4U07A

Atp bound to eukaryotic fic domain containing protein
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
326
structure length
323
Chain Sequence
AALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSINSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine monophosphate-protein transferase FICD
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 122
structure length 323
sequence length 326
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u07A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u07A01
3SHGA 5CGLA 4N39A 3GZ2A 4AY5A 3LKUA 1KLXA 4HOTA 1IYGA 5CCLA 2UY1B 3TGOA 4GYOA 1NZNA 2XGOA 3CVNA 4AY6A 4U0UA 3UUXA 2VGYA 4RG6A 2VQ2A 4J8DA 2QFCA 3E4BA 3KD7A 4U0ZA 4X2DA 3UQ3A 3CEQA 3QKYA 4PY3A 4GZ3A 3TAXA 4JA9A 4U04A 4BWRA 3SF4A 1WAO1 5A6CA 2ONDA 2FBNA 5G05C 5AYWD 2NC9A 3QWVA 3TG5A 3NF1A 4HOUA 3S6AA 3ZHEA 4UQZA 2YHCA 2WQHA 1KT1A 1TJCA 4N67A 5HQ8A 4H7XA 4GA2A 5CMTA 4RG9A 3GW4A 4GYWA 4BTAA 5KJLA 1IHGA 2OOEA 3MV2B 3KS2A 5EX0A 2XCCA 2Q7FA 3VTXA 5KJNA 3CVLA 2J9QA 4NRHB 4ABNA 2JLBA 3CKCA 4WNFA 4N3AA 4GYYA 4M16A 1KT0A 3MV3B 2G03A 2L6JA 3FWVA 3O48A 4YVQC 1ZU2A 2V5FA 3ZHEB 3AS8A 5G05J 1W3BA 3UPVA 4UQXA 2XGSA 5G04J 4JL0A 4WNDA 2FEZA 2FO7A 1B89A 3ZFWA 4AIFA 4GCOA 3N71A 3ASFA 5JJ6A 2KCKA 4JHRA 3LCAA 3ZCBA 4CDRA 5BNWA 5D0OD 2UWJG 3K9IA 2KC7A 4Y6CA 5FTPA 4WUYA 3LY7A 5HI7A 4EQFA 3ZC7A 3PE4A 5CKLA 1HXIA 4XIFA 3S7DA 4ME2A 2XGMA 2IFUA 3FFLA 3GYZA 3QWWA 3CUCA 4GA0A 4I2WA 4J0UA 4CGVA 4N2SA 2Y4TA 2VSYA 2E2EA 2HR2A 4N2QA 3MKRA 2F6SA 5JFZA 2FI7A 4I2ZA 4G23A 3S7BA 4N3BA 4I9CA 3ZGQA 3N3UA 2VY3A 4G24A 5DBKA 5LCWJ 5EX3A 4G25A 4N5CA 5G04C 1YA0A 3ULQA 2BUGA 2PQRA 3CVQA 5BT1A 3LYAA 3R9AB 3TG4A 3AS5A 4HOQA 4WNEA 2VSNA 5JJ7A 1ELRA 4GZ6A 1QQEA 4O6FA 5D0QD 3Q15A 5JFFA 3QOUA 4I9EA 3PDNA 2P58C 4BTBA 3QDNA 3RKVA 4WGJA 3ZN3A 5ARFA 3ASHA 3S7FA 3EDTB 4G1TA 3ZPJA 2PL2A 3Q49B 3SN9A 2AVPA 2PZIA 5FT9A 2VGXA 3AS4A 2KCLA 1Y8MA 3ASGA 4GA1A 3CVPA 5EKQD 2R5SA 3URZA 1XNFA 5EU0A 2C0LA 3RIBA 3ESKA 2KCVA 4CGWA 2YQ8A 4U07A 2MHKA 4UI9K 3CV0A 4KYOB 2IF4A 5LCWC 5KJMA 4N3CA 2Y4UA 1A17A 3CKBA 4APOA 1ZBPA 1NA0A 4I17A 5KJKA 3CK8A 3SE5A 2I6HA 5BW8C 4XI9A 3MEKA 4UI9J 3RO2A 3WXXA 5CHEE 4J8EA 4X2EA 4H7YA 2XCBA 4HOSA 2XPIA 4NQ0A 4AM9A 1PC2A 4WNGA 2DBAA 1HH8A 2GW1A 4BT9A 3ZLMA 1P5QA 4ITRA 5ARGA 4KXKB 5A7DB 3RU0A 3HYMB 3GZ1A 1WM5A 2LSUA 1E96B 4GZ5A 3RJVA 4A1SA 2JK8A 3MA5A 3Q4AB 3QWPA 4JA7A 5FJYA 1OUVA 2HYZA 1FCHA 4W9RA 5FZSA 3IEGA 4F3VA 5FZQA 3Q5MA 3PE3A 4YVOA 4XI0A 3BEEA 2PQNA 3LPZA 2C0MA 3VTYA 3LY8A 1NA3A 4U0SA 4GCNA 1QZ2A 5JJTA 4LEUA 4KBQA 4G26A 4B94A 2C2LA 3KAEA 3SZ7A 4HORA 3CK9A 4BT8A 4UI9C 3FP3A 3U4TA 5C1DA 5DIZA 3CK7A 2WPVA 3ASDA 4J8FA 3OXGA 2LSVA 5M72A 2XEVA 3Q47B 2KATA 3LY9A 4I1AA 2VZAA 4YNDA 4XI8A 3OXFA 2UY1A 4NPSA 4Y6WA 2VYIA 3S7JA 2LNIA 1ELWA 4LU4A 3RO3A 4G2VA 2FF4A 3OXLA 3U3WA 5CCMA 4UQYA 3JYSA 5FZRA 3LETA 4GPKA 1HZ4A 4X2CA 2VGXB 4IN3B 2HO1A
chains in the Genus database with same CATH superfamily
4DX1A 5AQ9A 3SHGA 4O1OA 3DSTA 1DNPA 2ZGGA 4FP7A 3ZUVB 1UG3A 2A5EA 2L0TB 2EIJE 4N39A 1VDYA 1TEZA 4U63A 4AY5A 1KLXA 1IYGA 2UY1B 2X6JA 5H7PA 4GYOA 1NZNA 3TGOA 3CVNA 3ESLA 3UUXA 2VSOE 2VGYA 3KD7A 5ENTD 4X2DA 3CHPA 4DRXE 3MJWA 4PY3A 4ILIA 4JZYA 4U8YD 4YDWA 4Q96A 5BV1A 3ZIMA 2XPYA 4BWRA 3NBNB 4KVOA 4HFGA 4RQIA 2ONDA 5G05C 4DX6D 3ULEG 4HLEA 4FADA 5CMWA 3NF1A 4GTQA 4IRUA 3PH0C 2YHCA 4Z68A 3QNKA 1KT1A 4N67A 2ZU6B 2IEJA 3CQCB 4GA2A 4P29A 5CMTA 2WQ7A 4LERA 2I1KA 3S2AA 3SO8A 5KWDA 4DLQA 1TNOA 4JB8P 3JUIA 5CEDB 4TUMA 5ENNA 3EJNA 5KJNA 3G2SA 4NACA 4HRNA 4WNFA 4N3AA 4BSXA 3G2VA 3MV3B 3HHMA 4EBAA 3FWVA 3O48A 4TXPA 4WWPA 2MYOA 1V54E 1HS6A 3E30A 3SBTB 1D9SA 1NL4A 1ZU2A 3V31A 3HDXA 2V5FA 3ZHEB 1E8WA 3AS8A 4U7EB 1W3BA 4HBDA 1AWCB 3UPVA 2NUNA 2LXMA 1GW6A 4F7AA 2FO7A 4WWOA 4HI8A 2FULA 4GCOA 3F6QA 2OEWA 2OVFA 3ASFA 3MCXA 5JJ6A 4K03A 2KCKA 2L0IA 2A5UA 2GRMA 5FQ7A 3DSSA 3ZCBA 4UWHA 4DX5D 2WXQA 3NZSA 4N5QA 4JEHA 3NAWA 5KNHD 2KC7A 3UKRG 3DWLG 4Q69A 1BPOA 2QZAA 4XIFA 4BX9A 1TN7A 4EZLA 3Q7FA 2IFUA 3TJPA 3FFLA 4AEZC 3R7RA 2P9UG 4GA0A 4I2WA 4JEUA 3RRNB 3R7QA 3C3OA 5J08A 1E8ZA 1X5BA 2Y4TA 2WM9A 3UM0A 4C0EA 3CVXA 2CHZA 4UUCA 2WXMA 3S7BA 4N3BA 3N3UA 3PZ3A 2V5QC 4G24A 5EIDA 3APCA 5EN5D 3SGHA 4G25A 5G04C 5BT1A 2OV8A 3LYAA 4HOQA 3ZNGA 1SA5A 1ELRA 2V4LA 1H2UA 1QQEA 3HXBA 3UM2A 1Z6TA 3B7RL 4FHJA 1BI7B 2LO6A 4M3OA 3PUJA 3PDNA 4BTBA 3QDNA 3CHSA 4OVVA 4B8CB 3ASHA 4GTTA 1EDUA 3Q49B 3SN9A 3SHFA 3AS4A 3ZXSA 1U3CA 1H2TC 3NB2A 5A23A 4ILGA 3AG3E 2R5SA 5EU0A 3CHRA 3RIBA 2WXFA 3CSTA 4CGWA 3UMVA 3AJIA 4UI9K 1SZAA 1QNFA 2QYJA 2IY0C 3CKBA 2YHEA 1Z3YA 3L6AA 3O4ZA 3FUFA 4ZFHA 3CK8A 5CEAA 2BTDA 4C48B 3RO2A 3NOCD 2XCBA 4HOSA 4HQDA 3TL5A 3V2OA 2V0PA 4OAUC 4OVUA 2X38A 1S0PA 1O1TA 2R2LA 3KSQA 4TXQA 4V3IA 1IXVA 1OXJA 4KXKB 5A7DB 4CYMD 4LRZA 2XQ0A 3HYMB 3PREA 3DSXA 4E6HA 2OCCE 2HYZA 5HS0A 3ZVVA 1S70B 3CR3A 3T9KA 5FZSA 3FUHA 2J08A 4WWNA 3PE3A 1ELKA 3Q9NC 2PQNA 3C3RA 2C0MA 3J5PA 2X6FA 3UX4A 1TN6A 4U0SA 3TWRA 3ZU7B 4GMRA 5AENA 3FU0A 2P9LG 1O5MA 4LEUA 4KBQA 3TWXA 4CZ2D 5E75A 4RLYA 3FP3A 5ENRD 3ABLE 3U4TA 2WQ6A 4FLHA 4RSYA 4J8FA 2XZDG 2ETAA 1HE8A 5EYPF 4GTMA 2YINA 2XEVA 1JCQA 5EYLA 4LUNU 3E37A 1OT8A 4FA6A 4I1AA 4YNDA 3DSWA 2CG3A 4LU4A 3VLFA 2H6FA 3VLEA 3FU5A 3L17A 4GPKA 1HZ4A 1HO8A 2P9KG 2IU1A 2HO1A 1JPLA 1MZCA 1IQUA 1A5EA 5CRVA 3JXIA 1G3NB 4I6JA 1JWGA 1HFAA 5T3RA 4UWFA 3ISMC 5JA4D 2AXUA 3LKUA 3FUKA 5CCLA 1H6PA 1PAQA 3UXGA 2I9CA 5D66A 4J8DA 2QFCA 3W9FA 4U0ZA 3SFYA 2I1JA 3EIQC 5EDSA 4JC8A 3UQ3A 4PUCA 3CEQA 3QKYA 3Q73A 5T8IA 1E8XA 1TN8A 3ZYQA 2KZTA 4JA9A 3P2BA 2MOWA 5AAOA 3ZYKA 3MGBA 2J4BA 1U3DA 1NI1A 