4U04A

Structure of a eukaryotic fic domain containing protein
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
327
structure length
315
Chain Sequence
b'RAALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenosine monophosphate-protein transferase FICD
publication title Crystal structure of the human, FIC-domain containing protein HYPE and implications for its functions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 120
structure length 315
sequence length 327
chains with identical sequence B
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 4u04A02
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u04A01
4A1SA 5FTPA 3N3UA 3CVLA 2LSVA 4G26A 5EU0A 1PC2A 5G05J 3CKCA 1KT0A 4APOA 5CMTA 5A6CA 4WNDA 3GZ1A 3ZPJA 4N2QA 4BTBA 4WNFA 1NZNA 3EDTB 3MA5A 3ASDA 3FP3A 5FZSA 4U0ZA 2FO7A 2KCVA 4N5CA 5FZRA 1OUVA 3LCAA 2G03A 1ZU2A 2HYZA 4GZ6A 3TAXA 1KLXA 5D0OD 1P5QA 1ELWA 3UQ3A 1IHGA 4I1AA 3ZHEA 4N3AA 3MKRA 5LCWJ 4XI9A 1QZ2A 4KBQA 4M16A 3U4TA 5CCLA 4PY3A 2VGXB 3ASFA 3ASHA 4I2WA 4BT8A 4HOTA 3GYZA 3LY9A 2VSNA 3U3WA 1HXIA 5G04C 3ZCBA 3K9IA 4RG9A 3RO3A 5LCWC 4JA7A 4J8EA 5ARFA 2L6JA 3LY8A 2UY1B 4KXKB 4HORA 3RJVA 3FWVA 2HR2A 4N67A 3ZN3A 4UQYA 2PQNA 3OXLA 3Q15A 3MEKA 3CEQA 4WNEA 2C0MA 2FBNA 5ARGA 4WUYA 5CCMA 3CK7A 3LETA 3QOUA 4Y6CA 4UQXA 5C1DA 2I6HA 3QWPA 5HQ8A 2KCLA 1HZ4A 5M72A 3LYAA 5CGLA 1W3BA 4CGVA 3S7DA 2UWJG 3MV3B 1B89A 3KAEA 3QDNA 3QKYA 2FEZA 4W9RA 2F6SA 4LU4A 2VGYA 2XGOA 2LNIA 2YHCA 1TJCA 5KJNA 4X2DA 1FCHA 3NF1A 3E4BA 2KCKA 2PQRA 2QFCA 1Y8MA 4BTAA 3CUCA 3PDNA 4GCOA 3SN9A 1IYGA 2XGMA 3KD7A 4JA9A 3ESKA 5JJTA 3URZA 3JYSA 4HOSA 4NRHB 4GYYA 2WQHA 4J0UA 3UUXA 4U0SA 4EQFA 2JLBA 4BT9A 4G24A 1ZBPA 2AVPA 3RU0A 2XGSA 4ME2A 2FF4A 4J8FA 4AM9A 3CV0A 5G04J 5EKQD 3LPZA 3O48A 3Q47B 3BEEA 3ZGQA 3CK8A 2Q7FA 2XEVA 2VZAA 3QWVA 2Y4TA 4XI0A 4NQ0A 5FJYA 3AS5A 4Y6WA 5HI7A 4NPSA 1KT1A 3ASGA 3ZFWA 1XNFA 2HO1A 1HH8A 4F3VA 2J9QA 3TGOA 2FI7A 3OXFA 4X2EA 2IFUA 3CKBA 3GZ2A 4X2CA 2VGXA 4JL0A 5KJLA 2YQ8A 3CVNA 2WPVA 3WXXA 4WGJA 5FT9A 4J8DA 5CHEE 3SF4A 2LSUA 3MV2B 3N71A 5DIZA 4G1TA 4GZ5A 5DBKA 2VY3A 4KYOB 4N3CA 2ONDA 5BNWA 3CVQA 5JFZA 4UI9J 1YA0A 3QWWA 5BT1A 4RG6A 3HYMB 2UY1A 2OOEA 5BW8C 4GCNA 4UI9K 3RO2A 4GYOA 3RIBA 3LY7A 4UI9C 3SHGA 3GW4A 3ZC7A 4GA2A 4H7XA 5EX0A 2NC9A 3ULQA 3FFLA 3UPVA 4HOQA 3S7FA 3OXGA 2DBAA 5FZQA 4AIFA 3S6AA 2JK8A 4N3BA 3ZHEB 5KJMA 2E2EA 2Y4UA 5JJ6A 2PL2A 3Q4AB 4ITRA 4AY5A 4AY6A 2VYIA 1E96B 2IF4A 3AS8A 5G05C 2BUGA 2R5SA 3Q49B 4LEUA 4YVOA 4GYWA 3S7JA 2KATA 4I9CA 3KS2A 4N39A 3PE3A 3R9AB 4HOUA 5JJ7A 3SE5A 1WM5A 3SZ7A 4ABNA 3AS4A 4N2SA 3ZLMA 4GA0A 2C2LA 4UQZA 4U04A 4XI8A 5CKLA 4JHRA 5EX3A 4GZ3A 1NA0A 3VTXA 5A7DB 4CGWA 3VTYA 3TG5A 3LKUA 2MHKA 3RKVA 2C0LA 1QQEA 2XPIA 4G25A 3Q5MA 3CK9A 3CVPA 4GPKA 2XCBA 5AYWD 3S7BA 2PZIA 3TG4A 2V5FA 4I2ZA 5KJKA 1NA3A 3PE4A 4YNDA 1WAO1 4U0UA 5D0QD 4B94A 4I17A 3IEGA 2VSYA 4WNGA 2XCCA 4IN3B 4GA1A 2GW1A 4BWRA 1A17A 4CDRA 1ELRA 5JFFA 4G2VA 4I9EA 4U07A 4H7YA 4YVQC 2KC7A 2P58C 2VQ2A 4O6FA 4G23A 4XIFA
chains in the Genus database with same CATH superfamily
3G2WA 5FTPA 3R9MA 1HG5A 4UWHA 1UN9A 2KM4A 4G26A 1SA5A 5CMTA 3DXMG 5A6CA 2WXJA 1O5MA 3CLJA 5CERB 3PZ4A 4N2QA 3LXUX 4U63A 5D2MC 1MX6A 4I6GA 1N52A 4TXRA 1NZNA 1EF1C 3ASDA 2CG3A 5FZSA 1DVPA 2V5QC 2OCCE 4GMLA 3ZYKA 1XGWA 2EQXA 1Z6TA 5FZRA 3CQGB 5AN8A 3SO8A 3ZYQA 5D0OD 3ML8A 1N0RA 1HFAA 1P5QA 1ELWA 4XKBA 4LSZE 3EHNA 3UXGA 3IKOB 3ULYA 1BI8B 4BSZB 5B1AE 2KBXA 3B7RL 4OAUC 4HOTA 1H6KA 2GRLA 2AXZA 4Q96A 1DCQA 1S64A 1N95A 5CEAA 5C2YA 4RG9A 5ENTD 5EYPF 1FPPA 1UJKA 4J8EA 3CSTA 5T3RA 2L6JA 3LY8A 4HORA 2V8SE 4EECA 4JC8A 3D3MA 4V3IA 1TN8A 3FWVA 1OWPA 3ZN3A 1K1AA 2PQNA 3W9FA 4EPZA 3CEQA 2P9PG 5ARGA 5AQ9A 4BX9A 4HXIA 2HM8A 4HFGA 3CK7A 1E90A 2I6HA 2XEEA 5C1DA 2KCLA 2XZTG 3D9IA 4A3VA 1W3BA 3L17A 1RZ4A 3S7DA 4CT4A 1LTXA 1TNBA 2UWJG 3QDNA 3FUNA 3ASNE 2FEZA 2L0TB 4E6HA 2F6SA 2WXHA 4GU5A 3ZUVB 4LU4A 3CVUA 3DBSA 5LX8A 2LNIA 1TJCA 4JB8P 4J8SA 1FCHA 