4U04A

Structure of a eukaryotic fic domain containing protein
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
327
structure length
315
Chain Sequence
RAALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Adenosine monophosphate-protein transferase FICD
total genus 120
structure length 315
sequence length 327
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u04A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u04A01
5AYWD 3QDNA 4CDRA 4JA9A 5ARFA 3LY9A 3KD7A 5CKLA 5JFZA 2YHCA 2F6SA 2LSUA 4ABNA 2KCKA 2Y4TA 1HZ4A 2UWJG 2XEVA 2DBAA 3JYSA 4I1AA 4GCNA 3ZHEA 5EX0A 1NA0A 4Y6CA 4JA7A 3PDNA 4G1TA 2PL2A 5ARGA 1KT0A 4U0ZA 2WQHA 3KAEA 4UI9C 3IEGA 2XGMA 5CGLA 3CK7A 4GYWA 4LU4A 4I9CA 2C0MA 3AS8A 3ZC7A 4WGJA 4HOSA 3UQ3A 3OXLA 4N3CA 2FEZA 2IFUA 5FTPA 3GYZA 4I17A 5M72A 3LYAA 4O6FA 3S7BA 3GZ1A 4Y6WA 2NC9A 3S7DA 4G26A 4GA1A 5D0OD 3BEEA 3TG5A 4HORA 2XCBA 3RO3A 4H7XA 2XGSA 4WNDA 2JK8A 3FWVA 3CKBA 4YNDA 1WAO1 5KJLA 2YQ8A 3CK8A 2FI7A 4WUYA 5FT9A 4GZ5A 4KXKB 3ASFA 4X2EA 4GZ6A 1XNFA 1W3BA 4NQ0A 4PY3A 3ASDA 3GW4A 2ONDA 3UUXA 3HYMB 4W9RA 2C2LA 5G04J 4G24A 4WNGA 3CVPA 2VGYA 4CGWA 3E4BA 3CKCA 1ELRA 3Q47B 3SF4A 2LSVA 5CCLA 3S7FA 2KCLA 4UQYA 4AIFA 2C0LA 2UY1A 4J8FA 5DBKA 4ITRA 5CCMA 1HXIA 4I2ZA 5A7DB 2KC7A 2Y4UA 1IYGA 4F3VA 4IN3B 1YA0A 2PQRA 3CV0A 3RIBA 1A17A 2XPIA 3CVQA 2GW1A 2J9QA 4B94A 4RG9A 3PE3A 2KCVA 4J8DA 2WPVA 4BWRA 2G03A 3TGOA 5EKQD 5A6CA 4N5CA 5JFFA 3CK9A 2HO1A 1E96B 2PQNA 3N3UA 3Q15A 4BTAA 2IF4A 3ASHA 1FCHA 4KBQA 1KLXA 5LCWJ 3CEQA 3RJVA 5BNWA 3AS4A 4LEUA 4I2WA 3Q49B 3ULQA 2P58C 4H7YA 3MEKA 2VZAA 2VQ2A 4X2CA 4AY5A 4UQZA 5G04C 4BT9A 3QKYA 3CVNA 3MKRA 3CVLA 2KATA 3OXGA 5D0QD 1NA3A 3LY7A 4U04A 4JHRA 3FP3A 3QOUA 3TAXA 2MHKA 2Q7FA 3VTYA 2VY3A 4WNEA 4G23A 4J8EA 4J0UA 3ZN3A 2VYIA 4M16A 2E2EA 4A1SA 1WM5A 1NZNA 3K9IA 4AM9A 2VSYA 4N67A 1ZBPA 2XGOA 3ZGQA 5C1DA 4YVOA 4NPSA 4G2VA 5CHEE 5G05C 3QWVA 4KYOB 4UI9K 3LPZA 1TJCA 2VSNA 3RKVA 1Y8MA 3KS2A 2LNIA 5HI7A 3ZPJA 5KJNA 3RU0A 3FFLA 5FZSA 5KJKA 2HYZA 4I9EA 5JJ6A 3ESKA 3OXFA 3AS5A 2HR2A 4GPKA 4WNFA 3CUCA 2FBNA 5HQ8A 4GZ3A 3S6AA 4GA2A 1ZU2A 3ASGA 5BW8C 3QWWA 5FJYA 5LCWC 5JJ7A 2FO7A 3LETA 4GYYA 2XCCA 2R5SA 1ELWA 4NRHB 4BTBA 2JLBA 4YVQC 2VGXA 3RO2A 5G05J 3ZLMA 4N3AA 1B89A 4N39A 1PC2A 1QZ2A 4N2QA 3NF1A 3S7JA 5JJTA 3MV2B 3LCAA 3U3WA 3R9AB 4N2SA 3O48A 4G25A 3ZCBA 4AY6A 5EX3A 4APOA 5DIZA 5BT1A 1P5QA 1IHGA 5KJMA 2QFCA 1OUVA 3ZHEB 2FF4A 2AVPA 3N71A 3VTXA 3MA5A 3MV3B 2VGXB 2OOEA 3SZ7A 4XI0A 3WXXA 1QQEA 4CGVA 3TG4A 5EU0A 4EQFA 4HOTA 4ME2A 1HH8A 4BT8A 4X2DA 3SE5A 5FZQA 3Q5MA 4U07A 4GYOA 2PZIA 4RG6A 4HOUA 2V5FA 4U0SA 4UI9J 4GCOA 3SN9A 4XI8A 4JL0A 3UPVA 1KT1A 2BUGA 5FZRA 3LKUA 2L6JA 4HOQA 3Q4AB 4UQXA 2UY1B 3QWPA 3LY8A 4GA0A 3U4TA 4XI9A 3EDTB 5CMTA 3SHGA 3GZ2A 4XIFA 3URZA 2I6HA 3PE4A 4U0UA 3ZFWA 4N3BA
chains in the Genus database with same CATH superfamily
4G8KA 1TN7A 3FDHA 3ML9A 3LVQE 3LJNA 1TNZA 3QDNA 4CDRA 4JA9A 3KD7A 4B8CB 3Q7FA 2X6HA 1UJKA 2UWJG 4PS8A 2GRQB 4I1MA 2DBAA 3DSWA 3FUIA 3NB2A 3FH5A 1V55E 3PDNA 2WXNA 1TN6A 5ARGA 2GGFA 1V54E 2CG3A 3APCA 3KSQA 2JABA 3FU3A 3IEGA 2XGMA 2I2OA 4GYWA 3UT7A 4I9CA 3ABLE 5BV1A 3V2XA 4WGJA 3KEZA 4EHMA 2AJAA 3UM2A 4HOSA 1G3NB 3UKRG 4B93B 3AG4E 5FTPA 3FH8A 3KSLA 3TWVA 3EJNA 4O6FA 4LSZE 2PM6A 4FA6A 5J08A 2H6GA 4XKBA 4GA1A 3Q78A 3TG5A 3CSTA 3FTSA 3UT8A 2JK8A 3CKBA 2WB2A 4HFGA 5KJLA 3HXDA 3D9JA 4A1GA 4KMOA 2J8SD 3EIQC 3PZ4A 3IHYA 2L0IA 2IJGX 4GZ5A 4KXKB 4TXRA 5FT9A 3ASFA 1XNFA 4U7EB 1LD7A 3KEAA 2DYRE 2R03A 1Z6TA 3ZYLA 4GTVA 4CGWA 1DCEA 4MRUA 3QJZA 4I6GA 4XEIG 3B7UX 3S7FA 4UQYA 2UY1A 4B8AA 3BUAA 4V3IA 4IN3B 4R7LA 5CRVA 1YA0A 2PQRA 5FIOA 1YCSB 4MBGA 4CT4A 2GW1A 2KCVA 4DX1A 4M3OA 3SFYA 2WPVA 3LEWA 3TJPA 4YDEA 5ENRD 5A6CA 5B1AE 1KZOA 5JFFA 5ENQD 3FUDA 3Q15A 1FCHA 3JQ0A 2XS8A 4PS7A 4B0ZA 1DNPA 1OWLA 2VSXE 4I2WA 4RQIA 3JCKC 4AEZC 3UINC 4EZKA 2VQ2A 5AAOA 1HU3A 1A5EA 5G04C 3LXUX 3CVNA 3WG7E 3OXGA 2KATA 4HXIA 5D0QD 1NA3A 5CRUA 4BESA 4U04A 3NZSA 3TWXA 3FY4A 3QOUA 2DZOA 3TAXA 5KWDA 2RD0A 4EECA 4A3VA 3L6AA 4DLOA 2LAHA 3CHQA 2VY3A 5CERB 3HXFA 4WNEA 4KZCA 2VTBB 3B7TA 3IXEA 4WWOA 1O5MA 4A1SA 1S0PA 1NZNA 4TRQA 1UN8A 1H19A 4GMRA 2VJ8A 2XHEA 4HB5A 4URKA 2CFZA 2LXLA 4GPMA 1E8YA 5FQ6A 2J4BA 4TXPA 3VLFA 3ULEG 4BSZB 3T5VA 4EZLA 1TJCA 2VSNA 2ZGGA 3RKVA 1MX4A 3ONKA 2YNQA 1VDYA 1D8DA 1TR4A 5HI7A 1TYQG 5E75A 2B0OE 1BU9A 5ENSD 2ILRA 3V30A 3ESKA 3FUMA 3HVEB 3CVXA 3AS5A 3HIZA 4CDNA 2V8SE 4GPKA 1N9AA 4GZ3A 3S6AA 4TUUA 3C5RA 2WMNA 2H6FA 3UM0A 3U9WA 4BERA 2EILE 3DXMG 5HKPA 3ASNE 3LETA 4GYYA 3RRMB 2XCCA 3UX4A 4KZ0A 4NRHB 3PNTB 4BY6A 4BTBA 4UUCA 1OT8A 4ILHB 2AW6A 3ZYMA 4HRMB 3Q75A 3D9NA 4PDXA 3QNKA 3CSFA 3PH0C 3S7JA 2NYJA 3D9PA 1OCCE 5C2YA 5AENA 3L22A 5T8IA 5AIJA 3DWLG 5JHBA 2IOSA 2WXJA 1WG0A 3C98A 2L9BA 3CIAA 2NSZA 2P9LG 2WXPA 1IHGA 2Y0BG 4CZ2D 2OCCE 2WXLA 3EHQA 1U3DA 3T8KA 2ZXWE 2AVPA 4DX2A 3VTXA 3MA5A 1DCQA 3MV3B 3E30A 4CGVA 3TG4A 3FH7A 5AQ7A 3ZNGA 4ME2A 5LP0A 1GW6A 3S2AA 3SFXA 1HH8A 4F6RD 3PS6A 5B1BE 4DI3A 2PZIA 3ABKE 4ZHBA 3NZUA 3ASOE 3AAAC 2KZTB 2BUGA 3L82A 3APDA 4HOQA 2L6JA 2UY1B 3QWPA 2VSOE 3SO8A 4GA0A 3NOGD 2Y3AA 4IYPA 4KVOA 4XI9A 3SNXA 2KM4A 4DLQA 4CEMA 2I6HA 3PE4A 4JEUA 3ZFWA 3ZU7B 3UMVA 2WXHA 5IY5E 2ETCA 5ARFA 1IHBA 3LY9A 2YHCA 2BEDA 4EBAA 3RK6A 4ABNA 3B13A 5D2MC 1IQRA 2Y4TA 2ZU6B 4ANVA 4O60A 1S70B 4G11A 2XEVA 2B6CA 3DSSA 1HS6A 3ZHEA 4Y6CA 1H6PA 1SVXA 5H7PA 3QB2A 5BUZA 2PL2A 2R05A 4GTMA 4O1OA 3PZ3A 3KAEA 4A55A 2HE0A 4LU4A 4DI4A 3PZ2A 4HI9A 3Q7AA 3BG0B 3ZXPA 3ZKJA 3OXLA 2OEVA 3UM1A 2FEZA 3EUVA 3V79K 4QQIA 1JUQA 2KZTA 1SZAA 3J5QB 1QYMA 4Y6WA 3S7BA 3V2OA 