4U04A

Structure of a eukaryotic fic domain containing protein
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
327
structure length
315
Chain Sequence
RAALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Adenosine monophosphate-protein transferase FICD
total genus 120
structure length 315
sequence length 327
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u04A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u04A01
3QKYA 1WAO1 4I2WA 1OUVA 2C2LA 3SN9A 5C1DA 4N5CA 2UY1A 2JLBA 3ASGA 3KD7A 5A7DB 4UI9J 4YNDA 4UQXA 4IN3B 5DIZA 4B94A 4N39A 5D0OD 2XGMA 4F3VA 3RO2A 1KLXA 3OXFA 4U07A 3LETA 5BW8C 4I9EA 3QDNA 4I2ZA 4JA9A 4GZ5A 4HOQA 3RIBA 5FZRA 3N3UA 4H7XA 4UI9K 3AS5A 4KXKB 3RKVA 2LSUA 4I1AA 3MV2B 2LSVA 3WXXA 2QFCA 4HORA 4GA1A 4X2DA 4AM9A 1HXIA 3BEEA 5KJMA 2XGSA 1HZ4A 2IFUA 3Q15A 2GW1A 2P58C 3S7FA 2V5FA 4WGJA 4U0SA 5JFFA 4GA2A 3HYMB 3MA5A 4N2QA 4HOUA 1QZ2A 3CKCA 4NRHB 3S7BA 5D0QD 3SHGA 4YVOA 2VGYA 4WUYA 3ZPJA 4GCNA 4XI9A 3RO3A 3EDTB 4EQFA 3CUCA 2L6JA 4I17A 4BTAA 4UQZA 3U3WA 5HQ8A 3QWVA 4XI8A 2PQNA 4N2SA 5BT1A 5M72A 1A17A 3FWVA 4XI0A 3OXGA 3OXLA 3MV3B 2XCCA 3LY8A 3SE5A 1WM5A 3ULQA 3IEGA 5FJYA 5ARGA 2VGXB 3TG5A 3TAXA 2UY1B 3QWWA 4KYOB 3ZFWA 3LY7A 3GZ1A 2E2EA 2KCVA 1FCHA 1ELWA 2YHCA 4LU4A 2WPVA 3ZCBA 2G03A 4ITRA 1XNFA 3PDNA 4JHRA 4CGVA 5FZQA 3SZ7A 5FT9A 2XGOA 4U0UA 4O6FA 4CDRA 3CVNA 5G04J 4CGWA 2Q7FA 5LCWJ 1YA0A 4ME2A 1ZU2A 4UQYA 3Q5MA 5CCMA 2FBNA 2WQHA 3RU0A 4AIFA 4RG9A 3N71A 5G05J 2MHKA 4H7YA 3CVPA 4G26A 5CCLA 2KC7A 2FF4A 4M16A 5KJLA 2ONDA 4BTBA 3R9AB 2JK8A 2XEVA 5CKLA 3CEQA 3MEKA 1W3BA 3TG4A 3AS4A 3CK7A 2C0MA 3S7JA 4AY5A 5JJTA 4GZ6A 4AY6A 4JL0A 2R5SA 4J0UA 2HYZA 3VTYA 4U04A 3SF4A 3ZHEB 3UUXA 4WNFA 4G24A 5G05C 4J8EA 2J9QA 5LCWC 3KAEA 4GPKA 5JJ7A 1KT1A 4GYWA 4WNEA 3E4BA 4GZ3A 3JYSA 2DBAA 2VY3A 2LNIA 1KT0A 5HI7A 3MKRA 3PE3A 5BNWA 5G04C 4APOA 4NQ0A 3ZLMA 5EX3A 2Y4TA 4LEUA 2PZIA 4ABNA 1PC2A 4HOSA 4BT9A 5JFZA 1ZBPA 4J8FA 2KATA 2VZAA 2VGXA 2PL2A 4X2CA 4Y6WA 3UQ3A 1HH8A 2AVPA 1QQEA 4HOTA 3CKBA 1NA3A 3PE4A 5CMTA 3VTXA 4NPSA 5CHEE 4G2VA 5EKQD 4BT8A 1Y8MA 3UPVA 1IHGA 2XPIA 4WNGA 3ZHEA 2FI7A 5EX0A 3S7DA 3QOUA 4KBQA 2HO1A 3GW4A 2VSNA 3TGOA 3U4TA 4N3BA 3FFLA 2FO7A 4RG6A 3ASFA 4J8DA 5JJ6A 3ESKA 5KJNA 3Q4AB 2Y4UA 2F6SA 3GZ2A 5KJKA 5CGLA 2YQ8A 3ZGQA 3QWPA 1TJCA 1NA0A 4GA0A 3CVQA 4G23A 2FEZA 3CV0A 2PQRA 4U0ZA 2OOEA 2KCKA 4YVQC 3NF1A 3Q47B 4G1TA 4GCOA 3CK9A 4W9RA 4N3CA 2UWJG 4BWRA 3RJVA 3FP3A 1IYGA 4PY3A 5FZSA 3LYAA 2VSYA 1B89A 5EU0A 5FTPA 3O48A 3Q49B 3ASDA 2NC9A 2IF4A 3AS8A 4JA7A 4G25A 1E96B 3LKUA 4GYYA 5DBKA 3K9IA 3LY9A 2HR2A 2BUGA 3ASHA 4Y6CA 1P5QA 3ZN3A 2I6HA 1NZNA 3ZC7A 4I9CA 4UI9C 1ELRA 3LPZA 3S6AA 5A6CA 3KS2A 3GYZA 4WNDA 4GYOA 2KCLA 4X2EA 2C0LA 3LCAA 3URZA 2XCBA 4XIFA 5AYWD 4N67A 2VYIA 2VQ2A 3CK8A 4A1SA 5ARFA 4N3AA 3CVLA
chains in the Genus database with same CATH superfamily
3NOCD 3QKYA 5KNGA 1WAO1 3Q73A 4DK5A 4FLHA 5J90A 2VSXE 3D9MA 1OUVA 4N5CA 1N0QA 1YMPA 2R17C 2KZTA 4L23A 4TXQA 3B13A 4A1GA 1TNOA 3I5PA 3PZ1A 5KNHD 4U07A 1U3DA 3LETA 3TXMA 2BKGA 3ABLE 1TNBA 1D8EA 3ABKE 4I2ZA 4JA9A 3RIBA 3N3UA 1E8YA 3V2XA 4H7XA 4PH4B 4LSZE 4WWOA 3TWUA 2LSUA 3DPYA 3WXXA 4L2LA 4U8VD 3AJIA 2GGFA 1HZ4A 1S63A 2IFUA 2L0IA 1OWMA 4XZ4A 4ZHBA 4I6GA 4LNUD 1UJKA 1K1BA 4EZLA 3CHSA 2A5UA 4GA2A 4U63A 2PM6A 3MGBA 1ELKA 3LVRE 5D66A 3QC1A 3ZYKA 1H6OA 1QZ2A 3MJWA 4FC8A 3FU3A 3C3QA 3MX3A 3HIZA 3ZYQA 2IONA 3V2OA 3FU5A 4BETA 2ZXWE 3RO3A 5CBNA 4BY6A 3CUCA 1JUQA 4I17A 3ENEA 4RSYA 3U3WA 2ZISA 4LCTA 4N2SA 5BT1A 3I4RB 4YDOA 1E8XA 2XZDG 2GROB 5ENSD 2X6JA 5FINA 2V4LA 5ARGA 1N54A 5C2YA 1H2VC 2NYJA 1NH1A 4KYOB 3ZFWA 3LY7A 2E2EA 2KCVA 4F1SA 1ELWA 4TUMA 4B0ZA 4LU4A 4ITRA 1XNFA 3HRAA 5FZQA 4U0UA 4O6FA 3EIJA 3CVNA 3W9GA 5G04J 2IQCA 4DX1A 3PNTB 3LXUX 2Q7FA 4D10C 3E37A 3UT7A 3AG4E 3QB2A 3SO8A 4UQYA 3HVEB 5CCMA 2AW6A 5ITZF 3RU0A 1V54E 3Q7FA 4AIFA 3R7RA 3B7UX 3UI2A 4H7YA 3FUIA 4G26A 5CCLA 2ZIRA 2H6GA 2AXVA 2X6KA 3PVLA 5EYLA 4FJZA 2ONDA 3R9AB 2XEVA 5CKLA 4GAAA 3CEQA 3FEYA 4HS2A 1W3BA 1HG2A 5AN8A 4AY5A 4A55A 1TNUA 1PY1A 1PAQA 3CQCB 4BEPA 3OAWA 3VTYA 4U04A 3RK6A 3FUEA 1IKND 4G24A 5G05C 1JCRA 4J8EA 2WMOA 3FH8A 4GTRA 2WXKA 3L17A 2PM7A 1JWGA 1QNFA 2L6BA 4JC8A 2CFZA 1HFAA 4GZ3A 2HE0A 3JYSA 2MYOA 2J07A 2DBAA 2VY3A 5JHAA 5AIJA 1OCRE 1KT0A 3SGHA 5HI7A 3MKRA 3CVXA 5BNWA 5J08A 3ML9A 4APOA 3ZLMA 3ZXPA 1SQMA 2PZIA 1UN8A 2GRQB 1V55E 3L6AA 1OY3D 1ZBPA 4K5AB 4J8FA 2KATA 3HDXA 4EHMA 2E0IA 5AQ7A 2VZAA 2PL2A 4URKA 3UQ3A 3UINC 3C5RA 4EZKA 5KWDA 5ENNA 5CEAA 3FTYA 1VDYA 5IY5E 3ZVVA 4NPSA 5CHEE 3D9JA 3CHPA 1Y8MA 1BPOA 2J08A 3ZHEA 2FI7A 2J49A 5CMYA 2X3MA 4TRQA 3FUJA 1UW4B 2WXJA 3LJNA 3DSWA 4DPRA 3V30A 1LD7A 5FQ4A 2L9BA 4Q69A 2DIWA 1IHBA 1OWNA 2F0YA 2XEEA 4FADA 3ESKA 3VLFA 1MHQA 5KJNA 1QBQA 2NSZA 2A5EA 2RKKA 2P2CP 4L7TA 3ZGQA 4OVVA 5FQ8A 3ABME 2FO1E 3D9OA 3FTWA 3CVQA 3FULA 2P9IG 4DX7D 4U0ZA 1EPUA 3ULEG 3L16A 1X5BA 3NF1A 5ANLA 1WG0A 1DVPA 1E7UA 2WQ6A 2MOWA 1HE8A 4N3CA 3SBSA 3ZNGA 1N95A 4UWKA 3DSUA 3FP3A 3T5VA 3GZSA 4E6HA 3IBEA 1MYOA 3DXKG 1E7VA 1TEZA 1B89A 3D9LA 4EBAG 2H6HA 1HO8A 3UIPC 3AS8A 4Y6CA 3ASHA 1U2VG 1N94A 1P5QA 2V4HC 2Y1LE 2P9UG 3S6AA 4LUNU 5A6CA 1N4PA 2X6IA 5T3RA 4AP2A 3LCAA 1IXVA 4GZDA 2LO6A 2VYIA 5BV0A 4DLOA 3RSEG 4F7AA 5ARFA 4N3AA 4IRUA 3DSXA 4F1PA 3G2WA 4ATZD 1YCSB 5AQAA 4GTOA 4I43A 2XRYA 5C1DA 2JLBA 2R05A 1GW6A 3KD7A 3HXCA 4L1BA 5A7DB 4UI9J 4YNDA 4DX5D 4TXRA 4N39A 1FVFA 1UG3A 5ANRA 2IEJA 1KLXA 2ZGDA 4ACKA 5BW8C 3DWLG 4I9EA 3QDNA 4WWNA 4L9PA 5FZRA 3FDHA 4UI9K 3JQ1A 4GTTA 3CGHA 3CHRA 4AV7A 2P9PG 4JD2G 3F6QA 4TXPA 1FT1A 3FTSA 4K0RA 1HXIA 3CQGB 2I9CA 