4U95D 3LEWA 5A6CA 2FBNA 4QQIA 3ML8A 3HIZA 2KBXA 2LXLA 4ACKA 4B0ZA 3FH5A 4HOUA 3S6AA 4TV3A 2WQHA 1FVFA 1TJCA 3FTWA 3E32A 2V8SE 3C72A 3V2XA 4DX7D 3FU6A 3LS8A 1JWFA 2ZXWE 2ZIRA 3KS2A 2DYRE 2Y1LE 2XCCA 4LNGA 3VTXA 2XENA 3B7TA 3DXMG 4GYYA 4M16A 4A55A 3BUAA 1Z3XA 2GRQB 4APFA 2G03A 3DEPA 3NQPA 3L82A 5ENPD 5LP0A 2DYSE 3AU5A 4L7TA 1INZA 5ENSD 3L54A 2E0IA 1DC2A 4EZJA 3RAUA 3D9NA 1B89A 3CLJA 4AIFA 3W9GA 4PH4B 2A4ZA 4XE0A 1OWMA 2RFAA 3UT7A 3LCAA 1N54A 4BX8A 5D0OD 2UWJG 3IBEA 5ANRA 2X6IA 5FTPA 4WUYA 5HKPA 3LY7A 3ZYLA 3DPYA 4EQFA 4JVSA 3S7DA 1KZOA 3T5VA 3CUCA 3I4GA 2BKKB 1MX2A 4CGVA 2CFZA 2VSYA 2E2EA 4N2QA 2R02A 3SFXA 3MKRA 1OWLA 2FI7A 3EHMA 4I6GA 1N4SA 2GRNB 2VGEA 4G23A 4I9CA 1WG0A 3NZUA 3QC1A 5LCWJ 4G11A 4N5CA 3FULA 4EBAG 1YA0A 1IHBA 5CERB 5D2MC 3CVQA 1YYHA 3DBSA 5JHBA 3R9AB 3TG4A 4YDOA 4FJYA 3L16A 4O6FA 3HRAA 4L1BA 3Q15A 2VSXE 4F53A 5T4YA 2P58C 4K5BA 4ATZD 3RKVA 3HVEA 4U96D 3FH7A 3EDTB 3ZPJA 3QJZA 1FT2A 2VTBA 5FT9A 2VGXA 3OTNA 4U8VD 2PM7A 2Y3AA 1Y8MA 1TNBA 4K0RA 3ZYMA 4CT0A 4WAFA 3ZKJA 5AQ7A 4GAAA 4G8KA 3EUVA 2YQ8A 1OCCE 4KYOB 2IF4A 4N3CA 2QC9A 1A17A 3L08A 4HVBA 3R9MA 4FULA 4EZKA 1ZBPA 3AG1E 4I17A 5KJKA 2I6HA 2L9BA 4XI9A 3ZW3A 3WXXA 4DLOA 3UIPC 4NIKA 4GB9A 4ITRA 5ARGA 2EILE 2VJ8A 3PZDA 2LSUA 1E96B 4HRLA 2JK8A 3MKQA 3MA5A 3Q4AB 2DZNA 2DZOA 2OVBA 1QBQA 3UIOC 4J7WA 3UKUG 4L23A 2F0YA 4F3VA 5BV0A 4AVXA 3D9JA 3VTYA 1QYMA 3HXFA 3LVQE 1NA3A 3J5QB 4GCNA 4K5AB 2BKGA 4IYPA 1Z5SC 4G26A 2BF0X 3SZ7A 2QY7A 4HORA 3EHRA 5B1BE 2OEVA 3G2WA 1D8EA 1O1RA 3SD5A 3OAWA 4UI9C 1BI8B 3ONLA 4CT4A 2KXPC 1N95A 5LOZA 4CRWA 4GPMA 3OXGA 4CCAA 2XS1A 5CECB 2EINE 3RK6A 3SQVA 2J49A 4PDXA 3AG2E 3TWVA 3FTZA 4I1OB 4UWKA 5LX8A 3OXFA 3P1UA 4Y6WA 2LNIA 1ELWA 5CBOA 4FC8A 3KEAA 4G2VA 3I4RB 2ETCA 3I3NA 4MS6A 5CCMA 1E8YA 2LUHA 5FZRA 3LETA 3L22A 1SVXA 4GTOA 3X2QE 2ZGDA 4DJAA 4X2CA 3SFZA 3AAAC 3FEYA 5G2NA 5EILA 3WG7E 5CGLA 2H6IA 5AN8A 2F8YA 4L9PA 4IULA 4JHKA 3GZ2A 3D9MA 2XPZA 1BD8A 3U66A 4DX2A 2XEHA 2XGOA 4AY6A 2CHWA 1MYOA 3DXKG 2ZISA 4DPRA 3UTMA 2VQ2A 4A63B 4EECA 3UINC 1HG5A 3Q75A 3D9IA 3DSVA 3ZEFA 1K1BA 2J09A 4GZ3A 2WXGA 3EIJA 4B93B 4GTVA 4AV7A 2EQXA 3IXEA 1WAO1 4L2LA 5AYWD 2NC9A 3QWVA 1EF1C 3TG5A 1FVHA 3FUNA 4H7XA 2IONA 4R7LA 1PY1A 4UWLA 3GW4A 4GYWA 1IHGA 2OOEA 3MV2B 5LFAA 2B0OE 3PRZA 3CHMA 2Q7FA 2JEKA 3CVLA 4ATGA 2NSZA 1JCSA 2CHXA 4F1SA 3JUEA 2KZTB 3CKCA 4KT6B 4CDMA 2LAHA 1KT0A 3FEXA 1E90A 1MJ0A 1U2VG 2L6JA 3V79K 4XKBA 2AW6A 4HB5A 3B7SA 3QK0A 1JCRA 4MRUA 4TXRA 4YVQC 3QARA 1UN8A 2GRRB 2IQCA 3T8MA 3JCKC 4UQXA 1N94A 5G04J 3FUEA 2FEZA 3NOGD 4HRMB 4FU3A 3ZFWA 1FPPA 1LTXA 3ABME 3FTVA 1E7VA 3CVVA 2GRLA 4CDRA 2F37A 2F8XK 2PM6A 4Y6CA 5KBAA 3IKOB 4GMLA 3PEUB 3FU3A 5CKLA 2XRYA 1OWNA 5AQBA 1TJFA 4GZDA 3FUJA 1HF8A 4GTSA 4J0UA 1N4PA 2DIWA 4N2SA 2IOLA 2HR2A 2F6SA 5JFZA 5BXUA 1DVPA 4I2ZA 5ANLA 3D9KA 2GGFA 3KEZA 3ZGQA 5DBKA 4RVBA 4JW1A 3BG0B 3DSUA 4BEPA 5ITZF 3ULQA 2BUGA 5CBNA 2PQRA 2X3MA 1LD8A 4WNEA 3AU4A 1K1AA 2VSNA 1H6OA 2Y0BG 3C5RA 3FUMA 4GZ6A 1YMPA 1HU3A 1Q2ZA 3BQOA 3CVUA 2L6BA 4LCTA 1D8DA 4QFVA 2DVWA 4I9EA 3KSLA 4A3VA 4WGJA 3ZN3A 5ARFA 2GRPB 3EU9A 3ENEA 2R17C 2P9NG 3ZRHA 4AJWA 3TWTA 1K3ZD 4BETA 3PZ2A 4ZHBA 5FIOA 4GU5A 3JQ1A 5FWQA 4GA1A 3CVPA 5EKQD 4L2YA 1DCEA 3URZA 1N11A 2C0LA 2KCVA 1H0AA 5BXOA 4U07A 2MHKA 4C0MA 1N9AA 1LF8A 1NP7A 4KMOA 4URKA 4TRQA 3PZ1A 2B6CA 3HVEB 4APOA 1KZPA 3JXJA 5BW8C 5FQ6A 3EHQA 2VTBB 4EPZA 4J8EA 3FTXA 2XPIA 4J8YA 4NQ0A 2WMNA 1PC2A 1X81A 4WNGA 1HH8A 1SZ9A 4BERA 3D9LA 1XGWA 2GW1A 5BUZA 5J90A 3ZLMA 1P5QA 4XEIG 4F1PA 2M63A 3GZ1A 2WXHA 5JHAA 3ULYA 3IHVA 3U64A 1OUVA 1OWOA 4BY6A 3IV0A 3IEGA 2FO1E 5AJDA 3Q5MA 4YVOA 3BEEA 4UWGA 4E85A 1IKND 3JQ0A 3MYVA 3LY8A 2QYUA 3FUDA 5JJTA 3HXDA 3PNTB 2LAIA 3CK9A 4XX5A 1MX4A 3IHYA 3FTSA 1TNYA 2P9PG 3RSEG 2Y69E 3VLDA 3MKQB 2WXKA 2HM8A 2XZTG 3MZLB 5C1DA 3DRAA 4JD2G 4LNBA 4O60A 2J4DA 4O1PA 4AOFA 2LSVA 3TWQA 4DK5A 3E33A 4I6EA 5KCMA 2KATA 2J8SD 3ML9A 3ONKA 4XI8A 1NFIE 2UY1A 2VYIA 2NYJA 4BSZB 1ZB1A 3RO3A 3T8KA 4EHMA 3RRUA 2WXJA 4HI9A 3C3QA 4K5CA 1MHQA 4D10C 3FUIA 1OCOE 4NURA 4XKCA 1YCSB 2GROB 3D3MA 3ASNE 1V55E 2XRZA 3CGHA 1KPSB 3EHNA 3B7BA 4HNAD 3CVWA 1NH1A 4I43A 3PUKA 4HOTA 2RD0A 3SBSA 2H6HA 3FY4A 4U0UA 4RG6A 3E4BA 4ILHB 4OYSA 3CSFA 4PS7A 3CIAA 1RZ4A 2P9IG 1H6KA 2AWIA 3TWUA 4DUIA 3RRMB 3APDA 4GTPA 3TAXA 4CEMA 2AXZA 3BU8A 3GZSA 2J07A 4CDNA 2WXIA 4U04A 4OAVB 3HG0D 3SF4A 1IQRA 1UOHA 2WB2A 4MBGA 3ZHEA 4UQZA 2H6GA 5HQ8A 1S64A 4RG9A 1UW4B 3CHQA 5AARA 4U8HA 4G8LA 4I1MA 4BTAA 5FQ4A 5KJLA 4KVMA 3ZXPA 4ACLA 2PNNA 4ANVA 2AJAA 5EX0A 2P9SG 1EPUA 1DCQA 2J9QA 4NRHB 4ABNA 3U9WA 2JLBA 3DEOA 4PS3A 5E76A 3CHOA 2IOSA 1SQMA 3SNXA 4F6RD 4LSZE 1WY6A 5EIBE 3CQGB 5G05J 3UM3A 2XGSA 1OCZE 4BESA 4JL0A 4WNDA 4PS8A 5FINA 3CVYA 5HRYA 5C2YA 5JMND 3V30A 1HX8A 1MX6A 3N71A 2CG2A 1WDYA 3AG4E 4JHRA 5ENQD 3L13A 3Q9UC 3G2TA 1HG2A 5BNWA 3Q78A 3K9IA 4YDYA 4J8SA 5HI7A 3ZC7A 3PE4A 3EU5A 3FDHA 1N4QA 1HXIA 4ME2A 2XGMA 4X8QA 1UJKA 5BPPA 2XHEA 3GYZA 3QWWA 3B7UX 4FHKA 3TWWA 3TXMA 3UI2A 2RFMA 2WMOA 5AJLA 3LJ3A 3B95A 2MRIA 1TNUA 2VY3A 4DI3A 3C98A 4JPSA 5EX3A 2BEDA 2XS8A 1E7UA 4DI4A 5CRUA 4AXHA 2X6HA 4GMJA 1AP7A 3AS5A 3HXEA 5JJ7A 3G2UA 2P2CP 3QB2A 2IJGX 2WXLA 3PZ4A 2AXVA 5D0QD 1BLXB 5G55A 4GTRA 3Q7AA 5JFFA 3QOUA 3D9PA 3APFA 3ABKE 2EIME 3T5XA 2RKKA 1OCRE 4KZ0A 2CFUA 2DWZA 3S7FA 4G1TA 2PL2A 2AVPA 2PZIA 1N4RA 2KCLA 2RG8A 3BG1B 2ILRA 3ASGA 5KNGA 3TXNA 3PNLB 4MLPA 4FLBA 1XNFA 2NUDA 3UT8A 3ESKA 1S63A 1H2VC 2WVIA 2DCPA 3CV0A 2WXPA 1K8KG 1LD7A 5LCWC 3UT4A 1Y6IA 5KJMA 4TUUA 3LJNA 2Y4UA 2IO3C 2R05A 3PS6A 3DPDA 4GZCA 1NA0A 3I5PA 1TR4A 3QAQA 3SE5A 4FJZA 4J6IA 5ENOD 1O1SA 2I2OA 3MEKA 4UI9J 5CHEE 4X2EA 1OWPA 4H7YA 3HXCA 3FHEA 4AM9A 2DBAA 1UJJA 1SW6A 2X6KA 4MKTA 3LXUX 5IY5E 4BT9A 3B13A 1OY3D 4C9BB 1N0RA 3RU0A 2V4HC 2HE0A 2WXRA 4B8AA 2WXNA 1WM5A 4GZ5A 3RJVA 4A1SA 1FT1A 2XEEA 3SI5A 3QWPA 2EIKE 4JA7A 4LNUD 5FJYA 5AQAA 3FTUA 1TNZA 4AP2A 1FCHA 4W9RA 5FZQA 3PVLA 4LG6A 5AIJA 3D9HA 4XI0A 3LPZA 2WXOA 3D9OA 4YDEA 2JABA 2ETBA 3MX3A 1QZ2A 1SA4A 3E34A 1N52A 4B94A 2C2LA 2IO2C 3KAEA 4A3TA 1L5JA 4JHJA 3UM1A 4ANXA 3SY2A 1N0QA 3PEVB 5CMYA 1JUQA 4BT8A 4BFRA 4B89A 1H19A 4KZCA 5B1AE 1MQSA 2NXPA 5DIZA 3CK7A 2WPVA 3ASDA 5FQ8A 3LDZA 4JXTA 3TWSA 5B3SE 4M7CA 5M72A 4XZ4A 2R03A 4HLLA 3Q47B 3LY9A 3L9TA 4ANUA 2VZAA 2R59A 2YNQA 4HXIA 1UN9A 4ANWA 4A1GA 4NPSA 3S7JA 3FTYA 2FF4A 1TYQG 1RW2A 4Q94A 3OXLA 4HS2A 3U3WA 4UQYA 3JYSA 3ASOE 3LVRE 1BU9A 3FH8A 2VGXB 4IN3B 2KM4A 1EYHA 3Q79A