2NC9A 3O4ZA 4HORA 3C72A 4Q96A 4AV7A 1X5BA 4LCTA 4H7XA 3D9IA 1S64A 3FWVA 4YNDA 3UIPC 1FVFA 2YQ8A 2E0IA 5JMND 4F7AA 2P9KG 5EN5D 2XZDG 3V31A 3GZSA 2XRZA 3FTUA 1W3BA 4NQ0A 3CVYA 3FUEA 3ABME 2EIJE 4B89A 2XENA 4ACKA 1FPPA 5EIBE 5KBAA 4W9RA 2XPZA 1KZPA 3CVPA 4FHJA 2VGYA 1SZ9A 2R02A 3G2UA 4LNGA 4FLBA 3ZRHA 4CT0A 4HLEA 1L5JA 2CHXA 2ETAA 2KCLA 3HVEA 1N52A 1UN9A 3CQCB 5CCMA 2XRYA 4HI8A 3UI2A 4J6IA 1IYGA 3TWSA 2L0TB 2GRPB 2CHWA 3RIBA 1A17A 2KBXA 4WAFA 3Q9UC 4ACLA 3TGOA 3D9OA 4LUNU 4KBQA 5LCWJ 4L9PA 3RJVA 3T8MA 3SGHA 5BNWA 1H2UA 1TEZA 4RLYA 2EIKE 3MEKA 1O1RA 4APFA 4FP7A 4AY5A 3PUKA 4UQZA 3RRNB 4BT9A 1YMPA 3LVRE 3QKYA 4YDYA 4GMJA 1N0RA 4I43A 3ML8A 3AG3E 2H6HA 4D10C 4P29A 2Q7FA 3VTYA 3ZN3A 2VYIA 2R59A 1NP7A 4M16A 5T3RA 1WM5A 3FTXA 3TWTA 1ZBPA 2XGOA 3ZGQA 3FUNA 1HE8A 1FVHA 1DVPA 4NPSA 1K8KG 4G2VA 5G2NA 5CHEE 4E6HA 3QWVA 4CRWA 4C48B 2P9NG 4TV3A 3LPZA 3FEXA 2BKKB 4LNUD 1Y8MA 2X38A 4L23A 4HVBA 2LNIA 3FEYA 1MJ0A 1OY3D 1Z3YA 3RU0A 5FZSA 3PEVB 3BU8A 3FTZA 5EIDA 2BF0X 5JJ6A 3AG2E 1HF8A 1TN8A 1HFAA 4J8YA 2HR2A 2PM7A 4WNFA 2FBNA 2KXPC 3VLEA 1MX2A 3FHEA 3FU5A 1OCOE 2XS1A 1H0AA 2J4DA 2FO7A 1FT1A 3AG1E 3T5XA 4YDOA 4OVVA 3G2WA 3L9TA 1MQSA 2A5UA 2JLBA 2J49A 5G05J 2CG2A 4AJWA 2GRRB 2WXFA 4G8LA 1INZA 1OWNA 4C0MA 2OVBA 3L08A 4PH4B 2MRIA 4ATGA 4HQDA 4JW1A 1RW2A 5BPPA 4LERA 3D9HA 3ZCBA 2F37A 4AY6A 3P2BA 1P5QA 1NH1A 3MYVA 2EINE 3X2QE 3CR3A 3DEPA 3FUFA 1Q2ZA 4HNAD 3ZEFA 3SZ7A 2VGXB 2OOEA 3WXXA 2PNNA 5ANLA 1QQEA 5EU0A 2BKGA 2IONA 4U07A 1E8ZA 3APFA 3HXEA 1X81A 4HOUA 2F8YA 4U0SA 3BG1B 3IKOB 4UI9J 2V5QC 2WMOA 4JL0A 4OVUA 3SBTB 1MYOA 3PZDA 4XZ4A 5FZRA 2A4ZA 4HBDA 4JPSA 3U4TA 4N5QA 5CMTA 4JB8P 3SHGA 1WY6A 1LD8A 2WQ6A 3GZ2A 4XIFA 3URZA 1D8EA 2IQCA 3E34A 3HHMA 5D66A 5T4YA 3NQPA 3L16A 5AYWD 4K5BA 5CKLA 3CHPA 2GRMA 3G2VA 4AXHA 1RZ4A 2WXRA 3R9MA 5EDSA 1BD8A 2IOLA 3U66A 2Y1LE 3CVWA 5LX8A 4GCNA 4UWLA 3ZYQA 3G2SA 5EX0A 1NFIE 4GTTA 3FUHA 4K5CA 3MKQA 2QYJA 2DIWA 3W9FA 4ILGA 1HG2A 5CGLA 3P1UA 2ZISA 4J8SA 3B7SA 4JEHA 1N94A 4L1BA 5AARA 4ANXA 4I6JA 3AS8A 3R7QA 5EYPF 3UQ3A 4N3CA 2P9IG 3FU0A 2IFUA 5E76A 3CVUA 4I17A 5M72A 5BV0A 3GZ1A 4K0RA 4FHKA 4FJYA 1Z3XA 4G26A 1TNYA 3BEEA 3RO3A 4UWGA 4A3TA 5ENNA 2XGSA 1D9SA 4DJAA 3I4GA 1KPSB 1WAO1 3CK8A 1N4PA 4WUYA 1TNBA 4GTRA 4TUMA 1XGWA 3RRUA 2GROB 2IU1A 4X2EA 4GZ6A 1JWFA 3TWQA 1E90A 2HM8A 2WXIA 2I9CA 3GW4A 4BETA 5J90A 4C9BB 3UUXA 2WVIA 2C2LA 4G24A 4GTQA 4AP2A 1YYHA 3E4BA 4U63A 2V4HC 3CKCA 1N4SA 3T9KA 1ELRA 2F8XK 1PY1A 5FINA 1HG5A 3I5PA 3SF4A 4DK5A 3EU9A 2LSVA 4FU3A 1UJJA 2Y69E 1EF1C 1K1BA 2RFMA 4AIFA 1SQMA 4I2ZA 2KC7A 2Y4UA 4F3VA 3CV0A 4MKTA 4GMLA 1ZB1A 2XPIA 2EQXA 4DX6D 2J9QA 3FULA 3G2TA 3PE3A 3MCXA 4J8DA 2DYSE 3NAWA 4BWRA 2G03A 5EKQD 4N5CA 2QYUA 3CK9A 2HO1A 1TJFA 1E96B 2IF4A 1KLXA 2GRLA 1UW4B 2VGEA 3UIOC 5CEAA 3ZYKA 2J08A 4E85A 4UWFA 4XX5A 4LEUA 2R17C 1BLXB 3Q49B 3ULQA 4OYSA 4H7YA 4L7TA 2VZAA 5FQ4A 1OWPA 4HS2A 3Q79A 3MKRA 3CVLA 4Q69A 5HS0A 3LY7A 1NL4A 3PEUB 2OVFA 4JHRA 3FP3A 2MHKA 1SA5A 1FT2A 3UTMA 4GTOA 1K3ZD 3K9IA 3UXGA 5ENOD 1UOHA 1JCSA 2VSYA 3ESLA 3MJWA 5C1DA 3MGBA 2NUDA 4YVOA 3TWRA 5G05C 3D3MA 2X6JA 2I1JA 4HLLA 2IO3C 1HO8A 5JA4D 4CDMA 3E37A 2RKKA 4FULA 1QNFA 5KJNA 2J09A 2NUNA 5BXUA 4I9EA 3I3NA 3AU4A 2XQ0A 3OXFA 4IULA 4NURA 1TNUA 4F53A 4L2LA 1JCRA 4IRUA 5HQ8A 2P2CP 1ZU2A 1OCZE 4BX9A 2NXPA 3IHVA 3ASGA 3QWWA 4F1SA 5LCWC 4NACA 2VTBA 3PUJA 2QC9A 4ZFHA 3TWUA 4XE0A 4DRXE 3C3QA 2R5SA 4RSYA 4DUIA 3PZ1A 3CGHA 4YVQC 3RO2A 4EPZA 5FWQA 1N11A 4FADA 4MLPA 4N3AA 1B89A 3B7RL 3CHSA 2F0YA 4OAUC 1Z5SC 2J07A 4DPRA 1PC2A 3QK0A 1EPUA 3NF1A 2WM9A 3LCAA 2XEEA 3JQ1A 3SI5A 4ANWA 5ENPD 5EILA 4N2SA 1E7UA 3RAUA 1EYHA 5EX3A 4APOA 3CHOA 5BT1A 1QBQA 3MKQB 5KJMA 4ANUA 2QZAA 2QFCA 3QAQA 1OUVA 5ITZF 2FO1E 3PVLA 2MOWA 3CQGB 2ZIRA 3ZHEB 2FF4A 4FLHA 3EHRA 2WXGA 4XI0A 4OAVB 2EIME 5AN8A 3TWWA 2X6FA 4L2YA 2A5EA 3SD5A 1IXVA 3DPDA 2I1KA 1IQUA 4X2DA 3SE5A 1OWMA 3ULYA 4GYOA 4RG6A 4U8YD 2V5FA 5ENTD 3CLJA 3BQOA 3QARA 4GCOA 4XI8A 1KT1A 1N4QA 2V4LA 3Q73A 3ZVVA 3LKUA 3Q4AB 4UQXA 1K1AA 3EHMA 1OCRE 1O1SA 1N0QA 5CBOA 4HRLA 2OV8A 4BX8A 4JVSA 1MHQA 4U0UA 5CECB 4U0ZA 3HG0D 4J7WA 3RSEG 2IY0C 4A63B 1SW6A 4U8VD 4C0EA 3IV0A 3HRAA 4FC8A 5JFZA 2F6SA 2LSUA 3DSVA 1NI1A 2KCKA 1LF8A 4JXTA 3SFZA 4AVXA 1HZ4A 1S63A 3SHFA 4NIKA 1O1TA 3JYSA 4I1AA 3ONLA 1NA0A 4JA7A 3UT4A 4G1TA 1KT0A 4JD2G 2WQHA 1HX8A 4GTPA 3UM3A 4UI9C 5FQ8A 3CK7A 2AXUA 3JUEA 2C0MA 2AXVA 3ZC7A 3DSXA 2YHEA 4LNBA 5AJDA 2FULA 4PS3A 3DSUA 2M63A 1Y6IA 3GYZA 4FJZA 1LTXA 3LYAA 2WXKA 3S7DA 3TXNA 3ISMC 3JXJA 3D9KA 3L54A 4TXQA 2JEKA 4GAAA 5D0OD 5HRYA 3CVVA 2X6KA 2XCBA 2IEJA 5AQBA 1N4RA 3EIJA 3SY2A 4WNDA 2X3MA 3SQVA 1H6OA 5B3SE 3E33A 4KT6B 2FI7A 1OWOA 1N54A 1AWCB 3DEOA 3UKUG 1IKND 2OEWA 4AOFA 4U95D 4WWPA 2XEHA 3DBSA 4PY3A 3ASDA 1BPOA 3J5PA 4JHKA 1AP7A 2ONDA 3HYMB 2WXMA 4LRZA 5G04J 3JUIA 3TL5A 4WNGA 4K5AB 3PREA 5ANRA 5AJLA 1U3CA 2LO6A 4JC8A 3D9LA 3Q47B 5CCLA 5AQAA 3EU5A 2C0LA 1U2VG 2P9PG 4J8FA 4ATZD 5DBKA 4ITRA 3NOCD 1HXIA 5A7DB 4GB9A 1H2VC 4ILIA 2MYOA 3DPYA 2H6IA 4BEPA 3CVQA 4B94A 2RFAA 3QC1A 2R2LA 3HXCA 4RG9A 3D9MA 3LS8A 1H6KA 2QY7A 3HDXA 2DCPA 2XPYA 2PQNA 3N3UA 1JCQA 3OAWA 4BTAA 3TXMA 3ASHA 2X6IA 4U8HA 3CEQA 1DC2A 4WWNA 3AS4A 2P58C 4EZJA 5CMYA 5EYLA 1MZCA 4X8QA 4X2CA 4UWHA 5FQ7A 4QFVA 3LDZA 5KNGA 5CEDB 1WDYA 2CHZA 4GU5A 4BSXA 2ZGDA 3L13A 4CCAA 2WXOA 4G23A 4J8EA 4J0UA 2E2EA 1TNOA 4M7CA 2AXZA 4PUCA 1E8XA 4AM9A 4N67A 2LAIA 5LFAA 3OTNA 1OXJA 2BTDA 4KYOB 4UI9K 2WXQA 3C3RA 1UG3A 3B7BA 2CFUA 1EDUA 4UWKA 1E8WA 3FTWA 2LXMA 3KS2A 3VLDA 2XZTG 3ZPJA 3FFLA 3FU6A 3CHRA 5A23A 3MX3A 5KJKA 2HYZA 1E7VA 3I4RB 4MS6A 3HXBA 4GTSA 4GZDA 1MX6A 4XKCA 3ZW3A 3AU5A 3LJ3A 3ZIMA 3CUCA 3W9GA 4GA2A 1PAQA 3DRAA 4RVBA 2LUHA 5BW8C 5LOZA 3JXIA 3FUKA 5FJYA 1N95A 5JJ7A 5BXOA 4I6EA 4CYMD 1JPLA 1ELWA 3PRZA 2V0PA 3FUJA 2VGXA 3R7RA 2DWZA 4O1PA 3ZLMA 3FTVA 4F1PA 2RG8A 4I1OB 3EHNA 4N39A 2WQ7A 5KCMA 1QZ2A 4JHJA 4N2QA 2DVWA 1JWGA 5JJTA 3MV2B 3U3WA 4Q94A 3R9AB 3DXKG 2GRNB 3ENEA 3O48A 3PNLB 4G25A 1ELKA 5G55A 5DIZA 4BFRA 3SBSA 2P9UG 1SA4A 3U64A 1BI8B 3N71A 3DSTA 3ZUVB 5JHAA 2P9SG 4EQFA 4HOTA 5CMWA 3Q9NC 4KVMA 2ETBA 3L17A 4GZCA 4DX7D 4BT8A 3C3OA 5FZQA 3Q5MA 3MZLB 4HRNA 3CHMA 4EBAG 4DX5D 3F6QA 3B95A 4LG6A 4Z68A 3IBEA 3SN9A 3UPVA 2DZNA 5AQ9A 3NBNB 3LY8A 4U96D 2IO2C 1BI7B 2AWIA 5CBNA 4K03A 2YINA 3ZXSA 3AJIA 3EDTB 3FTYA 2L6BA 5KNHD 4JZYA 4YDWA 1H2TC 4N3BA 3E32A
