4U07A

Atp bound to eukaryotic fic domain containing protein
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
326
structure length
323
Chain Sequence
AALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSINSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Adenosine monophosphate-protein transferase FICD
total genus 122
structure length 323
sequence length 326
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u07A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u07A01
2WQHA 5BW8C 3LCAA 4HORA 3CK9A 4I9CA 3KS2A 3KAEA 4G26A 3LKUA 3NF1A 3ZGQA 2JLBA 3S7DA 2V5FA 3CVQA 4NPSA 3Q4AB 2P58C 2Y4TA 1YA0A 4N39A 5FZQA 1HH8A 5BT1A 1P5QA 2FEZA 1KT1A 5EX0A 4XI9A 5FZRA 4UQYA 2PL2A 4YVOA 2Q7FA 1HZ4A 1NA3A 1IHGA 4G2VA 4Y6WA 3SZ7A 3ULQA 3WXXA 4KXKB 3QWPA 3E4BA 4J8FA 3CEQA 5JJ7A 3QWVA 3RO2A 1OUVA 5EX3A 2XGSA 3CVPA 5HI7A 3QOUA 4G24A 4I1AA 1KLXA 4N67A 4HOTA 2FO7A 2WPVA 3ASFA 4CGVA 4G23A 5CMTA 4WNFA 4X2DA 4AY6A 2BUGA 2F6SA 3Q5MA 4UQZA 2I6HA 2KC7A 2PQNA 3QKYA 4Y6CA 4GCOA 3SN9A 2FI7A 4RG6A 2LNIA 2ONDA 3QDNA 4U07A 5D0QD 5G05C 4BTBA 3TG4A 3AS5A 1QZ2A 4GZ3A 4G1TA 2HR2A 3ESKA 2J9QA 4J8DA 4U0SA 3AS4A 3ASDA 3UUXA 4AY5A 3EDTB 5ARGA 1ZBPA 3R9AB 5C1DA 2XGOA 2UY1B 3MKRA 4UQXA 2QFCA 4WGJA 3ASGA 4I2WA 4GPKA 5FJYA 3LPZA 4GA0A 3Q15A 5G04C 3ZCBA 4W9RA 5A6CA 2VYIA 3CV0A 3ZPJA 2VSNA 5LCWC 5CGLA 1W3BA 2L6JA 4UI9K 3CK7A 2HYZA 5G05J 4I17A 3GYZA 4G25A 4N2QA 4X2EA 3BEEA 3SF4A 2UY1A 2IFUA 2HO1A 3RO3A 4J0UA 3N3UA 3LY7A 4GYOA 2FBNA 3MV2B 5EKQD 4WNDA 5A7DB 5M72A 2C0LA 2XPIA 1ELRA 4H7YA 1XNFA 3TAXA 2XGMA 3Q49B 3S7BA 1QQEA 3JYSA 2KCVA 3HYMB 4J8EA 5BNWA 2FF4A 4JL0A 4LU4A 4GZ6A 2XCBA 4KBQA 2LSUA 2YQ8A 2NC9A 2YHCA 4B94A 3ZLMA 5HQ8A 2VGXA 4O6FA 3CKCA 5FZSA 2UWJG 3N71A 3S7FA 3GW4A 4U0UA 2VQ2A 5JJTA 3SHGA 3SE5A 4F3VA 3LY8A 2MHKA 5CCMA 4KYOB 1HXIA 3CKBA 3IEGA 3LETA 1WAO1 1WM5A 3OXLA 4WNEA 4GZ5A 4UI9J 4M16A 3CVNA 1E96B 2PQRA 2C2LA 5DIZA 5ARFA 1NA0A 2AVPA 3VTXA 3UQ3A 3CVLA 3Q47B 1PC2A 1ZU2A 4GYWA 2OOEA 3K9IA 4GA1A 1NZNA 3S6AA 1B89A 3MV3B 5JJ6A 4ITRA 4WNGA 2PZIA 3UPVA 3ZHEA 3ASHA 3RIBA 4CDRA 4U04A 1A17A 3RKVA 2DBAA 2R5SA 2C0MA 4U0ZA 4N3CA 5CCLA 5KJLA 2E2EA 4CGWA 4BT8A 4BTAA 5KJNA 3ZFWA 2VGYA 4N5CA 2IF4A 5FTPA 3PE3A 5DBKA 4PY3A 2VGXB 5G04J 2KCKA 4APOA 1Y8MA 3U4TA 3PE4A 4N3AA 5FT9A 4GYYA 4XIFA 2KATA 2JK8A 4JA9A 3FWVA 4YNDA 4JA7A 3AS8A 1TJCA 3O48A 4XI8A 3RU0A 2GW1A 3MA5A 3U3WA 4I2ZA 4JHRA 4IN3B 3TGOA 4X2CA 3KD7A 4LEUA 3S7JA 4WUYA 5JFZA 4ABNA 3QWWA 4YVQC 3OXFA 4RG9A 4AIFA 5JFFA 3PDNA 3ZC7A 3ZN3A 3MEKA 3TG5A 4NQ0A 4GCNA 3RJVA 4HOUA 4HOQA 3FP3A 5LCWJ 2VSYA 3LY9A 4N2SA 4UI9C 3VTYA 5D0OD 2XEVA 5KJMA 3OXGA 4A1SA 1IYGA 5CKLA 2G03A 3CK8A 4BWRA 5AYWD 4BT9A 5CHEE 3FFLA 4GA2A 4N3BA 5EU0A 2XCCA 3LYAA 4HOSA 1FCHA 4I9EA 4XI0A 3GZ1A 3URZA 4ME2A 3ZHEB 4NRHB 5KJKA 4H7XA 2KCLA 3GZ2A 4EQFA 2Y4UA 3CUCA 1KT0A 4AM9A 2VY3A 2VZAA 2LSVA 1ELWA
chains in the Genus database with same CATH superfamily
2FULA 3UXGA 2RG8A 4G26A 1Z6TA 3ONKA 3NF1A 3HXDA 3ZGQA 2JLBA 4G8KA 5AQAA 2EINE 4NPSA 2P58C 1FVFA 3DSXA 3DBSA 1EF1C 3MYVA 2AW6A 4MLPA 1MYOA 3Q75A 1JUQA 5FZQA 5BT1A 5BV1A 1KT1A 1YMPA 5KNHD 5EX0A 3QAQA 4XI9A 3SQVA 1MX2A 2PL2A 4XKCA 4C0MA 4DLOA 1HZ4A 2WQ6A 5A23A 1OXJA 3WXXA 3PS6A 3QWPA 5D66A 1TNZA 5H7PA 5FQ7A 4PS8A 1OY3D 3CEQA 3UT8A 4GZDA 3I4RB 2BKKB 2DZNA 4EPZA 3CLJA 5EX3A 4UWLA 4Z68A 3NB2A 4NACA 3QOUA 1AWCB 4FLHA 4GMRA 3CSFA 1LD8A 4UWFA 2IU1A 2ZXWE 4A55A 3PEVB 3JXJA 3ISMC 3Q5MA 3ESLA 4CDMA 4GTPA 3L17A 5EILA 4GCOA 1Y6IA 2FI7A 2P9SG 3LEWA 4RG6A 2LNIA 3UM2A 4B0ZA 5C2YA 2Y3AA 2GRLA 3D9KA 1O1RA 4LSZE 5D0QD 5LP0A 3TG4A 4X8QA 3PEUB 2HR2A 4TV3A 2KZTA 3ESKA 1ZB1A 3PZ2A 3ABME 4KZCA 2NUNA 3PRZA 2WXIA 4UWHA 4M7CA 4BSZB 5ARGA 2GROB 3LJ3A 3R9AB 3FTVA 1SQMA 2WMOA 3ASGA 4GA0A 3B13A 5A6CA 2LXMA 2WB2A 1S64A 2DZOA 5HS0A 4U7EB 1NFIE 1YYHA 3CK7A 2J07A 4DX6D 2DYRE 4E85A 5CRVA 3GYZA 4U8VD 4G25A 3NZUA 4X2EA 2F8YA 4FP7A 1E7UA 4B93B 4XKBA 5EYPF 4I6JA 3HDXA 5AQ7A 2I9CA 5AJLA 5EKQD 2FBNA 4JVSA 4ILIA 3LXUX 4JXTA 4CYMD 1XNFA 3TAXA 4F1PA 3B7BA 3L82A 2NUDA 4HVBA 2XCBA 1K1AA 4OAUC 2NC9A 2VGXA 3CKCA 5FZSA 2UWJG 4YDEA 2OV8A 3S7FA 3D9PA 3DSSA 5CEAA 2VQ2A 4EZKA 2LAIA 1QNFA 4I43A 1HX8A 3MKQA 4GTSA 3LETA 1WAO1 4UI9J 3DPYA 1JPLA 1MJ0A 2PQRA 3EHQA 1GW6A 1NL4A 1NA0A 4JC8A 2P9LG 2X6IA 1N11A 3K9IA 4TRQA 5D2MC 4GA1A 1IXVA 1NZNA 3S6AA 3QB2A 3MV3B 4ITRA 1N4QA 4DX5D 3MZLB 4ILHB 1UG3A 3QJZA 3UPVA 3ZHEA 3FTYA 5JMND 3AJIA 3T8KA 4CDRA 1A17A 5LFAA 3CR3A 3FUKA 4WWNA 1OWPA 2E2EA 4I6EA 2BTDA 3IHYA 3UT4A 4I1MA 1PY1A 5FTPA 3PE3A 5BPPA 5DBKA 4PY3A 5G04J 4YDOA 4HLLA 1Y8MA 3UM1A 2ZGGA 1AP7A 2MOWA 4FJYA 4QFVA 1OCZE 3HVEA 2KATA 2JK8A 1IHBA 1TNOA 4JEHA 4YNDA 4JA7A 3FHEA 3AS8A 4XI8A 1H0AA 2GW1A 3ZYMA 4LRZA 4IN3B 4DK5A 3S7JA 3ZU7B 4U63A 4WUYA 5JFZA 3TWQA 1OCRE 4ABNA 2AWIA 1FVHA 4AP2A 3VLFA 5JFFA 1DVPA 5ENQD 3RJVA 5AIJA 3KSQA 4JW1A 2H6GA 1N95A 3NAWA 3SO8A 4FHJA 4EZLA 5LCWJ 4N2SA 5D0OD 2WVIA 3V79K 3ZEFA 2IO3C 4A1SA 4CCAA 2X38A 3PVLA 3SFZA 3D3MA 3NOGD 2J08A 3IV0A 3ULYA 4BT9A 1BLXB 2EIKE 5CHEE 1SA5A 2ILRA 4GA2A 2MYOA 4MS6A 4HRLA 3FTXA 3SI5A 3CHOA 1TNYA 4E6HA 1FCHA 4I9EA 1MZCA 4A3VA 3LVQE 4GTQA 3UMVA 4GTTA 1FPPA 4HRNA 5AJDA 1UJJA 1E8YA 5BV0A 3W9GA 3C5RA 1KT0A 4WAFA 5IY5E 2QYJA 3ZNGA 5BW8C 3MKQB 4HORA 3CK9A 4I9CA 1JWGA 3KAEA 3TL5A 2V8SE 4HS2A 1U3CA 3Q78A 3E30A 1X81A 4B8CB 3Q4AB 2Y4TA 3MX3A 1EYHA 2GRPB 1YA0A 4N39A 1HH8A 3F6QA 2R05A 4DJAA 3B7SA 3CIAA 4MRUA 3IHVA 3TWRA 2E0IA 1TN8A 2KBXA 4UQYA 5FZRA 4YVOA 2Q7FA 1NA3A 1L5JA 1TJFA 4ANVA 3SZ7A 4AVXA 4TUMA 3E34A 3JXIA 5JJ7A 2OVFA 3QWVA 1OUVA 1N0QA 3CVPA 5T4YA 5HI7A 3JCKC 3LDZA 4N5QA 3BQOA 3GZSA 