4U07A

Atp bound to eukaryotic fic domain containing protein
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
326
structure length
323
Chain Sequence
AALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSINSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Adenosine monophosphate-protein transferase FICD
total genus 122
structure length 323
sequence length 326
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u07A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u07A01
1IYGA 3LY7A 3TAXA 5AYWD 2FO7A 4M16A 4JHRA 1W3BA 4AM9A 4GZ5A 4UI9J 2VGXA 5KJKA 4GYOA 4KBQA 1WM5A 3CK9A 3K9IA 3MV3B 5FZSA 3WXXA 3CKBA 3RIBA 4BTAA 1ZBPA 2HR2A 2PQRA 1NA3A 2FI7A 3RJVA 2JLBA 4Y6CA 3ZN3A 3MV2B 3LY9A 4H7YA 5FJYA 3LETA 1HXIA 5EX3A 1KLXA 2KCKA 3OXLA 3Q5MA 4YVOA 1IHGA 4HOUA 5CGLA 2XGSA 4AY5A 4I9CA 4I1AA 4H7XA 1NZNA 3CK8A 5DBKA 3UPVA 5D0QD 4I2ZA 2HYZA 4X2EA 4JA9A 3R9AB 3U3WA 2LSUA 4F3VA 3AS5A 2KCVA 3QKYA 3ZCBA 2C0MA 3MA5A 2VGXB 4XIFA 4WNEA 4JA7A 5JJTA 3RO3A 4G1TA 4JL0A 4PY3A 5M72A 2V5FA 3TGOA 3UUXA 1QQEA 1WAO1 3S7DA 4W9RA 2WPVA 2VSNA 3CEQA 5CCMA 4Y6WA 2E2EA 1ZU2A 3PE4A 4ABNA 4G23A 1HZ4A 5G04C 4ME2A 3TG4A 2I6HA 3RKVA 3BEEA 2Y4UA 3CVNA 4WNDA 4U07A 3CVPA 2XPIA 3EDTB 5KJLA 3O48A 4N67A 1KT0A 3LCAA 5BNWA 3Q15A 2ONDA 1A17A 2AVPA 4G24A 5KJMA 1NA0A 3VTXA 5LCWC 3UQ3A 2XGOA 4YNDA 3GZ1A 5A6CA 3Q49B 2YQ8A 2WQHA 4LEUA 4J8EA 3QOUA 4GA2A 3OXFA 4J8FA 5DIZA 4GZ6A 3QWPA 3JYSA 3RO2A 2PL2A 4KYOB 5KJNA 2DBAA 5C1DA 4NPSA 3ZHEA 4ITRA 3LKUA 5CMTA 3E4BA 3SZ7A 3PE3A 2GW1A 5JJ7A 2JK8A 5CKLA 3ASGA 4WGJA 3SE5A 2J9QA 1ELWA 2Q7FA 2NC9A 3S7JA 3MKRA 3LY8A 2XCCA 4HOTA 4U04A 2KATA 3CKCA 5FT9A 5EU0A 3KS2A 3CVQA 4X2CA 2KC7A 2QFCA 2VZAA 2C0LA 3SHGA 2VSYA 1P5QA 2XEVA 3ZPJA 3N3UA 4GCNA 4I17A 2VYIA 1E96B 4RG6A 3ZGQA 4GYYA 2P58C 3NF1A 5LCWJ 2VQ2A 3ASDA 3RU0A 4GA0A 1HH8A 4BTBA 3AS8A 4NRHB 4N3BA 5EX0A 4HORA 3GW4A 4N3AA 2OOEA 2R5SA 3VTYA 3S7FA 2UY1A 5CHEE 4KXKB 2UWJG 4N39A 1XNFA 2HO1A 3TG5A 3KAEA 4G2VA 4HOQA 2FF4A 4G26A 4B94A 4NQ0A 4UI9K 1B89A 2IF4A 5ARGA 4N2QA 4GYWA 2LSVA 2G03A 3HYMB 4XI9A 5A7DB 4HOSA 3QWVA 3QDNA 2UY1B 5G04J 4G25A 4N2SA 4GCOA 1QZ2A 2KCLA 4APOA 4EQFA 3FFLA 4N3CA 4AY6A 4CDRA 3ZC7A 4J0UA 1PC2A 2XCBA 4J8DA 3OXGA 4YVQC 5ARFA 5G05C 4U0ZA 5FZRA 5EKQD 3CUCA 3Q47B 4X2DA 3GYZA 5JJ6A 3S6AA 1ELRA 4XI0A 5D0OD 5FTPA 2XGMA 5JFFA 4LU4A 4CGVA 4U0UA 3Q4AB 5FZQA 2FBNA 2MHKA 3LPZA 1TJCA 3N71A 4N5CA 3ZLMA 3CK7A 3ULQA 2BUGA 5JFZA 4XI8A 3URZA 3CVLA 4GA1A 3SN9A 5BW8C 4GPKA 2PQNA 4I9EA 4UQXA 3QWWA 4U0SA 2FEZA 5BT1A 2LNIA 3ESKA 3MEKA 3FWVA 4I2WA 2Y4TA 1Y8MA 3FP3A 2VY3A 1OUVA 4RG9A 1KT1A 4IN3B 3U4TA 3ASFA 3KD7A 3PDNA 2C2LA 4BT8A 4CGWA 2YHCA 3S7BA 5HI7A 4BT9A 3AS4A 3ZFWA 4GZ3A 4A1SA 5G05J 2PZIA 4WNGA 3IEGA 4AIFA 3GZ2A 4WNFA 3ZHEB 1YA0A 2L6JA 5CCLA 3CV0A 4BWRA 5HQ8A 2F6SA 1FCHA 2VGYA 4UI9C 3SF4A 3ASHA 2IFUA 4WUYA 4UQYA 4UQZA 3LYAA 4O6FA
chains in the Genus database with same CATH superfamily
5JMND 2FO7A 4M16A 1W3BA 2I2OA 3NQPA 4AM9A 4UI9J 5KJKA 4GYOA 1SA5A 2OEVA 4IYPA 3K9IA 1D9SA 3MV3B 3PREA 1N4RA 3RAUA 5ENNA 3RIBA 2QY7A 3CHOA 2PQRA 2QC9A 2WXRA 1LD8A 2IOLA 3L54A 3RJVA 5ENSD 2WMNA 4EZKA 3MV2B 5EIBE 3UT4A 4TRQA 4YDYA 3Q79A 4H7YA 5FJYA 3D9NA 3OXLA 4YVOA 1IHGA 5CGLA 5LP0A 1MX6A 3VLDA 3SI5A 4A55A 4I9CA 3CVVA 4ILIA 2IQCA 4H7XA 2CG3A 3I3NA 1NZNA 4HLLA 5DBKA 1TNZA 4J8YA 2XEEA 3O4ZA 2HYZA 3TL5A 4JA9A 3R9AB 4F3VA 4TXQA 1NI1A 5T8IA 4WWOA 2LUHA 3UM3A 3ISMC 4RQIA 2J49A 2X6KA 5B1AE 4XIFA 3PZ2A 3HDXA 4XKBA 3ESLA 3L6AA 2MOWA 4GTTA 3F6QA 4G1TA 4JL0A 5M72A 2V5FA 3UUXA 3PS6A 3CVWA 3TWUA 3S7DA 4L23A 2P9SG 4O1OA 5CCMA 4L2YA 1MYOA 3FU6A 4ABNA 2EIME 1HG2A 1EF1C 3MCXA 4BEPA 5G04C 1NP7A 3UM2A 1HFAA 1O1SA 1HX8A 2X6HA 2P9IG 5BXUA 1HE8A 4U07A 3IBEA 2R59A 2IONA 3MKQB 3O48A 4I6GA 3UIOC 4HRMB 3SGHA 2YINA 2WXHA 3ML9A 4CEMA 3PZ4A 3GZSA 4TXRA 5EYLA 2J08A 3PUKA 1SQMA 2MYOA 4UWKA 1UJKA 1A17A 3DSTA 2AVPA 2J09A 4BX9A 4LCTA 3VTXA 5LCWC 1HO8A 2GRRB 3ZEFA 1V54E 5CERB 2Y69E 4JPSA 5LX8A 2E0IA 4JC8A 1MQSA 2XZDG 2XRYA 3QWPA 3JUEA 2DBAA 4L2LA 2WVIA 5BPPA 3ZHEA 3P2BA 3SNXA 2F37A 5HKPA 4C0EA 3D9IA 4JW1A 3SZ7A 3PE3A 1E8YA 3NAWA 3AG3E 3C72A 4TUUA 4FLHA 2J9QA 1OWPA 1S70B 3J5QB 2Q7FA 3DSUA 2NC9A 1OWMA 4EBAG 1E8ZA 3LY8A 5BUZA 4K5CA 1OWLA 4BETA 4DRXE 1SW6A 5FT9A 3KS2A 4E85A 1KZPA 1UJJA 4K03A 1PAQA 3ONLA 2GRNB 2KC7A 3FEYA 2VZAA 3PRZA 2HM8A 3FU5A 3PUJA 1P5QA 5CMYA 1S63A 3IKOB 1N9AA 1OCCE 1OWNA 4MBGA 5AARA 2P58C 2VGEA 3ASDA 4GA0A 3QNKA 4BTBA 1U3CA 3EIQC 4F53A 1N52A 1OWOA 2F8YA 2AXVA 2CG2A 4NRHB 3DSVA 3LXUX 2R5SA 2F0YA 3I5PA 3FULA 2UY1A 3IXEA 3CVXA 4N39A 3TG5A 2Y0BG 5ENQD 4G2VA 4DI4A 1UW4B 2R02A 2EILE 4UI9K 3TWWA 3IV0A 5G55A 1JUQA 1O1RA 4ZHBA 3E30A 3V2OA 4GYWA 2LSVA 3EHNA 2P9PG 3ASNE 3S2AA 3CLJA 1E8XA 5BXOA 3NBNB 3QDNA 1KZOA 2XQ0A 5ENPD 1FT2A 1QZ2A 2KCLA 4DLQA 1DNPA 4GTOA 4N3CA 2H6FA 5FIOA 3LS8A 1PY1A 3UKUG 3ZC7A 4J0UA 3OXGA 3FTWA 4YVQC 3VLEA 5G2NA 3NB2A 5FZRA 1IXVA 3EHQA 3CUCA 2VTBA 3TWQA 4DK5A 4CZ2D 3SQVA 1QNFA 5AN8A 5JJ6A 4ATGA 3ZNGA 1EYHA 5FTPA 2BKGA 4FHJA 3B95A 3FH7A 4B93B 4U0UA 1TEZA 3LPZA 2ZXWE 4U7EB 2BUGA 3SFXA 5JFZA 2ETAA 3TJPA 3SD5A 3MKQA 4FJZA 3R7RA 2BKKB 4I9EA 4NACA 3QWWA 2LNIA 2Y3AA 3ESKA 3MEKA 2AW6A 4I2WA 3JCKC 2Y4TA 3EU9A 1TJFA 3CHQA 3FP3A 3LJNA 5FQ4A 4F1PA 4C9BB 1MX4A 4IN3B 2AXZA 3ABKE 2C2LA 4CGWA 4XE0A 3ZW3A 2YHCA 4GU5A 4CT0A 3AS4A 1JWGA 4Q69A 4GMJA 4GZ3A 4A1SA 3G2SA 4JEHA 3GZ2A 4LRZA 1SA4A 5EYPF 2I1JA 5AJDA 3FTVA 3HVEB 1BI7B 4UI9C 3QARA 2IFUA 4WUYA 2EINE 4WAFA 4GMLA 4NURA 4I6JA 3FUMA 3BU8A 4JHRA 3SBTB 2WXPA 1WM5A 3CK9A 5D66A 5FZSA 3HXCA 3WXXA 3B7SA 3CKBA 3UT7A 4Z68A 4RVBA 1K1AA 4KMOA 3E34A 