3QC1A 3FUMA 3E4BA 4YDWA 3CUCA 3D9LA 4CEMA 3SN9A 4XZ4A 2XGMA 3KD7A 4JA9A 5JJTA 4FLBA 2EIME 3JYSA 3P1UA 2LUHA 4HVBA 4HOSA 4GAAA 1WDYA 3LDZA 2AXVA 4J0UA 4DPRA 4EQFA 5JA4D 4BT9A 4GMRA 2F37A 5BPPA 1ZBPA 2AVPA 4HI8A 3B7BA 2IEJA 4AM9A 1YCSB 1K3ZD 3CV0A 3LVRE 3D9HA 3CQCB 1V54E 3FHEA 4CDNA 3ZXSA 3DEOA 2EILE 2IY0C 3V30A 5FJYA 4HRMB 3PEUB 1H0AA 5HI7A 1DC2A 3C3QA 3FULA 3C72A 1N4RA 2LAHA 2ZU6B 5AIJA 4NPSA 4JPSA 3EIQC 2XPYA 3ZFWA 3T8MA 4O1OA 3ZVVA 2HO1A 3Q79A 2VSXE 3TGOA 2FI7A 3T9KA 2IFUA 5LOZA 5AAOA 4AVXA 5FWQA 5FQ8A 2HE0A 3L22A 2GRQB 1N4QA 3MV2B 2CFZA 4DX2A 4QFVA 4UI9J 4PDXA 4E85A 3W9GA 3UMVA 4FA6A 2L6BA 3AU5A 3Q78A 3HG0D 3SHFA 4GCNA 3RRUA 5BXOA 3BQOA 3ZYLA 4WAFA 4GYOA 3PS6A 3ABKE 3LY7A 5EIDA 3NQPA 3SHGA 5T8IA 4PUCA 4PH4B 3ML9A 4DK5A 1AWCB 5EX0A 4KZCA 3HXBA 1N4SA 5B3SE 4HOQA 3S7FA 2DBAA 3KSQA 5FZQA 4AIFA 3DSXA 4DLOA 2LXMA 3J5PA 2RFAA 4BEPA 4GTRA 2P2CP 2KXPC 5KJMA 5EDSA 5AJLA 2B0OE 2E2EA 3CHOA 4YDEA 2Y4UA 3FTUA 2JABA 3C3OA 2R02A 4AY6A 2WXOA 2BUGA 5EYLA 2R5SA 2R17C 4F6RD 4AV7A 2J08A 4LEUA 3EHMA 2X6HA 4YVOA 3S7JA 2KATA 1O1RA 4N39A 4GTPA 2VTBB 5JJ7A 4ABNA 4MS6A 2C2LA 4U04A 3MJWA 4JHRA 4K0RA 1NA0A 4NACA 5B1BE 5A7DB 4CGWA 4TXPA 3R7RA 4HRLA 2OVBA 2ZXWE 4TXQA 3LKUA 4LG6A 3RKVA 1SZ9A 4TUMA 1UOHA 4G25A 2AJAA 2P9KG 3UINC 3UM2A 5IY5E 3CHPA 2IO2C 1QBQA 5LP0A 5AYWD 1PAQA 3ESLA 3QB2A 1FVHA 3ENEA 2J09A 4GTSA 1MJ0A 2V5FA 1NA3A 4YNDA 5HKPA 4LNUD 1LF8A 5FQ7A 4U0UA 4B8CB 3IV0A 3CHMA 3CHSA 4IRUA 4B94A 3NZUA 4I17A 1L5JA 3FTZA 3S2AA 2XCCA 4EBAG 5JHBA 2WQ7A 5HRYA 3APCA 3SY2A 4CDRA 3JQ1A 1ELRA 1EDUA 5EN5D 1INZA 4F53A 3Q9NC 2EIKE 4FC8A 4I6EA 2E0IA 5AJDA 4H7YA 4ILHB 3G2UA 3G2SA 4DI4A 3E30A 3B7SA 1WG0A 2PM7A 3ONLA 1PC2A 5G05J 3TL5A 1Y6IA 2F8XK 1KT0A 3MKQA 5FQ6A 4RVBA 3E34A 4AXHA 3EIJA 3GZ1A 3ZPJA 3FUEA 1D8DA 2DYRE 4URKA 3EDTB 3FP3A 2I2OA 4AJWA 2DCPA 1X81A 2L9BA 3EU9A 2X6IA 3CHQA 3FUIA 1OUVA 3LCAA 2G03A 5AENA 3UM3A 2HYZA 4GZ6A 1YYHA 3FUHA 2WXQA 5CBNA 2DVWA 3DPDA 3UQ3A 4RLYA 1OXJA 3ZHEA 3JUEA 4N3AA 2P9UG 5LCWJ 3C98A 1QZ2A 4KBQA 5CCLA 5T4YA 2VGXB 3ASFA 3LY9A 1MQSA 1HXIA 4U8VD 4ANVA 1H6OA 1JUQA 3U64A 3K9IA 2ETCA 2XEHA 1TJFA 1HS6A 3RO3A 3MCXA 4FADA 2YNQA 2WM9A 4AEZC 3L54A 3FUJA 2WVIA 3TXMA 3ZRHA 3T5XA 2H6FA 3Q9UC 4UQYA 3FU0A 3MEKA 4WNEA 4JHKA 3NOCD 4ATZD 1SA4A 3UT4A 4L2YA 1WY6A 3LETA 4Y6CA 4OAVB 4UQXA 3ONKA 1HZ4A 4Z68A 3ISMC 1EPUA 2IOSA 4K5AB 4BX8A 4OVUA 4WWOA 3V31A 2AWIA 5KBAA 3J5QB 3FEXA 4K03A 5A23A 5KJNA 4X2DA 2ZIRA 3LEWA 4FLHA 1Y8MA 3UT8A 1V55E 4NIKA 2VSOE 3ESKA 3ABLE 4BERA 3OAWA 2WB2A 2LAIA 2XZDG 2F0YA 2GROB 4G24A 3AU4A 2CHXA 2NYJA 4LNGA 3RU0A 1HE8A 2XGSA 5JHAA 3O48A 3B13A 4I1MA 3NB2A 3PRZA 4O60A 1TN7A 4EZKA 3QARA 4XI0A 4CZ2D 3PUJA 2R03A 4Y6WA 4LUNU 1FT1A 3E33A 4K5BA 4R7LA 3ASGA 3HVEB 3BU8A 1MX4A 1XNFA 2XQ0A 2PNNA 3FUDA 3L6AA 4F3VA 2NUDA 3OXFA 4X2EA 3CIAA 3CKBA 4JEHA 2J4BA 3I5PA 2P9LG 2QC9A 4X2CA 4JL0A 4XX5A 5KJLA 1OCCE 3WXXA 2WPVA 3FTSA 3HIZA 3UKUG 4G1TA 2Y1LE 2VY3A 4KYOB 2ONDA 4U7EB 5CEDB 5JFZA 4ILGA 1MHQA 3PEVB 4RG6A 5KWDA 3HYMB 3LVQE 2V4LA 3RIBA 4QQIA 3AG2E 2BF0X 3UIPC 3ZC7A 4GA2A 4L1BA 4A63B 1SZAA 1AP7A 3BG0B 3UPVA 2VJ8A 3OXGA 3ZU7B 2WXFA 4CYMD 1X5BA 1UW4B 1NI1A 4EHMA 2FO1E 1EYHA 4N3BA 4JD2G 5ENPD 3ABME 3FU6A 4C0EA 2VYIA 1E96B 1O1TA 5G05C 3T5VA 2WXPA 1H6PA 3ZEFA 5J08A 4DUIA 1E7UA 4I9CA 3FTWA 3PE3A 4C9BB 5CBOA 3UX4A 3I3NA 3R9AB 3SE5A 3AS4A 1IKND 4AP2A 4GZ3A 2QZAA 3ZW3A 4Q94A 3RAUA 3AJIA 4GTOA 3DEPA 3TG5A 3DWLG 2DZNA 1E8WA 1UG3A 1LD7A 4DI3A 1KZPA 2ETAA 4DJAA 3CVPA 4GTVA 2A4ZA 3PNLB 5AQ7A 2X6KA 3KEZA 3UTMA 2KZTB 3AG3E 3TG4A 4APFA 1HF8A 3PZDA 4HLEA 4FU3A 4ILIA 3FH7A 2ILRA 4KVMA 1WAO1 3FTYA 4DX1A 4ANWA 5EILA 2MOWA 3JQ0A 3R7QA 4JHJA 4IN3B 3IHYA 4TRQA 2MYOA 2Y69E 2P9SG 3TWTA 1Z5SC 3RRNB 5JFFA 4G2VA 1TNYA 3UKRG 3GZSA 3KSLA 1NFIE 3MX3A 2P58C 2VQ2A 4GMJA 2WXMA 4O6FA 3SD5A 2DWZA 2WXKA 3UM1A 3HXEA 3FUFA 2YINA 2LSVA 3EU5A 2WXGA 5EU0A 3LJNA 1JWFA 4UUCA 2WXNA 5BUZA 4WNDA 2Y3AA 3JUIA 3NAWA 5BV1A 2V0PA 4WNFA 3CVWA 3TWXA 1IHBA 4L2LA 