3PNLB 3UI2A 4URKA 4N67A 1RW2A 1DNPA 4JEUA 3APFA 4X2DA 2BUGA 3V31A 3BG0B 4UQZA 1H6PA 2JEKA 5AENA 2CHWA 4I1OB 2PQNA 2XPYA 5ANLA 4TXRA 2IEJA 3FUEA 4EECA 5ENNA 2WXQA 2X6JA 3C3RA 1EDUA 2WXGA 4K0RA 2J9QA 4J8DA 2PM6A 3V2XA 2P9NG 1TNUA 4KZ0A 3UUXA 4AY5A 4UWKA 3EDTB 2M63A 3CHMA 2ZU6B 2VTBA 1ZBPA 2DYSE 2XGOA 2UY1B 3MKRA 5JA4D 4WGJA 4ANUA 4GPKA 5FJYA 3Q15A 3CVWA 3ZCBA 2L0TB 3ZRHA 3SD5A 5LCWC 1OT8A 3EIQC 4LCTA 3UM0A 2J09A 3EUVA 3FUMA 2L6JA 4BERA 3ASOE 1WDYA 5CECB 3Q7AA 4I17A 4Q96A 5AQ9A 3CVVA 3B7UX 4GMLA 3NBNB 3BEEA 3FUIA 2AXZA 2UY1A 2IFUA 4ATGA 3RO3A 4J0UA 3SHFA 5E75A 3LY7A 1JWFA 4WNDA 5B1BE 5M72A 2C0LA 2CHXA 1H2TC 3Q49B 1QQEA 3EU9A 2KCVA 4J8EA 2ETAA 5BNWA 2FF4A 4GZ6A 4KBQA 2P2CP 2YQ8A 4DUIA 3CHPA 2A5UA 5HQ8A 2CFZA 1V54E 4FLBA 5E76A 1U2VG 3KEAA 1TN7A 1N54A 3IXEA 1TEZA 1HF8A 1OCCE 4FHKA 3CHSA 4ZHBA 3SHGA 1HO8A 3PUJA 3FULA 3W9FA 1H6OA 2MHKA 3IEGA 3OXLA 4EHMA 4GZ5A 4R7LA 3HRAA 3EIJA 4HFGA 1MX4A 5DIZA 3B7RL 5ARFA 4GU5A 1JCQA 3UX4A 2QZAA 3RRNB 3CVLA 3AG4E 1H6KA 1KZPA 2JABA 2GGFA 2LO6A 2LUHA 2PZIA 2VGEA 4BESA 5BUZA 4GB9A 2X6FA 3CSTA 2IO2C 2KXPC 3EJNA 4L2YA 2VJ8A 2GRRB 3J5QB 3I4GA 3RKVA 2WQ7A 2R5SA 4U0ZA 4N3CA 2V4HC 4CGWA 1BU9A 4DRXE 4BTAA 5KJNA 3FTWA 4U8YD 4ACKA 2KCKA 4OVVA 5J90A 3U4TA 3L08A 4FULA 4G11A 3PE4A 5FT9A 4FU3A 3PZ4A 4XIFA 4A1GA 4JA9A 4DI4A 3EHRA 3FWVA 4PDXA 3MGBA 4PS3A 2XEEA 5KCMA 5CBNA 4J7WA 3TGOA 3KD7A 2KM4A 4BY6A 3TWUA 3PREA 3QWWA 3OXFA 4RG9A 2WXOA 3QC1A 2ZISA 3KEZA 5LX8A 3TWTA 3MEKA 3CVXA 4LNUD 4GCNA 4ATZD 4HOQA 3HVEB 4PUCA 4UI9C 3VTYA 1Z3YA 3R7RA 3L22A 3SBTB 4IRUA 4D10C 3TWXA 2G03A 4ACLA 4CRWA 4P29A 4RLYA 4UUCA 3FFLA 4CZ2D 4PH4B 4APFA 3FU0A 4XEIG 4HB5A 3L16A 2XPZA 4RSYA 3R7QA 4O60A 4QQIA 4NRHB 2A4ZA 5FIOA 2WXFA 4NURA 2NXPA 2ZGDA 2J4DA 3DSVA 3L54A 3DEOA 4C0EA 4AV7A 3PZ1A 2Y4UA 3D9LA 3CUCA 2VY3A 2VZAA 4L2LA 1BI8B 1UOHA 4K5CA 4ILGA 2OEVA 2DWZA 3FH7A 3JQ1A 4GTOA 3TWWA 4K03A 4CT0A 4PS7A 3ABLE 3ZW3A 5G2NA 3S7DA 1BD8A 2V5FA 1HG5A 2BF0X 3DXMG 3G2TA 2WXPA 4XX5A 1FT2A 3FUDA 4HI9A 2Y69E 1HS6A 2PNNA 3R9MA 1KZOA 2FEZA 3DSWA 4GMJA 4CT4A 2HM8A 5G55A 1IHGA 3JQ0A 3LJNA 5ENRD 2PM7A 3E4BA 1K3ZD 3QK0A 1MQSA 3ZIMA 2P9PG 5J08A 3E37A 3FEXA 4L7TA 3Q79A 3NZSA 3C3OA 3E33A 3VLEA 3QNKA 1KLXA 4HOTA 2FO7A 2WPVA 4HI8A 3FUJA 4WNFA 5FWQA 5ENOD 5CBOA 2I6HA 3J5PA 2KC7A 4B89A 3L6AA 1K1BA 3QKYA 2VSXE 4J8SA 2LXLA 3SY2A 2ONDA 1SW6A 2CHZA 3QDNA 2KZTB 5AQBA 4BTBA 3EHNA 1E8ZA 2BEDA 4CDNA 3AS5A 1QZ2A 4GZ3A 3CQCB 4G1TA 5CMWA 3D9OA 4K5BA 2LAHA 4MKTA 3ASDA 1SA4A 3FU6A 2XEHA 4JD2G 1U3DA 5C1DA 3TWVA 3CVYA 3BU8A 1NI1A 2L9BA 4UQXA 3D9IA 4U8HA 2J4BA 4I2WA 3LPZA 4W9RA 2VYIA 3CV0A 3ZPJA 2VSNA 2WXJA 2IOLA 3EU5A 5CGLA 5CMYA 3FTSA 2QC9A 4UI9K 3HXFA 2XS8A 1VDYA 2WXKA 1E90A 5EYLA 3C3QA 1TN6A 5AARA 2I2OA 3N3UA 3JUEA 4GYOA 3L9TA 2XPIA 3OTNA 3QARA 4L23A 3PZDA 1HFAA 1ELRA 3LS8A 4DPRA 3S7BA 3JYSA 3HYMB 2V5QC 4LU4A 1OWNA 3DRAA 2CFUA 1UN8A 3FH5A 3U64A 3ZLMA 4JHKA 2F37A 4O6FA 2Y1LE 1S70B 4RVBA 4GTMA 2XENA 3FTUA 3SGHA 2L6BA 4F53A 3GW4A 4NIKA 3PH0C 3SE5A 4KYOB 4KVOA 4O1PA 2F0YA 5BXOA 1E96B 4YDYA 5CERB 2C2LA 3UIPC 5B1AE 3VTXA 3Q47B 1PC2A 1ZU2A 4GYWA 3ZKJA 2WXLA 4XE0A 3NQPA 2QYUA 2X3MA 4KVMA 4F6RD 2XS1A 4WNGA 3UINC 1N9AA 5ENPD 2XZDG 1D8DA 3ASHA 4J6IA 2RFAA 4ANWA 2WM9A 5KJLA 4BT8A 1QYMA 3IBEA 3L13A 2X6HA 1DC2A 2ZIRA 3FU3A 2A5EA 3T9KA 3TWSA 3ZVVA 1JCRA 5KWDA 1S0PA 2FO1E 4BEPA 5JHAA 4BX9A 5EDSA 2RFMA 5AN8A 5EN5D 4IULA 2DIWA 3O48A 3FY4A 3WG7E 2P9IG 2OVBA 3MA5A 3U3WA 4J8YA 1YCSB 2H6IA 4X2CA 3Q9NC 3PZ3A 4LEUA 1H19A 1O1TA 4OAVB 3FDHA 1K8KG 4IYPA 2R17C 3B7TA 3CQGB 3ONLA 3PDNA 4O1OA 3RAUA 3ZC7A 3TXMA 5T3RA 3TG5A 4NQ0A 1UW4B 1Z5SC 2B0OE 3KSLA 2DCPA 3ML9A 3PNTB 2IJGX 3FP3A 3S2AA 4L9PA 2VSYA 3LY9A 2XEVA 3CK8A 3FH8A 4TXPA 1SZAA 1UN9A 4TXQA 2XHEA 3D9MA 1Z3XA 5ENTD 2WXNA 4C48B 1N94A 1IQUA 2EIJE 4N3BA 5EU0A 2XCCA 3LYAA 3FUHA 4HOSA 4GZCA 3TJPA 3ENEA 3UKUG 4K5AB 4DX2A 5CEDB 3URZA 4HBDA 4ME2A 3ZHEB 5KJKA 3CGHA 2KCLA 1E8XA 2IOSA 3GZ2A 3IKOB 2NSZA 3AG1E 5ANRA 2LSVA 3VLDA 1ELWA 2WQHA 3LCAA 4RQIA 3P1UA 3SFXA 3KS2A 4L1BA 2GRQB 3LKUA 1Q2ZA 5FQ8A 1O5MA 3FTZA 3HIZA 2XRZA 5ENSD 3CVQA 3CHQA 2WMNA 1BPOA 3DSTA 1BI7B 4OYSA 3D9HA 2L0IA 3HXCA 2XZTG 3C98A 3AU5A 3ML8A 1P5QA 4GAAA 2EILE 1DCEA 4AEZC 1D8EA 4GTVA 1OWOA 4G2VA 4Y6WA 3ULQA 4KXKB 3UIOC 3I3NA 4ANXA 4J8FA 4A3TA 2WXHA 3DXKG 3RO2A 2X6KA 1MX6A 3MJWA 5CRUA 2XGSA 3ZXPA 3ZYQA 3UTMA 2EIME 2R02A 1INZA 4G24A 4I1AA 3ASFA 4CGVA 3OAWA 4G23A 5CMTA 4AY6A 3HXBA 2F6SA 1XGWA 4DX7D 3I5PA 5EIDA 2I1JA 3ZYKA 4F7AA 1OWLA 4Y6CA 3SN9A 4A63B 2DVWA 4LERA 3DSUA 3RSEG 4KMOA 3PUKA 4LUNU 4U07A 5G05C 5ITZF 1FT1A 2AXVA 4ZFHA 4FC8A 3AG2E 2AXUA 3V30A 3DPDA 1D9SA 4GPMA 4AOFA 2V4LA 2J49A 4U0SA 3AS4A 3E32A 2YNQA 5FQ6A 1N4RA 4JPSA 4HRMB 3RRMB 5FINA 1TR4A 4Q69A 1LF8A 1E8WA 4B8AA 3TXNA 3G2VA 4HQDA 2R59A 4U96D 2RD0A 2QFCA 5FQ4A 1G3NB 5G04C 1N4SA 3ULEG 2ETCA 2BKGA 1W3BA 2XQ0A 1E7VA 2HYZA 5G05J 1S63A 4FADA 3DEPA 3G2UA 3B95A 4N2QA 3DWLG 4EBAG 4JZYA 2CG2A 4U95D 3SF4A 3P2BA 3Q73A 4C9BB 5KBAA 2HO1A 5LOZA 3HG0D 3ABKE 3MV2B 1QBQA 4AJWA 5A7DB 2I1KA 1OWMA 1N0RA 3SNXA 3ZUVB 2WXRA 3V2OA 3U66A 4H7YA 3ASNE 1X5BA 2XGMA 3U9WA 4JL0A 3D9NA 4DX1A 2IQCA 2CG3A 1TYQG 2LSUA 2YHCA 4B94A 1H2VC 2GRMA 3HXEA 4BFRA 1HE8A 3T5VA 3N71A 3FU5A 4BSXA 4U0UA 4DLQA 3UM3A 3ZYLA 5JJTA 4F3VA 3LY8A 5CCMA 1HXIA 3CKBA 1WM5A 4WNEA 4M16A 3CVNA 3FUFA 2AVPA 3UQ3A 4TUUA 2OOEA 2IONA 2YINA 2QY7A 4HLEA 3UT7A 5EIBE 1B89A 5JJ6A 1UJKA 1RZ4A 3SBSA 3AU4A 3AAAC 2EQXA 3Q7FA 3HHMA 4UWGA 3RIBA 2NYJA 4G8LA 4WWOA 4YDWA 2VTBB 4U04A 1N4PA 2DBAA 4I6GA 2C0MA 5CCLA 3G2WA 4JB8P 1HU3A 3JUIA 4XZ4A 5JHBA 3BG1B 3ZFWA 2VGYA 4N5CA 2ETBA 2IF4A 2HE0A 2VGXB 1OCOE 4EZJA 1TNBA 3X2QE 4F1SA 2J8SD 4APOA 3G2SA 3CVUA 3LVRE 1V55E 2H6HA 4N3AA 1SZ9A 1EPUA 4GYYA 1WG0A 1ELKA 2Y0BG 2OCCE 2F8XK 1MHQA 1JCSA 5HKPA 2RKKA 1TJCA 3T5XA 3EHMA 3RK6A 1PAQA 3RU0A 2B6CA 1DCQA 1N52A 4I2ZA 2H6FA 4JHRA 4AXHA 3SFYA 2V0PA 4M3OA 3Q9UC 4HXIA 2MRIA 3NOCD 4YVQC 2GRNB 1H2UA 1WY6A 2IY0C 4LG6A 2AJAA 4AIFA 3ZN3A 5BXUA 4HNAD 2WXMA 4OVUA 4EBAA 3MCXA 3BUAA 5B3SE 4HOUA 3O4ZA 4V3IA 4FJZA 5AAOA 2R03A 3RRUA 3CHRA 3D9JA 5KJMA 3OXGA 1IYGA 4LNGA 5CKLA 3FEYA 2P9KG 4DI3A 1KPSB 3FUNA 4BWRA 5AYWD 4Q94A 1NP7A 2P9UG 5HRYA 5KNGA 3ZXSA 2R2LA 1HG2A 1SVXA 1IQRA 4GTRA 1O1SA 4JHJA 1NH1A 4XI0A 1A5EA 3GZ1A 3T8MA 2OEWA 2XRYA 2YHEA 3APDA 4H7XA 4LNBA 5T8IA 1LD7A 1IKND 4BX8A 4MBGA 2VSOE 4KT6B 4EQFA 4WWPA 3APCA 4FA6A 1LTXA 4CEMA 4BETA 4AM9A 3AG3E 3C72A 3UKRG