chains in the Genus database with same CATH topology
2WQ7A 5G2NA 3SHGA 1JPLA 2XRZA 5CGLA 1IQUA 3CGHA 1DNPA 4I6JA 4FP7A 3EHNA 1JWGA 1UG3A 1HFAA 2L0TB 4IULA 4UWFA 5T3RA 4JHKA 4N39A 1VDYA 3GZ2A 3D9MA 1TEZA 3CVWA 4U63A 2XPZA 3U66A 4I43A 3PUKA 2AXUA 4AY5A 3LKUA 3FUKA 1KLXA 4HOTA 1IYGA 5CCLA 2UY1B 2X6JA 3TGOA 4GYOA 1NZNA 2XGOA 2RD0A 3SBSA 3CVNA 3ESLA 3FY4A 4AY6A 4U0UA 2CHWA 1PAQA 3UUXA 2I9CA 2VSOE 2VGYA 4RG6A 4DPRA 2VQ2A 4J8DA 4EECA 2QFCA 3E4BA 3KD7A 4U0ZA 4ILHB 4OYSA 4X2DA 1HG5A 3CSFA 2I1JA 3EIQC 4PS7A 5EDSA 4JC8A 3UQ3A 3CIAA 4PUCA 3CEQA 3QKYA 3CHPA 5T8IA 1H6KA 3D9IA 2AWIA 1E8XA 3ZEFA 3RRMB 3MJWA 4PY3A 4ILIA 3APDA 4GZ3A 2J09A 4JZYA 2WXGA 2KZTA 3ZYQA 3TAXA 4JA9A 3P2BA 3EIJA 4CEMA 2AXZA 2MOWA 3GZSA 2J07A 4Q96A 4CDNA 4AV7A 5BV1A 2WXIA 3ZYKA 2EQXA 3MGBA 2J4BA 4U04A 1U3DA 2XPYA 3ZIMA 4BWRA 3LEWA 3SF4A 1WAO1 1IQRA 4KVOA 4HFGA 4L2LA 5A6CA 2ONDA 2FBNA 5G05C 3ML8A 5AYWD 3HIZA 2NC9A 3QWVA 1EF1C 4ACKA 4HLEA 3TG5A 4B0ZA 4FADA 3NF1A 3FH5A 4HOUA 3S6AA 5CMWA 2WB2A 3ZHEA 1FVHA 4IRUA 3PH0C 4TV3A 4UQZA 2YHCA 3FUNA 3QNKA 2WQHA 1FVFA 1KT1A 1TJCA 3FTWA 4N67A 2ZU6B 5HQ8A 4H7XA 3CQCB 4GA2A 2IONA 4P29A 5CMTA 1UW4B 1PY1A 2V8SE 3CHQA 4RG9A 3GW4A 4R7LA 4GYWA 4I1MA 4U8HA 4UWLA 4BTAA 3FU6A 5FQ4A 4LERA 5KJLA 4KVMA 2I1KA 1JWFA 3LS8A 3S2AA 1IHGA 4ACLA 2OOEA 3MV2B 4DLQA 3KS2A 5LFAA 4ANVA 3JUIA 5EX0A 2XCCA 5ENNA 3PRZA 3CHMA 3EJNA 2Q7FA 3VTXA 5KJNA 2JEKA 1EPUA 3CVLA 2J9QA 3G2SA 4NRHB 4ABNA 2NSZA 2CHXA 3B7TA 3U9WA 2JLBA 4ATGA 4F1SA 4NACA 4PS3A 2KZTB 3CKCA 4KT6B 4WNFA 4N3AA 4BSXA 4GYYA 4M16A 4CDMA 2LAHA 1KT0A 4A55A 1Z3XA 3G2VA 3FEXA 5E76A 1E90A 3MV3B 3CHOA 2IOSA 3HHMA 4APFA 2G03A 2L6JA 3FWVA 3O48A 1SQMA 4WWPA 4EBAA 1HS6A 3NQPA 4XKBA 2AW6A 3SNXA 3B7SA 3QK0A 4MRUA 5LP0A 1WY6A 4YVQC 3SBTB 3AU5A 3QARA 1UN8A 4L7TA 1ZU2A 1INZA 3L54A 2E0IA 3HDXA 2V5FA 3CQGB 3ZHEB 1E8WA 3AS8A 5G05J 1W3BA 2IQCA 3UPVA 3T8MA 3JCKC 1GW6A 4UQXA 2XGSA 5G04J 4JL0A 4WNDA 4PS8A 4F7AA 4EZJA 3FUEA 2FEZA 3CVYA 2FO7A 3D9NA 4WWOA 1B89A 2FULA 3CLJA 4FU3A 3ZFWA 5C2YA 4AIFA 4GCOA 1HX8A 2OVFA 2CG2A 3ASFA 3N71A 4PH4B 3MCXA 5JJ6A 2A4ZA 2KCKA 2L0IA 4K03A 4XE0A 3FTVA 1OWMA 2A5UA 1E7VA 2GRMA 4JHRA 5FQ7A 3LCAA 3UT7A 1N54A 3CVVA 3L13A 3ZCBA 2GRLA 4UWHA 4BX8A 2WXQA 3G2TA 3NZSA 4CDRA 1HG2A 5BNWA 5D0OD 2PM6A 2UWJG 4JEHA 3K9IA 2KC7A 3IBEA 5ANRA 2X6IA 4Y6CA 5FTPA 4WUYA 4Q69A 3IKOB 3LY7A 3ZYLA 4GMLA 1BPOA 3PEUB 4J8SA 5HI7A 3FU3A 4EQFA 3ZC7A 3PE4A 5CKLA 2XRYA 1OWNA 3FDHA 4JVSA 1HXIA 4XIFA 4BX9A 3S7DA 4ME2A 2XGMA 4EZLA 1UJKA 3TJPA 1TJFA 2IFUA 3FFLA 2XHEA 5BPPA 3GYZA 3T5VA 4AEZC 3R7RA 4GZDA 3QWWA 3CUCA 3I4GA 3B7UX 4GA0A 3FUJA 4I2WA 4FHKA 4JEUA 3RRNB 3R7QA 1HF8A 3TXMA 4J0UA 1E8ZA 4CGVA 5J08A 1X5BA 2DIWA 4N2SA 2IOLA 2CFZA 2WM9A 2VSYA 2Y4TA 2E2EA 2HR2A 4N2QA 3MKRA 2F6SA 2WMOA 5JFZA 1OWLA 5AJLA 2FI7A 3EHMA 3LJ3A 4I6GA 4C0EA 2MRIA 3CVXA 1DVPA 4I2ZA 5ANLA 4G23A 3D9KA 2CHZA 2GGFA 2WXMA 3S7BA 3KEZA 4N3BA 4I9CA 3ZGQA 3N3UA 3NZUA 2VY3A 3QC1A 4G24A 5DBKA 4DI3A 3C98A 4RVBA 5LCWJ 4JPSA 3APCA 4G11A 4JW1A 3SGHA 5EX3A 3BG0B 4G25A 4N5CA 3FULA 1E7UA 4EBAG 5G04C 1YA0A 3ULQA 2BUGA 2PQRA 3CVQA 2X3MA 4DI4A 3DBSA 5BT1A 2OV8A 3LYAA 5JHBA 3R9AB 2X6HA 4GMJA 3TG4A 4AXHA 3AS5A 4HOQA 4WNEA 3AU4A 2VSNA 5JJ7A 3G2UA 1ELRA 2V4LA 3QB2A 3FUMA 4GZ6A 2IJGX 1H2UA 2WXLA 4FJYA 1QQEA 1HU3A 3L16A 4O6FA 4L1BA 3CVUA 2AXVA 1Z6TA 5D0QD 3B7RL 3Q15A 4FHJA 4LCTA 5G55A 2VSXE 4F53A 5JFFA 5T4YA 2LO6A 3QOUA 4M3OA 4QFVA 3PUJA 4I9EA 3PDNA 2P58C 3D9PA 4BTBA 3QDNA 4A3VA 3CHSA 3RKVA 3APFA 4WGJA 3HVEA 4OVVA 3FH7A 3T5XA 3ZN3A 5ARFA 4B8CB 3ASHA 4KZ0A 3ENEA 2CFUA 1EDUA 3S7FA 3EDTB 4G1TA 3ZPJA 2PL2A 3Q49B 3SN9A 2R17C 3QJZA 3ZRHA 2AVPA 2PZIA 2VTBA 5FT9A 3SHFA 2VGXA 4AJWA 3AS4A 3OTNA 2PM7A 2Y3AA 2KCLA 1Y8MA 2RG8A 3BG1B 4K0RA 2ILRA 3ZXSA 4GU5A 3JQ1A 1U3CA 3ASGA 3ZYMA 1H2TC 5FWQA 3TXNA 4CT0A 4GA1A 4WAFA 3CVPA 3PNLB 4MLPA 5EKQD 5A23A 4ILGA 4FLBA 4L2YA 4GAAA 2R5SA 3URZA 1XNFA 5EU0A 3UT8A 2C0LA 3CHRA 3RIBA 3ESKA 2WXFA 2KCVA 3CSTA 4CGWA 1H2VC 3UMVA 2YQ8A 1H0AA 2DCPA 2WVIA 4U07A 2MHKA 4C0MA 4UI9K 3CV0A 4KYOB 2WXPA 1SZAA 1LF8A 2IF4A 1QNFA 5LCWC 1NP7A 3UT4A 1Y6IA 4N3CA 4TUUA 5KJMA 4KMOA 2Y4UA 1A17A 3L08A 4URKA 3CKBA 4TRQA 2YHEA 4HVBA 3PS6A 1Z3YA 3L6AA 3O4ZA 3HVEB 4FULA 3FUFA 4APOA 3DPDA 1ZBPA 4EZKA 4GZCA 1NA0A 3I5PA 4I17A 5KJKA 3CK8A 3QAQA 3SE5A 2I6HA 5BW8C 2L9BA 5FQ6A 4FJZA 2BTDA 2VTBB 4J6IA 2I2OA 4XI9A 3MEKA 4UI9J 4EPZA 3RO2A 3ZW3A 3WXXA 5CHEE 4J8EA 4DLOA 4X2EA 1OWPA 3FTXA 4H7YA 2XCBA 4HOSA 2XPIA 3FHEA 4NQ0A 3TL5A 4AM9A 2WMNA 1PC2A 2V0PA 4OVUA 2DBAA 2X38A 1HH8A 1SZ9A 4WNGA 1S0PA 1UJJA 4GB9A 2X6KA 3D9LA 4MKTA 1XGWA 2GW1A 3LXUX 5BUZA 4V3IA 5J90A 4BT9A 3ZLMA 1P5QA 3B13A 4ITRA 5ARGA 4KXKB 4C9BB 2M63A 5A7DB 4LRZA 3RU0A 2VJ8A 2XQ0A 3HYMB 2WXRA 3PZDA 4B8AA 2WXNA 3GZ1A 1WM5A 2LSUA 1E96B 4GZ5A 