2XRZA 3U66A 4U0ZA 4UWKA 3EHRA 2KCVA 1KZOA 5ENOD 3FTXA 1ZU2A 3L9TA 3TAXA 4FULA 2EIJE 4I1OB 1DNPA 4IULA 3CVYA 1IHGA 3Q73A 4I1AA 3IXEA 4PS8A 4XI9A 5KNGA 3U4TA 3ASHA 3I4RB 4I2WA 4BT8A 2XPZA 2VSNA 5ITZF 3TWQA 3ZCBA 1FVFA 4M3OA 3DSWA 4JA7A 3JXIA 3UI2A 2OEVA 2UY1B 4U95D 2DZOA 3APDA 4U8YD 4N67A 3VLFA 4B89A 3OXLA 1IXVA 3DSSA 2QYUA 1U3DA 1H2VC 1NP7A 5H7PA 1A5EA 1MYOA 1S0PA 3X2QE 5CCMA 3QWPA 1QNFA 5HQ8A 2WQ6A 5M72A 5CGLA 3EUVA 2H6HA 4BETA 2J07A 5D66A 1B89A 3V2OA 3QKYA 4UWFA 1S63A 5ENNA 1N4PA 2VGYA 2XGOA 1U3CA 2H6IA 3SBTB 3L13A 2XRYA 3NF1A 3I4GA 2CHWA 2NXPA 2QFCA 1OWNA 2WMNA 2RG8A 4BTAA 4GCOA 2XHEA 1IYGA 3U9WA 1SQMA 2R59A 5E76A 4KVOA 1RW2A 3Q7AA 3O4ZA 4NRHB 5FINA 3SBSA 1E8XA 3UUXA 4U0SA 3MZLB 4BY6A 3DRAA 2JLBA 4ME2A 2FF4A 4J8FA 2I1JA 5EKQD 5G04J 3LPZA 3VLDA 3Q47B 3D9PA 1UJJA 2Y0BG 3BEEA 3ZGQA 5KNHD 2Q7FA 3QWVA 2Y4TA 4PS3A 1S70B 2OV8A 4NQ0A 2WXLA 4ZFHA 2BKGA 2MRIA 4ANXA 3D9NA 3HXCA 1JWGA 5CMWA 2DYSE 4KT6B 4XKCA 4U96D 2XS1A 1JCRA 3JXJA 4GTMA 3MGBA 1HH8A 4IYPA 2J9QA 3CVXA 2RFMA 3GZ2A 2GRMA 1N11A 3UIOC 2VGXA 2YQ8A 3CVNA 4HBDA 4BESA 1U2VG 5CHEE 3SF4A 1QYMA 2LSUA 5BV0A 3ASOE 1OCOE 2XS8A 3CVQA 2ZISA 3QWWA 3RSEG 5BT1A 1TYQG 3Q75A 4GB9A 3QNKA 5LFAA 4UI9K 1ZB1A 3RO2A 2IONA 1IQRA 3FU3A 4UI9C 3PNTB 3HRAA 1N9AA 1DCEA 4H7XA 1NH1A 2NC9A 3FFLA 3NOGD 4A3TA 4XE0A 4P29A 4TUUA 4HQDA 4TV3A 1D9SA 3UT7A 3PZ2A 4D10C 4L9PA 2JK8A 1OT8A 5KCMA 3ZNGA 3B7UX 1IQUA 2PL2A 2J49A 5FQ4A 3D9KA 4EZJA 4GYWA 3KS2A 5BXUA 1OWOA 2R2LA 3DPYA 4O1PA 4N2SA 3ZLMA 4GA0A 4UQZA 1Z3XA 4X8QA 5CKLA 4XI8A 4BSXA 1SW6A 5EX3A 4FJYA 3VTXA 1BU9A 1NL4A 3TWVA 5E75A 1JPLA 1K8KG 5ENSD 3L82A 4HNAD 2MHKA 1OWMA 2IU1A 1D8EA 3FTVA 3TWWA 2OVFA 1QQEA 3LS8A 3CK9A 1TNZA 5FIOA 4I6JA 4GPKA 4JVSA 2XCBA 4I2ZA 4B0ZA 5AQAA 5ENRD 5EIBE 1TNUA 2F8YA 4MRUA 3DSTA 4BFRA 3HVEA 2VSYA 4WNGA 4HLLA 1BD8A 4GA1A 2GW1A 4JXTA 4BWRA 3D9JA 1JCSA 4MKTA 2YHEA 2RKKA 4ZHBA 3AAAC 4WWPA 4CT0A 4U07A 3SFYA 4L7TA 3SFXA 3FH8A 2KC7A 4EZLA 4XIFA 4A1SA 3N3UA 3CVLA 1OCRE 1FT2A 3CKCA 3QJZA 3G2VA 4APOA 2VGEA 2CG2A 3Q7FA 3AG4E 4HRNA 4BTBA 3TWUA 2WXIA 3TJPA 2P9IG 5ENQD 3TWSA 2B6CA 3MA5A 2IO3C 1TR4A 3CGHA 3HXDA 3NBNB 3BG1B 1ELKA 4FHKA 4OVVA 1HX8A 2NSZA 2FO7A 4N5CA 3OTNA 4G8LA 2IJGX 1SVXA 3C3RA 3UM0A 4U8HA 1KLXA 2I9CA 3PZ3A 3HDXA 3SQVA 2BEDA 3P2BA 4YDYA 1PY1A 2GRNB 3MKRA 5J90A 4DX5D 4M16A 4PY3A 3DXKG 2ZGGA 4ATGA 3GYZA 3PVLA 3U3WA 5G04C 2GRRB 4UWGA 2CFUA 1HU3A 3EHQA 2QY7A 5LCWC 1OY3D 5ARFA 4AOFA 4KXKB 5CRVA 1HO8A 3RJVA 4F1SA 2HR2A 4GTTA 3D9MA 3APFA 4EBAA 2OEWA 3Q15A 2DIWA 2X3MA 5AARA 2C0MA 1H2UA 2FBNA 4LERA 5ANRA 2GRPB 2GGFA 2J8SD 4WUYA 4C48B 4Q69A 3V79K 2LO6A 4A55A 3DSUA 3IBEA 3QOUA 3AG1E 1Q2ZA 4JZYA 3LYAA 1K1BA 3TXNA 2A5EA 4CGVA 3LJ3A 1VDYA 3MV3B 2KZTA 4L23A 3KAEA 1TN6A 1E8YA 2J4DA 1Z3YA 4W9RA 3FUKA 1TEZA 1JCQA 5JMND 2YHCA 3SGHA 2CHZA 4B8AA 2KCKA 5CRUA 3T8KA 2PQRA 3DSVA 3D9OA 4A1GA 4LRZA 3PDNA 1TNOA 3B95A 3ULEG 3URZA 1H2TC 2I1KA 4YDOA 4GYYA 2WQHA 4J7WA 3V2XA 1YMPA 2WMOA 4ACKA 4ACLA 2X38A 4M7CA 4GZDA 4HI9A 2R05A 2ETBA 4GTQA 4NURA 4ANUA 3CK8A 2M63A 2XEVA 1BPOA 2VZAA 4HB5A 4HS2A 4JEUA 3AS5A 3SI5A 3PH0C 3FU5A 2BKKB 4CRWA 2VTBA 1KT1A 1E8ZA 1E7VA 4N5QA 5G2NA 3PUKA 3NZSA 3ZYMA 2A5UA 4I43A 1KPSB 1MZCA 3F6QA 5ANLA 4WGJA 5FT9A 4J8DA 2P9NG 3N71A 5DIZA 4GZ5A 5DBKA 4N3CA 2L0IA 2ZGDA 5BNWA 1YA0A 3PREA 3IHVA 4CCAA 3JCKC 2JEKA 2UY1A 3TWRA 4RSYA 2OOEA 3MKQB 5AQBA 5BW8C 3RRMB 1UN8A 2AW6A 4KMOA 2NUNA 2V4HC 4FHJA 3C5RA 3FY4A 3CSFA 4DX7D 4LNBA 3GW4A 3SNXA 3B7TA 4DLQA 3QAQA 1N54A 2LXLA 1G3NB 2FULA 3PZ1A 3ULQA 3ZIMA 3ZKJA 4CDMA 1MX2A 4DRXE 4F7AA 3KEAA 2IOLA 2XENA 3S6AA 2IQCA 3ZHEB 3G2TA 5JJ6A 3Q4AB 4ITRA 1OCZE 4K5CA 4AY5A 4DX6D 1N0QA 2IF4A 3AS8A 2AXUA 1BLXB 4J8YA 2X6FA 3Q49B 3L08A 3WG7E 4B93B 2RD0A 3CR3A 1GW6A 2PM6A 4G8KA 1BI7B 4HOUA 3E37A 1WM5A 3SZ7A 4FJZA 1N94A 2WXRA 1H19A 3CHRA 4JW1A 3BUAA 3VTYA 3L16A 4GPMA 3ZXPA 2C0LA 2XPIA 3Q5MA 4MBGA 4G11A 5HS0A 3QK0A 2BTDA 3S7BA 2PZIA 1OWLA 4KZ0A 3CVVA 5KJKA 3PE4A 2EINE 3RK6A 4GZCA 4UWLA 5D0QD 4WWNA 4RQIA 4F1PA 3HHMA 4LCTA 4MLPA 3IEGA 3SFZA 2QYJA 1LD8A 4C0MA 4PS7A 3VLEA 3FH5A 5G55A 1A17A 4XEIG 4OYSA 2X6JA 4I9EA 5CMYA 4J6IA 1HG2A 3FDHA 4YVQC 1O1SA 3E32A 3FEYA 3HXFA 3MYVA 5CECB 4FP7A 3EJNA 2H6GA 4G23A