1BD8A 4HQDA 3S7FA 4GZCA 2V5FA 4WGJA 4U0SA 2LAIA 3NB2A 4N2QA 4HOUA 4CDMA 1HS6A 4NRHB 2CHXA 3JUIA 1DC2A 3CHOA 2VGYA 1MX6A 5G2NA 3FUMA 2WXNA 2IY0C 3UX4A 2LUHA 5EILA 3EDTB 2GRPB 4BTAA 3NZSA 4DLQA 5HQ8A 3QWVA 4OAUC 2PQNA 3FU6A 4MLPA 1A17A 3FWVA 3PNLB 3OXGA 4XI0A 3OXLA 4YDWA 3SE5A 4EECA 4O1OA 1FT2A 3ULYA 3IEGA 4AJWA 4BFRA 2Y0BG 3FTXA 1TYQG 3TG5A 4NACA 3C3RA 3L13A 4JEHA 2MRIA 1FCHA 4HI8A 2X6HA 3MKQB 3ZCBA 4KMOA 3HVEA 3PDNA 4CGVA 1DCEA 4HVBA 5FT9A 2YINA 1S64A 1OWLA 2WB2A 3G2UA 4CGWA 5FQ7A 2GRNB 3JCKC 2V8SE 2KXPC 3IKOB 3BUAA 1H0AA 2WQ7A 3Q5MA 5BPPA 3APDA 2MHKA 3CVPA 4ACLA 5CEDB 2WM9A 3L54A 3ZRHA 2XPYA 5KJLA 4BTBA 3MZLB 3C98A 3D9KA 3MEKA 3UIOC 2WXQA 4P29A 4MBGA 1NFIE 4JL0A 4GTMA 3IXEA 5AARA 2HYZA 2EQXA 3UUXA 3ZYLA 1UOHA 4IULA 3ASOE 2QYJA 5LCWC 4OAVB 3BU8A 2FULA 3RRUA 2B0OE 3HHMA 4M3OA 4GYWA 1OWPA 4WNEA 3E4BA 4GTVA 2JEKA 5LFAA 3TWVA 5KBAA 1SA5A 3TWTA 2M63A 2P9KG 4XE0A 4BX8A 4EPZA 5EX3A 4Q94A 3HXBA 4X8QA 2RFMA 3LDZA 4FA6A 3EIQC 1EF1C 4HNAD 3L82A 1HH8A 3ASNE 4HOTA 4KVMA 4FULA 1FVHA 3CKBA 1NA3A 4AOFA 4PS7A 3ZEFA 4HBDA 3VTXA 3TWXA 3T8KA 2XPIA 3ZW3A 4WNGA 4GMJA 3SBTB 5EX0A 3S7DA 3SD5A 4KBQA 3UM2A 2HO1A 4DJAA 1OWOA 4N3BA 3PEVB 2FO7A 3UT8A 4U95D 3ASFA 2ZGGA 4JEUA 3FEXA 1TNZA 1LD8A 4DX2A 1JCSA 1OT8A 4CDNA 3NZUA 3Q4AB 3PZ3A 5CGLA 3DXMG 5HRYA 5E75A 1TJCA 3DSVA 1NA0A 5E76A 2AWIA 4GPMA 4GA0A 4Q96A 3R9MA 3CV0A 4L2YA 5LOZA 3SFXA 3EHMA 3SI5A 3Q47B 4GCOA 4W9RA 1OXJA 3T9KA 2DYRE 1IYGA 2CG2A 4PY3A 2BEDA 4GB9A 4TUUA 3LYAA 4XKCA 2VSYA 1MX2A 3G2VA 5EU0A 1O1SA 3P1UA 2CG3A 1SZ9A 2WXLA 4G25A 4OVUA 2F8YA 1OCZE 3K9IA 4BX9A 2XQ0A 3JUEA 1TN6A 1K3ZD 4NURA 1BU9A 4I9CA 1OCCE 1JCQA 3APFA 3KS2A 4MKTA 3ZIMA 4GMRA 4GYOA 2ETBA 2ILRA 3CHMA 5AYWD 5BXOA 5EN5D 5CBOA 4RLYA 3LS8A 3Q75A 1Z3YA 3IV0A 3J5PA 4I2WA 4CT0A 3PREA 5JHBA 2VJ8A 1A5EA 3C72A 4GTQA 2H6IA 3ASGA 3MCXA 4E85A 2P9NG 3G2SA 4B94A 4B8AA 4B93B 3CLJA 2PNNA 3DRAA 5D0OD 4XX5A 3FU0A 3CSFA 5ENOD 2NXPA 2QY7A 3RO2A 3ZU7B 2V0PA 1LTXA 4WAFA 3I3NA 2WXIA 2L0TB 1U3CA 4KT6B 3WG7E 4ANVA 3QARA 3AS5A 2ETCA 4KXKB 3RKVA 5T8IA 2J8SD 1Y6IA 4FP7A 4I1AA 3MV2B 2LSVA 2J09A 2QFCA 1HF8A 4HXIA 4HORA 4U8YD 3DPDA 4UWFA 3SFYA 1RW2A 2VTBB 2P9LG 3FUFA 1N11A 4HRNA 3MA5A 1S0PA 4C9BB 4K5CA 4DX6D 3EJNA 3EHNA 5D0QD 1TNYA 3CVVA 3E34A 4WUYA 4N5QA 3ZPJA 2WVIA 4LNGA 4ATGA 4JHJA 3U64A 4EQFA 2L6JA 2XEHA 4J8SA 3PEUB 5ENTD 4XI8A 2LAHA 1Q2ZA 3RRNB 3B7SA 3ML8A 5ENPD 5M72A 2GRRB 1OCOE 2IJGX 3MV3B 3ZYMA 2XCCA 3VLEA 3ULQA 3SY2A 3MYVA 2KBXA 1AP7A 5FJYA 1BI7B 2YNQA 3TAXA 2WXRA 2BKKB 3QWWA 4OYSA 1O1RA 2R02A 3GZ1A 3VLDA 4HFGA 5EYPF 4DUIA 4BESA 2IO3C 5BXUA 2WXMA 1MQSA 1N4QA 2VTBA 4CDRA 1YA0A 3NOGD 5G55A 5LP0A 4BSXA 1ZU2A 4NIKA 4UWHA 2WQHA 2WXHA 4UWGA 5G05J 4A3TA 4JVSA 1TJFA 5CECB 3D9NA 1AWCB 2FF4A 4M16A 4M7CA 4ZFHA 1K8KG 1H2UA 3PUKA 2OEWA 2EILE 5H7PA 1Z5SC 3AS4A 2I1JA 3CK7A 3S7JA 5JJTA 3TWQA 3JXIA 2R5SA 1IQRA 2QZAA 3EU9A 3ZHEB 3E32A 3IHYA 2J9QA 4GPKA 5JJ7A 1WY6A 1H6PA 4I6JA 5BUZA 2Y3AA 1E8ZA 3FY4A 4LRZA 5KCMA 1O1TA 4C48B 3ZUVB 4YDEA 3D3MA 2LNIA 3CR3A 3FH7A 2WXGA 2P9SG 4NQ0A 1KPSB 4I1OB 3T8MA 4JHKA 3B7RL 4LG6A 2XS8A 4LEUA 1UJJA 3DEPA 2XZTG 1PC2A 2WXPA 3FTVA 4ABNA 4BT9A 3SFZA 5T4YA 2DZOA 4KVOA 4Y6WA 3B7BA 3UTMA 3L9TA 4MRUA 2YHEA 4XKBA 5CMTA 2J4DA 2IOSA 4G2VA 1TN7A 5EKQD 1Z3XA 3NAWA 3EHQA 1IHGA 3BG0B 4HRMB 3L08A 3QK0A 3GW4A 3JQ0A 3TWWA 2XS1A 1H2TC 2H6FA 5AJLA 3TGOA 3U4TA 4U8HA 4CT4A 3FFLA 4RG6A 4CRWA 5JMND 3FHEA 4J8DA 3V31A 5JJ6A 2Y4UA 2F6SA 3GZ2A 4R7LA 3DBSA 3DSTA 1N0RA 4DI3A 2YQ8A 5LX8A 1DNPA 3UKRG 2B6CA 3CVWA 4ANWA 2DVWA 5CERB 1G3NB 3QAQA 4K5BA 3ESLA 2IU1A 1LF8A 4BWRA 3AU4A 1K1AA 2AXUA 3Q79A 4GU5A 5FQ6A 2WXOA 4APFA 3O48A 3Q49B 2DCPA 3ASDA 1NI1A 2NC9A 1ZB1A 2KZTB 4GYYA 1NL4A 5DBKA 5B1AE 3LY9A 3Q9NC 5AJDA 5BV1A 2BUGA 3X2QE 4PS3A 4FHKA 3ZN3A 3ZC7A 1HU3A 3CIAA 4HI9A 3APCA 2F8XK 4JW1A 4WNDA 1L5JA 5HKPA 2KCLA 4X2EA 4XIFA 4PDXA 3Q7AA 5HS0A 4N67A 2A4ZA 3I4GA 1N4SA 4GTSA 2GRLA 4FJYA 2R59A 4B89A 2EIKE 1H19A 1E90A 3QNKA 2C2LA 3SN9A 5CMWA 2UY1A 4AVXA 3RAUA 1INZA 4UQXA 4IN3B 3SHFA 1YYHA 2EIME 3BQOA 5DIZA 4U7EB 2XGMA 3FUDA 4F3VA 2JABA 3OTNA 1XGWA 2XHEA 3G2TA 3OXFA 1JWFA 2R03A 3PS6A 4AEZC 3LEWA 3ONLA 4GZ5A 4HOQA 3AG1E 5AQ9A 4QFVA 1IQUA 3V79K 4K03A 2EIJE 3NBNB 2I1KA 3FUNA 2EINE 3AU5A 4GTPA 5AQBA 5B3SE 3DSSA 1SW6A 4GA1A 4B8CB 2CFUA 4X2DA 4AM9A 3BEEA 5KJMA 2X6FA 3CVUA 2XGSA 3UM1A 1KZPA 2I2OA 3Q15A 3T5XA 4A63B 2GW1A 2P58C 2DWZA 3S2AA 3TWSA 4FLBA 5JFFA 3PZ2A 3IHVA 4DRXE 3AAAC 3HYMB 3B95A 4G8KA 3CSTA 3HXEA 3CKCA 2HM8A 3S7BA 3FTUA 4CYMD 1WDYA 3SHGA 4GMLA 4YVOA 1SA4A 3EHRA 4RVBA 2ZU6B 3Q9UC 1UN9A 4GCNA 3UT4A 4XI9A 5EDSA 1NP7A 4C0MA 3U66A 1BLXB 2DYSE 1FPPA 4UQZA 3KEAA 3KSLA 3PZ4A 3HXFA 5FWQA 2OVFA 3ZXSA 2OV8A 1SZAA 3ONKA 1JPLA 3LY8A 1WM5A 2VGEA 1HX8A 2RG8A 3Q78A 3LJ3A 2V5QC 4O60A 2VGXB 4EBAA 2UY1B 3AG3E 4TV3A 3PRZA 4UWLA 2YHCA 3P2BA 2WPVA 2G03A 4JHRA 4O1PA 3SZ7A 4J8YA 2XGOA 3HXDA 5LCWJ 4UUCA 3AG2E 3UXGA 4G8LA 2BF0X 4ME2A 5JA4D 2AJAA 1E8WA 2FBNA 4JZYA 4XEIG 4RG9A 2CHWA 3N71A 1N52A 2IOLA 3FH5A 2XENA 3TL5A 1MX4A 2RD0A 2KC7A 2QYUA 2OCCE 4EZJA 3B7TA 5FIOA 4PUCA 2JK8A 3ZKJA 3UMVA 3TG4A 2C0MA 4U96D 5B1BE 4C0EA 2NUNA 4GZ6A 4AY6A 5EIDA 4I6EA 2XPZA 4J0UA 3C3OA 3SF4A 3PH0C 2KM4A 4WNFA 4ILHB 3J5QB 3KAEA 4QQIA 4V3IA 2AXZA 3D9IA 1KT1A 3U9WA 1TR4A 3HG0D 3O4ZA 3TXNA 2BTDA 4ANUA 3UKUG 4IYPA 3L22A 5ENQD 2XRZA 3PE3A 5G04C 3UM0A 1H6KA 4G11A 4JPSA 2Y4TA 2RFAA 3NQPA 4HOSA 3TJPA 2LXLA 3EUVA 5JFZA 4DI4A 2DZNA 1DCQA 2VGXA 1TN8A 4X2CA 4FHJA 4ANXA 2AVPA 1QQEA 2WXFA 3CHQA 3PE4A 4HLEA 3MKQA 4ILGA 4BT8A 4KZCA 5ENRD 3UPVA 2X38A 3W9FA 4RQIA 2GRMA 3D9PA 1S70B 4J6IA 4MS6A 3UM3A 3R7QA 5EIBE 1EYHA 3QOUA 5CRUA 4KZ0A 4HLLA 2VSNA 4CZ2D 3TWRA 2IO2C 3SQVA 1BI8B 3DEOA 3SNXA 4YDYA 2J4BA 3PUJA 3KSQA 4CCAA 3FTZA 3EU5A 4CEMA 4F53A 1QYMA 1O5MA 5KJKA 2WMNA 3QWPA 4I1MA 4F6RD 1EDUA 2NUDA 3JXJA 4BERA 4G23A 2FEZA 4A3VA 2PQRA 1N9AA 2OOEA 2QC9A 3CVYA 2ETAA 2KCKA 3FUHA 4YVQC 5AENA 2OVBA 2OEVA 4HRLA 5A23A 4G1TA 1Z6TA 3CK9A 2UWJG 4LERA 4JB8P 3BG1B 3RJVA 3QJZA 4FU3A 1MJ0A 1D8DA 1MZCA 5FZSA 4JXTA 2LXMA 3RRMB 4HB5A 4BSZB 4ILIA 5FTPA 5D2MC 3ISMC 2VSOE 2Y69E 4WWPA 2IF4A 4JA7A 1E96B 3LKUA 3D9HA 2CHZA 4AXHA 5CRVA 4PS8A 1RZ4A 2HR2A 5AAOA 2F37A 3KEZA 3LVQE 2I6HA 1NZNA 4UI9C 1ELRA 3LPZA 1N4RA 3PZDA 1D9SA 4J7WA 3E30A 3GYZA 3FUKA 2C0LA 3URZA 2R2LA 2XCBA 4LNBA 1HG5A 1X81A 4Z68A 1KZOA 2VQ2A 3CK8A 4A1SA 1SVXA 3E33A 3CVLA
