4U04A

Structure of a eukaryotic fic domain containing protein
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
327
structure length
315
Chain Sequence
b'RAALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine monophosphate-protein transferase FICD
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 120
structure length 315
sequence length 327
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u04A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u04A01
5CCLA 2QFCA 4WUYA 2FI7A 3ZPJA 3JYSA 3GYZA 3AS4A 5JFZA 3GZ2A 1QQEA 3QWWA 3CKBA 5KJLA 1HZ4A 5FZRA 3LY7A 4X2EA 4N5CA 2XCBA 3QWPA 2YQ8A 2IF4A 3U4TA 5JJ7A 4HORA 2WQHA 1NZNA 4PY3A 3HYMB 5FZSA 4Y6CA 2XEVA 3LY9A 3S7BA 2VQ2A 3RO3A 3ESKA 4XI8A 1QZ2A 4G24A 3MEKA 3LY8A 4GYOA 4X2CA 2FO7A 3MA5A 5JJTA 3CVQA 3ZC7A 2ONDA 3KS2A 5CMTA 5FZQA 2KCLA 1E96B 4YVQC 3WXXA 3PDNA 4I2WA 2J9QA 5A6CA 4GA2A 4BTAA 5HI7A 3CK7A 3ULQA 4BTBA 2XPIA 3Q4AB 2WPVA 4N2QA 4XIFA 5KJMA 1B89A 3K9IA 3TGOA 1Y8MA 4XI9A 5JFFA 2Y4UA 4HOUA 3UPVA 3TAXA 2HR2A 1KT0A 5D0OD 2I6HA 2LSUA 4GZ6A 3ASDA 4UI9C 4XI0A 2NC9A 4U0ZA 3LETA 4I2ZA 3MV2B 4U07A 4RG9A 2C2LA 4G23A 3R9AB 2E2EA 3VTYA 2VZAA 2VGXB 2OOEA 4KBQA 3CKCA 5LCWC 4G2VA 3SF4A 2UY1B 5FJYA 3CV0A 5M72A 3EDTB 3AS5A 4WGJA 2FF4A 3N71A 3KD7A 3CVNA 4N39A 4JA7A 2DBAA 2BUGA 3Q5MA 4G25A 3S6AA 5ARFA 1IYGA 3PE4A 5G05J 2VGXA 3QWVA 4CDRA 1ELWA 3CK8A 1WM5A 4U0SA 2KC7A 2VSNA 2UY1A 3FFLA 4EQFA 3ZFWA 3SHGA 4JA9A 3Q15A 4GCOA 4NQ0A 5CHEE 3TG4A 5EU0A 2JK8A 4WNEA 3ZN3A 2XGMA 4Y6WA 2PQNA 1P5QA 4N3AA 4N2SA 4I1AA 5FTPA 1ZBPA 2XGOA 5ARGA 4GZ3A 5BT1A 5G04J 4LU4A 5HQ8A 3BEEA 3RJVA 3TG5A 4GYYA 5CCMA 3VTXA 4AIFA 4UQYA 4AY6A 1WAO1 4GA0A 4AM9A 5DBKA 2YHCA 4N67A 5A7DB 5AYWD 3N3UA 3ASFA 4N3CA 2P58C 3UQ3A 3LCAA 3NF1A 5CGLA 4RG6A 4JHRA 4ITRA 3ZCBA 4BT8A 2KCVA 4BWRA 1KT1A 3ZHEB 1KLXA 4CGVA 4HOQA 3E4BA 5D0QD 3QDNA 4B94A 3Q47B 2VYIA 3ZLMA 2KATA 4LEUA 4HOTA 3MV3B 4NRHB 4KYOB 4W9RA 2HO1A 1W3BA 3AS8A 3IEGA 4H7YA 4N3BA 5BNWA 3U3WA 3CUCA 3ASGA 2PL2A 3PE3A 5CKLA 3ZHEA 3UUXA 3CK9A 4H7XA 3RU0A 4UI9K 3MKRA 3QKYA 4J8DA 3OXGA 3S7FA 1FCHA 3KAEA 2VY3A 2LNIA 4X2DA 4M16A 4KXKB 2V5FA 4UQXA 4I17A 2F6SA 3SE5A 5KJKA 2FEZA 3URZA 5DIZA 4U0UA 2VSYA 4YVOA 5G05C 4I9EA 3GW4A 1TJCA 2L6JA 3LPZA 3OXLA 5EX0A 4O6FA 4WNDA 3ZGQA 5FT9A 3LYAA 3FP3A 3FWVA 1XNFA 3RIBA 4AY5A 4APOA 3LKUA 2XCCA 1ZU2A 3RO2A 4GYWA 5EKQD 4I9CA 4A1SA 4YNDA 2MHKA 3SN9A 2Q7FA 3S7JA 4HOSA 5G04C 4ABNA 2VGYA 5KJNA 2C0MA 3ASHA 4J0UA 1YA0A 4G26A 3QOUA 4WNFA 2KCKA 3CEQA 2PZIA 4NPSA 1A17A 3CVLA 1NA0A 1IHGA 5JJ6A 4WNGA 3CVPA 2LSVA 2C0LA 4BT9A 4CGWA 4U04A 5EX3A 1ELRA 4F3VA 2JLBA 2UWJG 4GA1A 4UQZA 2IFUA 4J8FA 3S7DA 5BW8C 2HYZA 4UI9J 2PQRA 3GZ1A 2Y4TA 1HXIA 3RKVA 2FBNA 2G03A 3Q49B 4GCNA 4GZ5A 3SZ7A 2GW1A 5C1DA 2R5SA 3OXFA 4ME2A 2XGSA 2AVPA 1NA3A 5LCWJ 1PC2A 1HH8A 4IN3B 1OUVA 4G1TA 3O48A 4J8EA 4JL0A 4GPKA
chains in the Genus database with same CATH superfamily
2AXVA 2IQCA 3W9GA 4DI4A 3E37A 4ZHBA 5LOZA 3ZYQA 3ULEG 3GZ2A 1JWFA 4I1MA 4IYPA 3NB2A 5HKPA 1HZ4A 1D8EA 3LY7A 2A5UA 4N5CA 3Q7AA 3RRMB 4E85A 3MZLB 2XZDG 3JQ1A 4HORA 3V2XA 3LY9A 2M63A 3S7BA 2DYRE 4XI8A 5IY5E 1H2TC 4G24A 2MRIA 4CCAA 3HXFA 2IO2C 3DSVA 2J09A 5JJTA 3CVQA 3Q7FA 5FZQA 2KCLA 2CHWA 3PDNA 3Q75A 3ZUVB 1Z5SC 2JABA 3DWLG 3L16A 3LJ3A 3ONLA 5ITZF 5HI7A 3NAWA 2NXPA 2J4BA 3KSLA 4A3TA 4FLBA 5T3RA 2DIWA 1K1AA 2XPIA 3P1UA 2ZGDA 1OWNA 1B89A 1Y8MA 2XRYA 2Y4UA 4GMLA 4WWNA 3SD5A 3ZW3A 2BKGA 3PZ1A 2XS8A 4O1PA 3ASDA 1FVHA 3JCKC 2ZXWE 4ILGA 4CT0A 3SFXA 3R7RA 4JW1A 5CEDB 2E2EA 1UG3A 2V8SE 5EYPF 3VTYA 1MYOA 2VZAA 4FJZA 3SFYA 4I6JA 2OOEA 4KBQA 5LCWC 4Q69A 3FDHA 3SF4A 3CVVA 4IULA 3CV0A 3AU5A 3AS5A 3N71A 1QBQA 2GRQB 1QNFA 2ETCA 3UM1A 3UKRG 3CVNA 4JA7A 2BUGA 3Q5MA 3FU3A 3S6AA 1U3CA 2P9UG 3ZKJA 5G05J 3UT8A 4KT6B 3RAUA 4U0SA 1GW6A 2VSNA 2UY1A 5JA4D 4K5AB 4GB9A 3CHPA 4BEPA 3Q15A 2X38A 5FQ7A 3FH8A 3AJIA 1TNUA 4MBGA 2XGMA 1UJKA 1JPLA 3GZSA 5ENTD 3UTMA 4NIKA 1TNOA 2J4DA 4XKBA 3ZYKA 2AXZA 4BESA 3TG5A 4GMRA 4GTQA 4UWHA 3CQGB 5H7PA 4AY6A 1FT2A 4AM9A 5DBKA 4N67A 1FPPA 3B7BA 1N0QA 3QARA 3N3UA 1EDUA 4KZ0A 4DX1A 3ASFA 4ACLA 4N3CA 1PAQA 1HU3A 3NF1A 4JZYA 4M7CA 2IONA 4L23A 5EIDA 1KPSB 2XPYA 4BT8A 2EQXA 2KCVA 2X6FA 1KT1A 3FUKA 3R9MA 4B94A 2VYIA 3LXUX 4KZCA 4L1BA 3ZVVA 3UIOC 4DX7D 3L08A 1G3NB 4HOTA 2NYJA 2Y69E 1HX8A 4NRHB 4F1SA 1SZ9A 3SBTB 4N5QA 2HO1A 2MYOA 4UUCA 3PNTB 3TL5A 4JB8P 4CZ2D 2PL2A 3SI5A 4BSZB 2P9LG 3PE3A 2DCPA 5LP0A 3ZHEA 3UUXA 1WY6A 3E32A 3RU0A 3FTXA 2LXMA 2WXLA 3QKYA 1N0RA 3D9NA 1AWCB 3MJWA 3ZXPA 4HNAD 5EN5D 3MCXA 3MGBA 5ENRD 2VY3A 3DEPA 4GAAA 5EYLA 4C0EA 2P9KG 3DEOA 2IOLA 4X2DA 4CEMA 3U66A 4I17A 3E34A 3C3QA 3ABME 4AP2A 2FEZA 1E7VA 3UINC 3G2SA 3FH7A 3OXLA 4ANVA 2NUNA 1LD8A 1OCOE 1TNZA 1XNFA 2VSXE 3E30A 4APOA 3FTYA 3DSUA 3UMVA 3CLJA 2VGEA 4ANWA 4A63B 4I9CA 4YNDA 3KEZA 4F6RD 5KNGA 3SN9A 3S7JA 3EU9A 3TJPA 4JHKA 3DSTA 4OAUC 2C0MA 3B13A 3EIQC 4HRMB 2KCKA 5A23A 2KZTB 2RG8A 3D9IA 4CDMA 3FUHA 4HVBA 1NA0A 2WMOA 4WNGA 4AOFA 1TJFA 5T4YA 2Y3AA 5EX3A 1ELRA 1N4SA 3LDZA 3ABKE 4F3VA 1N4RA 1NL4A 3L22A 4X8QA 3UI2A 4AV7A 4UQZA 2OEVA 3F6QA 2YINA 3APCA 4AJWA 3U64A 1MHQA 1DCEA 3DXMG 3GZ1A 3TWQA 1D8DA 1TEZA 1TN8A 2FBNA 2G03A 3C3OA 2X3MA 2WXGA 3UM0A 4GZ5A 3RRUA 1NA3A 4QQIA 3I3NA 3NOCD 1HS6A 1PC2A 1HE8A 3TWRA 4HBDA 4G1TA 1V54E 4J8EA 4JVSA 3DBSA 1N95A 4GPKA 3PRZA 2IO3C 2QFCA 5EDSA 2DWZA 4WUYA 5BXOA 1N52A 1K8KG 3QWWA 3CKBA 4LSZE 2QZAA 4MLPA 1OCZE 2YQ8A 5JJ7A 5B1AE 3KSQA 2WQHA 4PY3A 5FZSA 3R7QA 4C48B 5AIJA 4L2YA 4K5CA 1QZ2A 3MEKA 5C2YA 4ILIA 3FU6A 1BLXB 4DX5D 4GYOA 2FO7A 3EHMA 3KS2A 3ZU7B 1E96B 3L13A 5AENA 4AEZC 3L17A 1JUQA 