4U04A

Structure of a eukaryotic fic domain containing protein
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
327
structure length
315
Chain Sequence
RAALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine monophosphate-protein transferase FICD
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 120
structure length 315
sequence length 327
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u04A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u04A01
4GYYA 3RIBA 3GYZA 4RG9A 3Q49B 5DIZA 1IHGA 3ZC7A 5CHEE 4X2EA 3QWPA 2E2EA 2PQNA 3Q5MA 2JLBA 4G25A 5LCWC 5M72A 4I1AA 4BWRA 3TAXA 2GW1A 1NZNA 2JK8A 4BT9A 4BTBA 3Q47B 4XI8A 3CKBA 4HOTA 4I2WA 5D0OD 3SE5A 4XI9A 3S7DA 2P58C 4XI0A 4GYOA 3RKVA 2VY3A 5EX3A 3CEQA 4EQFA 3MV2B 5A7DB 3TGOA 4N3BA 3VTXA 4GPKA 4U04A 3S7BA 1P5QA 2XGMA 4UI9C 3GZ2A 5HI7A 3MKRA 3O48A 4H7YA 3TG5A 2Y4UA 2WQHA 4RG6A 3S7JA 4G1TA 3PE3A 5KJKA 3S7FA 4N39A 2UY1B 3EDTB 3CK7A 1ELRA 3N71A 3ZHEB 4GZ6A 4ME2A 2FF4A 3CKCA 4GZ3A 3MV3B 5JFFA 5FTPA 1KLXA 2VGXB 4I9EA 5BNWA 3RJVA 5HQ8A 1B89A 2FBNA 4HOSA 2YHCA 3CVLA 3SN9A 3FWVA 2FO7A 3NF1A 4N2SA 1PC2A 2HO1A 2XPIA 3LY8A 5CCMA 4HOUA 5CKLA 5D0QD 4ABNA 2AVPA 4YVQC 5EKQD 2Y4TA 3ASFA 1HXIA 4IN3B 5CGLA 4B94A 4I2ZA 4UI9J 5C1DA 4F3VA 4M16A 4WNGA 2KCVA 4GCNA 4AIFA 3CVPA 4U07A 4UI9K 3UQ3A 3ASGA 1KT1A 4WGJA 4W9RA 2IFUA 2VSYA 4KBQA 2VGYA 4WNFA 3RO2A 2LSVA 3OXFA 4WNEA 4WNDA 2WPVA 5CCLA 1HH8A 2L6JA 1TJCA 1XNFA 3S6AA 3RO3A 4N67A 3VTYA 5BW8C 4N3AA 4O6FA 4A1SA 1W3BA 3ZCBA 3N3UA 2XCCA 4JL0A 2PL2A 2I6HA 2KC7A 3CUCA 5G05J 3OXLA 4YVOA 5FJYA 2HYZA 1A17A 4UQXA 2DBAA 5FZQA 3GW4A 3LPZA 3SHGA 4UQZA 4U0UA 4U0SA 5JJ7A 2KCLA 2HR2A 1NA3A 2Q7FA 3LETA 5FT9A 3ULQA 5KJNA 1KT0A 4LU4A 2MHKA 3Q15A 4KXKB 4N2QA 4HORA 4X2CA 4G2VA 1E96B 5EU0A 5CMTA 2C2LA 2LSUA 4JA7A 5KJMA 3AS4A 2VZAA 2VQ2A 2C0LA 4J8DA 3KD7A 5KJLA 5JJTA 2KCKA 3ASHA 3UUXA 3ASDA 2F6SA 5DBKA 2ONDA 3LY9A 4G24A 4J0UA 5G05C 4I9CA 4ITRA 4Y6CA 3PE4A 3BEEA 3IEGA 3CK9A 4UQYA 2XEVA 1FCHA 4JA9A 2PQRA 3ZPJA 2UWJG 3KAEA 3CVQA 3SZ7A 4GCOA 4BT8A 4N3CA 4I17A 2FI7A 4X2DA 5AYWD 2XGOA 4XIFA 3FP3A 4NRHB 3QWWA 1Y8MA 5FZRA 4CGVA 4CDRA 5JFZA 1HZ4A 3AS5A 4GA1A 3QWVA 4PY3A 3SF4A 3QKYA 4KYOB 1QZ2A 2OOEA 5BT1A 3LCAA 3QDNA 4WUYA 4AM9A 1IYGA 2BUGA 3FFLA 4BTAA 1QQEA 2IF4A 3UPVA 2YQ8A 3LKUA 3U4TA 2FEZA 4APOA 3RU0A 2KATA 3ZLMA 5FZSA 3K9IA 1YA0A 2G03A 3MA5A 4CGWA 2LNIA 2NC9A 4H7XA 5JJ6A 4GA0A 5EX0A 3CK8A 3ZFWA 3PDNA 4G26A 4AY6A 2C0MA 2UY1A 5G04C 4J8EA 4GZ5A 3JYSA 2XCBA 3ZHEA 4AY5A 3ZN3A 3E4BA 4J8FA 4G23A 4U0ZA 2J9QA 5A6CA 3ESKA 5LCWJ 4NPSA 1ZU2A 4GA2A 3WXXA 2VGXA 3URZA 1OUVA 3GZ1A 4Y6WA 4N5CA 3MEKA 4YNDA 3QOUA 4GYWA 1WAO1 3KS2A 2QFCA 2XGSA 1ZBPA 2V5FA 2VSNA 3OXGA 4LEUA 3ZGQA 2PZIA 4HOQA 3TG4A 1NA0A 5ARGA 2VYIA 3CVNA 4NQ0A 3AS8A 3LYAA 1WM5A 3U3WA 2R5SA 3R9AB 5ARFA 1ELWA 3Q4AB 3CV0A 3HYMB 5G04J 4JHRA 3LY7A
chains in the Genus database with same CATH superfamily
4HLEA 2J07A 4GTPA 3SQVA 5A23A 1IHGA 1H6OA 5CHEE 4X2EA 3QWPA 3RK6A 4BFRA 3S2AA 5ENRD 1OXJA 4L23A 1LD7A 5M72A 3TAXA 1DNPA 2P9UG 3UX4A 3IKOB 3FUFA 1HG5A 3JQ0A 3CGHA 4XI8A 3CKBA 4KVOA 5D0OD 4OAVB 4CCAA 4NURA 3SE5A 5G2NA 4MRUA 3RKVA 4HI9A 4EQFA 1K1AA 5A7DB 1YCSB 4N3BA 4NIKA 3VTXA 2DYSE 3ABLE 3JUIA 1PY1A 2EIME 2P9SG 2OVFA 2A4ZA 4FU3A 4UI9C 3DRAA 2DVWA 4Q96A 2JABA 4P29A 4NACA 3HVEB 3TG5A 4DI4A 4G1TA 3RSEG 3CVWA 5ENSD 2BTDA 3UTMA 3CK7A 5LFAA 4JVSA 2F0YA 4D10C 3FUDA 2A5UA 4I6GA 4GZ3A 3MV3B 3LJ3A 1HO8A 1UW4B 1IHBA 1KLXA 5FTPA 3SGHA 2FBNA 1TNZA 5KBAA 1KZPA 3SN9A 3FWVA 3FTZA 3CLJA 2XPIA 5CBNA 4HOUA 1E90A 4MS6A 3HXBA 3PEUB 4IN3B 3U64A 4DI3A 1H2TC 3P2BA 4UI9J 3DSTA 3KSLA 3UKRG 5E75A 4HBDA 4M7CA 3FUKA 4WNGA 2KCVA 3EU9A 1OWOA 2XQ0A 4XE0A 4W9RA 2WXIA 3RO2A 4GZDA 3ASOE 3DSVA 2NUNA 3PH0C 2IO2C 2H6FA 2CG3A 3S6AA 2R02A 2CHWA 4FHJA 5BW8C 3VLFA 5BPPA 3APFA 5JHBA 2IY0C 3FUIA 4HNAD 4CRWA 1KZOA 2I6HA 1L5JA 5BV1A 1DC2A 1N4RA 3DSSA 3UI2A 1FVHA 3SD5A 2WXOA 3AG4E 3ZYMA 3E37A 5FJYA 2HYZA 3CIAA 3NZSA 3SHGA 5LP0A 4AOFA 1MX6A 2HR2A 3NAWA 3ZKJA 5KJNA 1DCEA 3CSFA 4HRMB 2MHKA 3Q15A 4KXKB 4N2QA 3BG1B 4HORA 3LXUX 3SBTB 3HVEA 3ML8A 4BSZB 2KBXA 4A3VA 4V3IA 3AS4A 5EYLA 1LD8A 3KD7A 4F1PA 2WXPA 1X81A 2KCKA 3PUJA 1K3ZD 4FP7A 3UUXA 3ASDA 2F6SA 5DBKA 3LY9A 3MJWA 4G24A 3B7SA 4GTMA 3HXDA 4HQDA 1H0AA 3R9MA 3Q9UC 2Y3AA 1TNBA 3T9KA 2UWJG 4GTOA 4BT8A 4I17A 4X2DA 3HRAA 4BX8A 1TNOA 2XEHA 3ESLA 1Y8MA 5H7PA 4JEUA 5ENOD 4A1GA 1PAQA 2P9NG 2BF0X 5ENPD 1S0PA 1MJ0A 2GRNB 2LO6A 4GTVA 5JFZA 3AS5A 2V5QC 3QWVA 3C72A 4KYOB 4FC8A 2CFUA 5BXOA 2IQCA 4WWPA 4WUYA 2BUGA 1EPUA 3HXFA 3ABKE 2F37A 1QQEA 5FINA 2YQ8A 3U4TA 4APOA 3UM3A 3BU8A 4JZYA 5CMYA 2OEVA 3CSTA 2DWZA 1SQMA 3L17A 1YA0A 4UWGA 1UN8A 1BD8A 3DEOA 3FUJA 1TYQG 2B6CA 3RRNB 3TWSA 3Q73A 4CGWA 1JPLA 4CT0A 1SA4A 3KEAA 1BPOA 3CQGB 5EILA 3D3MA 1YMPA 3BG0B 4H7XA 3U9WA 3CK8A 1E7VA 2X38A 5IY5E 3ZXPA 3TWXA 2XCBA 4BERA 2XENA 1D8EA 1FPPA 3UM0A 2J9QA 5A6CA 4B93B 3X2QE 1N0QA 4HS2A 4JHJA 3E30A 3FTVA 4LCTA 3JCKC 5LCWJ 5CMWA 3CVUA 4GPMA 3URZA 4HLLA 4YNDA 4PS8A 3ZEFA 1HX8A 3Q75A 3I3NA 3W9FA 3DPYA 2V5FA 2VSNA 5J08A 1K8KG 2L9BA 4FHKA 1TN7A 3I4RB 1MX4A 1NA0A 5ARGA 5FQ8A 3U3WA 3CHOA 3R9AB 3LVQE 4Q69A 1ELWA 3PRZA 1YYHA 5AQBA 4K0RA 4HB5A 1SZAA 1QYMA 3UM1A 3GYZA 4ILGA 5DIZA 5AN8A 5KWDA 1WG0A 5C2YA 3EIQC 3AU4A 2IOLA 2L6BA 3ZXSA 1E7UA 3RRUA 4TXRA 1LTXA 4BWRA 2VJ8A 5KNGA 3EJNA 4HVBA 1INZA 2GW1A 4LG6A 1UJKA 3ZYLA 2JK8A 3J5PA 3L22A 5EIBE 4U63A 1TNUA 5HKPA 3Q47B 1NL4A 3TJPA 3C98A 4I2WA 4A3TA 3L16A 3L9TA 3S7DA 2X3MA 2XS1A 5T4YA 4AXHA 1Z6TA 2R03A 2AXUA 1NH1A 2M63A 2WQ7A 5HI7A 2J8SD 3O48A 3VLDA 3QK0A 2F8XK 2NYJA 4H7YA 3CHMA 4MKTA 