3E32A 4Y6CA 3ZN3A 4FJYA 3DPYA 3UM1A 3ABME 1H6OA 1XGWA 5EX3A 3Q9NC 1KLXA 3FUDA 5H7PA 3ZXPA 3FUKA 3CHMA 3ZVVA 4HOUA 2XGSA 3J5PA 3ZUVB 3T5XA 2XZTG 4OYSA 4C0MA 1H2VC 3L82A 1WY6A 4DX7D 4JD2G 3BG0B 4JZYA 4J7WA 3UM0A 2EQXA 3UPVA 4F1SA 3BQOA 4A3TA 4JVSA 3FU0A 3AS5A 2EIJE 3E37A 1HF8A 3P1UA 2LXMA 5EN5D 4BY6A 3TXMA 3LDZA 1FVHA 3G2WA 4KZ0A 4JA7A 1OY3D 2DWZA 1OCOE 3ZYLA 5KWDA 4LG6A 3T9KA 2I9CA 3TGOA 3ZKJA 3B13A 4XEIG 4CCAA 2V0PA 4XZ4A 1K1BA 2KBXA 4K0RA 4Y6WA 1ZU2A 5ENTD 5KNGA 4XKCA 4AEZC 4G23A 3LEWA 2WQ7A 1N11A 4Q94A 4BFRA 3TG4A 2I6HA 1LTXA 3QK0A 2H6HA 2CHXA 2OCCE 2XPIA 5EILA 5BNWA 3L13A 5AQBA 3RSEG 3TWSA 4AJWA 3I4GA 2ONDA 4BSXA 2DZNA 2YHEA 2VSOE 1NA0A 2WXOA 2XGOA 3FU3A 4YNDA 4PS8A 3GZ1A 4APFA 2WQHA 4QFVA 3OAWA 3QAQA 1S64A 3CSTA 2KXPC 2YNQA 3JYSA 3D9KA 2PL2A 4KYOB 5IY5E 3E33A 3I4RB 5CMTA 3E4BA 4MRUA 3FTSA 3C3OA 5JJ7A 3UX4A 2JK8A 1EDUA 4R7LA 3ASGA 3FUNA 2IO2C 3S7JA 3U9WA 2NUNA 5ENOD 2V5QC 5ENRD 4A3VA 2R05A 2CFZA 2B0OE 4HOTA 4U04A 3CKCA 3UIPC 4ZFHA 4GZCA 3BUAA 3CVQA 4Q96A 2XEHA 4GCNA 4HI8A 3DPDA 4I17A 4DLOA 3ULEG 5B1BE 2OVFA 3NF1A 2IU1A 2GRQB 2VQ2A 2GGFA 4I43A 2X38A 3V31A 1HH8A 3EHMA 4GTPA 1TNOA 4WWPA 3CIAA 4N3BA 5EX0A 3KSLA 2XPYA 5CEAA 4U96D 2AXUA 5EDSA 5AJLA 3ML8A 1EPUA 4HRNA 1XNFA 2HO1A 3FTYA 3ZYKA 2ETCA 1OXJA 2A5UA 2FF4A 4G26A 1MZCA 4U8HA 2WXGA 4AP2A 2VTBB 2V4LA 2X6FA 5KCMA 4IULA 1IKND 3HYMB 4XI9A 1BD8A 2WMOA 5CRVA 5FQ7A 4N2SA 3ENEA 1N94A 3ZRHA 2L0IA 3D9JA 3TWVA 1INZA 3CVUA 4CDRA 2EIKE 1PC2A 2XCBA 4DPRA 4YDEA 5ARFA 4U0ZA 3V30A 4LUNU 3GYZA 1O5MA 2IO3C 3C3QA 3HG0D 4O60A 1ELRA 4XI0A 4ANVA 3LJ3A 3U66A 2XGMA 5JFFA 4CGVA 2DYSE 4FULA 4FP7A 5FWQA 3Q4AB 5FZQA 3UMVA 3X2QE 2FBNA 1IQUA 1TJCA 4N5CA 3ZLMA 3ULQA 5E75A 4HB5A 4XI8A 4I6EA 2CFUA 3SN9A 4GPKA 5T4YA 3PZ3A 2PQNA 3FTXA 3DSSA 2WM9A 2FO1E 4UQXA 4HBDA 3UI2A 3PEUB 3Q75A 3FWVA 1AP7A 2VJ8A 4TV3A 2XENA 2VY3A 1O1TA 1WG0A 3ASFA 1OT8A 3R9MA 4J6IA 1VDYA 4F6RD 3L16A 1TYQG 2QYJA 1Z3XA 4MS6A 3RRNB 5D2MC 3IHYA 4E6HA 1JCQA 2PZIA 4WNGA 1D8EA 3IEGA 1UOHA 1IHBA 1BLXB 3ZHEB 2L6JA 5CCLA 2F6SA 3QC1A 3MGBA 1UG3A 4A1GA 4UQYA 3KEAA 3ZYMA 2WXNA 3W9GA 5AYWD 1X5BA 4HFGA 4K5AB 4GZ5A 2VGXA 4KBQA 4HS2A 1E7UA 1A5EA 1MHQA 4BTAA 1ZBPA 2HR2A 1YMPA 1NA3A 2FI7A 2R17C 4U8VD 2R2LA 5J08A 4UWFA 4LNGA 2ZGDA 1N4SA 3WG7E 1IQRA 1Y6IA 3Q5MA 4WWNA 1TN8A 1N0RA 1D8DA 4AY5A 3RK6A 3PNLB 2XRZA 4I1AA 4GTRA 3HVEA 4GTVA 4GTQA 3CK8A 4G8LA 4FC8A 3RRUA 4I2ZA 3T5VA 1UN8A 4HQDA 4X2EA 1K3ZD 3UTMA 3L17A 1DC2A 3QKYA 2P9LG 3MA5A 4CDNA 4P29A 4B0ZA 5JJTA 2QYUA 4PY3A 5CBNA 2WQ6A 1NH1A 1BPOA 3FTUA 1QQEA 3HHMA 2CHZA 2DVWA 3CEQA 1ZB1A 2WXFA 2JABA 2GRLA 3D9HA 1YCSB 4X8QA 5A23A 5CRUA 4ACLA 3FDHA 4ATZD 2NYJA 4ANWA 2PNNA 2BEDA 3AU5A 3CQCB 1RW2A 2Y4UA 4G11A 2VSXE 2WXMA 4OVVA 3CVPA 3L22A 3EDTB 2JEKA 5KJLA 4N67A 1KT0A 2WXLA 3DBSA 3VLFA 4LNBA 3NOGD 1HS6A 4UWGA 1N54A 3HXEA 4M7CA 4DX6D 3ONKA 4KZCA 1FPPA 3UQ3A 1NFIE 5T3RA 2IJGX 3FHEA 2IEJA 5A6CA 3Q49B 3APCA 5KBAA 3JQ1A 4PDXA 5AAOA 1DVPA 2NXPA 2GRMA 4DX1A 4J8EA 3EJNA 4GA2A 3NZSA 3OXFA 3UT8A 5C2YA 4MKTA 4PUCA 4GZDA 5KJNA 3SO8A 4UUCA 3TWXA 4NPSA 5AQAA 4ITRA 3LKUA 3FH8A 2P9NG 2ZU6B 2RFAA 3Q7AA 4A63B 2GW1A 3EU5A 3FEXA 4DJAA 4DUIA 1KPSB 3AG2E 3DSWA 3SE5A 4AVXA 3EUVA 2FULA 4BSZB 2MRIA 3C98A 3MKRA 2LXLA 2XCCA 1LD7A 3HRAA 1N0QA 3D3MA 5EU0A 3CHPA 4CDMA 2QFCA 4DX2A 2C0LA 3SHGA 2VSYA 1L5JA 3BG1B 1TNBA 3PEVB 2XEVA 3ZPJA 4LSZE 3JXIA 4JHKA 4RSYA 2X3MA 2XS8A 3MX3A 2GROB 5CMWA 4XX5A 4ACKA 2B6CA 2DCPA 3AS8A 3SFYA 4DI3A 3T8KA 3DEPA 3G2UA 4KVMA 3CHSA 2V4HC 3FUJA 3GW4A 4N3AA 4K5BA 3VTYA 3B7RL 2Y1LE 1ELKA 4EZJA 1SZAA 4V3IA 1H19A 4HOQA 4EZLA 3HIZA 3TWRA 4B94A 4LERA 1B89A 1SVXA 2J8SD 4L9PA 4U8YD 2J07A 4EPZA 4KT6B 5B3SE 2ZGGA 2G03A 1Q2ZA 3FUEA 5HS0A 1FVFA 3FTZA 4IRUA 3APFA 4HOSA 2UY1B 1Z5SC 4G25A 3IHVA 3FY4A 1Z6TA 4AY6A 3B7TA 3T8MA 4FU3A 3OTNA 4ANUA 5EKQD 3PVLA 3Q47B 3D9LA 1N4QA 5JHAA 1JPLA 3S6AA 3G2VA 2BF0X 4LU4A 4DX5D 2M63A 1OCRE 3DRAA 4KVOA 4FADA 2MHKA 2XS1A 1OCZE 4JEUA 3N71A 1AWCB 4FHKA 3URZA 4N5QA 4UWLA 3CVLA 3PZDA 4GA1A 5BW8C 4EECA 2IY0C 1TN7A 2WXKA 5JA4D 2OV8A 2V8SE 5ITZF 3QJZA 2J4DA 5ANLA 1BU9A 4AXHA 3FUHA 1OUVA 3ZYQA 4RG9A 4L7TA 1KT1A 3KD7A 3PDNA 5HI7A 3NZUA 3ZFWA 3FUFA 4BX8A 5G05J 2LAIA 3B7UX 4AIFA 4WNFA 5HRYA 5KNHD 4JHJA 4F7AA 4J8SA 5HQ8A 2RFMA 1FCHA 2KZTB 2VGYA 2DIWA 2IOSA 3ASHA 1HG5A 3ZXSA 3G2TA 3LYAA 3UINC 4O6FA 2ILRA 2PM7A 3ABLE 1E90A 1IYGA 3LY7A 3TAXA 1N4PA 2F8XK 4L1BA 4G8KA 4BERA 2LAHA 3AAAC 2AJAA 1H6KA 4MLPA 4U95D 3DXMG 2P9UG 4JXTA 4OAVB 3CGHA 2P9KG 2JLBA 3LY9A 3UKRG 3L08A 3LETA 1HXIA 2KCKA 4TXPA 1U3DA 3JQ0A 4HLEA 2L0TB 4B8AA 2KM4A 3JUIA 1JCRA 1TNUA 3KEZA 1X81A 5D0QD 1N95A 3U3WA 2LSUA 5LOZA 4FA6A 5AQ9A 4CT4A 2KCVA 3W9FA 3DEOA 1JCSA 3ZCBA 2C0MA 5LFAA 2VGXB 4JB8P 4ILHB 3C5RA 5ANRA 3Q78A 4WNEA 4OVUA 2WXIA 3ZU7B 3RO3A 1WAO1 3HXDA 4EBAA 4GAAA 3DSXA 4CRWA 1NL4A 4W9RA 2WPVA 2VSNA 4YDWA 2E2EA 3PE4A 3FH5A 4HNAD 2PM6A 1HZ4A 3SY2A 2DZOA 2RKKA 2A5EA 3Q73A 4ME2A 4OAUC 1G3NB 2ETBA 4EHMA 3RKVA 3BEEA 3CVNA 4WNDA 4PS3A 3LCAA 3B7BA 3LVQE 4C48B 2R03A 3DWLG 3Q15A 3MYVA 2GRPB 3U64A 3KSQA 4G24A 5KJMA 4TUMA 4D10C 2YQ8A 4LEUA 4B89A 2RG8A 3QOUA 2RD0A 4J8FA 5DIZA 2WB2A 4GZ6A 1DCQA 1DCEA 3RO2A 1YYHA 3AG1E 5EIDA 3LVRE 5C1DA 5BV1A 1TN6A 3Q7FA 1H6PA 2ZISA 3CSFA 1S0PA 4B8CB 3QB2A 4GPMA 3TXNA 5CKLA 5AENA 4RLYA 3CVYA 3HXBA 4WGJA 3PH0C 1ELWA 4YDOA 2XHEA 2DYRE 1QYMA 3ZIMA 2A4ZA 2KATA 3SBSA 5CBOA 3UXGA 2BTDA 2X6IA 3V2XA 4X2CA 1HU3A 1H2UA 2X6JA 3RRMB 3N3UA 1UN9A 4GTSA 4HI9A 2VYIA 1E96B 4RG6A 3ZGQA 4GYYA 4AOFA 2J4BA 4FLBA 5BV0A 5LCWJ 3RU0A 3SHFA 3D9OA 5J90A 3R7QA 4HORA 2WXJA 2OOEA 3SFZA 2NSZA 3S7FA 1SZ9A 1WDYA 5CHEE 4KXKB 4HVBA 2UWJG 1FT1A 1H2TC 1V55E 3KAEA 3AJIA 4O1PA 4PS7A 4NQ0A 5FQ8A 4QQIA 2IF4A 5ARGA 4N2QA 4HXIA 2NUDA 4UWHA 2XPZA 5CEDB 1E8WA 1MJ0A 5A7DB 3QWVA 5G04J 1K8KG 2I1KA 3V79K 3FUIA 4GCOA 4EQFA 3MZLB 4APOA 3FFLA 1MX2A 3L9TA 1E7VA 1GW6A 4J8DA 4HRLA 5G05C 4NIKA 3APDA 2L6BA 4X2DA 4URKA 4AV7A 5FINA 1TR4A 3JXJA 5D0OD 2AWIA 3ASOE 3EHRA 2OVBA 2QZAA 1U2VG 5AQ7A 1LF8A 3CK7A 1Z3YA 4I1MA 2H6GA 3DXKG 3MJWA 2P2CP 1QBQA 2LO6A 3NOCD 3PNTB 4U0SA 2FEZA 4M3OA 5AIJA 3HXFA 5BT1A 1JWFA 4I1OB 3CHRA 4PH4B 2KZTA 1Y8MA 3TWTA 4GB9A 2HE0A 2ZIRA 2WXQA 3U4TA 3AG4E 4BT8A 2CHWA 1H0AA 3PZ1A 5E76A 3S7BA 5FQ6A 4ANXA 4BT9A 1BI8B 3ULYA 4BESA 5CECB 2L9BA 5JHBA 3D9MA 3Q9UC 3CR3A 2H6IA 2OEWA 3EIJA 1YA0A 3D9PA 3CV0A 4BWRA 3AU4A 3C3RA 1RZ4A 1TNYA 3SF4A 4GTMA 4ILGA 4LNUD 4GMRA 4U63A 4CYMD 4UQZA 3CQGB