4GTRA 4GZDA 4I2WA 1OXJA 4GZCA 5A6CA 4GA2A 4DK5A 4XZ4A 2DZOA 3CK7A 4L7TA 3ULQA 3JUIA 1LTXA 4B93B 3FUEA 4BTBA 3HDXA 3SQVA 3PZ4A 5ENOD 2PM6A 2KBXA 4N2QA 4MRUA 3K9IA 3U9WA 5JFFA 1IQRA 3HHMA 1NP7A 5D0OD 2LSUA 4RVBA 5BXUA 4GZ6A 1HO8A 1OT8A 4UI9C 3DXKG 2NC9A 3LETA 1MX2A 4WWPA 1SW6A 3MV2B 4U07A 3IHYA 4FHJA 1L5JA 4G23A 1KZPA 2WVIA 2B6CA 4LNUD 4ACKA 3TXMA 3TWTA 4CYMD 2UY1B 3G2UA 3Q79A 5FJYA 3ZIMA 3ZYMA 5M72A 1NI1A 4U95D 3T8KA 4DRXE 3FUNA 2DBAA 3FEYA 4U96D 3ZRHA 4JPSA 2CG2A 5ARFA 4TXPA 3D9JA 3PE4A 1O5MA 2VGXA 3QWVA 4CDRA 3TWXA 1ELWA 1WM5A 2XHEA 3SO8A 3RK6A 4XEIG 4DJAA 5EIBE 3SHGA 3TXNA 1S63A 4GCOA 2WXJA 3TG4A 2X6KA 3Q9NC 2JK8A 3UM2A 3PEUB 4DI3A 1OY3D 4BX8A 2IY0C 4LNBA 4N3AA 4I1AA 5FTPA 2XGOA 5ARGA 3MYVA 4UWKA 3SGHA 5G04J 3AU4A 4HS2A 3RJVA 5ENPD 5CCMA 5E76A 3PUKA 4HQDA 1WAO1 3CHQA 2YHCA 3JXJA 3FU0A 5AJLA 3APFA 5AAOA 5CBNA 5AYWD 3ISMC 4WWOA 4CRWA 5J08A 3ZNGA 1TNYA 3LCAA 5CGLA 3SBSA 4APFA 3C5RA 4RG6A 4JHRA 4ITRA 3ZCBA 3NQPA 3CVXA 4XX5A 4BWRA 5J90A 3G2VA 4LRZA 4L2LA 2OCCE 3ZHEB 4CGVA 3QDNA 2P9SG 2P2CP 2LXLA 2KATA 1UN8A 4HI8A 4XE0A 2GGFA 3G2WA 3APDA 3CHSA 3MV3B 3I5PA 4Q94A 2I2OA 3CVWA 5BNWA 3U3WA 2WB2A 3C72A 2A4ZA 3ML8A 4ZFHA 2WXKA 4FU3A 3MKRA 3D3MA 3S7FA 3KEAA 4BX9A 1FCHA 2LNIA 3CVUA 5JMND 5AQ9A 2F6SA 2XS1A 3CSTA 3BQOA 3O4ZA 5DIZA 3T5XA 2ZISA 5G05C 4I9EA 3GW4A 4PH4B 3LPZA 3VLDA 3BU8A 2EIME 3G2TA 2WXPA 5EX0A 3AAAC 4HXIA 4MKTA 1TYQG 2LUHA 4LERA 3FP3A 4RSYA 2IU1A 2Y0BG 3LKUA 4U8HA 2XZTG 3FHEA 2CFUA 4TUMA 2LAHA 4ABNA 2E0IA 5AQAA 4P29A 1MX4A 1YA0A 2JEKA 4G26A 4TXQA 5LFAA 4WNFA 1JCRA 4UWLA 3PREA 4EZKA 4J6IA 4PS3A 4RLYA 3FTZA 5JJ6A 5B3SE 2LSVA 4MS6A 3PVLA 1AP7A 2J07A 4CGWA 4F1PA 4O1OA 2X6IA 2H6GA 3EHQA 5KCMA 3QJZA 1N54A 2IFUA 4J8FA 3S7DA 1OWOA 2WXNA 4M3OA 2VTBA 2Y4TA 1DNPA 1HXIA 5JHAA 3D9LA 3Q49B 4GCNA 4FULA 2GW1A 3OXFA 4D10C 4ME2A 5FIOA 2V0PA 4ILHB 1HH8A 3JQ0A 4B0ZA 4GU5A 4J7WA 3Q9UC 3UXGA 2L0IA 3O48A 1UOHA 3C3RA 2IOSA 2WM9A 5CCLA 5BPPA 2FI7A 3ZPJA 1V55E 4EPZA 3GYZA 4G11A 4HRLA 1IXVA 2GRMA 1QQEA 2VJ8A 4I43A 3UM3A 4Q96A 3EUVA 2R02A 4X2EA 1EPUA 2KM4A 3CHRA 3DSSA 2R17C 1MJ0A 1SA4A 4FHKA 3VLEA 2XENA 1E8WA 3EJNA 3HYMB 2RFMA 2XEVA 2ZU6B 1E8ZA 2X6HA 2OV8A 3T5VA 4FA6A 2HM8A 4LCTA 4YDEA 2EILE 5E75A 1EF1C 3LY8A 3EHNA 3MA5A 2L0TB 3DSWA 4KVOA 3QAQA 2AWIA 4YVQC 3PUJA 4EBAG 2AJAA 3FTWA 3C98A 4WAFA 1N4QA 2J9QA 3CHOA 5HS0A 1OCCE 3OTNA 4AXHA 3CR3A 5ENQD 3FU5A 2GRNB 3UT4A 2WPVA 3TGOA 5KNHD 2X6JA 3TAXA 4FLHA 1KT0A 3LVQE 2I6HA 3HXCA 2I1KA 4U0ZA 5FQ8A 4GTOA 2NSZA 4I2ZA 4GTSA 1DVPA 3SFZA 1MZCA 4IRUA 1E8YA 5ENSD 3TWWA 2VGXB 3V30A 2VSOE 3LS8A 5ANLA 3CKCA 4G2VA 1LD7A 4GTTA 1DCQA 1NH1A 4I1OB 4KVMA 2H6IA 2FF4A 2WQ7A 4G8KA 5EILA 3FUDA 2XPZA 1QYMA 1INZA 1IYGA 3J5PA 4HLEA 3E33A 5BV0A 1Z6TA 3CK8A 1X5BA 5JHBA 3PS6A 3HXDA 4EQFA 2R03A 4ANXA 4JA9A 2XQ0A 2DYSE 5EU0A 3PZ2A 2L9BA 4WNEA 3ZN3A 2PQNA 4JXTA 5BT1A 2A5EA 4GZ3A 1H19A 2F0YA 2YHEA 3B95A 4A1GA 4LU4A 5HQ8A 3BEEA 3TWUA 4HRNA 2V4HC 4UWFA 3OAWA 3TWSA 4AIFA 4NACA 4UQYA 4GA0A 2F37A 1ZB1A 1YYHA 3MKQA 1PY1A 4JD2G 3QC1A 3RRNB 1O1SA 1E8XA 5G55A 3FEXA 4GPMA 3ONKA 1KLXA 1BD8A 4HOQA 5D0QD 4HI9A 5T8IA 5CRVA 2MOWA 3HVEA 3ZLMA 4QFVA 2F8XK 2QY7A 2L6BA 4DX6D 5AN8A 2KZTA 3NOGD 4KYOB 3UX4A 4B8CB 5D2MC 4ATZD 2IJGX 1W3BA 3HRAA 4H7YA 1EYHA 3CHMA 3T8MA 3FUIA 3CUCA 3UT7A 3MX3A 4PS7A 4I6EA 4GTPA 3CK9A 3D9KA 4UI9K 1HF8A 2H6FA 4J8DA 3OXGA 4OVVA 2WXQA 3FULA 4U8YD 2ETAA 5CBOA 3AG3E 4JC8A 2OVBA 3BG1B 4XKCA 3SE5A 4HLLA 3ML9A 4K03A 5HRYA 3URZA 1O1RA 4URKA 4U0UA 2VSYA 5AQBA 2KXPC 4O60A 3UIPC 1WDYA 4GTMA 3FTVA 1UN9A 2QC9A 2V4LA 5G2NA 1HG2A 2BKKB 3LYAA 5FT9A 2GRPB 3FWVA 5CMYA 3RIBA 1TNBA 1Z3YA 4FP7A 1SVXA 2ETBA 3RO2A 1Y6IA 4ATGA 5EKQD 4A1SA 2WXMA 3S2AA 4PDXA 3IHVA 3AG4E 4HOSA 5G04C 4NURA 1SZAA 2HE0A 3ASHA 4C0MA 4J0UA 2DVWA 2PNNA 1H6KA 3I4GA 1UW4B 2VTBB 2PZIA 4NPSA 1A17A 3ULYA 1N4PA 1MQSA 3CQCB 3CVPA 2CG3A 3LJNA 1U3DA 4EZLA 2EIJE 3SHFA 3ABLE 4BT9A 4PS8A 4U04A 1H2UA 1OWMA 4GA1A 1U2VG 3DPYA 4CDNA 5B1BE 2HYZA 1IQUA 4ANUA 1S64A 1OWPA 1JWGA 2J49A 3ZXSA 3ASOE 3SZ7A 1IKND 2R5SA 3JXIA 1OCRE 2XGSA 5LCWJ 4YDWA 5ANRA 2B0OE 4IN3B 4BETA 1OUVA 3W9FA 1Q2ZA 3FUMA 4JEUA 4JL0A 3V2OA 2XEEA 3DSXA 2R05A 3BUAA 2I1JA 4DX2A 3JYSA 5KWDA 2CHXA 3AS4A 1MX6A 5JFZA 4TXRA 1TN7A 2BF0X 5KJLA 5FZRA 2F8YA 5BUZA 2XCBA 3DRAA 3QWPA 1BU9A 3J5QB 3IKOB 2IF4A 3U4TA 3PEVB 5ENNA 3FY4A 2YNQA 4LNGA 1NZNA 4Y6CA 5BV1A 3D9PA 2XRZA 2WMNA 2VQ2A 3PNLB 3RO3A 4GTVA 3ESKA 2R59A 4TRQA 2Y1LE 2FULA 2J08A 4BSXA 4L9PA 4X2CA 3ZC7A 2GROB 2ONDA 4PUCA 5CMTA 1LF8A 3WXXA 4JHJA 2H6HA 4E6HA 3HXEA 4BTAA 4OAVB 2P9PG 3ASNE 2ZGGA 3Q4AB 1SA5A 2V5QC 4XIFA 5KJMA 3HIZA 4XI9A 4HOUA 1H6OA 5FQ6A 3UPVA 4DUIA 2HR2A 3IBEA 3BG0B 4FC8A 4F53A 3PH0C 4R7LA 4EBAA 3B7RL 4K5BA 4XI0A 1RZ4A 5AJDA 1S0PA 1VDYA 1N94A 3ENEA 3FTSA 4HB5A 4RG9A 1H0AA 4TUUA 2C2LA 3R9AB 5CEAA 4DLOA 2QYJA 1BI8B 1XGWA 3CIAA 3HG0D 4I6GA 4DPRA 4F7AA 1JCSA 3SNXA 4LG6A 5AQ7A 3CGHA 3EDTB 2GRRB 4WGJA 1DC2A 3D9HA 3KD7A 5CRUA 3B7TA 1RW2A 1O1TA 3FUJA 1H2VC 4N39A 5FWQA 2LO6A 1A5EA 5FINA 4G25A 4G8LA 4J8YA 2RKKA 3L82A 1FVFA 5D66A 4UWGA 4FADA 3NBNB 2KC7A 4BFRA 3FFLA 3B7UX 1X81A 3ZFWA 1TR4A 4U63A 3EIJA 1S70B 4TV3A 4NQ0A 5CHEE 3MKQB 2CHZA 3AG2E 5CECB 2NUDA 4U8VD 2WXOA 4Y6WA 4HFGA 2EIKE 1P5QA 1HFAA 4A3VA 4N2SA 3RSEG 1ZBPA 1ELKA 3JUEA 2WXRA 3L54A 4JEHA 3NZUA 4A55A 3Q78A 4GYYA 3VTXA 4BERA 4LUNU 1FT1A 3HVEB 5LX8A 2P9NG 5A7DB 2CFZA 2RFAA 3DPDA 1HG5A 3X2QE 2P58C 3UQ3A 3QB2A 2R2LA 3P2BA 1D9SA 3V79K 2BEDA 1N11A 3IV0A 3IXEA 3ZEFA 3PZDA 4B8AA 1E7UA 4U7EB 4YDYA 3E4BA 1N9AA 3D9MA 5FQ4A 3Q47B 3SY2A 3V31A 4LEUA 4CT4A 4J8SA 3FUFA 2LAIA 3ZYLA 3HXBA 4W9RA 4RQIA 2OVFA 3AS8A 3IEGA 4GMJA 4N3BA 2EINE 3ASGA 4EHMA 2WXIA 5CKLA 1NFIE 1K1BA 4H7XA 3FH5A 2GRLA 2J8SD 3EU5A 1TN6A 3FTUA 3KAEA 3D9OA 2QYUA 5KBAA 2WXHA 3Q73A 2WXFA 4BY6A 4M16A 4KXKB 3LVRE 2V5FA 4UQXA 2BTDA 1KZOA 5KJKA 1Z3XA 3QK0A 4YVOA 3L6AA 1TJCA 2L6JA 3I4RB 5CERB 3EHRA 4O6FA 3CVYA 4WNDA 3PZ3A 3WG7E 3ZGQA 1BPOA 2ZIRA 4AY5A 2DZNA 2XEHA 2XCCA 4V3IA 1ZU2A 4DLQA 4GYWA 2FO1E 5CMWA 2MHKA 4AVXA 2Q7FA 5AARA 2VGYA 4EECA 4C9BB 5KJNA 4OYSA 3QOUA 1YCSB 3CEQA 4Z68A 3CVLA 1UJJA 2AW6A 1IHGA 1BI7B 1K3ZD 1WG0A 2C0LA 3CSFA 2WQ6A 2JLBA 3ESLA 4FJYA 2P9IG 2AXUA 2UWJG 3B7SA 4B89A 5BW8C 4UI9J 3L9TA 1YMPA 2PQRA 4YDOA 3NZSA 3TWVA 4OVUA 3RKVA 2ILRA 2PM7A 3LEWA 3T9KA 2IEJA 5C1DA 1IHBA 3UKUG 2I9CA 2AVPA 1JCQA 4EZJA 1E90A 3VLFA 3QNKA 4KMOA 2OEWA 1SQMA 1OWLA 3AG1E 2RD0A 4K0RA 1H6PA