3PE3A 3S7FA 4N39A 2L0IA 3N71A 3ZHEB 4GZ6A 3B13A 4XX5A 1AWCB 3UIPC 3FDHA 2XHEA 5JFFA 2X6JA 4I9EA 3RJVA 5J90A 2YHCA 1TNYA 3V2OA 1OWPA 2MRIA 3E32A 2GGFA 3G2WA 3LY8A 5CKLA 2VSXE 4ABNA 4YVQC 1BU9A 3ASFA 5CGLA 1Z3XA 5HRYA 3AAAC 2WXHA 5KNHD 1TR4A 5CEDB 4OYSA 4IRUA 1AP7A 4TXPA 4AIFA 4J8SA 4UI9K 3UQ3A 3ASGA 4KBQA 2VGYA 4HI8A 1VDYA 3APDA 4WNEA 2WPVA 5FQ6A 1TJCA 1XNFA 5FQ7A 4U8VD 4I1OB 4L9PA 1BI7B 2WXNA 3ENEA 4L2YA 2BKGA 5JA4D 4N3AA 3ZYKA 2V4HC 4A1SA 3G2TA 3ZCBA 3N3UA 1V54E 3KSQA 1RW2A 4JL0A 4CZ2D 3FEYA 5ANRA 3ZU7B 5LOZA 1HF8A 1IQUA 1GW6A 2QZAA 3LDZA 2HE0A 3C3QA 3D9PA 1A17A 2ETCA 5FZQA 3CVVA 1IKND 4ILIA 2JEKA 4UQZA 4U0UA 5JJ7A 4EZJA 2KCLA 4I6EA 1NA3A 2Q7FA 3UT7A 3Q7FA 2WM9A 3ULQA 3HG0D 1ELKA 4G8KA 1A5EA 4LU4A 3TWWA 4TUMA 1QNFA 2EINE 2GRLA 3ZW3A 4X2CA 3DPDA 4G2VA 1E96B 4K5AB 4BETA 1N54A 3SHFA 5EU0A 5CMTA 5T8IA 4KMOA 4R7LA 1LF8A 4F1SA 3Q78A 3D9MA 1N94A 2VQ2A 2QYUA 5KJLA 2CHZA 3CHRA 4IULA 5JJTA 3G2UA 1HE8A 4RQIA 2RFAA 1U3CA 3CHQA 3Q9NC 4JHKA 4JW1A 3E34A 5AENA 4CT4A 3QARA 4I9CA 4F7AA 3BEEA 3IEGA 3L6AA 2XEVA 2WXFA 3SFYA 4JA9A 3ZPJA 3CVQA 4GCOA 4N3CA 1UG3A 3IBEA 2VSOE 1UOHA 5ITZF 5CECB 4DX1A 1S63A 2XGOA 3MX3A 4TRQA 5E76A 4XIFA 4KZ0A 3FP3A 4I6JA 2XRZA 2LAHA 1N9AA 4GMJA 3D9OA 4CGVA 3FTWA 3FUNA 3TXNA 4GA1A 2I2OA 3DXMG 4PY3A 3ZRHA 1QZ2A 2OOEA 3L82A 5BT1A 4FLHA 3B95A 3T8MA 4L2LA 3LS8A 3FUHA 3UPVA 4J6IA 1JCSA 4C0MA 2FEZA 1E8ZA 4Z68A 2WXKA 3MGBA 3V2XA 3RU0A 4U8YD 4WAFA 3K9IA 4APFA 2EIJE 3TL5A 4K03A 3JQ1A 4TXQA 2CG2A 2IU1A 3J5QB 4EBAA 4FJZA 4WWOA 4EBAG 3TWQA 2XRYA 4CDMA 1OWLA 1FT2A 5JJ6A 3CQCB 3CHSA 4I1MA 4X8QA 3QJZA 3SO8A 4J8EA 4GZ5A 3JYSA 2MYOA 2DYRE 3E4BA 4J8FA 4G23A 2P9KG 4U0ZA 4UWHA 4UWFA 1WDYA 2VGEA 4XEIG 3SY2A 2IEJA 4HXIA 4GB9A 2AW6A 4CDNA 2X6IA 4ATZD 1D8DA 4J8YA 2ZISA 3P1UA 4GYWA 1WAO1 2IOSA 4GU5A 2LXMA 1KPSB 3B7RL 1JUQA 3O4ZA 3EU5A 3FY4A 2ETBA 4HOQA 5CRVA 4NQ0A 4RLYA 4C48B 2R5SA 4DX6D 3TWUA 2ZXWE 3PNTB 5AARA 5ARFA 3Q4AB 3CV0A 4PS7A 4JHRA 2WXMA 1MQSA 3C3RA 4GYYA 3RIBA 3AU5A 4FADA 4F53A 1BLXB 4K5BA 1N52A 2E2EA 2JLBA 2X6HA 2Y1LE 2DCPA 5LCWC 4I1AA 5BUZA 3ULYA 2ZGGA 2R2LA 4BT9A 4BTBA 3DWLG 1K1BA 3Q79A 4HFGA 4XI0A 5EX3A 3MZLB 5AIJA 1EYHA 3IV0A 3TGOA 3KEZA 4GPKA 4LERA 4BY6A 1P5QA 3ZIMA 3CVXA 3APCA 3CR3A 4LNGA 3SBSA 1OWNA 2Y4UA 2WQHA 4RG6A 3S7JA 4BEPA 1Q2ZA 2UY1B 3CHPA 3EDTB 2L0TB 3FU3A 3U66A 1FVFA 2XPYA 4QFVA 2VGXB 3UIOC 5HQ8A 5B1AE 1B89A 4BSXA 4HOSA 4A63B 5FQ4A 4I43A 1IXVA 3NF1A 2OV8A 2HO1A 2KZTB 5D0QD 5BV0A 1OCCE 2AVPA 4DX5D 2Y69E 2WMOA 1XGWA 4F3VA 4M16A 2YINA 3FU5A 5FIOA 4GCNA 3RAUA 3MYVA 4U07A 4ANUA 5EDSA 4RVBA 1NFIE 1KT1A 2IFUA 4WNFA 4AJWA 3JXIA 3T5VA 4C0EA 4QQIA 2AWIA 3RO3A 3G2SA 3HDXA 4N67A 1SA5A 4DUIA 2XPZA 1W3BA 1UN9A 4B0ZA 2AXZA 4AP2A 2ZIRA 4GTSA 3DSXA 3L08A 4GTRA 2PL2A 3ZNGA 3SFZA 5ENTD 5G05J 4YVOA 4CYMD 2ZGDA 2DBAA 3FTSA 1SVXA 3GW4A 3LPZA 4EHMA 3WG7E 2LUHA 2CFZA 5D66A 4U0SA 1DVPA 4FJYA 3LETA 3ZUVB 1N4PA 1KT0A 2F8YA 3IXEA 3HXCA 4UWLA 1H2VC 3UKUG 3MKQB 3TWRA 3AG1E 2R17C 4DX2A 2C0LA 3ISMC 2NXPA 5CEAA 1OY3D 3NB2A 1IQRA 2WXJA 2J09A 3JUEA 2ONDA 3UINC 5ANLA 2B0OE 1E8XA 2YNQA 2NUDA 4J0UA 3PS6A 5BXUA 2WXLA 3FU6A 2KZTA 5EIDA 4DX7D 4LRZA 2J08A 4KVMA 3UM2A 1FCHA 1EDUA 3FH7A 3EHMA 3KAEA 3SZ7A 3ML9A 3FH8A 3EIJA 1O1TA 1MHQA 4J7WA 2QC9A 3LJNA 4E85A 3IHVA 4PUCA 3LVRE 4JEHA 2YHEA 4ANVA 4AV7A 4UUCA 1HFAA 3FHEA 3QWWA 1BI8B 2XZTG 4FA6A 4U95D 1HZ4A 4L7TA 5T3RA 2DZNA 3PZ4A 3SF4A 1HU3A 2QYJA 1QBQA 2QY7A 1JCRA 2R05A 2KXPC 2AJAA 3QDNA 2KM4A 4DLQA 5D2MC 3NQPA 4GMRA 3FFLA 2DIWA 2IF4A 3LKUA 3SFXA 3UT4A 3R7RA 3V31A 4LNBA 5CBOA 1G3NB 3FUMA 3DXKG 3HHMA 4TUUA 3C3OA 5ENNA 1E8YA 2V0PA 1NI1A 2LNIA 4HRNA 1HG2A 2GRQB 4U8HA 3EHNA 5B1BE 3D9IA 1EF1C 2X6KA 4YDYA 5AQ9A 1HS6A 4Q94A 1U3DA 2WB2A 5EX0A 3ZFWA 5LX8A 1S70B 3PDNA 4OVUA 1H19A 4TV3A 3ZYQA 3ZHEA 3FTYA 3PREA 2XS8A 3GZSA 1SW6A 1JCQA 3MKQA 2X6FA 3AG3E 4C9BB 3IHYA 4URKA 3GZ1A 2NSZA 4Y6WA 4KZCA 4BESA 4N5CA 3I5PA 1O1SA 3QOUA 3FUEA 3T5XA 1ZBPA 1V55E 4LEUA 3FTXA 4DRXE 2EILE 3ZGQA 3D9KA 5G55A 3ULEG 3TG4A 3B7TA 2VYIA 4IYPA 4RSYA 3LYAA 2LXLA 3ONLA 5B3SE 2GRPB 3F6QA 3T8KA 3HYMB 3NOCD 2MOWA 3W9GA 3MCXA 1OCRE 4O1PA 5AQ7A 3JXJA 4AVXA 4RG9A 2ETAA 2WXGA 3Q49B 2RKKA 5CRUA 3ZC7A 1TN8A 3Q5MA 2PQNA 1WY6A 4G25A 2OVBA 1NZNA 2BKKB 3PZ2A 1MYOA 3EHQA 3SNXA 4HOTA 1S64A 4CEMA 4L1BA 1RZ4A 4XKBA 2I9CA 4XI9A 1OT8A 2P58C 4GYOA 1UJJA 2VY3A 3CEQA 2DZOA 5AJLA 3MV2B 2EIKE 3PZ3A 4U04A 3S7BA 1N11A 2R59A 2XGMA 4DLOA 3GZ2A 2WMNA 2V8SE 3MKRA 4E6HA 3HXEA 2WQ6A 4FLBA 2OEWA 3ABME 5KJKA 2AXVA 4GTQA 4YDEA 4G11A 5FWQA 3I4GA 1ELRA 4ZHBA 4ME2A 1MZCA 2FF4A 1H6PA 2GRRB 2I1JA 2ILRA 2H6IA 3CKCA 4G8LA 2WVIA 1Z3YA 5BNWA 5JHAA 2IO3C 4ANXA 3D9JA 3CVLA 3QAQA 2FO1E 2FO7A 4N2SA 2VTBB 1PC2A 5CCMA 5EKQD 2Y4TA 1HXIA 2PNNA 5ENQD 4B94A 4LSZE 4O60A 4I2ZA 5CERB 5C1DA 3PZDA 3CVPA 1N4QA 3V30A 3BQOA 4WGJA 2VSYA 4U7EB 3Q7AA 2LSVA 3OXFA 4WNDA 5CCLA 1HH8A 1N4SA 2L6JA 3VTYA 4O6FA 4LNUD 1OCZE 3L54A 4ATGA 4U96D 2A5EA 3PVLA 4JD2G 2XCCA 4JC8A 4DJAA 2KC7A 3D9NA 3QC1A 3CUCA 3OXLA 1X5BA 2XZDG 3D9HA 2CHXA 4UQXA 3SI5A 3QB2A 2I1KA 4JPSA 3OTNA 5AJDA 2RG8A 2WXRA 2P9PG 5KCMA 1TEZA 2J4DA 5FT9A 3VLEA 2BEDA 3AG2E 1OWMA 3FTUA 3FULA 3ZVVA 2J4BA 2IONA 3V79K 3DEPA 3OAWA 4FULA 3DSUA 2C2LA 2LSUA 4JA7A 3AJIA 5EYPF 5KJMA 4EZLA 1FT1A 3CVYA 3TWTA 2VZAA 1MX2A 3NOGD 4J8DA 1NP7A 4XZ4A 3ASHA 3PUKA 3R7QA 4BX9A 5G05C 4XKCA 2VTBA 4ITRA 1DCQA 4PDXA 4Y6CA 3PE4A 3QNKA 1N95A 3CK9A 4UQYA 4ACKA 1TN6A 2IJGX 2GRMA 4OAUC 3RRMB 2PQRA 4KT6B 2E0IA 4GMLA 4B8CB 4B89A 3EUVA 4K5CA 2P9IG 5AQAA 5HS0A 2FI7A 4YDOA 3L13A 3UXGA 5AYWD 2P2CP 4YDWA 3UMVA 4NRHB 3DBSA 5FZRA 3FEXA 4CDRA 4EZKA 3TXMA 4LUNU 1JWFA 3DSWA 3QKYA 3HIZA 3C5RA 3LCAA 4GAAA 4AM9A 4F6RD 1IYGA 4O1OA 4BTAA 2XEEA 4GZCA 4A55A 2RD0A 4GTTA 4MLPA 2KATA 3ZLMA 4EPZA 4N5QA 5FZSA 4ANWA 3BUAA 2G03A 1ZB1A 3MA5A 4JB8P 4OVVA 2ZU6B 4JXTA 5JMND 2LAIA 3EHRA 3ONKA 2NC9A 3G2VA 4PS3A 2GROB 3FU0A 3UT8A 1E8WA 4B8AA 3FH5A 2HM8A 3E33A 3TWVA 4HRLA 4DK5A 2J49A 4GA0A 2Y0BG 4G26A 2OCCE 3PZ1A 4AY6A 2C0MA 2UY1A 5G04C 2FULA 3NZUA 1Y6IA 3ASNE 4WWNA 1H2UA 4AY5A 2PM7A 3ZN3A 1SZ9A 1TJFA 4UWKA 3NBNB 4PH4B 4EECA 2V4LA 3PEVB 3ESKA 4DPRA 5EN5D 4NPSA 1ZU2A 1O5MA 4GA2A 3WXXA 2VGXA 1N0RA 1OUVA 4ZFHA 2P9LG 4MBGA 1JWGA 2H6HA 3MEKA 1O1RA 5AAOA 3D9LA 1U2VG 3KS2A 2WXQA 2QFCA 1OCOE 2XGSA 3PNLB 4ACLA 3OXGA 2RFMA 2PZIA 2H6GA 1H6KA 3B7BA 3CVNA 2EQXA 3LEWA 3AS8A 1WM5A 3B7UX 4AEZC 1Z5SC 4ILHB 4M3OA 2PM6A 5G04J 1D9SA 3LY7A