chains in the Genus database with same CATH topology
2WQHA 4ILGA 5BW8C 2FULA 3LCAA 3MKQB 4HORA 3CK9A 3P1UA 1JWGA 2RG8A 3FH7A 3JQ1A 3KAEA 3KS2A 4G26A 4I9CA 4L1BA 3TL5A 3LKUA 1Z6TA 3ONKA 3NF1A 4K03A 3ZGQA 4CT0A 4PS7A 2V8SE 5FQ8A 2JLBA 3FTZA 3ZW3A 3HIZA 4HS2A 1U3CA 5G2NA 2XRZA 3S7DA 2V5FA 3CVQA 3CHQA 1HG5A 4NPSA 2BF0X 3G2TA 4B8CB 2WMNA 3Q4AB 1BPOA 2P58C 2Y4TA 1FVFA 3DBSA 1EF1C 2WXPA 3MX3A 3MYVA 4OYSA 2AW6A 4MLPA 1EYHA 2L0IA 4XX5A 3FUDA 1YA0A 1JUQA 1HS6A 4N39A 5FZQA 1HH8A 3C98A 3AU5A 3ML8A 1P5QA 4GAAA 5BT1A 5BV1A 2FEZA 1KT1A 4DJAA 5EX0A 3QAQA 4GMJA 4XI9A 3B7SA 3CIAA 4MRUA 3IHVA 4CT4A 2E0IA 4AEZC 5FZRA 4UQYA 2HM8A 2PL2A 5G55A 4XKCA 2Q7FA 4YVOA 1HZ4A 1NA3A 4C0MA 4DLOA 1L5JA 1TJFA 1OWOA 5A23A 4ANVA 1IHGA 2WQ6A 4G2VA 4Y6WA 3SZ7A 3ULQA 3JQ0A 4KXKB 3WXXA 3PS6A 3QWPA 2PM7A 4AVXA 3E4BA 3QK0A 1MQSA 3I3NA 5FQ7A 4PS8A 3ZIMA 4ANXA 5J08A 4J8FA 4A3TA 2WXHA 3CEQA 3FEXA 3UT8A 4L7TA 4GZDA 5JJ7A 2OVFA 3QWVA 3NZSA 2X6KA 1OUVA 3I4RB 3RO2A 4EPZA 3CLJA 3VLEA 5EX3A 3MJWA 4UWLA 2XGSA 3CVPA 5T4YA 5HI7A 3JCKC 3ZYQA 4NACA 3QOUA 3LDZA 1INZA 4G24A 3GZSA 3PNLB 3QNKA 4FLHA 4I1AA 4URKA 1KLXA 4N67A 3CSFA 4HOTA 4UWFA 2FO7A 2WPVA 3ASFA 4CGVA 3OAWA 1DNPA 2IU1A 4G23A 5CMTA 3APFA 3FUJA 4JEUA 4X2DA 4WNFA 2BUGA 5FWQA 4A55A 3PEVB 4AY6A 2F6SA 1XGWA 3BG0B 3Q5MA 3I5PA 4UQZA 2I6HA 3ESLA 4CDMA 2JEKA 2I1JA 2KC7A 3L17A 3ZYKA 5AENA 2CHWA 4B89A 3L6AA 4I1OB 4F7AA 1OWLA 2PQNA 2XPYA 3QKYA 2VSXE 4GCOA 4J8SA 1Y6IA 3SN9A 4Y6CA 2FI7A 5ANLA 3LEWA 4RG6A 4LERA 3FUEA 2LNIA 4EECA 4KMOA 5ENNA 2ONDA 4B0ZA 5C2YA 2CHZA 2Y3AA 3QDNA 2GRLA 3PUKA 3D9KA 4LUNU 4U07A 2KZTB 5D0QD 5G05C 4BTBA 5LP0A 3EHNA 1E8ZA 2AXVA 3TG4A 4FC8A 4CDNA 2AXUA 3AS5A 1QZ2A 2WXQA 4GZ3A 3PEUB 2X6JA 3CQCB 4G1TA 1EDUA 2HR2A 5CMWA 3D9OA 2WXGA 3DPDA 4TV3A 4K0RA 2KZTA 4AOFA 2LAHA 3ESKA 2J9QA 2V4LA 4J8DA 2PM6A 2J49A 4U0SA 3AS4A 4MKTA 2YNQA 3ASDA 4KZCA 5FQ6A 4KZ0A 3UUXA 4AY5A 4JPSA 3PRZA 3FU6A 2WXIA 3RRMB 4UWKA 4UWHA 3EDTB 2M63A 3CHMA 1U3DA 2ZU6B 3LJ3A 5ARGA 4Q69A 2VTBA 1LF8A 1ZBPA 3R9AB 5C1DA 1E8WA 2XGOA 3FTVA 1SQMA 4B8AA 3CVYA 3TXNA 2UY1B 2WMOA 3G2VA 2R59A 3MKRA 2L9BA 2RD0A 4UQXA 2QFCA 5FQ4A 3D9IA 4WGJA 3ASGA 4U8HA 4ANUA 2J4BA 4I2WA 4GPKA 5FJYA 3LPZA 4GA0A 3Q15A 5G04C 3CVWA 3ZCBA 2L0TB 4W9RA 3B13A 5A6CA 3ZRHA 2VYIA 3CV0A 3ZPJA 2VSNA 3SD5A 2WB2A 2WXJA 5LCWC 2IOLA 5CGLA 3EIQC 4LCTA 1W3BA 3FTSA 5CMYA 2J09A 2XQ0A 3FUMA 2L6JA 4UI9K 3CK7A 1E7VA 2HYZA 2J07A 5G05J 1VDYA 4I17A 4FADA 4Q96A 4E85A 2WXKA 3GYZA 3G2UA 3CVVA 4G25A 3NZUA 4N2QA 3B7UX 4X2EA 1E90A 4FP7A 1E7UA 4GMLA 4XKBA 4EBAG 4JZYA 2CG2A 4I6JA 3BEEA 3FUIA 3SF4A 2AXZA 2UY1A 3P2BA 3HDXA 4C9BB 2IFUA 4ATGA 2I9CA 2HO1A 5LOZA 2I2OA 4J0UA 3RO3A 3N3UA 3SHFA 5E75A 5AJLA 3LY7A 4GYOA 2FBNA 1JWFA 3MV2B 4ILIA 4JVSA 5EKQD 4AJWA 3LXUX 4WNDA 5A7DB 2I1KA 1OWMA 2C0LA 2XPIA 2CHXA 4JXTA 5M72A 3OTNA 3QARA 4L23A 3SNXA 2WXRA 3PZDA 1H2TC 1HFAA 1ELRA 3U66A 4H7YA 3LS8A 1XNFA 3TAXA 1X5BA 4DPRA 2XGMA 3Q49B 3S7BA 1QQEA 3JYSA 2KCVA 3HYMB 5ANRA 4J8EA 3U9WA 5BNWA 2FF4A 4JL0A 4LU4A 3D9NA 1OWNA 4HVBA 2IQCA 4GZ6A 2XCBA 2CG3A 4KBQA 2LSUA 2YQ8A 2CFUA 2NC9A 2YHCA 1UN8A 3FH5A 3U64A 3ZLMA 4B94A 4JHKA 3CHPA 1H2VC 2A5UA 5HQ8A 2GRMA 2VGXA 2CFZA 4O6FA 3CKCA 4FLBA 5E76A 4RVBA 4BFRA 5FZSA 1HE8A 3T5VA 2UWJG 3FTUA 3SGHA 2OV8A 3N71A 3S7FA 4F53A 3FU5A 3D9PA 1N54A 4BSXA 1TEZA 3GW4A 1HF8A 4U0UA 4FHKA 4DLQA 2VQ2A 3CHSA 3ZYLA 5JJTA 3SHGA 1HO8A 3SE5A 2LAIA 3FULA 3PH0C 3PUJA 1QNFA 4F3VA 4I43A 4EZKA 1HX8A 3LY8A 2MHKA 3MKQA 4KYOB 4KVOA 5CCMA 1HXIA 3CKBA 3IEGA 3LETA 1WAO1 1WM5A 3OXLA 4WNEA 4GZ5A 4UI9J 4M16A 3CVNA 4R7LA 3EIJA 4HFGA 1JPLA 1E96B 2PQRA 2C2LA 3FUFA 5DIZA 3B7RL 5ARFA 1GW6A 4GU5A 1NA0A 4JC8A 2AVPA 3VTXA 3UQ3A 3UX4A 4TUUA 2X6IA 3CVLA 3Q47B 3RRNB 1PC2A 1ZU2A 4GYWA 1H6KA 2OOEA 3K9IA 2WXLA 4XE0A 3NQPA 4TRQA 4GA1A 2IONA 1NZNA 3S6AA 2GGFA 2YINA 2QY7A 3QB2A 3UT7A 4HLEA 2X3MA 1B89A 3MV3B 5JJ6A 1UJKA 4ITRA 4KVMA 2LO6A 3SBSA 3AU4A 4WNGA 3MZLB 2PZIA 2EQXA 4ILHB 5BUZA 1UG3A 4GB9A 3QJZA 3UPVA 2X6FA 3ZHEA 3CSTA 3FTYA 3EJNA 3HHMA 4UWGA 4L2YA 3ASHA 4J6IA 3RIBA 4CDRA 2VJ8A 4WWOA 4ANWA 2VTBB 4U04A 2WM9A 1A17A 3I4GA 5LFAA 3CR3A 3RKVA 2DBAA 2WQ7A 2R5SA 3FUKA 4I6GA 2C0MA 4U0ZA 4WWNA 4N3CA 5CCLA 1OWPA 5KJLA 2E2EA 3G2WA 2BTDA 4I6EA 4CGWA 3IHYA 4BT8A 1HU3A 3JUIA 3IBEA 3UT4A 3L13A 4I1MA 4XZ4A 4BTAA 3BG1B 3ZFWA 2VGYA 4N5CA 5JHBA 5KJNA 1PY1A 2IF4A 3FTWA 3PE3A 5FTPA 5BPPA 2X6HA 5DBKA 3FU3A 4PY3A 2VGXB 5G04J 4F1SA 4EZJA 4ACKA 2KCKA 3ZVVA 4APOA 1Y8MA 4OVVA 5J90A 3G2SA 1S0PA 3U4TA 3CVUA 3L08A 3LVRE 4FULA 4G11A 3PE4A 4N3AA 5JHAA 1SZ9A 2MOWA 5FT9A 1EPUA 4FU3A 4GYYA 4BX9A 5EDSA 1ELKA 4FJYA 4QFVA 4XIFA 3HVEA 2KATA 4A1GA 2JK8A 4JA9A 4DI4A 3FWVA 4IULA 2DIWA 4JEHA 4YNDA 4JA7A 3FHEA 1MHQA 4PDXA 3AS8A 1TJCA 3T5XA 3EHMA 3MGBA 3O48A 3RK6A 3FY4A 4XI8A 1PAQA 1H0AA 3RU0A 2GW1A 4PS3A 2OVBA 