4U07A

Atp bound to eukaryotic fic domain containing protein
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
326
structure length
323
Chain Sequence
b'AALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSINSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine monophosphate-protein transferase FICD
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 122
structure length 323
sequence length 326
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u07A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u07A01
5EX3A 4X2DA 2I6HA 4B94A 4CDRA 2YHCA 4AY5A 4UI9C 1HH8A 3N71A 4F3VA 5DIZA 3URZA 3LKUA 5G05C 4H7XA 4NRHB 4HOUA 3KS2A 2C2LA 5FZRA 4J8FA 5ARFA 3RJVA 2R5SA 5G04C 5CHEE 3QWPA 3RKVA 5CMTA 2HR2A 4X2CA 4BTBA 3UUXA 3PE3A 2IFUA 3RO2A 4BWRA 4GPKA 3TAXA 3S7JA 5FZQA 5JJ6A 4EQFA 5KJLA 3MV2B 3SN9A 3TG5A 4AM9A 3VTXA 3GW4A 4UI9K 3OXGA 2XGOA 3CKBA 2C0LA 5BT1A 2WQHA 2XCBA 5FTPA 4RG6A 2VSNA 2NC9A 5FZSA 3ASFA 4JA7A 2C0MA 1WAO1 4N3AA 5M72A 2VY3A 4XI0A 4H7YA 5EKQD 4I1AA 3U3WA 3CKCA 2G03A 4U0SA 2KATA 4GCOA 2FF4A 3CVPA 4W9RA 2XGSA 3LY7A 3ASGA 3Q47B 5DBKA 5BNWA 3ASHA 2Y4UA 3CVLA 4WNFA 3QDNA 4A1SA 4WGJA 5C1DA 5HQ8A 4NPSA 5LCWJ 2DBAA 4ME2A 3ULQA 3MEKA 1OUVA 2IF4A 4KYOB 1ELWA 3GZ2A 4PY3A 2VGXB 3EDTB 4WNEA 1NZNA 3QOUA 3LYAA 5FT9A 1QQEA 5EX0A 4GYOA 2LSVA 4YVOA 5FJYA 4G23A 5A6CA 5D0OD 2J9QA 5KJNA 3MKRA 4GA0A 3UPVA 5JJ7A 3ZHEA 2HO1A 3RIBA 2XPIA 3O48A 5JFFA 2YQ8A 2XCCA 4CGWA 2VGXA 4U07A 1WM5A 2P58C 2PQNA 1IHGA 4GA1A 4CGVA 3ZC7A 1ELRA 3PE4A 4GZ3A 3WXXA 1TJCA 5KJMA 3PDNA 3QKYA 4M16A 1XNFA 3ZFWA 3ZGQA 4UI9J 4G26A 3MV3B 5BW8C 2MHKA 4BTAA 2VSYA 2VZAA 4BT9A 4HORA 3UQ3A 1B89A 3CK7A 3CEQA 5G05J 2FI7A 2KCVA 5EU0A 4U04A 4XI9A 3LPZA 3E4BA 3FWVA 3AS8A 5G04J 4Y6CA 3ASDA 4GCNA 3S7BA 3VTYA 4JHRA 4KBQA 3KD7A 4GA2A 2OOEA 3OXLA 2FO7A 4N5CA 4HOQA 1KLXA 3Q5MA 4G1TA 4I17A 4XI8A 4KXKB 2V5FA 4WUYA 2PQRA 2VGYA 3AS5A 4G25A 1IYGA 5JFZA 3CUCA 3SE5A 5CKLA 3JYSA 1HXIA 2L6JA 4I2WA 2JLBA 4ITRA 4GZ6A 3ZHEB 4Y6WA 3OXFA 4I9EA 4N2SA 5CCMA 3NF1A 4UQYA 4JA9A 1KT0A 4HOTA 5CGLA 4G2VA 4ABNA 3S7FA 1W3BA 4LEUA 1ZBPA 2QFCA 3ESKA 5ARGA 3LETA 2KCKA 2PL2A 3SF4A 4GYWA 3SHGA 3CVQA 2KCLA 4IN3B 4JL0A 3GYZA 4AY6A 4G24A 4N2QA 3Q15A 5AYWD 4U0ZA 3ZPJA 3RU0A 3HYMB 2JK8A 3QWVA 4XIFA 4GYYA 1KT1A 3AS4A 3LCAA 2Y4TA 1ZU2A 3CK8A 3MA5A 3ZN3A 3U4TA 2HYZA 3R9AB 4UQZA 3ZCBA 2UWJG 2VYIA 2LSUA 3TGOA 3GZ1A 4N67A 2LNIA 3S6AA 1E96B 1HZ4A 4HOSA 4J0UA 4J8EA 4YNDA 2BUGA 3CK9A 3Q4AB 2KC7A 4WNDA 4APOA 3IEGA 3S7DA 4J8DA 4YVQC 5CCLA 2AVPA 2GW1A 5A7DB 2F6SA 2E2EA 3CV0A 1P5QA 2WPVA 4GZ5A 5LCWC 3Q49B 1YA0A 1NA0A 3FFLA 4UQXA 4BT8A 3KAEA 2UY1B 3QWWA 4X2EA 2FBNA 2XGMA 4O6FA 5HI7A 3TG4A 5D0QD 3SZ7A 4N39A 3ZLMA 1QZ2A 1Y8MA 5JJTA 4RG9A 3RO3A 3LY9A 4N3BA 4U0UA 2VQ2A 2Q7FA 2UY1A 3BEEA 2PZIA 3CVNA 4I9CA 4N3CA 1A17A 3FP3A 3LY8A 1NA3A 1PC2A 1FCHA 5KJKA 2FEZA 4I2ZA 4WNGA 2XEVA 4LU4A 3K9IA 4AIFA 2ONDA 3N3UA 4NQ0A
chains in the Genus database with same CATH superfamily
5FQ7A 3SQVA 4DX2A 2I6HA 4B94A 4A1GA 4XEIG 4FJZA 2OCCE 5EDSA 3ZNGA 1OCOE 2Y69E 3N71A 4JHKA 1JWGA 1HO8A 4H7XA 1JPLA 2B6CA 5KBAA 5G2NA 3MYVA 3PZ2A 4PS8A 1Z5SC 3DEOA 2R5SA 5G04C 4C9BB 3CHQA 2QC9A 2YHEA 2KZTB 2XZDG 2I1KA 3DSTA 4Q69A 3PUJA 1JCSA 3ULYA 4BTBA 2J07A 1FPPA 3HIZA 1X81A 3RO2A 3SY2A 3L17A 5FINA 5JJ6A 1D8DA 4ZFHA 5CEAA 2MYOA 3MGBA 1RW2A 3OXGA 2XGOA 3CKBA 1N4SA 2P9NG 3Q7AA 3Q9NC 2XCBA 5FTPA 3CLJA 2NC9A 5M72A 2VY3A 2GRLA 4XI0A 3WG7E 4AP2A 4DI4A 3CKCA 2XEEA 2G03A 3CVPA 4TXPA 4FADA 4W9RA 3IBEA 1UJJA 4BSZB 1N0QA 5FQ6A 3Q47B 5DBKA 2CHZA 3BU8A 3IHVA 5ENPD 2XS8A 3CVLA 4ILIA 3G2UA 4N5QA 2DYRE 1TEZA 4WNFA 5HQ8A 3DRAA 1OWNA 3QJZA 3C5RA 2DBAA 3CHOA 2R05A 3ULQA 3SNXA 3RRNB 4KYOB 3GZ2A 4WNEA 3EHQA 5FT9A 2QYUA 1DC2A 3D9HA 4YVOA 1EDUA 5A6CA 4PS7A 1OCRE 2RD0A 2M63A 3B7SA 5E76A 3I3NA 1X5BA 3L9TA 5KJNA 5ENNA 1LTXA 3UPVA 5JJ7A 3ZHEA 4GMLA 3FTZA 3Q73A 3I5PA 3UKUG 2A5UA 3AG4E 2VGXA 5ENSD 5EYPF 1MHQA 4GA1A 3QB2A 3ZC7A 4OAUC 1ELRA 4GZ3A 2AXVA 4M7CA 3ZXPA 5H7PA 5EN5D 2I1JA 2XZTG 5AQ7A 1AWCB 2V0PA 3QKYA 4RLYA 1XNFA 4DLQA 2WXMA 4K0RA 4G26A 2MHKA 1OWLA 2NYJA 3DXMG 2VSYA 4BT9A 4HORA 1B89A 3CEQA 4I6GA 4ZHBA 5EU0A 3FEYA 3TWQA 3LPZA 3FWVA 2XQ0A 4Y6CA 3ENEA 3JQ0A 3EUVA 4KBQA 3KD7A 3UM1A 1HE8A 2XENA 5ANRA 3MJWA 2Y0BG 3D9PA 4A3VA 3KSQA 2OVFA 4HOQA 4WWPA 3LVRE 4HS2A 4L23A 1INZA 2PQRA 4F1SA 3FU3A 5JFZA 1H2TC 3G2WA 2VTBB 4C0MA 4GTOA 4GZ6A 4ITRA 1WDYA 1MX2A 4UQYA 5A23A 1KT0A 4GTVA 2VJ8A 2V4LA 2XS1A 2QFCA 1UN9A 3UI2A 3LETA 3UM3A 3SF4A 2P9LG 4B0ZA 3KEAA 1TNYA 2EIME 4I6JA 3OTNA 4IN3B 5CBNA 3V2OA 5AARA 3APFA 4AY6A 3FH5A 4QFVA 3PEVB 1QYMA 2ZU6B 2R59A 3ZPJA 1OWMA 3HYMB 3HDXA 4FJYA 3FTUA 1OCCE 4HI9A 4J7WA 4K03A 4GYYA 3LCAA 2VSOE 2Y4TA 1K1BA 3TWWA 1ZU2A 3MA5A 1OCZE 1S0PA 2CFUA 4V3IA 2HYZA 1UJKA 5AQAA 1N4RA 1SA4A 2RFAA 3HVEA 3FEXA 3QK0A 2ETAA 2LNIA 3QAQA 3EU9A 3JUEA 2OV8A 4J8EA 1JCRA 4OYSA 4O60A 2KC7A 1DCQA 1N4QA 2CFZA 4MRUA 2LXMA 5EIDA 2LO6A 5T8IA 3KSLA 2J08A 1H2UA 5FWQA 3EHMA 1GW6A 2Y1LE 3HG0D 4KVOA 5LCWC 1O1RA 5J08A 4GB9A 3CQCB 2VGEA 3FFLA 4G8KA 4TXQA 3MKQA 4E6HA 3QWWA 4EBAA 2XGMA 3GZSA 3T8KA 1QZ2A 2OVBA 2R2LA 4Z68A 2F8XK 3CHPA 1QBQA 4A55A 2WXLA 3FTVA 3L54A 1S63A 2PM7A 4ACLA 2VQ2A 1LD7A 3FU5A 2Q7FA 3BEEA 4E85A 4U7EB 4TUMA 3PZDA 3MX3A 3B13A 3TWVA 5KJKA 3LJNA 2FEZA 2XEVA 4LCTA 3K9IA 2ONDA 3CVUA 4JB8P 3SHFA 4UI9C 2WXQA 4YDOA 1NH1A 4Q94A 4FP7A 4DX6D 3ZKJA 2H6IA 5DIZA 2RG8A 1HU3A 3EJNA 1HX8A 4LERA 2WXHA 4LSZE 3FUMA 2C2LA 3BQOA 5FZRA 4J8FA 4ANWA 5CHEE 1Z6TA 3FHEA 1TN7A 3RKVA 5CMTA 2HR2A 3RSEG 4TXRA 2IOSA 3UKRG 2IFUA 4EQFA 1EYHA 2QY7A 3SN9A 3TG5A 3E34A 4QQIA 4AM9A 4B89A 4GMJA 4ILHB 