chains in the Genus database with same CATH topology
4HLEA 4GYYA 2J07A 4AVXA 3RIBA 3GYZA 4RG9A 2WXGA 3Q49B 3AU5A 4FADA 4ILGA 5DIZA 5A23A 4F53A 1IHGA 3ZC7A 5CHEE 4X2EA 3QWPA 3RK6A 1N52A 4BFRA 5C2YA 2E2EA 2PQNA 2IOLA 3AU4A 3EIQC 2JLBA 1WY6A 3Q5MA 3ZXSA 2X6HA 4G25A 3S2AA 1E7UA 3RRUA 2DCPA 5LCWC 4L23A 5M72A 4I1AA 4BWRA 3TAXA 5BUZA 2VJ8A 2OVBA 3EJNA 4HVBA 1INZA 2GW1A 1UJKA 3ZYLA 1NZNA 2JK8A 1DNPA 4BT9A 3UX4A 3L22A 3IKOB 4U63A 3FUFA 4BTBA 1HG5A 3JQ0A 3Q47B 3CGHA 4XI8A 3CKBA 3SNXA 4HOTA 4CEMA 3TJPA 3C98A 4I2WA 4KVOA 5D0OD 4L1BA 4A3TA 4XKBA 4CCAA 2I9CA 3L16A 4HFGA 4NURA 3SE5A 4XI9A 5G2NA 2P58C 2X3MA 5T4YA 3S7DA 4XI0A 4GYOA 4MRUA 1UJJA 3RKVA 2VY3A 5EX3A 3CEQA 4EQFA 3MZLB 5AIJA 4AXHA 5AJLA 3MV2B 5A7DB 1Z6TA 1EYHA 3IV0A 3TGOA 3KEZA 4N3BA 2AXUA 3VTXA 4GPKA 4U04A 4LERA 3JUIA 3S7BA 1PY1A 2M63A 4BY6A 2R59A 1P5QA 2OVFA 2XGMA 2WQ7A 2A4ZA 3ZIMA 4FU3A 4UI9C 3GZ2A 4DLOA 3CVXA 3APCA 2WMNA 2V8SE 5HI7A 3MKRA 3VLDA 3O48A 4Q96A 4E6HA 3QK0A 3CR3A 4P29A 3SBSA 4NACA 3HVEB 1OWNA 4H7YA 3TG5A 4DI4A 2Y4UA 2WQHA 2WQ6A 3CHMA 4RG6A 3S7JA 4FLBA 4MKTA 4G1TA 3CVWA 3PE3A 5KJKA 2AXVA 3S7FA 4N39A 2UY1B 3CHPA 2L0IA 4G11A 5FWQA 3EDTB 2BTDA 3I4GA 3CK7A 1ELRA 3N71A 3ZHEB 4GZ6A 4ME2A 2FF4A 3B13A 5LFAA 4JVSA 4D10C 2L0TB 4XX5A 3FU3A 3FUDA 2A5UA 2I1JA 2ILRA 3FDHA 3U66A 1FVFA 4I6GA 2XPYA 3CKCA 2XHEA 4GZ3A 4QFVA 3MV3B 3LJ3A 1HO8A 2WVIA 5JFFA 1Z3YA 1UW4B 5FTPA 1KLXA 2VGXB 2X6JA 4I9EA 5BNWA 3RJVA 3SGHA 5JHAA 5HQ8A 1B89A 2FBNA 4BSXA 5J90A 4HOSA 5FQ4A 2YHCA 3D9JA 3CVLA 4I43A 4ANXA 3QAQA 3SN9A 3FWVA 1OWPA 2MRIA 2FO7A 3NF1A 4N2SA 2VTBB 1PC2A 3FTZA 2OV8A 3CLJA 2HO1A 2GGFA 2KZTB 2XPIA 3G2WA 3LY8A 5CCMA 4HOUA 5CKLA 5D0QD 1E90A 4MS6A 5BV0A 2VSXE 4ABNA 2AVPA 3PEUB 4YVQC 5EKQD 2Y4TA 3ASFA 1HXIA 4IN3B 5CGLA 3U64A 1Z3XA 4B94A 4DI3A 1H2TC 2WXHA 4I2ZA 2WMOA 3P2BA 4UI9J 5C1DA 5E75A 1XGWA 4F3VA 4M16A 4OYSA 2YINA 3FUKA 3FU5A 4IRUA 4WNGA 2KCVA 3PZDA 4GCNA 4AIFA 3CVPA 3MYVA 4U07A 4J8SA 1OWOA 4ANUA 5EDSA 4RVBA 4UI9K 3UQ3A 3ASGA 2XQ0A 1KT1A 4XE0A 4WGJA 4W9RA 2IFUA 2VSYA 2WXIA 4KBQA 2VGYA 4WNFA 3RO2A 4AJWA 1VDYA 3APDA 2LSVA 4GZDA 3OXFA 4WNEA 4WNDA 2WPVA 3T5VA 5CCLA 1HH8A 2L6JA 3PH0C 5FQ6A 4C0EA 1TJCA 1XNFA 5FQ7A 4I1OB 2CG3A 3S6AA 2AWIA 3RO3A 3G2SA 3HDXA 2WXNA 3ENEA 4N67A 4L2YA 3VTYA 2CHWA 4FHJA 5BW8C 3VLFA 5BPPA 3APFA 4N3AA 2XPZA 4O6FA 3ZYKA 4A1SA 1W3BA 1UN9A 5JHBA 3L54A 4B0ZA 2AXZA 4AP2A 4ATGA 3FUIA 3G2TA 3PVLA 3ZCBA 3N3UA 2XCCA 3L08A 4JC8A 4JL0A 2PL2A 3FEYA 4CRWA 5ANRA 2I6HA 4DJAA 1L5JA 2KC7A 5LOZA 5BV1A 1HF8A 1IQUA 1GW6A 3D9NA 3QC1A 3CUCA 3SFZA 1FVHA 3SD5A 2WXOA 3ZYMA 5G05J 3OXLA 1X5BA 3LDZA 4YVOA 5FJYA 2HYZA 1A17A 3D9PA 2CHXA 3CIAA 4UQXA 3SI5A 3QB2A 2DBAA 5FZQA 3FTSA 3GW4A 3LPZA 3CVVA 2I1KA 3NZSA 3SHGA 2JEKA 4U0UA 4ILIA 4JPSA 4UQZA 4AOFA 3OTNA 5LP0A 2CFZA 5AJDA 4U0SA 5JJ7A 2WXRA 2RG8A 1DVPA 2KCLA 4FJYA 4EZJA 2HR2A 4I6EA 5KCMA 1TEZA 1NA3A 2Q7FA 3UT7A 2WM9A 3LETA 2J4DA 5FT9A 3ULQA 1ELKA 5KJNA 3VLEA 1KT0A 3CSFA 4LU4A 2MHKA 3Q15A 1QNFA 1OWMA 2GRLA 3LY7A 4KXKB 3FTUA 3FULA 4UWLA 4N2QA 3ZVVA 2J4BA 3BG1B 3ZW3A 4HORA 2IONA 4X2CA 1H2VC 3DPDA 3LXUX 4G2VA 1E96B 3SBTB 3HVEA 1N54A 3ML8A 3OAWA 4FULA 3SHFA 5EU0A 5CMTA 5T8IA 2C2LA 3MKQB 2LSUA 4JA7A 4A3VA 5KJMA 4EZLA 4KMOA 4R7LA 1LF8A 4V3IA 4F1SA 3CVYA 3D9MA 3AS4A 2VZAA 2VQ2A 2R17C 2C0LA 4J8DA 1NP7A 3KD7A 2NXPA 4XZ4A 5KJLA 2CHZA 2WXPA 3CHRA 4IULA 5JJTA 2KCKA 3ASHA 3PUJA 3G2UA 1IQRA 3PUKA 2WXJA 2J09A 1HE8A 3R7QA 4FP7A 1U3CA 3UUXA 3ASDA 3CHQA 2F6SA 5DBKA 4JHKA 2ONDA 3LY9A 4JW1A 3MJWA 5ANLA 4G24A 3B7SA 1E8XA 4CT4A 5AENA 2YNQA 4J0UA 4BX9A 3PS6A 5G05C 3QARA 1H0AA 4XKCA 2WXLA 2VTBA 3FU6A 4I9CA 4ITRA 4F7AA 4PDXA 2KZTA 4Y6CA 3PE4A 2Y3AA 3QNKA 3BEEA 3IEGA 3L6AA 3CK9A 4LRZA 4UQYA 4ACKA 2J08A 4KVMA 2XEVA 2WXFA 2IJGX 1FCHA 1EDUA 2GRMA 3RRMB 4JA9A 2PQRA 3FH7A 4KT6B 2E0IA 3ZPJA 3EHMA 2UWJG 3KAEA 3CVQA 4GMLA 3SZ7A 4GCOA 4BT8A 4B8CB 4N3CA 3ML9A 4I17A 4B89A 3FH8A 2FI7A 3EIJA 1UG3A 3IBEA 3L13A 4X2DA 2VSOE 1MHQA 4E85A 5AYWD 3IHVA 4PUCA 4BX8A 3LVRE 4JEHA 2YHEA 2XGOA 3MX3A 5E76A 4TRQA 4XIFA 4ANVA 4AV7A 4KZ0A 3FP3A 3UMVA 4NRHB 4I6JA 1HFAA 2XRZA 3FHEA 3QWWA 3ESLA 1Y8MA 3DBSA 5FZRA 4JEUA 4A1GA 2LAHA 4GMJA 3D9OA 4CGVA 1PAQA 4FA6A 3FEXA 4CDRA 4EZKA 2BF0X 1S0PA 3FTWA 3FUNA 3TXMA 2LO6A 4LUNU 3TXNA 5JFZA 1HZ4A 3AS5A 4GA1A 1JWFA 2I2OA 3QWVA 4PY3A 4L7TA 5T3RA 3ZRHA 3SF4A 3QKYA 1HU3A 3HIZA 4FC8A 1QZ2A 2OOEA 4KYOB 2CFUA 5BT1A 2IQCA 2QY7A 3LCAA 4FLHA 4GAAA 3QDNA 4WWPA 4WUYA 2KM4A 4AM9A 1IYGA 4DLQA 2BUGA 1EPUA 3NQPA 3FFLA 4BTAA 4L2LA 1QQEA 2DIWA 3LS8A 3T8MA 2IF4A 3FUHA 2YQ8A 3LKUA 4GZCA 4J6IA 3U4TA 3UPVA 4C0MA 4A55A 2FEZA 1E8ZA 3UT4A 2WXKA 3MGBA 4APOA 2RD0A 3RU0A 4WAFA 4JZYA 4MLPA 5CMYA 2KATA 3ZLMA 3R7RA 4EPZA 3CSTA 3K9IA 5FZSA 1SQMA 3L17A 4ANWA 4APFA 1YA0A 4UWGA 2G03A 3FUMA 3TL5A 1UN8A 3MA5A 4OVVA 3HHMA 3FUJA 4K03A 4TUUA 