chains in the Genus database with same CATH topology
5CCLA 2AXVA 2QFCA 5EDSA 2IQCA 5BPPA 4WUYA 4DI4A 2FI7A 2I1JA 3ZPJA 3JYSA 2CHXA 4EPZA 3GYZA 4G11A 5LOZA 3ZYQA 3AS4A 1N52A 2GRMA 5JFZA 3GZ2A 1JWFA 4I1MA 1QQEA 2VJ8A 4I43A 4IYPA 3QWWA 3CKBA 4Q96A 2BF0X 5KJLA 1HZ4A 5FZRA 3LY7A 4X2EA 4MLPA 2A5UA 4N5CA 5BUZA 2XCBA 3RRMB 1EPUA 3QWPA 2YQ8A 3IKOB 4E85A 2IF4A 2KM4A 3MZLB 3CHRA 5JJ7A 3PEVB 5ENNA 3U4TA 3FY4A 2YNQA 2R17C 3JQ1A 4HORA 4FHKA 3VLEA 1E8WA 2WQHA 1NZNA 3EJNA 4PY3A 3HYMB 5FZSA 4Y6CA 3R7QA 2XEVA 3LY9A 2ZU6B 5AIJA 5BV1A 1E8ZA 2X6HA 4L2YA 2OV8A 3T5VA 2M63A 3D9PA 3S7BA 2XRZA 4FA6A 2HM8A 2WMNA 4LCTA 2VQ2A 3PNLB 3RO3A 5E75A 3ESKA 1EF1C 4XI8A 1QZ2A 2R59A 1H2TC 4TRQA 4G24A 2FULA 2J08A 3LY8A 3MEKA 5C2YA 2MRIA 3EHNA 4ILIA 4BSXA 3FU6A 4CCAA 4GYOA 2J09A 4X2CA 2FO7A 3MA5A 5JJTA 3CVQA 3ZC7A 2ONDA 3EHMA 3KS2A 4PUCA 2L0TB 5CMTA 5FZQA 2KCLA 4KVOA 3QAQA 1E96B 1LF8A 2AWIA 3L13A 5AENA 4YVQC 3WXXA 4JHJA 4AEZC 3PUJA 3L17A 2CHWA 3PDNA 3L16A 4EBAG 1JUQA 3FTWA 3LJ3A 3ONLA 4GZDA 4E6HA 3C98A 4WAFA 4I2WA 2J9QA 3CHOA 4GZCA 3OTNA 4GA2A 5A6CA 4AXHA 4DK5A 4BTAA 3CR3A 4XZ4A 5HI7A 3CK7A 2NXPA 3FU5A 2J4BA 4L7TA 3ULQA 3JUIA 4A3TA 4FLBA 5T3RA 2DIWA 3FUEA 4BTBA 3HDXA 2XPIA 3Q4AB 3P1UA 3UT4A 2PM6A 2WPVA 1OWNA 4N2QA 4MRUA 4XIFA 5KJMA 1B89A 3K9IA 3TGOA 1Y8MA 3HIZA 4XI9A 3U9WA 5JFFA 1IQRA 2XRYA 2Y4UA 4GMLA 4HOUA 4WWNA 5FQ6A 3HHMA 3UPVA 2X6JA 3TAXA 4FLHA 3SD5A 1NP7A 2HR2A 3ZW3A 1KT0A 3IBEA 3LVQE 2I6HA 2LSUA 3BG0B 4FC8A 5D0OD 4F53A 4RVBA 3PH0C 4R7LA 4GZ6A 4EBAA 3B7RL 3ASDA 2I1KA 1HO8A 1FVHA 4UI9C 4XI0A 2NC9A 3JCKC 4U0ZA 5FQ8A 4ILGA 5AJDA 1S0PA 2NSZA 3LETA 4I2ZA 4WWPA 1VDYA 4CT0A 3MV2B 3ENEA 3FTSA 4U07A 1DVPA 4RG9A 3SFZA 3R7RA 3IHYA 1H0AA 4FHJA 1L5JA 4IRUA 4TUUA 1E8YA 2C2LA 4JW1A 4G23A 3R9AB 2E2EA 1UG3A 4DLOA 2V8SE 2WVIA 3VTYA 4ACKA 3TXMA 2VZAA 4FJZA 1XGWA 2VGXB 2VSOE 3CIAA 4I6JA 2OOEA 3LS8A 4KBQA 5ANLA 3CKCA 4Q69A 5LCWC 3FDHA 4G2VA 4I6GA 3SF4A 2UY1B 3G2UA 3CVVA 4IULA 5FJYA 3CV0A 4DPRA 3ZIMA 4F7AA 4I1OB 3ZYMA 4KVMA 3SNXA 3AU5A 3CGHA 5M72A 3EDTB 3AS5A 4WGJA 2FF4A 2WQ7A 3N71A 3KD7A 1QNFA 3B7TA 3FUDA 3FUNA 3CVNA 3FUJA 1H2VC 4N39A 4JA7A 5FWQA 2DBAA 2LO6A 3FEYA 2XPZA 2BUGA 3ZRHA 3Q5MA 3FU3A 4JPSA 1INZA 2CG2A 4G25A 3S6AA 1U3CA 5ARFA 1IYGA 3D9JA 3PE4A 4HLEA 5G05J 1FVFA 2VGXA 3QWVA 4CDRA 5BV0A 1ELWA 4CGWA 4UWGA 1Z6TA 3CK8A 4KT6B 1WM5A 1X5BA 4U0SA 1GW6A 2KC7A 2XHEA 2VSNA 3UT8A 3PS6A 4BFRA 2UY1A 3FFLA 5JHBA 3RK6A 4DJAA 4EQFA 3B7UX 4ANXA 3ZFWA 4GB9A 3SHGA 3CHPA 4U63A 4JA9A 3Q15A 3EIJA 4GCOA 4TV3A 2X38A 3TXNA 5FQ7A 3FH8A 4NQ0A 5CHEE 2WXJA 2XQ0A 3TG4A 2X6KA 3MKQB 5EU0A 2CHZA 2JK8A 3PEUB 2L9BA 4WNEA 4DI3A 2WXOA 3ZN3A 2XGMA 4BX8A 1UJKA 4Y6WA 2PQNA 4JXTA 4HFGA 1JPLA 1P5QA 1HFAA 3GZSA 4A3VA 4N3AA 4N2SA 4I1AA 1ZBPA 2XGOA 5ARGA 1ELKA 4GZ3A 1H19A 2J4DA 2WXRA 3L54A 3MYVA 4UWKA 3SGHA 4JEHA 2YHEA 5G04J 4A1GA 3NZUA 4XKBA 3ZYKA 2AXZA 3AU4A 4LU4A 4HS2A 4A55A 5HQ8A 3BEEA 3RJVA 3TG5A 4UWHA 4GYYA 3CQGB 3VTXA 5CCMA 4UWFA 5E76A 3OAWA 4AIFA 3PUKA 4NACA 4LUNU 4UQYA 4AY6A 3HVEB 1WAO1 4GA0A 4AM9A 5LX8A 3CHQA 2YHCA 5DBKA 4N67A 5A7DB 3FU0A 3MKQA 5AJLA 3APFA 1PY1A 3QARA 2CFZA 3QC1A 5AYWD 3N3UA 4WWOA 3RRNB 1EDUA 3DPDA 4CRWA 1HG5A 4KZ0A 5J08A 3ASFA 1E8XA 4ACLA 4N3CA 1PAQA 1HU3A 2P58C 3LCAA 3QB2A 3UQ3A 3NF1A 5CGLA 4JZYA 3SBSA 4APFA 3P2BA 5G55A 2IONA 4RG6A 4JHRA 4L23A 4ITRA 3ZCBA 2XPYA 4BT8A 2EQXA 2KCVA 3NQPA 3CVXA 2X6FA 3FEXA 4XX5A 4BWRA 5J90A 3G2VA 3IV0A 4LRZA 3ZEFA 4L2LA 3PZDA 3ONKA 1KT1A 3ZHEB 1KLXA 4B8AA 1E7UA 4CGVA 4HOQA 3E4BA 3FUKA 5D0QD 5T8IA 3D9MA 3QDNA 5FQ4A 4B94A 3Q47B 2MOWA 2VYIA 3LXUX 4KZCA 3HVEA 4L1BA 3ZLMA 2KATA 3ZVVA 5BT1A 4QFVA 1UN8A 4LEUA 2QY7A 4CT4A 4XE0A 2GGFA 3G2WA 3APDA 3L08A 4HOTA 3CHSA 4J8SA 1HX8A 3FUFA 2LAIA 2KZTA 3MV3B 3ZYLA 4NRHB 4F1SA 4KYOB 1SZ9A 3SBTB 3UX4A 4W9RA 4B8CB 2HO1A 3I5PA 2IJGX 2OVFA 4Q94A 1W3BA 2I2OA 3PNTB 3AS8A 3IEGA 4GMJA 4H7YA 4N3BA 5BNWA 3CVWA 3TL5A 3U3WA 2WB2A 1EYHA 3CHMA 3T8MA 3FUIA 3CUCA 3ASGA 2PL2A 3SI5A 2A4ZA 3UT7A 3PE3A 2DCPA 2WXIA 3MX3A 5CKLA 4PS7A 5LP0A 4I6EA 3ZHEA 3UUXA 3CK9A 1WY6A 3ML8A 3D9KA 4H7XA 2WXKA 3FH5A 4UI9K 1HF8A 3RU0A 4FU3A 3MKRA 3FTXA 2WXLA 3QKYA 3D9NA 4J8DA 3OXGA 4OVVA 2GRLA 3D3MA 3MJWA 3S7FA 2WXQA 3MCXA 3FULA 4BX9A 3MGBA 1FCHA 3FTUA 3KAEA 3D9OA 2VY3A 2LNIA 4GAAA 4C0EA 2IOLA 2WXHA 4X2DA 4CEMA 4JC8A 2WXFA 4BY6A 2OVBA 4M16A 3CVUA 4KXKB 3U66A 3LVRE 2V5FA 3BG1B 4I17A 4UQXA 2F6SA 4XKCA 2BTDA 3SE5A 3ML9A 3CSTA 4FADA 4K03A 5KJKA 4AP2A 2FEZA 3URZA 3O4ZA 4URKA 5DIZA 1E7VA 4U0UA 2VSYA 3T5XA 1Z3XA 3QK0A 4YVOA 3G2SA 5G05C 4I9EA 3GW4A 3L6AA 4PH4B 1TJCA 2L6JA 3FTVA 3LPZA 3VLDA 3G2TA 3FH7A 1UN9A 2WXPA 3I4RB 3OXLA 5EX0A 4HXIA 4O6FA 4MKTA 2V4LA 4ANVA 5G2NA 3CVYA 4WNDA 1HG2A 3ZGQA 4LERA 5FT9A 3LYAA 3FP3A 1BPOA 4RSYA 3FWVA 1XNFA 5CMYA 3RIBA 2VSXE 4AY5A 4APOA 3FTYA 2IU1A 1Z3YA 3CLJA 4FP7A 