3RJVA 3PREA 4A1SA 2JK8A 2WXHA 5JHAA 3SI5A 3MKQA 3MA5A 3Q4AB 4E6HA 3IHVA 3QWPA 4JA7A 5FJYA 3U64A 2OVBA 1OUVA 1OWOA 2HYZA 3FTUA 3ZVVA 4BY6A 3CR3A 4AP2A 1FCHA 4W9RA 5FZSA 3IV0A 3FUHA 4L23A 3IEGA 4F3VA 2J08A 5FZQA 3PVLA 5AJDA 3Q5MA 5BV0A 4WWNA 3PE3A 5AIJA 4YVOA 4AVXA 1ELKA 3D9JA 4XI0A 3BEEA 2PQNA 3LPZA 4UWGA 4E85A 2C0MA 3VTYA 2X6FA 3UX4A 3JQ0A 3MYVA 2WXOA 3LY8A 3D9OA 3LVQE 1NA3A 4U0SA 4GCNA 5AENA 3MX3A 3FU0A 3FUDA 4IYPA 1QZ2A 5JJTA 4LEUA 1N52A 4KBQA 4G26A 2BF0X 4B94A 2C2LA 4A3TA 3KAEA 1L5JA 3SZ7A 3PNTB 4JHJA 2LAIA 2QY7A 4HORA 3CK9A 4ANXA 4XX5A 3G2WA 3PEVB 5E75A 3IHYA 3FTSA 5CMYA 1JUQA 3VLDA 3SD5A 3MKQB 4BT8A 4BFRA 3OAWA 4B89A 1H19A 4KZCA 4UI9C 2WXKA 3FP3A 2HM8A 3ONLA 4CT4A 1MQSA 2NXPA 3MZLB 3U4TA 5C1DA 5DIZA 2WQ6A 3CK7A 4FLHA 2WPVA 3ASDA 4RSYA 5FQ8A 5LOZA 4J8FA 4CRWA 3LDZA 3OXGA 4CCAA 4JXTA 2J4DA 4AOFA 2LSVA 1HE8A 3RK6A 2J49A 2YINA 4PDXA 2XEVA 5M72A 4DK5A 4XZ4A 4I6EA 4LUNU 5KCMA 3Q47B 3FTZA 2KATA 3LY9A 4I1OB 3ML9A 4I1AA 4UWKA 4ANUA 4FA6A 5LX8A 2VZAA 2R59A 4YNDA 2YNQA 3ONKA 4XI8A 4HXIA 1UN9A 3OXFA 2CG3A 2UY1A 4ANWA 3P1UA 4A1GA 4NPSA 4Y6WA 2VYIA 3S7JA 2LNIA 1ELWA 4FC8A 4LU4A 3RO3A 4G2VA 3I4RB 3FTYA 2FF4A 4Q94A 3OXLA 2WXJA 4HS2A 3RRUA 3I3NA 3U3WA 4MS6A 3VLFA 5CCMA 4UQYA 1E8YA 3JYSA 1MHQA 5FZRA 3FUIA 4D10C 3LETA 3L22A 3VLEA 3LVRE 4NURA 4XKCA 3FU5A 3L17A 4GPKA 1HZ4A 1HO8A 4DJAA 3FH8A 4X2CA 2VGXB 4IN3B 3SFZA 2KM4A 1EYHA 3D3MA 2IU1A 3FEYA 2HO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHG A;  5CGL A;  4N39 A;  3GZ2 A;  4AY5 A;  3LKU A;  1KLX A;  4HOT A;  1IYG A;  5CCL A;  2UY1 B;  3TGO A;  4GYO A;  1NZN A;  2XGO A;  3CVN A;  4AY6 A;  4U0U A;  3UUX A;  2VGY A;  4RG6 A;  2VQ2 A;  4J8D A;  2QFC A;  3E4B A;  3KD7 A;  4U0Z A;  4X2D A;  3UQ3 A;  3CEQ A;  3QKY A;  4PY3 A;  4GZ3 A;  3TAX A;  4JA9 A;  4U04 A;  4BWR A;  3SF4 A;  1WAO 1;  5A6C A;  2OND A;  2FBN A;  5G05 C;  5AYW D;  2NC9 A;  3QWV A;  3TG5 A;  3NF1 A;  4HOU A;  3S6A A;  3ZHE A;  4UQZ A;  2YHC A;  2WQH A;  1KT1 A;  1TJC A;  4N67 A;  5HQ8 A;  4H7X A;  4GA2 A;  5CMT A;  4RG9 A;  3GW4 A;  4GYW A;  4BTA A;  5KJL A;  1IHG A;  2OOE A;  3MV2 B;  3KS2 A;  5EX0 A;  2XCC A;  2Q7F A;  3VTX A;  5KJN A;  3CVL A;  2J9Q A;  4NRH B;  4ABN A;  2JLB A;  3CKC A;  4WNF A;  4N3A A;  4GYY A;  4M16 A;  1KT0 A;  3MV3 B;  2G03 A;  2L6J A;  3FWV A;  3O48 A;  4YVQ C;  1ZU2 A;  2V5F A;  3ZHE B;  3AS8 A;  5G05 J;  1W3B A;  3UPV A;  4UQX A;  2XGS A;  5G04 J;  4JL0 A;  4WND A;  2FEZ A;  2FO7 A;  1B89 A;  3ZFW A;  4AIF A;  4GCO A;  3N71 A;  3ASF A;  5JJ6 A;  2KCK A;  4JHR A;  3LCA A;  3ZCB A;  4CDR A;  5BNW A;  5D0O D;  2UWJ G;  3K9I A;  2KC7 A;  4Y6C A;  5FTP A;  4WUY A;  3LY7 A;  5HI7 A;  4EQF A;  3ZC7 A;  3PE4 A;  5CKL A;  1HXI A;  4XIF A;  3S7D A;  4ME2 A;  2XGM A;  2IFU A;  3FFL A;  3GYZ A;  3QWW A;  3CUC A;  4GA0 A;  4I2W A;  4J0U A;  4CGV A;  4N2S A;  2Y4T A;  2VSY A;  2E2E A;  2HR2 A;  4N2Q A;  3MKR A;  2F6S A;  5JFZ A;  2FI7 A;  4I2Z A;  4G23 A;  3S7B A;  4N3B A;  4I9C A;  3ZGQ A;  3N3U A;  2VY3 A;  4G24 A;  5DBK A;  5LCW J;  5EX3 A;  4G25 A;  4N5C A;  5G04 C;  1YA0 A;  3ULQ A;  2BUG A;  2PQR A;  3CVQ A;  5BT1 A;  3LYA A;  3R9A B;  3TG4 A;  3AS5 A;  4HOQ A;  4WNE A;  2VSN A;  5JJ7 A;  1ELR A;  4GZ6 A;  1QQE A;  4O6F A;  5D0Q D;  3Q15 A;  5JFF A;  3QOU A;  4I9E A;  3PDN A;  2P58 C;  4BTB A;  3QDN A;  3RKV A;  4WGJ A;  3ZN3 A;  5ARF A;  3ASH A;  3S7F A;  3EDT B;  4G1T A;  3ZPJ A;  2PL2 A;  3Q49 B;  3SN9 A;  2AVP A;  2PZI A;  5FT9 A;  2VGX A;  3AS4 A;  2KCL A;  1Y8M A;  3ASG A;  4GA1 A;  3CVP A;  5EKQ D;  2R5S A;  3URZ A;  1XNF A;  5EU0 A;  2C0L A;  3RIB A;  3ESK A;  2KCV A;  4CGW A;  2YQ8 A;  4U07 A;  2MHK A;  4UI9 K;  3CV0 A;  4KYO B;  2IF4 A;  5LCW C;  5KJM A;  4N3C A;  2Y4U A;  1A17 A;  3CKB A;  4APO A;  1ZBP A;  1NA0 A;  4I17 A;  5KJK A;  3CK8 A;  3SE5 A;  2I6H A;  5BW8 C;  4XI9 A;  3MEK A;  4UI9 J;  3RO2 A;  3WXX A;  5CHE E;  4J8E A;  4X2E A;  4H7Y A;  2XCB A;  4HOS A;  2XPI A;  4NQ0 A;  4AM9 A;  1PC2 A;  4WNG A;  2DBA A;  1HH8 A;  2GW1 A;  4BT9 A;  3ZLM A;  1P5Q A;  4ITR A;  5ARG A;  4KXK B;  5A7D B;  3RU0 A;  3HYM B;  3GZ1 A;  1WM5 A;  2LSU A;  1E96 B;  4GZ5 A;  3RJV A;  4A1S A;  2JK8 A;  3MA5 A;  3Q4A B;  3QWP A;  4JA7 A;  5FJY A;  1OUV A;  2HYZ A;  1FCH A;  4W9R A;  5FZS A;  3IEG A;  4F3V A;  5FZQ A;  3Q5M A;  3PE3 A;  4YVO A;  4XI0 A;  3BEE A;  2PQN A;  3LPZ A;  2C0M A;  3VTY A;  3LY8 A;  1NA3 A;  4U0S A;  4GCN A;  1QZ2 A;  5JJT A;  4LEU A;  4KBQ A;  4G26 A;  4B94 A;  2C2L A;  3KAE A;  3SZ7 A;  4HOR A;  3CK9 A;  4BT8 A;  4UI9 C;  3FP3 A;  3U4T A;  5C1D A;  5DIZ A;  3CK7 A;  2WPV A;  3ASD A;  4J8F A;  3OXG A;  2LSV A;  5M72 A;  2XEV A;  3Q47 B;  2KAT A;  3LY9 A;  4I1A A;  2VZA A;  4YND A;  4XI8 A;  3OXF A;  2UY1 A;  4NPS A;  4Y6W A;  2VYI A;  3S7J A;  2LNI A;  1ELW A;  4LU4 A;  3RO3 A;  4G2V A;  2FF4 A;  3OXL A;  3U3W A;  5CCM A;  4UQY A;  3JYS A;  5FZR A;  3LET A;  4GPK A;  1HZ4 A;  4X2C A;  2VGX B;  4IN3 B;  2HO1 A; 
#chains in the Genus database with same CATH topology