3JQ1A 3RRNB 2ZU6B 4JXTA 5ENNA 1E8YA 4CGWA 1JPLA 2CG2A 4CT0A 1BPOA 2V0PA 2LNIA 2IU1A 3CQGB 4EBAA 2LAIA 1HG2A 3D3MA 4FJZA 3BG0B 3ONKA 3EHNA 4U8HA 4WWOA 4EBAG 2NC9A 3G2VA 3D9IA 4PS3A 3FU0A 2XRYA 3UT8A 1EF1C 4H7XA 1E8WA 4CDMA 2X6KA 4B8AA 3FH5A 2HM8A 4DK5A 1OWLA 3U9WA 5JJ6A 1HS6A 2J49A 3CQCB 4GA0A 1U3DA 4Q94A 2WB2A 3CHSA 5EX0A 3CK8A 4I1MA 3ZFWA 5LX8A 1E7VA 2X38A 3PDNA 3QJZA 4G26A 4OVUA 4AY6A 2C0MA 2UY1A 5G04C 1H19A 4TV3A 2FULA 3NZUA 4J8EA 4GZ5A 1Y6IA 3JYSA 4WWNA 3ZYQA 2XCBA 3ZHEA 1H2UA 4AY5A 2PM7A 3FTYA 3ZN3A 3PREA 1SZ9A 3E4BA 1TJFA 4J8FA 4UWKA 4G23A 3GZSA 4PH4B 4U0ZA 2J9QA 5A6CA 4UWHA 3MKQA 4UWFA 4EECA 2V4LA 4HS2A 3PEVB 2X6FA 3FTVA 3ESKA 4JHJA 4LCTA 4DPRA 3JCKC 5LCWJ 4C9BB 4HXIA 4GB9A 5CMWA 4NPSA 1ZU2A 4GA2A 3WXXA 2AW6A 2VGXA 3CVUA 3URZA 4CDNA 3IHYA 1OUVA 4URKA 2X6IA 3GZ1A 2NSZA 4Y6WA 4KZCA 1JWGA 4N5CA 3I5PA 3MEKA 4YNDA 4PS8A 3D9LA 3ZEFA 3P1UA 3QOUA 4GYWA 1WAO1 3KS2A 2WXQA 3FUEA 2IOSA 2QFCA 2XGSA 3PNLB 4GU5A 1HX8A 3T5XA 3I3NA 1ZBPA 2V5FA 2VSNA 4ACLA 5J08A 3OXGA 3B7RL 2L9BA 4LEUA 3FTXA 3ZGQA 1JUQA 3O4ZA 2PZIA 3D9KA 3FY4A 5G55A 4FHKA 4HOQA 3TG4A 1H6KA 3B7TA 3I4RB 1NA0A 5ARGA 2VYIA 3CVNA 4IYPA 2EQXA 3LEWA 4NQ0A 4RSYA 3AS8A 3LYAA 5FQ8A 1WM5A 3U3WA 2R5SA 3ONLA 3CHOA 3R9AB 3LVQE 3PNTB 3B7UX 4Q69A 5ARFA 4AEZC 1ELWA 3Q4AB 3PRZA 4ILHB 3CV0A 4PS7A 3HYMB 4M3OA 4K0RA 2MOWA 2PM6A 5G04J 3MCXA 4JHRA 2WXMA 1SZAA 1MQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GYY A;  3RIB A;  3GYZ A;  4RG9 A;  3Q49 B;  5DIZ A;  1IHG A;  3ZC7 A;  5CHE E;  4X2E A;  3QWP A;  2E2E A;  2PQN A;  3Q5M A;  2JLB A;  4G25 A;  5LCW C;  5M72 A;  4I1A A;  4BWR A;  3TAX A;  2GW1 A;  1NZN A;  2JK8 A;  4BT9 A;  4BTB A;  3Q47 B;  4XI8 A;  3CKB A;  4HOT A;  4I2W A;  5D0O D;  3SE5 A;  4XI9 A;  3S7D A;  2P58 C;  4XI0 A;  4GYO A;  3RKV A;  2VY3 A;  5EX3 A;  3CEQ A;  4EQF A;  3MV2 B;  5A7D B;  3TGO A;  4N3B A;  3VTX A;  4GPK A;  4U04 A;  3S7B A;  1P5Q A;  2XGM A;  4UI9 C;  3GZ2 A;  5HI7 A;  3MKR A;  3O48 A;  4H7Y A;  3TG5 A;  2Y4U A;  2WQH A;  4RG6 A;  3S7J A;  4G1T A;  3PE3 A;  5KJK A;  3S7F A;  4N39 A;  2UY1 B;  3EDT B;  3CK7 A;  1ELR A;  3N71 A;  3ZHE B;  4GZ6 A;  4ME2 A;  2FF4 A;  3CKC A;  4GZ3 A;  3MV3 B;  5JFF A;  5FTP A;  1KLX A;  2VGX B;  4I9E A;  5BNW A;  3RJV A;  5HQ8 A;  1B89 A;  2FBN A;  4HOS A;  2YHC A;  3CVL A;  3SN9 A;  3FWV A;  2FO7 A;  3NF1 A;  4N2S A;  1PC2 A;  2HO1 A;  2XPI A;  3LY8 A;  5CCM A;  4HOU A;  5CKL A;  5D0Q D;  4ABN A;  2AVP A;  4YVQ C;  5EKQ D;  2Y4T A;  3ASF A;  1HXI A;  4IN3 B;  5CGL A;  4B94 A;  4I2Z A;  4UI9 J;  5C1D A;  4F3V A;  4M16 A;  4WNG A;  2KCV A;  4GCN A;  4AIF A;  3CVP A;  4U07 A;  4UI9 K;  3UQ3 A;  3ASG A;  1KT1 A;  4WGJ A;  4W9R A;  2IFU A;  2VSY A;  4KBQ A;  2VGY A;  4WNF A;  3RO2 A;  2LSV A;  3OXF A;  4WNE A;  4WND A;  2WPV A;  5CCL A;  1HH8 A;  2L6J A;  1TJC A;  1XNF A;  3S6A A;  3RO3 A;  4N67 A;  3VTY A;  5BW8 C;  4N3A A;  4O6F A;  4A1S A;  1W3B A;  3ZCB A;  3N3U A;  2XCC A;  4JL0 A;  2PL2 A;  2I6H A;  2KC7 A;  3CUC A;  5G05 J;  3OXL A;  4YVO A;  5FJY A;  2HYZ A;  1A17 A;  4UQX A;  2DBA A;  5FZQ A;  3GW4 A;  3LPZ A;  3SHG A;  4UQZ A;  4U0U A;  4U0S A;  5JJ7 A;  2KCL A;  2HR2 A;  1NA3 A;  2Q7F A;  3LET A;  5FT9 A;  3ULQ A;  5KJN A;  1KT0 A;  4LU4 A;  2MHK A;  3Q15 A;  4KXK B;  4N2Q A;  4HOR A;  4X2C A;  4G2V A;  1E96 B;  5EU0 A;  5CMT A;  2C2L A;  2LSU A;  4JA7 A;  5KJM A;  3AS4 A;  2VZA A;  2VQ2 A;  2C0L A;  4J8D A;  3KD7 A;  5KJL A;  5JJT A;  2KCK A;  3ASH A;  3UUX A;  3ASD A;  2F6S A;  5DBK A;  2OND A;  3LY9 A;  4G24 A;  4J0U A;  5G05 C;  4I9C A;  4ITR A;  4Y6C A;  3PE4 A;  3BEE A;  3IEG A;  3CK9 A;  4UQY A;  2XEV A;  1FCH A;  4JA9 A;  2PQR A;  3ZPJ A;  2UWJ G;  3KAE A;  3CVQ A;  3SZ7 A;  4GCO A;  4BT8 A;  4N3C A;  4I17 A;  2FI7 A;  4X2D A;  5AYW D;  2XGO A;  4XIF A;  3FP3 A;  4NRH B;  3QWW A;  1Y8M A;  5FZR A;  4CGV A;  4CDR A;  5JFZ A;  1HZ4 A;  3AS5 A;  4GA1 A;  3QWV A;  4PY3 A;  3SF4 A;  3QKY A;  4KYO B;  1QZ2 A;  2OOE A;  5BT1 A;  3LCA A;  3QDN A;  4WUY A;  4AM9 A;  1IYG A;  2BUG A;  3FFL A;  4BTA A;  1QQE A;  2IF4 A;  3UPV A;  2YQ8 A;  3LKU A;  3U4T A;  2FEZ A;  4APO A;  3RU0 A;  2KAT A;  3ZLM A;  5FZS A;  3K9I A;  1YA0 A;  2G03 A;  3MA5 A;  4CGW A;  2LNI A;  2NC9 A;  4H7X A;  5JJ6 A;  4GA0 A;  5EX0 A;  3CK8 A;  3ZFW A;  3PDN A;  4G26 A;  4AY6 A;  2C0M A;  2UY1 A;  5G04 C;  4J8E A;  4GZ5 A;  3JYS A;  2XCB A;  3ZHE A;  4AY5 A;  3ZN3 A;  3E4B A;  4J8F A;  4G23 A;  4U0Z A;  2J9Q A;  5A6C A;  3ESK A;  5LCW J;  4NPS A;  1ZU2 A;  4GA2 A;  3WXX A;  2VGX A;  3URZ A;  1OUV A;  3GZ1 A;  4Y6W A;  4N5C A;  3MEK A;  4YND A;  3QOU A;  4GYW A;  1WAO 1;  3KS2 A;  2QFC A;  2XGS A;  1ZBP A;  2V5F A;  2VSN A;  3OXG A;  4LEU A;  3ZGQ A;  2PZI A;  4HOQ A;  3TG4 A;  1NA0 A;  5ARG A;  2VYI A;  3CVN A;  4NQ0 A;  3AS8 A;  3LYA A;  1WM5 A;  3U3W A;  2R5S A;  3R9A B;  5ARF A;  1ELW A;  3Q4A B;  3CV0 A;  3HYM B;  5G04 J;  4JHR A;  3LY7 A; 
#chains in the Genus database with same CATH topology