chains in the Genus database with same CATH topology
3SD5A 3G2WA 4A1SA 2WXKA 5FTPA 3N3UA 3CVLA 2PM7A 1HG5A 3FUFA 1UN9A 2YINA 2KM4A 2LSVA 4UWHA 3ONLA 2WXGA 5EU0A 1PC2A 4G26A 5G05J 3TL5A 1Y6IA 3CKCA 3QJZA 1JWFA 1KT0A 3G2VA 4APOA 3MKQA 5CMTA 5FQ6A 4RVBA 2WXNA 5A6CA 2WXJA 5BUZA 3CLJA 4WNDA 2Y3AA 3EIJA 3GZ1A 3JUIA 3ZPJA 4AXHA 2CG2A 3FUEA 4N2QA 3LXUX 4U63A 5BV1A 4BTBA 4I6GA 2V0PA 1N52A 2WXIA 4WNFA 3CVWA 3TJPA 4URKA 1NZNA 3EDTB 1EF1C 3MA5A 3ASDA 3FP3A 2I2OA 3CGHA 2CG3A 4L2LA 1DVPA 5FZSA 4GMLA 4AJWA 2XRZA 2DCPA 1ELKA 4U0ZA 3BG1B 4FHKA 2L9BA 4UWKA 4OVVA 3ZYKA 3U66A 1HX8A 1XGWA 2FO7A 2KCVA 2NSZA 2X6IA 2EQXA 3CHQA 3OTNA 4N5CA 1Z6TA 3FUIA 5FZRA 1OUVA 3CQGB 3LCAA 2G03A 5AENA 2IJGX 3FTXA 1ZU2A 2HYZA 4GZ6A 4U8HA 3TAXA 4FULA 1KLXA 3ZYQA 3FUHA 2WXQA 5D0OD 3ML8A 2I9CA 1HFAA 1P5QA 1ELWA 4I1OB 4XKBA 1DNPA 3DPDA 3HDXA 3UQ3A 3EHNA 4IULA 3CVYA 1IHGA 3IKOB 3P2BA 4I1AA 1PY1A 3ZHEA 4N3AA 3MKRA 5J90A 4PS8A 5LCWJ 4XI9A 3C98A 1QZ2A 3B7RL 4M16A 4KBQA 5T4YA 3U4TA 5CCLA 4PY3A 2VGXB 3ASFA 3ASHA 3I4RB 4I2WA 4BT8A 4HOTA 1H6KA 3GYZA 4ATGA 2GRLA 2XPZA 2VSNA 3LY9A 3PVLA 2AXZA 3U3WA 1MQSA 4Q96A 1HXIA 4ANVA 5G04C 1JUQA 4UWGA 3ZCBA 1FVFA 5C2YA 3U64A 3K9IA 2CFUA 1HU3A 1TJFA 4RG9A 4M3OA 1HS6A 2QY7A 3RO3A 5LCWC 4JA7A 3MCXA 1UJKA 4FADA 4J8EA 5ARFA 3CSTA 5T3RA 2L6JA 2YNQA 2WM9A 4AEZC 4AOFA 3L54A 3LY8A 2UY1B 4KXKB 3FUJA 2WVIA 4HORA 2V8SE 3TXMA 4EECA 1HO8A 4JC8A 3T5XA 3D3MA 4V3IA 3ZRHA 3RJVA 3FWVA 3APDA 4F1SA 1OWPA 4XIFA 2HR2A 4N67A 3VLFA 3ZN3A 4UQYA 4B89A 3D9MA 3APFA 2PQNA 3FU0A 3OXLA 4EBAA 3Q15A 3MEKA 2DIWA 2X3MA 3CEQA 1U3DA 4WNEA 4EPZA 2C0MA 1H2UA 1H2VC 2FBNA 4JHKA 4LERA 5ANRA 5ARGA 1NP7A 2GGFA 4Q69A 4WUYA 3UT4A 4L2YA 1S0PA 1WY6A 2LO6A 4A55A 4BX9A 4HXIA 3IBEA 2HM8A 5CCMA 4HFGA 3CK7A 3LETA 3QOUA 4Y6CA 4UQXA 1E90A 2I6HA 5C1DA 3QWPA 1QNFA 3ONKA 5HQ8A 2KCLA 2WQ6A 1HZ4A 5M72A 4JZYA 3D9IA 3LYAA 5CGLA 1EPUA 1W3BA 4A3VA 3TXNA 3L17A 4CGVA 3S7DA 4CT4A 2UWJG 3LJ3A 2IOSA 1VDYA 3MV3B 2KZTA 4L23A 4BX8A 2J07A 4OVUA 4WWOA 1B89A 3KAEA 3QDNA 2AWIA 3FUNA 3QKYA 1E8YA 2FEZA 2L0TB 2J4DA 4E6HA 1Z3YA 4UWFA 4W9RA 3FUKA 2F6SA 2WXHA 1TEZA 4GU5A 5ENNA 4LU4A 2VGYA 2XGOA 3CVUA 1U3CA 3DBSA 3FEXA 4K03A 5LX8A 2LNIA 2YHCA 3SBTB 1TJCA 2CHZA 3SGHA 5A23A 4B8AA 5KJNA 4J8SA 4X2DA 1FCHA 3L13A 3QC1A 2XRYA 3FUMA 4FLHA 3LEWA 3E4BA 2KCKA 3NF1A 3I4GA 2CHWA 2PQRA 2QFCA 2NXPA 1Y8MA 3D9OA 3UT8A 4A1GA 1OWNA 2WMNA 3CUCA 2RG8A 3D9LA 4LRZA 4BTAA 4CEMA 3PDNA 4GCOA 3SN9A 2VSOE 2XHEA 4XZ4A 1IYGA 2XGMA 3KD7A 4JA9A 3U9WA 1SQMA 3ESKA 2R59A 5E76A 5JJTA 4FLBA 3URZA 3JYSA 3P1UA 4HVBA 4KVOA 1H2TC 4HOSA 3OAWA 4GAAA 3LDZA 3O4ZA 2I1KA 4NRHB 4GYYA 2AXVA 2WB2A 2WQHA 4J0UA 3SBSA 1E8XA 3UUXA 4DPRA 4U0SA 3MZLB 2LAIA 4BY6A 4EQFA 2WMOA 2JLBA 4BT9A 4ACKA 5BPPA 4G24A 3AU4A 1ZBPA 4ACLA 2CHXA 2AVPA 2X38A 3RU0A 1HE8A 4GZDA 2XGSA 4ME2A 2FF4A 5JHAA 4J8FA 2I1JA 4AM9A 3CV0A 5EKQD 5G04J 3LVRE 3LPZA 3O48A 4NURA 3B13A 4I1MA 3VLDA 4ANUA 3Q47B 3D9PA 1UJJA 3CQCB 3BEEA 3PRZA 3ZGQA 3CK8A 2M63A 2Q7FA 3FHEA 4CDNA 2XEVA 1BPOA 3ZXSA 2VZAA 3QWVA 2Y4TA 3QARA 2OV8A 4PS3A 4XI0A 4EZKA 4NQ0A 2WXLA 4HS2A 5FJYA 3PUJA 4JEUA 3AS5A 3PEUB 4Y6WA 3SI5A 1H0AA 5HI7A 4LUNU 3PH0C 3FU5A 3FULA 2MRIA 2LAHA 2ZU6B 4ANXA 4CRWA 5AIJA 3D9NA 2VTBA 4NPSA 1JWGA 1KT1A 1E8ZA 5CMWA 4KT6B 4XKCA 1E7VA 4R7LA 4JPSA 3EIQC 3ASGA 2XPYA 3HVEB 5G2NA 3ZFWA 1XNFA 3PUKA 3NZSA 3T8MA 2XQ0A 3ZVVA 3ZYMA 2HO1A 2A5UA 4I43A 3FUDA 1HH8A 3L6AA 3MGBA 4F3VA 4IYPA 2VSXE 2J9QA 3TGOA 3CVXA 2FI7A 3OXFA 4X2EA 2IFUA 3CIAA 3CKBA 2GRMA 3GZ2A 4JEHA 5LOZA 2J4BA 3I5PA 5FWQA 4AVXA 5FQ8A 4X2CA 2VGXA 4JL0A 4XX5A 5KJLA 2YQ8A 3CVNA 2WPVA 3L22A 3WXXA 5ANLA 4WGJA 5FT9A 3FTSA 4J8DA 3HIZA 5CHEE 3SF4A 2LSUA 5BV0A 3MV2B 2CFZA 3N71A 5DIZA 4G1TA 4QFVA 4GZ5A 5DBKA 2VY3A 4KYOB 4N3CA 