chains in the Genus database with same CATH topology
2PM7A 1E90A 1IYGA 4GMLA 4NURA 2WXNA 3LY7A 4I6JA 3TAXA 3FUMA 5AYWD 2FO7A 4M16A 1X5BA 1W3BA 2I2OA 4HFGA 3NQPA 4JHRA 4L1BA 4GZ5A 4AM9A 4UI9J 2VGXA 3SBTB 5KJKA 4GYOA 4KBQA 2WXPA 4HS2A 1E7UA 1WM5A 4IYPA 3CK9A 2LAHA 3K9IA 3MV3B 5FZSA 1H6KA 3PREA 3B7SA 4MLPA 3WXXA 3CKBA 1MHQA 5ENNA 3RIBA 2QY7A 3UT7A 1ZBPA 2HR2A 4BTAA 3CHOA 2PQRA 2WXRA 1NA3A 2IOLA 4JXTA 3CGHA 3L54A 4RVBA 2FI7A 2R17C 4KMOA 3RJVA 2JLBA 4Y6CA 2WMNA 3ZN3A 5J08A 4EZKA 3MV2B 4FJYA 4UWFA 3UT4A 3LY9A 4TRQA 3L08A 4H7YA 5FJYA 3LETA 3D9NA 1XGWA 1HXIA 5EX3A 1IQRA 1Y6IA 1KLXA 2KCKA 3FUDA 3OXLA 3Q5MA 4WWNA 4YVOA 1IHGA 3FUKA 3CHMA 3ZVVA 4HOUA 5CGLA 1U3DA 3JQ0A 2XGSA 5BT1A 5LP0A 3VLDA 4HLEA 2L0TB 3T5XA 4B8AA 2KM4A 3SI5A 4A55A 4AY5A 4I9CA 4OYSA 3PNLB 3RK6A 3CVVA 4C0MA 3JUIA 1H2VC 4ILIA 2IQCA 2XRZA 4I1AA 1WY6A 4H7XA 2CG3A 3HVEA 3I3NA 1NZNA 3BG0B 3CK8A 3KEZA 4JZYA 5DBKA 4FC8A 3RRUA 2EQXA 3UPVA 5D0QD 4F1SA 4I2ZA 3O4ZA 3T5VA 1UN8A 2HYZA 3TL5A 4X2EA 4JA9A 3R9AB 3U3WA 2LSUA 5LOZA 4F3VA 4FA6A 4A3TA 4JVSA 3FU0A 4CT4A 3L17A 3AS5A 2KCVA 5T8IA 3QKYA 1HF8A 4WWOA 3ZCBA 2C0MA 3P1UA 5LFAA 3MA5A 2J49A 2VGXB 4CDNA 4ILHB 4BY6A 2X6KA 3TXMA 5ANRA 3LDZA 1FVHA 3G2WA 4XIFA 4WNEA 4OVUA 4KZ0A 3HDXA 2WXIA 4JA7A 4XKBA 3ESLA 3L6AA 4P29A 4B0ZA 2MOWA 5JJTA 3RO3A 4G1TA 4JL0A 4PY3A 3ZYLA 5M72A 2WQ6A 2I9CA 2V5FA 1BPOA 3TGOA 3UUXA 3FTUA 1QQEA 3PS6A 1WAO1 4EBAA 3HHMA 4GAAA 3CVWA 2CHZA 4CRWA 3B13A 4CCAA 2V0PA 3S7DA 4L23A 4W9RA 2WPVA 4XZ4A 2VSNA 3CEQA 5CCMA 4L2YA 2WXFA 4K0RA 2GRLA 2E2EA 4Y6WA 1ZU2A 3PE4A 3FU6A 3FH5A 4ABNA 4XKCA 1HG2A 1EF1C 3MCXA 4AEZC 2PM6A 4G23A 1HZ4A 5G04C 3LEWA 1NP7A 2WQ7A 1HFAA 5A23A 4ME2A 4ACLA 3FDHA 4Q94A 4BFRA 1HX8A 2X6HA 4ANWA 3TG4A 3AU5A 2I6HA 3CQCB 3RKVA 3BEEA 1HE8A 2Y4UA 3QK0A 4G11A 3CVNA 2VSXE 2WXMA 4WNDA 4U07A 4OVVA 3CVPA 3IBEA 2R59A 2CHXA 2JEKA 2XPIA 2IONA 4N67A 1KT0A 3EDTB 3L22A 2WXLA 3DBSA 3LCAA 3MKQB 3O48A 4I6GA 3VLFA 5BNWA 3L13A 3LVQE 1HS6A 2YINA 2WXHA 3ML9A 4UWGA 3SGHA 4CEMA 1N54A 3GZSA 4AJWA 3Q15A 3I4GA 3MYVA 5KJLA 2ONDA 4BSXA 3U64A 2J08A 3PUKA 1SQMA 4UWKA 1UJKA 1A17A 2AVPA 2YHEA 2J09A 2VSOE 4G24A 5KJMA 1NA0A 4BX9A 4LCTA 3VTXA 3ONKA 4KZCA 5LCWC 4D10C 2WXOA 3UQ3A 5T3RA 2IJGX 2XGOA 3FU3A 4YNDA 4PS8A 3FHEA 3GZ1A 4APFA 5A6CA 3Q49B 1HO8A 3APCA 2YQ8A 3JQ1A 2WQHA 4LEUA 4PDXA 3ZEFA 1DVPA 4B89A 2NXPA 2GRMA 2RG8A 4J8EA 3QOUA 3EJNA 4JPSA 2RD0A 4QFVA 3OAWA 2E0IA 4JC8A 5LX8A 4GA2A 3NZSA 1MQSA 3OXFA 4J8FA 3QAQA 5DIZA 3UT8A 2XRYA 3CSTA 2WB2A 4GZ6A 5C2YA 4MKTA 3QWPA 2YNQA 3JYSA 3D9KA 4PUCA 2PL2A 4GZDA 3RO2A 4KYOB 5KJNA 2DBAA 4L2LA 2WVIA 3LVRE 5BPPA 5C1DA 4NPSA 3ZHEA 5BV1A 3P2BA 4ITRA 3SNXA 3LKUA 3I4RB 5CMTA 3E4BA 4C0EA 3FH8A 3D9IA 4MRUA 2ZU6B 1S0PA 3CSFA 3FTSA 4JW1A 3SZ7A 4B8CB 3PE3A 1E8YA 3QB2A 2GW1A 5JJ7A 3TXNA 3UX4A 2JK8A 4TUUA 4FLHA 3FEXA 5CKLA 1EDUA 5AENA 4R7LA 4DJAA 3ASGA 3CVYA 4WGJA 3PH0C 3SE5A 2J9QA 1OWPA 4AVXA 3FUNA 1ELWA 2Q7FA 2NC9A 3S7JA 3U9WA 2FULA 2XHEA 2MRIA 3C98A 3MKRA 1OWMA 4EBAG 1E8ZA 3LY8A 3ZIMA 2XCCA 4A3VA 5BUZA 1OWLA 2CFZA 4HOTA 4U04A 2A4ZA 2KATA 3CKCA 3SBSA 4GZCA 3D3MA 5FT9A 5EU0A 3KS2A 2BTDA 3CVQA 4E85A 1UJJA 2X6IA 4K03A 1PAQA 3CHPA 4CDMA 3ONLA 4X2CA 1HU3A 2KC7A 1H2UA 2QFCA 3FEYA 2VZAA 3PRZA 2C0LA 3SHGA 2VSYA 2X6JA 3RRMB 1L5JA 2HM8A 3BG1B 3FU5A 3PEVB 3PUJA 1P5QA 4Q96A 5CMYA 2XEVA 3ZPJA 3N3UA 3IKOB 4GCNA 3DPDA 1UN9A 1OWNA 4I17A 4DLOA 2VYIA 1E96B 4RG6A 4JHKA 3ZGQA 4GYYA 4AOFA 2OVFA 2J4BA 4FLBA 4RSYA 5BV0A 2X3MA 2P58C 3NF1A 5LCWJ 2IU1A 3MX3A 2VQ2A 5CMWA 2GGFA 3ASDA 3RU0A 4I43A 2X38A 3SHFA 4GA0A 3D9OA 1HH8A 3QNKA 3EHMA 1U3CA 4XX5A 4ACKA 4BTBA 3EIQC 2DCPA 3AS8A 4F53A 1N52A 4DI3A 1OWOA 2AXVA 4WWPA 2CG2A 5J90A 3CIAA 3R7QA 4NRHB 4N3BA 5EX0A 4HORA 3G2UA 4KVMA 3CHSA 3FUJA 3GW4A 3LXUX 2WXJA 2XPYA 4N3AA 2OOEA 2R5SA 3SFZA 2AXUA 5EDSA 3VTYA 5AJLA 2NSZA 3ML8A 3S7FA 3I5PA 3B7RL 1SZ9A 1EPUA 3FULA 2UY1A 5CHEE 4KXKB 4HVBA 1ELKA 2UWJG 1H2TC 3CVXA 4N39A 1XNFA 2HO1A 3FTYA 3KAEA 3TG5A 3ZYKA 4EZJA 1SZAA 2A5UA 4G2VA 1H19A 4V3IA 4HOQA 4EZLA 3HIZA 2FF4A 4DI4A 4G26A 4B94A 1UW4B 4U8HA 4PS7A 4LERA 4NQ0A 1B89A 4UI9K 5FQ8A 2WXGA 2IF4A 3IV0A 2J07A 5ARGA 5G55A 1JUQA 4EPZA 4KT6B 4AP2A 2VTBB 4N2QA 4HXIA 2V4LA 4GYWA 2X6FA 2LSVA 3EHNA 2G03A 4UWHA 5KCMA 3S2AA 2XPZA 3FUEA 4IULA 3CLJA 1E8XA 1FVFA 1E8WA 3FTZA 3HYMB 4XI9A 4IRUA 5A7DB 3APFA 4HOSA 2WMOA 3QWVA 3QDNA 2UY1B 5G04J 2XQ0A 5FQ7A 2I1KA 4G25A 4N2SA 3FUIA 4GCOA 1QZ2A 2KCLA 3ENEA 3IHVA 1DNPA 3MZLB 4APOA 4DLQA 4EQFA 3ZRHA 3FFLA 3FY4A 4N3CA 1Z6TA 2L0IA 3D9JA 1INZA 4AY6A 3B7TA 3LS8A 1E7VA 4FU3A 1PY1A 3T8MA 4CDRA 3ZC7A 3CVUA 4J0UA 1GW6A 1PC2A 2XCBA 4DPRA 3OTNA 4J8DA 3OXGA 4ANUA 3FTWA 4YVQC 5ARFA 3VLEA 5G05C 5G2NA 4U0ZA 5FZRA 5EKQD 3PVLA 3CUCA 3APDA 3Q47B 2VTBA 4X2DA 4LUNU 4DK5A 3D9LA 3GYZA 4URKA 4AV7A 5JHAA 1QNFA 1JPLA 5JJ6A 3S6AA 