 4HLE A;  2J07 A;  4GTP A;  3SQV A;  5A23 A;  1IHG A;  1H6O A;  5CHE E;  4X2E A;  3QWP A;  3RK6 A;  4BFR A;  3S2A A;  5ENR D;  1OXJ A;  4L23 A;  1LD7 A;  5M72 A;  3TAX A;  1DNP A;  2P9U G;  3UX4 A;  3IKO B;  3FUF A;  1HG5 A;  3JQ0 A;  3CGH A;  4XI8 A;  3CKB A;  4KVO A;  5D0O D;  4OAV B;  4CCA A;  4NUR A;  3SE5 A;  5G2N A;  4MRU A;  3RKV A;  4HI9 A;  4EQF A;  1K1A A;  5A7D B;  1YCS B;  4N3B A;  4NIK A;  3VTX A;  2DYS E;  3ABL E;  3JUI A;  1PY1 A;  2EIM E;  2P9S G;  2OVF A;  2A4Z A;  4FU3 A;  4UI9 C;  3DRA A;  2DVW A;  4Q96 A;  2JAB A;  4P29 A;  4NAC A;  3HVE B;  3TG5 A;  4DI4 A;  4G1T A;  3RSE G;  3CVW A;  5ENS D;  2BTD A;  3UTM A;  3CK7 A;  5LFA A;  4JVS A;  2F0Y A;  4D10 C;  3FUD A;  2A5U A;  4I6G A;  4GZ3 A;  3MV3 B;  3LJ3 A;  1HO8 A;  1UW4 B;  1IHB A;  1KLX A;  5FTP A;  3SGH A;  2FBN A;  1TNZ A;  5KBA A;  1KZP A;  3SN9 A;  3FWV A;  3FTZ A;  3CLJ A;  2XPI A;  5CBN A;  4HOU A;  1E90 A;  4MS6 A;  3HXB A;  3PEU B;  4IN3 B;  3U64 A;  4DI3 A;  1H2T C;  3P2B A;  4UI9 J;  3DST A;  3KSL A;  3UKR G;  5E75 A;  4HBD A;  4M7C A;  3FUK A;  4WNG A;  2KCV A;  3EU9 A;  1OWO A;  2XQ0 A;  4XE0 A;  4W9R A;  2WXI A;  3RO2 A;  4GZD A;  3ASO E;  3DSV A;  2NUN A;  3PH0 C;  2IO2 C;  2H6F A;  2CG3 A;  3S6A A;  2R02 A;  2CHW A;  4FHJ A;  5BW8 C;  3VLF A;  5BPP A;  3APF A;  5JHB A;  2IY0 C;  3FUI A;  4HNA D;  4CRW A;  1KZO A;  2I6H A;  1L5J A;  5BV1 A;  1DC2 A;  1N4R A;  3DSS A;  3UI2 A;  1FVH A;  3SD5 A;  2WXO A;  3AG4 E;  3ZYM A;  3E37 A;  5FJY A;  2HYZ A;  3CIA A;  3NZS A;  3SHG A;  5LP0 A;  4AOF A;  1MX6 A;  2HR2 A;  3NAW A;  3ZKJ A;  5KJN A;  1DCE A;  3CSF A;  4HRM B;  2MHK A;  3Q15 A;  4KXK B;  4N2Q A;  3BG1 B;  4HOR A;  3LXU X;  3SBT B;  3HVE A;  3ML8 A;  4BSZ B;  2KBX A;  4A3V A;  4V3I A;  3AS4 A;  5EYL A;  1LD8 A;  3KD7 A;  4F1P A;  2WXP A;  1X81 A;  2KCK A;  3PUJ A;  1K3Z D;  4FP7 A;  3UUX A;  3ASD A;  2F6S A;  5DBK A;  3LY9 A;  3MJW A;  4G24 A;  3B7S A;  4GTM A;  3HXD A;  4HQD A;  1H0A A;  3R9M A;  3Q9U C;  2Y3A A;  1TNB A;  3T9K A;  2UWJ G;  4GTO A;  4BT8 A;  4I17 A;  4X2D A;  3HRA A;  4BX8 A;  1TNO A;  2XEH A;  3ESL A;  1Y8M A;  5H7P A;  4JEU A;  5ENO D;  4A1G A;  1PAQ A;  2P9N G;  2BF0 X;  5ENP D;  1S0P A;  1MJ0 A;  2GRN B;  2LO6 A;  4GTV A;  5JFZ A;  3AS5 A;  2V5Q C;  3QWV A;  3C72 A;  4KYO B;  4FC8 A;  2CFU A;  5BXO A;  2IQC A;  4WWP A;  4WUY A;  2BUG A;  1EPU A;  3HXF A;  3ABK E;  2F37 A;  1QQE A;  5FIN A;  2YQ8 A;  3U4T A;  4APO A;  3UM3 A;  3BU8 A;  4JZY A;  5CMY A;  2OEV A;  3CST A;  2DWZ A;  1SQM A;  3L17 A;  1YA0 A;  4UWG A;  1UN8 A;  1BD8 A;  3DEO A;  3FUJ A;  1TYQ G;  2B6C A;  3RRN B;  3TWS A;  3Q73 A;  4CGW A;  1JPL A;  4CT0 A;  1SA4 A;  3KEA A;  1BPO A;  3CQG B;  5EIL A;  3D3M A;  1YMP A;  3BG0 B;  4H7X A;  3U9W A;  3CK8 A;  1E7V A;  2X38 A;  5IY5 E;  3ZXP A;  3TWX A;  2XCB A;  4BER A;  2XEN A;  1D8E A;  1FPP A;  3UM0 A;  2J9Q A;  5A6C A;  4B93 B;  3X2Q E;  1N0Q A;  4HS2 A;  4JHJ A;  3E30 A;  3FTV A;  4LCT A;  3JCK C;  5LCW J;  5CMW A;  3CVU A;  4GPM A;  3URZ A;  4HLL A;  4YND A;  4PS8 A;  3ZEF A;  1HX8 A;  3Q75 A;  3I3N A;  3W9F A;  3DPY A;  2V5F A;  2VSN A;  5J08 A;  1K8K G;  2L9B A;  4FHK A;  1TN7 A;  3I4R B;  1MX4 A;  1NA0 A;  5ARG A;  5FQ8 A;  3U3W A;  3CHO A;  3R9A B;  3LVQ E;  4Q69 A;  1ELW A;  3PRZ A;  1YYH A;  5AQB A;  4K0R A;  4HB5 A;  1SZA A;  1QYM A;  3UM1 A;  3GYZ A;  4ILG A;  5DIZ A;  5AN8 A;  5KWD A;  1WG0 A;  5C2Y A;  3EIQ C;  3AU4 A;  2IOL A;  2L6B A;  3ZXS A;  1E7U A;  3RRU A;  4TXR A;  1LTX A;  4BWR A;  2VJ8 A;  5KNG A;  3EJN A;  4HVB A;  1INZ A;  2GW1 A;  4LG6 A;  1UJK A;  3ZYL A;  2JK8 A;  3J5P A;  3L22 A;  5EIB E;  4U63 A;  1TNU A;  5HKP A;  3Q47 B;  1NL4 A;  3TJP A;  3C98 A;  4I2W A;  4A3T A;  3L16 A;  3L9T A;  3S7D A;  2X3M A;  2XS1 A;  5T4Y A;  4AXH A;  1Z6T A;  2R03 A;  2AXU A;  1NH1 A;  2M63 A;  2WQ7 A;  5HI7 A;  2J8S D;  3O48 A;  3VLD A;  3QK0 A;  2F8X K;  2NYJ A;  4H7Y A;  3CHM A;  4MKT A;  3PE3 A;  3S7F A;  4N39 A;  2L0I A;  3N71 A;  3ZHE B;  4GZ6 A;  3B13 A;  4XX5 A;  1AWC B;  3UIP C;  3FDH A;  2XHE A;  5JFF A;  2X6J A;  4I9E A;  3RJV A;  5J90 A;  2YHC A;  1TNY A;  3V2O A;  1OWP A;  2MRI A;  3E32 A;  2GGF A;  3G2W A;  3LY8 A;  5CKL A;  2VSX E;  4ABN A;  4YVQ C;  1BU9 A;  3ASF A;  5CGL A;  1Z3X A;  5HRY A;  3AAA C;  2WXH A;  5KNH D;  1TR4 A;  5CED B;  4OYS A;  4IRU A;  1AP7 A;  4TXP A;  4AIF A;  4J8S A;  4UI9 K;  3UQ3 A;  3ASG A;  4KBQ A;  2VGY A;  4HI8 A;  1VDY A;  3APD A;  4WNE A;  2WPV A;  5FQ6 A;  1TJC A;  1XNF A;  5FQ7 A;  4U8V D;  4I1O B;  4L9P A;  1BI7 B;  2WXN A;  3ENE A;  4L2Y A;  2BKG A;  5JA4 D;  4N3A A;  3ZYK A;  2V4H C;  4A1S A;  3G2T A;  3ZCB A;  3N3U A;  1V54 E;  3KSQ A;  1RW2 A;  4JL0 A;  4CZ2 D;  3FEY A;  5ANR A;  3ZU7 B;  5LOZ A;  1HF8 A;  1IQU A;  1GW6 A;  2QZA A;  3LDZ A;  2HE0 A;  3C3Q A;  3D9P A;  1A17 A;  2ETC A;  5FZQ A;  3CVV A;  1IKN D;  4ILI A;  2JEK A;  4UQZ A;  4U0U A;  5JJ7 A;  4EZJ A;  2KCL A;  4I6E A;  1NA3 A;  2Q7F A;  3UT7 A;  3Q7F A;  2WM9 A;  3ULQ A;  3HG0 D;  1ELK A;  4G8K A;  1A5E A;  4LU4 A;  3TWW A;  4TUM A;  1QNF A;  2EIN E;  2GRL A;  3ZW3 A;  4X2C A;  3DPD A;  4G2V A;  1E96 B;  4K5A B;  4BET A;  1N54 A;  3SHF A;  5EU0 A;  5CMT A;  5T8I A;  4KMO A;  4R7L A;  1LF8 A;  4F1S A;  3Q78 A;  3D9M A;  1N94 A;  2VQ2 A;  2QYU A;  5KJL A;  2CHZ A;  3CHR A;  4IUL A;  5JJT A;  3G2U A;  1HE8 A;  4RQI A;  2RFA A;  1U3C A;  3CHQ A;  3Q9N C;  4JHK A;  4JW1 A;  3E34 A;  5AEN A;  4CT4 A;  3QAR A;  4I9C A;  4F7A A;  3BEE A;  3IEG A;  3L6A A;  2XEV A;  2WXF A;  3SFY A;  4JA9 A;  3ZPJ A;  3CVQ A;  4GCO A;  4N3C A;  1UG3 A;  3IBE A;  2VSO E;  1UOH A;  5ITZ F;  5CEC B;  4DX1 A;  1S63 A;  2XGO A;  3MX3 A;  4TRQ A;  5E76 A;  4XIF A;  4KZ0 A;  3FP3 A;  4I6J A;  2XRZ A;  2LAH A;  1N9A A;  4GMJ A;  3D9O A;  4CGV A;  3FTW A;  3FUN A;  3TXN A;  4GA1 A;  2I2O A;  3DXM G;  4PY3 A;  3ZRH A;  1QZ2 A;  2OOE A;  3L82 A;  5BT1 A;  4FLH A;  3B95 A;  3T8M A;  4L2L A;  3LS8 A;  3FUH A;  3UPV A;  4J6I A;  1JCS A;  4C0M A;  2FEZ A;  1E8Z A;  4Z68 A;  2WXK A;  