2ONDA 2L0IA 5BNWA 3CVQA 5JFZA 4UI9J 4PDXA 4E85A 4ILGA 1YA0A 3QWWA 1MHQA 3PEVB 4RG6A 5BT1A 3PREA 3IHVA 3HYMB 4CCAA 3JCKC 3LVQE 2JEKA 2UY1A 3UMVA 4GB9A 3AU5A 4RSYA 4FA6A 2OOEA 3MKQB 3QNKA 5BW8C 3RRMB 3SHFA 5LFAA 4GCNA 2V4LA 4UI9K 3RRUA 3ZYLA 4WAFA 3RO2A 1UN8A 2AW6A 4GYOA 3RIBA 4KMOA 3PS6A 2IONA 2BF0X 1IQRA 3FU3A 3LY7A 4UI9C 4FHJA 3FY4A 3CSFA 3NQPA 3SHGA 3PNTB 3SNXA 3GW4A 5T8IA 4PUCA 4PH4B 3ZC7A 3B7TA 3ML9A 4GA2A 4DLQA 4DK5A 3QAQA 4GMJA 1N54A 4L1BA 4H7XA 1SZAA 5EX0A 2NC9A 2FULA 3ULQA 3FFLA 4KZCA 4A3TA 4XE0A 3BG0B 4P29A 3ZIMA 3UPVA 4TUUA 4HOQA 2VJ8A 4CDMA 3S7FA 3OXGA 2DBAA 4F7AA 5FZQA 4AIFA 4TV3A 4DLOA 2WXFA 3UT7A 1X5BA 1UW4B 4D10C 2IOLA 3S6AA 1EYHA 2IQCA 2JK8A 4N3BA 3ZHEB 5KJMA 5EDSA 5AJLA 3FU6A 2E2EA 3CHOA 5KCMA 3G2TA 2Y4UA 5JJ6A 3B7UX 1IQUA 2PL2A 3FTUA 2J49A 3Q4AB 4ITRA 4C0EA 4AY5A 5FQ4A 2VYIA 4AY6A 1E96B 2IF4A 2WXOA 2AXUA 3AS8A 2BUGA 3D9KA 5G05C 2R5SA 2R17C 2X6FA 2WXPA 3Q49B 3T5VA 4AV7A 3L08A 4EZJA 2J08A 2RD0A 3CR3A 3EHMA 4LEUA 1GW6A 2X6HA 4GYWA 4YVOA 3ZEFA 5J08A 2PM6A 1E7UA 3S7JA 2KATA 4I9CA 3KS2A 3FTWA 4N39A 3PE3A 4C9BB 2VTBB 3UX4A 3I3NA 1OWOA 3R9AB 4HOUA 5JJ7A 3SE5A 1WM5A 3SZ7A 4ABNA 4MS6A 3AS4A 4N2SA 3ZLMA 4FJZA 4GA0A 2C2LA 4UQZA 1Z3XA 4U04A 4XI8A 5CKLA 3MJWA 4JHRA 4K0RA 4AP2A 5EX3A 4BSXA 4GZ3A 1NA0A 3ZW3A 4NACA 2WXRA 4Q94A 4FJYA 1H19A 3VTXA 5A7DB 4CGWA 3CHRA 3R7RA 4JW1A 5E75A 1JPLA 3VTYA 3TG5A 3L16A 2OVBA 3LKUA 2MHKA 3RKVA 1OWMA 2IU1A 3FTVA 1E8WA 1SZ9A 1UG3A 2C0LA 2OVFA 1QQEA 4DI3A 2XPIA 4G25A 3Q5MA 3LS8A 3CK9A 3CHPA 4G11A 3QK0A 4DJAA 3CVPA 4I6JA 5LP0A 2A4ZA 4GPKA 4JVSA 2XCBA 5AYWD 3PNLB 2BTDA 2X6KA 1PAQA 3ESLA 3KEZA 3S7BA 3QB2A 1FVHA 2KZTB 2PZIA 2J09A 3ENEA 3TG4A 4APFA 1HF8A 3PZDA 4HLEA 1OWLA 2V5FA 4I2ZA 4KZ0A 3CVVA 4B0ZA 4FU3A 5KJKA 1NA3A 3PE4A 4ILIA 4YNDA 3FH7A 2ILRA 1LF8A 4KVMA 1WAO1 5FQ7A 4U0UA 3FTYA 3RK6A 4MRUA 4B8CB 4GZCA 4UWLA 3IV0A 3CHMA 5D0QD 4WWNA 3CHSA 4ANWA 4IRUA 4B94A 4BFRA 3NZUA 4I17A 3HHMA 2MOWA 3JQ0A 4LCTA 4MLPA 1L5JA 3FTZA 3HVEA 3IEGA 3SFZA 2VSYA 4WNGA 2XCCA 4JHJA 3R7QA 4IN3B 3S2AA 4EBAG 4C0MA 3IHYA 5JHBA 2WQ7A 4GA1A 2GW1A 4TRQA 4PS7A 4JXTA 3VLEA 4BWRA 3D9JA 3FH5A 5G55A 3APCA 1A17A 4CDRA 3JQ1A 1ELRA 1EDUA 4MKTA 3RRNB 5JFFA 4G2VA 2YHEA 1INZA 4F53A 4FC8A 2X6JA 4I9EA 4OYSA 4WWPA 5CMYA 4CT0A 4I6EA 4U07A 2E0IA 5AJDA 4J6IA 3GZSA 1HG2A 3FDHA 4H7YA 4L7TA 4ILHB 4YVQC 3FEYA 3G2UA 3G2SA 4DI4A 3MYVA 3MX3A 4FP7A 3FH8A 2KC7A 2P58C 3EJNA 2VQ2A 2WXMA 4EZLA 4O6FA 4G23A 3B7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A1S A;  5FTP A;  3N3U A;  3CVL A;  2LSV A;  4G26 A;  5EU0 A;  1PC2 A;  5G05 J;  3CKC A;  1KT0 A;  4APO A;  5CMT A;  5A6C A;  4WND A;  3GZ1 A;  3ZPJ A;  4N2Q A;  4BTB A;  4WNF A;  1NZN A;  3EDT B;  3MA5 A;  3ASD A;  3FP3 A;  5FZS A;  4U0Z A;  2FO7 A;  2KCV A;  4N5C A;  5FZR A;  1OUV A;  3LCA A;  2G03 A;  1ZU2 A;  2HYZ A;  4GZ6 A;  3TAX A;  1KLX A;  5D0O D;  1P5Q A;  1ELW A;  3UQ3 A;  1IHG A;  4I1A A;  3ZHE A;  4N3A A;  3MKR A;  5LCW J;  4XI9 A;  1QZ2 A;  4KBQ A;  4M16 A;  3U4T A;  5CCL A;  4PY3 A;  2VGX B;  3ASF A;  3ASH A;  4I2W A;  4BT8 A;  4HOT A;  3GYZ A;  3LY9 A;  2VSN A;  3U3W A;  1HXI A;  5G04 C;  3ZCB A;  3K9I A;  4RG9 A;  3RO3 A;  5LCW C;  4JA7 A;  4J8E A;  5ARF A;  2L6J A;  3LY8 A;  2UY1 B;  4KXK B;  4HOR A;  3RJV A;  3FWV A;  2HR2 A;  4N67 A;  3ZN3 A;  4UQY A;  2PQN A;  3OXL A;  3Q15 A;  3MEK A;  3CEQ A;  4WNE A;  2C0M A;  2FBN A;  5ARG A;  4WUY A;  5CCM A;  3CK7 A;  3LET A;  3QOU A;  4Y6C A;  4UQX A;  5C1D A;  2I6H A;  3QWP A;  5HQ8 A;  2KCL A;  1HZ4 A;  5M72 A;  3LYA A;  5CGL A;  1W3B A;  4CGV A;  3S7D A;  2UWJ G;  3MV3 B;  1B89 A;  3KAE A;  3QDN A;  3QKY A;  2FEZ A;  4W9R A;  2F6S A;  4LU4 A;  2VGY A;  2XGO A;  2LNI A;  2YHC A;  1TJC A;  5KJN A;  4X2D A;  1FCH A;  3NF1 A;  3E4B A;  2KCK A;  2PQR A;  2QFC A;  1Y8M A;  4BTA A;  3CUC A;  3PDN A;  4GCO A;  3SN9 A;  1IYG A;  2XGM A;  3KD7 A;  4JA9 A;  3ESK A;  5JJT A;  3URZ A;  3JYS A;  4HOS A;  4NRH