1ELRA 4XI0A 4ATGA 5D0OD 3LJ3A 1EYHA 2AWIA 5FTPA 4ANVA 3G2VA 3U66A 2BF0X 4FHJA 2XGMA 5JFFA 4LU4A 3FH7A 4CGVA 2M63A 4U0UA 4FULA 4FP7A 5FWQA 3Q4AB 5FZQA 3UMVA 4KVOA 4FADA 2FBNA 1IQUA 2OVBA 2MHKA 1TEZA 3LPZA 4JEUA 1TJCA 3N71A 4N5CA 1LF8A 3ZLMA 3CK7A 3ULQA 2BUGA 5E75A 5JFZA 4XI8A 4I6EA 3TJPA 4FHKA 3SD5A 3URZA 1Z3YA 3CVLA 3PZDA 4GA1A 4I1MA 2CFUA 3MKQA 3MJWA 4UWLA 3SN9A 4FJZA 5BW8C 4GPKA 4EECA 5T4YA 4PS3A 3R7RA 2PQNA 3FTXA 4I9EA 2WM9A 4UQXA 4NACA 2WXKA 2LO6A 2OV8A 2V8SE 3QWWA 3PNTB 4U0SA 2FEZA 4M3OA 5AIJA 3PEUB 1JWFA 3QJZA 2J4DA 4I1OB 2LNIA 2Y3AA 3ESKA 3MEKA 3FWVA 2AW6A 3CHRA 4I2WA 4PH4B 2VJ8A 3JCKC 5ANLA 2KZTA 2Y4TA 1Y8MA 4TV3A 1TJFA 3CHQA 3FP3A 5FQ4A 4AXHA 3FUHA 2VY3A 1OUVA 3ZYQA 4C9BB 4RG9A 4GB9A 4L7TA 1KT1A 4IN3B 2WXQA 3U4TA 3ASFA 2AXZA 3KD7A 3PDNA 2C2LA 4BT8A 2CHWA 4J6IA 4CGWA 1H0AA 1VDYA 3L16A 4XE0A 3ZW3A 2YHCA 4GU5A 5E76A 5HI7A 3S7BA 3RRNB 1Z3XA 4MS6A 4CT0A 5FQ6A 4ANXA 4BT9A 3AS4A 3NZUA 3ZFWA 1JWGA 4Q69A 3FUFA 3IHYA 4GMJA 4GZ3A 4A1SA 4BX8A 4E6HA 3G2SA 5G05J 2L9BA 2LAIA 2PZIA 4WNGA 4JEHA 3B7UX 3IEGA 5JHBA 3D9MA 4AIFA 3GZ2A 4WNFA 3CR3A 4LRZA 3ZHEB 3EIJA 1YA0A 2L6JA 4JHJA 5CCLA 3D9PA 2I1JA 3CV0A 3AU4A 3FTVA 4J8SA 5AJDA 4BWRA 4F7AA 3HVEB 5HQ8A 2F6SA 1FCHA 2KZTB 2VGYA 4UI9C 3SF4A 2DIWA 2IOSA 3ASHA 3QARA 3QC1A 2IFUA 1HG5A 4ILGA 3MGBA 1UG3A 4A1GA 4U63A 3ZXSA 3G2TA 4WUYA 4UQYA 3ZYMA 4UQZA 3CQGB 4WAFA 3LYAA 4O6FA 2ILRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYG A;  3LY7 A;  3TAX A;  5AYW D;  2FO7 A;  4M16 A;  4JHR A;  1W3B A;  4AM9 A;  4GZ5 A;  4UI9 J;  2VGX A;  5KJK A;  4GYO A;  4KBQ A;  1WM5 A;  3CK9 A;  3K9I A;  3MV3 B;  5FZS A;  3WXX A;  3CKB A;  3RIB A;  4BTA A;  1ZBP A;  2HR2 A;  2PQR A;  1NA3 A;  2FI7 A;  3RJV A;  2JLB A;  4Y6C A;  3ZN3 A;  3MV2 B;  3LY9 A;  4H7Y A;  5FJY A;  3LET A;  1HXI A;  5EX3 A;  1KLX A;  2KCK A;  3OXL A;  3Q5M A;  4YVO A;  1IHG A;  4HOU A;  5CGL A;  2XGS A;  4AY5 A;  4I9C A;  4I1A A;  4H7X A;  1NZN A;  3CK8 A;  5DBK A;  3UPV A;  5D0Q D;  4I2Z A;  2HYZ A;  4X2E A;  4JA9 A;  3R9A B;  3U3W A;  2LSU A;  4F3V A;  3AS5 A;  2KCV A;  3QKY A;  3ZCB A;  2C0M A;  3MA5 A;  2VGX B;  4XIF A;  4WNE A;  4JA7 A;  5JJT A;  3RO3 A;  4G1T A;  4JL0 A;  4PY3 A;  5M72 A;  2V5F A;  3TGO A;  3UUX A;  1QQE A;  1WAO 1;  3S7D A;  4W9R A;  2WPV A;  2VSN A;  3CEQ A;  5CCM A;  4Y6W A;  2E2E A;  1ZU2 A;  3PE4 A;  4ABN A;  4G23 A;  1HZ4 A;  5G04 C;  4ME2 A;  3TG4 A;  2I6H A;  3RKV A;  3BEE A;  2Y4U A;  3CVN A;  4WND A;  4U07 A;  3CVP A;  2XPI A;  3EDT B;  5KJL A;  3O48 A;  4N67 A;  1KT0 A;  3LCA A;  5BNW A;  3Q15 A;  2OND A;  1A17 A;  2AVP A;  4G24 A;  5KJM A;  1NA0 A;  3VTX A;  5LCW C;  3UQ3 A;  2XGO A;  4YND A;  3GZ1 A;  5A6C A;  3Q49 B;  2YQ8 A;  2WQH A;  4LEU A;  4J8E A;  3QOU A;  4GA2 A;  3OXF A;  4J8F A;  5DIZ A;  4GZ6 A;  3QWP A;  3JYS A;  3RO2 A;  2PL2 A;  4KYO B;  5KJN A;  2DBA A;  5C1D A;  4NPS A;  3ZHE A;  4ITR A;  3LKU A;  5CMT A;  3E4B A;  3SZ7 A;  3PE3 A;  2GW1 A;  5JJ7 A;  2JK8 A;  5CKL A;  3ASG A;  4WGJ A;  3SE5 A;  2J9Q A;  1ELW A;  2Q7F A;  2NC9 A;  3S7J A;  3MKR A;  3LY8 A;  2XCC A;  4HOT A;  4U04 A;  2KAT A;  3CKC A;  5FT9 A;  5EU0 A;  3KS2 A;  3CVQ A;  4X2C A;  2KC7 A;  2QFC A;  2VZA A;  2C0L A;  3SHG A;  2VSY A;  1P5Q A;  2XEV A;  3ZPJ A;  3N3U A;  4GCN A;  4I17 A;  2VYI A;  1E96 B;  4RG6 A;  3ZGQ A;  4GYY A;  2P58 C;  3NF1 A;  5LCW J;  2VQ2 A;  3ASD A;  3RU0 A;  4GA0 A;  1HH8 A;  4BTB A;  3AS8 A;  4NRH B;  4N3B A;  5EX0 A;  4HOR A;  3GW4 A;  4N3A A;  2OOE A;  2R5S A;  3VTY A;  3S7F A;  2UY1 A;  5CHE E;  4KXK B;  2UWJ G;  4N39 A;  1XNF A;  2HO1 A;  3TG5 A;  3KAE A;  4G2V A;  4HOQ A;  2FF4 A;  4G26 A;  4B94 A;  4NQ0 A;  4UI9 K;  1B89 A;  2IF4 A;  5ARG A;  4N2Q A;  4GYW A;  2LSV A;  2G03 A;  3HYM B;  4XI9 A;  5A7D B;  4HOS A;  3QWV A;  3QDN A;  2UY1 B;  5G04 J;  4G25 A;  4N2S A;  4GCO A;  1QZ2 A;  2KCL A;  4APO A;  4EQF A;  3FFL A;  4N3C A;  4AY6 A;  4CDR A;  3ZC7 A;  4J0U A;  1PC2 A;  2XCB A;  4J8D A;  3OXG A;  4YVQ C;  5ARF A;  5G05 C;  4U0Z A;  5FZR A;  5EKQ D;  3CUC A;  3Q47 B;  4X2D A;  3GYZ A;  5JJ6 A;  3S6A A;  1ELR A;  4XI0 A;  5D0O D;  5FTP A;  2XGM A;  5JFF A;  4LU4 A;  4CGV A;  4U0U A;  3Q4A B;  5FZQ A;  2FBN A;  2MHK A;  3LPZ A;  1TJC A;  3N71 A;  4N5C A;  3ZLM A;  3CK7 A;  3ULQ A;  2BUG A;  5JFZ A;  4XI8 A;  3URZ A;  3CVL A;  4GA1 A;  3SN9 A;  5BW8 C;  4GPK A;  2PQN A;  4I9E A;  4UQX A;  3QWW A;  4U0S A;  2FEZ A;  5BT1 A;  2LNI A;  3ESK A;  3MEK A;  3FWV A;  4I2W A;  2Y4T A;  1Y8M A;  3FP3 A;  2VY3 A;  1OUV A;  4RG9 A;  1KT1 A;  4IN3 B;  3U4T A;  3ASF A;  3KD7 A;  3PDN A;  2C2L A;  4BT8 A;  4CGW A;  2YHC A;  3S7B A;  5HI7 A;  4BT9 A;  3AS4 A;  3ZFW A;  4GZ3 A;  4A1S A;  5G05 J;  2PZI A;  4WNG A;  3IEG A;  4AIF A;  3GZ2 A;  4WNF A;  3ZHE B;  1YA0 A;  2L6J A;  5CCL A;  3CV0 A;  4BWR A;  5HQ8 A;  2F6S A;  1FCH A;  2VGY A;  4UI9 C;  3SF4 A;  3ASH A;  2IFU A;  4WUY A;  4UQY A;  4UQZ A;  3LYA A;  4O6F A; 
#chains in the Genus database with same CATH topology