chains in the Genus database with same CATH topology
2R59A 3G2WA 1Z3YA 4B89A 3QKYA 1WAO1 4DK5A 3IV0A 4FLHA 5J90A 4I2WA 2VSXE 4CT0A 3PREA 1H19A 3D9MA 1OUVA 1E90A 2VJ8A 3QNKA 5JHBA 2C2LA 4I43A 2XRYA 3SN9A 5CMWA 4IRUA 5C1DA 4N5CA 2UY1A 2JLBA 4AVXA 3ASGA 1GW6A 3KD7A 3MCXA 4L1BA 5A7DB 4UI9J 4E85A 1INZA 4YNDA 4UQXA 4IN3B 3SHFA 5DIZA 3G2SA 4B94A 2R17C 4B8AA 3CLJA 4N39A 2KZTA 4L23A 1FVFA 5D0OD 4XX5A 2XGMA 3FUDA 1UG3A 4F3VA 5ANRA 3FU0A 3B13A 3OTNA 1XGWA 4A1GA 3I5PA 2XHEA 3CSFA 2NXPA 2QY7A 3RO2A 1KLXA 3G2TA 3OXFA 4U07A 2V0PA 4ACKA 1U3DA 3LETA 1JWFA 3TXMA 5BW8C 4WAFA 3I3NA 2WXIA 2L0TB 1U3CA 4I9EA 3QDNA 3PS6A 4I2ZA 4AEZC 4JA9A 3LEWA 3ONLA 4GZ5A 4HOQA 4KT6B 4WWNA 4ANVA 3RIBA 5FZRA 3N3UA 1E8YA 4H7XA 3FDHA 1IQUA 3JQ1A 3QARA 3AS5A 4PH4B 4QFVA 4KXKB 4UI9K 4WWOA 3RKVA 2LSUA 5T8IA 4K03A 1Y6IA 3CGHA 4FP7A 3CHRA 4I1AA 3MV2B 2I1KA 2LSVA 3FUNA 4AV7A 2J09A 3WXXA 2QFCA 3AU5A 1HF8A 4HXIA 3FTSA 4L2LA 4HORA 4GA1A 4B8CB 2CFUA 4X2DA 3DPDA 4K0RA 4AM9A 1HXIA 3BEEA 3CQGB 4UWFA 5KJMA 2X6FA 3CVUA 2XGSA 2I9CA 2GGFA 1HZ4A 2I2OA 2IFUA 2L0IA 1OWMA 3Q15A 3T5XA 4XZ4A 2GW1A 2P58C 3S7FA 4I6GA 4GZCA 1UJKA 2V5FA 4WGJA 3S2AA 4EZLA 4FLBA 2VTBB 4U0SA 5JFFA 2A5UA 3CHSA 2PM6A 3FUFA 3IHVA 4GA2A 2LAIA 4U63A 3MGBA 1ELKA 3HYMB 3LVRE 3MA5A 3QC1A 4N2QA 3ZYKA 4HOUA 1S0PA 3CSTA 4C9BB 1QZ2A 3CKCA 4CDMA 1HS6A 2HM8A 4NRHB 2CHXA 3EJNA 3S7BA 3EHNA 3FTUA 3MJWA 5D0QD 3JUIA 3SHGA 3CVVA 4GMLA 3CHOA 3FU3A 4FC8A 4YVOA 2VGYA 4RVBA 2ZU6B 3MX3A 5G2NA 4WUYA 3FUMA 3HIZA 3ZPJA 1UN9A 2WXNA 3ZYQA 2IONA 4GCNA 3UT4A 4XI9A 3UX4A 3FU5A 2WVIA 5EDSA 4ATGA 1NP7A 4C0MA 3RO3A 3EDTB 3U66A 4JHJA 3U64A 4EQFA 4BY6A 3CUCA 2L6JA 1JUQA 4I17A 4BTAA 4J8SA 4UQZA 3PEUB 3NZSA 3ENEA 4RSYA 3U3WA 4DLQA 5HQ8A 3QWVA 4XI8A 2LAHA 4LCTA 3RRNB 2PQNA 4N2SA 3FU6A 3B7SA 5BT1A 3I4RB 3ML8A 1E8XA 4MLPA 1A17A 5M72A 3FWVA 3PNLB 3OXGA 4XI0A 3OXLA 5FWQA 2OVFA 2IJGX 3MV3B 3ZXSA 2OV8A 1SZAA 3ONKA 1JPLA 3ZYMA 2XCCA 3LY8A 3VLEA 3SE5A 1WM5A 3ULQA 4EECA 2X6JA 1HX8A 2RG8A 3MYVA 3LJ3A 3IEGA 4AJWA 5FJYA 4BFRA 2V4LA 5ARGA 2VGXB 3FTXA 1N54A 2YNQA 5C2YA 4EBAA 3TG5A 2WXRA 4NACA 3TAXA 1H2VC 2UY1B 3L13A 3QWWA 4TV3A 4JEHA 2MRIA 4KYOB 3ZFWA 3LY7A 4OYSA 3GZ1A 2E2EA 2KCVA 1FCHA 3PRZA 4F1SA 3VLDA 1ELWA 4HFGA 2X6HA 3MKQB 4UWLA 2YHCA 3P2BA 4B0ZA 4LU4A 2WPVA 3ZCBA 4KMOA 3HVEA 2G03A 4ITRA 1XNFA 3PDNA 4JHRA 4CGVA 5FZQA 2WXMA 1MQSA 5FT9A 3SZ7A 4HVBA 2VTBA 2XGOA 4U0UA 2YINA 4O6FA 4CDRA 3EIJA 3CVNA 1OWLA 5G04J 2WB2A 3G2UA 2IQCA 4CGWA 5FQ7A 3PNTB 3LXUX 3JCKC 2Q7FA 4D10C 5LCWJ 1YA0A 5G55A 3UT7A 2V8SE 3QB2A 2BF0X 3IKOB 4ME2A 5LP0A 4BSXA 1E8WA 1ZU2A 1H0AA 4UQYA 2WQ7A 3HVEB 3Q5MA 5CCMA 2AW6A 4UWHA 2FBNA 2WQHA 3RU0A 4JZYA 4AIFA 4RG9A 3APDA 3R7RA 5BPPA 3B7UX 2CHWA 2WXHA 3N71A 4UWGA 2MHKA 5G05J 1N52A 2IOLA 3FH5A 4A3TA 4H7YA 3CVPA 4JVSA 4ACLA 3FUIA 4G26A 3TL5A 5CCLA 2RD0A 1TJFA 2WM9A 3D9NA 3L54A 2KC7A 3ZRHA 2FF4A 4M16A 2AXVA 2XPYA 2X6KA 3PVLA 5KJLA 4FJZA 2ONDA 4EZJA 4BTBA 3B7TA 3R9AB 1H2UA 3MZLB 3PUKA 4PUCA 2JK8A 3C98A 2XEVA 5CKLA 3D9KA 3CEQA 3MEKA 3FEYA 4GAAA 4HS2A 2WXQA 1W3BA 3UMVA 1HG2A 4P29A 3TG4A 3AS4A 2I1JA 3CK7A 2C0MA 3S7JA 4AY5A 4C0EA 5JJTA 4GZ6A 4AY6A 4JL0A 4I6EA 4A55A 1PY1A 1PAQA 2R5SA 2XPZA 4J0UA 3CQCB 1IQRA 2HYZA 3OAWA 3VTYA 4U04A 3SF4A 3RK6A 3ZHEB 3FUEA 3PH0C 2KM4A 2EQXA 3UUXA 4WNFA 4G24A 4ILHB 5G05C 3IHYA 3ZYLA 4J8EA 2J9QA 4IULA 2WMOA 3FH8A 5LCWC 2WXKA 3KAEA 2FULA 3RRUA 3L17A 4GPKA 5JJ7A 1WY6A 2PM7A 4V3IA 1JWGA 1QNFA 4I6JA 2AXZA 3HHMA 5BUZA 2Y3AA 3D9IA 1KT1A 1E8ZA 4M3OA 3FY4A 4LRZA 3U9WA 4JC8A 4GYWA 1OWPA 4WNEA 3E4BA 2CFZA 1HFAA 3O4ZA 5KCMA 4GZ3A 3TXNA 2JEKA 5LFAA 3JYSA 2BTDA 2J07A 2DBAA 3D3MA 2VY3A 4ANUA 5JHAA 4IYPA 5AIJA 2LNIA 3L22A 1KT0A 3SGHA 5HI7A 2M63A 2XRZA 3CR3A 3MKRA 3FH7A 3PE3A 4XE0A 3CVXA 5BNWA 5J08A 3ML9A 5G04C 4APOA 4BX8A 2WXGA 4NQ0A 4EPZA 3ZLMA 5EX3A 4I1OB 3T8MA 4JHKA 1H6KA 3B7RL 4G11A 4JPSA 2Y4TA 1SQMA 4LEUA 3NQPA 1UJJA 2PZIA 3FTVA 1PC2A 2WXPA 4Q94A 1UN8A 3TJPA 4ABNA 4HOSA 4BT9A 5JFZA 3SFZA 4DI4A 3L6AA 1ZBPA 5T4YA 4J8FA 2KATA 3HDXA 2E0IA 2VZAA 4KVOA 2VGXA 2PL2A 3LDZA 4FA6A 4FHJA 4X2CA 4Y6WA 4ANXA 4URKA 3EIQC 3UQ3A 1EF1C 1HH8A 2AVPA 1QQEA 4EZKA 4HOTA 2WXFA 4MRUA 5ENNA 4KVMA 4FULA 1FVHA 3CKBA 3FTYA 1NA3A 3CHQA 3PE4A 4AOFA 4PS7A 3ZEFA 1VDYA 2YHEA 4XKBA 5CMTA 4HLEA 2J4DA 3ZVVA 3MKQA 3VTXA 4NPSA 2IOSA 4ILGA 5CHEE 4G2VA 5EKQD 3D9JA 1Z3XA 4BT8A 3CHPA 4KZCA 1Y8MA 1BPOA 2X38A 3UPVA 2GRMA 2J08A 3D9PA 4J6IA 4MS6A 1IHGA 2XPIA 3BG0B 3R7QA 3ZW3A 4WNGA 4GMJA 3L08A 3SBTB 2FI7A 3ZHEA 5EX0A 2J49A 5CMYA 1EYHA 2X3MA 3S7DA 3QOUA 3SD5A 4KBQA 4TRQA 3FUJA 1UW4B 3QK0A 4KZ0A 2HO1A 3GW4A 2VSNA 3JQ0A 2WXJA 4DJAA 4DPRA 1H2TC 5AJLA 3TGOA 3U4TA 4U8HA 3SNXA 5FQ4A 1OWOA 2J4BA 4CT4A 3FFLA 4N3BA 3PEVB 2FO7A 4RG6A 3UT8A 2L9BA 3ASFA 4Q69A 2DIWA 3PUJA 3FEXA 4JEUA 4CRWA 3FHEA 4CCAA 4J8DA 1OWNA 3FTZA 4FADA 5JJ6A 4CEMA 4F53A 3ESKA 