 4DX1 A;  5AQ9 A;  3SHG A;  4O1O A;  3DST A;  1DNP A;  2ZGG A;  4FP7 A;  3ZUV B;  1UG3 A;  2A5E A;  2L0T B;  2EIJ E;  4N39 A;  1VDY A;  1TEZ A;  4U63 A;  4AY5 A;  1KLX A;  1IYG A;  2UY1 B;  2X6J A;  5H7P A;  4GYO A;  1NZN A;  3TGO A;  3CVN A;  3ESL A;  3UUX A;  2VSO E;  2VGY A;  3KD7 A;  5ENT D;  4X2D A;  3CHP A;  4DRX E;  3MJW A;  4PY3 A;  4ILI A;  4JZY A;  4U8Y D;  4YDW A;  4Q96 A;  5BV1 A;  3ZIM A;  2XPY A;  4BWR A;  3NBN B;  4KVO A;  4HFG A;  4RQI A;  2OND A;  5G05 C;  4DX6 D;  3ULE G;  4HLE A;  4FAD A;  5CMW A;  3NF1 A;  4GTQ A;  4IRU A;  3PH0 C;  2YHC A;  4Z68 A;  3QNK A;  1KT1 A;  4N67 A;  2ZU6 B;  2IEJ A;  3CQC B;  4GA2 A;  4P29 A;  5CMT A;  2WQ7 A;  4LER A;  2I1K A;  3S2A A;  3SO8 A;  5KWD A;  4DLQ A;  1TNO A;  4JB8 P;  3JUI A;  5CED B;  4TUM A;  5ENN A;  3EJN A;  5KJN A;  3G2S A;  4NAC A;  4HRN A;  4WNF A;  4N3A A;  4BSX A;  3G2V A;  3MV3 B;  3HHM A;  4EBA A;  3FWV A;  3O48 A;  4TXP A;  4WWP A;  2MYO A;  1V54 E;  1HS6 A;  3E30 A;  3SBT B;  1D9S A;  1NL4 A;  1ZU2 A;  3V31 A;  3HDX A;  2V5F A;  3ZHE B;  1E8W A;  3AS8 A;  4U7E B;  1W3B A;  4HBD A;  1AWC B;  3UPV A;  2NUN A;  2LXM A;  1GW6 A;  4F7A A;  2FO7 A;  4WWO A;  4HI8 A;  2FUL A;  4GCO A;  3F6Q A;  2OEW A;  2OVF A;  3ASF A;  3MCX A;  5JJ6 A;  4K03 A;  2KCK A;  2L0I A;  2A5U A;  2GRM A;  5FQ7 A;  3DSS A;  3ZCB A;  4UWH A;  4DX5 D;  2WXQ A;  3NZS A;  4N5Q A;  4JEH A;  3NAW A;  5KNH D;  2KC7 A;  3UKR G;  3DWL G;  4Q69 A;  1BPO A;  2QZA A;  4XIF A;  4BX9 A;  1TN7 A;  4EZL A;  3Q7F A;  2IFU A;  3TJP A;  3FFL A;  4AEZ C;  3R7R A;  2P9U G;  4GA0 A;  4I2W A;  4JEU A;  3RRN B;  3R7Q A;  3C3O A;  5J08 A;  1E8Z A;  1X5B A;  2Y4T A;  2WM9 A;  3UM0 A;  4C0E A;  3CVX A;  2CHZ A;  4UUC A;  2WXM A;  3S7B A;  4N3B A;  3N3U A;  3PZ3 A;  2V5Q C;  4G24 A;  5EID A;  3APC A;  5EN5 D;  3SGH A;  4G25 A;  5G04 C;  5BT1 A;  2OV8 A;  3LYA A;  4HOQ A;  3ZNG A;  1SA5 A;  1ELR A;  2V4L A;  1H2U A;  1QQE A;  3HXB A;  3UM2 A;  1Z6T A;  3B7R L;  4FHJ A;  1BI7 B;  2LO6 A;  4M3O A;  3PUJ A;  3PDN A;  4BTB A;  3QDN A;  3CHS A;  4OVV A;  4B8C B;  3ASH A;  4GTT A;  1EDU A;  3Q49 B;  3SN9 A;  3SHF A;  3AS4 A;  3ZXS A;  1U3C A;  1H2T C;  3NB2 A;  5A23 A;  4ILG A;  3AG3 E;  2R5S A;  5EU0 A;  3CHR A;  3RIB A;  2WXF A;  3CST A;  4CGW A;  3UMV A;  3AJI A;  4UI9 K;  1SZA A;  1QNF A;  2QYJ A;  2IY0 C;  3CKB A;  2YHE A;  1Z3Y A;  3L6A A;  3O4Z A;  3FUF A;  4ZFH A;  3CK8 A;  5CEA A;  2BTD A;  4C48 B;  3RO2 A;  3NOC D;  2XCB A;  4HOS A;  4HQD A;  3TL5 A;  3V2O A;  2V0P A;  4OAU C;  4OVU A;  2X38 A;  1S0P A;  1O1T A;  2R2L A;  3KSQ A;  4TXQ A;  4V3I A;  1IXV A;  1OXJ A;  4KXK B;  5A7D B;  4CYM D;  4LRZ A;  2XQ0 A;  3HYM B;  3PRE A;  3DSX A;  4E6H A;  2OCC E;  2HYZ A;  5HS0 A;  3ZVV A;  1S70 B;  3CR3 A;  3T9K A;  5FZS A;  3FUH A;  2J08 A;  4WWN A;  3PE3 A;  1ELK A;  3Q9N C;  2PQN A;  3C3R A;  2C0M A;  3J5P A;  2X6F A;  3UX4 A;  1TN6 A;  4U0S A;  3TWR A;  3ZU7 B;  4GMR A;  5AEN A;  3FU0 A;  2P9L G;  1O5M A;  4LEU A;  4KBQ A;  3TWX A;  4CZ2 D;  5E75 A;  4RLY A;  3FP3 A;  5ENR D;  3ABL E;  3U4T A;  2WQ6 A;  4FLH A;  4RSY A;  4J8F A;  2XZD G;  2ETA A;  1HE8 A;  5EYP F;  4GTM A;  2YIN A;  2XEV A;  1JCQ A;  5EYL A;  4LUN U;  3E37 A;  1OT8 A;  4FA6 A;  4I1A A;  4YND A;  3DSW A;  2CG3 A;  4LU4 A;  3VLF A;  2H6F A;  3VLE A;  3FU5 A;  3L17 A;  4GPK A;  1HZ4 A;  1HO8 A;  2P9K G;  2IU1 A;  2HO1 A;  1JPL A;  1MZC A;  1IQU A;  1A5E A;  5CRV A;  3JXI A;  1G3N B;  4I6J A;  1JWG A;  1HFA A;  5T3R A;  4UWF A;  3ISM C;  5JA4 D;  2AXU A;  3LKU A;  3FUK A;  5CCL A;  1H6P A;  1PAQ A;  3UXG A;  2I9C A;  5D66 A;  4J8D A;  2QFC A;  3W9F A;  4U0Z A;  3SFY A;  2I1J A;  3EIQ C;  5EDS A;  4JC8 A;  3UQ3 A;  4PUC A;  3CEQ A;  3QKY A;  3Q73 A;  5T8I A;  1E8X A;  1TN8 A;  3ZYQ A;  2KZT A;  4JA9 A;  3P2B A;  2MOW A;  5AAO A;  3ZYK A;  3MGB A;  2J4B A;  1U3D A;  1NI1 A;  4U95 D;  3LEW A;  5A6C A;  2FBN A;  4QQI A;  3ML8 A;  3HIZ A;  2KBX A;  2LXL A;  4ACK A;  4B0Z A;  3FH5 A;  4HOU A;  3S6A A;  4TV3 A;  2WQH A;  1FVF A;  1TJC A;  3FTW A;  3E32 A;  2V8S E;  3C72 A;  3V2X A;  4DX7 D;  3FU6 A;  3LS8 A;  1JWF A;  2ZXW E;  2ZIR A;  3KS2 A;  2DYR E;  2Y1L E;  2XCC A;  4LNG A;  3VTX A;  2XEN A;  3B7T A;  3DXM G;  4GYY A;  4M16 A;  4A55 A;  3BUA A;  1Z3X A;  2GRQ B;  4APF A;  2G03 A;  3DEP A;  3NQP A;  3L82 A;  5ENP D;  5LP0 A;  2DYS E;  3AU5 A;  4L7T A;  1INZ A;  5ENS D;  3L54 A;  2E0I A;  1DC2 A;  4EZJ A;  3RAU A;  3D9N A;  1B89 A;  3CLJ A;  4AIF A;  3W9G A;  4PH4 B;  2A4Z A;  4XE0 A;  1OWM A;  2RFA A;  3UT7 A;  3LCA A;  1N54 A;  4BX8 A;  5D0O D;  2UWJ G;  3IBE A;  5ANR A;  2X6I A;  5FTP A;  4WUY A;  5HKP A;  3LY7 A;  3ZYL A;  3DPY A;  4EQF A;  4JVS A;  3S7D A;  1KZO A;  3T5V A;  3CUC A;  3I4G A;  2BKK B;  1MX2 A;  4CGV A;  2CFZ A;  2VSY A;  2E2E A;  4N2Q A;  2R02 A;  3SFX A;  3MKR A;  1OWL A;  2FI7 A;  3EHM A;  4I6G A;  1N4S A;  2GRN B;  2VGE A;  4G23 A;  4I9C A;  1WG0 A;  3NZU A;  3QC1 A;  5LCW J;  4G11 A;  4N5C A;  3FUL A;  4EBA G;  1YA0 A;  1IHB A;  5CER B;  5D2M C;  3CVQ A;  1YYH A;  3DBS A;  5JHB A;  3R9A B;  3TG4 A;  4YDO A;  4FJY A;  3L16 A;  4O6F A;  3HRA A;  4L1B A;  3Q15 A;  2VSX E;  4F53 A;  5T4Y A;  2P58 C;  4K5B A;  4ATZ D;  3RKV A;  3HVE A;  4U96 D;  3FH7 A;  3EDT B;  3ZPJ A;  3QJZ A;  1FT2 A;  2VTB A;  5FT9 A;  2VGX A;  3OTN A;  4U8V D;  2PM7 A;  2Y3A A;  1Y8M A;  1TNB A;  4K0R A;  3ZYM A;  4CT0 A;  4WAF A;  3ZKJ A;  5AQ7 A;  4GAA A;  4G8K A;  3EUV A;  2YQ8 A;  1OCC E;  4KYO B;  2IF4 A;  4N3C A;  2QC9 A;  1A17 A;  3L08 A;  4HVB A;  3R9M A;  4FUL A;  4EZK A;  1ZBP A;  3AG1 E;  4I17 A;  5KJK A;  2I6H A;  2L9B A;  4XI9 A;  3ZW3 A;  3WXX A;  4DLO A;  3UIP C;  4NIK A;  4GB9 A;  4ITR A;  5ARG A;  2EIL E;  2VJ8 A;  3PZD A;  2LSU A;  1E96 B;  4HRL A;  2JK8 A;  3MKQ A;  3MA5 A;  3Q4A B;  2DZN A;  2DZO A;  2OVB A;  1QBQ A;  3UIO C;  4J7W A;  3UKU G;  4L23 A;  2F0Y A;  4F3V A;  5BV0 A;  4AVX A;  3D9J A;  3VTY A;  1QYM A;  3HXF A;  3LVQ E;  1NA3 A;  3J5Q B;  4GCN A;  4K5A B;  2BKG A;  4IYP