1BI7B 5D66A 2C0LA 5BT1A 2WQHA 3E30A 2FULA 4C0EA 2VSNA 4GTQA 4YDYA 5FZSA 2BEDA 4TRQA 3B7RL 5B1AE 2IOLA 4U0SA 2AJAA 2KATA 2FF4A 2XGSA 3TWRA 5JHBA 3DSVA 3ASHA 3ASOE 2GRRB 4AXHA 2J09A 1S70B 4JPSA 4HXIA 4A1SA 4WGJA 2RFMA 1IXVA 4JVSA 1E90A 2GRMA 2V4HC 2IF4A 5CRVA 4XE0A 4PY3A 2ZXWE 2VGXB 4RQIA 1QQEA 2X3MA 2NSZA 3ZU7B 4U95D 2J9QA 2J4DA 2V8SE 4LRZA 1K1AA 3FUFA 4J8YA 1ZB1A 1N54A 3V31A 3MKRA 4FC8A 3TWUA 4JEUA 3C98A 3R9MA 3ZYLA 3ML9A 3ML8A 3O48A 2KXPC 3PEUB 2XCCA 2ZISA 4U07A 4MKTA 2WM9A 3ESLA 4I1OB 4RSYA 5T3RA 2YNQA 4UWHA 4HB5A 5E75A 1TJCA 4F1PA 3U9WA 5KJMA 3HXCA 3NQPA 3PDNA 2AWIA 3SFXA 4I43A 4CCAA 3ZFWA 4B8AA 3TWXA 5BW8C 3UT8A 5G05J 1TR4A 3JXIA 1JWFA 4DX5D 1UG3A 2L6BA 1LF8A 3ASDA 4GCNA 3S7BA 3VTYA 2J49A 4GA2A 2OOEA 4AVXA 2FO7A 4N5CA 1KLXA 2WXRA 2B0OE 4I17A 3AS5A 3AG2E 3SO8A 1IYGA 3CR3A 4FULA 3SE5A 2L6JA 2JLBA 2WVIA 1IQRA 3B95A 2XPYA 3KEZA 4I9EA 4AOFA 3F6QA 4N2SA 5AIJA 3FTSA 4JA9A 1HFAA 4JW1A 3G2SA 3HXFA 3ZYMA 4ABNA 5CERB 1BD8A 4LEUA 3ESKA 1MQSA 3VLEA 3DSXA 2CHXA 5AN8A 1A5EA 3UTMA 4BEPA 3EIQC 2CG2A 4GAAA 4BY6A 5LP0A 2X6HA 2DVWA 4BETA 4CZ2D 3ULEG 2IO2C 3UIOC 3SBSA 3SGHA 3CK8A 3D3MA 4BX8A 1BPOA 2MRIA 1OY3D 4UQZA 1S64A 3TWTA 3ZCBA 1WY6A 3IV0A 2VYIA 3FTWA 3VLDA 2DZNA 3I4RB 4WAFA 2NUDA 5EYLA 1E96B 1G3NB 3CK9A 5CBOA 3Q4AB 1UN8A 4EBAG 4URKA 4LNGA 3IEGA 3L08A 1SQMA 3CVVA 1HS6A 2DYSE 5LOZA 3CVWA 2AVPA 2GW1A 4B8CB 2ZIRA 3ZIMA 3PZ4A 4O1OA 2I2OA 2E2EA 2F37A 3CV0A 5AQ9A 4GZ5A 2NXPA 1NFIE 4ATZD 1YA0A 1NA0A 2KZTA 3FTYA 4A3TA 4FLHA 2IU1A 4UQXA 3FTXA 3Q75A 3D9IA 2RKKA 3HRAA 3FULA 3TG4A 2OEVA 4GTPA 5KNHD 2GRPB 4DK5A 3B7UX 5D0QD 3SZ7A 5BUZA 4N39A 3FH7A 3HXEA 2AW6A 1PAQA 4OAVB 3RO3A 1TNBA 2IEJA 3CVNA 1E8ZA 4N3CA 2GROB 4WWOA 4ACKA 4HI8A 1YCSB 4U8YD 3PH0C 4ATGA 3SFYA 5LX8A 2IY0C 4EHMA 3C3OA 3AU5A 4ANUA 2P9UG 4HLLA 5EX3A 1H0AA 4X2DA 3D9MA 4GZDA 4CDRA 3J5PA 2YHCA 4L2YA 2X6KA 4AV7A 2CHWA 2X6JA 1HH8A 4F3VA 3URZA 3LKUA 3FUHA 1N95A 1V55E 3KS2A 5CEDB 5ARFA 3FU6A 3UX4A 4X2CA 4G11A 3NB2A 4DI3A 4KZCA 3PE3A 2WMNA 3QARA 1JCQA 3UXGA 3TAXA 2ETCA 4DJAA 3S7JA 4UWFA 2X6FA 2P9PG 5KJLA 1IKND 3TJPA 4HQDA 5FQ4A 1K3ZD 1YMPA 3PZ3A 3MV2B 3Q79A 4FU3A 4HLEA 5ANLA 3VTXA 3GW4A 4UI9K 3PRZA 3DPDA 2DZOA 4RG6A 3EU5A 2KM4A 4JZYA 3UT7A 3ASFA 4N3AA 1N11A 1HG5A 4NIKA 1O1TA 4X8QA 3O4ZA 2J4BA 3ASGA 3LY7A 1SZAA 4HRNA 1E8YA 1NP7A 3FU0A 5BNWA 4HBDA 1NI1A 4JC8A 3EIJA 5CRUA 1OWPA 5HRYA 3W9GA 2P2CP 3V2XA 4LG6A 1KPSB 1ELWA 1TNUA 3EDTB 1NZNA 3JQ1A 5EX0A 3BG0B 3I4GA 1L5JA 2DCPA 3V30A 2LAIA 4CYMD 3CQGB 5AJLA 2VTBA 4GA0A 1H2VC 3NOGD 3AJIA 3FUKA 1AP7A 3ONLA 3RIBA 3SBTB 3UIPC 3DSSA 3Q78A 5ENRD 3RK6A 2YQ8A 4I6EA 3APDA 4GPMA 1BLXB 3J5QB 4OVVA 2L9BA 5AQBA 3TXNA 3LDZA 2P58C 1IQUA 1TJFA 4BESA 5BV0A 3WXXA 1Q2ZA 4GTRA 2L0TB 4FA6A 4XKCA 3ZVVA 3ABME 2IONA 3MZLB 1IHBA 3CHMA 4KZ0A 4P29A 1XGWA 1EPUA 5G55A 4DPRA 3BUAA 4BTAA 4DX1A 2AXUA 2VZAA 3CK7A 1OXJA 3HHMA 2IQCA 2FI7A 5FQ8A 3QNKA 4GTSA 1N9AA 2NUNA 3AS8A 5G04J 1KZPA 4JHRA 1KZOA 4DLOA 1TN6A 3JCKC 4KMOA 3OXLA 2KBXA 5KWDA 4UWGA 4J6IA 2EILE 4OVUA 2V5FA 4WUYA 2VGYA 4G25A 5B3SE 2ETBA 5IY5E 3X2QE 3DBSA 1VDYA 5CKLA 3AU4A 1HXIA 3IKOB 3ZHEB 4I1MA 5JMND 3OXFA 3CVXA 5CCMA 4HOTA 5KCMA 5CGLA 2EINE 1W3BA 3AG1E 3L16A 5ARGA 2PL2A 3CVQA 2KCLA 4JL0A 2WXNA 4O1PA 3PZ1A 4G24A 3ASNE 1H6PA 4EZJA 1DVPA 4NACA 4JEHA 4XZ4A 2HM8A 4U0ZA 3L22A 3ZRHA 1DCEA 1PY1A 1TN8A 4XIFA 4KVMA 1MJ0A 1D8EA 3NZSA 4K5CA 5HS0A 1BI8B 3U66A 3U4TA 2BKKB 1MX6A 3R9AB 1SA5A 4UWLA 2UWJG 2LSUA 3TGOA 4CDNA 4N67A 1ELKA 2GRQB 3S6AA 3P2BA 1HZ4A 3G2VA 5ENOD 4YNDA 4CRWA 3T9KA 2WXIA 2ZGDA 3FUDA 4WNDA 4APOA 1MYOA 2A5EA 1N52A 4XX5A 4BX9A 1O1SA 4F6RD 3HXBA 4YVQC 2PM6A 5A7DB 5LFAA 1UW4B 2F6SA 2F0YA 2Y3AA 5J90A 1P5QA 4HNAD 5ENQD 2WQ7A 2AXZA 5CMYA 4CEMA 4BT8A 4HFGA 1H6OA 3LVQE 3R7QA 2L0IA 3C3QA 3ZYQA 2FBNA 2XRZA 1BU9A 2EIJE 5HI7A 2LXLA 2FO1E 3CHSA 3ZLMA 3FUJA 1Y8MA 4WWNA 5BXOA 4GTTA 4RG9A 3PREA 3LY9A 3B7BA 4ANXA 3DPYA 3DXKG 2WMOA 3C3RA 4CDMA 3MCXA 2UY1A 2PZIA 4I9CA 3HVEB 4U8VD 1JUQA 3ONKA 4GMRA 2JABA 3LY8A 1NA3A 2DWZA 1O5MA 4I2ZA 1K8KG 4HRMB 3N3UA 4F53A 4NQ0A 5ITZF 1MX4A 4R7LA 4AY5A 5EIBE 1OT8A 3TXMA 4CT0A 2P9IG 5CECB 3RRUA 3AG3E 3LEWA 5G05C 4CT4A 2JEKA 3DSWA 3T5VA 4NRHB 4HOUA 1E7UA 1FVHA 3RJVA 3UM0A 3QWPA 3BG1B 3V79K 2HE0A 3TL5A 4ANVA 3DEPA 3MKQB 3UUXA 4L7TA 4FLBA 4U96D 3CSTA 2IJGX 2WXJA 2MOWA 5JA4D 4BWRA 4DX7D 4GPKA 4B93B 3RRMB 5FIOA 5AENA 5FZQA 1MZCA 3U64A 4G8LA 3JXJA 3FY4A 3UT4A 1Y6IA 3LS8A 4NURA 4TUUA 2A4ZA 4EZKA 3CHRA 3RAUA 1V54E 2OEWA 4XKBA 4JA7A 2C0MA 1WAO1 2IO3C 4BFRA 4IYPA 4H7YA 5EKQD 4FHKA 4I1AA 3U3WA 4GCOA 2X38A 4HVBA 4GZCA 4L1BA 4MBGA 1HG2A 2Y4UA 2YINA 3L13A 3QDNA 2XRYA 4PUCA 3B7TA 5C1DA 3NAWA 2CG3A 1TYQG 2GGFA 4NPSA 5LCWJ 1FT1A 4YDWA 4ME2A 5BV1A 4KT6B 3MEKA 1OUVA 2PNNA 4RVBA 4PH4B 1YYHA 2BF0X 3DSUA 3QC1A 4LUNU 3QOUA 3LYAA 4YDEA 2BTDA 3E32A 5FJYA 4GYOA 2LSVA 3UINC 4G23A 2H6FA 5D0OD 1H19A 3FDHA 3PUKA 3SFZA 3E33A 1SW6A 4DRXE 3PVLA 3PNLB 2P9SG 2R02A 2BKGA 3JUIA 2HO1A 4EZLA 4FHJA 1D9SA 3ABLE 2XPIA 5JFFA 3L82A 4CGWA 3NOCD 4LNBA 5D2MC 1E8WA 1WM5A 3NZUA 2PQNA 1IHGA 1EF1C 2WQ6A 3LXUX 2P9KG 4CGVA 3AAAC 3Q7FA 3D9JA 3PE4A 4U8HA 5CMWA 1U3CA 4C48B 3UMVA 4GU5A 2WXFA 4JXTA 4IULA 4JHJA 4M16A 5BPPA 3ZGQA 4IRUA 2DIWA 4UI9J 3OAWA 3MV3B 2V5QC 3T8MA 1NL4A 3UQ3A 2XPZA 2KCVA 1N0RA 3ZEFA 4AEZC 3SI5A 4U04A 3FUEA 4XI9A 3E4BA 2H6GA 3SD5A 1N94A 5ENTD 1DNPA 3IXEA 3T5XA 1E7VA 4PS3A 3D9KA 3Q5MA 4G1TA 4TV3A 4XI8A 3R7RA 1Z3YA 4KXKB 3PS6A 4EECA 5B1BE 2EIKE 1LD8A 2XEHA 3D9NA 3CUCA 3JYSA 1HF8A 4I2WA 2R03A 2X6IA 4EPZA 2VSXE 3CSFA 4Y6WA 2J8SD 3NF1A 4GTMA 3W9FA 4G2VA 4U63A 3S7FA 3ZYKA 3ZXSA 5JHAA 5AAOA 3P1UA 3Q9UC 1ZBPA 3LJ3A 3ZUVB 4AJWA 1OWOA 2KCKA 2LAHA 4D10C 4GYWA 3SHGA 4APFA 1SVXA 4JD2G 3HXDA 2F8YA 3DWLG 4BSXA 3GYZA 3VLFA 4N2QA 3Q15A 4LNUD 2WXKA 3S2AA 5AJDA 5AYWD 5KNGA 1RZ4A 2H6HA 3RU0A 1E8XA 2JK8A 2E0IA 4K5BA 3QWVA 3G2TA 1KT1A 1SZ9A 3AS4A 3ZN3A 4J8SA 3ABKE 1U3DA 2WXPA 2R17C 3ISMC 4MS6A 1Z3XA 3GZ1A 3UM2A 4HOSA 4J0UA 2BUGA 3FUNA 2WXGA 4M3OA 4HRLA 3S7DA 4DUIA 2XHEA 1TNZA 1UOHA 4BERA 4J8DA 4ILGA 5CCLA 3CIAA 3C72A 3ZW3A 5BXUA 4UUCA 4MLPA 2QYJA 3EHRA 2WPVA 3Q49B 5T4YA 1WG0A 2QZAA 3KAEA 2UY1B 3EHNA 2EQXA 3CGHA 2LUHA 4X2EA 4UWKA 2ILRA 5C2YA 4O6FA 2WB2A 4K5AB 3PNTB 5EILA 1H6KA 4L9PA 1U2VG 3D9LA 3FH8A 5JJTA 3APCA 5HKPA 3TWSA 3CVYA 2GRNB 4N3BA 4U0UA 1FT2A 1TNOA 1N4PA 4PDXA 2I9CA 2ZGGA 3L6AA 3E37A 2WXOA 1A17A 3FP3A 4Q96A 4L2LA 1FVFA 3FUIA 3D9OA 1PC2A 1FCHA 1QNFA 4WNGA 4LU4A 3NBNB 4A63B 4AIFA 3IHYA 4F7AA
