;  3CKC A;  4PS3 A;  4GU5 A;  3G2W A;  3L22 A;  2Y4T A;  3NQP A;  1NZN A;  4CT4 A;  3S6A A;  4URK A;  4MS6 A;  3CVU A;  2LAI A;  3LEW A;  4H7X A;  3FU6 A;  3SN9 A;  2WXN A;  4PS7 A;  3SZ7 A;  5FZR A;  4XKB A;  4JEU A;  5EDS A;  4GCO A;  3LET A;  4BY6 A;  1ZBP A;  2R5S A;  2VSY A;  2XGS A;  3CVP A;  2AVP A;  2L0T B;  3HHM A;  1KT1 A;  2QY7 A;  4UWL A;  4V3I A;  1HFA A;  3D9P A;  4N67 A;  2CG3 A;  4ACK A;  4FU3 A;  4O6F A;  5ARF A;  1JPL A;  3R7R A;  2XGO A;  2KCK A;  4AY5 A;  4B89 A;  2AW6 A;  4LEU A;  3PEV B;  3B7R L;  2VSN A;  3EJN A;  1KT0 A;  2JLB A;  2IF4 A;  3CHP A;  3AS8 A;  3ZCB A;  3LXU X;  2LSU A;  1P5Q A;  2NXP A;  2VQ2 A;  5AJL A;  2IQC A;  3CV0 A;  3URZ A;  4GZ5 A;  4BFR A;  4KYO B;  4F53 A;  3P2B A;  4F1S A;  1TEZ A;  2P58 C;  1FVF A;  3CK9 A;  3HYM B;  3HVE B;  4J8F A;  3CVL A;  2KM4 A;  2FI7 A;  2NSZ A;  3GZS A;  3LDZ A;  4FP7 A;  3E4B A;  3ZPJ A;  4U07 A;  1NP7 A;  1IQR A;  2XCB A;  1E96 B;  2ZU6 B;  3G2U A;  3MZL B;  3MGB A;  2HR2 A;  4X2E A;  3N3U A;  1E8Z A;  4JW1 A;  5G2N A;  2OVB A;  3ENE A;  3P1U A;  4G26 A;  2KZT B;  4H7Y A;  2PM6 A;  3R7Q A;  4ANX A;  5M72 A;  4QFV A;  4I43 A;  4FC8 A;  2R59 A;  4ANW A;  1B89 A;  2J4D A;  2I1J A;  3MKQ A;  3CSF A;  5D0Q D;  3EIQ C;  4HOT A;  4LUN U;  2Y3A A;  2WXJ A;  3ONL A;  2DIW A;  3QC1 A;  2KCV A;  4L23 A;  4AOF A;  4GYY A;  4M16 A;  2XGM A;  4PS8 A;  4XZ4 A;  2X3M A;  3TG4 A;  3U3W A;  5E76 A;  4KXK B;  1YA0 A;  4WNF A;  3RK6 A;  3S7J A;  4JL0 A;  1NA0 A;  2XPY A;  1IQU A;  1NA3 A;  1Y8M A;  2VYI A;  3MA5 A;  2EQX A;  4UI9 J;  4XI9 A;  1E90 A;  3PEU B;  5C2Y A;  2VTB B;  4NUR A;  4I1M A;  1E7U A;  4NPS A;  1HE8 A;  2WMN A;  1PC2 A;  3FEX A;  3KS2 A;  4G25 A;  4ABN A;  5JHA A;  4AY6 A;  4U63 A;  4EBA G;  4N5C A;  3RKV A;  2UWJ G;  1XGW A;  4HOU A;  4BWR A;  3TXN A;  3CHM A;  5CCM A;  3VLF A;  5LCW C;  3LVR E;  4BTA A;  3RO3 A;  1SZ9 A;  3KEZ A;  2L6J A;  4AV7 A;  5ENN A;  4YND A;  3IHY A;  3SD5 A;  1Y6I A;  2LO6 A;  4Y6C A;  3FU0 A;  3Q5M A;  2PQR A;  3OTN A;  3L13 A;  4WUY A;  4U0S A;  3CR3 A;  3SHG A;  1UJJ A;  3L17 A;  4G11 A;  3PDN A;  5KJL A;  1SQM A;  5EU0 A;  4G1T A;  5AYW D;  5BNW A;  1ELK A;  5FWQ A;  5FJY A;  3SBS A;  1JUQ A;  2I9C A;  3FY4 A;  1SZA A;  3I4G A;  3B13 A;  4FUL A;  3FDH A;  1PAQ A;  4L2L A;  3L08 A;  2MRI A;  3I5P A;  4DK5 A;  2HYZ A;  4ANU A;  4GPK A;  1EPU A;  3AS4 A;  4UWK A;  5BUZ A;  4C9B B;  5KCM A;  1H2T C;  4X2C A;  3APC A;  3ZYK A;  4AIF A;  3EHN A;  3TJP A;  1ELR A;  3ZVV A;  3MJW A;  2J49 A;  4WND A;  2HO1 A;  1KLX A;  2YIN A;  1S0P A;  4DLQ A;  3PRE A;  3HVE A;  3FUE A;  2J09 A;  3RU0 A;  2LNI A;  4FJZ A;  2PZI A;  3VLD A;  3CHQ A;  4DI3 A;  2XRY A;  4GA0 A;  2NC9 A;  4E6H A;  3ZW3 A;  3JCK C;  4EPZ A;  3ULQ A;  3CVX A;  1Z3X A;  3FTU A;  