A;  1Z5S C;  4G26 A;  2BF0 X;  3SZ7 A;  2QY7 A;  4HOR A;  3EHR A;  5B1B E;  2OEV A;  3G2W A;  1D8E A;  1O1R A;  3SD5 A;  3OAW A;  4UI9 C;  1BI8 B;  3ONL A;  4CT4 A;  2KXP C;  1N95 A;  5LOZ A;  4CRW A;  4GPM A;  3OXG A;  4CCA A;  2XS1 A;  5CEC B;  2EIN E;  3RK6 A;  3SQV A;  2J49 A;  4PDX A;  3AG2 E;  3TWV A;  3FTZ A;  4I1O B;  4UWK A;  5LX8 A;  3OXF A;  3P1U A;  4Y6W A;  2LNI A;  1ELW A;  5CBO A;  4FC8 A;  3KEA A;  4G2V A;  3I4R B;  2ETC A;  3I3N A;  4MS6 A;  5CCM A;  1E8Y A;  2LUH A;  5FZR A;  3LET A;  3L22 A;  1SVX A;  4GTO A;  3X2Q E;  2ZGD A;  4DJA A;  4X2C A;  3SFZ A;  3AAA C;  3FEY A;  5G2N A;  5EIL A;  3WG7 E;  5CGL A;  2H6I A;  5AN8 A;  2F8Y A;  4L9P A;  4IUL A;  4JHK A;  3GZ2 A;  3D9M A;  2XPZ A;  1BD8 A;  3U66 A;  4DX2 A;  2XEH A;  2XGO A;  4AY6 A;  2CHW A;  1MYO A;  3DXK G;  2ZIS A;  4DPR A;  3UTM A;  2VQ2 A;  4A63 B;  4EEC A;  3UIN C;  1HG5 A;  3Q75 A;  3D9I A;  3DSV A;  3ZEF A;  1K1B A;  2J09 A;  4GZ3 A;  2WXG A;  3EIJ A;  4B93 B;  4GTV A;  4AV7 A;  2EQX A;  3IXE A;  1WAO 1;  4L2L A;  5AYW D;  2NC9 A;  3QWV A;  1EF1 C;  3TG5 A;  1FVH A;  3FUN A;  4H7X A;  2ION A;  4R7L A;  1PY1 A;  4UWL A;  3GW4 A;  4GYW A;  1IHG A;  2OOE A;  3MV2 B;  5LFA A;  2B0O E;  3PRZ A;  3CHM A;  2Q7F A;  2JEK A;  3CVL A;  4ATG A;  2NSZ A;  1JCS A;  2CHX A;  4F1S A;  3JUE A;  2KZT B;  3CKC A;  4KT6 B;  4CDM A;  2LAH A;  1KT0 A;  3FEX A;  1E90 A;  1MJ0 A;  1U2V G;  2L6J A;  3V79 K;  4XKB A;  2AW6 A;  4HB5 A;  3B7S A;  3QK0 A;  1JCR A;  4MRU A;  4TXR A;  4YVQ C;  3QAR A;  1UN8 A;  2GRR B;  2IQC A;  3T8M A;  3JCK C;  4UQX A;  1N94 A;  5G04 J;  3FUE A;  2FEZ A;  3NOG D;  4HRM B;  4FU3 A;  3ZFW A;  1FPP A;  1LTX A;  3ABM E;  3FTV A;  1E7V A;  3CVV A;  2GRL A;  4CDR A;  2F37 A;  2F8X K;  2PM6 A;  4Y6C A;  5KBA A;  3IKO B;  4GML A;  3PEU B;  3FU3 A;  5CKL A;  2XRY A;  1OWN A;  5AQB A;  1TJF A;  4GZD A;  3FUJ A;  1HF8 A;  4GTS A;  4J0U A;  1N4P A;  2DIW A;  4N2S A;  2IOL A;  2HR2 A;  2F6S A;  5JFZ A;  5BXU A;  1DVP A;  4I2Z A;  5ANL A;  3D9K A;  2GGF A;  3KEZ A;  3ZGQ A;  5DBK A;  4RVB A;  4JW1 A;  3BG0 B;  3DSU A;  4BEP A;  5ITZ F;  3ULQ A;  2BUG A;  5CBN A;  2PQR A;  2X3M A;  1LD8 A;  4WNE A;  3AU4 A;  1K1A A;  2VSN A;  1H6O A;  2Y0B G;  3C5R A;  3FUM A;  4GZ6 A;  1YMP A;  1HU3 A;  1Q2Z A;  3BQO A;  3CVU A;  2L6B A;  4LCT A;  1D8D A;  4QFV A;  2DVW A;  4I9E A;  3KSL A;  4A3V A;  4WGJ A;  3ZN3 A;  5ARF A;  2GRP B;  3EU9 A;  3ENE A;  2R17 C;  2P9N G;  3ZRH A;  4AJW A;  3TWT A;  1K3Z D;  4BET A;  3PZ2 A;  4ZHB A;  5FIO A;  4GU5 A;  3JQ1 A;  5FWQ A;  4GA1 A;  3CVP A;  5EKQ D;  4L2Y A;  1DCE A;  3URZ A;  1N11 A;  2C0L A;  2KCV A;  1H0A A;  5BXO A;  4U07 A;  2MHK A;  4C0M A;  1N9A A;  1LF8 A;  1NP7 A;  4KMO A;  4URK A;  4TRQ A;  3PZ1 A;  2B6C A;  3HVE B;  4APO A;  1KZP A;  3JXJ A;  5BW8 C;  5FQ6 A;  3EHQ A;  2VTB B;  4EPZ A;  4J8E A;  3FTX A;  2XPI A;  4J8Y A;  4NQ0 A;  2WMN A;  1PC2 A;  1X81 A;  4WNG A;  1HH8 A;  1SZ9 A;  4BER A;  3D9L A;  1XGW A;  2GW1 A;  5BUZ A;  5J90 A;  3ZLM A;  1P5Q A;  4XEI G;  4F1P A;  2M63 A;  3GZ1 A;  2WXH A;  5JHA A;  3ULY A;  3IHV A;  3U64 A;  1OUV A;  1OWO A;  4BY6 A;  3IV0 A;  3IEG A;  2FO1 E;  5AJD A;  3Q5M A;  4YVO A;  3BEE A;  4UWG A;  4E85 A;  1IKN D;  3JQ0 A;  3MYV A;  3LY8 A;  2QYU A;  3FUD A;  5JJT A;  3HXD A;  3PNT B;  2LAI A;  3CK9 A;  4XX5 A;  1MX4 A;  3IHY A;  3FTS A;  1TNY A;  2P9P G;  3RSE G;  2Y69 E;  3VLD A;  3MKQ B;  2WXK A;  2HM8 A;  2XZT G;  3MZL B;  5C1D A;  3DRA A;  4JD2 G;  4LNB A;  4O60 A;  2J4D A;  4O1P A;  4AOF A;  2LSV A;  3TWQ A;  4DK5 A;  3E33 A;  4I6E A;  5KCM A;  2KAT A;  2J8S D;  3ML9 A;  3ONK A;  4XI8 A;  1NFI E;  2UY1 A;  2VYI A;  2NYJ A;  4BSZ B;  1ZB1 A;  3RO3 A;  3T8K A;  4EHM A;  3RRU A;  2WXJ A;  4HI9 A;  3C3Q A;  4K5C A;  1MHQ A;  4D10 C;  3FUI A;  1OCO E;  4NUR A;  4XKC A;  1YCS B;  2GRO B;  3D3M A;  3ASN E;  1V55 E;  2XRZ A;  3CGH A;  1KPS B;  3EHN A;  3B7B A;  4HNA D;  3CVW A;  1NH1 A;  4I43 A;  3PUK A;  4HOT A;  2RD0 A;  3SBS A;  2H6H A;  3FY4 A;  4U0U A;  4RG6 A;  3E4B A;  4ILH B;  4OYS A;  3CSF A;  4PS7 A;  3CIA A;  1RZ4 A;  2P9I G;  1H6K A;  2AWI A;  3TWU A;  4DUI A;  3RRM B;  3APD A;  4GTP A;  3TAX A;  4CEM A;  2AXZ A;  3BU8 A;  3GZS A;  2J07 A;  4CDN A;  2WXI A;  4U04 A;  4OAV B;  3HG0 D;  3SF4 A;  1IQR A;  1UOH A;  2WB2 A;  4MBG A;  3ZHE A;  4UQZ A;  2H6G A;  5HQ8 A;  1S64 A;  4RG9 A;  1UW4 B;  3CHQ A;  5AAR A;  4U8H A;  4G8L A;  4I1M A;  4BTA A;  5FQ4 A;  5KJL A;  4KVM A;  3ZXP A;  4ACL A;  2PNN A;  4ANV A;  2AJA A;  5EX0 A;  2P9S G;  1EPU A;  1DCQ A;  2J9Q A;  4NRH B;  4ABN A;  3U9W A;  2JLB A;  3DEO A;  4PS3 A;  5E76 A;  3CHO A;  2IOS A;  1SQM A;  3SNX A;  4F6R D;  4LSZ E;  1WY6 A;  5EIB E;  3CQG B;  5G05 J;  3UM3 A;  2XGS A;  1OCZ E;  4BES A;  4JL0 A;  4WND A;  4PS8 A;  5FIN A;  3CVY A;  5HRY A;  5C2Y A;  5JMN D;  3V30 A;  1HX8 A;  1MX6 A;  3N71 A;  2CG2 A;  1WDY A;  3AG4 E;  4JHR A;  5ENQ D;  3L13 A;  3Q9U C;  3G2T A;  1HG2 A;  5BNW A;  3Q78 A;  3K9I A;  4YDY A;  4J8S A;  5HI7 A;  3ZC7 A;  3PE4 A;  3EU5 A;  3FDH A;  1N4Q A;  1HXI A;  4ME2 A;  2XGM A;  4X8Q A;  1UJK A;  5BPP A;  2XHE A;  3GYZ A;  3QWW A;  3B7U X;  4FHK A;  3TWW A;  3TXM A;  3UI2 A;  2RFM A;  2WMO A;  5AJL A;  3LJ3 A;  3B95 A;  2MRI A;  1TNU A;  2VY3 A;  4DI3 A;  3C98 A;  4JPS A;  5EX3 A;  2BED A;  2XS8 A;  1E7U A;  4DI4 A;  5CRU A;  4AXH A;  2X6H A;  4GMJ A;  1AP7 A;  3AS5 A;  3HXE A;  5JJ7 A;  3G2U A;  2P2C P;  3QB2 A;  2IJG X;  2WXL A;  3PZ4 A;  2AXV A;  5D0Q D;  