3VLFA 1MHQA 4CDNA 3NZUA 3Q4AB 2NSZA 2Y4UA 5KJNA 2F6SA 3GZ2A 4R7LA 5KJKA 5CGLA 4L7TA 3DBSA 2WMNA 2YQ8A 5E75A 4DI3A 5LX8A 1DNPA 3ZGQA 3QWPA 1TJCA 4I1MA 1NA0A 4OVVA 5FQ8A 3CVWA 5E76A 1EDUA 2AWIA 4ANWA 3D9OA 3FTWA 4GA0A 3CVQA 3FULA 4G23A 4Q96A 2FEZA 3CV0A 4A3VA 2PQRA 4L2YA 5LOZA 4U0ZA 2OOEA 1EPUA 3CVYA 3QAQA 2KCKA 3FUHA 3L16A 4YVQC 5AENA 1X5BA 2OVBA 3EHMA 3ESLA 3NF1A 5ANLA 3SI5A 4FJYA 1DVPA 1E7UA 3Q47B 4G1TA 2IU1A 1Z6TA 3CK9A 4GCOA 2MOWA 4W9RA 5A23A 2WQ6A 1HE8A 1LF8A 4N3CA 2UWJG 4LERA 3SBSA 4BWRA 3BG1B 4UWKA 3RJVA 3FP3A 3AU4A 3QJZA 3T5VA 4FU3A 1IYGA 2CG2A 3GZSA 4PY3A 4E6HA 3IBEA 4GB9A 4TUUA 2AXUA 4JXTA 5FZSA 3LYAA 4XKCA 2VSYA 3RRMB 4GU5A 5FQ6A 1E7VA 1TEZA 2WXOA 4APFA 1B89A 3G2VA 3D9LA 4EBAG 5EU0A 4ILIA 5FTPA 3O48A 3Q49B 2VSOE 2DCPA 3ASDA 2NC9A 4WWPA 3P1UA 2CG3A 1HO8A 2IF4A 2WXLA 1SZ9A 3AS8A 4JA7A 4G25A 1E96B 3LKUA 4OVUA 2KZTB 2CHZA 4AXHA 4GYYA 4PS8A 5DBKA 3K9IA 4BX9A 3LY9A 2HR2A 5AJDA 5BV1A 2BUGA 3ASHA 2XQ0A 4Y6CA 1P5QA 4PS3A 3KEZA 4NURA 4FHKA 3LVQE 3ZN3A 2I6HA 1NZNA 3ZC7A 1HU3A 4I9CA 3CIAA 4UI9C 1ELRA 3LPZA 3S6AA 4LUNU 3APCA 3PZDA 5A6CA 3APFA 3KS2A 4MKTA 3ZIMA 4JW1A 3GYZA 4WNDA 2X6IA 1L5JA 3FUKA 4GYOA 2KCLA 2ILRA 5T3RA 4X2EA 4AP2A 2C0LA 3CHMA 3LCAA 3URZA 2XCBA 4XIFA 4PDXA 1HG5A 4N67A 2A4ZA 5AYWD 3I4GA 4GZDA 2LO6A 2VYIA 5BV0A 4DLOA 2VQ2A 3CK8A 4A1SA 4F7AA 5ARFA 2GRLA 4N3AA 3CVLA 3LS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QKY A;  1WAO 1;  4I2W A;  1OUV A;  2C2L A;  3SN9 A;  5C1D A;  4N5C A;  2UY1 A;  2JLB A;  3ASG A;  3KD7 A;  5A7D B;  4UI9 J;  4YND A;  4UQX A;  4IN3 B;  5DIZ A;  4B94 A;  4N39 A;  5D0O D;  2XGM A;  4F3V A;  3RO2 A;  1KLX A;  3OXF A;  4U07 A;  3LET A;  5BW8 C;  4I9E A;  3QDN A;  4I2Z A;  4JA9 A;  4GZ5 A;  4HOQ A;  3RIB A;  5FZR A;  3N3U A;  4H7X A;  4UI9 K;  3AS5 A;  4KXK B;  3RKV A;  2LSU A;  4I1A A;  3MV2 B;  2LSV A;  3WXX A;  2QFC A;  4HOR A;  4GA1 A;  4X2D A;  4AM9 A;  1HXI A;  3BEE A;  5KJM A;  2XGS A;  1HZ4 A;  2IFU A;  3Q15 A;  2GW1 A;  2P58 C;  3S7F A;  2V5F A;  4WGJ A;  4U0S A;  5JFF A;  4GA2 A;  3HYM B;  3MA5 A;  4N2Q A;  4HOU A;  1QZ2 A;  3CKC A;  4NRH B;  3S7B A;  5D0Q D;  3SHG A;  4YVO A;  2VGY A;  4WUY A;  3ZPJ A;  4GCN A;  4XI9 A;  3RO3 A;  3EDT B;  4EQF A;  3CUC A;  2L6J A;  4I17 A;  4BTA A;  4UQZ A;  3U3W A;  5HQ8 A;  3QWV A;  4XI8 A;  2PQN A;  4N2S A;  5BT1 A;  5M72 A;  1A17 A;  3FWV A;  4XI0 A;  3OXG A;  3OXL A;  3MV3 B;  2XCC A;  3LY8 A;  3SE5 A;  1WM5 A;  3ULQ A;  3IEG A;  5FJY A;  5ARG A;  2VGX B;  3TG5 A;  3TAX A;  2UY1 B;  3QWW A;  4KYO B;  3ZFW A;  3LY7 A;  3GZ1 A;  2E2E A;  2KCV A;  1FCH A;  1ELW A;  2YHC A;  4LU4 A;  2WPV A;  3ZCB A;  2G03 A;  4ITR A;  1XNF A;  3PDN A;  4JHR A;  4CGV A;  5FZQ A;  3SZ7 A;  5FT9 A;  2XGO A;  4U0U A;  4O6F A;  4CDR A;  3CVN A;  5G04 J;  4CGW A;  2Q7F A;  5LCW J;  1YA0 A;  4ME2 A;  1ZU2 A;  4UQY A;  3Q5M A;  5CCM A;  2FBN A;  2WQH A;  3RU0 A;  4AIF A;  4RG9 A;  3N71 A;  5G05 J;  2MHK A;  4H7Y A;  3CVP A;  4G26 A;  5CCL A;  2KC7 A;  2FF4 A;  4M16 A;  5KJL A;  2OND A;  4BTB A;  3R9A B;  2JK8 A;  2XEV A;  5CKL A;  3CEQ A;  3MEK A;  1W3B A;  3TG4 A;  3AS4 A;  3CK7 A;  2C0M A;  3S7J A;  4AY5 A;  5JJT A;  4GZ6 A;  4AY6 A;  4JL0 A;  2R5S A;  4J0U A;  2HYZ A;  3VTY A;  4U04 A;  3SF4 A;  3ZHE B;  3UUX A;  4WNF A;  4G24 A;  5G05 C;  4J8E A;  2J9Q A;  5LCW C;  3KAE A;  4GPK A;  5JJ7 A;  1KT1 A;  4GYW A;  4WNE A;  3E4B A;  4GZ3 A;  3JYS A;  2DBA A;  2VY3 A;  2LNI A;  1KT0 A;  5HI7 A;  3MKR A;  3PE3 A;  5BNW A;  5G04 C;  4APO A;  4NQ0 A;  3ZLM A;  5EX3 A;  2Y4T A;  4LEU A;  2PZI A;  4ABN A;  1PC2 A;  4HOS A;  4BT9 A;  5JFZ A;  1ZBP A;  4J8F A;  2KAT A;  2VZA A;  2VGX A;  2PL2 A;  4X2C A;  4Y6W A;  3UQ3 A;  1HH8 A;  2AVP A;  1QQE A;  4HOT A;  3CKB A;  1NA3 A;  3PE4 A;  5CMT A;  3VTX A;  4NPS A;  5CHE E;  4G2V A;  5EKQ D;  4BT8 A;  1Y8M A;  3UPV A;  1IHG A;  2XPI A;  4WNG A;  3ZHE A;  2FI7 A;  5EX0 A;  3S7D A;  3QOU A;  4KBQ A;  2HO1 A;  3GW4 A;  2VSN A;  3TGO A;  3U4T A;  4N3B A;  3FFL A;  2FO7 A;  4RG6 A;  3ASF A;  4J8D A;  5JJ6 A;  3ESK A;  5KJN A;  3Q4A B;  2Y4U A;  2F6S A;  3GZ2 A;  5KJK A;  5CGL A;  2YQ8 A;  3ZGQ A;  3QWP A;  1TJC A;  1NA0 A;  4GA0 A;  3CVQ A;  4G23 A;  2FEZ A;  3CV0 A;  2PQR A;  4U0Z A;  2OOE A;  2KCK A;  4YVQ C;  3NF1 A;  3Q47 B;  4G1T A;  4GCO A;  3CK9 A;  4W9R A;  4N3C A;  2UWJ G;  4BWR A;  3RJV A;  3FP3 A;  1IYG A;  4PY3 A;  5FZS A;  3LYA A;  2VSY A;  1B89 A;  5EU0 A;  5FTP A;  3O48 A;  3Q49 B;  3ASD A;  2NC9 A;  2IF4 A;  3AS8 A;  4JA7 A;  4G25 A;  1E96 B;  3LKU A;  4GYY A;  5DBK A;  3K9I A;  3LY9 A;  2HR2 A;  2BUG A;  3ASH A;  4Y6C A;  1P5Q A;  3ZN3 A;  2I6H A;  1NZN A;  3ZC7 A;  4I9C A;  4UI9 C;  1ELR A;  3LPZ A;  3S6A A;  5A6C A;  3KS2 A;  3GYZ A;  4WND A;  4GYO A;  2KCL A;  4X2E A;  2C0L A;  3LCA A;  3URZ A;  2XCB A;  4XIF A;  5AYW D;  4N67 A;  2VYI A;  2VQ2 A;  3CK8 A;  4A1S A;  5ARF A;  4N3A A;  3CVL A; 
#chains in the Genus database with same CATH topology
