4U04A

Structure of a eukaryotic fic domain containing protein
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
327
structure length
315
Chain Sequence
RAALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Adenosine monophosphate-protein transferase FICD
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
total genus 120
structure length 315
sequence length 327
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u04A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u04A01
3LETA 5EU0A 2FBNA 2FEZA 1PC2A 3ZN3A 1HXIA 4N3CA 5DBKA 1ELWA 3FFLA 2VYIA 2LSVA 4ITRA 5G04C 5JJ6A 2FF4A 3HYMB 4WNDA 4XIFA 5BW8C 4N5CA 2J9QA 4HORA 4N67A 3QWPA 5EKQD 5G05J 3QKYA 3OXLA 2JK8A 1A17A 4AY6A 4J8DA 4UQZA 3TG4A 3PE3A 3U4TA 5FZSA 5CMTA 3UPVA 4WNEA 4N2QA 4BTBA 2KCLA 3JYSA 2F6SA 3TG5A 4YVQC 2PQRA 5HI7A 3N3UA 5CKLA 2MHKA 3O48A 4CGVA 3EDTB 2XPIA 4KBQA 4JA7A 2L6JA 1HZ4A 4HOTA 3N71A 1KLXA 3ASHA 2XCCA 3RIBA 4N3AA 1QZ2A 5JJTA 2DBAA 2XGSA 5JFFA 2KC7A 2P58C 4I2ZA 1QQEA 3ESKA 3CUCA 3AS5A 1ELRA 4XI0A 3LYAA 4GPKA 3ASFA 4AY5A 3CK7A 3ZLMA 4N2SA 4UQYA 3CVQA 3SHGA 4X2EA 4G23A 3ZGQA 3GZ2A 3KAEA 4Y6CA 1ZBPA 2VGXA 2VZAA 5C1DA 4KXKB 4UI9K 3FP3A 5EX3A 2V5FA 2C0LA 1P5QA 4CDRA 3Q5MA 3GW4A 2R5SA 3PDNA 4PY3A 2G03A 5HQ8A 1FCHA 3VTYA 5M72A 2IF4A 2HO1A 3CK9A 4LEUA 4I1AA 2QFCA 4I9EA 3QOUA 3LY7A 4X2DA 3KS2A 3RKVA 1HH8A 5A7DB 5LCWJ 1WM5A 3CK8A 3SN9A 2IFUA 4J0UA 5JJ7A 4XI9A 3E4BA 3GYZA 2PQNA 3Q15A 4WNFA 4G1TA 4HOUA 4CGWA 5KJLA 2XGOA 2WPVA 2VGXB 3SZ7A 4XI8A 3LPZA 2XGMA 4GA2A 3CEQA 3Q49B 3MEKA 4Y6WA 2Q7FA 4NPSA 2FO7A 3MV2B 4J8FA 3ULQA 5G05C 3IEGA 4H7YA 4APOA 1KT0A 3URZA 4U0SA 3CKCA 3FWVA 1E96B 3SF4A 2BUGA 5KJMA 3QWWA 4UI9C 3LCAA 1W3BA 2UY1A 4ABNA 1WAO1 2C2LA 3LY9A 3RJVA 2VQ2A 4GZ6A 4JHRA 4J8EA 4LU4A 4G25A 2HYZA 5D0QD 5CGLA 2KATA 4EQFA 3CVLA 3U3WA 3S6AA 3RO3A 2AVPA 2LSUA 2PZIA 4G2VA 3SE5A 1IYGA 4F3VA 4AIFA 4JL0A 3ZC7A 4RG9A 2HR2A 3S7FA 3NF1A 2KCKA 2XEVA 3S7DA 1OUVA 5BT1A 3AS4A 5G04J 2FI7A 4ME2A 4BT8A 3TGOA 2VSNA 2YHCA 3LY8A 4GCOA 5KJKA 4N39A 5FT9A 4NQ0A 3RU0A 3UUXA 5DIZA 4GZ3A 2XCBA 1B89A 5CCLA 4GYWA 1ZU2A 3CVNA 4U07A 1NA0A 4B94A 4O6FA 5CCMA 3WXXA 3VTXA 4N3BA 3ASGA 5ARGA 2E2EA 2UWJG 2UY1B 3MKRA 4IN3B 2Y4UA 5ARFA 3RO2A 4GCNA 3S7JA 4U0UA 2LNIA 1XNFA 4KYOB 4G24A 2VSYA 4GZ5A 1YA0A 4WNGA 3AS8A 3CVPA 5FJYA 3S7BA 1KT1A 2PL2A 4UI9J 3UQ3A 4WGJA 3MV3B 3Q4AB 5D0OD 3ZHEA 5JFZA 5A6CA 4I2WA 3R9AB 4U04A 2VGYA 4YNDA 2I6HA 1NZNA 2JLBA 2WQHA 4HOQA 4W9RA 5FZRA 3CKBA 5LCWC 2VY3A 4WUYA 4RG6A 5KJNA 4X2CA 3QDNA 2Y4TA 4H7XA 4GA0A 1IHGA 4AM9A 2C0MA 3CV0A 3LKUA 5FTPA 2NC9A 3ZCBA 4GA1A 2YQ8A 3GZ1A 5AYWD 4YVOA 4I9CA 3QWVA 5BNWA 1NA3A 3ZFWA 3KD7A 4UQXA 4U0ZA 4A1SA 4NRHB 2KCVA 5EX0A 4JA9A 3TAXA 2ONDA 3MA5A 3OXFA 3ASDA 4BWRA 3PE4A 5CHEE 4I17A 4BTAA 3Q47B 3BEEA 4G26A 4GYYA 1TJCA 4BT9A 4HOSA 3ZHEB 2GW1A 4M16A 5FZQA 2OOEA 3ZPJA 3K9IA 1Y8MA 4GYOA 3OXGA
chains in the Genus database with same CATH superfamily
3I3NA 3LETA 1AP7A 1FVFA 1PC2A 4XEIG 5EILA 2V4HC 3B13A 5DBKA 1IHBA 3PZ4A 4K5BA 5EYLA 4K03A 4C0MA 2XQ0A 4LNUD 2J9QA 1MHQA 5B1BE 2EQXA 3G2SA 4DX6D 4HRMB 2JK8A 1A17A 4DI3A 2ZXWE 1BU9A 3PE3A 3NBNB 5CMTA 3SGHA 1TNUA 4WNEA 4N2QA 2RD0A 2GRPB 3ZNGA 2V5QC 5HI7A 5CKLA 2V0PA 5D66A 3O48A 1ZB1A 2F37A 5HS0A 2VSXE 2XPIA 4KBQA 5LFAA 2I1KA 1A5EA 3RIBA 3DSSA 1QZ2A 4OYSA 2ZU6B 1TNBA 2DBAA 5JFFA 1Y6IA 4I2ZA 3SNXA 3ESKA 4I6JA 5FIOA 1EYHA 3AS5A 4ANUA 1OWLA 1QYMA 4L9PA 3IHVA 2DYRE 2F0YA 2AW6A 4LNBA 3PZ2A 3ASOE 4Y6CA 3X2QE 3APCA 4KZCA 2X6JA 5EYPF 5CMYA 4KXKB 1H2TC 3HXCA 3L22A 5FWQA 4JPSA 1JWGA 4Q96A 4BETA 1L5JA 3EHNA 1O1TA 4TXPA 2DZNA 4K0RA 4U96D 5ENNA 3E32A 3Q5MA 4UWKA 4JD2G 3PDNA 3V30A 1LTXA 2GRRB 1YYHA 1FCHA 3RRNB 3V2OA 5ENOD 1S0PA 3VTYA 2JEKA 5M72A 4GB9A 4HB5A 3ENEA 2QFCA 4E6HA 2E0IA 3EHRA 1OCCE 5EN5D 1NP7A 2A5UA 1D8EA 5BXOA 4RQIA 2XRZA 5ANRA 4BX8A 2IEJA 4XI9A 3AJIA 2VTBA 4JC8A 2B0OE 2EIME 1O1RA 3CVXA 2PQNA 4DI4A 5KNHD 4CGWA 2XGOA 1E8WA 1VDYA 1BD8A 1N4PA 2XGMA 4GA2A 3TWWA 3CEQA 4F53A 4HQDA 4O1PA 3MEKA 1U2VG 2WXNA 3DEPA 5HKPA 3AU4A 3OTNA 3JQ1A 5ITZF 4U8VD 2CG2A 2IQCA 1KZPA 4H7YA 3TJPA 4JEUA 1E96B 2VJ8A 3LCAA 5B3SE 5FQ4A 4DK5A 2C2LA 4DX7D 2R17C 1BPOA 2FO1E 4JHRA 1E8YA 5A23A 4X8QA 4LU4A 4G25A 2HYZA 3ZYKA 4JB8P 4BSZB 2ETAA 2KATA 4MBGA 3CVLA 3U3WA 3HXBA 2BTDA 1JPLA 4LCTA 2PZIA 1IYGA 4AIFA 4UWLA 3SQVA 3ABKE 4JL0A 4RG9A 2NSZA 2HR2A 4CT4A 2VTBB 3NF1A 3ZUVB 2PM6A 5BT1A 5G04J 4ME2A 4EHMA 2YHCA 3TXMA 3LY8A 3QJZA 2VSOE 4N39A 5FT9A 2XENA 3UUXA 4HI9A 4GZ3A 2Y3AA 2L0IA 1HS6A 3IBEA 4N5QA 3FH7A 1ZU2A 4TXQA 5ENPD 2DYSE 4O6FA 3SBTB 4GTQA 3VTXA 4WWPA 4LG6A 2OVBA 4IN3B 3RO2A 3ZYQA 4V3IA 4YDOA 4U0UA 2LNIA 4JXTA 1XNFA 2OCCE 2R59A 5J08A 3G2WA 1YA0A 3TWXA 1JUQA 1E8XA 2WMNA 1H19A 2P9KG 3CIAA 4AV7A 1KT1A 2JABA 3ULEG 3V31A 2BEDA 3MV3B 3BG1B 5T8IA 3CVUA 1SZAA 4I43A 4HOQA 2IY0C 1U3CA 4A63B 4L2LA 3MX3A 4DX5D 2WXOA 1FPPA 3PZ1A 4FJYA 3BG0B 2WXQA 3ASNE 2DWZA 5BV0A 1UJJA 3CV0A 3Q79A 3Q75A 4GA1A 4GTSA 1NL4A 4I9CA 2LXLA 3QWVA 5BNWA 1N9AA 3MKQB 5CECB 4JZYA 2X3MA 2WXPA 3NZUA 3ZYMA 4UUCA 4ACKA 4FADA 3T5VA 4IYPA 1K3ZD 3J5QB 4NRHB 4BESA 3NOCD 1MJ0A 1N4SA 3FU6A 1NFIE 3TAXA 3L08A 2RFMA 3C3OA 5CERB 4A1GA 1INZA 4WAFA 3FTSA 3QB2A 4GYYA 3EIJA 2F8YA 4BT9A 4HOSA 3IXEA 1MX2A 5AJLA 4M16A 1UW4B 3HXFA 4FULA 3ZPJA 1Y8MA 3ISMC 4GYOA 4HBDA 3OXGA 4E85A 3NAWA 2FEZA 2L0TB 2WXLA 1SVXA 3DSVA 3JUIA 4JHKA 2H6HA 2R2LA 3FFLA 3U64A 3DPDA 3HYMB 1JWFA 1V54E 5CMWA 4XIFA 4Q69A 2BF0X 5FQ6A 1H0AA 4I6GA 3KEAA 4HNAD 3QWPA 5EKQD 5G05J 3QKYA 3OXLA 2RKKA 5ANLA 4AY6A 3DEOA 3TG4A 3HXDA 2PNNA 3HVEA 3U4TA 5FZSA 4PDXA 1WY6A 5ENQD 2F6SA 3ABLE 3BU8A 1Z5SC 3FDHA 3CHPA 