3MGB A;  3V2X A;  3RU0 A;  4U8Y D;  4WAF A;  3K9I A;  4APF A;  2EIJ E;  3TL5 A;  4K03 A;  3JQ1 A;  4TXQ A;  2CG2 A;  2IU1 A;  3J5Q B;  4EBA A;  4FJZ A;  4WWO A;  4EBA G;  3TWQ A;  2XRY A;  4CDM A;  1OWL A;  1FT2 A;  5JJ6 A;  3CQC B;  3CHS A;  4I1M A;  4X8Q A;  3QJZ A;  3SO8 A;  4J8E A;  4GZ5 A;  3JYS A;  2MYO A;  2DYR E;  3E4B A;  4J8F A;  4G23 A;  2P9K G;  4U0Z A;  4UWH A;  4UWF A;  1WDY A;  2VGE A;  4XEI G;  3SY2 A;  2IEJ A;  4HXI A;  4GB9 A;  2AW6 A;  4CDN A;  2X6I A;  4ATZ D;  1D8D A;  4J8Y A;  2ZIS A;  3P1U A;  4GYW A;  1WAO 1;  2IOS A;  4GU5 A;  2LXM A;  1KPS B;  3B7R L;  1JUQ A;  3O4Z A;  3EU5 A;  3FY4 A;  2ETB A;  4HOQ A;  5CRV A;  4NQ0 A;  4RLY A;  4C48 B;  2R5S A;  4DX6 D;  3TWU A;  2ZXW E;  3PNT B;  5AAR A;  5ARF A;  3Q4A B;  3CV0 A;  4PS7 A;  4JHR A;  2WXM A;  1MQS A;  3C3R A;  4GYY A;  3RIB A;  3AU5 A;  4FAD A;  4F53 A;  1BLX B;  4K5B A;  1N52 A;  2E2E A;  2JLB A;  2X6H A;  2Y1L E;  2DCP A;  5LCW C;  4I1A A;  5BUZ A;  3ULY A;  2ZGG A;  2R2L A;  4BT9 A;  4BTB A;  3DWL G;  1K1B A;  3Q79 A;  4HFG A;  4XI0 A;  5EX3 A;  3MZL B;  5AIJ A;  1EYH A;  3IV0 A;  3TGO A;  3KEZ A;  4GPK A;  4LER A;  4BY6 A;  1P5Q A;  3ZIM A;  3CVX A;  3APC A;  3CR3 A;  4LNG A;  3SBS A;  1OWN A;  2Y4U A;  2WQH A;  4RG6 A;  3S7J A;  4BEP A;  1Q2Z A;  2UY1 B;  3CHP A;  3EDT B;  2L0T B;  3FU3 A;  3U66 A;  1FVF A;  2XPY A;  4QFV A;  2VGX B;  3UIO C;  5HQ8 A;  5B1A E;  1B89 A;  4BSX A;  4HOS A;  4A63 B;  5FQ4 A;  4I43 A;  1IXV A;  3NF1 A;  2OV8 A;  2HO1 A;  2KZT B;  5D0Q D;  5BV0 A;  1OCC E;  2AVP A;  4DX5 D;  2Y69 E;  2WMO A;  1XGW A;  4F3V A;  4M16 A;  2YIN A;  3FU5 A;  5FIO A;  4GCN A;  3RAU A;  3MYV A;  4U07 A;  4ANU A;  5EDS A;  4RVB A;  1NFI E;  1KT1 A;  2IFU A;  4WNF A;  4AJW A;  3JXI A;  3T5V A;  4C0E A;  4QQI A;  2AWI A;  3RO3 A;  3G2S A;  3HDX A;  4N67 A;  1SA5 A;  4DUI A;  2XPZ A;  1W3B A;  1UN9 A;  4B0Z A;  2AXZ A;  4AP2 A;  2ZIR A;  4GTS A;  3DSX A;  3L08 A;  4GTR A;  2PL2 A;  3ZNG A;  3SFZ A;  5ENT D;  5G05 J;  4YVO A;  4CYM D;  2ZGD A;  2DBA A;  3FTS A;  1SVX A;  3GW4 A;  3LPZ A;  4EHM A;  3WG7 E;  2LUH A;  2CFZ A;  5D66 A;  4U0S A;  1DVP A;  4FJY A;  3LET A;  3ZUV B;  1N4P A;  1KT0 A;  2F8Y A;  3IXE A;  3HXC A;  4UWL A;  1H2V C;  3UKU G;  3MKQ B;  3TWR A;  3AG1 E;  2R17 C;  4DX2 A;  2C0L A;  3ISM C;  2NXP A;  5CEA A;  1OY3 D;  3NB2 A;  1IQR A;  2WXJ A;  2J09 A;  3JUE A;  2OND A;  3UIN C;  5ANL A;  2B0O E;  1E8X A;  2YNQ A;  2NUD A;  4J0U A;  3PS6 A;  5BXU A;  2WXL A;  3FU6 A;  2KZT A;  5EID A;  4DX7 D;  4LRZ A;  2J08 A;  4KVM A;  3UM2 A;  1FCH A;  1EDU A;  3FH7 A;  3EHM A;  3KAE A;  3SZ7 A;  3ML9 A;  3FH8 A;  3EIJ A;  1O1T A;  1MHQ A;  4J7W A;  2QC9 A;  3LJN A;  4E85 A;  3IHV A;  4PUC A;  3LVR E;  4JEH A;  2YHE A;  4ANV A;  4AV7 A;  4UUC A;  1HFA A;  3FHE A;  3QWW A;  1BI8 B;  2XZT G;  4FA6 A;  4U95 D;  1HZ4 A;  4L7T A;  5T3R A;  2DZN A;  3PZ4 A;  3SF4 A;  1HU3 A;  2QYJ A;  1QBQ A;  2QY7 A;  1JCR A;  2R05 A;  2KXP C;  2AJA A;  3QDN A;  2KM4 A;  4DLQ A;  5D2M C;  3NQP A;  4GMR A;  3FFL A;  2DIW A;  2IF4 A;  3LKU A;  3SFX A;  3UT4 A;  3R7R A;  3V31 A;  4LNB A;  5CBO A;  1G3N B;  3FUM A;  3DXK G;  3HHM A;  4TUU A;  3C3O A;  5ENN A;  1E8Y A;  2V0P A;  1NI1 A;  2LNI A;  4HRN A;  1HG2 A;  2GRQ B;  4U8H A;  3EHN A;  5B1B E;  3D9I A;  1EF1 C;  2X6K A;  4YDY A;  5AQ9 A;  1HS6 A;  4Q94 A;  1U3D A;  2WB2 A;  5EX0 A;  3ZFW A;  5LX8 A;  1S70 B;  3PDN A;  4OVU A;  1H19 A;  4TV3 A;  3ZYQ A;  3ZHE A;  3FTY A;  3PRE A;  2XS8 A;  3GZS A;  1SW6 A;  1JCQ A;  3MKQ A;  2X6F A;  3AG3 E;  4C9B B;  3IHY A;  4URK A;  3GZ1 A;  2NSZ A;  4Y6W A;  4KZC A;  4BES A;  4N5C A;  3I5P A;  1O1S A;  3QOU A;  3FUE A;  3T5X A;  1ZBP A;  1V55 E;  4LEU A;  3FTX A;  4DRX E;  2EIL E;  3ZGQ A;  3D9K A;  5G55 A;  3ULE G;  3TG4 A;  3B7T A;  2VYI A;  4IYP A;  4RSY A;  3LYA A;  2LXL A;  3ONL A;  5B3S E;  2GRP B;  3F6Q A;  3T8K A;  3HYM B;  3NOC D;  2MOW A;  3W9G A;  3MCX A;  1OCR E;  4O1P A;  5AQ7 A;  3JXJ A;  4AVX A;  4RG9 A;  2ETA A;  2WXG A;  3Q49 B;  2RKK A;  5CRU A;  3ZC7 A;  1TN8 A;  3Q5M A;  2PQN A;  1WY6 A;  4G25 A;  2OVB A;  1NZN A;  2BKK B;  3PZ2 A;  1MYO A;  3EHQ A;  3SNX A;  4HOT A;  1S64 A;  4CEM A;  4L1B A;  1RZ4 A;  4XKB A;  2I9C A;  4XI9 A;  1OT8 A;  2P58 C;  4GYO A;  1UJJ A;  2VY3 A;  3CEQ A;  2DZO A;  5AJL A;  3MV2 B;  2EIK E;  3PZ3 A;  4U04 A;  3S7B A;  1N11 A;  2R59 A;  2XGM A;  4DLO A;  3GZ2 A;  2WMN A;  2V8S E;  3MKR A;  4E6H A;  3HXE A;  2WQ6 A;  4FLB A;  2OEW A;  3ABM E;  5KJK A;  2AXV A;  4GTQ A;  4YDE A;  4G11 A;  5FWQ A;  3I4G A;  1ELR A;  4ZHB A;  4ME2 A;  1MZC A;  2FF4 A;  1H6P A;  2GRR B;  2I1J A;  2ILR A;  2H6I A;  3CKC A;  4G8L A;  2WVI A;  1Z3Y A;  5BNW A;  5JHA A;  2IO3 C;  4ANX A;  3D9J A;  3CVL A;  3QAQ A;  2FO1 E;  2FO7 A;  4N2S A;  2VTB B;  1PC2 A;  5CCM A;  5EKQ D;  2Y4T A;  1HXI A;  2PNN A;  5ENQ D;  4B94 A;  4LSZ E;  4O60 A;  4I2Z A;  5CER B;  5C1D A;  3PZD A;  3CVP A;  1N4Q A;  3V30 A;  3BQO A;  4WGJ A;  2VSY A;  4U7E B;  3Q7A A;  2LSV A;  3OXF A;  4WND A;  5CCL A;  1HH8 A;  1N4S A;  2L6J A;  3VTY A;  4O6F A;  4LNU D;  1OCZ E;  3L54 A;  4ATG A;  4U96 D;  2A5E A;  3PVL A;  4JD2 G;  2XCC A;  4JC8 A;  4DJA A;  2KC7 A;  3D9N A;  3QC1 A;  3CUC A;  3OXL A;  1X5B A;  2XZD G;  3D9H A;  2CHX A;  4UQX A;  3SI5 A;  3QB2 A;  2I1K A;  4JPS A;  3OTN A;  5AJD A;  2RG8 A;  2WXR A;  2P9P G;  5KCM A;  1TEZ A;  2J4D A;  5FT9 A;  3VLE A;  2BED A;  3AG2 E;  1OWM A;  3FTU A;  3FUL A;  3ZVV A;  2J4B A;  2ION A;  3V79 