3UMVA 3LKUA 4ANWA 2XCCA 4V3IA 1ZU2A 3RO2A 4DLQA 4U8HA 1Y6IA 3FHEA 4GYWA 5EKQD 4ATGA 2CFUA 4I9CA 4A1SA 4YNDA 2WXMA 3KEZA 5CMWA 2MHKA 5FTPA 3S2AA 4PDXA 2LAHA 3SN9A 2Q7FA 3IHVA 3S7JA 4AVXA 4HOSA 5G04C 4ABNA 4NURA 1SZAA 3TJPA 2VGYA 2E0IA 4EECA 4C9BB 4JHKA 5KJNA 2C0MA 3ASHA 4C0MA 4P29A 4J0UA 1YA0A 2JEKA 3QOUA 4G26A 4OYSA 3B13A 3EIQC 1H6KA 5LFAA 3I4GA 4WNFA 2KCKA 1UW4B 3CEQA 2VTBB 2PZIA 4NPSA 5A23A 2KZTB 4UWLA 1A17A 3PREA 4EZKA 2RG8A 3D9IA 3CVLA 4J6IA 1MQSA 1UJJA 2AW6A 4CDMA 3FUHA 4PS3A 4HVBA 1NA0A 1IHGA 3FTZA 2WMOA 5JJ6A 3CQCB 4WNGA 3CVPA 2LSVA 2CG3A 4EZLA 1U3DA 4MS6A 4AOFA 3SHFA 3PVLA 1TJFA 2C0LA 2J07A 3CSFA 4PS8A 4U04A 2Y3AA 5EX3A 1ELRA 5T4YA 4BT9A 1H2UA 3LDZA 1OWMA 2WQ6A 4F3VA 2JLBA 3ESLA 2X6IA 3L22A 5KCMA 4FJYA 3QJZA 2AXUA 1N54A 2UWJG 3B7SA 4GA1A 4UQZA 4AV7A 2IFUA 4J8FA 4CDNA 4B89A 2YINA 3APCA 5BW8C 2HYZA 3S7DA 1OWOA 2WXNA 4UI9J 3U64A 4AJWA 2PQRA 1MHQA 4M3OA 1IQUA 3NZSA 3GZ1A 2VTBA 2Y4TA 1DNPA 1HXIA 4OVUA 3RKVA 2ILRA 3D9LA 2PM7A 4ANUA 5JHAA 1TEZA 2FBNA 2G03A 1OWPA 3Q49B 1JWGA 4GCNA 2J49A 3ZXSA 3LEWA 2X3MA 2WXGA 4FULA 4GZ5A 3SZ7A 2GW1A 5C1DA 2R5SA 3OXFA 3RRUA 4D10C 4ME2A 2I9CA 2V0PA 2XGSA 2AVPA 4EZJA 1NA3A 1E90A 3VLFA 3I3NA 5LCWJ 4ILHB 1HS6A 1PC2A 1HH8A 1HE8A 3QNKA 5ANRA 3JQ0A 4IN3B 1OUVA 4GU5A 4KMOA 4B0ZA 4G1TA 2L0IA 1SQMA 3O48A 1OWLA 4J8EA 4JVSA 3FUMA 2IOSA 2RD0A 4JEUA 3DBSA 4JL0A 4GPKA 4K0RA 2WM9A 3PRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCL A;  2QFC A;  4WUY A;  2FI7 A;  3ZPJ A;  3JYS A;  3GYZ A;  3AS4 A;  5JFZ A;  3GZ2 A;  1QQE A;  3QWW A;  3CKB A;  5KJL A;  1HZ4 A;  5FZR A;  3LY7 A;  4X2E A;  4N5C A;  2XCB A;  3QWP A;  2YQ8 A;  2IF4 A;  3U4T A;  5JJ7 A;  4HOR A;  2WQH A;  1NZN A;  4PY3 A;  3HYM B;  5FZS A;  4Y6C A;  2XEV A;  3LY9 A;  3S7B A;  2VQ2 A;  3RO3 A;  3ESK A;  4XI8 A;  1QZ2 A;  4G24 A;  3MEK A;  3LY8 A;  4GYO A;  4X2C A;  2FO7 A;  3MA5 A;  5JJT A;  3CVQ A;  3ZC7 A;  2OND A;  3KS2 A;  5CMT A;  5FZQ A;  2KCL A;  1E96 B;  4YVQ C;  3WXX A;  3PDN A;  4I2W A;  2J9Q A;  5A6C A;  4GA2 A;  4BTA A;  5HI7 A;  3CK7 A;  3ULQ A;  4BTB A;  2XPI A;  3Q4A B;  2WPV A;  4N2Q A;  4XIF A;  5KJM A;  1B89 A;  3K9I A;  3TGO A;  1Y8M A;  4XI9 A;  5JFF A;  2Y4U A;  4HOU A;  3UPV A;  3TAX A;  2HR2 A;  1KT0 A;  5D0O D;  2I6H A;  2LSU A;  4GZ6 A;  3ASD A;  4UI9 C;  4XI0 A;  2NC9 A;  4U0Z A;  3LET A;  4I2Z A;  3MV2 B;  4U07 A;  4RG9 A;  2C2L A;  4G23 A;  3R9A B;  2E2E A;  3VTY A;  2VZA A;  2VGX B;  2OOE A;  4KBQ A;  3CKC A;  5LCW C;  4G2V A;  3SF4 A;  2UY1 B;  5FJY A;  3CV0 A;  5M72 A;  3EDT B;  3AS5 A;  4WGJ A;  2FF4 A;  3N71 A;  3KD7 A;  3CVN A;  4N39 A;  4JA7 A;  2DBA A;  2BUG A;  3Q5M A;  4G25 A;  3S6A A;  5ARF A;  1IYG A;  3PE4 A;  5G05 J;  2VGX A;  3QWV A;  4CDR A;  1ELW A;  3CK8 A;  1WM5 A;  4U0S A;  2KC7 A;  2VSN A;  2UY1 A;  3FFL A;  4EQF A;  3ZFW A;  3SHG A;  4JA9 A;  3Q15 A;  4GCO A;  4NQ0 A;  5CHE E;  3TG4 A;  5EU0 A;  2JK8 A;  4WNE A;  3ZN3 A;  2XGM A;  4Y6W A;  2PQN A;  1P5Q A;  4N3A A;  4N2S A;  4I1A A;  5FTP A;  1ZBP A;  2XGO A;  5ARG A;  4GZ3 A;  5BT1 A;  5G04 J;  4LU4 A;  5HQ8 A;  3BEE A;  3RJV A;  3TG5 A;  4GYY A;  5CCM A;  3VTX A;  4AIF A;  4UQY A;  4AY6 A;  1WAO 1;  4GA0 A;  4AM9 A;  5DBK A;  2YHC A;  4N67 A;  5A7D B;  5AYW D;  3N3U A;  3ASF A;  4N3C A;  2P58 C;  3UQ3 A;  3LCA A;  3NF1 A;  5CGL A;  4RG6 A;  4JHR A;  4ITR A;  3ZCB A;  4BT8 A;  2KCV A;  4BWR A;  1KT1 A;  3ZHE B;  1KLX A;  4CGV A;  4HOQ A;  3E4B A;  5D0Q D;  3QDN A;  4B94 A;  3Q47 B;  2VYI A;  3ZLM A;  2KAT A;  4LEU A;  4HOT A;  3MV3 B;  4NRH B;  4KYO B;  4W9R A;  2HO1 A;  1W3B A;  3AS8 A;  3IEG A;  4H7Y A;  4N3B A;  5BNW A;  3U3W A;  3CUC A;  3ASG A;  2PL2 A;  3PE3 A;  5CKL A;  3ZHE A;  3UUX A;  3CK9 A;  4H7X A;  3RU0 A;  4UI9 K;  3MKR A;  3QKY A;  4J8D A;  3OXG A;  3S7F A;  1FCH A;  3KAE A;  2VY3 A;  2LNI A;  4X2D A;  4M16 A;  4KXK B;  2V5F A;  4UQX A;  4I17 A;  2F6S A;  3SE5 A;  5KJK A;  2FEZ A;  3URZ A;  5DIZ A;  4U0U A;  2VSY A;  4YVO A;  5G05 C;  4I9E A;  3GW4 A;  1TJC A;  2L6J A;  3LPZ A;  3OXL A;  5EX0 A;  4O6F A;  4WND A;  3ZGQ A;  5FT9 A;  3LYA A;  3FP3 A;  3FWV A;  1XNF A;  3RIB A;  4AY5 A;  4APO A;  3LKU A;  2XCC A;  1ZU2 A;  3RO2 A;  4GYW A;  5EKQ D;  4I9C A;  4A1S A;  4YND A;  2MHK A;  3SN9 A;  2Q7F A;  3S7J A;  4HOS A;  5G04 C;  4ABN A;  2VGY A;  5KJN A;  2C0M A;  3ASH A;  4J0U A;  1YA0 A;  4G26 A;  3QOU A;  4WNF A;  2KCK A;  3CEQ A;  2PZI A;  4NPS A;  1A17 A;  3CVL A;  1NA0 A;  1IHG A;  5JJ6 A;  4WNG A;  3CVP A;  2LSV A;  2C0L A;  4BT9 A;  4CGW A;  4U04 A;  5EX3 A;  1ELR A;  4F3V A;  2JLB A;  2UWJ G;  4GA1 A;  4UQZ A;  2IFU A;  4J8F A;  3S7D A;  5BW8 C;  2HYZ A;  4UI9 J;  2PQR A;  3GZ1 A;  2Y4T A;  1HXI A;  3RKV A;  2FBN A;  2G03 A;  3Q49 B;  4GCN A;  4GZ5 A;  3SZ7 A;  2GW1 A;  5C1D A;  2R5S A;  3OXF A;  4ME2 A;  2XGS A;  2AVP A;  1NA3 A;  5LCW J;  1PC2 A;  1HH8 A;  4IN3 B;  1OUV A;  4G1T A;  3O48 A;  4J8E A;  4JL0 A;  4GPK A; 
#chains in the Genus database with same CATH topology