3QC1A 3DSUA 2R02A 3EDTB 1DVPA 3SBSA 3N71A 3ASHA 3ZRHA 5AQAA 2IO3C 1G3NB 3EJNA 5JJTA 3DSWA 2AWIA 2XGSA 2P58C 2QY7A 5EDSA 5CRVA 2A4ZA 4GTMA 4PH4B 3QNKA 3L9TA 3I4RB 3ML9A 4XI0A 3AG3E 3ONLA 1UN8A 4GPKA 3EU9A 1NI1A 3L17A 4AY5A 4DPRA 4N2SA 3SHGA 1XGWA 4X2EA 4G23A 2KZTA 3HDXA 3KAEA 4GMLA 2VZAA 3LJ3A 3MJWA 1YMPA 4KMOA 3PS6A 3LXUX 3R7QA 3HVEB 2CHZA 2NUDA 2Y1LE 4DUIA 5EIBE 4UWFA 1N95A 3IHYA 1P5QA 3UT7A 3APFA 2NYJA 3AG4E 1N54A 3RK6A 2R5SA 3QK0A 4HS2A 4YDEA 3MYVA 4PY3A 4M7CA 4XKBA 4F7AA 3L13A 2ETBA 1MYOA 3DXMG 2KXPC 2IF4A 2WMOA 2A5EA 3QAQA 1N52A 4NIKA 3C3QA 3LY7A 4X2DA 3UT4A 3KS2A 3RKVA 3CHRA 5LCWJ 1WM5A 2WXJA 2YINA 5LP0A 3CK8A 1OWPA 4TUMA 4I1OB 3UTMA 3W9GA 5JJ7A 2XZTG 3ML8A 5KJLA 2KZTB 2GRQB 1TN6A 4U95D 3SZ7A 1GW6A 1IXVA 5D2MC 3LPZA 4BSXA 4K5CA 3NQPA 3UT8A 2P9NG 3AG1E 1N0QA 2FO7A 5AAOA 3FU5A 1MX4A 4APOA 1D8DA 2L9BA 2P9IG 3SF4A 3QWWA 3FUMA 1TNYA 1WAO1 3LY9A 3FUKA 4HRLA 4G8KA 3AU5A 3E37A 4J8EA 4UWHA 1OCRE 2AXUA 5CGLA 2AJAA 4EQFA 3RO3A 2AVPA 4ANWA 2IOLA 2ZIRA 3DRAA 1X81A 3S7DA 1OUVA 4LERA 5AARA 5AQ9A 3U66A 3TGOA 2VSNA 1FT1A 3B7SA 5E76A 4J8SA 3GZSA 3JQ0A 3UXGA 3Q7FA 1H6PA 3ESLA 1MQSA 3DBSA 4DJAA 1Z3YA 3FEYA 5CCLA 4GZCA 3FUHA 3PEUB 3EHQA 4GTOA 1NA0A 3MCXA 2J8SD 3JUEA 3KSLA 3WXXA 5CEAA 2LO6A 2E2EA 2ETCA 2UWJG 1LD7A 3MKRA 2Y4UA 5ARFA 4KT6B 4B8AA 2J4DA 4GPMA 3TWQA 3S7JA 1E8ZA 1E90A 3CHSA 5CEDB 4GMJA 2VSYA 3V2XA 4WNGA 4PS8A 5KWDA 3ZXPA 4ZFHA 3CVPA 3FUDA 3CVVA 3C98A 4FJZA 3UQ3A 4XE0A 5D0OD 1IKND 3ZHEA 3TWTA 5A6CA 3LEWA 4YNDA 3Q73A 1NZNA 3CKBA 4XZ4A 2VY3A 1N94A 3TXNA 5HRYA 3VLDA 4G11A 2HE0A 3PNLB 2LUHA 1OWMA 3QDNA 1NH1A 2Y4TA 3R9MA 3LJNA 4GA0A 3PUJA 4U7EB 2IO2C 5FTPA 1TNOA 5G55A 3NB2A 1JCQA 1ELKA 3ZCBA 4EZKA 3B7TA 5AYWD 4MS6A 3HXEA 2CHXA 1S64A 3IKOB 3D3MA 3ZU7B 4OVVA 3ZW3A 1IQRA 5EX0A 3MA5A 3ASDA 3ZKJA 5CHEE 3TWSA 1TR4A 5T3RA 2MYOA 3BEEA 2CFZA 1TJCA 2I2OA 3ZHEB 3Q9NC 4C9BB 4J7WA 3FU0A 2GRLA 4FU3A 1V55E 2LAIA 5BPPA 4IULA 4JVSA 5B1AE 4QFVA 3T8MA 1UG3A 3ZN3A 1OWOA 2L6BA 4P29A 1ELWA 3UM2A 5IY5E 2VYIA 3MKQA 2LSVA 4ITRA 4CDNA 5JJ6A 2FF4A 4WNDA 3D9PA 1OWNA 5BW8C 4FLHA 4ATGA 4N5CA 4EBAA 2XS1A 2P2CP 4N67A 4L1BA 3SFXA 4U8YD 5JHAA 3B95A 4J8DA 3FUEA 4JHJA 4UQZA 5AQ7A 5KBAA 4BFRA 2WB2A 2WXHA 4FHKA 4B8CB 1YCSB 4BY6A 3VLFA 3UI2A 4BTBA 2KCLA 2QYUA 1O1SA 2H6IA 4ILHB 4YVQC 3N3UA 2GRMA 2LXMA 4F1SA 1RW2A 3RSEG 2B6CA 2MHKA 4JA7A 2DCPA 3T5XA 4EPZA 4J6IA 1HZ4A 4AJWA 2Y0BG 2XCCA 3D9JA 4N3AA 2WQ6A 2KC7A 3PZ3A 1WG0A 3PRZA 1QQEA 5KCMA 1TYQG 3G2TA 5T4YA 2RFAA 4I1MA 5JMND 3ZYLA 1ELRA 1EPUA 3MGBA 4PS3A 4GTTA 1S63A 4GTPA 4LSZE 3ASFA 3NZSA 3ZLMA 4AP2A 3D9KA 1DCQA 3P1UA 4O1OA 3ZGQA 1ZBPA 2VGXA 3FUIA 3PVLA 3CSTA 4UI9K 3FP3A 5EX3A 2I9CA 3FEXA 4ACLA 3T9KA 3EUVA 2GRNB 3FU3A 2C0LA 4K5AB 4Q94A 2MRIA 3GW4A 2G03A 4JEHA 2AXVA 1UN9A 4LEUA 4GMRA 4I1AA 1JCRA 1K1AA 1N0RA 3B7UX 4PUCA 1Z6TA 4I9EA 4RVBA 3FHEA 1HH8A 5A7DB 3DPYA 2XRYA 1H6OA 4FA6A 5BXUA 4D10C 3SN9A 2IFUA 2R05A 3GYZA 3UKUG 3I4GA 4WNFA 4GZDA 4OVUA 2XS8A 4HOUA 4TRQA 3UX4A 1SA4A 2VGXB 4ILGA 2J08A 1HE8A 3B7BA 3E30A 1N4QA 4Y6WA 4PS7A 2RG8A 4NPSA 3MV2B 1D9SA 1KZOA 1SW6A 5CBNA 5ENTD 4B0ZA 2OVFA 1KT0A 1MX6A 3URZA 1TN8A 3CKCA 3Q78A 1OCOE 5BUZA 3C72A 2BUGA 3EU5A 5AENA 4GTRA 1DC2A 4ABNA 5CBOA 3TWUA 3L54A 4EZLA 2VQ2A 2CFUA 2P9SG 3ONKA 4NACA 4J8YA 5D0QD 3UM3A 5AJDA 5AN8A 3S6AA 1IQUA 3LDZA 3CGHA 3ZC7A 1RZ4A 1WDYA 2XEVA 3UINC 2WXMA 4GCOA 5KJKA 3FTUA 1E7VA 2WXFA 4LRZA 4OAUC 3L82A 3PH0C 4HVBA 5DIZA 3CSFA 3Q9UC 3CQGB 2XCBA 4GYWA 3KEZA 4AOFA 4F1PA 3DSXA 3T8KA 4U07A 2Y69E 3CVWA 2P9LG 3QARA 3C5RA 5CCMA 5LX8A 2HM8A 2X6IA 2M63A 2V4LA 3RRUA 4DLQA 2KM4A 3IV0A 3D9LA 3V79K 5ENRD 3FTWA 4EZJA 3FH8A 3ZEFA 2VGEA 2YNQA 4KYOB 4G24A 4HLLA 4LUNU 2WXKA 4MKTA 2AXZA 2GGFA 3AS8A 3I5PA 2PL2A 2ZISA 1U3DA 4WGJA 3Q4AB 4WWOA 4YDWA 5JFZA 1TJFA 5JA4D 2VGYA 3L16A 1HF8A 3CHOA 2I6HA 5FZRA 2EIKE 4BX9A 4A55A 4HRNA 2KBXA 3D9HA 4WUYA 1UOHA 4RG6A 4F6RD 3APDA 3FUFA 4X2CA 3JXJA 4FC8A 4AVXA 4H7XA 4L23A 4CDMA 1IHGA 4AM9A 3F6QA 3FUJA 3LKUA 2XEEA 2ZGDA 4C48B 1BI8B 5C2YA 2NC9A 1HO8A 4DX2A 5E75A 5AQBA 4A3VA 4URKA 3CVYA 3KD7A 2R03A 1N11A 4UQXA 4U0ZA 4A1SA 2OEVA 3FTXA 4AXHA 1Z3XA 2XEHA 2NUNA 4JA9A 3U9WA 2ONDA 3OXFA 4I17A 4BTAA 2H6GA 3FTZA 4EECA 2GW1A 3CHMA 2OOEA 4CZ2D 3K9IA 4G8LA 3G2UA 3UMVA 5EU0A 2FBNA 3FH5A 1HXIA 4N3CA 2IU1A 3EIQC 3PNTB 5G04C 1KPSB 1AWCB 3ZIMA 4HORA 1TN7A 3ZXSA 1QBQA 4ANXA 1HX8A 4OAVB 4GAAA 4CEMA 3UPVA 3JCKC 3LS8A 4UWGA 4M3OA 3JYSA 3HHMA 2XPYA 4ZHBA 3ULYA 4WWNA 4BEPA 3TG5A 2PQRA 4FHJA 1LD8A 1DCEA 5FQ7A 4CGVA 2X6FA 2P9UG 3CHQA 2L6JA 2WVIA 2F8XK 3ABME 4HOTA 1KLXA 3Q7AA 5LOZA 2XZDG 3FULA 2DZOA 1SA5A 5ENSD 3C3RA 1TEZA 2QC9A 3BUAA 2YHEA 3CUCA 4FLBA 3DXKG 2IOSA 2DVWA 2MOWA 1TNZA 3LYAA 4AEZC 3CK7A 4BERA 4UQYA 3PEVB 3CVQA 3GZ2A 3UKRG 4JW1A 5C1DA 4HI8A 3NOGD 3OAWA 1Q2ZA 1K1BA 1HG5A 5CRUA 2ILRA 4Z68A 3FY4A 2V5FA 3PZDA 3UM1A 3G2VA 1X5BA 4CDRA 2J09A 3PREA 1FT2A 4RLYA 3CQCB 4L2YA 3W9FA 1OY3D 3CLJA 3VLEA 5HQ8A 1OT8A 4TV3A 2X6KA 3SFZA 3LVQE 2LAHA 3TWRA 1O5MA 2HO1A 3CK9A 2EILE 4IRUA 4A3TA 2IJGX 1JCSA 3FTVA 4U8HA 4CT0A 3LVRE 3FTYA 3QOUA 4GU5A 3BQOA 5BV1A 2BKGA 4TUUA 1PY1A 3O4ZA 3ZVVA 4J0UA 3E4BA 5H7PA 3Q15A 2V8SE 4G1TA 4DRXE 2WPVA 2BKKB 4HLEA 4XI8A 4KVMA 4KZ0A 1EF1C 5EIDA 2PM7A 4CCAA 3Q49B 4DX1A 3HRAA 2Q7FA 4MRUA 2EINE 4J8FA 5FQ8A 3ULQA 2J4BA 5G05C 4O60A 3CR3A 2NXPA 3IEGA 4U0SA 1H6KA 3SHFA 3UIPC 3FWVA 5AIJA 3EHMA 5KJMA 2EIJE 4CRWA 3FUNA 2IONA 4UI9C 1W3BA 1HG2A 2UY1A 1E7UA 1LF8A 2OV8A 3RJVA 3TWVA 1BI7B 1HU3A 1DNPA 3JXIA 3KSQA 4GZ6A 1PAQA 2WQ7A 4B93B 3D9IA 1H2VC 4QQIA 3UM0A 2LSUA 4APFA 4G2VA 3SE5A 4F3VA 1N4RA 3AG2E 2GROB 4R7LA 4YDYA 4L7TA 4MLPA 3SD5A 4ATZD 3S7FA 4EBAG 2KCKA 3AS4A 5FINA 1H2UA 2FI7A 1BLXB 2DIWA 4BT8A 3AAAC 1MZCA 2ZGGA 2H6FA 2FULA 4NQ0A 3RU0A 4FP7A 4U63A 4NURA 2XPZA 1B89A 4CYMD 3CVNA 3MZLB 3SFYA 4LNGA 4B94A 3P2BA 1OXJA 4N3BA 3ASGA 2WM9A 5ARGA 4GTVA 2UY1B 3SI5A 2J07A 2P9PG 1SQMA 2I1JA 3RRMB 3S2AA 3SY2A 4GCNA 4C0EA 3HG0D 4XX5A 1SZ9A 3D9MA 4GZ5A 2J49A 3L6AA 1EDUA 5FJYA 3S7BA 4KVOA 4UI9J 1OCZE 2CHWA 3PUKA 4DLOA 4I2WA 3R9AB 1K8KG 3WG7E 4U04A 2JLBA 2WQHA 4W9RA 3E33A 3TL5A 2QZAA 5LCWC 5G2NA 3UIOC 2WXRA 5KJNA 5J90A 4HXIA 4B89A 3D9OA 4ANVA 2WXGA 3HIZA 4TXRA 1FVHA 2C0MA 2WXIA 3J5PA 2X38A 3E34A 4XKCA 1QNFA 2YQ8A 3GZ1A 1HFAA 5JHBA 4YVOA 3R7RA 1NA3A 3B7RL 3ZFWA 4RSYA 2QYJA 3DSTA 4ILIA 2KCVA 2XHEA 3D9NA 4BWRA 3PE4A 2CG3A 3RAUA 1S70B 3SO8A 3Q47B 2X6HA 4I6EA 4G26A 2OEWA 4HFGA 3DWLG 5KNGA 5FZQA 1UJKA