 3NOC D;  3QKY A;  5KNG A;  1WAO 1;  3Q73 A;  4DK5 A;  4FLH A;  5J90 A;  2VSX E;  3D9M A;  1OUV A;  4N5C A;  1N0Q A;  1YMP A;  2R17 C;  2KZT A;  4L23 A;  4TXQ A;  3B13 A;  4A1G A;  1TNO A;  3I5P A;  3PZ1 A;  5KNH D;  4U07 A;  1U3D A;  3LET A;  3TXM A;  2BKG A;  3ABL E;  1TNB A;  1D8E A;  3ABK E;  4I2Z A;  4JA9 A;  3RIB A;  3N3U A;  1E8Y A;  3V2X A;  4H7X A;  4PH4 B;  4LSZ E;  4WWO A;  3TWU A;  2LSU A;  3DPY A;  3WXX A;  4L2L A;  4U8V D;  3AJI A;  2GGF A;  1HZ4 A;  1S63 A;  2IFU A;  2L0I A;  1OWM A;  4XZ4 A;  4ZHB A;  4I6G A;  4LNU D;  1UJK A;  1K1B A;  4EZL A;  3CHS A;  2A5U A;  4GA2 A;  4U63 A;  2PM6 A;  3MGB A;  1ELK A;  3LVR E;  5D66 A;  3QC1 A;  3ZYK A;  1H6O A;  1QZ2 A;  3MJW A;  4FC8 A;  3FU3 A;  3C3Q A;  3MX3 A;  3HIZ A;  3ZYQ A;  2ION A;  3V2O A;  3FU5 A;  4BET A;  2ZXW E;  3RO3 A;  5CBN A;  4BY6 A;  3CUC A;  1JUQ A;  4I17 A;  3ENE A;  4RSY A;  3U3W A;  2ZIS A;  4LCT A;  4N2S A;  5BT1 A;  3I4R B;  4YDO A;  1E8X A;  2XZD G;  2GRO B;  5ENS D;  2X6J A;  5FIN A;  2V4L A;  5ARG A;  1N54 A;  5C2Y A;  1H2V C;  2NYJ A;  1NH1 A;  4KYO B;  3ZFW A;  3LY7 A;  2E2E A;  2KCV A;  4F1S A;  1ELW A;  4TUM A;  4B0Z A;  4LU4 A;  4ITR A;  1XNF A;  3HRA A;  5FZQ A;  4U0U A;  4O6F A;  3EIJ A;  3CVN A;  3W9G A;  5G04 J;  2IQC A;  4DX1 A;  3PNT B;  3LXU X;  2Q7F A;  4D10 C;  3E37 A;  3UT7 A;  3AG4 E;  3QB2 A;  3SO8 A;  4UQY A;  3HVE B;  5CCM A;  2AW6 A;  5ITZ F;  3RU0 A;  1V54 E;  3Q7F A;  4AIF A;  3R7R A;  3B7U X;  3UI2 A;  4H7Y A;  3FUI A;  4G26 A;  5CCL A;  2ZIR A;  2H6G A;  2AXV A;  2X6K A;  3PVL A;  5EYL A;  4FJZ A;  2OND A;  3R9A B;  2XEV A;  5CKL A;  4GAA A;  3CEQ A;  3FEY A;  4HS2 A;  1W3B A;  1HG2 A;  5AN8 A;  4AY5 A;  4A55 A;  1TNU A;  1PY1 A;  1PAQ A;  3CQC B;  4BEP A;  3OAW A;  3VTY A;  4U04 A;  3RK6 A;  3FUE A;  1IKN D;  4G24 A;  5G05 C;  1JCR A;  4J8E A;  2WMO A;  3FH8 A;  4GTR A;  2WXK A;  3L17 A;  2PM7 A;  1JWG A;  1QNF A;  2L6B A;  4JC8 A;  2CFZ A;  1HFA A;  4GZ3 A;  2HE0 A;  3JYS A;  2MYO A;  2J07 A;  2DBA A;  2VY3 A;  5JHA A;  5AIJ A;  1OCR E;  1KT0 A;  3SGH A;  5HI7 A;  3MKR A;  3CVX A;  5BNW A;  5J08 A;  3ML9 A;  4APO A;  3ZLM A;  3ZXP A;  1SQM A;  2PZI A;  1UN8 A;  2GRQ B;  1V55 E;  3L6A A;  1OY3 D;  1ZBP A;  4K5A B;  4J8F A;  2KAT A;  3HDX A;  4EHM A;  2E0I A;  5AQ7 A;  2VZA A;  2PL2 A;  4URK A;  3UQ3 A;  3UIN C;  3C5R A;  4EZK A;  5KWD A;  5ENN A;  5CEA A;  3FTY A;  1VDY A;  5IY5 E;  3ZVV A;  4NPS A;  5CHE E;  3D9J A;  3CHP A;  1Y8M A;  1BPO A;  2J08 A;  3ZHE A;  2FI7 A;  2J49 A;  5CMY A;  2X3M A;  4TRQ A;  3FUJ A;  1UW4 B;  2WXJ A;  3LJN A;  3DSW A;  4DPR A;  3V30 A;  1LD7 A;  5FQ4 A;  2L9B A;  4Q69 A;  2DIW A;  1IHB A;  1OWN A;  2F0Y A;  2XEE A;  4FAD A;  3ESK A;  3VLF A;  1MHQ A;  5KJN A;  1QBQ A;  2NSZ A;  2A5E A;  2RKK A;  2P2C P;  4L7T A;  3ZGQ A;  4OVV A;  5FQ8 A;  3ABM E;  2FO1 E;  3D9O A;  3FTW A;  3CVQ A;  3FUL A;  2P9I G;  4DX7 D;  4U0Z A;  1EPU A;  3ULE G;  3L16 A;  1X5B A;  3NF1 A;  5ANL A;  1WG0 A;  1DVP A;  1E7U A;  2WQ6 A;  2MOW A;  1HE8 A;  4N3C A;  3SBS A;  3ZNG A;  1N95 A;  4UWK A;  3DSU A;  3FP3 A;  3T5V A;  3GZS A;  4E6H A;  3IBE A;  1MYO A;  3DXK G;  1E7V A;  1TEZ A;  1B89 A;  3D9L A;  4EBA G;  2H6H A;  1HO8 A;  3UIP C;  3AS8 A;  4Y6C A;  3ASH A;  1U2V G;  1N94 A;  1P5Q A;  2V4H C;  2Y1L E;  2P9U G;  3S6A A;  4LUN U;  5A6C A;  1N4P A;  2X6I A;  5T3R A;  4AP2 A;  3LCA A;  1IXV A;  4GZD A;  2LO6 A;  2VYI A;  5BV0 A;  4DLO A;  3RSE G;  4F7A A;  5ARF A;  4N3A A;  4IRU A;  3DSX A;  4F1P A;  3G2W A;  4ATZ D;  1YCS B;  5AQA A;  4GTO A;  4I43 A;  2XRY A;  5C1D A;  2JLB A;  2R05 A;  1GW6 A;  3KD7 A;  3HXC A;  4L1B A;  5A7D B;  4UI9 J;  4YND A;  4DX5 D;  4TXR A;  4N39 A;  1FVF A;  1UG3 A;  5ANR A;  2IEJ A;  1KLX A;  2ZGD A;  4ACK A;  5BW8 C;  3DWL G;  4I9E A;  3QDN A;  4WWN A;  4L9P A;  5FZR A;  3FDH A;  4UI9 K;  3JQ1 A;  4GTT A;  3CGH A;  3CHR A;  4AV7 A;  2P9P G;  4JD2 G;  3F6Q A;  4TXP A;  1FT1 A;  3FTS A;  4K0R A;  1HXI A;  3CQG B;  2I9C A;  1BD8 A;  4HQD A;  3S7F A;  4GZC A;  2V5F A;  4WGJ A;  4U0S A;  2LAI A;  3NB2 A;  4N2Q A;  4HOU A;  4CDM A;  1HS6 A;  4NRH B;  2CHX A;  3JUI A;  1DC2 A;  3CHO A;  2VGY A;  1MX6 A;  5G2N A;  3FUM A;  2WXN A;  2IY0 C;  3UX4 A;  2LUH A;  5EIL A;  3EDT B;  2GRP B;  4BTA A;  3NZS A;  4DLQ A;  5HQ8 A;  3QWV A;  4OAU C;  2PQN A;  3FU6 A;  4MLP A;  1A17 A;  3FWV A;  3PNL B;  3OXG A;  4XI0 A;  3OXL A;  4YDW A;  3SE5 A;  4EEC A;  4O1O A;  1FT2 A;  3ULY A;  3IEG A;  4AJW A;  4BFR A;  2Y0B G;  3FTX A;  1TYQ G;  3TG5 A;  4NAC A;  3C3R A;  3L13 A;  4JEH A;  2MRI A;  1FCH A;  4HI8 A;  2X6H A;  3MKQ B;  3ZCB A;  4KMO A;  3HVE A;  3PDN A;  4CGV A;  1DCE A;  4HVB A;  5FT9 A;  2YIN A;  1S64 A;  1OWL A;  2WB2 A;  3G2U A;  4CGW A;  5FQ7 A;  2GRN B;  3JCK C;  2V8S E;  2KXP C;  3IKO B;  3BUA A;  1H0A A;  2WQ7 A;  3Q5M A;  5BPP A;  3APD A;  2MHK A;  3CVP A;  4ACL A;  5CED B;  2WM9 A;  3L54 A;  3ZRH A;  2XPY A;  5KJL A;  4BTB A;  3MZL B;  3C98 A;  3D9K A;  3MEK A;  3UIO C;  2WXQ A;  4P29 A;  4MBG A;  1NFI E;  4JL0 A;  4GTM A;  3IXE A;  5AAR A;  2HYZ A;  2EQX A;  3UUX A;  3ZYL A;  1UOH A;  4IUL A;  3ASO E;  2QYJ A;  5LCW C;  4OAV B;  3BU8 A;  2FUL A;  3RRU A;  2B0O E;  3HHM A;  4M3O A;  4GYW A;  1OWP A;  4WNE A;  3E4B A;  4GTV A;  2JEK A;  5LFA A;  3TWV A;  5KBA A;  1SA5 A;  3TWT A;  2M63 A;  2P9K G;  4XE0 A;  4BX8 A;  4EPZ A;  5EX3 A;  4Q94 A;  3HXB A;  4X8Q A;  2RFM A;  3LDZ A;  4FA6 A;  3EIQ C;  1EF1 C;  4HNA D;  3L82 A;  1HH8 A;  3ASN E;  4HOT A;  4KVM A;  4FUL A;  1FVH A;  3CKB A;  1NA3 A;  4AOF A;  4PS7 A;  3ZEF A;  4HBD A;  3VTX A;  3TWX A;  3T8K A;  2XPI A;  3ZW3 A;  4WNG A;  4GMJ A;  3SBT B;  5EX0 A;  3S7D A;  3SD5 A;  4KBQ A;  3UM2 A;  2HO1 A;  4DJA A;  1OWO A;  4N3B A;  3PEV B;  2FO7 A;  3UT8 A;  4U95 D;  3ASF A;  2ZGG A;  4JEU A;  3FEX A;  1TNZ A;  1LD8 A;  4DX2 A;  1JCS A;  1OT8 A;  4CDN A;  3NZU A;  3Q4A B;  3PZ3 A;  5CGL A;  3DXM G;  5HRY A;  5E75 A;  1TJC A;  3DSV A;  1NA0 A;  5E76 A;  2AWI A;  4GPM A;  4GA0 A;  4Q96 A;  3R9M A;  3CV0 A;  4L2Y A;  5LOZ A;  3SFX A;  3EHM A;  3SI5 A;  3Q47 B;  4GCO A;  4W9R A;  1OXJ A;  3T9K A;  2DYR E;  1IYG A;  2CG2 A;  4PY3 A;  2BED A;  4GB9 A;  4TUU A;  3LYA A;  4XKC A;  2VSY A;  1MX2 A;  3G2V A;  5EU0 A;  1O1S A;  3P1U A;  2CG3 A;  1SZ9 A;  2WXL A;  4G25 A;  4OVU A;  2F8Y A;  1OCZ E;  3K9I A;  4BX9 A;  2XQ0 A;  3JUE A;  1TN6 A;  1K3Z D;  4NUR A;  1BU9 A;  4I9C A;  1OCC E;  1JCQ A;  3APF A;  3KS2 A;  4MKT A;  3ZIM A;  4GMR A;  4GYO A;  2ETB A;  2ILR A;  3CHM A;  5AYW D;  5BXO A;  5EN5 D;  5CBO A;  4RLY A;  3LS8 A;  3Q75 A;  1Z3Y A;  3IV0 A;  3J5P A;  4I2W A;  4CT0 A;  3PRE A;  5JHB A;  2VJ8 A;  1A5E A;  3C72 A;  4GTQ A;  2H6I A;  3ASG A;  3MCX A;  4E85 A;  2P9N G;  3G2S A;  4B94 A;  4B8A A;  4B93 B;  3CLJ A;  2PNN A;  3DRA A;  5D0O D;  4XX5 A;  3FU0 A;  3CSF A;  5ENO D;  2NXP A;  2QY7 A;  3RO2 A;  3ZU7 B;  2V0P A;  1LTX A;  4WAF A;  3I3N A;  2WXI A;  2L0T B;  1U3C A;  4KT6 B;  3WG7 E;  4ANV A;  3QAR A;  3AS5 A;  2ETC A;  4KXK B;  3RKV A;  5T8I A;  2J8S D;  1Y6I A;  4FP7 A;  4I1A A;  3MV2 B;  2LSV A;  2J09 A;  2QFC A;  1HF8 A;  4HXI A;  4HOR A;  4U8Y D;  3DPD A;  4UWF A;  3SFY A;  1RW2 A;  2VTB B;  2P9L G;  3FUF A;  1N11 A;  4HRN A;  3MA5 A;  1S0P A;  4C9B B;  4K5C A;  4DX6 D;  3EJN A;  3EHN A;  5D0Q D;  1TNY A;  3CVV A;  3E34 A;  4WUY A;  4N5Q A;  3ZPJ A;  2WVI A;  4LNG A;  4ATG A;  4JHJ A;  3U64 A;  4EQF A;  2L6J A;  2XEH A;  4J8S A;  3PEU B;  5ENT D;  4XI8 A;  2LAH A;  1Q2Z A;  3RRN B;  3B7S A;  3ML8 A;  5ENP D;  5M72 A;  2GRR B;  1OCO E;  2IJG X;  3MV3 B;  3ZYM A;  2XCC A;  3VLE A;  3ULQ A;  3SY2 A;  3MYV A;  2KBX A;  1AP7 A;  5FJY A;  1BI7 B;  2YNQ A;  3TAX A;  2WXR A;  2BKK B;  3QWW A;  4OYS A;  1O1R A;  2R02 A;  3GZ1 A;  3VLD A;  4HFG A;  5EYP F;  4DUI A;  4BES A;  2IO3 C;  5BXU A;  2WXM A;  1MQS A;  1N4Q A;  2VTB A;  4CDR A;  1YA0 A;  3NOG D;  5G55 A;  5LP0 A;  4BSX A;  1ZU2 A;  4NIK A;  4UWH A;  2WQH A;  2WXH A;  4UWG A;  5G05 J;  4A3T A;  4JVS A;  1TJF A;  5CEC B;  3D9N A;  1AWC B;  2FF4 A;  4M16 A;  4M7C A;  4ZFH A;  1K8K G;  1H2U A;  3PUK A;  2OEW A;  2EIL E;  5H7P A;  1Z5S C;  3AS4 A;  2I1J A;  3CK7 A;  3S7J A;  5JJT A;  3TWQ A;  3JXI A;  2R5S A;  1IQR A;  2QZA A;  3EU9 A;  3ZHE B;  3E32 A;  3IHY A;  2J9Q A;  4GPK A;  5JJ7 A;  1WY6 A;  1H6P A;  4I6J A;  5BUZ A;  2Y3A A;  1E8Z A;  3FY4 A;  4LRZ A;  5KCM A;  1O1T A;  4C48 B;  3ZUV B;  4YDE A;  3D3M A;  2LNI A;  3CR3 A;  3FH7 A;  2WXG A;  2P9S G;  4NQ0 A;  1KPS B;  4I1O B;  3T8M A;  4JHK A;  3B7R L;  4LG6 A;  2XS8 A;  4LEU A;  1UJJ A;  3DEP A;  2XZT G;  1PC2 A;  2WXP A;  3FTV A;  4ABN A;  4BT9 A;  3SFZ A;  5T4Y A;  2DZO A;  4KVO A;  4Y6W A;  3B7B A;  3UTM A;  3L9T A;  4MRU A;  2YHE A;  4XKB A;  5CMT A;  2J4D A;  2IOS A;  4G2V A;  1TN7 A;  5EKQ D;  1Z3X A;  3NAW A;  3EHQ A;  1IHG A;  3BG0 B;  4HRM B;  3L08 A;  3QK0 A;  3GW4 A;  3JQ0 A;  3TWW A;  2XS1 A;  1H2T C;  2H6F A;  5AJL A;  3TGO A;  3U4T A;  4U8H A;  4CT4 A;  3FFL A;  4RG6 A;  4CRW A;  5JMN D;  3FHE A;  4J8D A;  3V31 A;  5JJ6 A;  2Y4U A;  2F6S A;  3GZ2 A;  4R7L A;  3DBS A;  3DST A;  1N0R A;  4DI3 A;  2YQ8 A;  5LX8 A;  1DNP A;  3UKR G;  2B6C A;  3CVW A;  4ANW A;  2DVW A;  5CER B;  1G3N B;  3QAQ A;  4K5B A;  3ESL A;  2IU1 A;  1LF8 A;  4BWR A;  3AU4 A;  1K1A A;  2AXU A;  3Q79 A;  4GU5 A;  5FQ6 A;  2WXO A;  4APF A;  3O48 A;  3Q49 B;  2DCP A;  3ASD A;  1NI1 A;  2NC9 A;  1ZB1 A;  2KZT B;  4GYY A;  1NL4 A;  5DBK A;  5B1A E;  3LY9 A;  3Q9N C;  5AJD A;  5BV1 A;  2BUG A;  3X2Q E;  4PS3 A;  4FHK A;  3ZN3 A;  3ZC7 A;  1HU3 A;  3CIA A;  4HI9 A;  3APC A;  2F8X K;  4JW1 A;  4WND A;  1L5J A;  5HKP A;  2KCL A;  4X2E A;  4XIF A;  4PDX A;  3Q7A A;  5HS0 A;  4N67 A;  2A4Z A;  3I4G A;  1N4S A;  4GTS A;  2GRL A;  4FJY A;  2R59 A;  4B89 A;  2EIK E;  1H19 A;  1E90 A;  3QNK A;  2C2L A;  3SN9 A;  5CMW A;  2UY1 A;  4AVX A;  3RAU A;  1INZ A;  4UQX A;  4IN3 B;  3SHF A;  1YYH A;  2EIM E;  3BQO A;  5DIZ A;  4U7E B;  2XGM A;  3FUD A;  4F3V A;  2JAB A;  3OTN A;  1XGW A;  2XHE A;  3G2T A;  3OXF A;  1JWF A;  2R03 A;  3PS6 A;  4AEZ C;  3LEW A;  3ONL A;  4GZ5 A;  4HOQ A;  3AG1 E;  5AQ9 A;  4QFV A;  1IQU A;  3V79 K;  4K03 A;  2EIJ E;  3NBN B;  2I1K A;  3FUN A;  2EIN E;  3AU5 A;  4GTP A;  5AQB A;  5B3S E;  3DSS A;  1SW6 A;  4GA1 A;  4B8C B;  2CFU A;  4X2D A;  4AM9 A;  3BEE A;  5KJM A;  2X6F A;  3CVU A;  2XGS A;  3UM1 A;  1KZP A;  2I2O A;  3Q15 A;  3T5X A;  4A63 B;  2GW1 A;  2P58 C;  2DWZ A;  3S2A A;  3TWS A;  4FLB A;  5JFF A;  3PZ2 A;  3IHV A;  4DRX E;  3AAA C;  3HYM B;  3B95 A;  4G8K A;  3CST A;  3HXE A;  3CKC A;  2HM8 A;  3S7B A;  3FTU A;  4CYM D;  1WDY A;  3SHG A;  4GML A;  4YVO A;  1SA4 A;  3EHR A;  4RVB A;  2ZU6 B;  3Q9U C;  1UN9 A;  4GCN A;  3UT4 A;  4XI9 A;  5EDS A;  1NP7 A;  4C0M A;  3U66 A;  1BLX B;  2DYS E;  1FPP A;  4UQZ A;  3KEA A;  3KSL A;  3PZ4 A;  3HXF A;  5FWQ A;  2OVF A;  3ZXS A;  2OV8 A;  1SZA A;  3ONK A;  1JPL A;  3LY8 A;  1WM5 A;  2VGE A;  1HX8 A;  2RG8 A;  3Q78 A;  3LJ3 A;  2V5Q C;  4O60 A;  2VGX B;  4EBA A;  2UY1 B;  3AG3 E;  4TV3 A;  3PRZ A;  4UWL A;  2YHC A;  3P2B A;  2WPV A;  2G03 A;  4JHR A;  4O1P A;  3SZ7 A;  4J8Y A;  2XGO A;  3HXD A;  5LCW J;  4UUC A;  3AG2 E;  3UXG A;  4G8L A;  2BF0 X;  4ME2 A;  5JA4 D;  2AJA A;  1E8W A;  2FBN A;  4JZY A;  4XEI G;  4RG9 A;  2CHW A;  3N71 A;  1N52 A;  2IOL A;  3FH5 A;  2XEN A;  3TL5 A;  1MX4 A;  2RD0 A;  2KC7 A;  2QYU A;  2OCC E;  4EZJ A;  3B7T A;  5FIO A;  4PUC A;  2JK8 A;  3ZKJ A;  3UMV A;  3TG4 A;  2C0M A;  4U96 D;  5B1B E;  4C0E A;  2NUN A;  4GZ6 