 2AXV A;  2IQC A;  3W9G A;  4DI4 A;  3E37 A;  4ZHB A;  5LOZ A;  3ZYQ A;  3ULE G;  3GZ2 A;  1JWF A;  4I1M A;  4IYP A;  3NB2 A;  5HKP A;  1HZ4 A;  1D8E A;  3LY7 A;  2A5U A;  4N5C A;  3Q7A A;  3RRM B;  4E85 A;  3MZL B;  2XZD G;  3JQ1 A;  4HOR A;  3V2X A;  3LY9 A;  2M63 A;  3S7B A;  2DYR E;  4XI8 A;  5IY5 E;  1H2T C;  4G24 A;  2MRI A;  4CCA A;  3HXF A;  2IO2 C;  3DSV A;  2J09 A;  5JJT A;  3CVQ A;  3Q7F A;  5FZQ A;  2KCL A;  2CHW A;  3PDN A;  3Q75 A;  3ZUV B;  1Z5S C;  2JAB A;  3DWL G;  3L16 A;  3LJ3 A;  3ONL A;  5ITZ F;  5HI7 A;  3NAW A;  2NXP A;  2J4B A;  3KSL A;  4A3T A;  4FLB A;  5T3R A;  2DIW A;  1K1A A;  2XPI A;  3P1U A;  2ZGD A;  1OWN A;  1B89 A;  1Y8M A;  2XRY A;  2Y4U A;  4GML A;  4WWN A;  3SD5 A;  3ZW3 A;  2BKG A;  3PZ1 A;  2XS8 A;  4O1P A;  3ASD A;  1FVH A;  3JCK C;  2ZXW E;  4ILG A;  4CT0 A;  3SFX A;  3R7R A;  4JW1 A;  5CED B;  2E2E A;  1UG3 A;  2V8S E;  5EYP F;  3VTY A;  1MYO A;  2VZA A;  4FJZ A;  3SFY A;  4I6J A;  2OOE A;  4KBQ A;  5LCW C;  4Q69 A;  3FDH A;  3SF4 A;  3CVV A;  4IUL A;  3CV0 A;  3AU5 A;  3AS5 A;  3N71 A;  1QBQ A;  2GRQ B;  1QNF A;  2ETC A;  3UM1 A;  3UKR G;  3CVN A;  4JA7 A;  2BUG A;  3Q5M A;  3FU3 A;  3S6A A;  1U3C A;  2P9U G;  3ZKJ A;  5G05 J;  3UT8 A;  4KT6 B;  3RAU A;  4U0S A;  1GW6 A;  2VSN A;  2UY1 A;  5JA4 D;  4K5A B;  4GB9 A;  3CHP A;  4BEP A;  3Q15 A;  2X38 A;  5FQ7 A;  3FH8 A;  3AJI A;  1TNU A;  4MBG A;  2XGM A;  1UJK A;  1JPL A;  3GZS A;  5ENT D;  3UTM A;  4NIK A;  1TNO A;  2J4D A;  4XKB A;  3ZYK A;  2AXZ A;  4BES A;  3TG5 A;  4GMR A;  4GTQ A;  4UWH A;  3CQG B;  5H7P A;  4AY6 A;  1FT2 A;  4AM9 A;  5DBK A;  4N67 A;  1FPP A;  3B7B A;  1N0Q A;  3QAR A;  3N3U A;  1EDU A;  4KZ0 A;  4DX1 A;  3ASF A;  4ACL A;  4N3C A;  1PAQ A;  1HU3 A;  3NF1 A;  4JZY A;  4M7C A;  2ION A;  4L23 A;  5EID A;  1KPS B;  2XPY A;  4BT8 A;  2EQX A;  2KCV A;  2X6F A;  1KT1 A;  3FUK A;  3R9M A;  4B94 A;  2VYI A;  3LXU X;  4KZC A;  4L1B A;  3ZVV A;  3UIO C;  4DX7 D;  3L08 A;  1G3N B;  4HOT A;  2NYJ A;  2Y69 E;  1HX8 A;  4NRH B;  4F1S A;  1SZ9 A;  3SBT B;  4N5Q A;  2HO1 A;  2MYO A;  4UUC A;  3PNT B;  3TL5 A;  4JB8 P;  4CZ2 D;  2PL2 A;  3SI5 A;  4BSZ B;  2P9L G;  3PE3 A;  2DCP A;  5LP0 A;  3ZHE A;  3UUX A;  1WY6 A;  3E32 A;  3RU0 A;  3FTX A;  2LXM A;  2WXL A;  3QKY A;  1N0R A;  3D9N A;  1AWC B;  3MJW A;  3ZXP A;  4HNA D;  5EN5 D;  3MCX A;  3MGB A;  5ENR D;  2VY3 A;  3DEP A;  4GAA A;  5EYL A;  4C0E A;  2P9K G;  3DEO A;  2IOL A;  4X2D A;  4CEM A;  3U66 A;  4I17 A;  3E34 A;  3C3Q A;  3ABM E;  4AP2 A;  2FEZ A;  1E7V A;  3UIN C;  3G2S A;  3FH7 A;  3OXL A;  4ANV A;  2NUN A;  1LD8 A;  1OCO E;  1TNZ A;  1XNF A;  2VSX E;  3E30 A;  4APO A;  3FTY A;  3DSU A;  3UMV A;  3CLJ A;  2VGE A;  4ANW A;  4A63 B;  4I9C A;  4YND A;  3KEZ A;  4F6R D;  5KNG A;  3SN9 A;  3S7J A;  3EU9 A;  3TJP A;  4JHK A;  3DST A;  4OAU C;  2C0M A;  3B13 A;  3EIQ C;  4HRM B;  2KCK A;  5A23 A;  2KZT B;  2RG8 A;  3D9I A;  4CDM A;  3FUH A;  4HVB A;  1NA0 A;  2WMO A;  4WNG A;  4AOF A;  1TJF A;  5T4Y A;  2Y3A A;  5EX3 A;  1ELR A;  1N4S A;  3LDZ A;  3ABK E;  4F3V A;  1N4R A;  1NL4 A;  3L22 A;  4X8Q A;  3UI2 A;  4AV7 A;  4UQZ A;  2OEV A;  3F6Q A;  2YIN A;  3APC A;  4AJW A;  3U64 A;  1MHQ A;  1DCE A;  3DXM G;  3GZ1 A;  3TWQ A;  1D8D A;  1TEZ A;  1TN8 A;  2FBN A;  2G03 A;  3C3O A;  2X3M A;  2WXG A;  3UM0 A;  4GZ5 A;  3RRU A;  1NA3 A;  4QQI A;  3I3N A;  3NOC D;  1HS6 A;  1PC2 A;  1HE8 A;  3TWR A;  4HBD A;  4G1T A;  1V54 E;  4J8E A;  4JVS A;  3DBS A;  1N95 A;  4GPK A;  3PRZ A;  2IO3 C;  2QFC A;  5EDS A;  2DWZ A;  4WUY A;  5BXO A;  1N52 A;  1K8K G;  3QWW A;  3CKB A;  4LSZ E;  2QZA A;  4MLP A;  1OCZ E;  2YQ8 A;  5JJ7 A;  5B1A E;  3KSQ A;  2WQH A;  4PY3 A;  5FZS A;  3R7Q A;  4C48 B;  5AIJ A;  4L2Y A;  4K5C A;  1QZ2 A;  3MEK A;  5C2Y A;  4ILI A;  3FU6 A;  1BLX B;  4DX5 D;  4GYO A;  2FO7 A;  3EHM A;  3KS2 A;  3ZU7 B;  1E96 B;  3L13 A;  5AEN A;  4AEZ C;  3L17 A;  1JUQ A;  4GTR A;  4GZD A;  4I2W A;  1OXJ A;  4GZC A;  5A6C A;  4GA2 A;  4DK5 A;  4XZ4 A;  2DZO A;  3CK7 A;  4L7T A;  3ULQ A;  3JUI A;  1LTX A;  4B93 B;  3FUE A;  4BTB A;  3HDX A;  3SQV A;  3PZ4 A;  5ENO D;  2PM6 A;  2KBX A;  4N2Q A;  4MRU A;  3K9I A;  3U9W A;  5JFF A;  1IQR A;  3HHM A;  1NP7 A;  5D0O D;  2LSU A;  4RVB A;  5BXU A;  4GZ6 A;  1HO8 A;  1OT8 A;  4UI9 C;  3DXK G;  2NC9 A;  3LET A;  1MX2 A;  4WWP A;  1SW6 A;  3MV2 B;  4U07 A;  3IHY A;  4FHJ A;  1L5J A;  4G23 A;  1KZP A;  2WVI A;  2B6C A;  4LNU D;  4ACK A;  3TXM A;  3TWT A;  4CYM D;  2UY1 B;  3G2U A;  3Q79 A;  5FJY A;  3ZIM A;  3ZYM A;  5M72 A;  1NI1 A;  4U95 D;  3T8K A;  4DRX E;  3FUN A;  2DBA A;  3FEY A;  4U96 D;  3ZRH A;  4JPS A;  2CG2 A;  5ARF A;  4TXP A;  3D9J A;  3PE4 A;  1O5M A;  2VGX A;  3QWV A;  4CDR A;  3TWX A;  1ELW A;  1WM5 A;  2XHE A;  3SO8 A;  3RK6 A;  4XEI G;  4DJA A;  5EIB E;  3SHG A;  3TXN A;  1S63 A;  4GCO A;  2WXJ A;  3TG4 A;  2X6K A;  3Q9N C;  2JK8 A;  3UM2 A;  3PEU B;  4DI3 A;  1OY3 D;  4BX8 A;  2IY0 C;  4LNB A;  4N3A A;  4I1A A;  5FTP A;  2XGO A;  5ARG A;  3MYV A;  4UWK A;  3SGH A;  5G04 J;  3AU4 A;  4HS2 A;  3RJV A;  5ENP D;  5CCM A;  5E76 A;  3PUK A;  4HQD A;  1WAO 1;  3CHQ A;  2YHC A;  3JXJ A;  3FU0 A;  5AJL A;  3APF A;  5AAO A;  5CBN A;  5AYW D;  3ISM C;  4WWO A;  4CRW A;  5J08 A;  3ZNG A;  1TNY A;  3LCA A;  5CGL A;  3SBS A;  4APF A;  3C5R A;  4RG6 A;  4JHR A;  4ITR A;  3ZCB A;  3NQP A;  3CVX A;  4XX5 A;  4BWR A;  5J90 A;  3G2V A;  4LRZ A;  4L2L A;  2OCC E;  3ZHE B;  4CGV A;  3QDN A;  2P9S G;  2P2C P;  2LXL A;  2KAT A;  1UN8 A;  4HI8 A;  4XE0 A;  2GGF A;  3G2W A;  3APD A;  3CHS A;  3MV3 B;  3I5P A;  4Q94 A;  2I2O A;  3CVW A;  5BNW A;  3U3W A;  2WB2 A;  3C72 A;  2A4Z A;  3ML8 A;  4ZFH A;  2WXK A;  4FU3 A;  3MKR A;  3D3M A;  3S7F A;  3KEA A;  4BX9 A;  1FCH A;  2LNI A;  3CVU A;  5JMN D;  5AQ9 A;  2F6S A;  2XS1 A;  3CST A;  3BQO A;  3O4Z A;  5DIZ A;  3T5X A;  2ZIS A;  5G05 C;  4I9E A;  3GW4 A;  4PH4 B;  3LPZ A;  3VLD A;  3BU8 A;  2EIM E;  3G2T A;  2WXP A;  5EX0 A;  3AAA C;  4HXI A;  4MKT A;  1TYQ G;  2LUH A;  