1BLX B;  5G55 A;  4GTR A;  3Q7A A;  5JFF A;  3QOU A;  3D9P A;  3APF A;  3ABK E;  2EIM E;  3T5X A;  2RKK A;  1OCR E;  4KZ0 A;  2CFU A;  2DWZ A;  3S7F A;  4G1T A;  2PL2 A;  2AVP A;  2PZI A;  1N4R A;  2KCL A;  2RG8 A;  3BG1 B;  2ILR A;  3ASG A;  5KNG A;  3TXN A;  3PNL B;  4MLP A;  4FLB A;  1XNF A;  2NUD A;  3UT8 A;  3ESK A;  1S63 A;  1H2V C;  2WVI A;  2DCP A;  3CV0 A;  2WXP A;  1K8K G;  1LD7 A;  5LCW C;  3UT4 A;  1Y6I A;  5KJM A;  4TUU A;  3LJN A;  2Y4U A;  2IO3 C;  2R05 A;  3PS6 A;  3DPD A;  4GZC A;  1NA0 A;  3I5P A;  1TR4 A;  3QAQ A;  3SE5 A;  4FJZ A;  4J6I A;  5ENO D;  1O1S A;  2I2O A;  3MEK A;  4UI9 J;  5CHE E;  4X2E A;  1OWP A;  4H7Y A;  3HXC A;  3FHE A;  4AM9 A;  2DBA A;  1UJJ A;  1SW6 A;  2X6K A;  4MKT A;  3LXU X;  5IY5 E;  4BT9 A;  3B13 A;  1OY3 D;  4C9B B;  1N0R A;  3RU0 A;  2V4H C;  2HE0 A;  2WXR A;  4B8A A;  2WXN A;  1WM5 A;  4GZ5 A;  3RJV A;  4A1S A;  1FT1 A;  2XEE A;  3SI5 A;  3QWP A;  2EIK E;  4JA7 A;  4LNU D;  5FJY A;  5AQA A;  3FTU A;  1TNZ A;  4AP2 A;  1FCH A;  4W9R A;  5FZQ A;  3PVL A;  4LG6 A;  5AIJ A;  3D9H A;  4XI0 A;  3LPZ A;  2WXO A;  3D9O A;  4YDE A;  2JAB A;  2ETB A;  3MX3 A;  1QZ2 A;  1SA4 A;  3E34 A;  1N52 A;  4B94 A;  2C2L A;  2IO2 C;  3KAE A;  4A3T A;  1L5J A;  4JHJ A;  3UM1 A;  4ANX A;  3SY2 A;  1N0Q A;  3PEV B;  5CMY A;  1JUQ A;  4BT8 A;  4BFR A;  4B89 A;  1H19 A;  4KZC A;  5B1A E;  1MQS A;  2NXP A;  5DIZ A;  3CK7 A;  2WPV A;  3ASD A;  5FQ8 A;  3LDZ A;  4JXT A;  3TWS A;  5B3S E;  4M7C A;  5M72 A;  4XZ4 A;  2R03 A;  4HLL A;  3Q47 B;  3LY9 A;  3L9T A;  4ANU A;  2VZA A;  2R59 A;  2YNQ A;  4HXI A;  1UN9 A;  4ANW A;  4A1G A;  4NPS A;  3S7J A;  3FTY A;  2FF4 A;  1TYQ G;  1RW2 A;  4Q94 A;  3OXL A;  4HS2 A;  3U3W A;  4UQY A;  3JYS A;  3ASO E;  3LVR E;  1BU9 A;  3FH8 A;  2VGX B;  4IN3 B;  2KM4 A;  1EYH A;  3Q79 A; 
#chains in the Genus database with same CATH homology
 2WQ7 A;  5G2N A;  3SHG A;  1JPL A;  2XRZ A;  5CGL A;  1IQU A;  3CGH A;  1DNP A;  4I6J A;  4FP7 A;  3EHN A;  1JWG A;  1UG3 A;  1HFA A;  2L0T B;  4IUL A;  4UWF A;  5T3R A;  4JHK A;  4N39 A;  1VDY A;  3GZ2 A;  3D9M A;  1TEZ A;  3CVW A;  4U63 A;  2XPZ A;  3U66 A;  4I43 A;  3PUK A;  2AXU A;  4AY5 A;  3LKU A;  3FUK A;  1KLX A;  4HOT A;  1IYG A;  5CCL A;  2UY1 B;  2X6J A;  3TGO A;  4GYO A;  1NZN A;  2XGO A;  2RD0 A;  3SBS A;  3CVN A;  3ESL A;  3FY4 A;  4AY6 A;  4U0U A;  2CHW A;  1PAQ A;  3UUX A;  2I9C A;  2VSO E;  2VGY A;  4RG6 A;  4DPR A;  2VQ2 A;  4J8D A;  4EEC A;  2QFC A;  3E4B A;  3KD7 A;  4U0Z A;  4ILH B;  4OYS A;  4X2D A;  1HG5 A;  3CSF A;  2I1J A;  3EIQ C;  4PS7 A;  5EDS A;  4JC8 A;  3UQ3 A;  3CIA A;  4PUC A;  3CEQ A;  3QKY A;  3CHP A;  5T8I A;  1H6K A;  3D9I A;  2AWI A;  1E8X A;  3ZEF A;  3RRM B;  3MJW A;  4PY3 A;  4ILI A;  3APD A;  4GZ3 A;  2J09 A;  4JZY A;  2WXG A;  2KZT A;  3ZYQ A;  3TAX A;  4JA9 A;  3P2B A;  3EIJ A;  4CEM A;  2AXZ A;  2MOW A;  3GZS A;  2J07 A;  4Q96 A;  4CDN A;  4AV7 A;  5BV1 A;  2WXI A;  3ZYK A;  2EQX A;  3MGB A;  2J4B A;  4U04 A;  1U3D A;  2XPY A;  3ZIM A;  4BWR A;  3LEW A;  3SF4 A;  1WAO 1;  1IQR A;  4KVO A;  4HFG A;  4L2L A;  5A6C A;  2OND A;  2FBN A;  5G05 C;  3ML8 A;  5AYW D;  3HIZ A;  2NC9 A;  3QWV A;  1EF1 C;  4ACK A;  4HLE A;  3TG5 A;  4B0Z A;  4FAD A;  3NF1 A;  3FH5 A;  4HOU A;  3S6A A;  5CMW A;  2WB2 A;  3ZHE A;  1FVH A;  4IRU A;  3PH0 C;  4TV3 A;  4UQZ A;  2YHC A;  3FUN A;  3QNK A;  2WQH A;  1FVF A;  1KT1 A;  1TJC A;  3FTW A;  4N67 A;  2ZU6 B;  5HQ8 A;  4H7X A;  3CQC B;  4GA2 A;  2ION A;  4P29 A;  5CMT A;  1UW4 B;  1PY1 A;  2V8S E;  3CHQ A;  4RG9 A;  3GW4 A;  4R7L A;  4GYW A;  4I1M A;  4U8H A;  4UWL A;  4BTA A;  3FU6 A;  5FQ4 A;  4LER A;  5KJL A;  4KVM A;  2I1K A;  1JWF A;  3LS8 A;  3S2A A;  1IHG A;  4ACL A;  2OOE A;  3MV2 B;  4DLQ A;  3KS2 A;  5LFA A;  4ANV A;  3JUI A;  5EX0 A;  2XCC A;  5ENN A;  3PRZ A;  3CHM A;  3EJN A;  2Q7F A;  3VTX A;  5KJN A;  2JEK A;  1EPU A;  3CVL A;  2J9Q A;  3G2S A;  4NRH B;  4ABN A;  2NSZ A;  2CHX A;  3B7T A;  3U9W A;  2JLB A;  4ATG A;  4F1S A;  4NAC A;  4PS3 A;  2KZT B;  3CKC A;  4KT6 B;  4WNF A;  4N3A A;  4BSX A;  4GYY A;  4M16 A;  4CDM A;  2LAH A;  1KT0 A;  4A55 A;  1Z3X A;  3G2V A;  3FEX A;  5E76 A;  1E90 A;  3MV3 B;  3CHO A;  2IOS A;  3HHM A;  4APF A;  2G03 A;  2L6J A;  3FWV A;  3O48 A;  1SQM A;  4WWP A;  4EBA A;  1HS6 A;  3NQP A;  4XKB A;  2AW6 A;  3SNX A;  3B7S A;  3QK0 A;  4MRU A;  5LP0 A;  1WY6 A;  4YVQ C;  3SBT B;  3AU5 A;  3QAR A;  1UN8 A;  4L7T A;  1ZU2 A;  1INZ A;  3L54 A;  2E0I A;  3HDX A;  2V5F A;  3CQG B;  3ZHE B;  1E8W A;  3AS8 A;  5G05 J;  1W3B A;  2IQC A;  3UPV A;  3T8M A;  3JCK C;  1GW6 A;  4UQX A;  2XGS A;  5G04 J;  4JL0 A;  4WND A;  4PS8 A;  4F7A A;  4EZJ A;  3FUE A;  2FEZ A;  3CVY A;  2FO7 A;  3D9N A;  4WWO A;  1B89 A;  2FUL A;  3CLJ A;  4FU3 A;  3ZFW A;  5C2Y A;  4AIF A;  4GCO A;  1HX8 A;  2OVF A;  2CG2 A;  3ASF A;  3N71 A;  4PH4 B;  3MCX A;  5JJ6 A;  2A4Z A;  2KCK A;  2L0I A;  4K03 A;  4XE0 A;  3FTV A;  1OWM A;  2A5U A;  1E7V A;  2GRM A;  4JHR A;  5FQ7 A;  3LCA A;  3UT7 A;  1N54 A;  3CVV A;  3L13 A;  3ZCB A;  2GRL A;  4UWH A;  4BX8 A;  2WXQ A;  3G2T A;  3NZS A;  4CDR A;  1HG2 A;  5BNW A;  5D0O D;  2PM6 A;  2UWJ G;  4JEH A;  3K9I A;  2KC7 A;  3IBE A;  5ANR A;  2X6I A;  4Y6C A;  5FTP A;  4WUY A;  4Q69 A;  3IKO B;  3LY7 A;  3ZYL A;  4GML A;  1BPO A;  3PEU B;  4J8S A;  5HI7 A;  3FU3 A;  4EQF A;  3ZC7 A;  3PE4 A;  5CKL A;  2XRY A;  1OWN A;  3FDH A;  4JVS A;  1HXI A;  4XIF A;  4BX9 A;  3S7D A;  4ME2 A;  2XGM A;  4EZL A;  