chains in the Genus database with same CATH topology
3UMVA 3NQPA 3FDHA 3L16A 3ML9A 3LVQE 2WXHA 5AYWD 3QDNA 4CDRA 4C0EA 4JA9A 3IV0A 5ARFA 4HORA 3LY9A 3KD7A 5CKLA 4FC8A 5JFZA 2GRMA 2YHCA 3CHPA 2X6HA 2F6SA 2LSUA 3G2VA 4B8CB 4EBAA 3RK6A 4ABNA 3B13A 4AXHA 2KCKA 1LF8A 4JXTA 3SFZA 1IQRA 4AVXA 1UJKA 2Y4TA 1HZ4A 2ZU6B 2WXRA 2UWJG 4ANVA 4PS8A 3SHFA 4I1MA 5EDSA 4G11A 2XEVA 2DBAA 3JYSA 2IOLA 4I1AA 3U66A 3FUIA 3CVWA 3ONLA 5LX8A 4GCNA 1HS6A 3ZHEA 4UWLA 3ZYQA 3G2SA 5EX0A 1NA0A 4Y6CA 3FH5A 4JA7A 3UT4A 3PDNA 4G1TA 2WXNA 3QB2A 5BUZA 2PL2A 3FUHA 5ARGA 2GGFA 1KT0A 2CG3A 3MKQA 2DIWA 3APCA 2WQHA 4ILGA 3FU3A 1HX8A 3KAEA 4A55A 4UI9C 1HG2A 3IEGA 2XGMA 2I2OA 5CGLA 3P1UA 5FQ8A 3CK7A 2AXUA 4GYWA 3UT7A 4LU4A 4I9CA 3B7SA 4J8SA 4JEHA 4DI4A 4L1BA 5BV1A 2C0MA 2AXVA 4I6JA 4ANXA 3AS8A 3ZC7A 4WGJA 3KEZA 2YHEA 3R7QA 3BG0B 4HOSA 5AJDA 2FULA 3UQ3A 4PS3A 3OXLA 4N3CA 3FU0A 2M63A 2FEZA 1Y6IA 2IFUA 5E76A 5FTPA 3FH8A 3CVUA 1JUQA 3GYZA 2KZTA 4I17A 3EJNA 4FJZA 5M72A 3LYAA 4O6FA 5BV0A 1SZAA 3S7BA 3GZ1A 4K0RA 4Y6WA 2WXKA 2PM6A 4FHKA 4FA6A 4FJYA 5J08A 2NC9A 3S7DA 1Z3XA 3TXNA 4XKBA 3D9KA 3L54A 3O4ZA 2JEKA 4G26A 4GA1A 3BEEA 4GAAA 5D0OD 2X6KA 2XCBA 3CSTA 3RO3A 4Q96A 3TG5A 3CVVA 3FTSA 4AV7A 1X5BA 4LCTA 4UWGA 3UT8A 3EIJA 4A3TA 4H7XA 5ENNA 2XGSA 4WNDA 2X3MA 3D9IA 2JK8A 3FWVA 4DJAA 3I4GA 3CKBA 2WB2A 4YNDA 4HFGA 1FVFA 1WAO1 5KJLA 2YQ8A 2E0IA 3CK8A 4KT6B 2FI7A 3D9JA 4F7AA 4A1GA 4KMOA 1OWOA 1N54A 3EIQC 4WUYA 3IHYA 2L0IA 1XGWA 3GZSA 2IJGX 4GZ5A 4KXKB 2IU1A 5FT9A 3ASFA 3RRUA 4AOFA 2XRZA 4X2EA 3FTUA 4WWPA 4GZ6A 1XNFA 1W3BA 3DBSA 4NQ0A 1JWFA 4PY3A 1E90A 3ASDA 3CVYA 3FUEA 1BPOA 2HM8A 4B89A 2WXIA 4ACKA 2I9CA 3GW4A 4JHKA 5J90A 4C9BB 2ONDA 3UUXA 3HYMB 4W9RA 2WVIA 2C2LA 2WXMA 4LRZA 1Z6TA 5G04J 3ZYLA 2XPZA 4G24A 3JUIA 3TL5A 4WNGA 3CVPA 4FHJA 2VGYA 1SZ9A 4CGWA 4AP2A 3PREA 5ANRA 3E4BA 4U63A 4MRUA 5AJLA 3G2UA 3QJZA 3CKCA 1U3CA 1ELRA 4FLBA 2LO6A 4JC8A 4I6GA 3B7UX 1PY1A 1HG5A 3I5PA 3D9LA 3ZRHA 4CT0A 3Q47B 3SF4A 4HLEA 1L5JA 2CHXA 4DK5A 2LSVA 5CCLA 4FU3A 3S7FA 1UJJA 2KCLA 3HVEA 4UQYA 1EF1C 1N52A 4AIFA 2C0LA 2UY1A 1SQMA 4J8FA 1UN9A 3CQCB 5DBKA 4ITRA 4B8AA 5CCMA 2XRYA 1HXIA 4I2ZA 5A7DB 4V3IA 2KC7A 2Y4UA 4J6IA 1IYGA 4F3VA 4IN3B 4GB9A 1H2VC 4R7LA 2L0TB 4ILIA 1YA0A 2PQRA 2CHWA 4N3BA 3CV0A 3RIBA 4MKTA 4GMLA 1A17A 4WAFA 2XPIA 4CT4A 2EQXA 3CVQA 2GW1A 2J9QA 4B94A 3QC1A 3FULA 4RG9A 3D9MA 3G2TA 3PE3A 2KCVA 3MCXA 4J8DA 3LS8A 4M3OA 2WPVA 4ACLA 3LEWA 2G03A 3TJPA 4BWRA 3TGOA 1H6KA 2QY7A 3D9OA 5EKQD 5A6CA 3HDXA 4N5CA 5JFFA 3CK9A 2HO1A 2DCPA 4LUNU 1TJFA 2XPYA 1E96B 2PQNA 3N3UA 3OAWA 3FUDA 3Q15A 4BTAA 2IF4A 3TXMA 3ASHA 1FCHA 2X6IA 4KBQA 1KLXA 2GRLA 4U8HA 3JQ0A 3CEQA 1UW4B 5LCWJ 3RJVA 4PS7A 4B0ZA 3ZYKA 3T8MA 1DNPA 2J08A 3SGHA 5BNWA 4E85A 4WWNA 1H2UA 1OWLA 2VSXE 4UWFA 4XX5A 3AS4A 4LEUA 2R17C 1TEZA 4I2WA 3Q49B 3JCKC 3ULQA 2P58C 4AEZC 4OYSA 4EZJA 4EZKA 4H7YA 5CMYA 3MEKA 4L7TA 2VZAA 4APFA 2VQ2A 4X2CA 5FQ4A 4FP7A 1HU3A 4AY5A 1OWPA 3PUKA 4UWHA 4HS2A 4UQZA 3RRNB 5G04C 4BT9A 5FQ7A 3LVRE 3QKYA 3LXUX 3CVNA 4QFVA 3MKRA 3CVLA 2KATA 3OXGA 4HXIA 1NA3A 5D0QD 4Q69A 3LDZA 4GMJA 3LY7A 3PEUB 4U04A 3NZSA 4I43A 3FY4A 2OVFA 4JHRA 3FP3A 3QOUA 3ML8A 2CHZA 3TAXA 2RD0A 4EECA 4D10C 4GU5A 4P29A 4A3VA 2MHKA 2Q7FA 3L6AA 4DLOA 4BSXA 3L13A 4CCAA 2LAHA 3CHQA 3VTYA 2VY3A 2WXOA 4WNEA 4G23A 4J8EA 4J0UA 3ZN3A 2VYIA 4KZCA 2R59A 2VTBB 1NP7A 3B7TA 4M16A 2E2EA 4WWOA 4A1SA 1S0PA 1WM5A 5T3RA 2AXZA 1NZNA 4PUCA 3K9IA 3FTXA 4TRQA 1E8XA 1H19A 1UN8A 4AM9A 2VSYA 2VJ8A 3ESLA 3MJWA 4N67A 1ZBPA 2LAIA 2XGOA 3ZGQA 2XHEA 5C1DA 3FUNA 4URKA 1HE8A 1FVHA 1DVPA 5LFAA 3OTNA 3MGBA 2CFZA 4YVOA 4NPSA 2BTDA 4G2VA 5G2NA 5CHEE 4E6HA 5G05C 3D3MA 3QWVA 4KYOB 1E8YA 2X6JA 2WXQA 2J4BA 4UI9K 1UG3A 5FQ6A 4CRWA 3VLFA 3T5VA 2CFUA 1EDUA 4UWKA 1E8WA 4TV3A 2I1JA 3LPZA 4EZLA 3FEXA 1TJCA 2VSNA 3RKVA 3FTWA 3ONKA 2YNQA 1HO8A 1Y8MA 1VDYA 3KS2A 2X38A 4L23A 4CDMA 3VLDA 4HVBA 2LNIA 3FEYA 5HI7A 1Z3YA 4FULA 3ZPJA 1QNFA 5KJNA 3RU0A 3FFLA 3FU6A 5E75A 2J09A 3CHRA 5A23A 5FZSA 3PEVB 3FTZA 3MX3A 2BF0X 5KJKA 2HYZA 4I9EA 3I3NA 5JJ6A 1E7VA 3AU4A 1HF8A 3I4RB 2ILRA 2XQ0A 4MS6A 1HFAA 3ESKA 3OXFA 4GZDA 4IULA 4NURA 4F53A 3FUMA 3HVEB 3CVXA 3AS5A 4XKCA 3ZW3A 2HR2A 2PM7A 3AU5A 3HIZA 4CDNA 2V8SE 4L2LA 4IRUA 3LJ3A 3ZIMA 4WNFA 4GPKA 3CUCA 2FBNA 5HQ8A 3VLEA 4GZ3A 3S6AA 4TUUA 4GA2A 1ZU2A 2WMNA 4BX9A 1PAQA 2NXPA 4RVBA 3IHVA 5LOZA 3ASGA 5BW8C 3QWWA 3FHEA 3FUKA 3FU5A 5FJYA 3U9WA 4F1SA 5LCWC 4NACA 2VTBA 1H0AA 5JJ7A 2J4DA 2FO7A 3PUJA 3LETA 4GYYA 4I6EA 3T5XA 3RRMB 2XCCA 4OVVA 3G2WA 4XE0A 1MQSA 1JPLA 3UX4A 2R5SA 1ELWA 3PRZA 4KZ0A 2V0PA 4NRHB 4RSYA 3PNTB 3CGHA 2A5UA 2JLBA 4YVQC 3FUJA 2VGXA 4BTBA 3RO2A 4BY6A 4EPZA 5FWQA 3R7RA 2J49A 4ILHB 2AW6A 3ZYMA 5G05J 3ZLMA 2CG2A 4AJWA 4FADA 4MLPA 4N3AA 3FTVA 1B89A 3B7RL 3CHSA 2RG8A 4I1OB 2WXFA 2J07A 3D9NA 4DPRA 3ZFWA 4PDXA 3QNKA 3EHNA 4N39A 