chains in the Genus database with same CATH topology
3I3NA 3LETA 5EU0A 2FBNA 1FVFA 2FEZA 4QFVA 3FH5A 1UG3A 1PC2A 3T8MA 3ZN3A 1OWOA 2L0TB 4P29A 2WXLA 1HXIA 3B13A 4N3CA 4JHKA 3JUIA 1ELWA 5DBKA 3FFLA 3U64A 2IU1A 2VYIA 3EIQC 3PNTB 3MKQA 2LSVA 4ITRA 5G04C 5JJ6A 2FF4A 3DPDA 3HYMB 4K03A 4C0MA 4CDNA 1JWFA 4WNDA 2XQ0A 3D9PA 1OWNA 3ZIMA 5CMWA 4XIFA 5BW8C 2BF0X 4Q69A 4FLHA 5FQ6A 4ATGA 4N5CA 2J9QA 1MHQA 4EBAA 4HORA 1H0AA 2EQXA 4I6GA 4N67A 3G2SA 4L1BA 3QWPA 5EKQD 5G05J 3ZXSA 3QKYA 3OXLA 4ANXA 2JK8A 1A17A 4DI3A 5ANLA 5JHAA 4AY6A 4J8DA 4JHJA 3FUEA 4UQZA 3TG4A 1HX8A 3PE3A 4BFRA 3HVEA 3U4TA 2WB2A 2WXHA 5FZSA 5CMTA 4GAAA 4CEMA 4FHKA 3SGHA 4B8CB 4BY6A 3UPVA 3VLFA 3JCKC 3LS8A 1WY6A 4PDXA 4M3OA 4UWGA 4WNEA 4BTBA 2KCLA 3JYSA 4N2QA 2RD0A 3HHMA 2XPYA 4ILHB 4WWNA 2F6SA 3TG5A 4YVQC 3FDHA 2PQRA 5HI7A 3N3UA 2GRMA 4FHJA 5CKLA 3CHPA 3QC1A 4F1SA 2V0PA 2MHKA 5FQ7A 3O48A 4CGVA 2X6FA 3EDTB 3CHQA 2VSXE 2XPIA 4KBQA 4JA7A 2L6JA 2WVIA 1DVPA 2DCPA 3T5XA 4EPZA 3SBSA 4J6IA 1HZ4A 4AJWA 4HOTA 5LFAA 2I1KA 3N71A 1KLXA 3ASHA 5LOZA 3ZRHA 2XCCA 3RIBA 3EJNA 3D9JA 4N3AA 1QZ2A 4OYSA 2WQ6A 2ZU6B 5JJTA 2DBAA 2AWIA 5JFFA 2XGSA 2KC7A 2P58C 3FULA 1Y6IA 4I2ZA 3PRZA 2QY7A 3SNXA 5EDSA 1QQEA 3ESKA 1TEZA 4I6JA 2A4ZA 5KCMA 4PH4B 2YHEA 3G2TA 3CUCA 1EYHA 5T4YA 4FLBA 4I1MA 3QNKA 3AS5A 3ZYLA 3I4RB 1ELRA 2IOSA 4ANUA 2MOWA 3ML9A 1EPUA 1OWLA 3LYAA 3MGBA 4XI0A 3ONLA 1UN8A 3IHVA 4PS3A 4GPKA 4AEZC 3L17A 3ASFA 4AY5A 2AW6A 3CK7A 3NZSA 3ZLMA 4AP2A 4DPRA 4N2SA 3D9KA 4UQYA 3PEVB 3P1UA 3CVQA 3SHGA 1XGWA 4X2EA 4G23A 2KZTA 3ZGQA 3GZ2A 3HDXA 3KAEA 4Y6CA 1ZBPA 3APCA 4JW1A 4KZCA 4GMLA 2VGXA 2X6JA 2VZAA 3LJ3A 3FUIA 3MJWA 5CMYA 5C1DA 3PVLA 3OAWA 4KMOA 4KXKB 1H2TC 3PS6A 3CSTA 4UI9K 3LXUX 1HG5A 3FP3A 5EX3A 3L22A 5FWQA 4JPSA 3R7QA 1JWGA 2I9CA 2ILRA 4Q96A 3HVEB 3FEXA 2CHZA 4ACLA 3FY4A 2V5FA 3PZDA 1L5JA 4UWFA 3EHNA 3G2VA 3FU3A 3IHYA 2C0LA 1X5BA 4K0RA 1P5QA 4Q94A 3UT7A 4CDRA 2J09A 3PREA 3APFA 2MRIA 5ENNA 3Q5MA 3CQCB 4L2YA 1N54A 4UWKA 3GW4A 2R5SA 3RK6A 3PDNA 3QK0A 4HS2A 3CLJA 3MYVA 4PY3A 2G03A 3VLEA 4JEHA 5HQ8A 1FCHA 3RRNB 4XKBA 4F7AA 4TV3A 1S0PA 3VTYA 2X6KA 2JEKA 3L13A 5M72A 3SFZA 3LVQE 4GB9A 2LAHA 2IF4A 2HO1A 2AXVA 2WMOA 3CK9A 1UN9A 4LEUA 3ENEA 4I1AA 4IRUA 4A3TA 3QAQA 2IJGX 2QFCA 4E6HA 1N52A 2E0IA 3B7UX 4PUCA 1Z6TA 3FTVA 4I9EA 4U8HA 4CT0A 3LVRE 4RVBA 3FTYA 3QOUA 4GU5A 3LY7A 4X2DA 3UT4A 3KS2A 3RKVA 5BV1A 1NP7A 3FHEA 1HH8A 2A5UA 3CHRA 5A7DB 5LCWJ 1WM5A 2WXJA 2YINA 5LP0A 2XRYA 2XRZA 3CK8A 4FA6A 5ANRA 4D10C 3SN9A 1OWPA 4I1OB 4TUUA 4BX8A 1PY1A 2IFUA 3O4ZA 3ZVVA 4J0UA 5JJ7A 4XI9A 3E4BA 2VTBA 3GYZA 4JC8A 3I4GA 3CVXA 2PQNA 3ML8A 3Q15A 4GZDA 4WNFA 4DI4A 2V8SE 4OVUA 4G1TA 4HOUA 4TRQA 2KZTB 3UX4A 2XGOA 4CGWA 5KJLA 2WPVA 2VGXB 3SZ7A 4HLEA 1GW6A 4XI8A 1E8WA 4KVMA 1VDYA 3LPZA 4BSXA 2XGMA 4GA2A 4ILGA 3CEQA 2J08A 4KZ0A 1EF1C 4F53A 3NQPA 3UT8A 1HE8A 2PM7A 4CCAA 3Q49B 3MEKA 2WXNA 3AU4A 4Y6WA 3OTNA 2Q7FA 4PS7A 2RG8A 3JQ1A 4NPSA 4MRUA 2FO7A 3MV2B 4J8FA 5FQ8A 3FU5A 2CG2A 2IQCA 2J4BA 5G05C 3ULQA 4B0ZA 3CR3A 2NXPA 3IEGA 4H7YA 4APOA 2OVFA 1KT0A 3TJPA 3URZA 2L9BA 4U0SA 4JEUA 3CKCA 1H6KA 3SHFA 3FWVA 1E96B 3EHMA 3SF4A 2BUGA 5AIJA 5BUZA 4CRWA 5KJMA 3FUNA 2IONA 3QWWA 4UI9C 3FUMA 2VJ8A 5AENA 3LCAA 1W3BA 1HG2A 2UY1A 4ABNA 5FQ4A 4DK5A 1WAO1 1E7UA 1LF8A 2C2LA 2OV8A 2R17C 3L54A 3FUKA 3LY9A 3RJVA 1BPOA 4EZLA 2VQ2A 1HU3A 2CFUA 1DNPA 4GZ6A 1E8YA 3AU5A 4J8EA 4JHRA 5A23A 4UWHA 4LU4A 4G25A 3ONKA 2AXUA 4NACA 2HYZA 5D0QD 5CGLA 3ZYKA 1PAQA 5AJDA 2WQ7A 3D9IA 2KATA 1H2VC 3CVLA 4EQFA 3U3WA 3S6AA 3RO3A 2BTDA 1JPLA 2AVPA 1IQUA 2LSUA 4LCTA 4APFA 2PZIA 4G2VA 3SE5A 1IYGA 3LDZA 4F3VA 4AIFA 3CGHA 4R7LA 4UWLA 4L7TA 4MLPA 4ANWA 4JL0A 3ZC7A 2IOLA 4RG9A 3SD5A 2NSZA 2HR2A 4CT4A 2VTBB 3S7FA 3NF1A 4EBAG 2KCKA 2XEVA 3S7DA 1OUVA 2PM6A 5BT1A 3AS4A 2WXMA 4LERA 5G04J 1H2UA 3U66A 2FI7A 4ME2A 2DIWA 4BT8A 3TGOA 2VSNA 2YHCA 3TXMA 3B7SA 3LY8A 4GCOA 5E76A 5KJKA 3FTUA 1E7VA 2WXFA 3QJZA 2FULA 2VSOE 4J8SA 4N39A 4LRZA 3GZSA 3JQ0A 5FT9A 4NQ0A 3RU0A 3UUXA 3ESLA 3PH0C 4FP7A 4U63A 5DIZA 4HVBA 4NURA 4GZ3A 2Y3AA 3CSFA 1MQSA 3CQGB 2XCBA 2XPZA 3DBSA 4DJAA 2L0IA 1Z3YA 3FEYA 1B89A 4GZCA 5CCLA 4GYWA 1HS6A 3IBEA 3KEZA 3FH7A 4AOFA 3FUHA 3PEUB 1ZU2A 3CVNA 4U07A 3MZLB 3CVWA 1NA0A 3QARA 4B94A 3MCXA 4O6FA 5CCMA 5LX8A 2HM8A 3WXXA 2X6IA 2M63A 3SBTB 3P2BA 2V4LA 3VTXA 4N3BA 3ASGA 3RRUA 4WWPA 2WM9A 2LO6A 5ARGA 4DLQA 2E2EA 2KM4A 3IV0A 2UWJG 2UY1B 2J07A 3D9LA 3MKRA 2OVBA 4IN3B 3SI5A 2Y4UA 1SQMA 2I1JA 3FTWA 4EZJA 5ARFA 3RO2A 3RRMB 4KT6B 3S2AA 4V3IA 3ZYQA 4B8AA 2J4DA 4GCNA 3S7JA 4U0UA 3FH8A 1E8ZA 2LNIA 1E90A 3ZEFA 3CHSA 4C0EA 4JXTA 1XNFA 4XX5A 4GMJA 2R59A 1SZ9A 2YNQA 3D9MA 4G24A 4KYOB 4LUNU 5J08A 2VSYA 4GZ5A 2WXKA 3G2WA 1YA0A 4MKTA 4WNGA 4PS8A 1JUQA 1E8XA 2WMNA 2AXZA 2GGFA 1H19A 2J49A 3AS8A 3CIAA 3CVPA 3FUDA 3L6AA 3CVVA 1EDUA 