4LER A;  3FP3 A;  4RSY A;  2IU1 A;  2Y0B G;  3LKU A;  4U8H A;  2XZT G;  3FHE A;  2CFU A;  4TUM A;  2LAH A;  4ABN A;  2E0I A;  5AQA A;  4P29 A;  1MX4 A;  1YA0 A;  2JEK A;  4G26 A;  4TXQ A;  5LFA A;  4WNF A;  1JCR A;  4UWL A;  3PRE A;  4EZK A;  4J6I A;  4PS3 A;  4RLY A;  3FTZ A;  5JJ6 A;  5B3S E;  2LSV A;  4MS6 A;  3PVL A;  1AP7 A;  2J07 A;  4CGW A;  4F1P A;  4O1O A;  2X6I A;  2H6G A;  3EHQ A;  5KCM A;  3QJZ A;  1N54 A;  2IFU A;  4J8F A;  3S7D A;  1OWO A;  2WXN A;  4M3O A;  2VTB A;  2Y4T A;  1DNP A;  1HXI A;  5JHA A;  3D9L A;  3Q49 B;  4GCN A;  4FUL A;  2GW1 A;  3OXF A;  4D10 C;  4ME2 A;  5FIO A;  2V0P A;  4ILH B;  1HH8 A;  3JQ0 A;  4B0Z A;  4GU5 A;  4J7W A;  3Q9U C;  3UXG A;  2L0I A;  3O48 A;  1UOH A;  3C3R A;  2IOS A;  2WM9 A;  5CCL A;  5BPP A;  2FI7 A;  3ZPJ A;  1V55 E;  4EPZ A;  3GYZ A;  4G11 A;  4HRL A;  1IXV A;  2GRM A;  1QQE A;  2VJ8 A;  4I43 A;  3UM3 A;  4Q96 A;  3EUV A;  2R02 A;  4X2E A;  1EPU A;  2KM4 A;  3CHR A;  3DSS A;  2R17 C;  1MJ0 A;  1SA4 A;  4FHK A;  3VLE A;  2XEN A;  1E8W A;  3EJN A;  3HYM B;  2RFM A;  2XEV A;  2ZU6 B;  1E8Z A;  2X6H A;  2OV8 A;  3T5V A;  4FA6 A;  2HM8 A;  4LCT A;  4YDE A;  2EIL E;  5E75 A;  1EF1 C;  3LY8 A;  3EHN A;  3MA5 A;  2L0T B;  3DSW A;  4KVO A;  3QAQ A;  2AWI A;  4YVQ C;  3PUJ A;  4EBA G;  2AJA A;  3FTW A;  3C98 A;  4WAF A;  1N4Q A;  2J9Q A;  3CHO A;  5HS0 A;  1OCC E;  3OTN A;  4AXH A;  3CR3 A;  5ENQ D;  3FU5 A;  2GRN B;  3UT4 A;  2WPV A;  3TGO A;  5KNH D;  2X6J A;  3TAX A;  4FLH A;  1KT0 A;  3LVQ E;  2I6H A;  3HXC A;  2I1K A;  4U0Z A;  5FQ8 A;  4GTO A;  2NSZ A;  4I2Z A;  4GTS A;  1DVP A;  3SFZ A;  1MZC A;  4IRU A;  1E8Y A;  5ENS D;  3TWW A;  2VGX B;  3V30 A;  2VSO E;  3LS8 A;  5ANL A;  3CKC A;  4G2V A;  1LD7 A;  4GTT A;  1DCQ A;  1NH1 A;  4I1O B;  4KVM A;  2H6I A;  2FF4 A;  2WQ7 A;  4G8K A;  5EIL A;  3FUD A;  2XPZ A;  1QYM A;  1INZ A;  1IYG A;  3J5P A;  4HLE A;  3E33 A;  5BV0 A;  1Z6T A;  3CK8 A;  1X5B A;  5JHB A;  3PS6 A;  3HXD A;  4EQF A;  2R03 A;  4ANX A;  4JA9 A;  2XQ0 A;  2DYS E;  5EU0 A;  3PZ2 A;  2L9B A;  4WNE A;  3ZN3 A;  2PQN A;  4JXT A;  5BT1 A;  2A5E A;  4GZ3 A;  1H19 A;  2F0Y A;  2YHE A;  3B95 A;  4A1G A;  4LU4 A;  5HQ8 A;  3BEE A;  3TWU A;  4HRN A;  2V4H C;  4UWF A;  3OAW A;  3TWS A;  4AIF A;  4NAC A;  4UQY A;  4GA0 A;  2F37 A;  1ZB1 A;  1YYH A;  3MKQ A;  1PY1 A;  4JD2 G;  3QC1 A;  3RRN B;  1O1S A;  1E8X A;  5G55 A;  3FEX A;  4GPM A;  3ONK A;  1KLX A;  1BD8 A;  4HOQ A;  5D0Q D;  4HI9 A;  5T8I A;  5CRV A;  2MOW A;  3HVE A;  3ZLM A;  4QFV A;  2F8X K;  2QY7 A;  2L6B A;  4DX6 D;  5AN8 A;  2KZT A;  3NOG D;  4KYO B;  3UX4 A;  4B8C B;  5D2M C;  4ATZ D;  2IJG X;  1W3B A;  3HRA A;  4H7Y A;  1EYH A;  3CHM A;  3T8M A;  3FUI A;  3CUC A;  3UT7 A;  3MX3 A;  4PS7 A;  4I6E A;  4GTP A;  3CK9 A;  3D9K A;  4UI9 K;  1HF8 A;  2H6F A;  4J8D A;  3OXG A;  4OVV A;  2WXQ A;  3FUL A;  4U8Y D;  2ETA A;  5CBO A;  3AG3 E;  4JC8 A;  2OVB A;  3BG1 B;  4XKC A;  3SE5 A;  4HLL A;  3ML9 A;  4K03 A;  5HRY A;  3URZ A;  1O1R A;  4URK A;  4U0U A;  2VSY A;  5AQB A;  2KXP C;  4O60 A;  3UIP C;  1WDY A;  4GTM A;  3FTV A;  1UN9 A;  2QC9 A;  2V4L A;  5G2N A;  1HG2 A;  2BKK B;  3LYA A;  5FT9 A;  2GRP B;  3FWV A;  5CMY A;  3RIB A;  1TNB A;  1Z3Y A;  4FP7 A;  1SVX A;  2ETB A;  3RO2 A;  1Y6I A;  4ATG A;  5EKQ D;  4A1S A;  2WXM A;  3S2A A;  4PDX A;  3IHV A;  3AG4 E;  4HOS A;  5G04 C;  4NUR A;  1SZA A;  2HE0 A;  3ASH A;  4C0M A;  4J0U A;  2DVW A;  2PNN A;  1H6K A;  3I4G A;  1UW4 B;  2VTB B;  2PZI A;  4NPS A;  1A17 A;  3ULY A;  1N4P A;  1MQS A;  3CQC B;  3CVP A;  2CG3 A;  3LJN A;  1U3D A;  4EZL A;  2EIJ E;  3SHF A;  3ABL E;  4BT9 A;  4PS8 A;  4U04 A;  1H2U A;  1OWM A;  4GA1 A;  1U2V G;  3DPY A;  4CDN A;  5B1B E;  2HYZ A;  1IQU A;  4ANU A;  1S64 A;  1OWP A;  1JWG A;  2J49 A;  3ZXS A;  3ASO E;  3SZ7 A;  1IKN D;  2R5S A;  3JXI A;  1OCR E;  2XGS A;  5LCW J;  4YDW A;  5ANR A;  2B0O E;  4IN3 B;  4BET A;  1OUV A;  3W9F A;  1Q2Z A;  3FUM A;  4JEU A;  4JL0 A;  3V2O A;  2XEE A;  3DSX A;  2R05 A;  3BUA A;  2I1J A;  4DX2 A;  3JYS A;  5KWD A;  2CHX A;  3AS4 A;  1MX6 A;  5JFZ A;  4TXR A;  1TN7 A;  2BF0 X;  5KJL A;  5FZR A;  2F8Y A;  5BUZ A;  2XCB A;  3DRA A;  3QWP A;  1BU9 A;  3J5Q B;  3IKO B;  2IF4 A;  3U4T A;  3PEV B;  5ENN A;  3FY4 A;  2YNQ A;  4LNG A;  1NZN A;  4Y6C A;  5BV1 A;  3D9P A;  2XRZ A;  2WMN A;  2VQ2 A;  3PNL B;  3RO3 A;  4GTV A;  3ESK A;  2R59 A;  4TRQ A;  2Y1L E;  2FUL A;  2J08 A;  4BSX A;  4L9P A;  4X2C A;  3ZC7 A;  2GRO B;  2OND A;  4PUC A;  5CMT A;  1LF8 A;  3WXX A;  4JHJ A;  2H6H A;  4E6H A;  3HXE A;  4BTA A;  4OAV B;  2P9P G;  3ASN E;  2ZGG A;  3Q4A B;  1SA5 A;  2V5Q C;  4XIF A;  5KJM A;  3HIZ A;  4XI9 A;  4HOU A;  1H6O A;  5FQ6 A;  3UPV A;  4DUI A;  2HR2 A;  3IBE A;  3BG0 B;  4FC8 A;  4F53 A;  3PH0 C;  4R7L A;  4EBA A;  3B7R L;  4K5B A;  4XI0 A;  1RZ4 A;  5AJD A;  1S0P A;  1VDY A;  1N94 A;  3ENE A;  3FTS A;  4HB5 A;  4RG9 A;  1H0A A;  4TUU A;  2C2L A;  3R9A B;  5CEA A;  4DLO A;  2QYJ A;  1BI8 B;  1XGW A;  3CIA A;  3HG0 D;  4I6G A;  4DPR A;  4F7A A;  1JCS A;  3SNX A;  4LG6 A;  5AQ7 A;  3CGH A;  3EDT B;  2GRR B;  4WGJ A;  1DC2 A;  3D9H A;  3KD7 A;  5CRU A;  3B7T A;  1RW2 A;  1O1T A;  3FUJ A;  1H2V C;  4N39 A;  5FWQ A;  2LO6 A;  1A5E A;  5FIN A;  4G25 A;  4G8L A;  4J8Y A;  2RKK A;  3L82 A;  1FVF A;  5D66 A;  4UWG A;  4FAD A;  3NBN B;  2KC7 A;  4BFR A;  3FFL A;  3B7U X;  1X81 A;  3ZFW A;  1TR4 A;  4U63 A;  3EIJ A;  1S70 B;  4TV3 A;  4NQ0 A;  5CHE E;  3MKQ B;  2CHZ A;  3AG2 