K;  3DEP A;  3OAW A;  4FUL A;  3DSU A;  2C2L A;  2LSU A;  4JA7 A;  3AJI A;  5EYP F;  5KJM A;  4EZL A;  1FT1 A;  3CVY A;  3TWT A;  2VZA A;  1MX2 A;  3NOG D;  4J8D A;  1NP7 A;  4XZ4 A;  3ASH A;  3PUK A;  3R7Q A;  4BX9 A;  5G05 C;  4XKC A;  2VTB A;  4ITR A;  1DCQ A;  4PDX A;  4Y6C A;  3PE4 A;  3QNK A;  1N95 A;  3CK9 A;  4UQY A;  4ACK A;  1TN6 A;  2IJG X;  2GRM A;  4OAU C;  3RRM B;  2PQR A;  4KT6 B;  2E0I A;  4GML A;  4B8C B;  4B89 A;  3EUV A;  4K5C A;  2P9I G;  5AQA A;  5HS0 A;  2FI7 A;  4YDO A;  3L13 A;  3UXG A;  5AYW D;  2P2C P;  4YDW A;  3UMV A;  4NRH B;  3DBS A;  5FZR A;  3FEX A;  4CDR A;  4EZK A;  3TXM A;  4LUN U;  1JWF A;  3DSW A;  3QKY A;  3HIZ A;  3C5R A;  3LCA A;  4GAA A;  4AM9 A;  4F6R D;  1IYG A;  4O1O A;  4BTA A;  2XEE A;  4GZC A;  4A55 A;  2RD0 A;  4GTT A;  4MLP A;  2KAT A;  3ZLM A;  4EPZ A;  4N5Q A;  5FZS A;  4ANW A;  3BUA A;  2G03 A;  1ZB1 A;  3MA5 A;  4JB8 P;  4OVV A;  2ZU6 B;  4JXT A;  5JMN D;  2LAI A;  3EHR A;  3ONK A;  2NC9 A;  3G2V A;  4PS3 A;  2GRO B;  3FU0 A;  3UT8 A;  1E8W A;  4B8A A;  3FH5 A;  2HM8 A;  3E33 A;  3TWV A;  4HRL A;  4DK5 A;  2J49 A;  4GA0 A;  2Y0B G;  4G26 A;  2OCC E;  3PZ1 A;  4AY6 A;  2C0M A;  2UY1 A;  5G04 C;  2FUL A;  3NZU A;  1Y6I A;  3ASN E;  4WWN A;  1H2U A;  4AY5 A;  2PM7 A;  3ZN3 A;  1SZ9 A;  1TJF A;  4UWK A;  3NBN B;  4PH4 B;  4EEC A;  2V4L A;  3PEV B;  3ESK A;  4DPR A;  5EN5 D;  4NPS A;  1ZU2 A;  1O5M A;  4GA2 A;  3WXX A;  2VGX A;  1N0R A;  1OUV A;  4ZFH A;  2P9L G;  4MBG A;  1JWG A;  2H6H A;  3MEK A;  1O1R A;  5AAO A;  3D9L A;  1U2V G;  3KS2 A;  2WXQ A;  2QFC A;  1OCO E;  2XGS A;  3PNL B;  4ACL A;  3OXG A;  2RFM A;  2PZI A;  2H6G A;  1H6K A;  3B7B A;  3CVN A;  2EQX A;  3LEW A;  3AS8 A;  1WM5 A;  3B7U X;  4AEZ C;  1Z5S C;  4ILH B;  4M3O A;  2PM6 A;  5G04 J;  1D9S A;  3LY7 A; 
#chains in the Genus database with same CATH homology
 4HLE A;  4GYY A;  2J07 A;  4AVX A;  3RIB A;  3GYZ A;  4RG9 A;  2WXG A;  3Q49 B;  3AU5 A;  4FAD A;  4ILG A;  5DIZ A;  5A23 A;  4F53 A;  1IHG A;  3ZC7 A;  5CHE E;  4X2E A;  3QWP A;  3RK6 A;  1N52 A;  4BFR A;  5C2Y A;  2E2E A;  2PQN A;  2IOL A;  3AU4 A;  3EIQ C;  2JLB A;  1WY6 A;  3Q5M A;  3ZXS A;  2X6H A;  4G25 A;  3S2A A;  1E7U A;  3RRU A;  2DCP A;  5LCW C;  4L23 A;  5M72 A;  4I1A A;  4BWR A;  3TAX A;  5BUZ A;  2VJ8 A;  2OVB A;  3EJN A;  4HVB A;  1INZ A;  2GW1 A;  1UJK A;  3ZYL A;  1NZN A;  2JK8 A;  1DNP A;  4BT9 A;  3UX4 A;  3L22 A;  3IKO B;  4U63 A;  3FUF A;  4BTB A;  1HG5 A;  3JQ0 A;  3Q47 B;  3CGH A;  4XI8 A;  3CKB A;  3SNX A;  4HOT A;  4CEM A;  3TJP A;  3C98 A;  4I2W A;  4KVO A;  5D0O D;  4L1B A;  4A3T A;  4XKB A;  4CCA A;  2I9C A;  3L16 A;  4HFG A;  4NUR A;  3SE5 A;  4XI9 A;  5G2N A;  2P58 C;  2X3M A;  5T4Y A;  3S7D A;  4XI0 A;  4GYO A;  4MRU A;  1UJJ A;  3RKV A;  2VY3 A;  5EX3 A;  3CEQ A;  4EQF A;  3MZL B;  5AIJ A;  4AXH A;  5AJL A;  3MV2 B;  5A7D B;  1Z6T A;  1EYH A;  3IV0 A;  3TGO A;  3KEZ A;  4N3B A;  2AXU A;  3VTX A;  4GPK A;  4U04 A;  4LER A;  3JUI A;  3S7B A;  1PY1 A;  2M63 A;  4BY6 A;  2R59 A;  1P5Q A;  2OVF A;  2XGM A;  2WQ7 A;  2A4Z A;  3ZIM A;  4FU3 A;  4UI9 C;  3GZ2 A;  4DLO A;  3CVX A;  3APC A;  2WMN A;  2V8S E;  5HI7 A;  3MKR A;  3VLD A;  3O48 A;  4Q96 A;  4E6H A;  3QK0 A;  3CR3 A;  4P29 A;  3SBS A;  4NAC A;  3HVE B;  1OWN A;  4H7Y A;  3TG5 A;  4DI4 A;  2Y4U A;  2WQH A;  2WQ6 A;  3CHM A;  4RG6 A;  3S7J A;  4FLB A;  4MKT A;  4G1T A;  3CVW A;  3PE3 A;  5KJK A;  2AXV A;  3S7F A;  4N39 A;  2UY1 B;  3CHP A;  2L0I A;  4G11 A;  5FWQ A;  3EDT B;  2BTD A;  3I4G A;  3CK7 A;  1ELR A;  3N71 A;  3ZHE B;  4GZ6 A;  4ME2 A;  2FF4 A;  3B13 A;  5LFA A;  4JVS A;  4D10 C;  2L0T B;  4XX5 A;  3FU3 A;  3FUD A;  2A5U A;  2I1J A;  2ILR A;  3FDH A;  3U66 A;  1FVF A;  4I6G A;  2XPY A;  3CKC A;  2XHE A;  4GZ3 A;  4QFV A;  3MV3 B;  3LJ3 A;  1HO8 A;  2WVI A;  5JFF A;  1Z3Y A;  1UW4 B;  5FTP A;  1KLX A;  2VGX B;  2X6J A;  4I9E A;  5BNW A;  3RJV A;  3SGH A;  5JHA A;  5HQ8 A;  1B89 A;  2FBN A;  4BSX A;  5J90 A;  4HOS A;  5FQ4 A;  2YHC A;  3D9J A;  3CVL A;  4I43 A;  4ANX A;  3QAQ A;  3SN9 A;  3FWV A;  1OWP A;  2MRI A;  2FO7 A;  3NF1 A;  4N2S A;  2VTB B;  1PC2 A;  3FTZ A;  2OV8 A;  3CLJ A;  2HO1 A;  2GGF A;  2KZT B;  2XPI A;  3G2W A;  3LY8 A;  5CCM A;  4HOU A;  5CKL A;  5D0Q D;  1E90 A;  4MS6 A;  5BV0 A;  2VSX E;  4ABN A;  2AVP A;  3PEU B;  4YVQ C;  5EKQ D;  2Y4T A;  3ASF A;  1HXI A;  4IN3 B;  5CGL A;  3U64 A;  1Z3X A;  4B94 A;  4DI3 A;  1H2T C;  2WXH A;  4I2Z A;  2WMO A;  3P2B A;  4UI9 J;  5C1D A;  5E75 A;  1XGW A;  4F3V A;  4M16 A;  4OYS A;  2YIN A;  3FUK A;  3FU5 A;  4IRU A;  4WNG A;  2KCV A;  3PZD A;  4GCN A;  4AIF A;  3CVP A;  3MYV A;  4U07 A;  4J8S A;  1OWO A;  4ANU A;  5EDS A;  4RVB A;  4UI9 K;  3UQ3 A;  3ASG A;  2XQ0 A;  1KT1 A;  4XE0 A;  4WGJ A;  4W9R A;  2IFU A;  2VSY A;  2WXI A;  4KBQ A;  2VGY A;  4WNF A;  3RO2 A;  4AJW A;  1VDY A;  3APD A;  2LSV A;  4GZD A;  3OXF A;  4WNE A;  4WND A;  2WPV A;  3T5V A;  5CCL A;  1HH8 A;  2L6J A;  3PH0 C;  5FQ6 A;  4C0E A;  1TJC A;  1XNF A;  5FQ7 A;  4I1O B;  2CG3 A;  3S6A A;  2AWI A;  3RO3 A;  3G2S A;  3HDX A;  2WXN A;  3ENE A;  4N67 A;  4L2Y A;  3VTY A;  2CHW A;  4FHJ A;  5BW8 C;  3VLF A;  5BPP A;  3APF A;  4N3A A;  2XPZ A;  4O6F A;  3ZYK A;  4A1S A;  1W3B A;  1UN9 A;  5JHB A;  3L54 A;  4B0Z A;  2AXZ A;  4AP2 A;  4ATG A;  3FUI A;  3G2T A;  3PVL A;  3ZCB A;  3N3U A;  2XCC A;  3L08 A;  4JC8 A;  4JL0 A;  2PL2 A;  3FEY A;  4CRW A;  5ANR A;  2I6H A;  4DJA A;  1L5J A;  2KC7 A;  5LOZ A;  5BV1 A;  1HF8 A;  1IQU A;  1GW6 A;  3D9N A;  3QC1 A;  3CUC A;  3SFZ A;  1FVH A;  3SD5 A;  2WXO A;  3ZYM A;  5G05 J;  3OXL A;  1X5B A;  3LDZ A;  4YVO A;  5FJY A;  2HYZ A;  1A17 A;  3D9P A;  2CHX A;  3CIA A;  4UQX A;  3SI5 A;  3QB2 A;  2DBA A;  5FZQ A;  3FTS A;  3GW4 A;  3LPZ A;  3CVV A;  2I1K A;  3NZS A;  3SHG A;  2JEK A;  4U0U A;  4ILI A;  4JPS A;  4UQZ A;  4AOF A;  3OTN A;  5LP0 A;  2CFZ A;  5AJD A;  4U0S A;  5JJ7 A;  2WXR A;  2RG8 A;  1DVP A;  2KCL A;  4FJY A;  4EZJ A;  2HR2 A;  4I6E A;  5KCM A;  1TEZ A;  1NA3 A;  2Q7F A;  3UT7 A;  2WM9 A;  3LET A;  2J4D A;  5FT9 A;  3ULQ A;  1ELK A;  5KJN A;  3VLE A;  1KT0 A;  3CSF A;  4LU4 A;  2MHK A;  3Q15 A;  1QNF A;  1OWM A;  2GRL A;  3LY7 A;  4KXK B;  3FTU A;  3FUL A;  4UWL A;  4N2Q A;  3ZVV A;  2J4B A;  3BG1 B;  3ZW3 A;  4HOR A;  2ION A;  4X2C A;  1H2V C;  3DPD A;  3LXU X;  4G2V A;  1E96 B;  3SBT B;  3HVE A;  1N54 A;  3ML8 A;  3OAW A;  4FUL A;  3SHF A;  5EU0 A;  5CMT A;  5T8I A;  2C2L A;  3MKQ B;  2LSU A;  4JA7 A;  4A3V A;  5KJM A;  4EZL A;  4KMO A;  4R7L A;  1LF8 A;  4V3I A;  4F1S A;  3CVY A;  3D9M A;  3AS4 A;  2VZA A;  2VQ2 A;  2R17 C;  2C0L A;  4J8D A;  1NP7 A;  3KD7 A;  2NXP A;  4XZ4 A;  5KJL A;  2CHZ A;  2WXP A;  3CHR A;  4IUL A;  5JJT A;  2KCK A;  3ASH A;  3PUJ A;  3G2U A;  1IQR A;  3PUK A;  2WXJ A;  2J09 A;  1HE8 A;  3R7Q A;  4FP7 A;  1U3C A;  3UUX A;  3ASD A;  3CHQ A;  2F6S A;  5DBK A;  4JHK A;  2OND A;  3LY9 A;  4JW1 A;  3MJW A;  5ANL A;  4G24 A;  3B7S A;  1E8X A;  4CT4 A;  5AEN A;  2YNQ A;  4J0U A;  4BX9 A;  3PS6 A;  5G05 C;  3QAR A;  1H0A A;  4XKC A;  2WXL A;  2VTB A;  3FU6 A;  4I9C A;  4ITR A;  4F7A A;  4PDX A;  2KZT A;  4Y6C A;  3PE4 A;  2Y3A A;  3QNK A;  3BEE A;  3IEG A;  3L6A A;  3CK9 A;  4LRZ A;  4UQY A;  4ACK A;  2J08 A;  4KVM A;  2XEV A;  2WXF A;  2IJG X;  1FCH A;  1EDU A;  2GRM A;  3RRM B;  4JA9 A;  2PQR A;  3FH7 A;  4KT6 B;  2E0I A;  3ZPJ A;  3EHM A;  2UWJ G;  3KAE A;  3CVQ A;  4GML A;  3SZ7 A;  4GCO A;  4BT8 A;  4B8C B;  4N3C A;  3ML9 A;  4I17 A;  4B89 A;  3FH8 A;  2FI7 A;  3EIJ A;  1UG3 A;  3IBE A;  3L13 A;  4X2D A;  2VSO E;  1MHQ A;  4E85 A;  5AYW D;  3IHV A;  4PUC A;  4BX8 A;  3LVR E;  4JEH A;  2YHE A;  2XGO A;  3MX3 A;  5E76 A;  4TRQ A;  4XIF A;  4ANV A;  4AV7 A;  4KZ0 A;  3FP3 A;  3UMV A;  4NRH B;  4I6J A;  1HFA A;  2XRZ A;  3FHE A;  3QWW A;  3ESL A;  1Y8M A;  3DBS A;  5FZR A;  4JEU A;  4A1G A;  2LAH A;  4GMJ A;  3D9O A;  4CGV A;  1PAQ A;  4FA6 A;  3FEX A;  4CDR A;  4EZK A;  2BF0 X;  1S0P A;  3FTW A;  3FUN A;  3TXM A;  2LO6 A;  4LUN U;  3TXN A;  5JFZ A;  1HZ4 A;  3AS5 A;  4GA1 A;  1JWF A;  2I2O A;  3QWV A;  4PY3 A;  4L7T A;  5T3R A;  3ZRH A;  3SF4 A;  3QKY A;  1HU3 A;  3HIZ A;  4FC8 A;  1QZ2 A;  2OOE A;  4KYO B;  2CFU A;  5BT1 A;  2IQC A;  2QY7 A;  3LCA A;  4FLH A;  4GAA A;  3QDN A;  4WWP A;  4WUY A;  2KM4 A;  4AM9 A;  1IYG A;  4DLQ A;  2BUG A;  1EPU A;  3NQP A;  3FFL A;  4BTA A;  4L2L A;  1QQE A;  2DIW A;  3LS8 A;  3T8M A;  2IF4 A;  3FUH A;  2YQ8 A;  3LKU A;  4GZC A;  4J6I A;  3U4T A;  3UPV A;  4C0M A;  4A55 A;  2FEZ A;  1E8Z A;  3UT4 A;  2WXK A;  3MGB A;  4APO A;  2RD0 A;  3RU0 A;  4WAF A;  4JZY A;  4MLP A;  5CMY A;  2KAT A;  3ZLM A;  3R7R A;  4EPZ A;  3CST A;  3K9I A;  5FZS A;  1SQM A;  3L17 A;  4ANW A;  4APF A;  1YA0 A;  4UWG A;  2G03 A;  3FUM A;  3TL5 A;  1UN8 A;  3MA5 A;  4OVV A;  3HHM A;  3FUJ A;  4K03 A;  4TUU A;  3JQ1 A;  3RRN B;  2ZU6 B;  4JXT A;  5ENN A;  1E8Y A;  4CGW A;  1JPL A;  2CG2 A;  4CT0 A;  1BPO A;  2V0P A;  2LNI A;  2IU1 A;  3CQG B;  4EBA A;  2LAI A;  1HG2 A;  3D3M A;  4FJZ A;  3BG0 B;  3ONK A;  3EHN A;  4U8H A;  4WWO A;  4EBA G;  2NC9 A;  3G2V A;  3D9I A;  4PS3 A;  3FU0 A;  2XRY A;  3UT8 A;  1EF1 C;  4H7X A;  1E8W A;  4CDM A;  2X6K A;  4B8A A;  3FH5 A;  2HM8 A;  4DK5 A;  1OWL A;  3U9W A;  5JJ6 A;  1HS6 A;  2J49 A;  3CQC B;  4GA0 A;  1U3D A;  4Q94 A;  2WB2 A;  3CHS A;  5EX0 A;  3CK8 A;  4I1M A;  3ZFW A;  5LX8 A;  1E7V A;  2X38 A;  3PDN A;  3QJZ A;  4G26 A;  4OVU A;  4AY6 A;  2C0M A;  2UY1 A;  5G04 C;  1H19 A;  4TV3 A;  2FUL A;  3NZU A;  4J8E A;  4GZ5 A;  1Y6I A;  3JYS A;  4WWN A;  3ZYQ A;  2XCB A;  3ZHE A;  1H2U A;  4AY5 A;  2PM7 A;  3FTY A;  3ZN3 A;  3PRE A;  1SZ9 A;  3E4B A;  1TJF A;  4J8F A;  4UWK A;  4G23 A;  3GZS A;  4PH4 B;  4U0Z A;  2J9Q A;  5A6C A;  4UWH A;  3MKQ A;  4UWF A;  4EEC A;  2V4L A;  4HS2 A;  3PEV B;  2X6F A;  3FTV A;  3ESK A;  4JHJ A;  4LCT A;  4DPR A;  3JCK C;  5LCW J;  4C9B B;  4HXI A;  4GB9 A;  5CMW A;  4NPS A;  1ZU2 A;  4GA2 A;  3WXX A;  2AW6 A;  2VGX A;  3CVU A;  3URZ A;  4CDN A;  3IHY A;  1OUV A;  4URK A;  2X6I A;  3GZ1 A;  2NSZ A;  4Y6W A;  4KZC A;  1JWG A;  4N5C A;  3I5P A;  3MEK A;  4YND A;  4PS8 A;  3D9L A;  3ZEF A;  3P1U A;  3QOU A;  4GYW A;  1WAO 1;  3KS2 A;  2WXQ A;  3FUE A;  2IOS A;  2QFC A;  2XGS A;  3PNL B;  4GU5 A;  1HX8 A;  3T5X A;  3I3N A;  1ZBP A;  2V5F A;  2VSN A;  4ACL A;  5J08 A;  3OXG A;  3B7R L;  2L9B A;  4LEU A;  3FTX A;  3ZGQ A;  1JUQ A;  3O4Z A;  2PZI A;  3D9K A;  3FY4 A;  5G55 A;  4FHK A;  4HOQ A;  3TG4 A;  1H6K A;  3B7T A;  3I4R B;  1NA0 A;  5ARG A;  2VYI A;  3CVN A;  4IYP A;  2EQX A;  3LEW A;  4NQ0 A;  4RSY A;  3AS8 A;  3LYA A;  5FQ8 A;  1WM5 A;  3U3W A;  2R5S A;  3ONL A;  3CHO A;  3R9A B;  3LVQ E;  3PNT B;  3B7U X;  4Q69 A;  5ARF A;  4AEZ C;  1ELW A;  3Q4A B;  3PRZ A;  4ILH B;  3CV0 A;  4PS7 A;  3HYM B;  4M3O A;  4K0R A;  2MOW A;  2PM6 A;  5G04 J;  3MCX A;  4JHR A;  2WXM A;  1SZA A;  1MQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...