4AV7A 5FJYA 3S7BA 1KT1A 4KVOA 3I5PA 3C98A 2PL2A 4FJZA 4UI9J 1U3DA 4WGJA 4XE0A 3UQ3A 3MV3B 3Q4AB 2CHWA 4WWOA 5D0OD 3BG1B 3PUKA 5T8IA 3CVUA 3ZHEA 4DLOA 5JFZA 1SZAA 1TJFA 4I2WA 3R9AB 5A6CA 3LEWA 4U04A 2VGYA 3L16A 1HF8A 4YNDA 3CHOA 2I6HA 4I43A 1NZNA 2JLBA 2WQHA 4HOQA 4W9RA 5FZRA 4BX9A 1U3CA 3CKBA 4A55A 3TL5A 4XZ4A 5LCWC 4L2LA 2VY3A 4WUYA 5G2NA 3TXNA 3VLDA 2WXRA 4RG6A 4G11A 5KJNA 3PNLB 3APDA 3FUFA 1OWMA 5J90A 3MX3A 4X2CA 2WXOA 3QDNA 4FC8A 4HXIA 2Y4TA 4B89A 4AVXA 4FJYA 4H7XA 3D9OA 3BG0B 2WXGA 2WXQA 4ANVA 4L23A 4GA0A 3PUJA 4CDMA 1IHGA 5BV0A 3HIZA 4AM9A 1FVHA 1UJJA 2C0MA 3CV0A 3FUJA 3LKUA 5FTPA 5G55A 2WXIA 1ELKA 2X38A 5C2YA 2NC9A 4XKCA 3ZCBA 1HO8A 1QNFA 4GA1A 2YQ8A 3GZ1A 4EZKA 3B7TA 5E75A 1HFAA 5JHBA 5AYWD 4MS6A 4YVOA 4A3VA 2CHXA 3R7RA 4I9CA 3QWVA 5BNWA 4URKA 3CVYA 3IKOB 3MKQB 1NA3A 3B7RL 2X3MA 4JZYA 3ZFWA 2WXPA 3D3MA 3KD7A 3NZUA 4UQXA 3ZYMA 4U0ZA 4ACKA 4RSYA 4FADA 4A1SA 3T5VA 4IYPA 4NRHB 3FTXA 4OVVA 4ILIA 2KCVA 3ZW3A 4AXHA 2XHEA 1IQRA 1Z3XA 5EX0A 3FU6A 4JA9A 3U9WA 3TAXA 2ONDA 3L08A 3MA5A 3OXFA 3ASDA 3D9NA 4BWRA 3PE4A 5CHEE 4I17A 5T3RA 2CG3A 4A1GA 4BTAA 4WAFA 1INZA 3FTSA 3QB2A 3Q47B 2X6HA 4I6EA 3FTZA 3BEEA 4G26A 2CFZA 4GYYA 3EIJA 1TJCA 4BT9A 2I2OA 4HOSA 3ZHEB 4HFGA 5AJLA 4EECA 2GW1A 4M16A 3CHMA 1UW4B 4C9BB 5FZQA 4FULA 2OOEA 3FU0A 1UJKA 3ZPJA 3K9IA 2GRLA 4FU3A 3G2UA 1Y8MA 4GYOA 2LAIA 5BPPA 4IULA 3UMVA 3OXGA 4E85A 4JVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LET A;  5EU0 A;  2FBN A;  2FEZ A;  1PC2 A;  3ZN3 A;  1HXI A;  4N3C A;  5DBK A;  1ELW A;  3FFL A;  2VYI A;  2LSV A;  4ITR A;  5G04 C;  5JJ6 A;  2FF4 A;  3HYM B;  4WND A;  4XIF A;  5BW8 C;  4N5C A;  2J9Q A;  4HOR A;  4N67 A;  3QWP A;  5EKQ D;  5G05 J;  3QKY A;  3OXL A;  2JK8 A;  1A17 A;  4AY6 A;  4J8D A;  4UQZ A;  3TG4 A;  3PE3 A;  3U4T A;  5FZS A;  5CMT A;  3UPV A;  4WNE A;  4N2Q A;  4BTB A;  2KCL A;  3JYS A;  2F6S A;  3TG5 A;  4YVQ C;  2PQR A;  5HI7 A;  3N3U A;  5CKL A;  2MHK A;  3O48 A;  4CGV A;  3EDT B;  2XPI A;  4KBQ A;  4JA7 A;  2L6J A;  1HZ4 A;  4HOT A;  3N71 A;  1KLX A;  3ASH A;  2XCC A;  3RIB A;  4N3A A;  1QZ2 A;  5JJT A;  2DBA A;  2XGS A;  5JFF A;  2KC7 A;  2P58 C;  4I2Z A;  1QQE A;  3ESK A;  3CUC A;  3AS5 A;  1ELR A;  4XI0 A;  3LYA A;  4GPK A;  3ASF A;  4AY5 A;  3CK7 A;  3ZLM A;  4N2S A;  4UQY A;  3CVQ A;  3SHG A;  4X2E A;  4G23 A;  3ZGQ A;  3GZ2 A;  3KAE A;  4Y6C A;  1ZBP A;  2VGX A;  2VZA A;  5C1D A;  4KXK B;  4UI9 K;  3FP3 A;  5EX3 A;  2V5F A;  2C0L A;  1P5Q A;  4CDR A;  3Q5M A;  3GW4 A;  2R5S A;  3PDN A;  4PY3 A;  2G03 A;  5HQ8 A;  1FCH A;  3VTY A;  5M72 A;  2IF4 A;  2HO1 A;  3CK9 A;  4LEU A;  4I1A A;  2QFC A;  4I9E A;  3QOU A;  3LY7 A;  4X2D A;  3KS2 A;  3RKV A;  1HH8 A;  5A7D B;  5LCW J;  1WM5 A;  3CK8 A;  3SN9 A;  2IFU A;  4J0U A;  5JJ7 A;  4XI9 A;  3E4B A;  3GYZ A;  2PQN A;  3Q15 A;  4WNF A;  4G1T A;  4HOU A;  4CGW A;  5KJL A;  2XGO A;  2WPV A;  2VGX B;  3SZ7 A;  4XI8 A;  3LPZ A;  2XGM A;  4GA2 A;  3CEQ A;  3Q49 B;  3MEK A;  4Y6W A;  2Q7F A;  4NPS A;  2FO7 A;  3MV2 B;  4J8F A;  3ULQ A;  5G05 C;  3IEG A;  4H7Y A;  4APO A;  1KT0 A;  3URZ A;  4U0S A;  3CKC A;  3FWV A;  1E96 B;  3SF4 A;  2BUG A;  5KJM A;  3QWW A;  4UI9 C;  3LCA A;  1W3B A;  2UY1 A;  4ABN A;  1WAO 1;  2C2L A;  3LY9 A;  3RJV A;  2VQ2 A;  4GZ6 A;  4JHR A;  4J8E A;  4LU4 A;  4G25 A;  2HYZ A;  5D0Q D;  5CGL A;  2KAT A;  4EQF A;  3CVL A;  3U3W A;  3S6A A;  3RO3 A;  2AVP A;  2LSU A;  2PZI A;  4G2V A;  3SE5 A;  1IYG A;  4F3V A;  4AIF A;  4JL0 A;  3ZC7 A;  4RG9 A;  2HR2 A;  3S7F A;  3NF1 A;  2KCK A;  2XEV A;  3S7D A;  1OUV A;  5BT1 A;  3AS4 A;  5G04 J;  2FI7 A;  4ME2 A;  4BT8 A;  3TGO A;  2VSN A;  2YHC A;  3LY8 A;  4GCO A;  5KJK A;  4N39 A;  5FT9 A;  4NQ0 A;  3RU0 A;  3UUX A;  5DIZ A;  4GZ3 A;  2XCB A;  1B89 A;  5CCL A;  4GYW A;  1ZU2 A;  3CVN A;  4U07 A;  1NA0 A;  4B94 A;  4O6F A;  5CCM A;  3WXX A;  3VTX A;  4N3B A;  3ASG A;  5ARG A;  2E2E A;  2UWJ G;  2UY1 B;  3MKR A;  4IN3 B;  2Y4U A;  5ARF A;  3RO2 A;  4GCN A;  3S7J A;  4U0U A;  2LNI A;  1XNF A;  4KYO B;  4G24 A;  2VSY A;  4GZ5 A;  1YA0 A;  4WNG A;  3AS8 A;  3CVP A;  5FJY A;  3S7B A;  1KT1 A;  2PL2 A;  4UI9 J;  3UQ3 A;  4WGJ A;  3MV3 B;  3Q4A B;  5D0O D;  3ZHE A;  5JFZ A;  5A6C A;  4I2W A;  3R9A B;  4U04 A;  2VGY A;  4YND A;  2I6H A;  1NZN A;  2JLB A;  2WQH A;  4HOQ A;  4W9R A;  5FZR A;  3CKB A;  5LCW C;  2VY3 A;  4WUY A;  4RG6 A;  5KJN A;  4X2C A;  3QDN A;  2Y4T A;  4H7X A;  4GA0 A;  1IHG A;  4AM9 A;  2C0M A;  3CV0 A;  3LKU A;  5FTP A;  2NC9 A;  3ZCB A;  4GA1 A;  2YQ8 A;  3GZ1 A;  5AYW D;  4YVO A;  4I9C A;  3QWV A;  5BNW A;  1NA3 A;  3ZFW A;  3KD7 A;  4UQX A;  4U0Z A;  4A1S A;  4NRH B;  2KCV A;  5EX0 A;  4JA9 A;  3TAX A;  2OND A;  3MA5 A;  3OXF A;  3ASD A;  4BWR A;  3PE4 A;  5CHE E;  4I17 A;  4BTA A;  3Q47 B;  3BEE A;  4G26 A;  4GYY A;  1TJC A;  4BT9 A;  4HOS A;  3ZHE B;  2GW1 A;  4M16 A;  5FZQ A;  2OOE A;  3ZPJ A;  3K9I A;  1Y8M A;  4GYO A;  3OXG A; 
#chains in the Genus database with same CATH topology