1N52A 3MA5A 3ZYMA 3U3WA 4I2ZA 4AXHA 4JHRA 5KCMA 4LRZA 4IN3B 2V0PA 3TGOA 4X2CA 3KD7A 4M3OA 4HXIA 4DK5A 2MRIA 4LEUA 2KM4A 3S7JA 1H19A 4BY6A 4U63A 4WUYA 5JFZA 3PREA 4ABNA 2AWIA 3QWWA 3FDHA 3OXFA 4YVQC 1H2UA 1FVHA 4IYPA 2R17C 3B7TA 1WY6A 4RG9A 4AP2A 2WXOA 3VLFA 3CQGB 3ONLA 3QC1A 5JFFA 3PDNA 4AIFA 3KEZA 3ZC7A 3ZN3A 5LX8A 1DVPA 3MEKA 3TXMA 3CVXA 5T3RA 3TG5A 4NQ0A 2WXMA 4GCNA 1UW4B 3RJVA 5AIJA 4JW1A 4OVUA 4EBAA 3MCXA 4HOUA 3O4ZA 4V3IA 2DCPA 4FJZA 3ML9A 4FHJA 3PNTB 3RRUA 2IJGX 4HOQA 3CHRA 3HVEB 4EZLA 3FP3A 4PUCA 3S2AA 3D9JA 2VSYA 3LY9A 5LCWJ 4UI9C 3VTYA 5D0OD 2XEVA 5KJMA 1Z3YA 4N2SA 2WVIA 3R7RA 3L22A 3SBTB 4IRUA 3OXGA 3ZEFA 4A1SA 4D10C 1IYGA 4CCAA 2X38A 5CKLA 3FEYA 3PVLA 2G03A 3SFZA 3CK8A 3D3MA 4DI3A 3FH8A 2J08A 3IV0A 1SZAA 3FUNA 1UN9A 4ACLA 4BWRA 4CRWA 5AYWD 2XHEA 4Q94A 3D9MA 1NP7A 4P29A 4BT9A 1Z3XA 5CHEE 2WXNA 3FFLA 2ILRA 4GA2A 4MS6A 3ZXSA 1IQUA 3FTXA 4N3BA 3SI5A 4PH4B 1HG2A 3CHOA 5EU0A 4APFA 2XCCA 3LYAA 3FUHA 4HOSA 3FU0A 1IQRA 4E6HA 4GZCA 1FCHA 4I9EA 3TJPA 4JHJA 3ENEA 3L16A 4A3VA 2XPZA 3LVQE 4XI0A 3GZ1A 3URZA 3T8MA 4RSYA 2XRYA 2YHEA 3UMVA 4ME2A 3R7QA 3ZHEB 3APDA 4NRHB 5KJKA 3CGHA 2A4ZA 4H7XA 2KCLA 2WXFA 1E8XA 5T8IA 4NURA 5AJDA 2NXPA 1UJJA 1E8YA 4BX8A 2VSOE 2J4DA 4KT6B 5BV0A 2IOSA 3GZ2A 4EQFA 3L54A 4WWPA 3IKOB 3APCA 4AV7A 4C0EA 2Y4UA 4FA6A 2NSZA 4CEMA 3D9LA 3CUCA 4WAFA 1KT0A 4AM9A 2VY3A 2VZAA 4L2LA 2LSVA 3VLDA 1ELWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WQH A;  5BW8 C;  3LCA A;  4HOR A;  3CK9 A;  4I9C A;  3KS2 A;  3KAE A;  4G26 A;  3LKU A;  3NF1 A;  3ZGQ A;  2JLB A;  3S7D A;  2V5F A;  3CVQ A;  4NPS A;  3Q4A B;  2P58 C;  2Y4T A;  1YA0 A;  4N39 A;  5FZQ A;  1HH8 A;  5BT1 A;  1P5Q A;  2FEZ A;  1KT1 A;  5EX0 A;  4XI9 A;  5FZR A;  4UQY A;  2PL2 A;  4YVO A;  2Q7F A;  1HZ4 A;  1NA3 A;  1IHG A;  4G2V A;  4Y6W A;  3SZ7 A;  3ULQ A;  3WXX A;  4KXK B;  3QWP A;  3E4B A;  4J8F A;  3CEQ A;  5JJ7 A;  3QWV A;  3RO2 A;  1OUV A;  5EX3 A;  2XGS A;  3CVP A;  5HI7 A;  3QOU A;  4G24 A;  4I1A A;  1KLX A;  4N67 A;  4HOT A;  2FO7 A;  2WPV A;  3ASF A;  4CGV A;  4G23 A;  5CMT A;  4WNF A;  4X2D A;  4AY6 A;  2BUG A;  2F6S A;  3Q5M A;  4UQZ A;  2I6H A;  2KC7 A;  2PQN A;  3QKY A;  4Y6C A;  4GCO A;  3SN9 A;  2FI7 A;  4RG6 A;  2LNI A;  2OND A;  3QDN A;  4U07 A;  5D0Q D;  5G05 C;  4BTB A;  3TG4 A;  3AS5 A;  1QZ2 A;  4GZ3 A;  4G1T A;  2HR2 A;  3ESK A;  2J9Q A;  4J8D A;  4U0S A;  3AS4 A;  3ASD A;  3UUX A;  4AY5 A;  3EDT B;  5ARG A;  1ZBP A;  3R9A B;  5C1D A;  2XGO A;  2UY1 B;  3MKR A;  4UQX A;  2QFC A;  4WGJ A;  3ASG A;  4I2W A;  4GPK A;  5FJY A;  3LPZ A;  4GA0 A;  3Q15 A;  5G04 C;  3ZCB A;  4W9R A;  5A6C A;  2VYI A;  3CV0 A;  3ZPJ A;  2VSN A;  5LCW C;  5CGL A;  1W3B A;  2L6J A;  4UI9 K;  3CK7 A;  2HYZ A;  5G05 J;  4I17 A;  3GYZ A;  4G25 A;  4N2Q A;  4X2E A;  3BEE A;  3SF4 A;  2UY1 A;  2IFU A;  2HO1 A;  3RO3 A;  4J0U A;  3N3U A;  3LY7 A;  4GYO A;  2FBN A;  3MV2 B;  5EKQ D;  4WND A;  5A7D B;  5M72 A;  2C0L A;  2XPI A;  1ELR A;  4H7Y A;  1XNF A;  3TAX A;  2XGM A;  3Q49 B;  3S7B A;  1QQE A;  3JYS A;  2KCV A;  3HYM B;  4J8E A;  5BNW A;  2FF4 A;  4JL0 A;  4LU4 A;  4GZ6 A;  2XCB A;  4KBQ A;  2LSU A;  2YQ8 A;  2NC9 A;  2YHC A;  4B94 A;  3ZLM A;  5HQ8 A;  2VGX A;  4O6F A;  3CKC A;  5FZS A;  2UWJ G;  3N71 A;  3S7F A;  3GW4 A;  4U0U A;  2VQ2 A;  5JJT A;  3SHG A;  3SE5 A;  4F3V A;  3LY8 A;  2MHK A;  5CCM A;  4KYO B;  1HXI A;  3CKB A;  3IEG A;  3LET A;  1WAO 1;  1WM5 A;  3OXL A;  4WNE A;  4GZ5 A;  4UI9 J;  4M16 A;  3CVN A;  1E96 B;  2PQR A;  2C2L A;  5DIZ A;  5ARF A;  1NA0 A;  2AVP A;  3VTX A;  3UQ3 A;  3CVL A;  3Q47 B;  1PC2 A;  1ZU2 A;  4GYW A;  2OOE A;  3K9I A;  4GA1 A;  1NZN A;  3S6A A;  1B89 A;  3MV3 B;  5JJ6 A;  4ITR A;  4WNG A;  2PZI A;  3UPV A;  3ZHE A;  3ASH A;  3RIB A;  4CDR A;  4U04 A;  1A17 A;  3RKV A;  2DBA A;  2R5S A;  2C0M A;  4U0Z A;  4N3C A;  5CCL A;  5KJL A;  2E2E A;  4CGW A;  4BT8 A;  4BTA A;  5KJN A;  3ZFW A;  2VGY A;  4N5C A;  2IF4 A;  5FTP A;  3PE3 A;  5DBK A;  4PY3 A;  2VGX B;  5G04 J;  2KCK A;  4APO A;  1Y8M A;  3U4T A;  3PE4 A;  4N3A A;  5FT9 A;  4GYY A;  4XIF A;  2KAT A;  2JK8 A;  4JA9 A;  3FWV A;  4YND A;  4JA7 A;  3AS8 A;  1TJC A;  3O48 A;  4XI8 A;  3RU0 A;  2GW1 A;  3MA5 A;  3U3W A;  4I2Z A;  4JHR A;  4IN3 B;  3TGO A;  4X2C A;  3KD7 A;  4LEU A;  3S7J A;  4WUY A;  5JFZ A;  4ABN A;  3QWW A;  4YVQ C;  3OXF A;  4RG9 A;  4AIF A;  5JFF A;  3PDN A;  3ZC7 A;  3ZN3 A;  3MEK A;  3TG5 A;  4NQ0 A;  4GCN A;  3RJV A;  4HOU A;  4HOQ A;  3FP3 A;  5LCW J;  2VSY A;  3LY9 A;  4N2S A;  4UI9 C;  3VTY A;  5D0O D;  2XEV A;  5KJM A;  3OXG A;  4A1S A;  1IYG A;  5CKL A;  2G03 A;  3CK8 A;  4BWR A;  5AYW D;  4BT9 A;  5CHE E;  3FFL A;  4GA2 A;  4N3B A;  5EU0 A;  2XCC A;  3LYA A;  4HOS A;  1FCH A;  4I9E A;  4XI0 A;  3GZ1 A;  3URZ A;  4ME2 A;  3ZHE B;  4NRH B;  5KJK A;  4H7X A;  2KCL A;  3GZ2 A;  4EQF A;  2Y4U A;  3CUC A;  1KT0 A;  4AM9 A;  2VY3 A;  2VZA A;  2LSV A;  1ELW A; 
#chains in the Genus database with same CATH topology