chains in the Genus database with same CATH topology
5FQ7A 5EX3A 1H0AA 4X2DA 2I6HA 3D9MA 3CVUA 4B94A 4A1GA 4GZDA 4CDRA 3SHFA 4R7LA 4FJZA 2YHCA 4L2YA 4UI9C 4AY5A 2WXQA 2X6KA 4AV7A 5EDSA 2CHWA 4Q94A 2X6JA 1HH8A 3TXMA 4CT0A 4FP7A 3N71A 4JHKA 4F3VA 5DIZA 2RG8A 3URZA 1HU3A 3RRUA 1JWGA 3LEWA 3LKUA 5G05C 1HO8A 4H7XA 3EJNA 3FUHA 2JEKA 4CT4A 1HX8A 1JPLA 3T5VA 4LERA 4NRHB 2WXHA 4HOUA 5G2NA 3KS2A 3MYVA 3FUMA 2C2LA 4PS8A 5FZRA 1E7UA 1FVHA 4J8FA 5ARFA 3RJVA 4ANWA 2R5SA 5G04C 4C9BB 3CHQA 5CHEE 3FU6A 3UX4A 2YHEA 1Z6TA 3FHEA 2KZTB 3QWPA 3BG1B 2I1KA 4Q69A 3PUJA 3RKVA 3TL5A 4ANVA 5CMTA 2HR2A 4X2CA 4BTBA 3MKQB 2J07A 4G11A 3UUXA 4DI3A 4L7TA 4FLBA 4KZCA 3PE3A 2WMNA 3HIZA 3CSTA 2IJGX 2IOSA 2WXJA 3QARA 2IFUA 3RO2A 2MOWA 4BWRA 4GPKA 3L17A 3TAXA 4DJAA 3RRMB 3S7JA 5AENA 5FZQA 4UWFA 5JJ6A 3U64A 2X6FA 4EQFA 5KJLA 1EYHA 3TJPA 2QY7A 5FQ4A 3FY4A 3MV2B 3SN9A 3TG5A 3UT4A 3MGBA 1Y6IA 3LS8A 4FU3A 4HLEA 5ANLA 4AM9A 4NURA 3VTXA 3GW4A 4UI9K 3OXGA 4B89A 3PRZA 4GMJA 2XGOA 3CKBA 3DPDA 4ILHB 4TUUA 2C0LA 5BT1A 2WQHA 2A4ZA 4EZKA 2XCBA 2FULA 5FTPA 4C0EA 4RG6A 2VSNA 3CHRA 2KM4A 4JZYA 3CLJA 2NC9A 4XKBA 5FZSA 3ASFA 4JA7A 2C0MA 3UT7A 1WAO1 4N3AA 5M72A 2VY3A 2GRLA 4BFRA 4XI0A 1HG5A 4TRQA 4IYPA 4H7YA 3B7RL 5EKQD 4FHKA 4I1AA 4AP2A 4DI4A 3U3WA 3CKCA 2G03A 2IOLA 4U0SA 2KATA 2X38A 4GCOA 2FF4A 3CVPA 4HVBA 4FADA 4W9RA 2XGSA 3IBEA 4GZCA 3O4ZA 2J4BA 1UJJA 3ASGA 3LY7A 5JHBA 1SZAA 4L1BA 1E8YA 1NP7A 3FU0A 3Q47B 5DBKA 5FQ6A 5BNWA 2CHZA 3IHVA 1HG2A 3ASHA 2Y4UA 3CVLA 4ILIA 4AXHA 4JC8A 3G2UA 3EIJA 2J09A 1OWPA 1TEZA 4WNFA 2YINA 3L13A 3QDNA 4JPSA 4HXIA 2XRYA 4PUCA 4A1SA 4WGJA 3B7TA 5C1DA 5HQ8A 2CG3A 2GGFA 4NPSA 1E90A 1OWNA 3QJZA 2DBAA 4JVSA 5LCWJ 4ME2A 3CHOA 2GRMA 3ULQA 5BV1A 4KT6B 3MEKA 1OUVA 4RVBA 4PH4B 2IF4A 3SNXA 3RRNB 2BF0X 4KYOB 1ELWA 3GZ2A 3QC1A 4XE0A 4PY3A 2VGXB 3EDTB 4WNEA 1NZNA 4LUNU 3QOUA 3LYAA 5FT9A 2BTDA 3JQ1A 1QQEA 5EX0A 2X3MA 2LSVA 1EDUA 3BG0B 4GYOA 4YVOA 2NSZA 4G23A 3I4GA 5A6CA 4PS7A 1L5JA 5D0OD 1H19A 2RD0A 2M63A 3B7SA 3FDHA 2DCPA 3I3NA 2J9QA 2J4DA 2LAIA 2V8SE 3PUKA 4LRZA 5E76A 3SFZA 1X5BA 3CQGB 3FUFA 5KJNA 3PVLA 1N54A 5AJLA 2VTBA 3MKRA 3PNLB 5ENNA 4GA0A 3UPVA 4FC8A 1H2VC 5JJ7A 3FUKA 3ZHEA 3JUIA 4GMLA 3FTZA 2HO1A 4JEUA 3ONLA 3RIBA 3C98A 4EZLA 3I5PA 2A5UA 4FHJA 3SBTB 3ZYLA 3ML9A 2XPIA 3ML8A 3O48A 5JFFA 3RK6A 3PEUB 2YQ8A 2XCCA 4I6EA 2VGXA 4CGWA 3APDA 4U07A 4MKTA 4OVVA 2WM9A 2L9BA 3ESLA 3TXNA 1E8WA 3LDZA 1WM5A 3NZUA 2P58C 2PQNA 1IHGA 1EF1C 1MHQA 4I1OB 4GA1A 2WQ6A 3QB2A 3LXUX 1IQUA 1TJFA 4RSYA 5BV0A 5T3RA 4CGVA 3ZC7A 2YNQA 3D9JA 1ELRA 3PE4A 4GZ3A 2AXVA 4U8HA 3WXXA 4UWHA 5E75A 1TJCA 3U9WA 5CMWA 5KJMA 2L0TB 4FA6A 3NQPA 1U3CA 4XKCA 3UMVA 3ZVVA 2I1JA 3PDNA 2AWIA 2IONA 3MZLB 4GU5A 3CHMA 4KZ0A 2WXFA 4I43A 2V0PA 4JXTA 4IULA 4CCAA 3QKYA 1XGWA 4JHJA 4M16A 1EPUA 1XNFA 4P29A 3ZFWA 4DLQA 2WXMA 5BPPA 3ZGQA 4B8AA 4IRUA 2DIWA 4UI9J 5G55A 4K0RA 3OAWA 4G26A 4DPRA 3MV3B 5BW8C 2MHKA 4BTAA 1OWLA 2AXUA 3T8MA 2VSYA 2VZAA 4BT9A 4HORA 3UQ3A 3UT8A 1B89A 2XPZA 3CEQA 3CK7A 4I6GA 3HHMA 5G05J 2IQCA 2FI7A 2KCVA 5FQ8A 3ZEFA 5EU0A 3QNKA 4AEZC 3SI5A 4U04A 1JWFA 3FEYA 1UG3A 3FUEA 4XI9A 3LPZA 1LF8A 3E4BA 2XQ0A 3FWVA 3AS8A 5G04J 4Y6CA 3ASDA 4GCNA 3ENEA 3S7BA 3JQ0A 3SD5A 3VTYA 2J49A 4JHRA 4KBQA 3KD7A 4GA2A 4DLOA 2OOEA 1HE8A 4AVXA 3JCKC 4KMOA 1DNPA 3OXLA 5ANRA 3T5XA 3MJWA 2FO7A 3D9PA 4UWGA 4J6IA 4N5CA 1E7VA 4A3VA 4PS3A 2OVFA 1KLXA 4HOQA 2WXRA 3LVRE 4WWPA 3D9KA 3Q5MA 4G1TA 4HS2A 4I17A 4OVUA 4TV3A 4XI8A 4L23A 3R7RA 1Z3YA 4KXKB 2V5FA 3PS6A 4WUYA 4EECA 2PQRA 1INZA 2VGYA 3AS5A 4F1SA 4G25A 1IYGA 3CR3A 3FU3A 5JFZA 1H2TC 3D9NA 3CUCA 3G2WA 4FULA 3DBSA 2VTBB 3SE5A 1VDYA 5CKLA 4C0MA 3AU4A 3JYSA 1HXIA 2L6JA 1HF8A 4I2WA 2JLBA 4ITRA 2WVIA 2X6IA 3IKOB 4GZ6A 3ZHEB 4EPZA 4I1MA 2VSXE 1IQRA 3CSFA 4Y6WA 2XPYA 3OXFA 3KEZA 4I9EA 4AOFA 3CVXA 4N2SA 5CCMA 5AIJA 3NF1A 3FTSA 4UQYA 4JA9A 1HFAA 4JW1A 5A23A 1KT0A 4HOTA 3G2SA 5KCMA 5CGLA 3ZYMA 4G2VA 4U63A 4ABNA 3S7FA 3ZYKA 2VJ8A 3ZXSA 1W3BA 5JHAA 4LEUA 3P1UA 2V4LA 1ZBPA 3L16A 3LJ3A 2QFCA 3ESKA 4AJWA 1UN9A 5ARGA 3LETA 1MQSA 1OWOA 5FJYA 3VLEA 2KCKA 2PL2A 2LAHA 3SF4A 4D10C 4GYWA 4B0ZA 3SHGA 4APFA 2CHXA 3CVQA 4I6JA 2KCLA 3OTNA 4IN3B 4JL0A 4BSXA 2WXNA 3APFA 3GYZA 4AY6A 3VLFA 4G24A 4N2QA 3Q15A 4EZJA 1DVPA 2WXKA 3FH5A 4NACA 5AJDA 3S2AA 4QFVA 3EIQC 4JEHA 2CG2A 4GAAA 5AYWD 2HM8A 3PEVB 4XZ4A 4U0ZA 2ZU6B 2R59A 3L22A 3ZPJA 1OWMA 3RU0A 4BY6A 3HYMB 2X6HA 3HDXA 5LP0A 4FJYA 1E8XA 3FTUA 3ZRHA 2JK8A 2E0IA 1PY1A 3QWVA 3G2TA 4XIFA 4KVMA 4K03A 4GYYA 1KT1A 1SZ9A 3AS4A 3LCAA 3NZSA 2VSOE 3SBSA 3SGHA 2Y4TA 1ZU2A 3CK8A 3D3MA 3MA5A 4BX8A 1BPOA 1S0PA 3ZN3A 3U66A 2CFUA 2MRIA 4V3IA 4J8SA 2HYZA 3U4TA 1UJKA 3R9AB 4UQZA 1U3DA 2WXPA 4UWLA 3ZCBA 2R17C 1WY6A 3IV0A 2VYIA 2UWJG 3HVEA 3FTWA 2LSUA 3FEXA 4MS6A 3QK0A 3TGOA 1Z3XA 