 3I3N A;  3LET A;  1AP7 A;  1FVF A;  1PC2 A;  4XEI G;  5EIL A;  2V4H C;  3B13 A;  5DBK A;  1IHB A;  3PZ4 A;  4K5B A;  5EYL A;  4K03 A;  4C0M A;  2XQ0 A;  4LNU D;  2J9Q A;  1MHQ A;  5B1B E;  2EQX A;  3G2S A;  4DX6 D;  4HRM B;  2JK8 A;  1A17 A;  4DI3 A;  2ZXW E;  1BU9 A;  3PE3 A;  3NBN B;  5CMT A;  3SGH A;  1TNU A;  4WNE A;  4N2Q A;  2RD0 A;  2GRP B;  3ZNG A;  2V5Q C;  5HI7 A;  5CKL A;  2V0P A;  5D66 A;  3O48 A;  1ZB1 A;  2F37 A;  5HS0 A;  2VSX E;  2XPI A;  4KBQ A;  5LFA A;  2I1K A;  1A5E A;  3RIB A;  3DSS A;  1QZ2 A;  4OYS A;  2ZU6 B;  1TNB A;  2DBA A;  5JFF A;  1Y6I A;  4I2Z A;  3SNX A;  3ESK A;  4I6J A;  5FIO A;  1EYH A;  3AS5 A;  4ANU A;  1OWL A;  1QYM A;  4L9P A;  3IHV A;  2DYR E;  2F0Y A;  2AW6 A;  4LNB A;  3PZ2 A;  3ASO E;  4Y6C A;  3X2Q E;  3APC A;  4KZC A;  2X6J A;  5EYP F;  5CMY A;  4KXK B;  1H2T C;  3HXC A;  3L22 A;  5FWQ A;  4JPS A;  1JWG A;  4Q96 A;  4BET A;  1L5J A;  3EHN A;  1O1T A;  4TXP A;  2DZN A;  4K0R A;  4U96 D;  5ENN A;  3E32 A;  3Q5M A;  4UWK A;  4JD2 G;  3PDN A;  3V30 A;  1LTX A;  2GRR B;  1YYH A;  1FCH A;  3RRN B;  3V2O A;  5ENO D;  1S0P A;  3VTY A;  2JEK A;  5M72 A;  4GB9 A;  4HB5 A;  3ENE A;  2QFC A;  4E6H A;  2E0I A;  3EHR A;  1OCC E;  5EN5 D;  1NP7 A;  2A5U A;  1D8E A;  5BXO A;  4RQI A;  2XRZ A;  5ANR A;  4BX8 A;  2IEJ A;  4XI9 A;  3AJI A;  2VTB A;  4JC8 A;  2B0O E;  2EIM E;  1O1R A;  3CVX A;  2PQN A;  4DI4 A;  5KNH D;  4CGW A;  2XGO A;  1E8W A;  1VDY A;  1BD8 A;  1N4P A;  2XGM A;  4GA2 A;  3TWW A;  3CEQ A;  4F53 A;  4HQD A;  4O1P A;  3MEK A;  1U2V G;  2WXN A;  3DEP A;  5HKP A;  3AU4 A;  3OTN A;  3JQ1 A;  5ITZ F;  4U8V D;  2CG2 A;  2IQC A;  1KZP A;  4H7Y A;  3TJP A;  4JEU A;  1E96 B;  2VJ8 A;  3LCA A;  5B3S E;  5FQ4 A;  4DK5 A;  2C2L A;  4DX7 D;  2R17 C;  1BPO A;  2FO1 E;  4JHR A;  1E8Y A;  5A23 A;  4X8Q A;  4LU4 A;  4G25 A;  2HYZ A;  3ZYK A;  4JB8 P;  4BSZ B;  2ETA A;  2KAT A;  4MBG A;  3CVL A;  3U3W A;  3HXB A;  2BTD A;  1JPL A;  4LCT A;  2PZI A;  1IYG A;  4AIF A;  4UWL A;  3SQV A;  3ABK E;  4JL0 A;  4RG9 A;  2NSZ A;  2HR2 A;  4CT4 A;  2VTB B;  3NF1 A;  3ZUV B;  2PM6 A;  5BT1 A;  5G04 J;  4ME2 A;  4EHM A;  2YHC A;  3TXM A;  3LY8 A;  3QJZ A;  2VSO E;  4N39 A;  5FT9 A;  2XEN A;  3UUX A;  4HI9 A;  4GZ3 A;  2Y3A A;  2L0I A;  1HS6 A;  3IBE A;  4N5Q A;  3FH7 A;  1ZU2 A;  4TXQ A;  5ENP D;  2DYS E;  4O6F A;  3SBT B;  4GTQ A;  3VTX A;  4WWP A;  4LG6 A;  2OVB A;  4IN3 B;  3RO2 A;  3ZYQ A;  4V3I A;  4YDO A;  4U0U A;  2LNI A;  4JXT A;  1XNF A;  2OCC E;  2R59 A;  5J08 A;  3G2W A;  1YA0 A;  3TWX A;  1JUQ A;  1E8X A;  2WMN A;  1H19 A;  2P9K G;  3CIA A;  4AV7 A;  1KT1 A;  2JAB A;  3ULE G;  3V31 A;  2BED A;  3MV3 B;  3BG1 B;  5T8I A;  3CVU A;  1SZA A;  4I43 A;  4HOQ A;  2IY0 C;  1U3C A;  4A63 B;  4L2L A;  3MX3 A;  4DX5 D;  2WXO A;  1FPP A;  3PZ1 A;  4FJY A;  3BG0 B;  2WXQ A;  3ASN E;  2DWZ A;  5BV0 A;  1UJJ A;  3CV0 A;  3Q79 A;  3Q75 A;  4GA1 A;  4GTS A;  1NL4 A;  4I9C A;  2LXL A;  3QWV A;  5BNW A;  1N9A A;  3MKQ B;  5CEC B;  4JZY A;  2X3M A;  2WXP A;  3NZU A;  3ZYM A;  4UUC A;  4ACK A;  4FAD A;  3T5V A;  4IYP A;  1K3Z D;  3J5Q B;  4NRH B;  4BES A;  3NOC D;  1MJ0 A;  1N4S A;  3FU6 A;  1NFI E;  3TAX A;  3L08 A;  2RFM A;  3C3O A;  5CER B;  4A1G A;  1INZ A;  4WAF A;  3FTS A;  3QB2 A;  4GYY A;  3EIJ A;  2F8Y A;  4BT9 A;  4HOS A;  3IXE A;  1MX2 A;  5AJL A;  4M16 A;  1UW4 B;  3HXF A;  4FUL A;  3ZPJ A;  1Y8M A;  3ISM C;  4GYO A;  4HBD A;  3OXG A;  4E85 A;  3NAW A;  2FEZ A;  2L0T B;  2WXL A;  1SVX A;  3DSV A;  3JUI A;  4JHK A;  2H6H A;  2R2L A;  3FFL A;  3U64 A;  3DPD A;  3HYM B;  1JWF A;  1V54 E;  5CMW A;  4XIF A;  4Q69 A;  2BF0 X;  5FQ6 A;  1H0A A;  4I6G A;  3KEA A;  4HNA D;  3QWP A;  5EKQ D;  5G05 J;  3QKY A;  3OXL A;  2RKK A;  5ANL A;  4AY6 A;  3DEO A;  3TG4 A;  3HXD A;  2PNN A;  3HVE A;  3U4T A;  5FZS A;  4PDX A;  1WY6 A;  5ENQ D;  2F6S A;  3ABL E;  3BU8 A;  1Z5S C;  3FDH A;  3CHP A;  3QC1 A;  3DSU A;  2R02 A;  3EDT B;  1DVP A;  3SBS A;  3N71 A;  3ASH A;  3ZRH A;  5AQA A;  2IO3 C;  1G3N B;  3EJN A;  5JJT A;  3DSW A;  2AWI A;  2XGS A;  2P58 C;  2QY7 A;  5EDS A;  5CRV A;  2A4Z A;  4GTM A;  4PH4 B;  3QNK A;  3L9T A;  3I4R B;  3ML9 A;  4XI0 A;  3AG3 E;  3ONL A;  1UN8 A;  4GPK A;  3EU9 A;  1NI1 A;  3L17 A;  4AY5 A;  4DPR A;  4N2S A;  3SHG A;  1XGW A;  4X2E A;  4G23 A;  2KZT A;  3HDX A;  3KAE A;  4GML A;  2VZA A;  3LJ3 A;  3MJW A;  1YMP A;  4KMO A;  3PS6 A;  3LXU X;  3R7Q A;  3HVE B;  2CHZ A;  2NUD A;  2Y1L E;  4DUI A;  5EIB E;  4UWF A;  1N95 A;  3IHY A;  1P5Q A;  3UT7 A;  3APF A;  2NYJ A;  3AG4 E;  1N54 A;  3RK6 A;  2R5S A;  3QK0 A;  4HS2 A;  4YDE A;  3MYV A;  4PY3 A;  4M7C A;  4XKB A;  4F7A A;  3L13 A;  2ETB A;  1MYO A;  3DXM G;  2KXP C;  2IF4 A;  2WMO A;  2A5E A;  3QAQ A;  1N52 A;  4NIK A;  3C3Q A;  3LY7 A;  4X2D A;  3UT4 A;  3KS2 A;  3RKV A;  3CHR A;  5LCW J;  1WM5 A;  2WXJ A;  2YIN A;  5LP0 A;  3CK8 A;  1OWP A;  4TUM A;  4I1O B;  3UTM A;  3W9G A;  5JJ7 A;  2XZT G;  3ML8 A;  5KJL A;  2KZT B;  2GRQ B;  1TN6 A;  4U95 D;  3SZ7 A;  1GW6 A;  1IXV A;  5D2M C;  3LPZ A;  4BSX A;  4K5C A;  3NQP A;  3UT8 A;  2P9N G;  3AG1 E;  1N0Q A;  2FO7 A;  5AAO A;  3FU5 A;  1MX4 A;  4APO A;  1D8D A;  2L9B A;  2P9I G;  3SF4 A;  3QWW A;  3FUM A;  1TNY A;  1WAO 1;  3LY9 A;  3FUK A;  4HRL A;  4G8K A;  3AU5 A;  3E37 A;  4J8E A;  4UWH A;  1OCR E;  2AXU A;  5CGL A;  2AJA A;  4EQF A;  3RO3 A;  2AVP A;  4ANW A;  2IOL A;  2ZIR A;  3DRA A;  1X81 A;  3S7D A;  1OUV A;  4LER A;  5AAR A;  5AQ9 A;  3U66 A;  3TGO A;  2VSN A;  1FT1 A;  3B7S A;  5E76 A;  4J8S A;  3GZS A;  3JQ0 A;  3UXG A;  3Q7F A;  1H6P A;  3ESL A;  1MQS A;  3DBS A;  4DJA A;  1Z3Y A;  3FEY A;  5CCL A;  4GZC A;  3FUH A;  3PEU B;  3EHQ A;  4GTO A;  1NA0 A;  3MCX A;  2J8S D;  3JUE A;  3KSL A;  3WXX A;  5CEA A;  2LO6 A;  2E2E A;  2ETC A;  2UWJ G;  1LD7 A;  3MKR A;  2Y4U A;  5ARF A;  4KT6 B;  4B8A A;  2J4D A;  4GPM A;  3TWQ A;  3S7J A;  1E8Z A;  1E90 A;  3CHS A;  5CED B;  4GMJ A;  2VSY A;  3V2X A;  4WNG A;  4PS8 A;  5KWD A;  3ZXP A;  4ZFH A;  3CVP A;  