 5JMN D;  2FO7 A;  4M16 A;  1W3B A;  2I2O A;  3NQP A;  4AM9 A;  4UI9 J;  5KJK A;  4GYO A;  1SA5 A;  2OEV A;  4IYP A;  3K9I A;  1D9S A;  3MV3 B;  3PRE A;  1N4R A;  3RAU A;  5ENN A;  3RIB A;  2QY7 A;  3CHO A;  2PQR A;  2QC9 A;  2WXR A;  1LD8 A;  2IOL A;  3L54 A;  3RJV A;  5ENS D;  2WMN A;  4EZK A;  3MV2 B;  5EIB E;  3UT4 A;  4TRQ A;  4YDY A;  3Q79 A;  4H7Y A;  5FJY A;  3D9N A;  3OXL A;  4YVO A;  1IHG A;  5CGL A;  5LP0 A;  1MX6 A;  3VLD A;  3SI5 A;  4A55 A;  4I9C A;  3CVV A;  4ILI A;  2IQC A;  4H7X A;  2CG3 A;  3I3N A;  1NZN A;  4HLL A;  5DBK A;  1TNZ A;  4J8Y A;  2XEE A;  3O4Z A;  2HYZ A;  3TL5 A;  4JA9 A;  3R9A B;  4F3V A;  4TXQ A;  1NI1 A;  5T8I A;  4WWO A;  2LUH A;  3UM3 A;  3ISM C;  4RQI A;  2J49 A;  2X6K A;  5B1A E;  4XIF A;  3PZ2 A;  3HDX A;  4XKB A;  3ESL A;  3L6A A;  2MOW A;  4GTT A;  3F6Q A;  4G1T A;  4JL0 A;  5M72 A;  2V5F A;  3UUX A;  3PS6 A;  3CVW A;  3TWU A;  3S7D A;  4L23 A;  2P9S G;  4O1O A;  5CCM A;  4L2Y A;  1MYO A;  3FU6 A;  4ABN A;  2EIM E;  1HG2 A;  1EF1 C;  3MCX A;  4BEP A;  5G04 C;  1NP7 A;  3UM2 A;  1HFA A;  1O1S A;  1HX8 A;  2X6H A;  2P9I G;  5BXU A;  1HE8 A;  4U07 A;  3IBE A;  2R59 A;  2ION A;  3MKQ B;  3O48 A;  4I6G A;  3UIO C;  4HRM B;  3SGH A;  2YIN A;  2WXH A;  3ML9 A;  4CEM A;  3PZ4 A;  3GZS A;  4TXR A;  5EYL A;  2J08 A;  3PUK A;  1SQM A;  2MYO A;  4UWK A;  1UJK A;  1A17 A;  3DST A;  2AVP A;  2J09 A;  4BX9 A;  4LCT A;  3VTX A;  5LCW C;  1HO8 A;  2GRR B;  3ZEF A;  1V54 E;  5CER B;  2Y69 E;  4JPS A;  5LX8 A;  2E0I A;  4JC8 A;  1MQS A;  2XZD G;  2XRY A;  3QWP A;  3JUE A;  2DBA A;  4L2L A;  2WVI A;  5BPP A;  3ZHE A;  3P2B A;  3SNX A;  2F37 A;  5HKP A;  4C0E A;  3D9I A;  4JW1 A;  3SZ7 A;  3PE3 A;  1E8Y A;  3NAW A;  3AG3 E;  3C72 A;  4TUU A;  4FLH A;  2J9Q A;  1OWP A;  1S70 B;  3J5Q B;  2Q7F A;  3DSU A;  2NC9 A;  1OWM A;  4EBA G;  1E8Z A;  3LY8 A;  5BUZ A;  4K5C A;  1OWL A;  4BET A;  4DRX E;  1SW6 A;  5FT9 A;  3KS2 A;  4E85 A;  1KZP A;  1UJJ A;  4K03 A;  1PAQ A;  3ONL A;  2GRN B;  2KC7 A;  3FEY A;  2VZA A;  3PRZ A;  2HM8 A;  3FU5 A;  3PUJ A;  1P5Q A;  5CMY A;  1S63 A;  3IKO B;  1N9A A;  1OCC E;  1OWN A;  4MBG A;  5AAR A;  2P58 C;  2VGE A;  3ASD A;  4GA0 A;  3QNK A;  4BTB A;  1U3C A;  3EIQ C;  4F53 A;  1N52 A;  1OWO A;  2F8Y A;  2AXV A;  2CG2 A;  4NRH B;  3DSV A;  3LXU X;  2R5S A;  2F0Y A;  3I5P A;  3FUL A;  2UY1 A;  3IXE A;  3CVX A;  4N39 A;  3TG5 A;  2Y0B G;  5ENQ D;  4G2V A;  4DI4 A;  1UW4 B;  2R02 A;  2EIL E;  4UI9 K;  3TWW A;  3IV0 A;  5G55 A;  1JUQ A;  1O1R A;  4ZHB A;  3E30 A;  3V2O A;  4GYW A;  2LSV A;  3EHN A;  2P9P G;  3ASN E;  3S2A A;  3CLJ A;  1E8X A;  5BXO A;  3NBN B;  3QDN A;  1KZO A;  2XQ0 A;  5ENP D;  1FT2 A;  1QZ2 A;  2KCL A;  4DLQ A;  1DNP A;  4GTO A;  4N3C A;  2H6F A;  5FIO A;  3LS8 A;  1PY1 A;  3UKU G;  3ZC7 A;  4J0U A;  3OXG A;  3FTW A;  4YVQ C;  3VLE A;  5G2N A;  3NB2 A;  5FZR A;  1IXV A;  3EHQ A;  3CUC A;  2VTB A;  3TWQ A;  4DK5 A;  4CZ2 D;  3SQV A;  1QNF A;  5AN8 A;  5JJ6 A;  4ATG A;  3ZNG A;  1EYH A;  5FTP A;  2BKG A;  4FHJ A;  3B95 A;  3FH7 A;  4B93 B;  4U0U A;  1TEZ A;  3LPZ A;  2ZXW E;  4U7E B;  2BUG A;  3SFX A;  5JFZ A;  2ETA A;  3TJP A;  3SD5 A;  3MKQ A;  4FJZ A;  3R7R A;  2BKK B;  4I9E A;  4NAC A;  3QWW A;  2LNI A;  2Y3A A;  3ESK A;  3MEK A;  2AW6 A;  4I2W A;  3JCK C;  2Y4T A;  3EU9 A;  1TJF A;  3CHQ A;  3FP3 A;  3LJN A;  5FQ4 A;  4F1P A;  4C9B B;  1MX4 A;  4IN3 B;  2AXZ A;  3ABK E;  2C2L A;  4CGW A;  4XE0 A;  3ZW3 A;  2YHC A;  4GU5 A;  4CT0 A;  3AS4 A;  1JWG A;  4Q69 A;  4GMJ A;  4GZ3 A;  4A1S A;  3G2S A;  4JEH A;  3GZ2 A;  4LRZ A;  1SA4 A;  5EYP F;  2I1J A;  5AJD A;  3FTV A;  3HVE B;  1BI7 B;  4UI9 C;  3QAR A;  2IFU A;  4WUY A;  2EIN E;  4WAF A;  4GML A;  4NUR A;  4I6J A;  3FUM A;  3BU8 A;  4JHR A;  3SBT B;  2WXP A;  1WM5 A;  3CK9 A;  5D66 A;  5FZS A;  3HXC A;  3WXX A;  3B7S A;  3CKB A;  3UT7 A;  4Z68 A;  4RVB A;  1K1A A;  4KMO A;  3E34 A;  3E32 A;  4Y6C A;  3ZN3 A;  4FJY A;  3DPY A;  3UM1 A;  3ABM E;  1H6O A;  1XGW A;  5EX3 A;  3Q9N C;  1KLX A;  3FUD A;  5H7P A;  3ZXP A;  3FUK A;  3CHM A;  3ZVV A;  4HOU A;  2XGS A;  3J5P A;  3ZUV B;  3T5X A;  2XZT G;  4OYS A;  4C0M A;  1H2V C;  3L82 A;  1WY6 A;  4DX7 D;  4JD2 G;  3BG0 B;  4JZY A;  4J7W A;  3UM0 A;  2EQX A;  3UPV A;  4F1S A;  3BQO A;  4A3T A;  4JVS A;  3FU0 A;  3AS5 A;  2EIJ E;  3E37 A;  1HF8 A;  3P1U A;  2LXM A;  5EN5 D;  4BY6 A;  3TXM A;  3LDZ A;  1FVH A;  3G2W A;  4KZ0 A;  4JA7 A;  1OY3 D;  2DWZ A;  1OCO E;  3ZYL A;  5KWD A;  4LG6 A;  3T9K A;  2I9C A;  3TGO A;  3ZKJ A;  3B13 A;  4XEI G;  4CCA A;  2V0P A;  4XZ4 A;  1K1B A;  2KBX A;  4K0R A;  4Y6W A;  1ZU2 A;  5ENT D;  5KNG A;  4XKC A;  4AEZ C;  4G23 A;  3LEW A;  2WQ7 A;  1N11 A;  4Q94 A;  4BFR A;  3TG4 A;  2I6H A;  1LTX A;  3QK0 A;  2H6H A;  2CHX A;  2OCC E;  2XPI A;  5EIL A;  5BNW A;  3L13 A;  5AQB A;  3RSE G;  3TWS A;  4AJW A;  3I4G A;  2OND A;  4BSX A;  2DZN A;  2YHE A;  2VSO E;  1NA0 A;  2WXO A;  2XGO A;  3FU3 A;  4YND A;  4PS8 A;  3GZ1 A;  4APF A;  2WQH A;  4QFV A;  3OAW A;  3QAQ A;  1S64 A;  3CST A;  2KXP C;  2YNQ A;  3JYS A;  3D9K A;  2PL2 A;  4KYO B;  5IY5 E;  3E33 A;  3I4R B;  5CMT A;  3E4B A;  4MRU A;  3FTS A;  3C3O A;  5JJ7 A;  3UX4 A;  2JK8 A;  1EDU A;  4R7L A;  3ASG A;  3FUN A;  2IO2 C;  3S7J A;  3U9W A;  2NUN A;  5ENO D;  2V5Q C;  5ENR D;  4A3V A;  2R05 A;  2CFZ A;  2B0O E;  4HOT A;  4U04 A;  3CKC A;  3UIP C;  4ZFH A;  4GZC A;  3BUA A;  3CVQ A;  4Q96 A;  2XEH A;  4GCN A;  4HI8 A;  3DPD A;  4I17 A;  4DLO A;  3ULE G;  5B1B E;  2OVF A;  3NF1 A;  2IU1 A;  2GRQ B;  2VQ2 A;  2GGF A;  4I43 A;  2X38 A;  3V31 A;  1HH8 A;  3EHM A;  4GTP A;  1TNO A;  4WWP A;  3CIA A;  4N3B A;  5EX0 A;  3KSL A;  2XPY A;  5CEA A;  4U96 D;  2AXU A;  5EDS A;  5AJL A;  3ML8 A;  1EPU A;  4HRN A;  1XNF A;  2HO1 A;  3FTY A;  3ZYK A;  2ETC A;  1OXJ A;  2A5U A;  2FF4 A;  4G26 A;  1MZC A;  4U8H A;  2WXG A;  4AP2 A;  2VTB B;  2V4L A;  2X6F A;  5KCM A;  4IUL A;  1IKN D;  3HYM B;  4XI9 A;  1BD8 A;  2WMO A;  5CRV A;  5FQ7 A;  4N2S A;  3ENE A;  1N94 A;  