 2FUL A;  3UXG A;  2RG8 A;  4G26 A;  1Z6T A;  3ONK A;  3NF1 A;  3HXD A;  3ZGQ A;  2JLB A;  4G8K A;  5AQA A;  2EIN E;  4NPS A;  2P58 C;  1FVF A;  3DSX A;  3DBS A;  1EF1 C;  3MYV A;  2AW6 A;  4MLP A;  1MYO A;  3Q75 A;  1JUQ A;  5FZQ A;  5BT1 A;  5BV1 A;  1KT1 A;  1YMP A;  5KNH D;  5EX0 A;  3QAQ A;  4XI9 A;  3SQV A;  1MX2 A;  2PL2 A;  4XKC A;  4C0M A;  4DLO A;  1HZ4 A;  2WQ6 A;  5A23 A;  1OXJ A;  3WXX A;  3PS6 A;  3QWP A;  5D66 A;  1TNZ A;  5H7P A;  5FQ7 A;  4PS8 A;  1OY3 D;  3CEQ A;  3UT8 A;  4GZD A;  3I4R B;  2BKK B;  2DZN A;  4EPZ A;  3CLJ A;  5EX3 A;  4UWL A;  4Z68 A;  3NB2 A;  4NAC A;  3QOU A;  1AWC B;  4FLH A;  4GMR A;  3CSF A;  1LD8 A;  4UWF A;  2IU1 A;  2ZXW E;  4A55 A;  3PEV B;  3JXJ A;  3ISM C;  3Q5M A;  3ESL A;  4CDM A;  4GTP A;  3L17 A;  5EIL A;  4GCO A;  1Y6I A;  2FI7 A;  2P9S G;  3LEW A;  4RG6 A;  2LNI A;  3UM2 A;  4B0Z A;  5C2Y A;  2Y3A A;  2GRL A;  3D9K A;  1O1R A;  4LSZ E;  5D0Q D;  5LP0 A;  3TG4 A;  4X8Q A;  3PEU B;  2HR2 A;  4TV3 A;  2KZT A;  3ESK A;  1ZB1 A;  3PZ2 A;  3ABM E;  4KZC A;  2NUN A;  3PRZ A;  2WXI A;  4UWH A;  4M7C A;  4BSZ B;  5ARG A;  2GRO B;  3LJ3 A;  3R9A B;  3FTV A;  1SQM A;  2WMO A;  3ASG A;  4GA0 A;  3B13 A;  5A6C A;  2LXM A;  2WB2 A;  1S64 A;  2DZO A;  5HS0 A;  4U7E B;  1NFI E;  1YYH A;  3CK7 A;  2J07 A;  4DX6 D;  2DYR E;  4E85 A;  5CRV A;  3GYZ A;  4U8V D;  4G25 A;  3NZU A;  4X2E A;  2F8Y A;  4FP7 A;  1E7U A;  4B93 B;  4XKB A;  5EYP F;  4I6J A;  3HDX A;  5AQ7 A;  2I9C A;  5AJL A;  5EKQ D;  2FBN A;  4JVS A;  4ILI A;  3LXU X;  4JXT A;  4CYM D;  1XNF A;  3TAX A;  4F1P A;  3B7B A;  3L82 A;  2NUD A;  4HVB A;  2XCB A;  1K1A A;  4OAU C;  2NC9 A;  2VGX A;  3CKC A;  5FZS A;  2UWJ G;  4YDE A;  2OV8 A;  3S7F A;  3D9P A;  3DSS A;  5CEA A;  2VQ2 A;  4EZK A;  2LAI A;  1QNF A;  4I43 A;  1HX8 A;  3MKQ A;  4GTS A;  3LET A;  1WAO 1;  4UI9 J;  3DPY A;  1JPL A;  1MJ0 A;  2PQR A;  3EHQ A;  1GW6 A;  1NL4 A;  1NA0 A;  4JC8 A;  2P9L G;  2X6I A;  1N11 A;  3K9I A;  4TRQ A;  5D2M C;  4GA1 A;  1IXV A;  1NZN A;  3S6A A;  3QB2 A;  3MV3 B;  4ITR A;  1N4Q A;  4DX5 D;  3MZL B;  4ILH B;  1UG3 A;  3QJZ A;  3UPV A;  3ZHE A;  3FTY A;  5JMN D;  3AJI A;  3T8K A;  4CDR A;  1A17 A;  5LFA A;  3CR3 A;  3FUK A;  4WWN A;  1OWP A;  2E2E A;  4I6E A;  2BTD A;  3IHY A;  3UT4 A;  4I1M A;  1PY1 A;  5FTP A;  3PE3 A;  5BPP A;  5DBK A;  4PY3 A;  5G04 J;  4YDO A;  4HLL A;  1Y8M A;  3UM1 A;  2ZGG A;  1AP7 A;  2MOW A;  4FJY A;  4QFV A;  1OCZ E;  3HVE A;  2KAT A;  2JK8 A;  1IHB A;  1TNO A;  4JEH A;  4YND A;  4JA7 A;  3FHE A;  3AS8 A;  4XI8 A;  1H0A A;  2GW1 A;  3ZYM A;  4LRZ A;  4IN3 B;  4DK5 A;  3S7J A;  3ZU7 B;  4U63 A;  4WUY A;  5JFZ A;  3TWQ A;  1OCR E;  4ABN A;  2AWI A;  1FVH A;  4AP2 A;  3VLF A;  5JFF A;  1DVP A;  5ENQ D;  3RJV A;  5AIJ A;  3KSQ A;  4JW1 A;  2H6G A;  1N95 A;  3NAW A;  3SO8 A;  4FHJ A;  4EZL A;  5LCW J;  4N2S A;  5D0O D;  2WVI A;  3V79 K;  3ZEF A;  2IO3 C;  4A1S A;  4CCA A;  2X38 A;  3PVL A;  3SFZ A;  3D3M A;  3NOG D;  2J08 A;  3IV0 A;  3ULY A;  4BT9 A;  1BLX B;  2EIK E;  5CHE E;  1SA5 A;  2ILR A;  4GA2 A;  2MYO A;  4MS6 A;  4HRL A;  3FTX A;  3SI5 A;  3CHO A;  1TNY A;  4E6H A;  1FCH A;  4I9E A;  1MZC A;  4A3V A;  3LVQ E;  4GTQ A;  3UMV A;  4GTT A;  1FPP A;  4HRN A;  5AJD A;  1UJJ A;  1E8Y A;  5BV0 A;  3W9G A;  3C5R A;  1KT0 A;  4WAF A;  5IY5 E;  2QYJ A;  3ZNG A;  5BW8 C;  3MKQ B;  4HOR A;  3CK9 A;  4I9C A;  1JWG A;  3KAE A;  3TL5 A;  2V8S E;  4HS2 A;  1U3C A;  3Q78 A;  3E30 A;  1X81 A;  4B8C B;  3Q4A B;  2Y4T A;  3MX3 A;  1EYH A;  2GRP B;  1YA0 A;  4N39 A;  1HH8 A;  3F6Q A;  2R05 A;  4DJA A;  3B7S A;  3CIA A;  4MRU A;  3IHV A;  3TWR A;  2E0I A;  1TN8 A;  2KBX A;  4UQY A;  5FZR A;  4YVO A;  2Q7F A;  1NA3 A;  1L5J A;  1TJF A;  4ANV A;  3SZ7 A;  4AVX A;  4TUM A;  3E34 A;  3JXI A;  5JJ7 A;  2OVF A;  3QWV A;  1OUV A;  1N0Q A;  3CVP A;  5T4Y A;  5HI7 A;  3JCK C;  3LDZ A;  4N5Q A;  3BQO A;  3GZS A;  3PNL B;  3UI2 A;  4URK A;  4N67 A;  1RW2 A;  1DNP A;  4JEU A;  3APF A;  4X2D A;  2BUG A;  3V31 A;  3BG0 B;  4UQZ A;  1H6P A;  2JEK A;  5AEN A;  2CHW A;  4I1O B;  2PQN A;  2XPY A;  5ANL A;  4TXR A;  2IEJ A;  3FUE A;  4EEC A;  5ENN A;  2WXQ A;  2X6J A;  3C3R A;  1EDU A;  2WXG A;  4K0R A;  2J9Q A;  4J8D A;  2PM6 A;  3V2X A;  2P9N G;  1TNU A;  4KZ0 A;  3UUX A;  4AY5 A;  4UWK A;  3EDT B;  2M63 A;  3CHM A;  2ZU6 B;  2VTB A;  1ZBP A;  2DYS E;  2XGO A;  2UY1 B;  3MKR A;  5JA4 D;  4WGJ A;  4ANU A;  4GPK A;  5FJY A;  3Q15 A;  3CVW A;  3ZCB A;  2L0T B;  3ZRH A;  3SD5 A;  5LCW C;  1OT8 A;  3EIQ C;  4LCT A;  3UM0 A;  2J09 A;  3EUV A;  3FUM A;  2L6J A;  4BER A;  3ASO E;  1WDY A;  5CEC B;  3Q7A A;  4I17 A;  4Q96 A;  5AQ9 A;  3CVV A;  3B7U X;  4GML A;  3NBN B;  3BEE A;  3FUI A;  2AXZ A;  2UY1 A;  2IFU A;  4ATG A;  3RO3 A;  4J0U A;  3SHF A;  5E75 A;  3LY7 A;  1JWF A;  4WND A;  5B1B E;  5M72 A;  2C0L A;  2CHX A;  1H2T C;  3Q49 B;  1QQE A;  3EU9 A;  2KCV A;  4J8E A;  2ETA A;  5BNW A;  2FF4 A;  4GZ6 A;  4KBQ A;  2P2C P;  2YQ8 A;  4DUI A;  3CHP A;  2A5U A;  5HQ8 A;  2CFZ A;  1V54 E;  4FLB A;  5E76 A;  1U2V G;  3KEA A;  1TN7 A;  1N54 A;  3IXE A;  1TEZ A;  1HF8 A;  1OCC E;  4FHK A;  3CHS A;  4ZHB A;  3SHG A;  1HO8 A;  3PUJ A;  3FUL A;  3W9F A;  1H6O A;  2MHK A;  3IEG A;  3OXL A;  4EHM A;  4GZ5 A;  4R7L A;  3HRA A;  3EIJ A;  4HFG A;  1MX4 A;  5DIZ A;  3B7R L;  5ARF A;  4GU5 A;  1JCQ A;  3UX4 A;  2QZA A;  3RRN B;  3CVL A;  3AG4 E;  1H6K A;  1KZP A;  2JAB A;  2GGF A;  2LO6 A;  2LUH A;  2PZI A;  2VGE A;  4BES A;  5BUZ A;  4GB9 A;  2X6F A;  3CST A;  2IO2 C;  2KXP C;  3EJN A;  4L2Y A;  2VJ8 A;  2GRR B;  3J5Q B;  3I4G A;  3RKV A;  2WQ7 A;  2R5S A;  4U0Z A;  4N3C A;  2V4H C;  4CGW A;  1BU9 A;  4DRX E;  4BTA A;  5KJN A;  3FTW A;  4U8Y D;  4ACK A;  2KCK A;  4OVV A;  5J90 A;  3U4T A;  3L08 A;  4FUL A;  4G11 A;  3PE4 A;  5FT9 A;  4FU3 A;  3PZ4 A;  4XIF A;  4A1G A;  4JA9 A;  4DI4 A;  3EHR A;  3FWV A;  4PDX A;  3MGB A;  4PS3 A;  2XEE A;  5KCM A;  5CBN A;  4J7W A;  3TGO A;  3KD7 A;  2KM4 A;  4BY6 A;  3TWU A;  3PRE A;  3QWW A;  