1INZA 1PC2A 5KCMA 2WQ7A 1OWNA 4C0MA 3QK0A 3CSFA 1EPUA 1QZ2A 4JHJA 4N2QA 2OVBA 3L08A 3NF1A 3PH0C 1JWGA 4PH4B 3S7JA 2MRIA 4ATGA 2WM9A 5JJTA 3MV2B 3LCAA 3D9PA 5C2YA 5AENA 3JQ1A 4JW1A 4Q94A 3SI5A 4ANWA 3U3WA 3L22A 3R9AB 5T8IA 5AIJA 5BPPA 5JHBA 4N2SA 3ENEA 3O48A 1E7UA 4LERA 2IOSA 3PNLB 2WXJA 4G25A 3ZCBA 1ELKA 2L9BA 3C98A 5G55A 1EYHA 5EX3A 4AY6A 4APOA 3CHOA 5DIZA 4BFRA 3CIAA 2NSZA 2WXPA 1P5QA 1IHGA 3MKQB 3P2BA 3SBSA 5BT1A 5KJMA 4ANUA 3MYVA 2QFCA 2WXLA 1U3DA 3QAQA 1OUVA 3CR3A 3PVLA 2MOWA 3U64A 3CQGB 3ZHEB 2FF4A 3FUFA 4FLHA 2AVPA 3N71A 3VTXA 3MA5A 3ZEFA 2WXGA 2VGXB 2OOEA 3MV3B 3SZ7A 4XI0A 3WXXA 5JHAA 5ANLA 1QQEA 4CGVA 3TG4A 3FH7A 2X6FA 4JEUA 5EU0A 4L2YA 4EQFA 4HOTA 5CMWA 4KVMA 4ME2A 5LP0A 3SD5A 3L17A 1GW6A 2IONA 3S2AA 3DPDA 2I1KA 1HH8A 4GZCA 1IQUA 4BT8A 3PS6A 4X2DA 3SE5A 5FZQA 1OWMA 4U07A 3MZLB 3Q5MA 3APFA 1E8ZA 2PZIA 4GYOA 4DI3A 4RG6A 3CHMA 4EBAG 4HOUA 2V5FA 4U0SA 3CLJA 3BG1B 3IKOB 4UI9J 3QARA 4GCOA 3NZUA 2WMOA 3IBEA 3SN9A 4XI8A 4JL0A 4OVUA 3UPVA 3SBTB 2KZTB 1KT1A 2BUGA 2V4LA 3PZDA 3ZVVA 3APDA 4XZ4A 5FZRA 3LKUA 2L6JA 4HOQA 3Q4AB 4UQXA 2UY1B 3QWPA 3LY8A 2VSOE 2A4ZA 4GA0A 4JPSA 2Y3AA 3U4TA 3EHMA 2AWIA 4IYPA 4K03A 4KVOA 2YINA 4XI9A 3ZXSA 3FTYA 3EDTB 3SNXA 5CMTA 3SHGA 1WY6A 2KM4A 2WQ6A 3GZ2A 2OV8A 4DLQA 4XIFA 3URZA 4BX8A 4CEMA 2I6HA 4JZYA 4JVSA 1MHQA 2IQCA 3PE4A 4U0UA 1H2TC 3HHMA 4U0ZA 5T4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AYW D;  3QDN A;  4CDR A;  4JA9 A;  5ARF A;  3LY9 A;  3KD7 A;  5CKL A;  5JFZ A;  2YHC A;  2F6S A;  2LSU A;  4ABN A;  2KCK A;  2Y4T A;  1HZ4 A;  2UWJ G;  2XEV A;  2DBA A;  3JYS A;  4I1A A;  4GCN A;  3ZHE A;  5EX0 A;  1NA0 A;  4Y6C A;  4JA7 A;  3PDN A;  4G1T A;  2PL2 A;  5ARG A;  1KT0 A;  4U0Z A;  2WQH A;  3KAE A;  4UI9 C;  3IEG A;  2XGM A;  5CGL A;  3CK7 A;  4GYW A;  4LU4 A;  4I9C A;  2C0M A;  3AS8 A;  3ZC7 A;  4WGJ A;  4HOS A;  3UQ3 A;  3OXL A;  4N3C A;  2FEZ A;  2IFU A;  5FTP A;  3GYZ A;  4I17 A;  5M72 A;  3LYA A;  4O6F A;  3S7B A;  3GZ1 A;  4Y6W A;  2NC9 A;  3S7D A;  4G26 A;  4GA1 A;  5D0O D;  3BEE A;  3TG5 A;  4HOR A;  2XCB A;  3RO3 A;  4H7X A;  2XGS A;  4WND A;  2JK8 A;  3FWV A;  3CKB A;  4YND A;  1WAO 1;  5KJL A;  2YQ8 A;  3CK8 A;  2FI7 A;  4WUY A;  5FT9 A;  4GZ5 A;  4KXK B;  3ASF A;  4X2E A;  4GZ6 A;  1XNF A;  1W3B A;  4NQ0 A;  4PY3 A;  3ASD A;  3GW4 A;  2OND A;  3UUX A;  3HYM B;  4W9R A;  2C2L A;  5G04 J;  4G24 A;  4WNG A;  3CVP A;  2VGY A;  4CGW A;  3E4B A;  3CKC A;  1ELR A;  3Q47 B;  3SF4 A;  2LSV A;  5CCL A;  3S7F A;  2KCL A;  4UQY A;  4AIF A;  2C0L A;  2UY1 A;  4J8F A;  5DBK A;  4ITR A;  5CCM A;  1HXI A;  4I2Z A;  5A7D B;  2KC7 A;  2Y4U A;  1IYG A;  4F3V A;  4IN3 B;  1YA0 A;  2PQR A;  3CV0 A;  3RIB A;  1A17 A;  2XPI A;  3CVQ A;  2GW1 A;  2J9Q A;  4B94 A;  4RG9 A;  3PE3 A;  2KCV A;  4J8D A;  2WPV A;  4BWR A;  2G03 A;  3TGO A;  5EKQ D;  5A6C A;  4N5C A;  5JFF A;  3CK9 A;  2HO1 A;  1E96 B;  2PQN A;  3N3U A;  3Q15 A;  4BTA A;  2IF4 A;  3ASH A;  1FCH A;  4KBQ A;  1KLX A;  5LCW J;  3CEQ A;  3RJV A;  5BNW A;  3AS4 A;  4LEU A;  4I2W A;  3Q49 B;  3ULQ A;  2P58 C;  4H7Y A;  3MEK A;  2VZA A;  2VQ2 A;  4X2C A;  4AY5 A;  4UQZ A;  5G04 C;  4BT9 A;  3QKY A;  3CVN A;  3MKR A;  3CVL A;  2KAT A;  3OXG A;  5D0Q D;  1NA3 A;  3LY7 A;  4U04 A;  4JHR A;  3FP3 A;  3QOU A;  3TAX A;  2MHK A;  2Q7F A;  3VTY A;  2VY3 A;  4WNE A;  4G23 A;  4J8E A;  4J0U A;  3ZN3 A;  2VYI A;  4M16 A;  2E2E A;  4A1S A;  1WM5 A;  1NZN A;  3K9I A;  4AM9 A;  2VSY A;  4N67 A;  1ZBP A;  2XGO A;  3ZGQ A;  5C1D A;  4YVO A;  4NPS A;  4G2V A;  5CHE E;  5G05 C;  3QWV A;  4KYO B;  4UI9 K;  3LPZ A;  1TJC A;  2VSN A;  3RKV A;  1Y8M A;  3KS2 A;  2LNI A;  5HI7 A;  3ZPJ A;  5KJN A;  3RU0 A;  3FFL A;  5FZS A;  5KJK A;  2HYZ A;  4I9E A;  5JJ6 A;  3ESK A;  3OXF A;  3AS5 A;  2HR2 A;  4GPK A;  4WNF A;  3CUC A;  2FBN A;  5HQ8 A;  4GZ3 A;  3S6A A;  4GA2 A;  1ZU2 A;  3ASG A;  5BW8 C;  3QWW A;  5FJY A;  5LCW C;  5JJ7 A;  2FO7 A;  3LET A;  4GYY A;  2XCC A;  2R5S A;  1ELW A;  4NRH B;  4BTB A;  2JLB A;  4YVQ C;  2VGX A;  3RO2 A;  5G05 J;  3ZLM A;  4N3A A;  1B89 A;  4N39 A;  1PC2 A;  1QZ2 A;  4N2Q A;  3NF1 A;  3S7J A;  5JJT A;  3MV2 B;  3LCA A;  3U3W A;  3R9A B;  4N2S A;  3O48 A;  4G25 A;  3ZCB A;  4AY6 A;  5EX3 A;  4APO A;  5DIZ A;  5BT1 A;  1P5Q A;  1IHG A;  5KJM A;  2QFC A;  1OUV A;  3ZHE B;  2FF4 A;  2AVP A;  3N71 A;  3VTX A;  3MA5 A;  3MV3 B;  2VGX B;  2OOE A;  3SZ7 A;  4XI0 A;  3WXX A;  1QQE A;  4CGV A;  3TG4 A;  5EU0 A;  4EQF A;  4HOT A;  4ME2 A;  1HH8 A;  4BT8 A;  4X2D A;  3SE5 A;  5FZQ A;  3Q5M A;  4U07 A;  4GYO A;  2PZI A;  4RG6 A;  4HOU A;  2V5F A;  4U0S A;  4UI9 J;  4GCO A;  3SN9 A;  4XI8 A;  4JL0 A;  3UPV A;  1KT1 A;  2BUG A;  5FZR A;  3LKU A;  2L6J A;  4HOQ A;  3Q4A B;  4UQX A;  2UY1 B;  3QWP A;  3LY8 A;  4GA0 A;  3U4T A;  4XI9 A;  3EDT B;  5CMT A;  3SHG A;  3GZ2 A;  4XIF A;  3URZ A;  2I6H A;  3PE4 A;  4U0U A;  3ZFW A;  4N3B A; 
#chains in the Genus database with same CATH topology