3ZRH A;  2L0I A;  3D9J A;  3TWV A;  1INZ A;  3CVU A;  4CDR A;  2EIK E;  1PC2 A;  2XCB A;  4DPR A;  4YDE A;  5ARF A;  4U0Z A;  3V30 A;  4LUN U;  3GYZ A;  1O5M A;  2IO3 C;  3C3Q A;  3HG0 D;  4O60 A;  1ELR A;  4XI0 A;  4ANV A;  3LJ3 A;  3U66 A;  2XGM A;  5JFF A;  4CGV A;  2DYS E;  4FUL A;  4FP7 A;  5FWQ A;  3Q4A B;  5FZQ A;  3UMV A;  3X2Q E;  2FBN A;  1IQU A;  1TJC A;  4N5C A;  3ZLM A;  3ULQ A;  5E75 A;  4HB5 A;  4XI8 A;  4I6E A;  2CFU A;  3SN9 A;  4GPK A;  5T4Y A;  3PZ3 A;  2PQN A;  3FTX A;  3DSS A;  2WM9 A;  2FO1 E;  4UQX A;  4HBD A;  3UI2 A;  3PEU B;  3Q75 A;  3FWV A;  1AP7 A;  2VJ8 A;  4TV3 A;  2XEN A;  2VY3 A;  1O1T A;  1WG0 A;  3ASF A;  1OT8 A;  3R9M A;  4J6I A;  1VDY A;  4F6R D;  3L16 A;  1TYQ G;  2QYJ A;  1Z3X A;  4MS6 A;  3RRN B;  5D2M C;  3IHY A;  4E6H A;  1JCQ A;  2PZI A;  4WNG A;  1D8E A;  3IEG A;  1UOH A;  1IHB A;  1BLX B;  3ZHE B;  2L6J A;  5CCL A;  2F6S A;  3QC1 A;  3MGB A;  1UG3 A;  4A1G A;  4UQY A;  3KEA A;  3ZYM A;  2WXN A;  3W9G A;  5AYW D;  1X5B A;  4HFG A;  4K5A B;  4GZ5 A;  2VGX A;  4KBQ A;  4HS2 A;  1E7U A;  1A5E A;  1MHQ A;  4BTA A;  1ZBP A;  2HR2 A;  1YMP A;  1NA3 A;  2FI7 A;  2R17 C;  4U8V D;  2R2L A;  5J08 A;  4UWF A;  4LNG A;  2ZGD A;  1N4S A;  3WG7 E;  1IQR A;  1Y6I A;  3Q5M A;  4WWN A;  1TN8 A;  1N0R A;  1D8D A;  4AY5 A;  3RK6 A;  3PNL B;  2XRZ A;  4I1A A;  4GTR A;  3HVE A;  4GTV A;  4GTQ A;  3CK8 A;  4G8L A;  4FC8 A;  3RRU A;  4I2Z A;  3T5V A;  1UN8 A;  4HQD A;  4X2E A;  1K3Z D;  3UTM A;  3L17 A;  1DC2 A;  3QKY A;  2P9L G;  3MA5 A;  4CDN A;  4P29 A;  4B0Z A;  5JJT A;  2QYU A;  4PY3 A;  5CBN A;  2WQ6 A;  1NH1 A;  1BPO A;  3FTU A;  1QQE A;  3HHM A;  2CHZ A;  2DVW A;  3CEQ A;  1ZB1 A;  2WXF A;  2JAB A;  2GRL A;  3D9H A;  1YCS B;  4X8Q A;  5A23 A;  5CRU A;  4ACL A;  3FDH A;  4ATZ D;  2NYJ A;  4ANW A;  2PNN A;  2BED A;  3AU5 A;  3CQC B;  1RW2 A;  2Y4U A;  4G11 A;  2VSX E;  2WXM A;  4OVV A;  3CVP A;  3L22 A;  3EDT B;  2JEK A;  5KJL A;  4N67 A;  1KT0 A;  2WXL A;  3DBS A;  3VLF A;  4LNB A;  3NOG D;  1HS6 A;  4UWG A;  1N54 A;  3HXE A;  4M7C A;  4DX6 D;  3ONK A;  4KZC A;  1FPP A;  3UQ3 A;  1NFI E;  5T3R A;  2IJG X;  3FHE A;  2IEJ A;  5A6C A;  3Q49 B;  3APC A;  5KBA A;  3JQ1 A;  4PDX A;  5AAO A;  1DVP A;  2NXP A;  2GRM A;  4DX1 A;  4J8E A;  3EJN A;  4GA2 A;  3NZS A;  3OXF A;  3UT8 A;  5C2Y A;  4MKT A;  4PUC A;  4GZD A;  5KJN A;  3SO8 A;  4UUC A;  3TWX A;  4NPS A;  5AQA A;  4ITR A;  3LKU A;  3FH8 A;  2P9N G;  2ZU6 B;  2RFA A;  3Q7A A;  4A63 B;  2GW1 A;  3EU5 A;  3FEX A;  4DJA A;  4DUI A;  1KPS B;  3AG2 E;  3DSW A;  3SE5 A;  4AVX A;  3EUV A;  2FUL A;  4BSZ B;  2MRI A;  3C98 A;  3MKR A;  2LXL A;  2XCC A;  1LD7 A;  3HRA A;  1N0Q A;  3D3M A;  5EU0 A;  3CHP A;  4CDM A;  2QFC A;  4DX2 A;  2C0L A;  3SHG A;  2VSY A;  1L5J A;  3BG1 B;  1TNB A;  3PEV B;  2XEV A;  3ZPJ A;  4LSZ E;  3JXI A;  4JHK A;  4RSY A;  2X3M A;  2XS8 A;  3MX3 A;  2GRO B;  5CMW A;  4XX5 A;  4ACK A;  2B6C A;  2DCP A;  3AS8 A;  3SFY A;  4DI3 A;  3T8K A;  3DEP A;  3G2U A;  4KVM A;  3CHS A;  2V4H C;  3FUJ A;  3GW4 A;  4N3A A;  4K5B A;  3VTY A;  3B7R L;  2Y1L E;  1ELK A;  4EZJ A;  1SZA A;  4V3I A;  1H19 A;  4HOQ A;  4EZL A;  3HIZ A;  3TWR A;  4B94 A;  4LER A;  1B89 A;  1SVX A;  2J8S D;  4L9P A;  4U8Y D;  2J07 A;  4EPZ A;  4KT6 B;  5B3S E;  2ZGG A;  2G03 A;  1Q2Z A;  3FUE A;  5HS0 A;  1FVF A;  3FTZ A;  4IRU A;  3APF A;  4HOS A;  2UY1 B;  1Z5S C;  4G25 A;  3IHV A;  3FY4 A;  1Z6T A;  4AY6 A;  3B7T A;  3T8M A;  4FU3 A;  3OTN A;  4ANU A;  5EKQ D;  3PVL A;  3Q47 B;  3D9L A;  1N4Q A;  5JHA A;  1JPL A;  3S6A A;  3G2V A;  2BF0 X;  4LU4 A;  4DX5 D;  2M63 A;  1OCR E;  3DRA A;  4KVO A;  4FAD A;  2MHK A;  2XS1 A;  1OCZ E;  4JEU A;  3N71 A;  1AWC B;  4FHK A;  3URZ A;  4N5Q A;  4UWL A;  3CVL A;  3PZD A;  4GA1 A;  5BW8 C;  4EEC A;  2IY0 C;  1TN7 A;  2WXK A;  5JA4 D;  2OV8 A;  2V8S E;  5ITZ F;  3QJZ A;  2J4D A;  5ANL A;  1BU9 A;  4AXH A;  3FUH A;  1OUV A;  3ZYQ A;  4RG9 A;  4L7T A;  1KT1 A;  3KD7 A;  3PDN A;  5HI7 A;  3NZU A;  3ZFW A;  3FUF A;  4BX8 A;  5G05 J;  2LAI A;  3B7U X;  4AIF A;  4WNF A;  5HRY A;  5KNH D;  4JHJ A;  4F7A A;  4J8S A;  5HQ8 A;  2RFM A;  1FCH A;  2KZT B;  2VGY A;  2DIW A;  2IOS A;  3ASH A;  1HG5 A;  3ZXS A;  3G2T A;  3LYA A;  3UIN C;  4O6F A;  2ILR A;  2PM7 A;  3ABL E;  1E90 A;  1IYG A;  3LY7 A;  3TAX A;  1N4P A;  2F8X K;  4L1B A;  4G8K A;  4BER A;  2LAH A;  3AAA C;  2AJA A;  1H6K A;  4MLP A;  4U95 D;  3DXM G;  2P9U G;  4JXT A;  4OAV B;  3CGH A;  2P9K G;  2JLB A;  3LY9 A;  3UKR G;  3L08 A;  3LET A;  1HXI A;  2KCK A;  4TXP A;  1U3D A;  3JQ0 A;  4HLE A;  2L0T B;  4B8A A;  2KM4 A;  3JUI A;  1JCR A;  1TNU A;  3KEZ A;  1X81 A;  5D0Q D;  1N95 A;  3U3W A;  2LSU A;  5LOZ A;  4FA6 A;  5AQ9 A;  4CT4 A;  2KCV A;  3W9F A;  3DEO A;  1JCS A;  3ZCB A;  2C0M A;  5LFA A;  2VGX B;  4JB8 P;  4ILH B;  3C5R A;  5ANR A;  3Q78 A;  4WNE A;  4OVU A;  2WXI A;  3ZU7 B;  3RO3 A;  1WAO 1;  3HXD A;  4EBA A;  4GAA A;  3DSX A;  4CRW A;  1NL4 A;  4W9R A;  2WPV A;  2VSN A;  4YDW A;  2E2E A;  3PE4 A;  3FH5 A;  4HNA D;  2PM6 A;  1HZ4 A;  3SY2 A;  2DZO A;  2RKK A;  2A5E A;  3Q73 A;  4ME2 A;  4OAU C;  1G3N B;  2ETB A;  4EHM A;  3RKV A;  3BEE A;  3CVN A;  4WND A;  4PS3 A;  3LCA A;  3B7B A;  3LVQ E;  4C48 B;  2R03 A;  3DWL G;  3Q15 A;  3MYV A;  2GRP B;  3U64 A;  3KSQ A;  4G24 A;  5KJM A;  4TUM A;  4D10 C;  2YQ8 A;  4LEU A;  4B89 A;  2RG8 A;  3QOU A;  2RD0 A;  4J8F A;  5DIZ A;  2WB2 A;  4GZ6 A;  1DCQ A;  1DCE A;  3RO2 A;  1YYH A;  3AG1 E;  5EID A;  