1UJK A;  3TJP A;  1TJF A;  2IFU A;  3FFL A;  2XHE A;  5BPP A;  3GYZ A;  3T5V A;  4AEZ C;  3R7R A;  4GZD A;  3QWW A;  3CUC A;  3I4G A;  3B7U X;  4GA0 A;  3FUJ A;  4I2W A;  4FHK A;  4JEU A;  3RRN B;  3R7Q A;  1HF8 A;  3TXM A;  4J0U A;  1E8Z A;  4CGV A;  5J08 A;  1X5B A;  2DIW A;  4N2S A;  2IOL A;  2CFZ A;  2WM9 A;  2VSY A;  2Y4T A;  2E2E A;  2HR2 A;  4N2Q A;  3MKR A;  2F6S A;  2WMO A;  5JFZ A;  1OWL A;  5AJL A;  2FI7 A;  3EHM A;  3LJ3 A;  4I6G A;  4C0E A;  2MRI A;  3CVX A;  1DVP A;  4I2Z A;  5ANL A;  4G23 A;  3D9K A;  2CHZ A;  2GGF A;  2WXM A;  3S7B A;  3KEZ A;  4N3B A;  4I9C A;  3ZGQ A;  3N3U A;  3NZU A;  2VY3 A;  3QC1 A;  4G24 A;  5DBK A;  4DI3 A;  3C98 A;  4RVB A;  5LCW J;  4JPS A;  3APC A;  4G11 A;  4JW1 A;  3SGH A;  5EX3 A;  3BG0 B;  4G25 A;  4N5C A;  3FUL A;  1E7U A;  4EBA G;  5G04 C;  1YA0 A;  3ULQ A;  2BUG A;  2PQR A;  3CVQ A;  2X3M A;  4DI4 A;  3DBS A;  5BT1 A;  2OV8 A;  3LYA A;  5JHB A;  3R9A B;  2X6H A;  4GMJ A;  3TG4 A;  4AXH A;  3AS5 A;  4HOQ A;  4WNE A;  3AU4 A;  2VSN A;  5JJ7 A;  3G2U A;  1ELR A;  2V4L A;  3QB2 A;  3FUM A;  4GZ6 A;  2IJG X;  1H2U A;  2WXL A;  4FJY A;  1QQE A;  1HU3 A;  3L16 A;  4O6F A;  4L1B A;  3CVU A;  2AXV A;  1Z6T A;  5D0Q D;  3B7R L;  3Q15 A;  4FHJ A;  4LCT A;  5G55 A;  2VSX E;  4F53 A;  5JFF A;  5T4Y A;  2LO6 A;  3QOU A;  4M3O A;  4QFV A;  3PUJ A;  4I9E A;  3PDN A;  2P58 C;  3D9P A;  4BTB A;  3QDN A;  4A3V A;  3CHS A;  3RKV A;  3APF A;  4WGJ A;  3HVE A;  4OVV A;  3FH7 A;  3T5X A;  3ZN3 A;  5ARF A;  4B8C B;  3ASH A;  4KZ0 A;  3ENE A;  2CFU A;  1EDU A;  3S7F A;  3EDT B;  4G1T A;  3ZPJ A;  2PL2 A;  3Q49 B;  3SN9 A;  2R17 C;  3QJZ A;  3ZRH A;  2AVP A;  2PZI A;  2VTB A;  5FT9 A;  3SHF A;  2VGX A;  4AJW A;  3AS4 A;  3OTN A;  2PM7 A;  2Y3A A;  2KCL A;  1Y8M A;  2RG8 A;  3BG1 B;  4K0R A;  2ILR A;  3ZXS A;  4GU5 A;  3JQ1 A;  1U3C A;  3ASG A;  3ZYM A;  1H2T C;  5FWQ A;  3TXN A;  4CT0 A;  4GA1 A;  4WAF A;  3CVP A;  3PNL B;  4MLP A;  5EKQ D;  5A23 A;  4ILG A;  4FLB A;  4L2Y A;  4GAA A;  2R5S A;  3URZ A;  1XNF A;  5EU0 A;  3UT8 A;  2C0L A;  3CHR A;  3RIB A;  3ESK A;  2WXF A;  2KCV A;  3CST A;  4CGW A;  1H2V C;  3UMV A;  2YQ8 A;  1H0A A;  2DCP A;  2WVI A;  4U07 A;  2MHK A;  4C0M A;  4UI9 K;  3CV0 A;  4KYO B;  2WXP A;  1SZA A;  1LF8 A;  2IF4 A;  1QNF A;  5LCW C;  1NP7 A;  3UT4 A;  1Y6I A;  4N3C A;  4TUU A;  5KJM A;  4KMO A;  2Y4U A;  1A17 A;  3L08 A;  4URK A;  3CKB A;  4TRQ A;  2YHE A;  4HVB A;  3PS6 A;  1Z3Y A;  3L6A A;  3O4Z A;  3HVE B;  4FUL A;  3FUF A;  4APO A;  3DPD A;  1ZBP A;  4EZK A;  4GZC A;  1NA0 A;  3I5P A;  4I17 A;  5KJK A;  3CK8 A;  3QAQ A;  3SE5 A;  2I6H A;  5BW8 C;  2L9B A;  5FQ6 A;  4FJZ A;  2BTD A;  2VTB B;  4J6I A;  2I2O A;  4XI9 A;  3MEK A;  4UI9 J;  4EPZ A;  3RO2 A;  3ZW3 A;  3WXX A;  5CHE E;  4J8E A;  4DLO A;  4X2E A;  1OWP A;  3FTX A;  4H7Y A;  2XCB A;  4HOS A;  2XPI A;  3FHE A;  4NQ0 A;  3TL5 A;  4AM9 A;  2WMN A;  1PC2 A;  2V0P A;  4OVU A;  2DBA A;  2X38 A;  1HH8 A;  1SZ9 A;  4WNG A;  1S0P A;  1UJJ A;  4GB9 A;  2X6K A;  3D9L A;  4MKT A;  1XGW A;  2GW1 A;  3LXU X;  5BUZ A;  4V3I A;  5J90 A;  4BT9 A;  3ZLM A;  1P5Q A;  3B13 A;  4ITR A;  5ARG A;  4KXK B;  4C9B B;  2M63 A;  5A7D B;  4LRZ A;  3RU0 A;  2VJ8 A;  2XQ0 A;  3HYM B;  2WXR A;  3PZD A;  4B8A A;  2WXN A;  3GZ1 A;  1WM5 A;  2LSU A;  1E96 B;  4GZ5 A;  3RJV A;  3PRE A;  4A1S A;  2JK8 A;  2WXH A;  5JHA A;  3SI5 A;  3MKQ A;  3MA5 A;  3Q4A B;  4E6H A;  3IHV A;  3QWP A;  4JA7 A;  5FJY A;  3U64 A;  2OVB A;  1OUV A;  1OWO A;  2HYZ A;  3FTU A;  3ZVV A;  4BY6 A;  3CR3 A;  4AP2 A;  1FCH A;  4W9R A;  5FZS A;  3IV0 A;  3FUH A;  4L23 A;  3IEG A;  4F3V A;  2J08 A;  5FZQ A;  3PVL A;  5AJD A;  3Q5M A;  5BV0 A;  4WWN A;  3PE3 A;  5AIJ A;  4YVO A;  4AVX A;  1ELK A;  3D9J A;  4XI0 A;  3BEE A;  2PQN A;  3LPZ A;  4UWG A;  4E85 A;  2C0M A;  3VTY A;  2X6F A;  3UX4 A;  3JQ0 A;  3MYV A;  2WXO A;  3LY8 A;  3D9O A;  3LVQ E;  1NA3 A;  4U0S A;  4GCN A;  5AEN A;  3MX3 A;  3FU0 A;  3FUD A;  4IYP A;  1QZ2 A;  5JJT A;  4LEU A;  1N52 A;  4KBQ A;  4G26 A;  2BF0 X;  4B94 A;  2C2L A;  4A3T A;  3KAE A;  1L5J A;  3SZ7 A;  3PNT B;  4JHJ A;  2LAI A;  2QY7 A;  4HOR A;  3CK9 A;  4ANX A;  4XX5 A;  3G2W A;  3PEV B;  5E75 A;  3IHY A;  3FTS A;  5CMY A;  1JUQ A;  3VLD A;  3SD5 A;  3MKQ B;  4BT8 A;  4BFR A;  3OAW A;  4B89 A;  1H19 A;  4KZC A;  4UI9 C;  2WXK A;  3FP3 A;  2HM8 A;  3ONL A;  4CT4 A;  1MQS A;  2NXP A;  3MZL B;  3U4T A;  5C1D A;  5DIZ A;  2WQ6 A;  3CK7 A;  4FLH A;  2WPV A;  3ASD A;  4RSY A;  5FQ8 A;  5LOZ A;  4J8F A;  4CRW A;  3LDZ A;  3OXG A;  4CCA A;  4JXT A;  2J4D A;  4AOF A;  2LSV A;  1HE8 A;  3RK6 A;  2J49 A;  2YIN A;  4PDX A;  2XEV A;  5M72 A;  4DK5 A;  4XZ4 A;  4I6E A;  4LUN U;  5KCM A;  3Q47 B;  3FTZ A;  2KAT A;  3LY9 A;  4I1O B;  3ML9 A;  4I1A A;  4UWK A;  4ANU A;  4FA6 A;  5LX8 A;  2VZA A;  2R59 A;  4YND A;  2YNQ A;  3ONK A;  4XI8 A;  4HXI A;  1UN9 A;  3OXF A;  2CG3 A;  2UY1 A;  4ANW A;  3P1U A;  4A1G A;  4NPS A;  4Y6W A;  2VYI A;  3S7J A;  2LNI A;  1ELW A;  4FC8 A;  4LU4 A;  3RO3 A;  4G2V A;  3I4R B;  3FTY A;  2FF4 A;  4Q94 A;  3OXL A;  2WXJ A;  4HS2 A;  3RRU A;  3I3N A;  3U3W A;  4MS6 A;  3VLF A;  5CCM A;  4UQY A;  1E8Y A;  3JYS A;  1MHQ A;  5FZR A;  3FUI A;  4D10 C;  3LET A;  3L22 A;  3VLE A;  3LVR E;  4NUR A;  4XKC A;  3FU5 A;  3L17 A;  4GPK A;  1HZ4 A;  1HO8 A;  4DJA A;  3FH8 A;  4X2C A;  2VGX B;  4IN3 B;  3SFZ A;  2KM4 A;  1EYH A;  3D3M A;  2IU1 A;  3FEY A;  2HO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...