B;  4GYY A;  2WQH A;  4J0U A;  3UUX A;  4U0S A;  4EQF A;  2JLB A;  4BT9 A;  4G24 A;  1ZBP A;  2AVP A;  3RU0 A;  2XGS A;  4ME2 A;  2FF4 A;  4J8F A;  4AM9 A;  3CV0 A;  5G04 J;  5EKQ D;  3LPZ A;  3O48 A;  3Q47 B;  3BEE A;  3ZGQ A;  3CK8 A;  2Q7F A;  2XEV A;  2VZA A;  3QWV A;  2Y4T A;  4XI0 A;  4NQ0 A;  5FJY A;  3AS5 A;  4Y6W A;  5HI7 A;  4NPS A;  1KT1 A;  3ASG A;  3ZFW A;  1XNF A;  2HO1 A;  1HH8 A;  4F3V A;  2J9Q A;  3TGO A;  2FI7 A;  3OXF A;  4X2E A;  2IFU A;  3CKB A;  3GZ2 A;  4X2C A;  2VGX A;  4JL0 A;  5KJL A;  2YQ8 A;  3CVN A;  2WPV A;  3WXX A;  4WGJ A;  5FT9 A;  4J8D A;  5CHE E;  3SF4 A;  2LSU A;  3MV2 B;  3N71 A;  5DIZ A;  4G1T A;  4GZ5 A;  5DBK A;  2VY3 A;  4KYO B;  4N3C A;  2OND A;  5BNW A;  3CVQ A;  5JFZ A;  4UI9 J;  1YA0 A;  3QWW A;  5BT1 A;  4RG6 A;  3HYM B;  2UY1 A;  2OOE A;  5BW8 C;  4GCN A;  4UI9 K;  3RO2 A;  4GYO A;  3RIB A;  3LY7 A;  4UI9 C;  3SHG A;  3GW4 A;  3ZC7 A;  4GA2 A;  4H7X A;  5EX0 A;  2NC9 A;  3ULQ A;  3FFL A;  3UPV A;  4HOQ A;  3S7F A;  3OXG A;  2DBA A;  5FZQ A;  4AIF A;  3S6A A;  2JK8 A;  4N3B A;  3ZHE B;  5KJM A;  2E2E A;  2Y4U A;  5JJ6 A;  2PL2 A;  3Q4A B;  4ITR A;  4AY5 A;  4AY6 A;  2VYI A;  1E96 B;  2IF4 A;  3AS8 A;  5G05 C;  2BUG A;  2R5S A;  3Q49 B;  4LEU A;  4YVO A;  4GYW A;  3S7J A;  2KAT A;  4I9C A;  3KS2 A;  4N39 A;  3PE3 A;  3R9A B;  4HOU A;  5JJ7 A;  3SE5 A;  1WM5 A;  3SZ7 A;  4ABN A;  3AS4 A;  4N2S A;  3ZLM A;  4GA0 A;  2C2L A;  4UQZ A;  4U04 A;  4XI8 A;  5CKL A;  4JHR A;  5EX3 A;  4GZ3 A;  1NA0 A;  3VTX A;  5A7D B;  4CGW A;  3VTY A;  3TG5 A;  3LKU A;  2MHK A;  3RKV A;  2C0L A;  1QQE A;  2XPI A;  4G25 A;  3Q5M A;  3CK9 A;  3CVP A;  4GPK A;  2XCB A;  5AYW D;  3S7B A;  2PZI A;  3TG4 A;  2V5F A;  4I2Z A;  5KJK A;  1NA3 A;  3PE4 A;  4YND A;  1WAO 1;  4U0U A;  5D0Q D;  4B94 A;  4I17 A;  3IEG A;  2VSY A;  4WNG A;  2XCC A;  4IN3 B;  4GA1 A;  2GW1 A;  4BWR A;  1A17 A;  4CDR A;  1ELR A;  5JFF A;  4G2V A;  4I9E A;  4U07 A;  4H7Y A;  4YVQ C;  2KC7 A;  2P58 C;  2VQ2 A;  4O6F A;  4G23 A;  4XIF A; 
#chains in the Genus database with same CATH topology
 3G2W A;  5FTP A;  3R9M A;  1HG5 A;  4UWH A;  1UN9 A;  2KM4 A;  4G26 A;  1SA5 A;  5CMT A;  3DXM G;  5A6C A;  2WXJ A;  1O5M A;  3CLJ A;  5CER B;  3PZ4 A;  4N2Q A;  3LXU X;  4U63 A;  5D2M C;  1MX6 A;  4I6G A;  1N52 A;  4TXR A;  1NZN A;  1EF1 C;  3ASD A;  2CG3 A;  5FZS A;  1DVP A;  2V5Q C;  2OCC E;  4GML A;  3ZYK A;  1XGW A;  2EQX A;  1Z6T A;  5FZR A;  3CQG B;  5AN8 A;  3SO8 A;  3ZYQ A;  5D0O D;  3ML8 A;  1N0R A;  1HFA A;  1P5Q A;  1ELW A;  4XKB A;  4LSZ E;  3EHN A;  3UXG A;  3IKO B;  3ULY A;  1BI8 B;  4BSZ B;  5B1A E;  2KBX A;  3B7R L;  4OAU C;  4HOT A;  1H6K A;  2GRL A;  2AXZ A;  4Q96 A;  1DCQ A;  1S64 A;  1N95 A;  5CEA A;  5C2Y A;  4RG9 A;  5ENT D;  5EYP F;  1FPP A;  1UJK A;  4J8E A;  3CST A;  5T3R A;  2L6J A;  3LY8 A;  4HOR A;  2V8S E;  4EEC A;  4JC8 A;  3D3M A;  4V3I A;  1TN8 A;  3FWV A;  1OWP A;  3ZN3 A;  1K1A A;  2PQN A;  3W9F A;  4EPZ A;  3CEQ A;  2P9P G;  5ARG A;  5AQ9 A;  4BX9 A;  4HXI A;  2HM8 A;  4HFG A;  3CK7 A;  1E90 A;  2I6H A;  2XEE A;  5C1D A;  2KCL A;  2XZT G;  3D9I A;  4A3V A;  1W3B A;  3L17 A;  1RZ4 A;  3S7D A;  4CT4 A;  1LTX A;  1TNB A;  2UWJ G;  3QDN A;  3FUN A;  3ASN E;  2FEZ A;  2L0T B;  4E6H A;  2F6S A;  2WXH A;  4GU5 A;  3ZUV B;  4LU4 A;  3CVU A;  3DBS A;  5LX8 A;  2LNI A;  1TJC A;  4JB8 P;  4J8S A;  1FCH A;  3QC1 A;  3FUM A;  3E4B A;  4YDW A;  3CUC A;  3D9L A;  4CEM A;  3SN9 A;  4XZ4 A;  2XGM A;  3KD7 A;  4JA9 A;  5JJT A;  4FLB A;  2EIM E;  3JYS A;  3P1U A;  2LUH A;  4HVB A;  4HOS A;  4GAA A;  1WDY A;  3LDZ A;  2AXV A;  4J0U A;  4DPR A;  4EQF A;  5JA4 D;  4BT9 A;  4GMR A;  2F37 A;  5BPP A;  1ZBP A;  2AVP A;  4HI8 A;  3B7B A;  2IEJ A;  4AM9 A;  1YCS B;  1K3Z D;  3CV0 A;  3LVR E;  3D9H A;  3CQC B;  1V54 E;  3FHE A;  4CDN A;  3ZXS A;  3DEO A;  2EIL E;  2IY0 C;  3V30 A;  5FJY A;  4HRM B;  