A;  4AY6 A;  5EID A;  4I6E A;  2XPZ A;  4J0U A;  3C3O A;  3SF4 A;  3PH0 C;  2KM4 A;  4WNF A;  4ILH B;  3J5Q B;  3KAE A;  4QQI A;  4V3I A;  2AXZ A;  3D9I A;  1KT1 A;  3U9W A;  1TR4 A;  3HG0 D;  3O4Z A;  3TXN A;  2BTD A;  4ANU A;  3UKU G;  4IYP A;  3L22 A;  5ENQ D;  2XRZ A;  3PE3 A;  5G04 C;  3UM0 A;  1H6K A;  4G11 A;  4JPS A;  2Y4T A;  2RFA A;  3NQP A;  4HOS A;  3TJP A;  2LXL A;  3EUV A;  5JFZ A;  4DI4 A;  2DZN A;  1DCQ A;  2VGX A;  1TN8 A;  4X2C A;  4FHJ A;  4ANX A;  2AVP A;  1QQE A;  2WXF A;  3CHQ A;  3PE4 A;  4HLE A;  3MKQ A;  4ILG A;  4BT8 A;  4KZC A;  5ENR D;  3UPV A;  2X38 A;  3W9F A;  4RQI A;  2GRM A;  3D9P A;  1S70 B;  4J6I A;  4MS6 A;  3UM3 A;  3R7Q A;  5EIB E;  1EYH A;  3QOU A;  5CRU A;  4KZ0 A;  4HLL A;  2VSN A;  4CZ2 D;  3TWR A;  2IO2 C;  3SQV A;  1BI8 B;  3DEO A;  3SNX A;  4YDY A;  2J4B A;  3PUJ A;  3KSQ A;  4CCA A;  3FTZ A;  3EU5 A;  4CEM A;  4F53 A;  1QYM A;  1O5M A;  5KJK A;  2WMN A;  3QWP A;  4I1M A;  4F6R D;  1EDU A;  2NUD A;  3JXJ A;  4BER A;  4G23 A;  2FEZ A;  4A3V A;  2PQR A;  1N9A A;  2OOE A;  2QC9 A;  3CVY A;  2ETA A;  2KCK A;  3FUH A;  4YVQ C;  5AEN A;  2OVB A;  2OEV A;  4HRL A;  5A23 A;  4G1T A;  1Z6T A;  3CK9 A;  2UWJ G;  4LER A;  4JB8 P;  3BG1 B;  3RJV A;  3QJZ A;  4FU3 A;  1MJ0 A;  1D8D A;  1MZC A;  5FZS A;  4JXT A;  2LXM A;  3RRM B;  4HB5 A;  4BSZ B;  4ILI A;  5FTP A;  5D2M C;  3ISM C;  2VSO E;  2Y69 E;  4WWP A;  2IF4 A;  4JA7 A;  1E96 B;  3LKU A;  3D9H A;  2CHZ A;  4AXH A;  5CRV A;  4PS8 A;  1RZ4 A;  2HR2 A;  5AAO A;  2F37 A;  3KEZ A;  3LVQ E;  2I6H A;  1NZN A;  4UI9 C;  1ELR A;  3LPZ A;  1N4R A;  3PZD A;  1D9S A;  4J7W A;  3E30 A;  3GYZ A;  3FUK A;  2C0L A;  3URZ A;  2R2L A;  2XCB A;  4LNB A;  1HG5 A;  1X81 A;  4Z68 A;  1KZO A;  2VQ2 A;  3CK8 A;  4A1S A;  1SVX A;  3E33 A;  3CVL A; 
#chains in the Genus database with same CATH homology
 2R59 A;  3G2W A;  1Z3Y A;  4B89 A;  3QKY A;  1WAO 1;  4DK5 A;  3IV0 A;  4FLH A;  5J90 A;  4I2W A;  2VSX E;  4CT0 A;  3PRE A;  1H19 A;  3D9M A;  1OUV A;  1E90 A;  2VJ8 A;  3QNK A;  5JHB A;  2C2L A;  4I43 A;  2XRY A;  3SN9 A;  5CMW A;  4IRU A;  5C1D A;  4N5C A;  2UY1 A;  2JLB A;  4AVX A;  3ASG A;  1GW6 A;  3KD7 A;  3MCX A;  4L1B A;  5A7D B;  4UI9 J;  4E85 A;  1INZ A;  4YND A;  4UQX A;  4IN3 B;  3SHF A;  5DIZ A;  3G2S A;  4B94 A;  2R17 C;  4B8A A;  3CLJ A;  4N39 A;  2KZT A;  4L23 A;  1FVF A;  5D0O D;  4XX5 A;  2XGM A;  3FUD A;  1UG3 A;  4F3V A;  5ANR A;  3FU0 A;  3B13 A;  3OTN A;  1XGW A;  4A1G A;  3I5P A;  2XHE A;  3CSF A;  2NXP A;  2QY7 A;  3RO2 A;  1KLX A;  3G2T A;  3OXF A;  4U07 A;  2V0P A;  4ACK A;  1U3D A;  3LET A;  1JWF A;  3TXM A;  5BW8 C;  4WAF A;  3I3N A;  2WXI A;  2L0T B;  1U3C A;  4I9E A;  3QDN A;  3PS6 A;  4I2Z A;  4AEZ C;  4JA9 A;  3LEW A;  3ONL A;  4GZ5 A;  4HOQ A;  4KT6 B;  4WWN A;  4ANV A;  3RIB A;  5FZR A;  3N3U A;  1E8Y A;  4H7X A;  3FDH A;  1IQU A;  3JQ1 A;  3QAR A;  3AS5 A;  4PH4 B;  4QFV A;  4KXK B;  4UI9 K;  4WWO A;  3RKV A;  2LSU A;  5T8I A;  4K03 A;  1Y6I A;  3CGH A;  4FP7 A;  3CHR A;  4I1A A;  3MV2 B;  2I1K A;  2LSV A;  3FUN A;  4AV7 A;  2J09 A;  3WXX A;  2QFC A;  3AU5 A;  1HF8 A;  4HXI A;  3FTS A;  4L2L A;  4HOR A;  4GA1 A;  4B8C B;  2CFU A;  4X2D A;  3DPD A;  4K0R A;  4AM9 A;  1HXI A;  3BEE A;  3CQG B;  4UWF A;  5KJM A;  2X6F A;  3CVU A;  2XGS A;  2I9C A;  2GGF A;  1HZ4 A;  2I2O A;  2IFU A;  2L0I A;  1OWM A;  3Q15 A;  3T5X A;  4XZ4 A;  2GW1 A;  2P58 C;  3S7F A;  4I6G A;  4GZC A;  1UJK A;  2V5F A;  4WGJ A;  3S2A A;  4EZL A;  4FLB A;  2VTB B;  4U0S A;  5JFF A;  2A5U A;  3CHS A;  2PM6 A;  3FUF A;  3IHV A;  4GA2 A;  2LAI A;  4U63 A;  3MGB A;  1ELK A;  3HYM B;  3LVR E;  3MA5 A;  3QC1 A;  4N2Q A;  3ZYK A;  4HOU A;  1S0P A;  3CST A;  4C9B B;  1QZ2 A;  3CKC A;  4CDM A;  1HS6 A;  2HM8 A;  4NRH B;  2CHX A;  3EJN A;  3S7B A;  3EHN A;  3FTU A;  3MJW A;  5D0Q D;  3JUI A;  3SHG A;  3CVV A;  4GML A;  3CHO A;  3FU3 A;  4FC8 A;  4YVO A;  2VGY A;  4RVB A;  2ZU6 B;  3MX3 A;  5G2N A;  4WUY A;  3FUM A;  3HIZ A;  3ZPJ A;  1UN9 A;  2WXN A;  3ZYQ A;  2ION A;  4GCN A;  3UT4 A;  4XI9 A;  3UX4 A;  3FU5 A;  2WVI A;  5EDS A;  4ATG A;  1NP7 A;  4C0M A;  3RO3 A;  3EDT B;  3U66 A;  4JHJ A;  3U64 A;  4EQF A;  4BY6 A;  3CUC A;  2L6J A;  1JUQ A;  4I17 A;  4BTA A;  4J8S A;  4UQZ A;  3PEU B;  3NZS A;  3ENE A;  4RSY A;  3U3W A;  4DLQ A;  5HQ8 A;  3QWV A;  4XI8 A;  2LAH A;  4LCT A;  3RRN B;  2PQN A;  4N2S A;  3FU6 A;  3B7S A;  5BT1 A;  3I4R B;  3ML8 A;  1E8X A;  4MLP A;  1A17 A;  5M72 A;  3FWV A;  3PNL B;  3OXG A;  4XI0 A;  3OXL A;  5FWQ A;  2OVF A;  2IJG X;  3MV3 B;  3ZXS A;  2OV8 A;  1SZA A;  3ONK A;  1JPL A;  3ZYM A;  2XCC A;  3LY8 A;  3VLE A;  3SE5 A;  1WM5 A;  3ULQ A;  4EEC A;  2X6J A;  1HX8 A;  2RG8 A;  3MYV A;  3LJ3 A;  3IEG A;  4AJW A;  5FJY A;  4BFR A;  2V4L A;  5ARG A;  2VGX B;  3FTX A;  1N54 A;  2YNQ A;  5C2Y A;  4EBA A;  3TG5 A;  2WXR A;  4NAC A;  3TAX A;  1H2V C;  2UY1 B;  3L13 A;  3QWW A;  4TV3 A;  4JEH A;  2MRI A;  4KYO B;  3ZFW A;  3LY7 A;  4OYS A;  3GZ1 A;  2E2E A;  2KCV A;  1FCH A;  3PRZ A;  4F1S A;  3VLD A;  1ELW A;  4HFG A;  2X6H A;  3MKQ B;  4UWL A;  2YHC A;  3P2B A;  4B0Z A;  4LU4 A;  2WPV A;  3ZCB A;  4KMO A;  3HVE A;  2G03 A;  4ITR A;  1XNF A;  3PDN A;  4JHR A;  4CGV A;  5FZQ A;  2WXM A;  1MQS A;  5FT9 A;  3SZ7 A;  4HVB A;  2VTB A;  2XGO A;  4U0U A;  2YIN A;  4O6F A;  4CDR A;  3EIJ A;  3CVN A;  1OWL A;  5G04 J;  2WB2 A;  3G2U A;  2IQC A;  4CGW A;  5FQ7 A;  3PNT B;  3LXU X;  3JCK C;  2Q7F A;  4D10 C;  5LCW