4AEZ C;  4HVB A;  5A7D B;  4J8D A;  3QJZ A;  1UG3 A;  5JJ6 A;  4U8H A;  1W3B A;  4P29 A;  2I2O A;  4G23 A;  4APO A;  4HOS A;  2I1K A;  3CST A;  1Z6T A;  3CHS A;  2L0I A;  4OVV A;  3RRM B;  2IOL A;  2YHE A;  3CGH A;  3MV3 B;  3PVL A;  4L2Y A;  3CVV A;  4U0Z A;  1N52 A;  3IV0 A;  4EEC A;  1HX8 A;  2RG8 A;  2FUL A;  3FTV A;  3FUJ A;  4KVO A;  3CQC B;  3G2S A;  3PUK A;  1HG5 A;  2WXG A;  3GZ1 A;  3SBT B;  2VTB A;  4GA2 A;  4I6E A;  3D9K A;  3N71 A;  4I17 A;  3ASD A;  3KAE A;  5G04 J;  3FUD A;  3K9I A;  3U64 A;  4I1O B;  5G55 A;  4BX9 A;  3QDN A;  3ZIM A;  4I2W A;  5A6C A;  3UQ3 A;  4WAF A;  2IOS A;  2VJ8 A;  3FH8 A;  2WXK A;  4JZY A;  4IRU A;  3FUF A;  4TUU A;  4ME2 A;  3APF A;  3PE4 A;  4B94 A;  2DBA A;  5A23 A;  2WMO A;  5LFA A;  1VDY A;  5AIJ A;  4KVM A;  2ILR A;  3ZEF A;  2RD0 A;  3FTX A;  3ZHE B;  4MRU A;  3S7D A;  4PY3 A;  5BT1 A;  3ZN3 A;  4CDR A;  2PL2 A;  4JC8 A;  4ACL A;  2WQH A;  4GML A;  3FH7 A;  5LX8 A;  5JHB A;  3SI5 A;  4KZC A;  4KBQ A;  4G24 A;  4K0R A;  2PM7 A;  1HG2 A;  4PDX A;  3B7T A;  3MYV A;  3ZC7 A;  4J8S A;  1IYG A;  4Q69 A;  3PNL B;  2X6F A;  1MQS A;  4I6J A;  2CHX A;  4UI9 K;  1UW4 B;  2E2E A;  2M63 A;  4JVS A;  2OOE A;  4GYO A;  4XI8 A;  4F3V A;  2AXV A;  3AU4 A;  1ZU2 A;  3OXF A;  1UJK A;  1H19 A;  4WNE A;  2XPZ A;  3NZS A;  3ML8 A;  5AEN A;  3UX4 A;  1DNP A;  1E8W A;  3ZGQ A;  5CKL A;  4Q96 A;  4RG6 A;  3UPV A;  1H2V C;  3CUC A;  2C0M A;  3D9N A;  3UT7 A;  4EZL A;  5E75 A;  1MHQ A;  4EBA A;  4FHJ A;  2FBN A;  3LYA A;  4U0U A;  4XX5 A;  2J08 A;  2J4B A;  3OAW A;  3ZXS A;  3QWW A;  3QB2 A;  5JJT A;  2XHE A;  1DVP A;  3FEY A;  1WM5 A;  3CK8 A;  2E0I A;  3NF1 A;  4ILI A;  2WXP A;  3TGO A;  3ML9 A;  5FZS A;  1OWO A;  2WQ7 A;  4DPR A;  4TRQ A;  1EF1 C;  2CHW A;  3LPZ A;  5BW8 C;  3RRN B;  4IN3 B;  1QQE A;  3D9I A;  2WB2 A;  2X6K A;  4YVQ C;  4APF A;  2J07 A;  2WXO A;  3QKY A;  3CVY A;  5DIZ A;  3CK7 A;  4JHK A;  4B8C B;  2KCL A;  2X6H A;  1OWM A;  3G2T A;  1OWL A;  3SF4 A;  3FTS A;  4A3T A;  3FU5 A;  3IHV A;  5EKQ D;  3T5V A;  2V0P A;  5G05 C;  3VLE A;  4N2Q A;  3PE3 A;  4FLH A;  3S7F A;  3QWP A;  4M3O A;  4XI0 A;  3S7B A;  1IHG A;  5EX0 A;  1HXI A;  3DBS A;  4WWO A;  3UT8 A;  4D10 C;  4FLB A;  4GZD A;  3HIZ A;  4X2D A;  4JA7 A;  5T4Y A;  3R9A B;  3FP3 A;  3ZHE A;  4GA1 A;  4BT9 A;  4G2V A;  5FQ6 A;  4LRZ A;  1GW6 A;  2VZA A;  4UWF A;  1ELW A;  2BTD A;  3FH5 A;  1FVH A;  3CVW A;  2KAT A;  3FTZ A;  3SHF A;  2KC7 A;  3G2V A;  3KD7 A;  2GRM A;  5KJN A;  2JK8 A;  4JXT A;  4Y6W A;  1H0A A;  4NRH B;  1TJF A;  4XIF A;  2HM8 A;  4IYP A;  3OXL A;  2YNQ A;  3TXM A;  4N3C A;  1H6K A;  4EQF A;  3LKU A;  1HF8 A;  5DBK A;  3CVQ A;  3CQG B;  3BG0 B;  2CG2 A;  4ATG A;  3FUN A;  4WGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...