 4G8K A;  1TN7 A;  3FDH A;  3ML9 A;  3LVQ E;  3LJN A;  1TNZ A;  3QDN A;  4CDR A;  4JA9 A;  3KD7 A;  4B8C B;  3Q7F A;  2X6H A;  1UJK A;  2UWJ G;  4PS8 A;  2GRQ B;  4I1M A;  2DBA A;  3DSW A;  3FUI A;  3NB2 A;  3FH5 A;  1V55 E;  3PDN A;  2WXN A;  1TN6 A;  5ARG A;  2GGF A;  1V54 E;  2CG3 A;  3APC A;  3KSQ A;  2JAB A;  3FU3 A;  3IEG A;  2XGM A;  2I2O A;  4GYW A;  3UT7 A;  4I9C A;  3ABL E;  5BV1 A;  3V2X A;  4WGJ A;  3KEZ A;  4EHM A;  2AJA A;  3UM2 A;  4HOS A;  1G3N B;  3UKR G;  4B93 B;  3AG4 E;  5FTP A;  3FH8 A;  3KSL A;  3TWV A;  3EJN A;  4O6F A;  4LSZ E;  2PM6 A;  4FA6 A;  5J08 A;  2H6G A;  4XKB A;  4GA1 A;  3Q78 A;  3TG5 A;  3CST A;  3FTS A;  3UT8 A;  2JK8 A;  3CKB A;  2WB2 A;  4HFG A;  5KJL A;  3HXD A;  3D9J A;  4A1G A;  4KMO A;  2J8S D;  3EIQ C;  3PZ4 A;  3IHY A;  2L0I A;  2IJG X;  4GZ5 A;  4KXK B;  4TXR A;  5FT9 A;  3ASF A;  1XNF A;  4U7E B;  1LD7 A;  3KEA A;  2DYR E;  2R03 A;  1Z6T A;  3ZYL A;  4GTV A;  4CGW A;  1DCE A;  4MRU A;  3QJZ A;  4I6G A;  4XEI G;  3B7U X;  3S7F A;  4UQY A;  2UY1 A;  4B8A A;  3BUA A;  4V3I A;  4IN3 B;  4R7L A;  5CRV A;  1YA0 A;  2PQR A;  5FIO A;  1YCS B;  4MBG A;  4CT4 A;  2GW1 A;  2KCV A;  4DX1 A;  4M3O A;  3SFY A;  2WPV A;  3LEW A;  3TJP A;  4YDE A;  5ENR D;  5A6C A;  5B1A E;  1KZO A;  5JFF A;  5ENQ D;  3FUD A;  3Q15 A;  1FCH A;  3JQ0 A;  2XS8 A;  4PS7 A;  4B0Z A;  1DNP A;  1OWL A;  2VSX E;  4I2W A;  4RQI A;  3JCK C;  4AEZ C;  3UIN C;  4EZK A;  2VQ2 A;  5AAO A;  1HU3 A;  1A5E A;  5G04 C;  3LXU X;  3CVN A;  3WG7 E;  3OXG A;  2KAT A;  4HXI A;  5D0Q D;  1NA3 A;  5CRU A;  4BES A;  4U04 A;  3NZS A;  3TWX A;  3FY4 A;  3QOU A;  2DZO A;  3TAX A;  5KWD A;  2RD0 A;  4EEC A;  4A3V A;  3L6A A;  4DLO A;  2LAH A;  3CHQ A;  2VY3 A;  5CER B;  3HXF A;  4WNE A;  4KZC A;  2VTB B;  3B7T A;  3IXE A;  4WWO A;  1O5M A;  4A1S A;  1S0P A;  1NZN A;  4TRQ A;  1UN8 A;  1H19 A;  4GMR A;  2VJ8 A;  2XHE A;  4HB5 A;  4URK A;  2CFZ A;  2LXL A;  4GPM A;  1E8Y A;  5FQ6 A;  2J4B A;  4TXP A;  3VLF A;  3ULE G;  4BSZ B;  3T5V A;  4EZL A;  1TJC A;  2VSN A;  2ZGG A;  3RKV A;  1MX4 A;  3ONK A;  2YNQ A;  1VDY A;  1D8D A;  1TR4 A;  5HI7 A;  1TYQ G;  5E75 A;  2B0O E;  1BU9 A;  5ENS D;  2ILR A;  3V30 A;  3ESK A;  3FUM A;  3HVE B;  3CVX A;  3AS5 A;  3HIZ A;  4CDN A;  2V8S E;  4GPK A;  1N9A A;  4GZ3 A;  3S6A A;  4TUU A;  3C5R A;  2WMN A;  2H6F A;  3UM0 A;  3U9W A;  4BER A;  2EIL E;  3DXM G;  5HKP A;  3ASN E;  3LET A;  4GYY A;  3RRM B;  2XCC A;  3UX4 A;  4KZ0 A;  4NRH B;  3PNT B;  4BY6 A;  4BTB A;  4UUC A;  1OT8 A;  4ILH B;  2AW6 A;  3ZYM A;  4HRM B;  3Q75 A;  3D9N A;  4PDX A;  3QNK A;  3CSF A;  3PH0 C;  3S7J A;  2NYJ A;  3D9P A;  1OCC E;  5C2Y A;  5AEN A;  3L22 A;  5T8I A;  5AIJ A;  3DWL G;  5JHB A;  2IOS A;  2WXJ A;  1WG0 A;  3C98 A;  2L9B A;  3CIA A;  2NSZ A;  2P9L G;  2WXP A;  1IHG A;  2Y0B G;  4CZ2 D;  2OCC E;  2WXL A;  3EHQ A;  1U3D A;  3T8K A;  2ZXW E;  2AVP A;  4DX2 A;  3VTX A;  3MA5 A;  1DCQ A;  3MV3 B;  3E30 A;  4CGV A;  3TG4 A;  3FH7 A;  5AQ7 A;  3ZNG A;  4ME2 A;  5LP0 A;  1GW6 A;  3S2A A;  3SFX A;  1HH8 A;  4F6R D;  3PS6 A;  5B1B E;  4DI3 A;  2PZI A;  3ABK E;  4ZHB A;  3NZU A;  3ASO E;  3AAA C;  2KZT B;  2BUG A;  3L82 A;  3APD A;  4HOQ A;  2L6J A;  2UY1 B;  3QWP A;  2VSO E;  3SO8 A;  4GA0 A;  3NOG D;  2Y3A A;  4IYP A;  4KVO A;  4XI9 A;  3SNX A;  2KM4 A;  4DLQ A;  4CEM A;  2I6H A;  3PE4 A;  4JEU A;  3ZFW A;  3ZU7 B;  3UMV A;  2WXH A;  5IY5 E;  2ETC A;  5ARF A;  1IHB A;  3LY9 A;  2YHC A;  2BED A;  4EBA A;  3RK6 A;  4ABN A;  3B13 A;  5D2M C;  1IQR A;  2Y4T A;  2ZU6 B;  4ANV A;  4O60 A;  1S70 B;  4G11 A;  2XEV A;  2B6C A;  3DSS A;  1HS6 A;  3ZHE A;  4Y6C A;  1H6P A;  1SVX A;  5H7P A;  3QB2 A;  5BUZ A;  2PL2 A;  2R05 A;  4GTM A;  4O1O A;  3PZ3 A;  3KAE A;  4A55 A;  2HE0 A;  4LU4 A;  4DI4 A;  3PZ2 A;  4HI9 A;  3Q7A A;  3BG0 B;  3ZXP A;  3ZKJ A;  3OXL A;  2OEV A;  3UM1 A;  2FEZ A;  3EUV A;  3V79 K;  4QQI A;  1JUQ A;  2KZT A;  1SZA A;  3J5Q B;  1QYM A;  4Y6W A;  3S7B A;  3V2O A;  2NC9 A;  3O4Z A;  4HOR A;  3C72 A;  4Q96 A;  4AV7 A;  1X5B A;  4LCT A;  4H7X A;  3D9I A;  1S64 A;  3FWV A;  4YND A;  3UIP C;  1FVF A;  2YQ8 A;  2E0I A;  5JMN D;  4F7A A;  2P9K G;  5EN5 D;  2XZD G;  3V31 A;  3GZS A;  2XRZ A;  3FTU A;  1W3B A;  4NQ0 A;  3CVY A;  3FUE A;  3ABM E;  2EIJ E;  4B89 A;  2XEN A;  4ACK A;  1FPP A;  5EIB E;  5KBA A;  4W9R A;  2XPZ A;  1KZP A;  3CVP A;  4FHJ A;  2VGY A;  1SZ9 A;  2R02 A;  3G2U A;  4LNG A;  4FLB A;  3ZRH A;  4CT0 A;  4HLE A;  1L5J A;  2CHX A;  2ETA A;  2KCL A;  3HVE A;  1N52 A;  1UN9 A;  3CQC B;  5CCM A;  2XRY A;  4HI8 A;  3UI2 A;  4J6I A;  1IYG A;  3TWS A;  2L0T B;  2GRP B;  2CHW A;  3RIB A;  1A17 A;  2KBX A;  4WAF A;  3Q9U C;  4ACL A;  3TGO A;  3D9O A;  4LUN U;  4KBQ A;  5LCW J;  4L9P A;  3RJV A;  3T8M A;  3SGH A;  5BNW A;  1H2U A;  1TEZ A;  4RLY A;  2EIK E;  3MEK A;  1O1R A;  4APF A;  4FP7 A;  4AY5 A;  3PUK A;  4UQZ A;  3RRN B;  4BT9 A;  1YMP A;  3LVR E;  3QKY A;  4YDY A;  4GMJ A;  1N0R A;  4I43 A;  3ML8 A;  3AG3 E;  2H6H A;  4D10 C;  4P29 A;  2Q7F A;  3VTY A;  3ZN3 A;  2VYI A;  2R59 A;  1NP7 A;  4M16 A;  5T3R A;  1WM5 A;  3FTX A;  3TWT A;  1ZBP A;  2XGO A;  3ZGQ A;  3FUN A;  1HE8 A;  1FVH A;  1DVP A;  4NPS A;  1K8K G;  4G2V A;  5G2N A;  5CHE E;  4E6H A;  3QWV A;  4CRW A;  4C48 B;  2P9N G;  4TV3 A;  3LPZ A;  3FEX A;  2BKK B;  4LNU D;  1Y8M A;  2X38 A;  4L23 A;  4HVB A;  2LNI A;  3FEY A;  1MJ0 A;  1OY3 D;  1Z3Y A;  3RU0 A;  5FZS A;  3PEV B;  3BU8 A;  3FTZ A;  5EID A;  2BF0 X;  5JJ6 A;  3AG2 E;  1HF8 A;  1TN8 A;  1HFA A;  4J8Y A;  2HR2 A;  2PM7 A;  4WNF A;  2FBN A;  2KXP C;  3VLE A;  1MX2 A;  3FHE A;  3FU5 A;  1OCO E;  2XS1 A;  1H0A A;  2J4D A;  2FO7 A;  1FT1 A;  3AG1 E;  3T5X A;  4YDO A;  4OVV A;  3G2W A;  3L9T A;  1MQS A;  2A5U A;  2JLB A;  2J49 A;  5G05 J;  2CG2 A;  4AJW A;  2GRR B;  2WXF A;  4G8L A;  1INZ A;  1OWN A;  4C0M A;  2OVB A;  3L08 A;  4PH4 B;  2MRI A;  4ATG A;  4HQD A;  4JW1 A;  1RW2 A;  5BPP A;  4LER A;  3D9H A;  3ZCB A;  2F37 A;  4AY6 A;  3P2B A;  1P5Q A;  1NH1 A;  3MYV A;  2EIN E;  3X2Q