3OXF A;  4RG9 A;  2WXO A;  3QC1 A;  2ZIS A;  3KEZ A;  5LX8 A;  3TWT A;  3MEK A;  3CVX A;  4LNU D;  4GCN A;  4ATZ D;  4HOQ A;  3HVE B;  4PUC A;  4UI9 C;  3VTY A;  1Z3Y A;  3R7R A;  3L22 A;  3SBT B;  4IRU A;  4D10 C;  3TWX A;  2G03 A;  4ACL A;  4CRW A;  4P29 A;  4RLY A;  4UUC A;  3FFL A;  4CZ2 D;  4PH4 B;  4APF A;  3FU0 A;  4XEI G;  4HB5 A;  3L16 A;  2XPZ A;  4RSY A;  3R7Q A;  4O60 A;  4QQI A;  4NRH B;  2A4Z A;  5FIO A;  2WXF A;  4NUR A;  2NXP A;  2ZGD A;  2J4D A;  3DSV A;  3L54 A;  3DEO A;  4C0E A;  4AV7 A;  3PZ1 A;  2Y4U A;  3D9L A;  3CUC A;  2VY3 A;  2VZA A;  4L2L A;  1BI8 B;  1UOH A;  4K5C A;  4ILG A;  2OEV A;  2DWZ A;  3FH7 A;  3JQ1 A;  4GTO A;  3TWW A;  4K03 A;  4CT0 A;  4PS7 A;  3ABL E;  3ZW3 A;  5G2N A;  3S7D A;  1BD8 A;  2V5F A;  1HG5 A;  2BF0 X;  3DXM G;  3G2T A;  2WXP A;  4XX5 A;  1FT2 A;  3FUD A;  4HI9 A;  2Y69 E;  1HS6 A;  2PNN A;  3R9M A;  1KZO A;  2FEZ A;  3DSW A;  4GMJ A;  4CT4 A;  2HM8 A;  5G55 A;  1IHG A;  3JQ0 A;  3LJN A;  5ENR D;  2PM7 A;  3E4B A;  1K3Z D;  3QK0 A;  1MQS A;  3ZIM A;  2P9P G;  5J08 A;  3E37 A;  3FEX A;  4L7T A;  3Q79 A;  3NZS A;  3C3O A;  3E33 A;  3VLE A;  3QNK A;  1KLX A;  4HOT A;  2FO7 A;  2WPV A;  4HI8 A;  3FUJ A;  4WNF A;  5FWQ A;  5ENO D;  5CBO A;  2I6H A;  3J5P A;  2KC7 A;  4B89 A;  3L6A A;  1K1B A;  3QKY A;  2VSX E;  4J8S A;  2LXL A;  3SY2 A;  2OND A;  1SW6 A;  2CHZ A;  3QDN A;  2KZT B;  5AQB A;  4BTB A;  3EHN A;  1E8Z A;  2BED A;  4CDN A;  3AS5 A;  1QZ2 A;  4GZ3 A;  3CQC B;  4G1T A;  5CMW A;  3D9O A;  4K5B A;  2LAH A;  4MKT A;  3ASD A;  1SA4 A;  3FU6 A;  2XEH A;  4JD2 G;  1U3D A;  5C1D A;  3TWV A;  3CVY A;  3BU8 A;  1NI1 A;  2L9B A;  4UQX A;  3D9I A;  4U8H A;  2J4B A;  4I2W A;  3LPZ A;  4W9R A;  2VYI A;  3CV0 A;  3ZPJ A;  2VSN A;  2WXJ A;  2IOL A;  3EU5 A;  5CGL A;  5CMY A;  3FTS A;  2QC9 A;  4UI9 K;  3HXF A;  2XS8 A;  1VDY A;  2WXK A;  1E90 A;  5EYL A;  3C3Q A;  1TN6 A;  5AAR A;  2I2O A;  3N3U A;  3JUE A;  4GYO A;  3L9T A;  2XPI A;  3OTN A;  3QAR A;  4L23 A;  3PZD A;  1HFA A;  1ELR A;  3LS8 A;  4DPR A;  3S7B A;  3JYS A;  3HYM B;  2V5Q C;  4LU4 A;  1OWN A;  3DRA A;  2CFU A;  1UN8 A;  3FH5 A;  3U64 A;  3ZLM A;  4JHK A;  2F37 A;  4O6F A;  2Y1L E;  1S70 B;  4RVB A;  4GTM A;  2XEN A;  3FTU A;  3SGH A;  2L6B A;  4F53 A;  3GW4 A;  4NIK A;  3PH0 C;  3SE5 A;  4KYO B;  4KVO A;  4O1P A;  2F0Y A;  5BXO A;  1E96 B;  4YDY A;  5CER B;  2C2L A;  3UIP C;  5B1A E;  3VTX A;  3Q47 B;  1PC2 A;  1ZU2 A;  4GYW A;  3ZKJ A;  2WXL A;  4XE0 A;  3NQP A;  2QYU A;  2X3M A;  4KVM A;  4F6R D;  2XS1 A;  4WNG A;  3UIN C;  1N9A A;  5ENP D;  2XZD G;  1D8D A;  3ASH A;  4J6I A;  2RFA A;  4ANW A;  2WM9 A;  5KJL A;  4BT8 A;  1QYM A;  3IBE A;  3L13 A;  2X6H A;  1DC2 A;  2ZIR A;  3FU3 A;  2A5E A;  3T9K A;  3TWS A;  3ZVV A;  1JCR A;  5KWD A;  1S0P A;  2FO1 E;  4BEP A;  5JHA A;  4BX9 A;  5EDS A;  2RFM A;  5AN8 A;  5EN5 D;  4IUL A;  2DIW A;  3O48 A;  3FY4 A;  3WG7 E;  2P9I G;  2OVB A;  3MA5 A;  3U3W A;  4J8Y A;  1YCS B;  2H6I A;  4X2C A;  3Q9N C;  3PZ3 A;  4LEU A;  1H19 A;  1O1T A;  4OAV B;  3FDH A;  1K8K G;  4IYP A;  2R17 C;  3B7T A;  3CQG B;  3ONL A;  3PDN A;  4O1O A;  3RAU A;  3ZC7 A;  3TXM A;  5T3R A;  3TG5 A;  4NQ0 A;  1UW4 B;  1Z5S C;  2B0O E;  3KSL A;  2DCP A;  3ML9 A;  3PNT B;  2IJG X;  3FP3 A;  3S2A A;  4L9P A;  2VSY A;  3LY9 A;  2XEV A;  3CK8 A;  3FH8 A;  4TXP A;  1SZA A;  1UN9 A;  4TXQ A;  2XHE A;  3D9M A;  1Z3X A;  5ENT D;  2WXN A;  4C48 B;  1N94 A;  1IQU A;  2EIJ E;  4N3B A;  5EU0 A;  2XCC A;  3LYA A;  3FUH A;  4HOS A;  4GZC A;  3TJP A;  3ENE A;  3UKU G;  4K5A B;  4DX2 A;  5CED B;  3URZ A;  4HBD A;  4ME2 A;  3ZHE B;  5KJK A;  3CGH A;  2KCL A;  1E8X A;  2IOS A;  3GZ2 A;  3IKO B;  2NSZ A;  3AG1 E;  5ANR A;  2LSV A;  3VLD A;  1ELW A;  2WQH A;  3LCA A;  4RQI A;  3P1U A;  3SFX A;  3KS2 A;  4L1B A;  2GRQ B;  3LKU A;  1Q2Z A;  5FQ8 A;  1O5M A;  3FTZ A;  3HIZ A;  2XRZ A;  5ENS D;  3CVQ A;  3CHQ A;  2WMN A;  1BPO A;  3DST A;  1BI7 B;  4OYS A;  3D9H A;  2L0I A;  3HXC A;  2XZT G;  3C98 A;  3AU5 A;  3ML8 A;  1P5Q A;  4GAA A;  2EIL E;  1DCE A;  4AEZ C;  1D8E A;  4GTV A;  1OWO A;  4G2V A;  4Y6W A;  3ULQ A;  4KXK B;  3UIO C;  3I3N A;  4ANX A;  4J8F A;  4A3T A;  2WXH A;  3DXK G;  3RO2 A;  2X6K A;  1MX6 A;  3MJW A;  5CRU A;  2XGS A;  3ZXP A;  3ZYQ A;  3UTM A;  2EIM E;  2R02 A;  1INZ A;  4G24 A;  4I1A A;  3ASF A;  4CGV A;  3OAW A;  4G23 A;  5CMT A;  4AY6 A;  3HXB A;  2F6S A;  1XGW A;  4DX7 D;  3I5P A;  5EID A;  2I1J A;  3ZYK A;  4F7A A;  1OWL A;  4Y6C A;  3SN9 A;  4A63 B;  2DVW A;  4LER A;  3DSU A;  3RSE G;  4KMO A;  3PUK A;  4LUN U;  4U07 A;  5G05 C;  5ITZ F;  1FT1 A;  2AXV A;  4ZFH A;  4FC8 A;  3AG2 E;  2AXU A;  3V30 A;  3DPD A;  1D9S A;  4GPM A;  4AOF A;  2V4L A;  2J49 A;  4U0S A;  3AS4 A;  3E32 A;  2YNQ A;  5FQ6 A;  1N4R A;  4JPS A;  4HRM B;  3RRM B;  5FIN A;  1TR4 A;  4Q69 A;  1LF8 A;  1E8W A;  4B8A A;  3TXN A;  3G2V A;  4HQD A;  2R59 A;  4U96 D;  2RD0 A;  2QFC A;  5FQ4 A;  1G3N B;  5G04 C;  1N4S A;  3ULE G;  2ETC A;  2BKG A;  1W3B A;  2XQ0 A;  1E7V A;  2HYZ A;  5G05 J;  1S63 A;  4FAD A;  3DEP A;  3G2U A;  3B95 A;  4N2Q A;  3DWL G;  4EBA G;  4JZY A;  2CG2 A;  4U95 D;  3SF4 A;  3P2B A;  3Q73 A;  4C9B B;  5KBA A;  2HO1 A;  5LOZ A;  3HG0 D;  3ABK E;  3MV2 B;  1QBQ A;  4AJW A;  5A7D B;  2I1K A;  1OWM A;  1N0R A;  3SNX A;  3ZUV B;  2WXR A;  3V2O A;  3U66 A;  4H7Y A;  3ASN E;  1X5B A;  2XGM A;  3U9W A;  4JL0 A;  3D9N A;  4DX1 A;  2IQC A;  2CG3 A;  1TYQ G;  2LSU A;  2YHC A;  4B94 A;  1H2V C;  