3VLDA 4CDNA 3GZ1A 4N67A 2LNIA 1ELKA 3I4RB 3QAQA 4WAFA 3S6AA 3P2BA 1E96B 1HZ4A 4HOSA 3G2VA 2OV8A 4J8EA 4J0UA 4YNDA 4CRWA 2BUGA 4OYSA 3CK9A 2WXIA 1UN8A 2KC7A 3FUNA 3Q4AB 3FUDA 4WNDA 4APOA 4EBAG 2WXGA 4URKA 3IEGA 2CFZA 4M3OA 3S7DA 2XHEA 4MRUA 3L08A 1N52A 2LO6A 1SQMA 4XX5A 4BX9A 3CVVA 5T8IA 4J8DA 4ILGA 4YVQC 2J08A 1HS6A 5LOZA 5CCLA 3CIAA 3CVWA 2PM6A 3ZW3A 2AVPA 2GW1A 4B8CB 1H2UA 5FWQA 5A7DB 5LFAA 3EHMA 3ZIMA 1GW6A 1UW4B 4MLPA 2I2OA 2F6SA 2E2EA 2Y3AA 3CV0A 5J90A 1P5QA 2WPVA 4GZ5A 2NXPA 4KVOA 5LCWC 3Q49B 5T4YA 5J08A 4GB9A 1YA0A 2WQ7A 3CQCB 1NA0A 2KZTA 3FTYA 4A3TA 3FFLA 2AXZA 5CMYA 4FLHA 2IU1A 4CEMA 4UQXA 4BT8A 4HFGA 3KAEA 3LVQE 2UY1B 3EHNA 3MKQA 3FTXA 3R7QA 2EQXA 4E6HA 3D9IA 3CGHA 2L0IA 3QWWA 4X2EA 2FBNA 3ZYQA 3FULA 2XRZA 4UWKA 4EBAA 2ILRA 5C2YA 2XGMA 3GZSA 4O6FA 5HI7A 2WB2A 3PNTB 3TG4A 3CHSA 4DK5A 3B7UX 5D0QD 3SZ7A 5BUZA 1H6KA 4N39A 3FH7A 3ZLMA 3FUJA 1QZ2A 1Y8MA 2OVBA 3D9LA 2AW6A 3FH8A 4WWNA 5JJTA 1PAQA 3CHPA 4RG9A 3APCA 3PREA 4A55A 2WXLA 3CVYA 3RO3A 3FTVA 3LY9A 3L54A 2PM7A 4N3BA 4U0UA 4ACLA 4ANXA 2VQ2A 4PDXA 3FU5A 2I9CA 2Q7FA 2WMOA 4CDMA 3MCXA 3L6AA 2UY1A 3BEEA 2PZIA 3CVNA 1E8ZA 4I9CA 4N3CA 4E85A 4WWOA 3HVEB 2WXOA 3PZDA 1JUQA 4ACKA 3ONKA 1A17A 3FP3A 3MX3A 4Q96A 4L2LA 1FVFA 3LY8A 3B13A 3FUIA 3PH0C 4ATGA 1NA3A 3D9OA 5LX8A 1PC2A 1FCHA 5KJKA 2FEZA 4I2ZA 1QNFA 4WNGA 2XEVA 4LU4A 4LCTA 3K9IA 4AIFA 2ONDA 3IHYA 3N3UA 3AU5A 4F53A 4NQ0A 4F7AA 4ANUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EX3 A;  4X2D A;  2I6H A;  4B94 A;  4CDR A;  2YHC A;  4AY5 A;  4UI9 C;  1HH8 A;  3N71 A;  4F3V A;  5DIZ A;  3URZ A;  3LKU A;  5G05 C;  4H7X A;  4NRH B;  4HOU A;  3KS2 A;  2C2L A;  5FZR A;  4J8F A;  5ARF A;  3RJV A;  2R5S A;  5G04 C;  5CHE E;  3QWP A;  3RKV A;  5CMT A;  2HR2 A;  4X2C A;  4BTB A;  3UUX A;  3PE3 A;  2IFU A;  3RO2 A;  4BWR A;  4GPK A;  3TAX A;  3S7J A;  5FZQ A;  5JJ6 A;  4EQF A;  5KJL A;  3MV2 B;  3SN9 A;  3TG5 A;  4AM9 A;  3VTX A;  3GW4 A;  4UI9 K;  3OXG A;  2XGO A;  3CKB A;  2C0L A;  5BT1 A;  2WQH A;  2XCB A;  5FTP A;  4RG6 A;  2VSN A;  2NC9 A;  5FZS A;  3ASF A;  4JA7 A;  2C0M A;  1WAO 1;  4N3A A;  5M72 A;  2VY3 A;  4XI0 A;  4H7Y A;  5EKQ D;  4I1A A;  3U3W A;  3CKC A;  2G03 A;  4U0S A;  2KAT A;  4GCO A;  2FF4 A;  3CVP A;  4W9R A;  2XGS A;  3LY7 A;  3ASG A;  3Q47 B;  5DBK A;  5BNW A;  3ASH A;  2Y4U A;  3CVL A;  4WNF A;  3QDN A;  4A1S A;  4WGJ A;  5C1D A;  5HQ8 A;  4NPS A;  5LCW J;  2DBA A;  4ME2 A;  3ULQ A;  3MEK A;  1OUV A;  2IF4 A;  4KYO B;  1ELW A;  3GZ2 A;  4PY3 A;  2VGX B;  3EDT B;  4WNE A;  1NZN A;  3QOU A;  3LYA A;  5FT9 A;  1QQE A;  5EX0 A;  4GYO A;  2LSV A;  4YVO A;  5FJY A;  4G23 A;  5A6C A;  5D0O D;  2J9Q A;  5KJN A;  3MKR A;  4GA0 A;  3UPV A;  5JJ7 A;  3ZHE A;  2HO1 A;  3RIB A;  2XPI A;  3O48 A;  5JFF A;  2YQ8 A;  2XCC A;  4CGW A;  2VGX A;  4U07 A;  1WM5 A;  2P58 C;  2PQN A;  1IHG A;  4GA1 A;  4CGV A;  3ZC7 A;  1ELR A;  3PE4 A;  4GZ3 A;  3WXX A;  1TJC A;  5KJM A;  3PDN A;  3QKY A;  4M16 A;  1XNF A;  3ZFW A;  3ZGQ A;  4UI9 J;  4G26 A;  3MV3 B;  5BW8 C;  2MHK A;  4BTA A;  2VSY A;  2VZA A;  4BT9 A;  4HOR A;  3UQ3 A;  1B89 A;  3CK7 A;  3CEQ A;  5G05 J;  2FI7 A;  2KCV A;  5EU0 A;  4U04 A;  4XI9 A;  3LPZ A;  3E4B A;  3FWV A;  3AS8 A;  5G04 J;  4Y6C A;  3ASD A;  4GCN A;  3S7B A;  3VTY A;  4JHR A;  4KBQ A;  3KD7 A;  4GA2 A;  2OOE A;  3OXL A;  2FO7 A;  4N5C A;  4HOQ A;  1KLX A;  3Q5M A;  4G1T A;  4I17 A;  4XI8 A;  4KXK B;  2V5F A;  4WUY A;  2PQR A;  2VGY A;  3AS5 A;  4G25 A;  1IYG A;  5JFZ A;  3CUC A;  3SE5 A;  5CKL A;  3JYS A;  1HXI A;  2L6J A;  4I2W A;  2JLB A;  4ITR A;  4GZ6 A;  3ZHE B;  4Y6W A;  3OXF A;  4I9E A;  4N2S A;  5CCM A;  3NF1 A;  4UQY A;  4JA9 A;  1KT0 A;  4HOT A;  5CGL A;  4G2V A;  4ABN A;  3S7F A;  1W3B A;  4LEU A;  1ZBP A;  2QFC A;  3ESK A;  5ARG A;  3LET A;  2KCK A;  2PL2 A;  3SF4 A;  4GYW A;  3SHG A;  3CVQ A;  2KCL A;  4IN3 B;  4JL0 A;  3GYZ A;  4AY6 A;  4G24 A;  4N2Q A;  3Q15 A;  5AYW D;  4U0Z A;  3ZPJ A;  3RU0 A;  3HYM B;  2JK8 A;  3QWV A;  4XIF A;  4GYY A;  1KT1 A;  3AS4 A;  3LCA A;  2Y4T A;  1ZU2 A;  3CK8 A;  3MA5 A;  3ZN3 A;  3U4T A;  2HYZ A;  3R9A B;  4UQZ A;  3ZCB A;  2UWJ G;  2VYI A;  2LSU A;  3TGO A;  3GZ1 A;  4N67 A;  2LNI A;  3S6A A;  1E96 B;  1HZ4 A;  4HOS A;  4J0U A;  4J8E A;  4YND A;  2BUG A;  3CK9 A;  3Q4A B;  2KC7 A;  4WND A;  4APO A;  3IEG A;  3S7D A;  4J8D A;  4YVQ C;  5CCL A;  2AVP A;  2GW1 A;  5A7D B;  2F6S A;  2E2E A;  3CV0 A;  1P5Q A;  2WPV A;  4GZ5 A;  5LCW C;  3Q49 B;  1YA0 A;  1NA0 A;  3FFL A;  4UQX A;  4BT8 A;  3KAE A;  2UY1 B;  3QWW A;  4X2E A;  2FBN A;  2XGM A;  4O6F A;  5HI7 A;  3TG4 A;  5D0Q D;  3SZ7 A;  4N39 A;  3ZLM A;  1QZ2 A;  1Y8M A;  5JJT A;  4RG9 A;  3RO3 A;  3LY9 A;  4N3B A;  4U0U A;  2VQ2 A;  2Q7F A;  2UY1 A;  3BEE A;  2PZI A;  3CVN A;  4I9C A;  4N3C A;  1A17 A;  3FP3 A;  3LY8 A;  1NA3 A;  1PC2 A;  1FCH A;  5KJK A;  2FEZ A;  4I2Z A;  4WNG A;  2XEV A;  4LU4 A;  3K9I A;  4AIF A;  2OND A;  3N3U A;  4NQ0 A; 
#chains in the Genus database with same CATH topology