E;  3CR3 A;  3DEP A;  3FUF A;  1Q2Z A;  4HNA D;  3ZEF A;  3SZ7 A;  2VGX B;  2OOE A;  3WXX A;  2PNN A;  5ANL A;  1QQE A;  5EU0 A;  2BKG A;  2ION A;  4U07 A;  1E8Z A;  3APF A;  3HXE A;  1X81 A;  4HOU A;  2F8Y A;  4U0S A;  3BG1 B;  3IKO B;  4UI9 J;  2V5Q C;  2WMO A;  4JL0 A;  4OVU A;  3SBT B;  1MYO A;  3PZD A;  4XZ4 A;  5FZR A;  2A4Z A;  4HBD A;  4JPS A;  3U4T A;  4N5Q A;  5CMT A;  4JB8 P;  3SHG A;  1WY6 A;  1LD8 A;  2WQ6 A;  3GZ2 A;  4XIF A;  3URZ A;  1D8E A;  2IQC A;  3E34 A;  3HHM A;  5D66 A;  5T4Y A;  3NQP A;  3L16 A;  5AYW D;  4K5B A;  5CKL A;  3CHP A;  2GRM A;  3G2V A;  4AXH A;  1RZ4 A;  2WXR A;  3R9M A;  5EDS A;  1BD8 A;  2IOL A;  3U66 A;  2Y1L E;  3CVW A;  5LX8 A;  4GCN A;  4UWL A;  3ZYQ A;  3G2S A;  5EX0 A;  1NFI E;  4GTT A;  3FUH A;  4K5C A;  3MKQ A;  2QYJ A;  2DIW A;  3W9F A;  4ILG A;  1HG2 A;  5CGL A;  3P1U A;  2ZIS A;  4J8S A;  3B7S A;  4JEH A;  1N94 A;  4L1B A;  5AAR A;  4ANX A;  4I6J A;  3AS8 A;  3R7Q A;  5EYP F;  3UQ3 A;  4N3C A;  2P9I G;  3FU0 A;  2IFU A;  5E76 A;  3CVU A;  4I17 A;  5M72 A;  5BV0 A;  3GZ1 A;  4K0R A;  4FHK A;  4FJY A;  1Z3X A;  4G26 A;  1TNY A;  3BEE A;  3RO3 A;  4UWG A;  4A3T A;  5ENN A;  2XGS A;  1D9S A;  4DJA A;  3I4G A;  1KPS B;  1WAO 1;  3CK8 A;  1N4P A;  4WUY A;  1TNB A;  4GTR A;  4TUM A;  1XGW A;  3RRU A;  2GRO B;  2IU1 A;  4X2E A;  4GZ6 A;  1JWF A;  3TWQ A;  1E90 A;  2HM8 A;  2WXI A;  2I9C A;  3GW4 A;  4BET A;  5J90 A;  4C9B B;  3UUX A;  2WVI A;  2C2L A;  4G24 A;  4GTQ A;  4AP2 A;  1YYH A;  3E4B A;  4U63 A;  2V4H C;  3CKC A;  1N4S A;  3T9K A;  1ELR A;  2F8X K;  1PY1 A;  5FIN A;  1HG5 A;  3I5P A;  3SF4 A;  4DK5 A;  3EU9 A;  2LSV A;  4FU3 A;  1UJJ A;  2Y69 E;  1EF1 C;  1K1B A;  2RFM A;  4AIF A;  1SQM A;  4I2Z A;  2KC7 A;  2Y4U A;  4F3V A;  3CV0 A;  4MKT A;  4GML A;  1ZB1 A;  2XPI A;  2EQX A;  4DX6 D;  2J9Q A;  3FUL A;  3G2T A;  3PE3 A;  3MCX A;  4J8D A;  2DYS E;  3NAW A;  4BWR A;  2G03 A;  5EKQ D;  4N5C A;  2QYU A;  3CK9 A;  2HO1 A;  1TJF A;  1E96 B;  2IF4 A;  1KLX A;  2GRL A;  1UW4 B;  2VGE A;  3UIO C;  5CEA A;  3ZYK A;  2J08 A;  4E85 A;  4UWF A;  4XX5 A;  4LEU A;  2R17 C;  1BLX B;  3Q49 B;  3ULQ A;  4OYS A;  4H7Y A;  4L7T A;  2VZA A;  5FQ4 A;  1OWP A;  4HS2 A;  3Q79 A;  3MKR A;  3CVL A;  4Q69 A;  5HS0 A;  3LY7 A;  1NL4 A;  3PEU B;  2OVF A;  4JHR A;  3FP3 A;  2MHK A;  1SA5 A;  1FT2 A;  3UTM A;  4GTO A;  1K3Z D;  3K9I A;  3UXG A;  5ENO D;  1UOH A;  1JCS A;  2VSY A;  3ESL A;  3MJW A;  5C1D A;  3MGB A;  2NUD A;  4YVO A;  3TWR A;  5G05 C;  3D3M A;  2X6J A;  2I1J A;  4HLL A;  2IO3 C;  1HO8 A;  5JA4 D;  4CDM A;  3E37 A;  2RKK A;  4FUL A;  1QNF A;  5KJN A;  2J09 A;  2NUN A;  5BXU A;  4I9E A;  3I3N A;  3AU4 A;  2XQ0 A;  3OXF A;  4IUL A;  4NUR A;  1TNU A;  4F53 A;  4L2L A;  1JCR A;  4IRU A;  5HQ8 A;  2P2C P;  1ZU2 A;  1OCZ E;  4BX9 A;  2NXP A;  3IHV A;  3ASG A;  3QWW A;  4F1S A;  5LCW C;  4NAC A;  2VTB A;  3PUJ A;  2QC9 A;  4ZFH A;  3TWU A;  4XE0 A;  4DRX E;  3C3Q A;  2R5S A;  4RSY A;  4DUI A;  3PZ1 A;  3CGH A;  4YVQ C;  3RO2 A;  4EPZ A;  5FWQ A;  1N11 A;  4FAD A;  4MLP A;  4N3A A;  1B89 A;  3B7R L;  3CHS A;  2F0Y A;  4OAU C;  1Z5S C;  2J07 A;  4DPR A;  1PC2 A;  3QK0 A;  1EPU A;  3NF1 A;  2WM9 A;  3LCA A;  2XEE A;  3JQ1 A;  3SI5 A;  4ANW A;  5ENP D;  5EIL A;  4N2S A;  1E7U A;  3RAU A;  1EYH A;  5EX3 A;  4APO A;  3CHO A;  5BT1 A;  1QBQ A;  3MKQ B;  5KJM A;  4ANU A;  2QZA A;  2QFC A;  3QAQ A;  1OUV A;  5ITZ F;  2FO1 E;  3PVL A;  2MOW A;  3CQG B;  2ZIR A;  3ZHE B;  2FF4 A;  4FLH A;  3EHR A;  2WXG A;  4XI0 A;  4OAV B;  2EIM E;  5AN8 A;  3TWW A;  2X6F A;  4L2Y A;  2A5E A;  3SD5 A;  1IXV A;  3DPD A;  2I1K A;  1IQU A;  4X2D A;  3SE5 A;  1OWM A;  3ULY A;  4GYO A;  4RG6 A;  4U8Y D;  2V5F A;  5ENT D;  3CLJ A;  3BQO A;  3QAR A;  4GCO A;  4XI8 A;  1KT1 A;  1N4Q A;  2V4L A;  3Q73 A;  3ZVV A;  3LKU A;  3Q4A B;  4UQX A;  1K1A A;  3EHM A;  1OCR E;  1O1S A;  1N0Q A;  5CBO A;  4HRL A;  2OV8 A;  4BX8 A;  4JVS A;  1MHQ A;  4U0U A;  5CEC B;  4U0Z A;  3HG0 D;  4J7W A;  3RSE G;  2IY0 C;  4A63 B;  1SW6 A;  4U8V D;  4C0E A;  3IV0 A;  3HRA A;  4FC8 A;  5JFZ A;  2F6S A;  2LSU A;  3DSV A;  1NI1 A;  2KCK A;  1LF8 A;  4JXT A;  3SFZ A;  4AVX A;  1HZ4 A;  1S63 A;  3SHF A;  4NIK A;  1O1T A;  3JYS A;  4I1A A;  3ONL A;  1NA0 A;  4JA7 A;  3UT4 A;  4G1T A;  1KT0 A;  4JD2 G;  2WQH A;  1HX8 A;  4GTP A;  3UM3 A;  4UI9 C;  5FQ8 A;  3CK7 A;  2AXU A;  3JUE A;  2C0M A;  2AXV A;  3ZC7 A;  3DSX A;  2YHE A;  4LNB A;  5AJD A;  2FUL A;  4PS3 A;  3DSU A;  2M63 A;  1Y6I A;  3GYZ A;  4FJZ A;  1LTX A;  3LYA A;  2WXK A;  3S7D A;  3TXN A;  3ISM C;  3JXJ A;  3D9K A;  3L54 A;  4TXQ A;  2JEK A;  4GAA A;  5D0O D;  5HRY A;  3CVV A;  2X6K A;  2XCB A;  2IEJ A;  5AQB A;  1N4R A;  3EIJ A;  3SY2 A;  4WND A;  2X3M A;  3SQV A;  1H6O A;  5B3S E;  3E33 A;  4KT6 B;  2FI7 A;  1OWO A;  1N54 A;  1AWC B;  3DEO A;  3UKU G;  1IKN D;  2OEW A;  4AOF A;  4U95 D;  4WWP A;  2XEH A;  3DBS A;  4PY3 A;  3ASD A;  1BPO A;  3J5P A;  4JHK A;  1AP7 A;  2OND A;  3HYM B;  2WXM A;  4LRZ A;  5G04 J;  3JUI A;  3TL5 A;  4WNG A;  4K5A B;  3PRE A;  5ANR A;  5AJL A;  1U3C A;  2LO6 A;  4JC8 A;  3D9L A;  3Q47 B;  5CCL A;  5AQA A;  3EU5 A;  2C0L A;  1U2V G;  2P9P G;  4J8F A;  4ATZ D;  5DBK A;  4ITR A;  3NOC D;  1HXI A;  5A7D B;  4GB9 A;  1H2V C;  4ILI A;  2MYO A;  3DPY A;  2H6I A;  4BEP A;  3CVQ A;  4B94 A;  2RFA A;  3QC1 A;  2R2L A;  3HXC A;  4RG9 A;  3D9M A;  3LS8 A;  1H6K A;  2QY7 A;  3HDX A;  2DCP A;  2XPY A;  2PQN A;  3N3U A;  1JCQ A;  3OAW