2GRM A;  3HXE A;  4BFR A;  1HE8 A;  3T5V A;  3N71 A;  3FU5 A;  4BSX A;  4U0U A;  4DLQ A;  3UM3 A;  3ZYL A;  5JJT A;  4F3V A;  3LY8 A;  5CCM A;  1HXI A;  3CKB A;  1WM5 A;  4WNE A;  4M16 A;  3CVN A;  3FUF A;  2AVP A;  3UQ3 A;  4TUU A;  2OOE A;  2ION A;  2YIN A;  2QY7 A;  4HLE A;  3UT7 A;  5EIB E;  1B89 A;  5JJ6 A;  1UJK A;  1RZ4 A;  3SBS A;  3AU4 A;  3AAA C;  2EQX A;  3Q7F A;  3HHM A;  4UWG A;  3RIB A;  2NYJ A;  4G8L A;  4WWO A;  4YDW A;  2VTB B;  4U04 A;  1N4P A;  2DBA A;  4I6G A;  2C0M A;  5CCL A;  3G2W A;  4JB8 P;  1HU3 A;  3JUI A;  4XZ4 A;  5JHB A;  3BG1 B;  3ZFW A;  2VGY A;  4N5C A;  2ETB A;  2IF4 A;  2HE0 A;  2VGX B;  1OCO E;  4EZJ A;  1TNB A;  3X2Q E;  4F1S A;  2J8S D;  4APO A;  3G2S A;  3CVU A;  3LVR E;  1V55 E;  2H6H A;  4N3A A;  1SZ9 A;  1EPU A;  4GYY A;  1WG0 A;  1ELK A;  2Y0B G;  2OCC E;  2F8X K;  1MHQ A;  1JCS A;  5HKP A;  2RKK A;  1TJC A;  3T5X A;  3EHM A;  3RK6 A;  1PAQ A;  3RU0 A;  2B6C A;  1DCQ A;  1N52 A;  4I2Z A;  2H6F A;  4JHR A;  4AXH A;  3SFY A;  2V0P A;  4M3O A;  3Q9U C;  4HXI A;  2MRI A;  3NOC D;  4YVQ C;  2GRN B;  1H2U A;  1WY6 A;  2IY0 C;  4LG6 A;  2AJA A;  4AIF A;  3ZN3 A;  5BXU A;  4HNA D;  2WXM A;  4OVU A;  4EBA A;  3MCX A;  3BUA A;  5B3S E;  4HOU A;  3O4Z A;  4V3I A;  4FJZ A;  5AAO A;  2R03 A;  3RRU A;  3CHR A;  3D9J A;  5KJM A;  3OXG A;  1IYG A;  4LNG A;  5CKL A;  3FEY A;  2P9K G;  4DI3 A;  1KPS B;  3FUN A;  4BWR A;  5AYW D;  4Q94 A;  1NP7 A;  2P9U G;  5HRY A;  5KNG A;  3ZXS A;  2R2L A;  1HG2 A;  1SVX A;  1IQR A;  4GTR A;  1O1S A;  4JHJ A;  1NH1 A;  4XI0 A;  1A5E A;  3GZ1 A;  3T8M A;  2OEW A;  2XRY A;  2YHE A;  3APD A;  4H7X A;  4LNB A;  5T8I A;  1LD7 A;  1IKN D;  4BX8 A;  4MBG A;  2VSO E;  4KT6 B;  4EQF A;  4WWP A;  3APC A;  4FA6 A;  1LTX A;  4CEM A;  4BET A;  4AM9 A;  3AG3 E;  3C72 A;  3UKR G; 
#chains in the Genus database with same CATH homology
 2WQH A;  4ILG A;  5BW8 C;  2FUL A;  3LCA A;  3MKQ B;  4HOR A;  3CK9 A;  3P1U A;  1JWG A;  2RG8 A;  3FH7 A;  3JQ1 A;  3KAE A;  3KS2 A;  4G26 A;  4I9C A;  4L1B A;  3TL5 A;  3LKU A;  1Z6T A;  3ONK A;  3NF1 A;  4K03 A;  3ZGQ A;  4CT0 A;  4PS7 A;  2V8S E;  5FQ8 A;  2JLB A;  3FTZ A;  3ZW3 A;  3HIZ A;  4HS2 A;  1U3C A;  5G2N A;  2XRZ A;  3S7D A;  2V5F A;  3CVQ A;  3CHQ A;  1HG5 A;  4NPS A;  2BF0 X;  3G2T A;  4B8C B;  2WMN A;  3Q4A B;  1BPO A;  2P58 C;  2Y4T A;  1FVF A;  3DBS A;  1EF1 C;  2WXP A;  3MX3 A;  3MYV A;  4OYS A;  2AW6 A;  4MLP A;  1EYH A;  2L0I A;  4XX5 A;  3FUD A;  1YA0 A;  1JUQ A;  1HS6 A;  4N39 A;  5FZQ A;  1HH8 A;  3C98 A;  3AU5 A;  3ML8 A;  1P5Q A;  4GAA A;  5BT1 A;  5BV1 A;  2FEZ A;  1KT1 A;  4DJA A;  5EX0 A;  3QAQ A;  4GMJ A;  4XI9 A;  3B7S A;  3CIA A;  4MRU A;  3IHV A;  4CT4 A;  2E0I A;  4AEZ C;  5FZR A;  4UQY A;  2HM8 A;  2PL2 A;  5G55 A;  4XKC A;  2Q7F A;  4YVO A;  1HZ4 A;  1NA3 A;  4C0M A;  4DLO A;  1L5J A;  1TJF A;  1OWO A;  5A23 A;  4ANV A;  1IHG A;  2WQ6 A;  4G2V A;  4Y6W A;  3SZ7 A;  3ULQ A;  3JQ0 A;  4KXK B;  3WXX A;  3PS6 A;  3QWP A;  2PM7 A;  4AVX A;  3E4B A;  3QK0 A;  1MQS A;  3I3N A;  5FQ7 A;  4PS8 A;  3ZIM A;  4ANX A;  5J08 A;  4J8F A;  4A3T A;  2WXH A;  3CEQ A;  3FEX A;  3UT8 A;  4L7T A;  4GZD A;  5JJ7 A;  2OVF A;  3QWV A;  3NZS A;  2X6K A;  1OUV A;  3I4R B;  3RO2 A;  4EPZ A;  3CLJ A;  3VLE A;  5EX3 A;  3MJW A;  4UWL A;  2XGS A;  3CVP A;  5T4Y A;  5HI7 A;  3JCK C;  3ZYQ A;  4NAC A;  3QOU A;  3LDZ A;  1INZ A;  4G24 A;  3GZS A;  3PNL B;  3QNK A;  4FLH A;  4I1A A;  4URK A;  1KLX A;  4N67 A;  3CSF A;  4HOT A;  4UWF A;  2FO7 A;  2WPV A;  3ASF A;  4CGV A;  3OAW A;  1DNP A;  2IU1 A;  4G23 A;  5CMT A;  3APF A;  3FUJ A;  4JEU A;  4X2D A;  4WNF A;  2BUG A;  5FWQ A;  4A55 A;  3PEV B;  4AY6 A;  2F6S A;  1XGW A;  3BG0 B;  3Q5M A;  3I5P A;  4UQZ A;  2I6H A;  3ESL A;  4CDM A;  2JEK A;  2I1J A;  2KC7 A;  3L17 A;  3ZYK A;  5AEN A;  2CHW A;  4B89 A;  3L6A A;  4I1O B;  4F7A A;  1OWL A;  2PQN A;  2XPY A;  3QKY A;  2VSX E;  4GCO A;  4J8S A;  1Y6I A;  3SN9 A;  4Y6C A;  2FI7 A;  5ANL A;  3LEW A;  4RG6 A;  4LER A;  3FUE A;  2LNI A;  4EEC A;  4KMO A;  5ENN A;  2OND A;  4B0Z A;  5C2Y A;  2CHZ A;  2Y3A A;  3QDN A;  2GRL A;  3PUK A;  3D9K A;  4LUN U;  4U07 A;  2KZT B;  5D0Q D;  5G05 C;  4BTB A;  5LP0 A;  3EHN A;  1E8Z A;  2AXV A;  3TG4 A;  4FC8 A;  4CDN A;  2AXU A;  3AS5 A;  1QZ2 A;  2WXQ A;  4GZ3 A;  3PEU B;  2X6J A;  3CQC B;  4G1T A;  1EDU A;  2HR2 A;  5CMW A;  3D9O A;  2WXG A;  3DPD A;  4TV3 A;  4K0R A;  2KZT A;  4AOF A;  2LAH A;  3ESK A;  2J9Q A;  2V4L A;  4J8D A;  2PM6 A;  2J49 A;  4U0S A;  3AS4 A;  4MKT A;  2YNQ A;  3ASD A;  4KZC A;  5FQ6 A;  4KZ0 A;  3UUX A;  4AY5 A;  4JPS A;  3PRZ A;  3FU6 A;  2WXI A;  3RRM B;  4UWK A;  4UWH A;  3EDT B;  2M63 A;  3CHM A;  1U3D A;  2ZU6 B;  3LJ3 A;  5ARG A;  4Q69 A;  2VTB A;  1LF8 A;  1ZBP A;  3R9A B;  5C1D A;  1E8W A;  2XGO A;  3FTV A;  1SQM A;  4B8A A;  3CVY A;  3TXN A;  2UY1 B;  2WMO A;  3G2V A;  2R59 A;  3MKR A;  2L9B A;  2RD0 A;  4UQX A;  2QFC A;  5FQ4 A;  3D9I A;  4WGJ A;  3ASG A;  4U8H A;  4ANU A;  2J4B A;  4I2W A;  4GPK A;  5FJY A;  3LPZ A;  4GA0 A;  3Q15 A;  5G04 C;  3CVW A;  3ZCB A;  2L0T B;  4W9R A;  3B13 A;  5A6C A;  3ZRH A;  2VYI A;  3CV0 A;  3ZPJ A;  2VSN A;  3SD5 A;  2WB2 A;  2WXJ A;  5LCW C;  2IOL A;  5CGL A;  3EIQ C;  4LCT A;  1W3B A;  3FTS A;  5CMY A;  2J09 A;  2XQ0 A;  3FUM A;  2L6J A;  4UI9 K;  3CK7 A;  1E7V A;  2HYZ A;  2J07 A;  5G05 J;  1VDY A;  4I17 A;  4FAD A;  4Q96 A;  4E85 A;  2WXK A;  3GYZ A;  3G2U A;  3CVV A;  4G25 A;  3NZU A;  4N2Q A;  3B7U