 5FQ7 A;  3SQV A;  4DX2 A;  2I6H A;  4B94 A;  4A1G A;  4XEI G;  4FJZ A;  2OCC E;  5EDS A;  3ZNG A;  1OCO E;  2Y69 E;  3N71 A;  4JHK A;  1JWG A;  1HO8 A;  4H7X A;  1JPL A;  2B6C A;  5KBA A;  5G2N A;  3MYV A;  3PZ2 A;  4PS8 A;  1Z5S C;  3DEO A;  2R5S A;  5G04 C;  4C9B B;  3CHQ A;  2QC9 A;  2YHE A;  2KZT B;  2XZD G;  2I1K A;  3DST A;  4Q69 A;  3PUJ A;  1JCS A;  3ULY A;  4BTB A;  2J07 A;  1FPP A;  3HIZ A;  1X81 A;  3RO2 A;  3SY2 A;  3L17 A;  5FIN A;  5JJ6 A;  1D8D A;  4ZFH A;  5CEA A;  2MYO A;  3MGB A;  1RW2 A;  3OXG A;  2XGO A;  3CKB A;  1N4S A;  2P9N G;  3Q7A A;  3Q9N C;  2XCB A;  5FTP A;  3CLJ A;  2NC9 A;  5M72 A;  2VY3 A;  2GRL A;  4XI0 A;  3WG7 E;  4AP2 A;  4DI4 A;  3CKC A;  2XEE A;  2G03 A;  3CVP A;  4TXP A;  4FAD A;  4W9R A;  3IBE A;  1UJJ A;  4BSZ B;  1N0Q A;  5FQ6 A;  3Q47 B;  5DBK A;  2CHZ A;  3BU8 A;  3IHV A;  5ENP D;  2XS8 A;  3CVL A;  4ILI A;  3G2U A;  4N5Q A;  2DYR E;  1TEZ A;  4WNF A;  5HQ8 A;  3DRA A;  1OWN A;  3QJZ A;  3C5R A;  2DBA A;  3CHO A;  2R05 A;  3ULQ A;  3SNX A;  3RRN B;  4KYO B;  3GZ2 A;  4WNE A;  3EHQ A;  5FT9 A;  2QYU A;  1DC2 A;  3D9H A;  4YVO A;  1EDU A;  5A6C A;  4PS7 A;  1OCR E;  2RD0 A;  2M63 A;  3B7S A;  5E76 A;  3I3N A;  1X5B A;  3L9T A;  5KJN A;  5ENN A;  1LTX A;  3UPV A;  5JJ7 A;  3ZHE A;  4GML A;  3FTZ A;  3Q73 A;  3I5P A;  3UKU G;  2A5U A;  3AG4 E;  2VGX A;  5ENS D;  5EYP F;  1MHQ A;  4GA1 A;  3QB2 A;  3ZC7 A;  4OAU C;  1ELR A;  4GZ3 A;  2AXV A;  4M7C A;  3ZXP A;  5H7P A;  5EN5 D;  2I1J A;  2XZT G;  5AQ7 A;  1AWC B;  2V0P A;  3QKY A;  4RLY A;  1XNF A;  4DLQ A;  2WXM A;  4K0R A;  4G26 A;  2MHK A;  1OWL A;  2NYJ A;  3DXM G;  2VSY A;  4BT9 A;  4HOR A;  1B89 A;  3CEQ A;  4I6G A;  4ZHB A;  5EU0 A;  3FEY A;  3TWQ A;  3LPZ A;  3FWV A;  2XQ0 A;  4Y6C A;  3ENE A;  3JQ0 A;  3EUV A;  4KBQ A;  3KD7 A;  3UM1 A;  1HE8 A;  2XEN A;  5ANR A;  3MJW A;  2Y0B G;  3D9P A;  4A3V A;  3KSQ A;  2OVF A;  4HOQ A;  4WWP A;  3LVR E;  4HS2 A;  4L23 A;  1INZ A;  2PQR A;  4F1S A;  3FU3 A;  5JFZ A;  1H2T C;  3G2W A;  2VTB B;  4C0M A;  4GTO A;  4GZ6 A;  4ITR A;  1WDY A;  1MX2 A;  4UQY A;  5A23 A;  1KT0 A;  4GTV A;  2VJ8 A;  2V4L A;  2XS1 A;  2QFC A;  1UN9 A;  3UI2 A;  3LET A;  3UM3 A;  3SF4 A;  2P9L G;  4B0Z A;  3KEA A;  1TNY A;  2EIM E;  4I6J A;  3OTN A;  4IN3 B;  5CBN A;  3V2O A;  5AAR A;  3APF A;  4AY6 A;  3FH5 A;  4QFV A;  3PEV B;  1QYM A;  2ZU6 B;  2R59 A;  3ZPJ A;  1OWM A;  3HYM B;  3HDX A;  4FJY A;  3FTU A;  1OCC E;  4HI9 A;  4J7W A;  4K03 A;  4GYY A;  3LCA A;  2VSO E;  2Y4T A;  1K1B A;  3TWW A;  1ZU2 A;  3MA5 A;  1OCZ E;  1S0P A;  2CFU A;  4V3I A;  2HYZ A;  1UJK A;  5AQA A;  1N4R A;  1SA4 A;  2RFA A;  3HVE A;  3FEX A;  3QK0 A;  2ETA A;  2LNI A;  3QAQ A;  3EU9 A;  3JUE A;  2OV8 A;  4J8E A;  1JCR A;  4OYS A;  4O60 A;  2KC7 A;  1DCQ A;  1N4Q A;  2CFZ A;  4MRU A;  2LXM A;  5EID A;  2LO6 A;  5T8I A;  3KSL A;  2J08 A;  1H2U A;  5FWQ A;  3EHM A;  1GW6 A;  2Y1L E;  3HG0 D;  4KVO A;  5LCW C;  1O1R A;  5J08 A;  4GB9 A;  3CQC B;  2VGE A;  3FFL A;  4G8K A;  4TXQ A;  3MKQ A;  4E6H A;  3QWW A;  4EBA A;  2XGM A;  3GZS A;  3T8K A;  1QZ2 A;  2OVB A;  2R2L A;  4Z68 A;  2F8X K;  3CHP A;  1QBQ A;  4A55 A;  2WXL A;  3FTV A;  3L54 A;  1S63 A;  2PM7 A;  4ACL A;  2VQ2 A;  1LD7 A;  3FU5 A;  2Q7F A;  3BEE A;  4E85 A;  4U7E B;  4TUM A;  3PZD A;  3MX3 A;  3B13 A;  3TWV A;  5KJK A;  3LJN A;  2FEZ A;  2XEV A;  4LCT A;  3K9I A;  2OND A;  3CVU A;  4JB8 P;  3SHF A;  4UI9 C;  2WXQ A;  4YDO A;  1NH1 A;  4Q94 A;  4FP7 A;  4DX6 D;  3ZKJ A;  2H6I A;  5DIZ A;  2RG8 A;  1HU3 A;  3EJN A;  1HX8 A;  4LER A;  2WXH A;  4LSZ E;  3FUM A;  2C2L A;  3BQO A;  5FZR A;  4J8F A;  4ANW A;  5CHE E;  1Z6T A;  3FHE A;  1TN7 A;  3RKV A;  5CMT A;  2HR2 A;  3RSE G;  4TXR A;  2IOS A;  3UKR G;  2IFU A;  4EQF A;  1EYH A;  2QY7 A;  3SN9 A;  3TG5 A;  3E34 A;  4QQI A;  4AM9 A;  4B89 A;  4GMJ A;  4ILH B;  1BI7 B;  5D66 A;  2C0L A;  5BT1 A;  2WQH A;  3E30 A;  2FUL A;  4C0E A;  2VSN A;  4GTQ A;  4YDY A;  5FZS A;  2BED A;  4TRQ A;  3B7R L;  5B1A E;  2IOL A;  4U0S A;  2AJA A;  2KAT A;  2FF4 A;  2XGS A;  3TWR A;  5JHB A;  3DSV A;  3ASH A;  3ASO E;  2GRR B;  4AXH A;  2J09 A;  1S70 B;  4JPS A;  4HXI A;  4A1S A;  4WGJ A;  2RFM A;  1IXV A;  4JVS A;  1E90 A;  2GRM A;  2V4H C;  2IF4 A;  5CRV A;  4XE0 A;  4PY3 A;  2ZXW E;  2VGX B;  4RQI A;  1QQE A;  2X3M A;  2NSZ A;  3ZU7 B;  4U95 D;  2J9Q A;  2J4D A;  2V8S E;  4LRZ A;  1K1A A;  3FUF A;  4J8Y A;  1ZB1 A;  1N54 A;  3V31 A;  3MKR A;  4FC8 A;  3TWU A;  4JEU A;  3C98 A;  3R9M A;  3ZYL A;  3ML9 A;  3ML8 A;  3O48 A;  2KXP C;  3PEU B;  2XCC A;  2ZIS A;  4U07 A;  4MKT A;  2WM9 A;  3ESL A;  4I1O B;  4RSY A;  5T3R A;  2YNQ A;  4UWH A;  4HB5 A;  5E75 A;  1TJC A;  4F1P A;  3U9W A;  5KJM A;  3HXC A;  3NQP A;  3PDN A;  2AWI A;  3SFX A;  4I43 A;  4CCA A;  3ZFW A;  4B8A A;  3TWX A;  5BW8 C;  3UT8 A;  5G05 J;  1TR4 A;  3JXI A;  1JWF A;  4DX5 D;  1UG3 A;  2L6B A;  1LF8 A;  3ASD A;  4GCN A;  3S7B A;  3VTY A;  2J49 A;  4GA2 A;  2OOE A;  4AVX A;  2FO7 A;  4N5C A;  1KLX A;  2WXR A;  2B0O E;  4I17 A;  3AS5 A;  3AG2 E;  3SO8 A;  1IYG A;  3CR3 A;  4FUL A;  3SE5 A;  2L6J A;  2JLB A;  2WVI A;  1IQR A;  3B95 A;  2XPY A;  3KEZ A;  4I9E A;  4AOF A;  3F6Q A;  4N2S A;  5AIJ A;  3FTS A;  4JA9 A;  1HFA A;  4JW1 A;  3G2S A;  3HXF A;  3ZYM A;  4ABN A;  5CER B;  1BD8 A;  4LEU A;  3ESK A;  1MQS A;  3VLE A;  3DSX A;  2CHX A;  5AN8 A;  1A5E A;  3UTM A;  4BEP A;  3EIQ C;  2CG2 A;  4GAA A;  4BY6 A;  5LP0 A;  2X6H A;  2DVW A;  4BET A;  4CZ2 D;  3ULE G;  2IO2 C;  3UIO C;  3SBS A;  3SGH A;  3CK8 A;  3D3M A;  4BX8 A;  1BPO A;  2MRI A;  1OY3 D;  4UQZ A;  1S64 A;  3TWT A;  3ZCB A;  1WY6 A;  3IV0 A;  2VYI A;  3FTW A;  3VLD A;  2DZN A;  3I4R B;  4WAF A;  2NUD A;  5EYL A;  1E96 B;  1G3N B;  3CK9 A;  5CBO A;  3Q4A B;  1UN8 A;  4EBA G;  4URK A;  4LNG A;  3IEG A;  3L08 A;  1SQM A;  3CVV A;  1HS6 A;  2DYS E;  5LOZ A;  3CVW A;  2AVP A;  2GW1 A;  4B8C B;  2ZIR A;  3ZIM A;  3PZ4 A;  4O1O A;  2I2O A;  2E2E A;  2F37 A;  3CV0 A;  5AQ9 A;  4GZ5 