E;  5CEC B;  2NUD A;  4U8V D;  2WXO A;  4Y6W A;  4HFG A;  2EIK E;  1P5Q A;  1HFA A;  4A3V A;  4N2S A;  3RSE G;  1ZBP A;  1ELK A;  3JUE A;  2WXR A;  3L54 A;  4JEH A;  3NZU A;  4A55 A;  3Q78 A;  4GYY A;  3VTX A;  4BER A;  4LUN U;  1FT1 A;  3HVE B;  5LX8 A;  2P9N G;  5A7D B;  2CFZ A;  2RFA A;  3DPD A;  1HG5 A;  3X2Q E;  2P58 C;  3UQ3 A;  3QB2 A;  2R2L A;  3P2B A;  1D9S A;  3V79 K;  2BED A;  1N11 A;  3IV0 A;  3IXE A;  3ZEF A;  3PZD A;  4B8A A;  1E7U A;  4U7E B;  4YDY A;  3E4B A;  1N9A A;  3D9M A;  5FQ4 A;  3Q47 B;  3SY2 A;  3V31 A;  4LEU A;  4CT4 A;  4J8S A;  3FUF A;  2LAI A;  3ZYL A;  3HXB A;  4W9R A;  4RQI A;  2OVF A;  3AS8 A;  3IEG A;  4GMJ A;  4N3B A;  2EIN E;  3ASG A;  4EHM A;  2WXI A;  5CKL A;  1NFI E;  1K1B A;  4H7X A;  3FH5 A;  2GRL A;  2J8S D;  3EU5 A;  1TN6 A;  3FTU A;  3KAE A;  3D9O A;  2QYU A;  5KBA A;  2WXH A;  3Q73 A;  2WXF A;  4BY6 A;  4M16 A;  4KXK B;  3LVR E;  2V5F A;  4UQX A;  2BTD A;  1KZO A;  5KJK A;  1Z3X A;  3QK0 A;  4YVO A;  3L6A A;  1TJC A;  2L6J A;  3I4R B;  5CER B;  3EHR A;  4O6F A;  3CVY A;  4WND A;  3PZ3 A;  3WG7 E;  3ZGQ A;  1BPO A;  2ZIR A;  4AY5 A;  2DZN A;  2XEH A;  2XCC A;  4V3I A;  1ZU2 A;  4DLQ A;  4GYW A;  2FO1 E;  5CMW A;  2MHK A;  4AVX A;  2Q7F A;  5AAR A;  2VGY A;  4EEC A;  4C9B B;  5KJN A;  4OYS A;  3QOU A;  1YCS B;  3CEQ A;  4Z68 A;  3CVL A;  1UJJ A;  2AW6 A;  1IHG A;  1BI7 B;  1K3Z D;  1WG0 A;  2C0L A;  3CSF A;  2WQ6 A;  2JLB A;  3ESL A;  4FJY A;  2P9I G;  2AXU A;  2UWJ G;  3B7S A;  4B89 A;  5BW8 C;  4UI9 J;  3L9T A;  1YMP A;  2PQR A;  4YDO A;  3NZS A;  3TWV A;  4OVU A;  3RKV A;  2ILR A;  2PM7 A;  3LEW A;  3T9K A;  2IEJ A;  5C1D A;  1IHB A;  3UKU G;  2I9C A;  2AVP A;  1JCQ A;  4EZJ A;  1E90 A;  3VLF A;  3QNK A;  4KMO A;  2OEW A;  1SQM A;  1OWL A;  3AG1 E;  2RD0 A;  4K0R A;  1H6P A; 
#chains in the Genus database with same CATH homology
 5CCL A;  2AXV A;  2QFC A;  5EDS A;  2IQC A;  5BPP A;  4WUY A;  4DI4 A;  2FI7 A;  2I1J A;  3ZPJ A;  3JYS A;  2CHX A;  4EPZ A;  3GYZ A;  4G11 A;  5LOZ A;  3ZYQ A;  3AS4 A;  1N52 A;  2GRM A;  5JFZ A;  3GZ2 A;  1JWF A;  4I1M A;  1QQE A;  2VJ8 A;  4I43 A;  4IYP A;  3QWW A;  3CKB A;  4Q96 A;  2BF0 X;  5KJL A;  1HZ4 A;  5FZR A;  3LY7 A;  4X2E A;  4MLP A;  2A5U A;  4N5C A;  5BUZ A;  2XCB A;  3RRM B;  1EPU A;  3QWP A;  2YQ8 A;  3IKO B;  4E85 A;  2IF4 A;  2KM4 A;  3MZL B;  3CHR A;  5JJ7 A;  3PEV B;  5ENN A;  3U4T A;  3FY4 A;  2YNQ A;  2R17 C;  3JQ1 A;  4HOR A;  4FHK A;  3VLE A;  1E8W A;  2WQH A;  1NZN A;  3EJN A;  4PY3 A;  3HYM B;  5FZS A;  4Y6C A;  3R7Q A;  2XEV A;  3LY9 A;  2ZU6 B;  5AIJ A;  5BV1 A;  1E8Z A;  2X6H A;  4L2Y A;  2OV8 A;  3T5V A;  2M63 A;  3D9P A;  3S7B A;  2XRZ A;  4FA6 A;  2HM8 A;  2WMN A;  4LCT A;  2VQ2 A;  3PNL B;  3RO3 A;  5E75 A;  3ESK A;  1EF1 C;  4XI8 A;  1QZ2 A;  2R59 A;  1H2T C;  4TRQ A;  4G24 A;  2FUL A;  2J08 A;  3LY8 A;  3MEK A;  5C2Y A;  2MRI A;  3EHN A;  4ILI A;  4BSX A;  3FU6 A;  4CCA A;  4GYO A;  2J09 A;  4X2C A;  2FO7 A;  3MA5 A;  5JJT A;  3CVQ A;  3ZC7 A;  2OND A;  3EHM A;  3KS2 A;  4PUC A;  2L0T B;  5CMT A;  5FZQ A;  2KCL A;  4KVO A;  3QAQ A;  1E96 B;  1LF8 A;  2AWI A;  3L13 A;  5AEN A;  4YVQ C;  3WXX A;  4JHJ A;  4AEZ C;  3PUJ A;  3L17 A;  2CHW A;  3PDN A;  3L16 A;  4EBA G;  1JUQ A;  3FTW A;  3LJ3 A;  3ONL A;  4GZD A;  4E6H A;  3C98 A;  4WAF A;  4I2W A;  2J9Q A;  3CHO A;  4GZC A;  3OTN A;  4GA2 A;  5A6C A;  4AXH A;  4DK5 A;  4BTA A;  3CR3 A;  4XZ4 A;  5HI7 A;  3CK7 A;  2NXP A;  3FU5 A;  2J4B A;  4L7T A;  3ULQ A;  3JUI A;  4A3T A;  4FLB A;  5T3R A;  2DIW A;  3FUE A;  4BTB A;  3HDX A;  2XPI A;  3Q4A B;  3P1U A;  3UT4 A;  2PM6 A;  2WPV A;  1OWN A;  4N2Q A;  4MRU A;  4XIF A;  5KJM A;  1B89 A;  3K9I A;  3TGO A;  1Y8M A;  3HIZ A;  4XI9 A;  3U9W A;  5JFF A;  1IQR A;  2XRY A;  2Y4U A;  4GML A;  4HOU A;  4WWN A;  5FQ6 A;  3HHM A;  3UPV A;  2X6J A;  3TAX A;  4FLH A;  3SD5 A;  1NP7 A;  2HR2 A;  3ZW3 A;  1KT0 A;  3IBE A;  3LVQ E;  2I6H A;  2LSU A;  3BG0 B;  4FC8 A;  5D0O D;  4F53 A;  4RVB A;  3PH0 C;  4R7L A;  4GZ6 A;  4EBA A;  3B7R L;  3ASD A;  2I1K A;  1HO8 A;  1FVH A;  4UI9 C;  4XI0 A;  2NC9 A;  3JCK C;  4U0Z A;  5FQ8 A;  4ILG A;  5AJD A;  1S0P A;  2NSZ A;  3LET A;  4I2Z A;  4WWP A;  1VDY A;  4CT0 A;  3MV2 B;  3ENE A;  3FTS A;  4U07 A;  1DVP A;  4RG9 A;  3SFZ A;  3R7R A;  3IHY A;  1H0A A;  4FHJ A;  1L5J A;  4IRU A;  4TUU A;  1E8Y A;  2C2L A;  4JW1 A;  4G23 A;  3R9A B;  2E2E A;  1UG3 A;  4DLO A;  2V8S E;  2WVI A;  3VTY A;  4ACK A;  3TXM A;  2VZA A;  4FJZ A;  1XGW A;  2VGX B;  2VSO E;  3CIA A;  4I6J A;  2OOE A;  3LS8 A;  4KBQ A;  5ANL A;  3CKC A;  4Q69 A;  5LCW C;  3FDH A;  4G2V A;  4I6G A;  3SF4 A;  2UY1 B;  3G2U A;  3CVV A;  4IUL A;  5FJY A;  3CV0 A;  4DPR A;  3ZIM A;  4F7A A;  4I1O B;  3ZYM A;  4KVM A;  3SNX A;  3AU5 A;  3CGH A;  5M72 A;  3EDT B;  3AS5 A;  4WGJ A;  2FF4 A;  2WQ7 A;  3N71 A;  3KD7 A;  1QNF A;  3B7T A;  3FUD A;  3FUN A;  3CVN A;  3FUJ A;  1H2V C;  4N39 A;  4JA7 A;  5FWQ A;  2DBA A;  2LO6 A;  3FEY A;  2XPZ A;  2BUG A;  3ZRH A;  3Q5M A;  3FU3 A;  4JPS A;  1INZ A;  2CG2 A;  4G25 A;  3S6A A;  1U3C A;  5ARF A;  1IYG A;  3D9J A;  3PE4 A;  4HLE A;  5G05 J;  1FVF A;  2VGX A;  3QWV A;  4CDR A;  5BV0 A;  1ELW A;  4CGW A;  4UWG A;  1Z6T A;  3CK8 A;  4KT6 B;  1WM5 A;  1X5B A;  4U0S A;  1GW6 A;  2KC7 A;  2XHE A;  2VSN A;  3UT8 A;  3PS6 A;  4BFR A;  2UY1 A;  3FFL A;  5JHB A;  3RK6 A;  4DJA A;  4EQF A;  3B7U X;  4ANX A;  3ZFW A;  4GB9 A;  3SHG A;  3CHP A;  4U63 A;  4JA9 A;  3Q15 A;  3EIJ A;  