3PEU B;  1H0A A;  5HI7 A;  1DC2 A;  3C3Q A;  3FUL A;  3C72 A;  1N4R A;  2LAH A;  2ZU6 B;  5AIJ A;  4NPS A;  4JPS A;  3EIQ C;  2XPY A;  3ZFW A;  3T8M A;  4O1O A;  3ZVV A;  2HO1 A;  3Q79 A;  2VSX E;  3TGO A;  2FI7 A;  3T9K A;  2IFU A;  5LOZ A;  5AAO A;  4AVX A;  5FWQ A;  5FQ8 A;  2HE0 A;  3L22 A;  2GRQ B;  1N4Q A;  3MV2 B;  2CFZ A;  4DX2 A;  4QFV A;  4UI9 J;  4PDX A;  4E85 A;  3W9G A;  3UMV A;  4FA6 A;  2L6B A;  3AU5 A;  3Q78 A;  3HG0 D;  3SHF A;  4GCN A;  3RRU A;  5BXO A;  3BQO A;  3ZYL A;  4WAF A;  4GYO A;  3PS6 A;  3ABK E;  3LY7 A;  5EID A;  3NQP A;  3SHG A;  5T8I A;  4PUC A;  4PH4 B;  3ML9 A;  4DK5 A;  1AWC B;  5EX0 A;  4KZC A;  3HXB A;  1N4S A;  5B3S E;  4HOQ A;  3S7F A;  2DBA A;  3KSQ A;  5FZQ A;  4AIF A;  3DSX A;  4DLO A;  2LXM A;  3J5P A;  2RFA A;  4BEP A;  4GTR A;  2P2C P;  2KXP C;  5KJM A;  5EDS A;  5AJL A;  2B0O E;  2E2E A;  3CHO A;  4YDE A;  2Y4U A;  3FTU A;  2JAB A;  3C3O A;  2R02 A;  4AY6 A;  2WXO A;  2BUG A;  5EYL A;  2R5S A;  2R17 C;  4F6R D;  4AV7 A;  2J08 A;  4LEU A;  3EHM A;  2X6H A;  4YVO A;  3S7J A;  2KAT A;  1O1R A;  4N39 A;  4GTP A;  2VTB B;  5JJ7 A;  4ABN A;  4MS6 A;  2C2L A;  4U04 A;  3MJW A;  4JHR A;  4K0R A;  1NA0 A;  4NAC A;  5B1B E;  5A7D B;  4CGW A;  4TXP A;  3R7R A;  4HRL A;  2OVB A;  2ZXW E;  4TXQ A;  3LKU A;  4LG6 A;  3RKV A;  1SZ9 A;  4TUM A;  1UOH A;  4G25 A;  2AJA A;  2P9K G;  3UIN C;  3UM2 A;  5IY5 E;  3CHP A;  2IO2 C;  1QBQ A;  5LP0 A;  5AYW D;  1PAQ A;  3ESL A;  3QB2 A;  1FVH A;  3ENE A;  2J09 A;  4GTS A;  1MJ0 A;  2V5F A;  1NA3 A;  4YND A;  5HKP A;  4LNU D;  1LF8 A;  5FQ7 A;  4U0U A;  4B8C B;  3IV0 A;  3CHM A;  3CHS A;  4IRU A;  4B94 A;  3NZU A;  4I17 A;  1L5J A;  3FTZ A;  3S2A A;  2XCC A;  4EBA G;  5JHB A;  2WQ7 A;  5HRY A;  3APC A;  3SY2 A;  4CDR A;  3JQ1 A;  1ELR A;  1EDU A;  5EN5 D;  1INZ A;  4F53 A;  3Q9N C;  2EIK E;  4FC8 A;  4I6E A;  2E0I A;  5AJD A;  4H7Y A;  4ILH B;  3G2U A;  3G2S A;  4DI4 A;  3E30 A;  3B7S A;  1WG0 A;  2PM7 A;  3ONL A;  1PC2 A;  5G05 J;  3TL5 A;  1Y6I A;  2F8X K;  1KT0 A;  3MKQ A;  5FQ6 A;  4RVB A;  3E34 A;  4AXH A;  3EIJ A;  3GZ1 A;  3ZPJ A;  3FUE A;  1D8D A;  2DYR E;  4URK A;  3EDT B;  3FP3 A;  2I2O A;  4AJW A;  2DCP A;  1X81 A;  2L9B A;  3EU9 A;  2X6I A;  3CHQ A;  3FUI A;  1OUV A;  3LCA A;  2G03 A;  5AEN A;  3UM3 A;  2HYZ A;  4GZ6 A;  1YYH A;  3FUH A;  2WXQ A;  5CBN A;  2DVW A;  3DPD A;  3UQ3 A;  4RLY A;  1OXJ A;  3ZHE A;  3JUE A;  4N3A A;  2P9U G;  5LCW J;  3C98 A;  1QZ2 A;  4KBQ A;  5CCL A;  5T4Y A;  2VGX B;  3ASF A;  3LY9 A;  1MQS A;  1HXI A;  4U8V D;  4ANV A;  1H6O A;  1JUQ A;  3U64 A;  3K9I A;  2ETC A;  2XEH A;  1TJF A;  1HS6 A;  3RO3 A;  3MCX A;  4FAD A;  2YNQ A;  2WM9 A;  4AEZ C;  3L54 A;  3FUJ A;  2WVI A;  3TXM A;  3ZRH A;  3T5X A;  2H6F A;  3Q9U C;  4UQY A;  3FU0 A;  3MEK A;  4WNE A;  4JHK A;  3NOC D;  4ATZ D;  1SA4 A;  3UT4 A;  4L2Y A;  1WY6 A;  3LET A;  4Y6C A;  4OAV B;  4UQX A;  3ONK A;  1HZ4 A;  4Z68 A;  3ISM C;  1EPU A;  2IOS A;  4K5A B;  4BX8 A;  4OVU A;  4WWO A;  3V31 A;  2AWI A;  5KBA A;  3J5Q B;  3FEX A;  4K03 A;  5A23 A;  5KJN A;  4X2D A;  2ZIR A;  3LEW A;  4FLH A;  1Y8M A;  3UT8 A;  1V55 E;  4NIK A;  2VSO E;  3ESK A;  3ABL E;  4BER A;  3OAW A;  2WB2 A;  2LAI A;  2XZD G;  2F0Y A;  2GRO B;  4G24 A;  3AU4 A;  2CHX A;  2NYJ A;  4LNG A;  3RU0 A;  1HE8 A;  2XGS A;  5JHA A;  3O48 A;  3B13 A;  4I1M A;  3NB2 A;  3PRZ A;  4O60 A;  1TN7 A;  4EZK A;  3QAR A;  4XI0 A;  4CZ2 D;  3PUJ A;  2R03 A;  4Y6W A;  4LUN U;  1FT1 A;  3E33 A;  4K5B A;  4R7L A;  3ASG A;  3HVE B;  3BU8 A;  1MX4 A;  1XNF A;  2XQ0 A;  2PNN A;  3FUD A;  3L6A A;  4F3V A;  2NUD A;  3OXF A;  4X2E A;  3CIA A;  3CKB A;  4JEH A;  2J4B A;  3I5P A;  2P9L G;  2QC9 A;  4X2C A;  4JL0 A;  4XX5 A;  5KJL A;  1OCC E;  3WXX A;  2WPV A;  3FTS A;  3HIZ A;  3UKU G;  4G1T A;  2Y1L E;  2VY3 A;  4KYO B;  2OND A;  4U7E B;  5CED B;  5JFZ A;  4ILG A;  1MHQ A;  3PEV