J;  1YA0 A;  5G55 A;  3UT7 A;  2V8S E;  3QB2 A;  2BF0 X;  3IKO B;  4ME2 A;  5LP0 A;  4BSX A;  1E8W A;  1ZU2 A;  1H0A A;  4UQY A;  2WQ7 A;  3HVE B;  3Q5M A;  5CCM A;  2AW6 A;  4UWH A;  2FBN A;  2WQH A;  3RU0 A;  4JZY A;  4AIF A;  4RG9 A;  3APD A;  3R7R A;  5BPP A;  3B7U X;  2CHW A;  2WXH A;  3N71 A;  4UWG A;  2MHK A;  5G05 J;  1N52 A;  2IOL A;  3FH5 A;  4A3T A;  4H7Y A;  3CVP A;  4JVS A;  4ACL A;  3FUI A;  4G26 A;  3TL5 A;  5CCL A;  2RD0 A;  1TJF A;  2WM9 A;  3D9N A;  3L54 A;  2KC7 A;  3ZRH A;  2FF4 A;  4M16 A;  2AXV A;  2XPY A;  2X6K A;  3PVL A;  5KJL A;  4FJZ A;  2OND A;  4EZJ A;  4BTB A;  3B7T A;  3R9A B;  1H2U A;  3MZL B;  3PUK A;  4PUC A;  2JK8 A;  3C98 A;  2XEV A;  5CKL A;  3D9K A;  3CEQ A;  3MEK A;  3FEY A;  4GAA A;  4HS2 A;  2WXQ A;  1W3B A;  3UMV A;  1HG2 A;  4P29 A;  3TG4 A;  3AS4 A;  2I1J A;  3CK7 A;  2C0M A;  3S7J A;  4AY5 A;  4C0E A;  5JJT A;  4GZ6 A;  4AY6 A;  4JL0 A;  4I6E A;  4A55 A;  1PY1 A;  1PAQ A;  2R5S A;  2XPZ A;  4J0U A;  3CQC B;  1IQR A;  2HYZ A;  3OAW A;  3VTY A;  4U04 A;  3SF4 A;  3RK6 A;  3ZHE B;  3FUE A;  3PH0 C;  2KM4 A;  2EQX A;  3UUX A;  4WNF A;  4G24 A;  4ILH B;  5G05 C;  3IHY A;  3ZYL A;  4J8E A;  2J9Q A;  4IUL A;  2WMO A;  3FH8 A;  5LCW C;  2WXK A;  3KAE A;  2FUL A;  3RRU A;  3L17 A;  4GPK A;  5JJ7 A;  1WY6 A;  2PM7 A;  4V3I A;  1JWG A;  1QNF A;  4I6J A;  2AXZ A;  3HHM A;  5BUZ A;  2Y3A A;  3D9I A;  1KT1 A;  1E8Z A;  4M3O A;  3FY4 A;  4LRZ A;  3U9W A;  4JC8 A;  4GYW A;  1OWP A;  4WNE A;  3E4B A;  2CFZ A;  1HFA A;  3O4Z A;  5KCM A;  4GZ3 A;  3TXN A;  2JEK A;  5LFA A;  3JYS A;  2BTD A;  2J07 A;  2DBA A;  3D3M A;  2VY3 A;  4ANU A;  5JHA A;  4IYP A;  5AIJ A;  2LNI A;  3L22 A;  1KT0 A;  3SGH A;  5HI7 A;  2M63 A;  2XRZ A;  3CR3 A;  3MKR A;  3FH7 A;  3PE3 A;  4XE0 A;  3CVX A;  5BNW A;  5J08 A;  3ML9 A;  5G04 C;  4APO A;  4BX8 A;  2WXG A;  4NQ0 A;  4EPZ A;  3ZLM A;  5EX3 A;  4I1O B;  3T8M A;  4JHK A;  1H6K A;  3B7R L;  4G11 A;  4JPS A;  2Y4T A;  1SQM A;  4LEU A;  3NQP A;  1UJJ A;  2PZI A;  3FTV A;  1PC2 A;  2WXP A;  4Q94 A;  1UN8 A;  3TJP A;  4ABN A;  4HOS A;  4BT9 A;  5JFZ A;  3SFZ A;  4DI4 A;  3L6A A;  1ZBP A;  5T4Y A;  4J8F A;  2KAT A;  3HDX A;  2E0I A;  2VZA A;  4KVO A;  2VGX A;  2PL2 A;  3LDZ A;  4FA6 A;  4FHJ A;  4X2C A;  4Y6W A;  4ANX A;  4URK A;  3EIQ C;  3UQ3 A;  1EF1 C;  1HH8 A;  2AVP A;  1QQE A;  4EZK A;  4HOT A;  2WXF A;  4MRU A;  5ENN A;  4KVM A;  4FUL A;  1FVH A;  3CKB A;  3FTY A;  1NA3 A;  3CHQ A;  3PE4 A;  4AOF A;  4PS7 A;  3ZEF A;  1VDY A;  2YHE A;  4XKB A;  5CMT A;  4HLE A;  2J4D A;  3ZVV A;  3MKQ A;  3VTX A;  4NPS A;  2IOS A;  4ILG A;  5CHE E;  4G2V A;  5EKQ D;  3D9J A;  1Z3X A;  4BT8 A;  3CHP A;  4KZC A;  1Y8M A;  1BPO A;  2X38 A;  3UPV A;  2GRM A;  2J08 A;  3D9P A;  4J6I A;  4MS6 A;  1IHG A;  2XPI A;  3BG0 B;  3R7Q A;  3ZW3 A;  4WNG A;  4GMJ A;  3L08 A;  3SBT B;  2FI7 A;  3ZHE A;  5EX0 A;  2J49 A;  5CMY A;  1EYH A;  2X3M A;  3S7D A;  3QOU A;  3SD5 A;  4KBQ A;  4TRQ A;  3FUJ A;  1UW4 B;  3QK0 A;  4KZ0 A;  2HO1 A;  3GW4 A;  2VSN A;  3JQ0 A;  2WXJ A;  4DJA A;  4DPR A;  1H2T C;  5AJL A;  3TGO A;  3U4T A;  4U8H A;  3SNX A;  5FQ4 A;  1OWO A;  2J4B A;  4CT4 A;  3FFL A;  4N3B A;  3PEV B;  2FO7 A;  4RG6 A;  3UT8 A;  2L9B A;  3ASF A;  4Q69 A;  2DIW A;  3PUJ A;  3FEX A;  4JEU A;  4CRW A;  3FHE A;  4CCA A;  4J8D A;  1OWN A;  3FTZ A;  4FAD A;  5JJ6 A;  4CEM A;  4F53 A;  3ESK A;  3VLF A;  1MHQ A;  4CDN A;  3NZU A;  3Q4A B;  2NSZ A;  2Y4U A;  5KJN A;  2F6S A;  3GZ2 A;  4R7L A;  5KJK A;  5CGL A;  4L7T A;  3DBS A;  2WMN A;  2YQ8 A;  5E75 A;  4DI3 A;  5LX8 A;  1DNP A;  3ZGQ A;  3QWP A;  1TJC A;  4I1M A;  1NA0 A;  4OVV A;  5FQ8 A;  3CVW A;  5E76 A;  1EDU A;  2AWI A;  4ANW A;  3D9O A;  3FTW A;  4GA0 A;  3CVQ A;  3FUL A;  4G23 A;  4Q96 A;  2FEZ A;  3CV0 A;  4A3V A;  2PQR A;  4L2Y A;  5LOZ A;  4U0Z A;  2OOE A;  1EPU A;  3CVY A;  3QAQ A;  2KCK A;  3FUH A;  3L16 A;  4YVQ C;  5AEN A;  1X5B A;  2OVB A;  3EHM A;  3ESL A;  3NF1 A;  5ANL A;  3SI5 A;  4FJY A;  1DVP A;  1E7U A;  3Q47 B;  4G1T A;  2IU1 A;  1Z6T A;  3CK9 A;  4GCO A;  2MOW A;  4W9R A;  5A23 A;  2WQ6 A;  1HE8 A;  1LF8 A;  4N3C A;  2UWJ G;  4LER A;  3SBS A;  4BWR A;  3BG1 B;  4UWK A;  3RJV A;  3FP3 A;  3AU4 A;  3QJZ A;  3T5V A;  4FU3 A;  1IYG A;  2CG2 A;  3GZS A;  4PY3 A;  4E6H A;  3IBE A;  4GB9 A;  4TUU A;  2AXU A;  4JXT A;  5FZS A;  3LYA A;  4XKC A;  2VSY A;  3RRM B;  4GU5 A;  5FQ6 A;  1E7V A;  1TEZ A;  2WXO A;  4APF A;  1B89 A;  3G2V A;  3D9L A;  4EBA G;  5EU0 A;  4ILI A;  5FTP A;  3O48 A;  3Q49 B;  2VSO E;  2DCP A;  3ASD A;  2NC9 A;  4WWP A;  3P1U A;  2CG3 A;  1HO8 A;  2IF4 A;  2WXL A;  1SZ9 A;  3AS8 A;  4JA7 A;  4G25 A;  1E96 B;  3LKU A;  4OVU A;  2KZT B;  2CHZ A;  4AXH A;  4GYY A;  4PS8 A;  5DBK A;  3K9I A;  4BX9 A;  3LY9 A;  2HR2 A;  5AJD A;  5BV1 A;  2BUG A;  3ASH A;  2XQ0 A;  4Y6C A;  1P5Q A;  4PS3 A;  3KEZ A;  4NUR A;  4FHK A;  3LVQ E;  3ZN3 A;  2I6H A;  1NZN A;  3ZC7 A;  1HU3 A;  4I9C A;  3CIA A;  4UI9 C;  1ELR A;  3LPZ A;  3S6A A;  4LUN U;  3APC A;  3PZD A;  5A6C A;  3APF A;  3KS2 A;  4MKT A;  3ZIM A;  4JW1 A;  3GYZ A;  4WND A;  2X6I A;  1L5J A;  3FUK A;  4GYO A;  2KCL A;  2ILR A;  5T3R A;  4X2E A;  4AP2 A;  2C0L A;  3CHM A;  3LCA A;  3URZ A;  2XCB A;  4XIF A;  4PDX A;  1HG5 A;  4N67 A;  2A4Z A;  5AYW D;  3I4G A;  4GZD A;  2LO6 A;  2VYI A;  5BV0 A;  4DLO A;  2VQ2 A;  3CK8 A;  4A1S A;  4F7A A;  5ARF A;  2GRL A;  4N3A A;  3CVL A;  3LS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...