A;  2NXP A;  1NFI E;  4ATZ D;  1YA0 A;  1NA0 A;  2KZT A;  3FTY A;  4A3T A;  4FLH A;  2IU1 A;  4UQX A;  3FTX A;  3Q75 A;  3D9I A;  2RKK A;  3HRA A;  3FUL A;  3TG4 A;  2OEV A;  4GTP A;  5KNH D;  2GRP B;  4DK5 A;  3B7U X;  5D0Q D;  3SZ7 A;  5BUZ A;  4N39 A;  3FH7 A;  3HXE A;  2AW6 A;  1PAQ A;  4OAV B;  3RO3 A;  1TNB A;  2IEJ A;  3CVN A;  1E8Z A;  4N3C A;  2GRO B;  4WWO A;  4ACK A;  4HI8 A;  1YCS B;  4U8Y D;  3PH0 C;  4ATG A;  3SFY A;  5LX8 A;  2IY0 C;  4EHM A;  3C3O A;  3AU5 A;  4ANU A;  2P9U G;  4HLL A;  5EX3 A;  1H0A A;  4X2D A;  3D9M A;  4GZD A;  4CDR A;  3J5P A;  2YHC A;  4L2Y A;  2X6K A;  4AV7 A;  2CHW A;  2X6J A;  1HH8 A;  4F3V A;  3URZ A;  3LKU A;  3FUH A;  1N95 A;  1V55 E;  3KS2 A;  5CED B;  5ARF A;  3FU6 A;  3UX4 A;  4X2C A;  4G11 A;  3NB2 A;  4DI3 A;  4KZC A;  3PE3 A;  2WMN A;  3QAR A;  1JCQ A;  3UXG A;  3TAX A;  2ETC A;  4DJA A;  3S7J A;  4UWF A;  2X6F A;  2P9P G;  5KJL A;  1IKN D;  3TJP A;  4HQD A;  5FQ4 A;  1K3Z D;  1YMP A;  3PZ3 A;  3MV2 B;  3Q79 A;  4FU3 A;  4HLE A;  5ANL A;  3VTX A;  3GW4 A;  4UI9 K;  3PRZ A;  3DPD A;  2DZO A;  4RG6 A;  3EU5 A;  2KM4 A;  4JZY A;  3UT7 A;  3ASF A;  4N3A A;  1N11 A;  1HG5 A;  4NIK A;  1O1T A;  4X8Q A;  3O4Z A;  2J4B A;  3ASG A;  3LY7 A;  1SZA A;  4HRN A;  1E8Y A;  1NP7 A;  3FU0 A;  5BNW A;  4HBD A;  1NI1 A;  4JC8 A;  3EIJ A;  5CRU A;  1OWP A;  5HRY A;  3W9G A;  2P2C P;  3V2X A;  4LG6 A;  1KPS B;  1ELW A;  1TNU A;  3EDT B;  1NZN A;  3JQ1 A;  5EX0 A;  3BG0 B;  3I4G A;  1L5J A;  2DCP A;  3V30 A;  2LAI A;  4CYM D;  3CQG B;  5AJL A;  2VTB A;  4GA0 A;  1H2V C;  3NOG D;  3AJI A;  3FUK A;  1AP7 A;  3ONL A;  3RIB A;  3SBT B;  3UIP C;  3DSS A;  3Q78 A;  5ENR D;  3RK6 A;  2YQ8 A;  4I6E A;  3APD A;  4GPM A;  1BLX B;  3J5Q B;  4OVV A;  2L9B A;  5AQB A;  3TXN A;  3LDZ A;  2P58 C;  1IQU A;  1TJF A;  4BES A;  5BV0 A;  3WXX A;  1Q2Z A;  4GTR A;  2L0T B;  4FA6 A;  4XKC A;  3ZVV A;  3ABM E;  2ION A;  3MZL B;  1IHB A;  3CHM A;  4KZ0 A;  4P29 A;  1XGW A;  1EPU A;  5G55 A;  4DPR A;  3BUA A;  4BTA A;  4DX1 A;  2AXU A;  2VZA A;  3CK7 A;  1OXJ A;  3HHM A;  2IQC A;  2FI7 A;  5FQ8 A;  3QNK A;  4GTS A;  1N9A A;  2NUN A;  3AS8 A;  5G04 J;  1KZP A;  4JHR A;  1KZO A;  4DLO A;  1TN6 A;  3JCK C;  4KMO A;  3OXL A;  2KBX A;  5KWD A;  4UWG A;  4J6I A;  2EIL E;  4OVU A;  2V5F A;  4WUY A;  2VGY A;  4G25 A;  5B3S E;  2ETB A;  5IY5 E;  3X2Q E;  3DBS A;  1VDY A;  5CKL A;  3AU4 A;  1HXI A;  3IKO B;  3ZHE B;  4I1M A;  5JMN D;  3OXF A;  3CVX A;  5CCM A;  4HOT A;  5KCM A;  5CGL A;  2EIN E;  1W3B A;  3AG1 E;  3L16 A;  5ARG A;  2PL2 A;  3CVQ A;  2KCL A;  4JL0 A;  2WXN A;  4O1P A;  3PZ1 A;  4G24 A;  3ASN E;  1H6P A;  4EZJ A;  1DVP A;  4NAC A;  4JEH A;  4XZ4 A;  2HM8 A;  4U0Z A;  3L22 A;  3ZRH A;  1DCE A;  1PY1 A;  1TN8 A;  4XIF A;  4KVM A;  1MJ0 A;  1D8E A;  3NZS A;  4K5C A;  5HS0 A;  1BI8 B;  3U66 A;  3U4T A;  2BKK B;  1MX6 A;  3R9A B;  1SA5 A;  4UWL A;  2UWJ G;  2LSU A;  3TGO A;  4CDN A;  4N67 A;  1ELK A;  2GRQ B;  3S6A A;  3P2B A;  1HZ4 A;  3G2V A;  5ENO D;  4YND A;  4CRW A;  3T9K A;  2WXI A;  2ZGD A;  3FUD A;  4WND A;  4APO A;  1MYO A;  2A5E A;  1N52 A;  4XX5 A;  4BX9 A;  1O1S A;  4F6R D;  3HXB A;  4YVQ C;  2PM6 A;  5A7D B;  5LFA A;  1UW4 B;  2F6S A;  2F0Y A;  2Y3A A;  5J90 A;  1P5Q A;  4HNA D;  5ENQ D;  2WQ7 A;  2AXZ A;  5CMY A;  4CEM A;  4BT8 A;  4HFG A;  1H6O A;  3LVQ E;  3R7Q A;  2L0I A;  3C3Q A;  3ZYQ A;  2FBN A;  2XRZ A;  1BU9 A;  2EIJ E;  5HI7 A;  2LXL A;  2FO1 E;  3CHS A;  3ZLM A;  3FUJ A;  1Y8M A;  4WWN A;  5BXO A;  4GTT A;  4RG9 A;  3PRE A;  3LY9 A;  3B7B A;  4ANX A;  3DPY A;  3DXK G;  2WMO A;  3C3R A;  4CDM A;  3MCX A;  2UY1 A;  2PZI A;  4I9C A;  3HVE B;  4U8V D;  1JUQ A;  3ONK A;  4GMR A;  2JAB A;  3LY8 A;  1NA3 A;  2DWZ A;  1O5M A;  4I2Z A;  1K8K G;  4HRM B;  3N3U A;  4F53 A;  4NQ0 A;  5ITZ F;  1MX4 A;  4R7L A;  4AY5 A;  5EIB E;  1OT8 A;  3TXM A;  4CT0 A;  2P9I G;  5CEC B;  3RRU A;  3AG3 E;  3LEW A;  5G05 C;  4CT4 A;  2JEK A;  3DSW A;  3T5V A;  4NRH B;  4HOU A;  1E7U A;  1FVH A;  3RJV A;  3UM0 A;  3QWP A;  3BG1 B;  3V79 K;  2HE0 A;  3TL5 A;  4ANV A;  3DEP A;  3MKQ B;  3UUX A;  4L7T A;  4FLB A;  4U96 D;  3CST A;  2IJG X;  2WXJ A;  2MOW A;  5JA4 D;  4BWR A;  4DX7 D;  4GPK A;  4B93 B;  3RRM B;  5FIO A;  5AEN A;  5FZQ A;  1MZC A;  3U64 A;  4G8L A;  3JXJ A;  3FY4 A;  3UT4 A;  1Y6I A;  3LS8 A;  4NUR A;  4TUU A;  2A4Z A;  4EZK A;  3CHR A;  3RAU A;  1V54 E;  2OEW A;  4XKB A;  4JA7 A;  2C0M A;  1WAO 1;  2IO3 C;  4BFR A;  4IYP A;  4H7Y A;  5EKQ D;  4FHK A;  4I1A A;  3U3W A;  4GCO A;  2X38 A;  4HVB A;  4GZC A;  4L1B A;  4MBG A;  1HG2 A;  2Y4U A;  2YIN A;  3L13 A;  3QDN A;  2XRY A;  4PUC A;  3B7T A;  5C1D A;  3NAW A;  2CG3 A;  1TYQ G;  2GGF A;  4NPS A;  5LCW J;  1FT1 A;  4YDW A;  4ME2 A;  5BV1 A;  4KT6 B;  3MEK A;  1OUV A;  2PNN A;  4RVB A;  4PH4 B;  1YYH A;  2BF0 X;  3DSU A;  3QC1 A;  4LUN U;  3QOU A;  3LYA A;  4YDE A;  2BTD A;  3E32 A;  5FJY A;  4GYO A;  2LSV A;  3UIN C;  4G23 A;  2H6F A;  5D0O D;  1H19 A;  3FDH A;  3PUK A;  3SFZ A;  3E33 A;  1SW6 A;  4DRX E;  3PVL A;  3PNL B;  2P9S G;  2R02 A;  2BKG A;  3JUI A;  2HO1 A;  4EZL A;  4FHJ A;  1D9S A;  3ABL E;  2XPI A;  5JFF A;  3L82 A;  4CGW A;  3NOC D;  4LNB A;  5D2M C;  1E8W A;  1WM5 A;  3NZU A;  2PQN A;  1IHG A;  1EF1 C;  2WQ6 A;  3LXU X;  2P9K G;  4CGV A;  3AAA C;  3Q7F A;  3D9J A;  3PE4 A;  4U8H A;  5CMW A;  1U3C A;  4C48 B;  3UMV A;  4GU5 A;  2WXF A;  4JXT A;  4IUL A;  4JHJ A;  4M16 A;  5BPP A;  3ZGQ A;  4IRU A;  2DIW A;  4UI9 J;  