3LVR E;  5C1D A;  5BV1 A;  1TN6 A;  3Q7F A;  1H6P A;  2ZIS A;  3CSF A;  1S0P A;  4B8C B;  3QB2 A;  4GPM A;  3TXN A;  5CKL A;  5AEN A;  4RLY A;  3CVY A;  3HXB A;  4WGJ A;  3PH0 C;  1ELW A;  4YDO A;  2XHE A;  2DYR E;  1QYM A;  3ZIM A;  2A4Z A;  2KAT A;  3SBS A;  5CBO A;  3UXG A;  2BTD A;  2X6I A;  3V2X A;  4X2C A;  1HU3 A;  1H2U A;  2X6J A;  3RRM B;  3N3U A;  1UN9 A;  4GTS A;  4HI9 A;  2VYI A;  1E96 B;  4RG6 A;  3ZGQ A;  4GYY A;  4AOF A;  2J4B A;  4FLB A;  5BV0 A;  5LCW J;  3RU0 A;  3SHF A;  3D9O A;  5J90 A;  3R7Q A;  4HOR A;  2WXJ A;  2OOE A;  3SFZ A;  2NSZ A;  3S7F A;  1SZ9 A;  1WDY A;  5CHE E;  4KXK B;  4HVB A;  2UWJ G;  1FT1 A;  1H2T C;  1V55 E;  3KAE A;  3AJI A;  4O1P A;  4PS7 A;  4NQ0 A;  5FQ8 A;  4QQI A;  2IF4 A;  5ARG A;  4N2Q A;  4HXI A;  2NUD A;  4UWH A;  2XPZ A;  5CED B;  1E8W A;  1MJ0 A;  5A7D B;  3QWV A;  5G04 J;  1K8K G;  2I1K A;  3V79 K;  3FUI A;  4GCO A;  4EQF A;  3MZL B;  4APO A;  3FFL A;  1MX2 A;  3L9T A;  1E7V A;  1GW6 A;  4J8D A;  4HRL A;  5G05 C;  4NIK A;  3APD A;  2L6B A;  4X2D A;  4URK A;  4AV7 A;  5FIN A;  1TR4 A;  3JXJ A;  5D0O D;  2AWI A;  3ASO E;  3EHR A;  2OVB A;  2QZA A;  1U2V G;  5AQ7 A;  1LF8 A;  3CK7 A;  1Z3Y A;  4I1M A;  2H6G A;  3DXK G;  3MJW A;  2P2C P;  1QBQ A;  2LO6 A;  3NOC D;  3PNT B;  4U0S A;  2FEZ A;  4M3O A;  5AIJ A;  3HXF A;  5BT1 A;  1JWF A;  4I1O B;  3CHR A;  4PH4 B;  2KZT A;  1Y8M A;  3TWT A;  4GB9 A;  2HE0 A;  2ZIR A;  2WXQ A;  3U4T A;  3AG4 E;  4BT8 A;  2CHW A;  1H0A A;  3PZ1 A;  5E76 A;  3S7B A;  5FQ6 A;  4ANX A;  4BT9 A;  1BI8 B;  3ULY A;  4BES A;  5CEC B;  2L9B A;  5JHB A;  3D9M A;  3Q9U C;  3CR3 A;  2H6I A;  2OEW A;  3EIJ A;  1YA0 A;  3D9P A;  3CV0 A;  4BWR A;  3AU4 A;  3C3R A;  1RZ4 A;  1TNY A;  3SF4 A;  4GTM A;  4ILG A;  4LNU D;  4GMR A;  4U63 A;  4CYM D;  4UQZ A;  3CQG B; 
#chains in the Genus database with same CATH homology
 2PM7 A;  1E90 A;  1IYG A;  4GML A;  4NUR A;  2WXN A;  3LY7 A;  4I6J A;  3TAX A;  3FUM A;  5AYW D;  2FO7 A;  4M16 A;  1X5B A;  1W3B A;  2I2O A;  4HFG A;  3NQP A;  4JHR A;  4L1B A;  4GZ5 A;  4AM9 A;  4UI9 J;  2VGX A;  3SBT B;  5KJK A;  4GYO A;  4KBQ A;  2WXP A;  4HS2 A;  1E7U A;  1WM5 A;  4IYP A;  3CK9 A;  2LAH A;  3K9I A;  3MV3 B;  5FZS A;  1H6K A;  3PRE A;  3B7S A;  4MLP A;  3WXX A;  3CKB A;  1MHQ A;  5ENN A;  3RIB A;  2QY7 A;  3UT7 A;  1ZBP A;  2HR2 A;  4BTA A;  3CHO A;  2PQR A;  2WXR A;  1NA3 A;  2IOL A;  4JXT A;  3CGH A;  3L54 A;  4RVB A;  2FI7 A;  2R17 C;  4KMO A;  3RJV A;  2JLB A;  4Y6C A;  2WMN A;  3ZN3 A;  5J08 A;  4EZK A;  3MV2 B;  4FJY A;  4UWF A;  3UT4 A;  3LY9 A;  4TRQ A;  3L08 A;  4H7Y A;  5FJY A;  3LET A;  3D9N A;  1XGW A;  1HXI A;  5EX3 A;  1IQR A;  1Y6I A;  1KLX A;  2KCK A;  3FUD A;  3OXL A;  3Q5M A;  4WWN A;  4YVO A;  1IHG A;  3FUK A;  3CHM A;  3ZVV A;  4HOU A;  5CGL A;  1U3D A;  3JQ0 A;  2XGS A;  5BT1 A;  5LP0 A;  3VLD A;  4HLE A;  2L0T B;  3T5X A;  4B8A A;  2KM4 A;  3SI5 A;  4A55 A;  4AY5 A;  4I9C A;  4OYS A;  3PNL B;  3RK6 A;  3CVV A;  4C0M A;  3JUI A;  1H2V C;  4ILI A;  2IQC A;  2XRZ A;  4I1A A;  1WY6 A;  4H7X A;  2CG3 A;  3HVE A;  3I3N A;  1NZN A;  3BG0 B;  3CK8 A;  3KEZ A;  4JZY A;  5DBK A;  4FC8 A;  3RRU A;  2EQX A;  3UPV A;  5D0Q D;  4F1S A;  4I2Z A;  3O4Z A;  3T5V A;  1UN8 A;  2HYZ A;  3TL5 A;  4X2E A;  4JA9 A;  3R9A B;  3U3W A;  2LSU A;  5LOZ A;  4F3V A;  4FA6 A;  4A3T A;  4JVS A;  3FU0 A;  4CT4 A;  3L17 A;  3AS5 A;  2KCV A;  5T8I A;  3QKY A;  1HF8 A;  4WWO A;  3ZCB A;  2C0M A;  3P1U A;  5LFA A;  3MA5 A;  2J49 A;  2VGX B;  4CDN A;  4ILH B;  4BY6 A;  2X6K A;  3TXM A;  5ANR A;  3LDZ A;  1FVH A;  3G2W A;  4XIF A;  4WNE A;  4OVU A;  4KZ0 A;  3HDX A;  2WXI A;  4JA7 A;  4XKB A;  3ESL A;  3L6A A;  4P29 A;  4B0Z A;  2MOW A;  5JJT A;  3RO3 A;  4G1T A;  4JL0 A;  4PY3 A;  3ZYL A;  5M72 A;  2WQ6 A;  2I9C A;  2V5F A;  1BPO A;  3TGO A;  3UUX A;  3FTU A;  1QQE A;  3PS6 A;  1WAO 1;  4EBA A;  3HHM A;  4GAA A;  3CVW A;  2CHZ A;  4CRW A;  3B13 A;  4CCA A;  2V0P A;  3S7D A;  4L23 A;  4W9R A;  2WPV A;  4XZ4 A;  2VSN A;  3CEQ A;  5CCM A;  4L2Y A;  2WXF A;  4K0R A;  2GRL A;  2E2E A;  4Y6W A;  1ZU2 A;  3PE4 A;  3FU6 A;  3FH5 A;  4ABN A;  4XKC A;  1HG2 A;  1EF1 C;  3MCX A;  4AEZ C;  2PM6 A;  4G23 A;  1HZ4 A;  5G04 C;  3LEW A;  1NP7 A;  2WQ7 A;  1HFA A;  5A23 A;  4ME2 A;  4ACL A;  3FDH A;  4Q94 A;  4BFR A;  1HX8 A;  2X6H A;  4ANW A;  3TG4 A;  3AU5 A;  2I6H A;  3CQC B;  3RKV A;  3BEE A;  1HE8 A;  2Y4U A;  3QK0 A;  4G11 A;  3CVN A;  2VSX E;  2WXM A;  4WND A;  4U07 A;  4OVV A;  3CVP A;  3IBE A;  2R59 A;  2CHX A;  2JEK A;  2XPI A;  2ION A;  4N67 A;  1KT0 A;  3EDT B;  3L22 A;  2WXL A;  3DBS A;  3LCA A;  3MKQ B;  3O48 A;  4I6G A;  3VLF A;  5BNW A;  3L13 A;  3LVQ E;  1HS6 A;  2YIN A;  2WXH A;  3ML9 A;  4UWG A;  3SGH A;  4CEM A;  1N54 A;  3GZS A;  4AJW A;  3Q15 A;  3I4G A;  3MYV A;  5KJL A;  2OND A;  4BSX A;  3U64 A;  2J08 A;  3PUK A;  1SQM A;  4UWK A;  1UJK A;  1A17 A;  2AVP A;  2YHE A;  2J09 A;  2VSO E;  4G24 A;  5KJM A;  1NA0 A;  4BX9 A;  4LCT A;  3VTX A;  3ONK A;  4KZC A;  5LCW C;  4D10 C;  2WXO A;  3UQ3 A;  5T3R A;  2IJG X;  2XGO A;  3FU3 A;  4YND A;  4PS8 A;  3FHE A;  3GZ1 A;  4APF A;  5A6C A;  3Q49 B;  1HO8 A;  3APC A;  2YQ8 A;  3JQ1 A;  2WQH A;  4LEU A;  4PDX A;  3ZEF A;  1DVP A;  4B89 A;  2NXP A;  2GRM A;  2RG8 A;  4J8E A;  3QOU A;  3EJN A;  4JPS A;  2RD0 A;  4QFV A;  3OAW A;  2E0I A;  4JC8 A;  5LX8 A;  4GA2 A;  3NZS A;  1MQS A;  3OXF A;  4J8F A;  3QAQ A;  5DIZ A;  3UT8 A;  2XRY A;  3CST A;  2WB2 A;  4GZ6 A;  