3FUD A;  3CVV A;  3C98 A;  4FJZ A;  3UQ3 A;  4XE0 A;  5D0O D;  1IKN D;  3ZHE A;  3TWT A;  5A6C A;  3LEW A;  4YND A;  3Q73 A;  1NZN A;  3CKB A;  4XZ4 A;  2VY3 A;  1N94 A;  3TXN A;  5HRY A;  3VLD A;  4G11 A;  2HE0 A;  3PNL B;  2LUH A;  1OWM A;  3QDN A;  1NH1 A;  2Y4T A;  3R9M A;  3LJN A;  4GA0 A;  3PUJ A;  4U7E B;  2IO2 C;  5FTP A;  1TNO A;  5G55 A;  3NB2 A;  1JCQ A;  1ELK A;  3ZCB A;  4EZK A;  3B7T A;  5AYW D;  4MS6 A;  3HXE A;  2CHX A;  1S64 A;  3IKO B;  3D3M A;  3ZU7 B;  4OVV A;  3ZW3 A;  1IQR A;  5EX0 A;  3MA5 A;  3ASD A;  3ZKJ A;  5CHE E;  3TWS A;  1TR4 A;  5T3R A;  2MYO A;  3BEE A;  2CFZ A;  1TJC A;  2I2O A;  3ZHE B;  3Q9N C;  4C9B B;  4J7W A;  3FU0 A;  2GRL A;  4FU3 A;  1V55 E;  2LAI A;  5BPP A;  4IUL A;  4JVS A;  5B1A E;  4QFV A;  3T8M A;  1UG3 A;  3ZN3 A;  1OWO A;  2L6B A;  4P29 A;  1ELW A;  3UM2 A;  5IY5 E;  2VYI A;  3MKQ A;  2LSV A;  4ITR A;  4CDN A;  5JJ6 A;  2FF4 A;  4WND A;  3D9P A;  1OWN A;  5BW8 C;  4FLH A;  4ATG A;  4N5C A;  4EBA A;  2XS1 A;  2P2C P;  4N67 A;  4L1B A;  3SFX A;  4U8Y D;  5JHA A;  3B95 A;  4J8D A;  3FUE A;  4JHJ A;  4UQZ A;  5AQ7 A;  5KBA A;  4BFR A;  2WB2 A;  2WXH A;  4FHK A;  4B8C B;  1YCS B;  4BY6 A;  3VLF A;  3UI2 A;  4BTB A;  2KCL A;  2QYU A;  1O1S A;  2H6I A;  4ILH B;  4YVQ C;  3N3U A;  2GRM A;  2LXM A;  4F1S A;  1RW2 A;  3RSE G;  2B6C A;  2MHK A;  4JA7 A;  2DCP A;  3T5X A;  4EPZ A;  4J6I A;  1HZ4 A;  4AJW A;  2Y0B G;  2XCC A;  3D9J A;  4N3A A;  2WQ6 A;  2KC7 A;  3PZ3 A;  1WG0 A;  3PRZ A;  1QQE A;  5KCM A;  1TYQ G;  3G2T A;  5T4Y A;  2RFA A;  4I1M A;  5JMN D;  3ZYL A;  1ELR A;  1EPU A;  3MGB A;  4PS3 A;  4GTT A;  1S63 A;  4GTP A;  4LSZ E;  3ASF A;  3NZS A;  3ZLM A;  4AP2 A;  3D9K A;  1DCQ A;  3P1U A;  4O1O A;  3ZGQ A;  1ZBP A;  2VGX A;  3FUI A;  3PVL A;  3CST A;  4UI9 K;  3FP3 A;  5EX3 A;  2I9C A;  3FEX A;  4ACL A;  3T9K A;  3EUV A;  2GRN B;  3FU3 A;  2C0L A;  4K5A B;  4Q94 A;  2MRI A;  3GW4 A;  2G03 A;  4JEH A;  2AXV A;  1UN9 A;  4LEU A;  4GMR A;  4I1A A;  1JCR A;  1K1A A;  1N0R A;  3B7U X;  4PUC A;  1Z6T A;  4I9E A;  4RVB A;  3FHE A;  1HH8 A;  5A7D B;  3DPY A;  2XRY A;  1H6O A;  4FA6 A;  5BXU A;  4D10 C;  3SN9 A;  2IFU A;  2R05 A;  3GYZ A;  3UKU G;  3I4G A;  4WNF A;  4GZD A;  4OVU A;  2XS8 A;  4HOU A;  4TRQ A;  3UX4 A;  1SA4 A;  2VGX B;  4ILG A;  2J08 A;  1HE8 A;  3B7B A;  3E30 A;  1N4Q A;  4Y6W A;  4PS7 A;  2RG8 A;  4NPS A;  3MV2 B;  1D9S A;  1KZO A;  1SW6 A;  5CBN A;  5ENT D;  4B0Z A;  2OVF A;  1KT0 A;  1MX6 A;  3URZ A;  1TN8 A;  3CKC A;  3Q78 A;  1OCO E;  5BUZ A;  3C72 A;  2BUG A;  3EU5 A;  5AEN A;  4GTR A;  1DC2 A;  4ABN A;  5CBO A;  3TWU A;  3L54 A;  4EZL A;  2VQ2 A;  2CFU A;  2P9S G;  3ONK A;  4NAC A;  4J8Y A;  5D0Q D;  3UM3 A;  5AJD A;  5AN8 A;  3S6A A;  1IQU A;  3LDZ A;  3CGH A;  3ZC7 A;  1RZ4 A;  1WDY A;  2XEV A;  3UIN C;  2WXM A;  4GCO A;  5KJK A;  3FTU A;  1E7V A;  2WXF A;  4LRZ A;  4OAU C;  3L82 A;  3PH0 C;  4HVB A;  5DIZ A;  3CSF A;  3Q9U C;  3CQG B;  2XCB A;  4GYW A;  3KEZ A;  4AOF A;  4F1P A;  3DSX A;  3T8K A;  4U07 A;  2Y69 E;  3CVW A;  2P9L G;  3QAR A;  3C5R A;  5CCM A;  5LX8 A;  2HM8 A;  2X6I A;  2M63 A;  2V4L A;  3RRU A;  4DLQ A;  2KM4 A;  3IV0 A;  3D9L A;  3V79 K;  5ENR D;  3FTW A;  4EZJ A;  3FH8 A;  3ZEF A;  2VGE A;  2YNQ A;  4KYO B;  4G24 A;  4HLL A;  4LUN U;  2WXK A;  4MKT A;  2AXZ A;  2GGF A;  3AS8 A;  3I5P A;  2PL2 A;  2ZIS A;  1U3D A;  4WGJ A;  3Q4A B;  4WWO A;  4YDW A;  5JFZ A;  1TJF A;  5JA4 D;  2VGY A;  3L16 A;  1HF8 A;  3CHO A;  2I6H A;  5FZR A;  2EIK E;  4BX9 A;  4A55 A;  4HRN A;  2KBX A;  3D9H A;  4WUY A;  1UOH A;  4RG6 A;  4F6R D;  3APD A;  3FUF A;  4X2C A;  3JXJ A;  4FC8 A;  4AVX A;  4H7X A;  4L23 A;  4CDM A;  1IHG A;  4AM9 A;  3F6Q A;  3FUJ A;  3LKU A;  2XEE A;  2ZGD A;  4C48 B;  1BI8 B;  5C2Y A;  2NC9 A;  1HO8 A;  4DX2 A;  5E75 A;  5AQB A;  4A3V A;  4URK A;  3CVY A;  3KD7 A;  2R03 A;  1N11 A;  4UQX A;  4U0Z A;  4A1S A;  2OEV A;  3FTX A;  4AXH A;  1Z3X A;  2XEH A;  2NUN A;  4JA9 A;  3U9W A;  2OND A;  3OXF A;  4I17 A;  4BTA A;  2H6G A;  3FTZ A;  4EEC A;  2GW1 A;  3CHM A;  2OOE A;  4CZ2 D;  3K9I A;  4G8L A;  3G2U A;  3UMV A;  5EU0 A;  2FBN A;  3FH5 A;  1HXI A;  4N3C A;  2IU1 A;  3EIQ C;  3PNT B;  5G04 C;  1KPS B;  1AWC B;  3ZIM A;  4HOR A;  1TN7 A;  3ZXS A;  1QBQ A;  4ANX A;  1HX8 A;  4OAV B;  4GAA A;  4CEM A;  3UPV A;  3JCK C;  3LS8 A;  4UWG A;  4M3O A;  3JYS A;  3HHM A;  2XPY A;  4ZHB A;  3ULY A;  4WWN A;  4BEP A;  3TG5 A;  2PQR A;  4FHJ A;  1LD8 A;  1DCE A;  5FQ7 A;  4CGV A;  2X6F A;  2P9U G;  3CHQ A;  2L6J A;  2WVI A;  2F8X K;  3ABM E;  4HOT A;  1KLX A;  3Q7A A;  5LOZ A;  2XZD G;  3FUL A;  2DZO A;  1SA5 A;  5ENS D;  3C3R A;  1TEZ A;  2QC9 A;  3BUA A;  2YHE A;  3CUC A;  4FLB A;  3DXK G;  2IOS A;  2DVW A;  2MOW A;  1TNZ A;  3LYA A;  4AEZ C;  3CK7 A;  4BER A;  4UQY A;  3PEV B;  3CVQ A;  3GZ2 A;  3UKR G;  4JW1 A;  5C1D A;  4HI8 A;  3NOG D;  3OAW A;  1Q2Z A;  1K1B A;  1HG5 A;  5CRU A;  2ILR A;  4Z68 A;  3FY4 A;  2V5F A;  3PZD A;  3UM1 A;  3G2V A;  1X5B A;  4CDR A;  2J09 A;  3PRE A;  1FT2 A;  4RLY A;  3CQC B;  4L2Y A;  3W9F A;  1OY3 D;  3CLJ A;  3VLE A;  5HQ8 A;  1OT8 A;  4TV3 A;  2X6K A;  3SFZ A;  3LVQ E;  2LAH A;  3TWR A;  1O5M A;  2HO1 A;  3CK9 A;  2EIL E;  4IRU A;  4A3T A;  2IJG X;  1JCS A;  3FTV A;  4U8H A;  4CT0 A;  3LVR E;  3FTY A;  3QOU A;  4GU5 A;  3BQO A;  5BV1 A;  2BKG A;  4TUU A;  1PY1 A;  3O4Z A;  3ZVV A;  4J0U A;  3E4B A;  5H7P A;  3Q15 A;  2V8S E;  4G1T A;  4DRX E;  2WPV A;  2BKK B;  4HLE A;  4XI8 A;  