3OAW A;  3MV3 B;  2V5Q C;  3T8M A;  1NL4 A;  3UQ3 A;  2XPZ A;  2KCV A;  1N0R A;  3ZEF A;  4AEZ C;  3SI5 A;  4U04 A;  3FUE A;  4XI9 A;  3E4B A;  2H6G A;  3SD5 A;  1N94 A;  5ENT D;  1DNP A;  3IXE A;  3T5X A;  1E7V A;  4PS3 A;  3D9K A;  3Q5M A;  4G1T A;  4TV3 A;  4XI8 A;  3R7R A;  1Z3Y A;  4KXK B;  3PS6 A;  4EEC A;  5B1B E;  2EIK E;  1LD8 A;  2XEH A;  3D9N A;  3CUC A;  3JYS A;  1HF8 A;  4I2W A;  2R03 A;  2X6I A;  4EPZ A;  2VSX E;  3CSF A;  4Y6W A;  2J8S D;  3NF1 A;  4GTM A;  3W9F A;  4G2V A;  4U63 A;  3S7F A;  3ZYK A;  3ZXS A;  5JHA A;  5AAO A;  3P1U A;  3Q9U C;  1ZBP A;  3LJ3 A;  3ZUV B;  4AJW A;  1OWO A;  2KCK A;  2LAH A;  4D10 C;  4GYW A;  3SHG A;  4APF A;  1SVX A;  4JD2 G;  3HXD A;  2F8Y A;  3DWL G;  4BSX A;  3GYZ A;  3VLF A;  4N2Q A;  3Q15 A;  4LNU D;  2WXK A;  3S2A A;  5AJD A;  5AYW D;  5KNG A;  1RZ4 A;  2H6H A;  3RU0 A;  1E8X A;  2JK8 A;  2E0I A;  4K5B A;  3QWV A;  3G2T A;  1KT1 A;  1SZ9 A;  3AS4 A;  3ZN3 A;  4J8S A;  3ABK E;  1U3D A;  2WXP A;  2R17 C;  3ISM C;  4MS6 A;  1Z3X A;  3GZ1 A;  3UM2 A;  4HOS A;  4J0U A;  2BUG A;  3FUN A;  2WXG A;  4M3O A;  4HRL A;  3S7D A;  4DUI A;  2XHE A;  1TNZ A;  1UOH A;  4BER A;  4J8D A;  4ILG A;  5CCL A;  3CIA A;  3C72 A;  3ZW3 A;  5BXU A;  4UUC A;  4MLP A;  2QYJ A;  3EHR A;  2WPV A;  3Q49 B;  5T4Y A;  1WG0 A;  2QZA A;  3KAE A;  2UY1 B;  3EHN A;  2EQX A;  3CGH A;  2LUH A;  4X2E A;  4UWK A;  2ILR A;  5C2Y A;  4O6F A;  2WB2 A;  4K5A B;  3PNT B;  5EIL A;  1H6K A;  4L9P A;  1U2V G;  3D9L A;  3FH8 A;  5JJT A;  3APC A;  5HKP A;  3TWS A;  3CVY A;  2GRN B;  4N3B A;  4U0U A;  1FT2 A;  1TNO A;  1N4P A;  4PDX A;  2I9C A;  2ZGG A;  3L6A A;  3E37 A;  2WXO A;  1A17 A;  3FP3 A;  4Q96 A;  4L2L A;  1FVF A;  3FUI A;  3D9O A;  1PC2 A;  1FCH A;  1QNF A;  4WNG A;  4LU4 A;  3NBN B;  4A63 B;  4AIF A;  3IHY A;  4F7A A; 
#chains in the Genus database with same CATH homology
 5FQ7 A;  5EX3 A;  1H0A A;  4X2D A;  2I6H A;  3D9M A;  3CVU A;  4B94 A;  4A1G A;  4GZD A;  4CDR A;  3SHF A;  4R7L A;  4FJZ A;  2YHC A;  4L2Y A;  4UI9 C;  4AY5 A;  2WXQ A;  2X6K A;  4AV7 A;  5EDS A;  2CHW A;  4Q94 A;  2X6J A;  1HH8 A;  3TXM A;  4CT0 A;  4FP7 A;  3N71 A;  4JHK A;  4F3V A;  5DIZ A;  2RG8 A;  3URZ A;  1HU3 A;  3RRU A;  1JWG A;  3LEW A;  3LKU A;  5G05 C;  1HO8 A;  4H7X A;  3EJN A;  3FUH A;  2JEK A;  4CT4 A;  1HX8 A;  1JPL A;  3T5V A;  4LER A;  4NRH B;  2WXH A;  4HOU A;  5G2N A;  3KS2 A;  3MYV A;  3FUM A;  2C2L A;  4PS8 A;  5FZR A;  1E7U A;  1FVH A;  4J8F A;  5ARF A;  3RJV A;  4ANW A;  2R5S A;  5G04 C;  4C9B B;  3CHQ A;  5CHE E;  3FU6 A;  3UX4 A;  2YHE A;  1Z6T A;  3FHE A;  2KZT B;  3QWP A;  3BG1 B;  2I1K A;  4Q69 A;  3PUJ A;  3RKV A;  3TL5 A;  4ANV A;  5CMT A;  2HR2 A;  4X2C A;  4BTB A;  3MKQ B;  2J07 A;  4G11 A;  3UUX A;  4DI3 A;  4L7T A;  4FLB A;  4KZC A;  3PE3 A;  2WMN A;  3HIZ A;  3CST A;  2IJG X;  2IOS A;  2WXJ A;  3QAR A;  2IFU A;  3RO2 A;  2MOW A;  4BWR A;  4GPK A;  3L17 A;  3TAX A;  4DJA A;  3RRM B;  3S7J A;  5AEN A;  5FZQ A;  4UWF A;  5JJ6 A;  3U64 A;  2X6F A;  4EQF A;  5KJL A;  1EYH A;  3TJP A;  2QY7 A;  5FQ4 A;  3FY4 A;  3MV2 B;  3SN9 A;  3TG5 A;  3UT4 A;  3MGB A;  1Y6I A;  3LS8 A;  4FU3 A;  4HLE A;  5ANL A;  4AM9 A;  4NUR A;  3VTX A;  3GW4 A;  4UI9 K;  3OXG A;  4B89 A;  3PRZ A;  4GMJ A;  2XGO A;  3CKB A;  3DPD A;  4ILH B;  4TUU A;  2C0L A;  5BT1 A;  2WQH A;  2A4Z A;  4EZK A;  2XCB A;  2FUL A;  5FTP A;  4C0E A;  4RG6 A;  2VSN A;  3CHR A;  2KM4 A;  4JZY A;  3CLJ A;  2NC9 A;  4XKB A;  5FZS A;  3ASF A;  4JA7 A;  2C0M A;  3UT7 A;  1WAO 1;  4N3A A;  5M72 A;  2VY3 A;  2GRL A;  4BFR A;  4XI0 A;  1HG5 A;  4TRQ A;  4IYP A;  4H7Y A;  3B7R L;  5EKQ D;  4FHK A;  4I1A A;  4AP2 A;  4DI4 A;  3U3W A;  3CKC A;  2G03 A;  2IOL A;  4U0S A;  2KAT A;  2X38 A;  4GCO A;  2FF4 A;  3CVP A;  4HVB A;  4FAD A;  4W9R A;  2XGS A;  3IBE A;  4GZC A;  3O4Z A;  2J4B A;  1UJJ A;  3ASG A;  3LY7 A;  5JHB A;  1SZA A;  4L1B A;  1E8Y A;  1NP7 A;  3FU0 A;  3Q47 B;  5DBK A;  5FQ6 A;  5BNW A;  2CHZ A;  3IHV A;  1HG2 A;  3ASH A;  2Y4U A;  3CVL A;  4ILI A;  4AXH A;  4JC8 A;  3G2U A;  3EIJ A;  2J09 A;  1OWP A;  1TEZ A;  4WNF A;  2YIN A;  3L13 A;  3QDN A;  4JPS A;  4HXI A;  2XRY A;  4PUC A;  4A1S A;  4WGJ A;  3B7T A;  5C1D A;  5HQ8 A;  2CG3 A;  2GGF A;  4NPS A;  1E90 A;  1OWN A;  3QJZ A;  2DBA A;  4JVS A;  5LCW J;  4ME2 A;  3CHO A;  2GRM A;  3ULQ A;  5BV1 A;  4KT6 B;  3MEK A;  1OUV A;  4RVB A;  4PH4 B;  2IF4 A;  3SNX A;  3RRN B;  2BF0 X;  4KYO B;  1ELW A;  3GZ2 A;  3QC1 A;  4XE0 A;  4PY3 A;  2VGX B;  3EDT B;  4WNE A;  1NZN A;  4LUN U;  3QOU A;  3LYA A;  5FT9 A;  2BTD A;  3JQ1 A;  1QQE A;  5EX0 A;  2X3M A;  2LSV A;  1EDU A;  3BG0 B;  4GYO A;  4YVO A;  2NSZ A;  4G23 A;  3I4G A;  5A6C A;  4PS7 A;  1L5J A;  5D0O D;  1H19 A;  2RD0 A;  2M63 A;  3B7S A;  3FDH A;  2DCP A;  3I3N A;  2J9Q A;  2J4D A;  2LAI A;  2V8S E;  3PUK A;  4LRZ A;  5E76 A;  3SFZ A;  1X5B A;  3CQG B;  3FUF A;  5KJN A;  3PVL A;  1N54 A;  5AJL A;  2VTB A;  3MKR A;  3PNL B;  5ENN A;  4GA0 A;  3UPV A;  4FC8 A;  1H2V C;  5JJ7 A;  3FUK A;  3ZHE A;  3JUI A;  4GML A;  3FTZ A;  2HO1 A;  4JEU A;  3ONL A;  3RIB A;  3C98 A;  4EZL A;  3I5P A;  2A5U A;  4FHJ A;  3SBT B;  3ZYL A;  3ML9 A;  2XPI A;  3ML8 A;  3O48 A;  5JFF A;  3RK6 A;  3PEU B;  2YQ8 A;  2XCC A;  4I6E A;  2VGX A;  4CGW A;  3APD A;  4U07 A;  4MKT A;  4OVV A;  2WM9 A;  2L9B A;  3ESL A;  3TXN A;  1E8W A;  3LDZ A;  1WM5 A;  3NZU A;  2P58 C;  2PQN A;  1IHG A;  1EF1 C;  1MHQ A;  4I1O B;  4GA1 A;  2WQ6 A;  3QB2 A;  3LXU X;  