5C2Y A;  4MKT A;  3QWP A;  2YNQ A;  3JYS A;  3D9K A;  4PUC A;  2PL2 A;  4GZD A;  3RO2 A;  4KYO B;  5KJN A;  2DBA A;  4L2L A;  2WVI A;  3LVR E;  5BPP A;  5C1D A;  4NPS A;  3ZHE A;  5BV1 A;  3P2B A;  4ITR A;  3SNX A;  3LKU A;  3I4R B;  5CMT A;  3E4B A;  4C0E A;  3FH8 A;  3D9I A;  4MRU A;  2ZU6 B;  1S0P A;  3CSF A;  3FTS A;  4JW1 A;  3SZ7 A;  4B8C B;  3PE3 A;  1E8Y A;  3QB2 A;  2GW1 A;  5JJ7 A;  3TXN A;  3UX4 A;  2JK8 A;  4TUU A;  4FLH A;  3FEX A;  5CKL A;  1EDU A;  5AEN A;  4R7L A;  4DJA A;  3ASG A;  3CVY A;  4WGJ A;  3PH0 C;  3SE5 A;  2J9Q A;  1OWP A;  4AVX A;  3FUN A;  1ELW A;  2Q7F A;  2NC9 A;  3S7J A;  3U9W A;  2FUL A;  2XHE A;  2MRI A;  3C98 A;  3MKR A;  1OWM A;  4EBA G;  1E8Z A;  3LY8 A;  3ZIM A;  2XCC A;  4A3V A;  5BUZ A;  1OWL A;  2CFZ A;  4HOT A;  4U04 A;  2A4Z A;  2KAT A;  3CKC A;  3SBS A;  4GZC A;  3D3M A;  5FT9 A;  5EU0 A;  3KS2 A;  2BTD A;  3CVQ A;  4E85 A;  1UJJ A;  2X6I A;  4K03 A;  1PAQ A;  3CHP A;  4CDM A;  3ONL A;  4X2C A;  1HU3 A;  2KC7 A;  1H2U A;  2QFC A;  3FEY A;  2VZA A;  3PRZ A;  2C0L A;  3SHG A;  2VSY A;  2X6J A;  3RRM B;  1L5J A;  2HM8 A;  3BG1 B;  3FU5 A;  3PEV B;  3PUJ A;  1P5Q A;  4Q96 A;  5CMY A;  2XEV A;  3ZPJ A;  3N3U A;  3IKO B;  4GCN A;  3DPD A;  1UN9 A;  1OWN A;  4I17 A;  4DLO A;  2VYI A;  1E96 B;  4RG6 A;  4JHK A;  3ZGQ A;  4GYY A;  4AOF A;  2OVF A;  2J4B A;  4FLB A;  4RSY A;  5BV0 A;  2X3M A;  2P58 C;  3NF1 A;  5LCW J;  2IU1 A;  3MX3 A;  2VQ2 A;  5CMW A;  2GGF A;  3ASD A;  3RU0 A;  4I43 A;  2X38 A;  3SHF A;  4GA0 A;  3D9O A;  1HH8 A;  3QNK A;  3EHM A;  1U3C A;  4XX5 A;  4ACK A;  4BTB A;  3EIQ C;  2DCP A;  3AS8 A;  4F53 A;  1N52 A;  4DI3 A;  1OWO A;  2AXV A;  4WWP A;  2CG2 A;  5J90 A;  3CIA A;  3R7Q A;  4NRH B;  4N3B A;  5EX0 A;  4HOR A;  3G2U A;  4KVM A;  3CHS A;  3FUJ A;  3GW4 A;  3LXU X;  2WXJ A;  2XPY A;  4N3A A;  2OOE A;  2R5S A;  3SFZ A;  2AXU A;  5EDS A;  3VTY A;  5AJL A;  2NSZ A;  3ML8 A;  3S7F A;  3I5P A;  3B7R L;  1SZ9 A;  1EPU A;  3FUL A;  2UY1 A;  5CHE E;  4KXK B;  4HVB A;  1ELK A;  2UWJ G;  1H2T C;  3CVX A;  4N39 A;  1XNF A;  2HO1 A;  3FTY A;  3KAE A;  3TG5 A;  3ZYK A;  4EZJ A;  1SZA A;  2A5U A;  4G2V A;  1H19 A;  4V3I A;  4HOQ A;  4EZL A;  3HIZ A;  2FF4 A;  4DI4 A;  4G26 A;  4B94 A;  1UW4 B;  4U8H A;  4PS7 A;  4LER A;  4NQ0 A;  1B89 A;  4UI9 K;  5FQ8 A;  2WXG A;  2IF4 A;  3IV0 A;  2J07 A;  5ARG A;  5G55 A;  1JUQ A;  4EPZ A;  4KT6 B;  4AP2 A;  2VTB B;  4N2Q A;  4HXI A;  2V4L A;  4GYW A;  2X6F A;  2LSV A;  3EHN A;  2G03 A;  4UWH A;  5KCM A;  3S2A A;  2XPZ A;  3FUE A;  4IUL A;  3CLJ A;  1E8X A;  1FVF A;  1E8W A;  3FTZ A;  3HYM B;  4XI9 A;  4IRU A;  5A7D B;  3APF A;  4HOS A;  2WMO A;  3QWV A;  3QDN A;  2UY1 B;  5G04 J;  2XQ0 A;  5FQ7 A;  2I1K A;  4G25 A;  4N2S A;  3FUI A;  4GCO A;  1QZ2 A;  2KCL A;  3ENE A;  3IHV A;  1DNP A;  3MZL B;  4APO A;  4DLQ A;  4EQF A;  3ZRH A;  3FFL A;  3FY4 A;  4N3C A;  1Z6T A;  2L0I A;  3D9J A;  1INZ A;  4AY6 A;  3B7T A;  3LS8 A;  1E7V A;  4FU3 A;  1PY1 A;  3T8M A;  4CDR A;  3ZC7 A;  3CVU A;  4J0U A;  1GW6 A;  1PC2 A;  2XCB A;  4DPR A;  3OTN A;  4J8D A;  3OXG A;  4ANU A;  3FTW A;  4YVQ C;  5ARF A;  3VLE A;  5G05 C;  5G2N A;  4U0Z A;  5FZR A;  5EKQ D;  3PVL A;  3CUC A;  3APD A;  3Q47 B;  2VTB A;  4X2D A;  4LUN U;  4DK5 A;  3D9L A;  3GYZ A;  4URK A;  4AV7 A;  5JHA A;  1QNF A;  1JPL A;  5JJ6 A;  3S6A A;  1ELR A;  4XI0 A;  4ATG A;  5D0O D;  3LJ3 A;  1EYH A;  2AWI A;  5FTP A;  4ANV A;  3G2V A;  3U66 A;  2BF0 X;  4FHJ A;  2XGM A;  5JFF A;  4LU4 A;  3FH7 A;  4CGV A;  2M63 A;  4U0U A;  4FUL A;  4FP7 A;  5FWQ A;  3Q4A B;  5FZQ A;  3UMV A;  4KVO A;  4FAD A;  2FBN A;  1IQU A;  2OVB A;  2MHK A;  1TEZ A;  3LPZ A;  4JEU A;  1TJC A;  3N71 A;  4N5C A;  1LF8 A;  3ZLM A;  3CK7 A;  3ULQ A;  2BUG A;  5E75 A;  5JFZ A;  4XI8 A;  4I6E A;  3TJP A;  4FHK A;  3SD5 A;  3URZ A;  1Z3Y A;  3CVL A;  3PZD A;  4GA1 A;  4I1M A;  2CFU A;  3MKQ A;  3MJW A;  4UWL A;  3SN9 A;  4FJZ A;  5BW8 C;  4GPK A;  4EEC A;  5T4Y A;  4PS3 A;  3R7R A;  2PQN A;  3FTX A;  4I9E A;  2WM9 A;  4UQX A;  4NAC A;  2WXK A;  2LO6 A;  2OV8 A;  2V8S E;  3QWW A;  3PNT B;  4U0S A;  2FEZ A;  4M3O A;  5AIJ A;  3PEU B;  1JWF A;  3QJZ A;  2J4D A;  4I1O B;  2LNI A;  2Y3A A;  3ESK A;  3MEK A;  3FWV A;  2AW6 A;  3CHR A;  4I2W A;  4PH4 B;  2VJ8 A;  3JCK C;  5ANL A;  2KZT A;  2Y4T A;  1Y8M A;  4TV3 A;  1TJF A;  3CHQ A;  3FP3 A;  5FQ4 A;  4AXH A;  3FUH A;  2VY3 A;  1OUV A;  3ZYQ A;  4C9B B;  4RG9 A;  4GB9 A;  4L7T A;  1KT1 A;  4IN3 B;  2WXQ A;  3U4T A;  3ASF A;  2AXZ A;  3KD7 A;  3PDN A;  2C2L A;  4BT8 A;  2CHW A;  4J6I A;  4CGW A;  1H0A A;  1VDY A;  3L16 A;  4XE0 A;  3ZW3 A;  2YHC A;  4GU5 A;  5E76 A;  5HI7 A;  3S7B A;  3RRN B;  1Z3X A;  4MS6 A;  4CT0 A;  5FQ6 A;  4ANX A;  4BT9 A;  3AS4 A;  3NZU A;  3ZFW A;  1JWG A;  4Q69 A;  3FUF A;  3IHY A;  4GMJ A;  4GZ3 A;  4A1S A;  4BX8 A;  4E6H A;  3G2S A;  5G05 J;  2L9B A;  2LAI A;  2PZI A;  4WNG A;  4JEH A;  3B7U X;  3IEG A;  5JHB A;  3D9M A;  4AIF A;  3GZ2 A;  4WNF A;  3CR3 A;  4LRZ A;  3ZHE B;  3EIJ A;  1YA0 A;  2L6J A;  4JHJ A;  5CCL A;  3D9P A;  2I1J A;  3CV0 A;  3AU4 A;  3FTV A;  4J8S A;  5AJD A;  4BWR A;  4F7A A;  3HVE B;  5HQ8 A;  2F6S A;  1FCH A;  2KZT B;  2VGY A;  4UI9 C;  3SF4 A;  2DIW A;  2IOS A;  3ASH A;  3QAR A;  3QC1 A;  2IFU A;  1HG5 A;  4ILG A;  3MGB A;  1UG3 A;  4A1G A;  4U63 A;  3ZXS A;  3G2T A;  4WUY A;  4UQY A;  3ZYM A;  4UQZ A;  3CQG B;  4WAF A;  3LYA A;  4O6F A;  2ILR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...