X;  4X2E A;  1E90 A;  4FP7 A;  1E7U A;  4GML A;  4XKB A;  4EBA G;  4JZY A;  2CG2 A;  4I6J A;  3BEE A;  3FUI A;  3SF4 A;  2AXZ A;  2UY1 A;  3P2B A;  3HDX A;  4C9B B;  2IFU A;  4ATG A;  2I9C A;  2HO1 A;  5LOZ A;  2I2O A;  4J0U A;  3RO3 A;  3N3U A;  3SHF A;  5E75 A;  5AJL A;  3LY7 A;  4GYO A;  2FBN A;  1JWF A;  3MV2 B;  4ILI A;  4JVS A;  5EKQ D;  4AJW A;  3LXU X;  4WND A;  5A7D B;  2I1K A;  1OWM A;  2C0L A;  2XPI A;  2CHX A;  4JXT A;  5M72 A;  3OTN A;  3QAR A;  4L23 A;  3SNX A;  2WXR A;  3PZD A;  1H2T C;  1HFA A;  1ELR A;  3U66 A;  4H7Y A;  3LS8 A;  1XNF A;  3TAX A;  1X5B A;  4DPR A;  2XGM A;  3Q49 B;  3S7B A;  1QQE A;  3JYS A;  2KCV A;  3HYM B;  5ANR A;  4J8E A;  3U9W A;  5BNW A;  2FF4 A;  4JL0 A;  4LU4 A;  3D9N A;  1OWN A;  4HVB A;  2IQC A;  4GZ6 A;  2XCB A;  2CG3 A;  4KBQ A;  2LSU A;  2YQ8 A;  2CFU A;  2NC9 A;  2YHC A;  1UN8 A;  3FH5 A;  3U64 A;  3ZLM A;  4B94 A;  4JHK A;  3CHP A;  1H2V C;  2A5U A;  5HQ8 A;  2GRM A;  2VGX A;  2CFZ A;  4O6F A;  3CKC A;  4FLB A;  5E76 A;  4RVB A;  4BFR A;  5FZS A;  1HE8 A;  3T5V A;  2UWJ G;  3FTU A;  3SGH A;  2OV8 A;  3N71 A;  3S7F A;  4F53 A;  3FU5 A;  3D9P A;  1N54 A;  4BSX A;  1TEZ A;  3GW4 A;  1HF8 A;  4U0U A;  4FHK A;  4DLQ A;  2VQ2 A;  3CHS A;  3ZYL A;  5JJT A;  3SHG A;  1HO8 A;  3SE5 A;  2LAI A;  3FUL A;  3PH0 C;  3PUJ A;  1QNF A;  4F3V A;  4I43 A;  4EZK A;  1HX8 A;  3LY8 A;  2MHK A;  3MKQ A;  4KYO B;  4KVO A;  5CCM A;  1HXI A;  3CKB A;  3IEG A;  3LET A;  1WAO 1;  1WM5 A;  3OXL A;  4WNE A;  4GZ5 A;  4UI9 J;  4M16 A;  3CVN A;  4R7L A;  3EIJ A;  4HFG A;  1JPL A;  1E96 B;  2PQR A;  2C2L A;  3FUF A;  5DIZ A;  3B7R L;  5ARF A;  1GW6 A;  4GU5 A;  1NA0 A;  4JC8 A;  2AVP A;  3VTX A;  3UQ3 A;  3UX4 A;  4TUU A;  2X6I A;  3CVL A;  3Q47 B;  3RRN B;  1PC2 A;  1ZU2 A;  4GYW A;  1H6K A;  2OOE A;  3K9I A;  2WXL A;  4XE0 A;  3NQP A;  4TRQ A;  4GA1 A;  2ION A;  1NZN A;  3S6A A;  2GGF A;  2YIN A;  2QY7 A;  3QB2 A;  3UT7 A;  4HLE A;  2X3M A;  1B89 A;  3MV3 B;  5JJ6 A;  1UJK A;  4ITR A;  4KVM A;  2LO6 A;  3SBS A;  3AU4 A;  4WNG A;  3MZL B;  2PZI A;  2EQX A;  4ILH B;  5BUZ A;  1UG3 A;  4GB9 A;  3QJZ A;  3UPV A;  2X6F A;  3ZHE A;  3CST A;  3FTY A;  3EJN A;  3HHM A;  4UWG A;  4L2Y A;  3ASH A;  4J6I A;  3RIB A;  4CDR A;  2VJ8 A;  4WWO A;  4ANW A;  2VTB B;  4U04 A;  2WM9 A;  1A17 A;  3I4G A;  5LFA A;  3CR3 A;  3RKV A;  2DBA A;  2WQ7 A;  2R5S A;  3FUK A;  4I6G A;  2C0M A;  4U0Z A;  4WWN A;  4N3C A;  5CCL A;  1OWP A;  5KJL A;  2E2E A;  3G2W A;  2BTD A;  4I6E A;  4CGW A;  3IHY A;  4BT8 A;  1HU3 A;  3JUI A;  3IBE A;  3UT4 A;  3L13 A;  4I1M A;  4XZ4 A;  4BTA A;  3BG1 B;  3ZFW A;  2VGY A;  4N5C A;  5JHB A;  5KJN A;  1PY1 A;  2IF4 A;  3FTW A;  3PE3 A;  5FTP A;  5BPP A;  2X6H A;  5DBK A;  3FU3 A;  4PY3 A;  2VGX B;  5G04 J;  4F1S A;  4EZJ A;  4ACK A;  2KCK A;  3ZVV A;  4APO A;  1Y8M A;  4OVV A;  5J90 A;  3G2S A;  1S0P A;  3U4T A;  3CVU A;  3L08 A;  3LVR E;  4FUL A;  4G11 A;  3PE4 A;  4N3A A;  5JHA A;  1SZ9 A;  2MOW A;  5FT9 A;  1EPU A;  4FU3 A;  4GYY A;  4BX9 A;  5EDS A;  1ELK A;  4FJY A;  4QFV A;  4XIF A;  3HVE A;  2KAT A;  4A1G A;  2JK8 A;  4JA9 A;  4DI4 A;  3FWV A;  4IUL A;  2DIW A;  4JEH A;  4YND A;  4JA7 A;  3FHE A;  1MHQ A;  4PDX A;  3AS8 A;  1TJC A;  3T5X A;  3EHM A;  3MGB A;  3O48 A;  3RK6 A;  3FY4 A;  4XI8 A;  1PAQ A;  1H0A A;  3RU0 A;  2GW1 A;  4PS3 A;  2OVB A;  1N52 A;  3MA5 A;  3ZYM A;  3U3W A;  4I2Z A;  4AXH A;  4JHR A;  5KCM A;  4LRZ A;  4IN3 B;  2V0P A;  3TGO A;  4X2C A;  3KD7 A;  4M3O A;  4HXI A;  4DK5 A;  2MRI A;  4LEU A;  2KM4 A;  3S7J A;  1H19 A;  4BY6 A;  4U63 A;  4WUY A;  5JFZ A;  3PRE A;  4ABN A;  2AWI A;  3QWW A;  3FDH A;  3OXF A;  4YVQ C;  1H2U A;  1FVH A;  4IYP A;  2R17 C;  3B7T A;  1WY6 A;  4RG9 A;  4AP2 A;  2WXO A;  3VLF A;  3CQG B;  3ONL A;  3QC1 A;  5JFF A;  3PDN A;  4AIF A;  3KEZ A;  3ZC7 A;  3ZN3 A;  5LX8 A;  1DVP A;  3MEK A;  3TXM A;  3CVX A;  5T3R A;  3TG5 A;  4NQ0 A;  2WXM A;  4GCN A;  1UW4 B;  3RJV A;  5AIJ A;  4JW1 A;  4OVU A;  4EBA A;  3MCX A;  4HOU A;  3O4Z A;  4V3I A;  2DCP A;  4FJZ A;  3ML9 A;  4FHJ A;  3PNT B;  3RRU A;  2IJG X;  4HOQ A;  3CHR A;  3HVE B;  4EZL A;  3FP3 A;  4PUC A;  3S2A A;  3D9J A;  2VSY A;  3LY9 A;  5LCW J;  4UI9 C;  3VTY A;  5D0O D;  2XEV A;  5KJM A;  1Z3Y A;  4N2S A;  2WVI A;  3R7R A;  3L22 A;  3SBT B;  4IRU A;  3OXG A;  3ZEF A;  4A1S A;  4D10 C;  1IYG A;  4CCA A;  2X38 A;  5CKL A;  3FEY A;  3PVL A;  2G03 A;  3SFZ A;  3CK8 A;  3D3M A;  4DI3 A;  3FH8 A;  2J08 A;  3IV0 A;  1SZA A;  3FUN A;  1UN9 A;  4ACL A;  4BWR A;  4CRW A;  5AYW D;  2XHE A;  4Q94 A;  3D9M A;  1NP7 A;  4P29 A;  4BT9 A;  1Z3X A;  5CHE E;  2WXN A;  3FFL A;  2ILR A;  4GA2 A;  4MS6 A;  3ZXS A;  1IQU A;  3FTX A;  4N3B A;  3SI5 A;  4PH4 B;  1HG2 A;  3CHO A;  5EU0 A;  4APF A;  2XCC A;  3LYA A;  3FUH A;  4HOS A;  3FU0 A;  1IQR A;  4E6H A;  4GZC A;  1FCH A;  4I9E A;  3TJP A;  4JHJ A;  3ENE A;  3L16 A;  4A3V A;  2XPZ A;  3LVQ E;  4XI0 A;  3GZ1 A;  3URZ A;  3T8M A;  4RSY A;  2XRY A;  2YHE A;  3UMV A;  4ME2 A;  3R7Q A;  3ZHE B;  3APD A;  4NRH B;  5KJK A;  3CGH A;  2A4Z A;  4H7X A;  2KCL A;  2WXF A;  1E8X A;  5T8I A;  4NUR A;  5AJD A;  2NXP A;  1UJJ A;  1E8Y A;  4BX8 A;  2VSO E;  2J4D A;  4KT6 B;  5BV0 A;  2IOS A;  3GZ2 A;  4EQF A;  3L54 A;  4WWP A;  3IKO B;  3APC A;  4AV7 A;  4C0E A;  2Y4U A;  4FA6 A;  2NSZ A;  4CEM A;  3D9L A;  3CUC A;  4WAF A;  1KT0 A;  4AM9 A;  2VY3 A;  2VZA A;  4L2L A;  2LSV A;  3VLD A;  1ELW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...