A;  4BTA A;  3TXM A;  3ASH A;  2X6I A;  4U8H A;  3CEQ A;  1DC2 A;  4WWN A;  3AS4 A;  2P58 C;  4EZJ A;  5CMY A;  5EYL A;  1MZC A;  4X8Q A;  4X2C A;  4UWH A;  5FQ7 A;  4QFV A;  3LDZ A;  5KNG A;  5CED B;  1WDY A;  2CHZ A;  4GU5 A;  4BSX A;  2ZGD A;  3L13 A;  4CCA A;  2WXO A;  4G23 A;  4J8E A;  4J0U A;  2E2E A;  1TNO A;  4M7C A;  2AXZ A;  4PUC A;  1E8X A;  4AM9 A;  4N67 A;  2LAI A;  5LFA A;  3OTN A;  1OXJ A;  2BTD A;  4KYO B;  4UI9 K;  2WXQ A;  3C3R A;  1UG3 A;  3B7B A;  2CFU A;  1EDU A;  4UWK A;  1E8W A;  3FTW A;  2LXM A;  3KS2 A;  3VLD A;  2XZT G;  3ZPJ A;  3FFL A;  3FU6 A;  3CHR A;  5A23 A;  3MX3 A;  5KJK A;  2HYZ A;  1E7V A;  3I4R B;  4MS6 A;  3HXB A;  4GTS A;  4GZD A;  1MX6 A;  4XKC A;  3ZW3 A;  3AU5 A;  3LJ3 A;  3ZIM A;  3CUC A;  3W9G A;  4GA2 A;  1PAQ A;  3DRA A;  4RVB A;  2LUH A;  5BW8 C;  5LOZ A;  3JXI A;  3FUK A;  5FJY A;  1N95 A;  5JJ7 A;  5BXO A;  4I6E A;  4CYM D;  1JPL A;  1ELW A;  3PRZ A;  2V0P A;  3FUJ A;  2VGX A;  3R7R A;  2DWZ A;  4O1P A;  3ZLM A;  3FTV A;  4F1P A;  2RG8 A;  4I1O B;  3EHN A;  4N39 A;  2WQ7 A;  5KCM A;  1QZ2 A;  4JHJ A;  4N2Q A;  2DVW A;  1JWG A;  5JJT A;  3MV2 B;  3U3W A;  4Q94 A;  3R9A B;  3DXK G;  2GRN B;  3ENE A;  3O48 A;  3PNL B;  4G25 A;  1ELK A;  5G55 A;  5DIZ A;  4BFR A;  3SBS A;  2P9U G;  1SA4 A;  3U64 A;  1BI8 B;  3N71 A;  3DST A;  3ZUV B;  5JHA A;  2P9S G;  4EQF A;  4HOT A;  5CMW A;  3Q9N C;  4KVM A;  2ETB A;  3L17 A;  4GZC A;  4DX7 D;  4BT8 A;  3C3O A;  5FZQ A;  3Q5M A;  3MZL B;  4HRN A;  3CHM A;  4EBA G;  4DX5 D;  3F6Q A;  3B95 A;  4LG6 A;  4Z68 A;  3IBE A;  3SN9 A;  3UPV A;  2DZN A;  5AQ9 A;  3NBN B;  3LY8 A;  4U96 D;  2IO2 C;  1BI7 B;  2AWI A;  5CBN A;  4K03 A;  2YIN A;  3ZXS A;  3AJI A;  3EDT B;  3FTY A;  2L6B A;  5KNH D;  4JZY A;  4YDW A;  1H2T C;  4N3B A;  3E32 A; 
#chains in the Genus database with same CATH homology
 3UMV A;  3NQP A;  3FDH A;  3L16 A;  3ML9 A;  3LVQ E;  2WXH A;  5AYW D;  3QDN A;  4CDR A;  4C0E A;  4JA9 A;  3IV0 A;  5ARF A;  4HOR A;  3LY9 A;  3KD7 A;  5CKL A;  4FC8 A;  5JFZ A;  2GRM A;  2YHC A;  3CHP A;  2X6H A;  2F6S A;  2LSU A;  3G2V A;  4B8C B;  4EBA A;  3RK6 A;  4ABN A;  3B13 A;  4AXH A;  2KCK A;  1LF8 A;  4JXT A;  3SFZ A;  1IQR A;  4AVX A;  1UJK A;  2Y4T A;  1HZ4 A;  2ZU6 B;  2WXR A;  2UWJ G;  4ANV A;  4PS8 A;  3SHF A;  4I1M A;  5EDS A;  4G11 A;  2XEV A;  2DBA A;  3JYS A;  2IOL A;  4I1A A;  3U66 A;  3FUI A;  3CVW A;  3ONL A;  5LX8 A;  4GCN A;  1HS6 A;  3ZHE A;  4UWL A;  3ZYQ A;  3G2S A;  5EX0 A;  1NA0 A;  4Y6C A;  3FH5 A;  4JA7 A;  3UT4 A;  3PDN A;  4G1T A;  2WXN A;  3QB2 A;  5BUZ A;  2PL2 A;  3FUH A;  5ARG A;  2GGF A;  1KT0 A;  2CG3 A;  3MKQ A;  2DIW A;  3APC A;  2WQH A;  4ILG A;  3FU3 A;  1HX8 A;  3KAE A;  4A55 A;  4UI9 C;  1HG2 A;  3IEG A;  2XGM A;  2I2O A;  5CGL A;  3P1U A;  5FQ8 A;  3CK7 A;  2AXU A;  4GYW A;  3UT7 A;  4LU4 A;  4I9C A;  3B7S A;  4J8S A;  4JEH A;  4DI4 A;  4L1B A;  5BV1 A;  2C0M A;  2AXV A;  4I6J A;  4ANX A;  3AS8 A;  3ZC7 A;  4WGJ A;  3KEZ A;  2YHE A;  3R7Q A;  3BG0 B;  4HOS A;  5AJD A;  2FUL A;  3UQ3 A;  4PS3 A;  3OXL A;  4N3C A;  3FU0 A;  2M63 A;  2FEZ A;  1Y6I A;  2IFU A;  5E76 A;  5FTP A;  3FH8 A;  3CVU A;  1JUQ A;  3GYZ A;  2KZT A;  4I17 A;  3EJN A;  4FJZ A;  5M72 A;  3LYA A;  4O6F A;  5BV0 A;  1SZA A;  3S7B A;  3GZ1 A;  4K0R A;  4Y6W A;  2WXK A;  2PM6 A;  4FHK A;  4FA6 A;  4FJY A;  5J08 A;  2NC9 A;  3S7D A;  1Z3X A;  3TXN A;  4XKB A;  3D9K A;  3L54 A;  3O4Z A;  2JEK A;  4G26 A;  4GA1 A;  3BEE A;  4GAA A;  5D0O D;  2X6K A;  2XCB A;  3CST A;  3RO3 A;  4Q96 A;  3TG5 A;  3CVV A;  3FTS A;  4AV7 A;  1X5B A;  4LCT A;  4UWG A;  3UT8 A;  3EIJ A;  4A3T A;  4H7X A;  5ENN A;  2XGS A;  4WND A;  2X3M A;  3D9I A;  2JK8 A;  3FWV A;  4DJA A;  3I4G A;  3CKB A;  2WB2 A;  4YND A;  4HFG A;  1FVF A;  1WAO 1;  5KJL A;  2YQ8 A;  2E0I A;  3CK8 A;  4KT6 B;  2FI7 A;  3D9J A;  4F7A A;  4A1G A;  4KMO A;  1OWO A;  1N54 A;  3EIQ C;  4WUY A;  3IHY A;  2L0I A;  1XGW A;  3GZS A;  2IJG X;  4GZ5 A;  4KXK B;  2IU1 A;  5FT9 A;  3ASF A;  3RRU A;  4AOF A;  2XRZ A;  4X2E A;  3FTU A;  4WWP A;  4GZ6 A;  1XNF A;  1W3B A;  3DBS A;  4NQ0 A;  1JWF A;  4PY3 A;  1E90 A;  3ASD A;  3CVY A;  3FUE A;  1BPO A;  2HM8 A;  4B89 A;  2WXI A;  4ACK A;  2I9C A;  3GW4 A;  4JHK A;  5J90 A;  4C9B B;  2OND A;  3UUX A;  3HYM B;  4W9R A;  2WVI A;  2C2L A;  2WXM A;  4LRZ A;  1Z6T A;  5G04 J;  3ZYL A;  2XPZ A;  4G24 A;  3JUI A;  3TL5 A;  4WNG A;  3CVP A;  4FHJ A;  2VGY A;  1SZ9 A;  4CGW A;  4AP2 A;  3PRE A;  5ANR A;  3E4B A;  4U63 A;  4MRU A;  5AJL A;  3G2U A;  3QJZ A;  3CKC A;  1U3C A;  1ELR A;  4FLB A;  2LO6 A;  4JC8 A;  4I6G A;  3B7U X;  1PY1 A;  1HG5 A;  3I5P A;  3D9L A;  3ZRH A;  4CT0 A;  3Q47 B;  3SF4 A;  4HLE A;  1L5J A;  2CHX A;  4DK5 A;  2LSV A;  5CCL A;  4FU3 A;  3S7F A;  1UJJ A;  2KCL A;  3HVE A;  4UQY A;  1EF1 C;  1N52 A;  4AIF A;  2C0L A;  2UY1 A;  1SQM A;  4J8F A;  1UN9 A;  3CQC B;  5DBK A;  4ITR A;  4B8A A;  5CCM A;  2XRY A;  1HXI A;  4I2Z A;  5A7D B;  4V3I A;  2KC7 A;  2Y4U A;  4J6I A;  1IYG A;  4F3V A;  4IN3 B;  4GB9 A;  1H2V C;  4R7L A;  2L0T B;  4ILI A;  1YA0 A;  2PQR A;  2CHW A;  4N3B A;  3CV0 A;  3RIB A;  4MKT A;  4GML A;  1A17 A;  4WAF A;  2XPI A;  4CT4 A;  2EQX A;  3CVQ A;  2GW1 A;  2J9Q A;  4B94 A;  3QC1 A;  3FUL A;  4RG9 A;  3D9M A;  3G2T A;  3PE3 A;  2KCV A;  3MCX A;  4J8D A;  3LS8 A;  4M3O A;  2WPV A;  4ACL A;  3LEW A;  2G03 A;  3TJP A;  4BWR A;  3TGO A;  1H6K A;  2QY7 A;  3D9O A;  5EKQ D;  5A6C A;  3HDX A;  4N5C A;  5JFF