4GCO A;  4TV3 A;  2X38 A;  3TXN A;  5FQ7 A;  3FH8 A;  4NQ0 A;  5CHE E;  2WXJ A;  2XQ0 A;  3TG4 A;  2X6K A;  3MKQ B;  5EU0 A;  2CHZ A;  2JK8 A;  3PEU B;  2L9B A;  4WNE A;  4DI3 A;  2WXO A;  3ZN3 A;  2XGM A;  4BX8 A;  1UJK A;  4Y6W A;  2PQN A;  4JXT A;  4HFG A;  1JPL A;  1P5Q A;  1HFA A;  3GZS A;  4A3V A;  4N3A A;  4N2S A;  4I1A A;  1ZBP A;  2XGO A;  5ARG A;  1ELK A;  4GZ3 A;  1H19 A;  2J4D A;  2WXR A;  3L54 A;  3MYV A;  4UWK A;  3SGH A;  4JEH A;  2YHE A;  5G04 J;  4A1G A;  3NZU A;  4XKB A;  3ZYK A;  2AXZ A;  3AU4 A;  4LU4 A;  4HS2 A;  4A55 A;  5HQ8 A;  3BEE A;  3RJV A;  3TG5 A;  4UWH A;  4GYY A;  3CQG B;  3VTX A;  5CCM A;  4UWF A;  5E76 A;  3OAW A;  4AIF A;  3PUK A;  4NAC A;  4LUN U;  4UQY A;  4AY6 A;  3HVE B;  1WAO 1;  4GA0 A;  4AM9 A;  5LX8 A;  3CHQ A;  2YHC A;  5DBK A;  4N67 A;  5A7D B;  3FU0 A;  3MKQ A;  5AJL A;  3APF A;  1PY1 A;  3QAR A;  2CFZ A;  3QC1 A;  5AYW D;  3N3U A;  4WWO A;  3RRN B;  1EDU A;  3DPD A;  4CRW A;  1HG5 A;  4KZ0 A;  5J08 A;  3ASF A;  1E8X A;  4ACL A;  4N3C A;  1PAQ A;  1HU3 A;  2P58 C;  3LCA A;  3QB2 A;  3UQ3 A;  3NF1 A;  5CGL A;  4JZY A;  3SBS A;  4APF A;  3P2B A;  5G55 A;  2ION A;  4RG6 A;  4JHR A;  4L23 A;  4ITR A;  3ZCB A;  2XPY A;  4BT8 A;  2EQX A;  2KCV A;  3NQP A;  3CVX A;  2X6F A;  3FEX A;  4XX5 A;  4BWR A;  5J90 A;  3G2V A;  3IV0 A;  4LRZ A;  3ZEF A;  4L2L A;  3PZD A;  3ONK A;  1KT1 A;  3ZHE B;  1KLX A;  4B8A A;  1E7U A;  4CGV A;  4HOQ A;  3E4B A;  3FUK A;  5D0Q D;  5T8I A;  3D9M A;  3QDN A;  5FQ4 A;  4B94 A;  3Q47 B;  2MOW A;  2VYI A;  3LXU X;  4KZC A;  3HVE A;  4L1B A;  3ZLM A;  2KAT A;  3ZVV A;  5BT1 A;  4QFV A;  1UN8 A;  4LEU A;  2QY7 A;  4CT4 A;  4XE0 A;  2GGF A;  3G2W A;  3APD A;  3L08 A;  4HOT A;  3CHS A;  4J8S A;  1HX8 A;  3FUF A;  2LAI A;  2KZT A;  3MV3 B;  3ZYL A;  4NRH B;  4F1S A;  4KYO B;  1SZ9 A;  3SBT B;  3UX4 A;  4W9R A;  4B8C B;  2HO1 A;  3I5P A;  2IJG X;  2OVF A;  4Q94 A;  1W3B A;  2I2O A;  3PNT B;  3AS8 A;  3IEG A;  4GMJ A;  4H7Y A;  4N3B A;  5BNW A;  3CVW A;  3TL5 A;  3U3W A;  2WB2 A;  1EYH A;  3CHM A;  3T8M A;  3FUI A;  3CUC A;  3ASG A;  2PL2 A;  3SI5 A;  2A4Z A;  3UT7 A;  3PE3 A;  2DCP A;  2WXI A;  3MX3 A;  5CKL A;  4PS7 A;  5LP0 A;  4I6E A;  3ZHE A;  3UUX A;  3CK9 A;  1WY6 A;  3ML8 A;  3D9K A;  4H7X A;  2WXK A;  3FH5 A;  4UI9 K;  1HF8 A;  3RU0 A;  4FU3 A;  3MKR A;  3FTX A;  2WXL A;  3QKY A;  3D9N A;  4J8D A;  3OXG A;  4OVV A;  2GRL A;  3D3M A;  3MJW A;  3S7F A;  2WXQ A;  3MCX A;  3FUL A;  4BX9 A;  3MGB A;  1FCH A;  3FTU A;  3KAE A;  3D9O A;  2VY3 A;  2LNI A;  4GAA A;  4C0E A;  2IOL A;  2WXH A;  4X2D A;  4CEM A;  4JC8 A;  2WXF A;  4BY6 A;  2OVB A;  4M16 A;  3CVU A;  4KXK B;  3U66 A;  3LVR E;  2V5F A;  3BG1 B;  4I17 A;  4UQX A;  2F6S A;  4XKC A;  2BTD A;  3SE5 A;  3ML9 A;  3CST A;  4FAD A;  4K03 A;  5KJK A;  4AP2 A;  2FEZ A;  3URZ A;  3O4Z A;  4URK A;  5DIZ A;  1E7V A;  4U0U A;  2VSY A;  3T5X A;  1Z3X A;  3QK0 A;  4YVO A;  3G2S A;  5G05 C;  4I9E A;  3GW4 A;  3L6A A;  4PH4 B;  1TJC A;  2L6J A;  3FTV A;  3LPZ A;  3VLD A;  3G2T A;  3FH7 A;  1UN9 A;  2WXP A;  3I4R B;  3OXL A;  5EX0 A;  4HXI A;  4O6F A;  4MKT A;  2V4L A;  4ANV A;  5G2N A;  3CVY A;  4WND A;  1HG2 A;  3ZGQ A;  4LER A;  5FT9 A;  3LYA A;  3FP3 A;  1BPO A;  4RSY A;  3FWV A;  1XNF A;  5CMY A;  3RIB A;  2VSX E;  4AY5 A;  4APO A;  3FTY A;  2IU1 A;  1Z3Y A;  3CLJ A;  4FP7 A;  3UMV A;  3LKU A;  4ANW A;  2XCC A;  4V3I A;  1ZU2 A;  3RO2 A;  4DLQ A;  4U8H A;  1Y6I A;  3FHE A;  4GYW A;  5EKQ D;  4ATG A;  2CFU A;  4I9C A;  4A1S A;  4YND A;  2WXM A;  3KEZ A;  5CMW A;  2MHK A;  5FTP A;  3S2A A;  4PDX A;  2LAH A;  3SN9 A;  2Q7F A;  3IHV A;  3S7J A;  4AVX A;  4HOS A;  5G04 C;  4ABN A;  4NUR A;  1SZA A;  3TJP A;  2VGY A;  2E0I A;  4EEC A;  4C9B B;  4JHK A;  5KJN A;  2C0M A;  3ASH A;  4C0M A;  4P29 A;  4J0U A;  1YA0 A;  2JEK A;  3QOU A;  4G26 A;  4OYS A;  3B13 A;  3EIQ C;  1H6K A;  5LFA A;  3I4G A;  4WNF A;  2KCK A;  1UW4 B;  3CEQ A;  2VTB B;  2PZI A;  4NPS A;  5A23 A;  2KZT B;  4UWL A;  1A17 A;  3PRE A;  4EZK A;  2RG8 A;  3D9I A;  3CVL A;  4J6I A;  1MQS A;  1UJJ A;  2AW6 A;  4CDM A;  3FUH A;  4PS3 A;  4HVB A;  1NA0 A;  1IHG A;  3FTZ A;  2WMO A;  5JJ6 A;  3CQC B;  4WNG A;  3CVP A;  2LSV A;  2CG3 A;  4EZL A;  1U3D A;  4MS6 A;  4AOF A;  3SHF A;  3PVL A;  1TJF A;  2C0L A;  2J07 A;  3CSF A;  4PS8 A;  4U04 A;  2Y3A A;  5EX3 A;  1ELR A;  5T4Y A;  4BT9 A;  1H2U A;  3LDZ A;  1OWM A;  2WQ6 A;  4F3V A;  2JLB A;  3ESL A;  2X6I A;  3L22 A;  5KCM A;  4FJY A;  3QJZ A;  2AXU A;  1N54 A;  2UWJ G;  3B7S A;  4GA1 A;  4UQZ A;  4AV7 A;  2IFU A;  4J8F A;  4CDN A;  4B89 A;  2YIN A;  3APC A;  5BW8 C;  2HYZ A;  3S7D A;  1OWO A;  2WXN A;  4UI9 J;  3U64 A;  4AJW A;  2PQR A;  1MHQ A;  4M3O A;  1IQU A;  3NZS A;  3GZ1 A;  2VTB A;  2Y4T A;  1DNP A;  1HXI A;  4OVU A;  3RKV A;  2ILR A;  3D9L A;  2PM7 A;  4ANU A;  5JHA A;  1TEZ A;  2FBN A;  2G03 A;  1OWP A;  3Q49 B;  1JWG A;  4GCN A;  2J49 A;  3ZXS A;  3LEW A;  2X3M A;  2WXG A;  4FUL A;  4GZ5 A;  3SZ7 A;  2GW1 A;  5C1D A;  2R5S A;  3OXF A;  3RRU A;  4D10 C;  4ME2 A;  2I9C A;  2V0P A;  2XGS A;  2AVP A;  4EZJ A;  1NA3 A;  1E90 A;  3VLF A;  3I3N A;  5LCW J;  4ILH B;  1HS6 A;  1PC2 A;  1HH8 A;  1HE8 A;  3QNK A;  5ANR A;  3JQ0 A;  4IN3 B;  1OUV A;  4GU5 A;  4KMO A;  4B0Z A;  4G1T A;  2L0I A;  1SQM A;  3O48 A;  1OWL A;  4J8E A;  4JVS A;  3FUM A;  2IOS A;  2RD0 A;  4JEU A;  3DBS A;  4JL0 A;  4GPK A;  4K0R A;  2WM9 A;  3PRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...