4KVM A;  4KZ0 A;  1EF1 C;  5EID A;  2PM7 A;  4CCA A;  3Q49 B;  4DX1 A;  3HRA A;  2Q7F A;  4MRU A;  2EIN E;  4J8F A;  5FQ8 A;  3ULQ A;  2J4B A;  5G05 C;  4O60 A;  3CR3 A;  2NXP A;  3IEG A;  4U0S A;  1H6K A;  3SHF A;  3UIP C;  3FWV A;  5AIJ A;  3EHM A;  5KJM A;  2EIJ E;  4CRW A;  3FUN A;  2ION A;  4UI9 C;  1W3B A;  1HG2 A;  2UY1 A;  1E7U A;  1LF8 A;  2OV8 A;  3RJV A;  3TWV A;  1BI7 B;  1HU3 A;  1DNP A;  3JXI A;  3KSQ A;  4GZ6 A;  1PAQ A;  2WQ7 A;  4B93 B;  3D9I A;  1H2V C;  4QQI A;  3UM0 A;  2LSU A;  4APF A;  4G2V A;  3SE5 A;  4F3V A;  1N4R A;  3AG2 E;  2GRO B;  4R7L A;  4YDY A;  4L7T A;  4MLP A;  3SD5 A;  4ATZ D;  3S7F A;  4EBA G;  2KCK A;  3AS4 A;  5FIN A;  1H2U A;  2FI7 A;  1BLX B;  2DIW A;  4BT8 A;  3AAA C;  1MZC A;  2ZGG A;  2H6F A;  2FUL A;  4NQ0 A;  3RU0 A;  4FP7 A;  4U63 A;  4NUR A;  2XPZ A;  1B89 A;  4CYM D;  3CVN A;  3MZL B;  3SFY A;  4LNG A;  4B94 A;  3P2B A;  1OXJ A;  4N3B A;  3ASG A;  2WM9 A;  5ARG A;  4GTV A;  2UY1 B;  3SI5 A;  2J07 A;  2P9P G;  1SQM A;  2I1J A;  3RRM B;  3S2A A;  3SY2 A;  4GCN A;  4C0E A;  3HG0 D;  4XX5 A;  1SZ9 A;  3D9M A;  4GZ5 A;  2J49 A;  3L6A A;  1EDU A;  5FJY A;  3S7B A;  4KVO A;  4UI9 J;  1OCZ E;  2CHW A;  3PUK A;  4DLO A;  4I2W A;  3R9A B;  1K8K G;  3WG7 E;  4U04 A;  2JLB A;  2WQH A;  4W9R A;  3E33 A;  3TL5 A;  2QZA A;  5LCW C;  5G2N A;  3UIO C;  2WXR A;  5KJN A;  5J90 A;  4HXI A;  4B89 A;  3D9O A;  4ANV A;  2WXG A;  3HIZ A;  4TXR A;  1FVH A;  2C0M A;  2WXI A;  3J5P A;  2X38 A;  3E34 A;  4XKC A;  1QNF A;  2YQ8 A;  3GZ1 A;  1HFA A;  5JHB A;  4YVO A;  3R7R A;  1NA3 A;  3B7R L;  3ZFW A;  4RSY A;  2QYJ A;  3DST A;  4ILI A;  2KCV A;  2XHE A;  3D9N A;  4BWR A;  3PE4 A;  2CG3 A;  3RAU A;  1S70 B;  3SO8 A;  3Q47 B;  2X6H A;  4I6E A;  4G26 A;  2OEW A;  4HFG A;  3DWL G;  5KNG A;  5FZQ A;  1UJK A; 
#chains in the Genus database with same CATH homology
 3I3N A;  3LET A;  5EU0 A;  2FBN A;  1FVF A;  2FEZ A;  4QFV A;  3FH5 A;  1UG3 A;  1PC2 A;  3T8M A;  3ZN3 A;  1OWO A;  2L0T B;  4P29 A;  2WXL A;  1HXI A;  3B13 A;  4N3C A;  4JHK A;  3JUI A;  1ELW A;  5DBK A;  3FFL A;  3U64 A;  2IU1 A;  2VYI A;  3EIQ C;  3PNT B;  3MKQ A;  2LSV A;  4ITR A;  5G04 C;  5JJ6 A;  2FF4 A;  3DPD A;  3HYM B;  4K03 A;  4C0M A;  4CDN A;  1JWF A;  4WND A;  2XQ0 A;  3D9P A;  1OWN A;  3ZIM A;  5CMW A;  4XIF A;  5BW8 C;  2BF0 X;  4Q69 A;  4FLH A;  5FQ6 A;  4ATG A;  4N5C A;  2J9Q A;  1MHQ A;  4EBA A;  4HOR A;  1H0A A;  2EQX A;  4I6G A;  4N67 A;  3G2S A;  4L1B A;  3QWP A;  5EKQ D;  5G05 J;  3ZXS A;  3QKY A;  3OXL A;  4ANX A;  2JK8 A;  1A17 A;  4DI3 A;  5ANL A;  5JHA A;  4AY6 A;  4J8D A;  4JHJ A;  3FUE A;  4UQZ A;  3TG4 A;  1HX8 A;  3PE3 A;  4BFR A;  3HVE A;  3U4T A;  2WB2 A;  2WXH A;  5FZS A;  5CMT A;  4GAA A;  4CEM A;  4FHK A;  3SGH A;  4B8C B;  4BY6 A;  3UPV A;  3VLF A;  3JCK C;  3LS8 A;  1WY6 A;  4PDX A;  4M3O A;  4UWG A;  4WNE A;  4BTB A;  2KCL A;  3JYS A;  4N2Q A;  2RD0 A;  3HHM A;  2XPY A;  4ILH B;  4WWN A;  2F6S A;  3TG5 A;  4YVQ C;  3FDH A;  2PQR A;  5HI7 A;  3N3U A;  2GRM A;  4FHJ A;  5CKL A;  3CHP A;  3QC1 A;  4F1S A;  2V0P A;  2MHK A;  5FQ7 A;  3O48 A;  4CGV A;  2X6F A;  3EDT B;  3CHQ A;  2VSX E;  2XPI A;  4KBQ A;  4JA7 A;  2L6J A;  2WVI A;  1DVP A;  2DCP A;  3T5X A;  4EPZ A;  3SBS A;  4J6I A;  1HZ4 A;  4AJW A;  4HOT A;  5LFA A;  2I1K A;  3N71 A;  1KLX A;  3ASH A;  5LOZ A;  3ZRH A;  2XCC A;  3RIB A;  3EJN A;  3D9J A;  4N3A A;  1QZ2 A;  4OYS A;  2WQ6 A;  2ZU6 B;  5JJT A;  2DBA A;  2AWI A;  5JFF A;  2XGS A;  2KC7 A;  2P58 C;  3FUL A;  1Y6I A;  4I2Z A;  3PRZ A;  2QY7 A;  3SNX A;  5EDS A;  1QQE A;  3ESK A;  1TEZ A;  4I6J A;  2A4Z A;  5KCM A;  4PH4 B;  2YHE A;  3G2T A;  3CUC A;  1EYH A;  5T4Y A;  4FLB A;  4I1M A;  3QNK A;  3AS5 A;  3ZYL A;  3I4R B;  1ELR A;  2IOS A;  4ANU A;  2MOW A;  3ML9 A;  1EPU A;  1OWL A;  3LYA A;  3MGB A;  4XI0 A;  3ONL A;  1UN8 A;  3IHV A;  4PS3 A;  4GPK A;  4AEZ C;  3L17 A;  3ASF A;  4AY5 A;  2AW6 A;  3CK7 A;  3NZS A;  3ZLM A;  4AP2 A;  4DPR A;  4N2S A;  3D9K A;  4UQY A;  3PEV B;  3P1U A;  3CVQ A;  3SHG A;  1XGW A;  4X2E A;  4G23 A;  2KZT A;  3ZGQ A;  3GZ2 A;  3HDX A;  3KAE A;  4Y6C A;  1ZBP A;  3APC A;  4JW1 A;  4KZC A;  4GML A;  2VGX A;  2X6J A;  2VZA A;  3LJ3 A;  3FUI A;  3MJW A;  5CMY A;  5C1D A;  3PVL A;  3OAW A;  4KMO A;  4KXK B;  1H2T C;  3PS6 A;  3CST A;  4UI9 K;  3LXU X;  1HG5 A;  3FP3 A;  5EX3 A;  3L22 A;  5FWQ A;  4JPS A;  3R7Q A;  1JWG A;  2I9C A;  2ILR A;  4Q96 A;  3HVE B;  3FEX A;  2CHZ A;  4ACL A;  3FY4 A;  2V5F A;  3PZD A;  1L5J A;  4UWF A;  3EHN A;  3G2V A;  3FU3 A;  3IHY A;  2C0L A;  1X5B A;  4K0R A;  1P5Q A;  4Q94 A;  3UT7 A;  4CDR A;  2J09 A;  3PRE A;  3APF A;  2MRI A;  5ENN A;  3Q5M A;  3CQC B;  4L2Y A;  1N54 A;  4UWK A;  3GW4 A;  2R5S A;  3RK6 A;  3PDN A;  3QK0 A;  4HS2 A;  3CLJ A;  3MYV A;  4PY3 A;  2G03 A;  3VLE A;  4JEH A;  5HQ8 A;  1FCH A;  3RRN B;  4XKB A;  4F7A A;  4TV3 A;  1S0P A;  3VTY A;  2X6K A;  2JEK A;  3L13 A;  5M72 A;  3SFZ A;  3LVQ E;  4GB9 A;  2LAH A;  2IF4 A;  2HO1 A;  2AXV A;  2WMO A;  3CK9 A;  1UN9 A;  4LEU A;  3ENE A;  4I1A A;  4IRU A;  4A3T A;  3QAQ A;  2IJG X;  2QFC A;  4E6H A;  1N52 A;  2E0I A;  3B7U X;  4PUC A;  1Z6T A;  3FTV A;  4I9E A;  4U8H A;  4CT0 A;  3LVR E;  4RVB A;  3FTY A;  3QOU A;  4GU5 A;  3LY7 A;  4X2D A;  3UT4 A;  3KS2 A;  3RKV A;  5BV1 A;  1NP7 A;  3FHE A;  1HH8 A;  2A5U A;  3CHR A;  5A7D B;  5LCW J;  1WM5 A;  2WXJ A;  2YIN A;  5LP0 A;  2XRY A;  2XRZ A;  3CK8 A;  4FA6 A;  5ANR A;  4D10 C;  3SN9 A;  1OWP