A;  3CK9 A;  2HO1 A;  2DCP A;  4LUN U;  1TJF A;  2XPY A;  1E96 B;  2PQN A;  3N3U A;  3OAW A;  3FUD A;  3Q15 A;  4BTA A;  2IF4 A;  3TXM A;  3ASH A;  1FCH A;  2X6I A;  4KBQ A;  1KLX A;  2GRL A;  4U8H A;  3JQ0 A;  3CEQ A;  1UW4 B;  5LCW J;  3RJV A;  4PS7 A;  4B0Z A;  3ZYK A;  3T8M A;  1DNP A;  2J08 A;  3SGH A;  5BNW A;  4E85 A;  4WWN A;  1H2U A;  1OWL A;  2VSX E;  4UWF A;  4XX5 A;  3AS4 A;  4LEU A;  2R17 C;  1TEZ A;  4I2W A;  3Q49 B;  3JCK C;  3ULQ A;  2P58 C;  4AEZ C;  4OYS A;  4EZJ A;  4EZK A;  4H7Y A;  5CMY A;  3MEK A;  4L7T A;  2VZA A;  4APF A;  2VQ2 A;  4X2C A;  5FQ4 A;  4FP7 A;  1HU3 A;  4AY5 A;  1OWP A;  3PUK A;  4UWH A;  4HS2 A;  4UQZ A;  3RRN B;  5G04 C;  4BT9 A;  5FQ7 A;  3LVR E;  3QKY A;  3LXU X;  3CVN A;  4QFV A;  3MKR A;  3CVL A;  2KAT A;  3OXG A;  4HXI A;  1NA3 A;  5D0Q D;  4Q69 A;  3LDZ A;  4GMJ A;  3LY7 A;  3PEU B;  4U04 A;  3NZS A;  4I43 A;  3FY4 A;  2OVF A;  4JHR A;  3FP3 A;  3QOU A;  3ML8 A;  2CHZ A;  3TAX A;  2RD0 A;  4EEC A;  4D10 C;  4GU5 A;  4P29 A;  4A3V A;  2MHK A;  2Q7F A;  3L6A A;  4DLO A;  4BSX A;  3L13 A;  4CCA A;  2LAH A;  3CHQ A;  3VTY A;  2VY3 A;  2WXO A;  4WNE A;  4G23 A;  4J8E A;  4J0U A;  3ZN3 A;  2VYI A;  4KZC A;  2R59 A;  2VTB B;  1NP7 A;  3B7T A;  4M16 A;  2E2E A;  4WWO A;  4A1S A;  1S0P A;  1WM5 A;  5T3R A;  2AXZ A;  1NZN A;  4PUC A;  3K9I A;  3FTX A;  4TRQ A;  1E8X A;  1H19 A;  1UN8 A;  4AM9 A;  2VSY A;  2VJ8 A;  3ESL A;  3MJW A;  4N67 A;  1ZBP A;  2LAI A;  2XGO A;  3ZGQ A;  2XHE A;  5C1D A;  3FUN A;  4URK A;  1HE8 A;  1FVH A;  1DVP A;  5LFA A;  3OTN A;  3MGB A;  2CFZ A;  4YVO A;  4NPS A;  2BTD A;  4G2V A;  5G2N A;  5CHE E;  4E6H A;  5G05 C;  3D3M A;  3QWV A;  4KYO B;  1E8Y A;  2X6J A;  2WXQ A;  2J4B A;  4UI9 K;  1UG3 A;  5FQ6 A;  4CRW A;  3VLF A;  3T5V A;  2CFU A;  1EDU A;  4UWK A;  1E8W A;  4TV3 A;  2I1J A;  3LPZ A;  4EZL A;  3FEX A;  1TJC A;  2VSN A;  3RKV A;  3FTW A;  3ONK A;  2YNQ A;  1HO8 A;  1Y8M A;  1VDY A;  3KS2 A;  2X38 A;  4L23 A;  4CDM A;  3VLD A;  4HVB A;  2LNI A;  3FEY A;  5HI7 A;  1Z3Y A;  4FUL A;  3ZPJ A;  1QNF A;  5KJN A;  3RU0 A;  3FFL A;  3FU6 A;  5E75 A;  2J09 A;  3CHR A;  5A23 A;  5FZS A;  3PEV B;  3FTZ A;  3MX3 A;  2BF0 X;  5KJK A;  2HYZ A;  4I9E A;  3I3N A;  5JJ6 A;  1E7V A;  3AU4 A;  1HF8 A;  3I4R B;  2ILR A;  2XQ0 A;  4MS6 A;  1HFA A;  3ESK A;  3OXF A;  4GZD A;  4IUL A;  4NUR A;  4F53 A;  3FUM A;  3HVE B;  3CVX A;  3AS5 A;  4XKC A;  3ZW3 A;  2HR2 A;  2PM7 A;  3AU5 A;  3HIZ A;  4CDN A;  2V8S E;  4L2L A;  4IRU A;  3LJ3 A;  3ZIM A;  4WNF A;  4GPK A;  3CUC A;  2FBN A;  5HQ8 A;  3VLE A;  4GZ3 A;  3S6A A;  4TUU A;  4GA2 A;  1ZU2 A;  2WMN A;  4BX9 A;  1PAQ A;  2NXP A;  4RVB A;  3IHV A;  5LOZ A;  3ASG A;  5BW8 C;  3QWW A;  3FHE A;  3FUK A;  3FU5 A;  5FJY A;  3U9W A;  4F1S A;  5LCW C;  4NAC A;  2VTB A;  1H0A A;  5JJ7 A;  2J4D A;  2FO7 A;  3PUJ A;  3LET A;  4GYY A;  4I6E A;  3T5X A;  3RRM B;  2XCC A;  4OVV A;  3G2W A;  4XE0 A;  1MQS A;  1JPL A;  3UX4 A;  2R5S A;  1ELW A;  3PRZ A;  4KZ0 A;  2V0P A;  4NRH B;  4RSY A;  3PNT B;  3CGH A;  2A5U A;  2JLB A;  4YVQ C;  3FUJ A;  2VGX A;  4BTB A;  3RO2 A;  4BY6 A;  4EPZ A;  5FWQ A;  3R7R A;  2J49 A;  4ILH B;  2AW6 A;  3ZYM A;  5G05 J;  3ZLM A;  2CG2 A;  4AJW A;  4FAD A;  4MLP A;  4N3A A;  3FTV A;  1B89 A;  3B7R L;  3CHS A;  2RG8 A;  4I1O B;  2WXF A;  2J07 A;  3D9N A;  4DPR A;  3ZFW A;  4PDX A;  3QNK A;  3EHN A;  4N39 A;  1INZ A;  1PC2 A;  5KCM A;  2WQ7 A;  1OWN A;  4C0M A;  3QK0 A;  3CSF A;  1EPU A;  1QZ2 A;  4JHJ A;  4N2Q A;  2OVB A;  3L08 A;  3NF1 A;  3PH0 C;  1JWG A;  4PH4 B;  3S7J A;  2MRI A;  4ATG A;  2WM9 A;  5JJT A;  3MV2 B;  3LCA A;  3D9P A;  5C2Y A;  5AEN A;  3JQ1 A;  4JW1 A;  4Q94 A;  3SI5 A;  4ANW A;  3U3W A;  3L22 A;  3R9A B;  5T8I A;  5AIJ A;  5BPP A;  5JHB A;  4N2S A;  3ENE A;  3O48 A;  1E7U A;  4LER A;  2IOS A;  3PNL B;  2WXJ A;  4G25 A;  3ZCB A;  1ELK A;  2L9B A;  3C98 A;  5G55 A;  1EYH A;  5EX3 A;  4AY6 A;  4APO A;  3CHO A;  5DIZ A;  4BFR A;  3CIA A;  2NSZ A;  2WXP A;  1P5Q A;  1IHG A;  3MKQ B;  3P2B A;  3SBS A;  5BT1 A;  5KJM A;  4ANU A;  3MYV A;  2QFC A;  2WXL A;  1U3D A;  3QAQ A;  1OUV A;  3CR3 A;  3PVL A;  2MOW A;  3U64 A;  3CQG B;  3ZHE B;  2FF4 A;  3FUF A;  4FLH A;  2AVP A;  3N71 A;  3VTX A;  3MA5 A;  3ZEF A;  2WXG A;  2VGX B;  2OOE A;  3MV3 B;  3SZ7 A;  4XI0 A;  3WXX A;  5JHA A;  5ANL A;  1QQE A;  4CGV A;  3TG4 A;  3FH7 A;  2X6F A;  4JEU A;  5EU0 A;  4L2Y A;  4EQF A;  4HOT A;  5CMW A;  4KVM A;  4ME2 A;  5LP0 A;  3SD5 A;  3L17 A;  1GW6 A;  2ION A;  3S2A A;  3DPD A;  2I1K A;  1HH8 A;  4GZC A;  1IQU A;  4BT8 A;  3PS6 A;  4X2D A;  3SE5 A;  5FZQ A;  1OWM A;  4U07 A;  3MZL B;  3Q5M A;  3APF A;  1E8Z A;  2PZI A;  4GYO A;  4DI3 A;  4RG6 A;  3CHM A;  4EBA G;  4HOU A;  2V5F A;  4U0S A;  3CLJ A;  3BG1 B;  3IKO B;  4UI9 J;  3QAR A;  4GCO A;  3NZU A;  2WMO A;  3IBE A;  3SN9 A;  4XI8 A;  4JL0 A;  4OVU A;  3UPV A;  3SBT B;  2KZT B;  1KT1 A;  2BUG A;  2V4L A;  3PZD A;  3ZVV A;  3APD A;  4XZ4 A;  5FZR A;  3LKU A;  2L6J A;  4HOQ A;  3Q4A B;  4UQX A;  2UY1 B;  3QWP A;  3LY8 A;  2VSO E;  2A4Z A;  4GA0 A;  4JPS A;  2Y3A A;  3U4T A;  3EHM A;  2AWI A;  4IYP A;  4K03 A;  4KVO A;  2YIN A;  4XI9 A;  3ZXS A;  3FTY A;  3EDT B;  3SNX A;  5CMT A;  3SHG A;  1WY6 A;  2KM4 A;  2WQ6 A;  3GZ2 A;  2OV8 A;  4DLQ A;  4XIF A;  3URZ A;  4BX8 A;  4CEM A;  2I6H A;  4JZY A;  4JVS A;  1MHQ A;  2IQC A;  3PE4 A;  4U0U A;  1H2T C;  3HHM A;  4U0Z A;  5T4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...