1IQU A;  1TJF A;  4RSY A;  5BV0 A;  5T3R A;  4CGV A;  3ZC7 A;  2YNQ A;  3D9J A;  1ELR A;  3PE4 A;  4GZ3 A;  2AXV A;  4U8H A;  3WXX A;  4UWH A;  5E75 A;  1TJC A;  3U9W A;  5CMW A;  5KJM A;  2L0T B;  4FA6 A;  3NQP A;  1U3C A;  4XKC A;  3UMV A;  3ZVV A;  2I1J A;  3PDN A;  2AWI A;  2ION A;  3MZL B;  4GU5 A;  3CHM A;  4KZ0 A;  2WXF A;  4I43 A;  2V0P A;  4JXT A;  4IUL A;  4CCA A;  3QKY A;  1XGW A;  4JHJ A;  4M16 A;  1EPU A;  1XNF A;  4P29 A;  3ZFW A;  4DLQ A;  2WXM A;  5BPP A;  3ZGQ A;  4B8A A;  4IRU A;  2DIW A;  4UI9 J;  5G55 A;  4K0R A;  3OAW A;  4G26 A;  4DPR A;  3MV3 B;  5BW8 C;  2MHK A;  4BTA A;  1OWL A;  2AXU A;  3T8M A;  2VSY A;  2VZA A;  4BT9 A;  4HOR A;  3UQ3 A;  3UT8 A;  1B89 A;  2XPZ A;  3CEQ A;  3CK7 A;  4I6G A;  3HHM A;  5G05 J;  2IQC A;  2FI7 A;  2KCV A;  5FQ8 A;  3ZEF A;  5EU0 A;  3QNK A;  4AEZ C;  3SI5 A;  4U04 A;  1JWF A;  3FEY A;  1UG3 A;  3FUE A;  4XI9 A;  3LPZ A;  1LF8 A;  3E4B A;  2XQ0 A;  3FWV A;  3AS8 A;  5G04 J;  4Y6C A;  3ASD A;  4GCN A;  3ENE A;  3S7B A;  3JQ0 A;  3SD5 A;  3VTY A;  2J49 A;  4JHR A;  4KBQ A;  3KD7 A;  4GA2 A;  4DLO A;  2OOE A;  1HE8 A;  4AVX A;  3JCK C;  4KMO A;  1DNP A;  3OXL A;  5ANR A;  3T5X A;  3MJW A;  2FO7 A;  3D9P A;  4UWG A;  4J6I A;  4N5C A;  1E7V A;  4A3V A;  4PS3 A;  2OVF A;  1KLX A;  4HOQ A;  2WXR A;  3LVR E;  4WWP A;  3D9K A;  3Q5M A;  4G1T A;  4HS2 A;  4I17 A;  4OVU A;  4TV3 A;  4XI8 A;  4L23 A;  3R7R A;  1Z3Y A;  4KXK B;  2V5F A;  3PS6 A;  4WUY A;  4EEC A;  2PQR A;  1INZ A;  2VGY A;  3AS5 A;  4F1S A;  4G25 A;  1IYG A;  3CR3 A;  3FU3 A;  5JFZ A;  1H2T C;  3D9N A;  3CUC A;  3G2W A;  4FUL A;  3DBS A;  2VTB B;  3SE5 A;  1VDY A;  5CKL A;  4C0M A;  3AU4 A;  3JYS A;  1HXI A;  2L6J A;  1HF8 A;  4I2W A;  2JLB A;  4ITR A;  2WVI A;  2X6I A;  3IKO B;  4GZ6 A;  3ZHE B;  4EPZ A;  4I1M A;  2VSX E;  1IQR A;  3CSF A;  4Y6W A;  2XPY A;  3OXF A;  3KEZ A;  4I9E A;  4AOF A;  3CVX A;  4N2S A;  5CCM A;  5AIJ A;  3NF1 A;  3FTS A;  4UQY A;  4JA9 A;  1HFA A;  4JW1 A;  5A23 A;  1KT0 A;  4HOT A;  3G2S A;  5KCM A;  5CGL A;  3ZYM A;  4G2V A;  4U63 A;  4ABN A;  3S7F A;  3ZYK A;  2VJ8 A;  3ZXS A;  1W3B A;  5JHA A;  4LEU A;  3P1U A;  2V4L A;  1ZBP A;  3L16 A;  3LJ3 A;  2QFC A;  3ESK A;  4AJW A;  1UN9 A;  5ARG A;  3LET A;  1MQS A;  1OWO A;  5FJY A;  3VLE A;  2KCK A;  2PL2 A;  2LAH A;  3SF4 A;  4D10 C;  4GYW A;  4B0Z A;  3SHG A;  4APF A;  2CHX A;  3CVQ A;  4I6J A;  2KCL A;  3OTN A;  4IN3 B;  4JL0 A;  4BSX A;  2WXN A;  3APF A;  3GYZ A;  4AY6 A;  3VLF A;  4G24 A;  4N2Q A;  3Q15 A;  4EZJ A;  1DVP A;  2WXK A;  3FH5 A;  4NAC A;  5AJD A;  3S2A A;  4QFV A;  3EIQ C;  4JEH A;  2CG2 A;  4GAA A;  5AYW D;  2HM8 A;  3PEV B;  4XZ4 A;  4U0Z A;  2ZU6 B;  2R59 A;  3L22 A;  3ZPJ A;  1OWM A;  3RU0 A;  4BY6 A;  3HYM B;  2X6H A;  3HDX A;  5LP0 A;  4FJY A;  1E8X A;  3FTU A;  3ZRH A;  2JK8 A;  2E0I A;  1PY1 A;  3QWV A;  3G2T A;  4XIF A;  4KVM A;  4K03 A;  4GYY A;  1KT1 A;  1SZ9 A;  3AS4 A;  3LCA A;  3NZS A;  2VSO E;  3SBS A;  3SGH A;  2Y4T A;  1ZU2 A;  3CK8 A;  3D3M A;  3MA5 A;  4BX8 A;  1BPO A;  1S0P A;  3ZN3 A;  3U66 A;  2CFU A;  2MRI A;  4V3I A;  4J8S A;  2HYZ A;  3U4T A;  1UJK A;  3R9A B;  4UQZ A;  1U3D A;  2WXP A;  4UWL A;  3ZCB A;  2R17 C;  1WY6 A;  3IV0 A;  2VYI A;  2UWJ G;  3HVE A;  3FTW A;  2LSU A;  3FEX A;  4MS6 A;  3QK0 A;  3TGO A;  1Z3X A;  3VLD A;  4CDN A;  3GZ1 A;  4N67 A;  2LNI A;  1ELK A;  3I4R B;  3QAQ A;  4WAF A;  3S6A A;  3P2B A;  1E96 B;  1HZ4 A;  4HOS A;  3G2V A;  2OV8 A;  4J8E A;  4J0U A;  4YND A;  4CRW A;  2BUG A;  4OYS A;  3CK9 A;  2WXI A;  1UN8 A;  2KC7 A;  3FUN A;  3Q4A B;  3FUD A;  4WND A;  4APO A;  4EBA G;  2WXG A;  4URK A;  3IEG A;  2CFZ A;  4M3O A;  3S7D A;  2XHE A;  4MRU A;  3L08 A;  1N52 A;  2LO6 A;  1SQM A;  4XX5 A;  4BX9 A;  3CVV A;  5T8I A;  4J8D A;  4ILG A;  4YVQ C;  2J08 A;  1HS6 A;  5LOZ A;  5CCL A;  3CIA A;  3CVW A;  2PM6 A;  3ZW3 A;  2AVP A;  2GW1 A;  4B8C B;  1H2U A;  5FWQ A;  5A7D B;  5LFA A;  3EHM A;  3ZIM A;  1GW6 A;  1UW4 B;  4MLP A;  2I2O A;  2F6S A;  2E2E A;  2Y3A A;  3CV0 A;  5J90 A;  1P5Q A;  2WPV A;  4GZ5 A;  2NXP A;  4KVO A;  5LCW C;  3Q49 B;  5T4Y A;  5J08 A;  4GB9 A;  1YA0 A;  2WQ7 A;  3CQC B;  1NA0 A;  2KZT A;  3FTY A;  4A3T A;  3FFL A;  2AXZ A;  5CMY A;  4FLH A;  2IU1 A;  4CEM A;  4UQX A;  4BT8 A;  4HFG A;  3KAE A;  3LVQ E;  2UY1 B;  3EHN A;  3MKQ A;  3FTX A;  3R7Q A;  2EQX A;  4E6H A;  3D9I A;  3CGH A;  2L0I A;  3QWW A;  4X2E A;  2FBN A;  3ZYQ A;  3FUL A;  2XRZ A;  4UWK A;  4EBA A;  2ILR A;  5C2Y A;  2XGM A;  3GZS A;  4O6F A;  5HI7 A;  2WB2 A;  3PNT B;  3TG4 A;  3CHS A;  4DK5 A;  3B7U X;  5D0Q D;  3SZ7 A;  5BUZ A;  1H6K A;  4N39 A;  3FH7 A;  3ZLM A;  3FUJ A;  1QZ2 A;  1Y8M A;  2OVB A;  3D9L A;  2AW6 A;  3FH8 A;  4WWN A;  5JJT A;  1PAQ A;  3CHP A;  4RG9 A;  3APC A;  3PRE A;  4A55 A;  2WXL A;  3CVY A;  3RO3 A;  3FTV A;  3LY9 A;  3L54 A;  2PM7 A;  4N3B A;  4U0U A;  4ACL A;  4ANX A;  2VQ2 A;  4PDX A;  3FU5 A;  2I9C A;  2Q7F A;  2WMO A;  4CDM A;  3MCX A;  3L6A A;  2UY1 A;  3BEE A;  2PZI A;  3CVN A;  1E8Z A;  4I9C A;  4N3C A;  4E85 A;  4WWO A;  3HVE B;  2WXO A;  3PZD A;  1JUQ A;  4ACK A;  3ONK A;  1A17 A;  3FP3 A;  3MX3 A;  4Q96 A;  4L2L A;  1FVF A;  3LY8 A;  3B13 A;  3FUI A;  3PH0 C;  4ATG A;  1NA3 A;  3D9O A;  5LX8 A;  1PC2 A;  1FCH A;  5KJK A;  2FEZ A;  4I2Z A;  1QNF A;  4WNG A;  2XEV A;  4LU4 A;  4LCT A;  3K9I A;  4AIF A;  2OND A;  3IHY A;  3N3U A;  3AU5 A;  4F53 A;  4NQ0 A;  4F7A A;  4ANU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...