A;  4I1O B;  4TUU A;  4BX8 A;  1PY1 A;  2IFU A;  3O4Z A;  3ZVV A;  4J0U A;  5JJ7 A;  4XI9 A;  3E4B A;  2VTB A;  3GYZ A;  4JC8 A;  3I4G A;  3CVX A;  2PQN A;  3ML8 A;  3Q15 A;  4GZD A;  4WNF A;  4DI4 A;  2V8S E;  4OVU A;  4G1T A;  4HOU A;  4TRQ A;  2KZT B;  3UX4 A;  2XGO A;  4CGW A;  5KJL A;  2WPV A;  2VGX B;  3SZ7 A;  4HLE A;  1GW6 A;  4XI8 A;  1E8W A;  4KVM A;  1VDY A;  3LPZ A;  4BSX A;  2XGM A;  4GA2 A;  4ILG A;  3CEQ A;  2J08 A;  4KZ0 A;  1EF1 C;  4F53 A;  3NQP A;  3UT8 A;  1HE8 A;  2PM7 A;  4CCA A;  3Q49 B;  3MEK A;  2WXN A;  3AU4 A;  4Y6W A;  3OTN A;  2Q7F A;  4PS7 A;  2RG8 A;  3JQ1 A;  4NPS A;  4MRU A;  2FO7 A;  3MV2 B;  4J8F A;  5FQ8 A;  3FU5 A;  2CG2 A;  2IQC A;  2J4B A;  5G05 C;  3ULQ A;  4B0Z A;  3CR3 A;  2NXP A;  3IEG A;  4H7Y A;  4APO A;  2OVF A;  1KT0 A;  3TJP A;  3URZ A;  2L9B A;  4U0S A;  4JEU A;  3CKC A;  1H6K A;  3SHF A;  3FWV A;  1E96 B;  3EHM A;  3SF4 A;  2BUG A;  5AIJ A;  5BUZ A;  4CRW A;  5KJM A;  3FUN A;  2ION A;  3QWW A;  4UI9 C;  3FUM A;  2VJ8 A;  5AEN A;  3LCA A;  1W3B A;  1HG2 A;  2UY1 A;  4ABN A;  5FQ4 A;  4DK5 A;  1WAO 1;  1E7U A;  1LF8 A;  2C2L A;  2OV8 A;  2R17 C;  3L54 A;  3FUK A;  3LY9 A;  3RJV A;  1BPO A;  4EZL A;  2VQ2 A;  1HU3 A;  2CFU A;  1DNP A;  4GZ6 A;  1E8Y A;  3AU5 A;  4J8E A;  4JHR A;  5A23 A;  4UWH A;  4LU4 A;  4G25 A;  3ONK A;  2AXU A;  4NAC A;  2HYZ A;  5D0Q D;  5CGL A;  3ZYK A;  1PAQ A;  5AJD A;  2WQ7 A;  3D9I A;  2KAT A;  1H2V C;  3CVL A;  4EQF A;  3U3W A;  3S6A A;  3RO3 A;  2BTD A;  1JPL A;  2AVP A;  1IQU A;  2LSU A;  4LCT A;  4APF A;  2PZI A;  4G2V A;  3SE5 A;  1IYG A;  3LDZ A;  4F3V A;  4AIF A;  3CGH A;  4R7L A;  4UWL A;  4L7T A;  4MLP A;  4ANW A;  4JL0 A;  3ZC7 A;  2IOL A;  4RG9 A;  3SD5 A;  2NSZ A;  2HR2 A;  4CT4 A;  2VTB B;  3S7F A;  3NF1 A;  4EBA G;  2KCK A;  2XEV A;  3S7D A;  1OUV A;  2PM6 A;  5BT1 A;  3AS4 A;  2WXM A;  4LER A;  5G04 J;  1H2U A;  3U66 A;  2FI7 A;  4ME2 A;  2DIW A;  4BT8 A;  3TGO A;  2VSN A;  2YHC A;  3TXM A;  3B7S A;  3LY8 A;  4GCO A;  5E76 A;  5KJK A;  3FTU A;  1E7V A;  2WXF A;  3QJZ A;  2FUL A;  2VSO E;  4J8S A;  4N39 A;  4LRZ A;  3GZS A;  3JQ0 A;  5FT9 A;  4NQ0 A;  3RU0 A;  3UUX A;  3ESL A;  3PH0 C;  4FP7 A;  4U63 A;  5DIZ A;  4HVB A;  4NUR A;  4GZ3 A;  2Y3A A;  3CSF A;  1MQS A;  3CQG B;  2XCB A;  2XPZ A;  3DBS A;  4DJA A;  2L0I A;  1Z3Y A;  3FEY A;  1B89 A;  4GZC A;  5CCL A;  4GYW A;  1HS6 A;  3IBE A;  3KEZ A;  3FH7 A;  4AOF A;  3FUH A;  3PEU B;  1ZU2 A;  3CVN A;  4U07 A;  3MZL B;  3CVW A;  1NA0 A;  3QAR A;  4B94 A;  3MCX A;  4O6F A;  5CCM A;  5LX8 A;  2HM8 A;  3WXX A;  2X6I A;  2M63 A;  3SBT B;  3P2B A;  2V4L A;  3VTX A;  4N3B A;  3ASG A;  3RRU A;  4WWP A;  2WM9 A;  2LO6 A;  5ARG A;  4DLQ A;  2E2E A;  2KM4 A;  3IV0 A;  2UWJ G;  2UY1 B;  2J07 A;  3D9L A;  3MKR A;  2OVB A;  4IN3 B;  3SI5 A;  2Y4U A;  1SQM A;  2I1J A;  3FTW A;  4EZJ A;  5ARF A;  3RO2 A;  3RRM B;  4KT6 B;  3S2A A;  4V3I A;  3ZYQ A;  4B8A A;  2J4D A;  4GCN A;  3S7J A;  4U0U A;  3FH8 A;  1E8Z A;  2LNI A;  1E90 A;  3ZEF A;  3CHS A;  4C0E A;  4JXT A;  1XNF A;  4XX5 A;  4GMJ A;  2R59 A;  1SZ9 A;  2YNQ A;  3D9M A;  4G24 A;  4KYO B;  4LUN U;  5J08 A;  2VSY A;  4GZ5 A;  2WXK A;  3G2W A;  1YA0 A;  4MKT A;  4WNG A;  4PS8 A;  1JUQ A;  1E8X A;  2WMN A;  2AXZ A;  2GGF A;  1H19 A;  2J49 A;  3AS8 A;  3CIA A;  3CVP A;  3FUD A;  3L6A A;  3CVV A;  1EDU A;  4AV7 A;  5FJY A;  3S7B A;  1KT1 A;  4KVO A;  3I5P A;  3C98 A;  2PL2 A;  4FJZ A;  4UI9 J;  1U3D A;  4WGJ A;  4XE0 A;  3UQ3 A;  3MV3 B;  3Q4A B;  2CHW A;  4WWO A;  5D0O D;  3BG1 B;  3PUK A;  5T8I A;  3CVU A;  3ZHE A;  4DLO A;  5JFZ A;  1SZA A;  1TJF A;  4I2W A;  3R9A B;  5A6C A;  3LEW A;  4U04 A;  2VGY A;  3L16 A;  1HF8 A;  4YND A;  3CHO A;  2I6H A;  4I43 A;  1NZN A;  2JLB A;  2WQH A;  4HOQ A;  4W9R A;  5FZR A;  4BX9 A;  1U3C A;  3CKB A;  4A55 A;  3TL5 A;  4XZ4 A;  5LCW C;  4L2L A;  2VY3 A;  4WUY A;  5G2N A;  3TXN A;  3VLD A;  2WXR A;  4RG6 A;  4G11 A;  5KJN A;  3PNL B;  3APD A;  3FUF A;  1OWM A;  5J90 A;  3MX3 A;  4X2C A;  2WXO A;  3QDN A;  4FC8 A;  4HXI A;  2Y4T A;  4B89 A;  4AVX A;  4FJY A;  4H7X A;  3D9O A;  3BG0 B;  2WXG A;  2WXQ A;  4ANV A;  4L23 A;  4GA0 A;  3PUJ A;  4CDM A;  1IHG A;  5BV0 A;  3HIZ A;  4AM9 A;  1FVH A;  1UJJ A;  2C0M A;  3CV0 A;  3FUJ A;  3LKU A;  5FTP A;  5G55 A;  2WXI A;  1ELK A;  2X38 A;  5C2Y A;  2NC9 A;  4XKC A;  3ZCB A;  1HO8 A;  1QNF A;  4GA1 A;  2YQ8 A;  3GZ1 A;  4EZK A;  3B7T A;  5E75 A;  1HFA A;  5JHB A;  5AYW D;  4MS6 A;  4YVO A;  4A3V A;  2CHX A;  3R7R A;  4I9C A;  3QWV A;  5BNW A;  4URK A;  3CVY A;  3IKO B;  3MKQ B;  1NA3 A;  3B7R L;  2X3M A;  4JZY A;  3ZFW A;  2WXP A;  3D3M A;  3KD7 A;  3NZU A;  4UQX A;  3ZYM A;  4U0Z A;  4ACK A;  4RSY A;  4FAD A;  4A1S A;  3T5V A;  4IYP A;  4NRH B;  3FTX A;  4OVV A;  4ILI A;  2KCV A;  3ZW3 A;  4AXH A;  2XHE A;  1IQR A;  1Z3X A;  5EX0 A;  3FU6 A;  4JA9 A;  3U9W A;  3TAX A;  2OND A;  3L08 A;  3MA5 A;  3OXF A;  3ASD A;  3D9N A;  4BWR A;  3PE4 A;  5CHE E;  4I17 A;  5T3R A;  2CG3 A;  4A1G A;  4BTA A;  4WAF A;  1INZ A;  3FTS A;  3QB2 A;  3Q47 B;  2X6H A;  4I6E A;  3FTZ A;  3BEE A;  4G26 A;  2CFZ A;  4GYY A;  3EIJ A;  1TJC A;  4BT9 A;  2I2O A;  4HOS A;  3ZHE B;  4HFG A;  5AJL A;  4EEC A;  2GW1 A;  4M16 A;  3CHM A;  1UW4 B;  4C9B B;  5FZQ A;  4FUL A;  2OOE A;  3FU0 A;  1UJK A;  3ZPJ A;  3K9I A;  2GRL A;  4FU3 A;  3G2U A;  1Y8M A;  4GYO A;  2LAI A;  5BPP A;  4IUL A;  3UMV A;  3OXG A;  4E85 A;  4JVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...