B;  4RG6 A;  5KWD A;  3HYM B;  3LVQ E;  2V4L A;  3RIB A;  4QQI A;  3AG2 E;  2BF0 X;  3UIP C;  3ZC7 A;  4GA2 A;  4L1B A;  4A63 B;  1SZA A;  1AP7 A;  3BG0 B;  3UPV A;  2VJ8 A;  3OXG A;  3ZU7 B;  2WXF A;  4CYM D;  1X5B A;  1UW4 B;  1NI1 A;  4EHM A;  2FO1 E;  1EYH A;  4N3B A;  4JD2 G;  5ENP D;  3ABM E;  3FU6 A;  4C0E A;  2VYI A;  1E96 B;  1O1T A;  5G05 C;  3T5V A;  2WXP A;  1H6P A;  3ZEF A;  5J08 A;  4DUI A;  1E7U A;  4I9C A;  3FTW A;  3PE3 A;  4C9B B;  5CBO A;  3UX4 A;  3I3N A;  3R9A B;  3SE5 A;  3AS4 A;  1IKN D;  4AP2 A;  4GZ3 A;  2QZA A;  3ZW3 A;  4Q94 A;  3RAU A;  3AJI A;  4GTO A;  3DEP A;  3TG5 A;  3DWL G;  2DZN A;  1E8W A;  1UG3 A;  1LD7 A;  4DI3 A;  1KZP A;  2ETA A;  4DJA A;  3CVP A;  4GTV A;  2A4Z A;  3PNL B;  5AQ7 A;  2X6K A;  3KEZ A;  3UTM A;  2KZT B;  3AG3 E;  3TG4 A;  4APF A;  1HF8 A;  3PZD A;  4HLE A;  4FU3 A;  4ILI A;  3FH7 A;  2ILR A;  4KVM A;  1WAO 1;  3FTY A;  4DX1 A;  4ANW A;  5EIL A;  2MOW A;  3JQ0 A;  3R7Q A;  4JHJ A;  4IN3 B;  3IHY A;  4TRQ A;  2MYO A;  2Y69 E;  2P9S G;  3TWT A;  1Z5S C;  3RRN B;  5JFF A;  4G2V A;  1TNY A;  3UKR G;  3GZS A;  3KSL A;  1NFI E;  3MX3 A;  2P58 C;  2VQ2 A;  4GMJ A;  2WXM A;  4O6F A;  3SD5 A;  2DWZ A;  2WXK A;  3UM1 A;  3HXE A;  3FUF A;  2YIN A;  2LSV A;  3EU5 A;  2WXG A;  5EU0 A;  3LJN A;  1JWF A;  4UUC A;  2WXN A;  5BUZ A;  4WND A;  2Y3A A;  3JUI A;  3NAW A;  5BV1 A;  2V0P A;  4WNF A;  3CVW A;  3TWX A;  1IHB A;  4L2L A;  2XRZ A;  3U66 A;  4U0Z A;  4UWK A;  3EHR A;  2KCV A;  1KZO A;  5ENO D;  3FTX A;  1ZU2 A;  3L9T A;  3TAX A;  4FUL A;  2EIJ E;  4I1O B;  1DNP A;  4IUL A;  3CVY A;  1IHG A;  3Q73 A;  4I1A A;  3IXE A;  4PS8 A;  4XI9 A;  5KNG A;  3U4T A;  3ASH A;  3I4R B;  4I2W A;  4BT8 A;  2XPZ A;  2VSN A;  5ITZ F;  3TWQ A;  3ZCB A;  1FVF A;  4M3O A;  3DSW A;  4JA7 A;  3JXI A;  3UI2 A;  2OEV A;  2UY1 B;  4U95 D;  2DZO A;  3APD A;  4U8Y D;  4N67 A;  3VLF A;  4B89 A;  3OXL A;  1IXV A;  3DSS A;  2QYU A;  1U3D A;  1H2V C;  1NP7 A;  5H7P A;  1A5E A;  1MYO A;  1S0P A;  3X2Q E;  5CCM A;  3QWP A;  1QNF A;  5HQ8 A;  2WQ6 A;  5M72 A;  5CGL A;  3EUV A;  2H6H A;  4BET A;  2J07 A;  5D66 A;  1B89 A;  3V2O A;  3QKY A;  4UWF A;  1S63 A;  5ENN A;  1N4P A;  2VGY A;  2XGO A;  1U3C A;  2H6I A;  3SBT B;  3L13 A;  2XRY A;  3NF1 A;  3I4G A;  2CHW A;  2NXP A;  2QFC A;  1OWN A;  2WMN A;  2RG8 A;  4BTA A;  4GCO A;  2XHE A;  1IYG A;  3U9W A;  1SQM A;  2R59 A;  5E76 A;  4KVO A;  1RW2 A;  3Q7A A;  3O4Z A;  4NRH B;  5FIN A;  3SBS A;  1E8X A;  3UUX A;  4U0S A;  3MZL B;  4BY6 A;  3DRA A;  2JLB A;  4ME2 A;  2FF4 A;  4J8F A;  2I1J A;  5EKQ D;  5G04 J;  3LPZ A;  3VLD A;  3Q47 B;  3D9P A;  1UJJ A;  2Y0B G;  3BEE A;  3ZGQ A;  5KNH D;  2Q7F A;  3QWV A;  2Y4T A;  4PS3 A;  1S70 B;  2OV8 A;  4NQ0 A;  2WXL A;  4ZFH A;  2BKG A;  2MRI A;  4ANX A;  3D9N A;  3HXC A;  1JWG A;  5CMW A;  2DYS E;  4KT6 B;  4XKC A;  4U96 D;  2XS1 A;  1JCR A;  3JXJ A;  4GTM A;  3MGB A;  1HH8 A;  4IYP A;  2J9Q A;  3CVX A;  2RFM A;  3GZ2 A;  2GRM A;  1N11 A;  3UIO C;  2VGX A;  2YQ8 A;  3CVN A;  4HBD A;  4BES A;  1U2V G;  5CHE E;  3SF4 A;  1QYM A;  2LSU A;  5BV0 A;  3ASO E;  1OCO E;  2XS8 A;  3CVQ A;  2ZIS A;  3QWW A;  3RSE G;  5BT1 A;  1TYQ G;  3Q75 A;  4GB9 A;  3QNK A;  5LFA A;  4UI9 K;  1ZB1 A;  3RO2 A;  2ION A;  1IQR A;  3FU3 A;  4UI9 C;  3PNT B;  3HRA A;  1N9A A;  1DCE A;  4H7X A;  1NH1 A;  2NC9 A;  3FFL A;  3NOG D;  4A3T A;  4XE0 A;  4P29 A;  4TUU A;  4HQD A;  4TV3 A;  1D9S A;  3UT7 A;  3PZ2 A;  4D10 C;  4L9P A;  2JK8 A;  1OT8 A;  5KCM A;  3ZNG A;  3B7U X;  1IQU A;  2PL2 A;  2J49 A;  5FQ4 A;  3D9K A;  4EZJ A;  4GYW A;  3KS2 A;  5BXU A;  1OWO A;  2R2L A;  3DPY A;  4O1P A;  4N2S A;  3ZLM A;  4GA0 A;  4UQZ A;  1Z3X A;  4X8Q A;  5CKL A;  4XI8 A;  4BSX A;  1SW6 A;  5EX3 A;  4FJY A;  3VTX A;  1BU9 A;  1NL4 A;  3TWV A;  5E75 A;  1JPL A;  1K8K G;  5ENS D;  3L82 A;  4HNA D;  2MHK A;  1OWM A;  2IU1 A;  1D8E A;  3FTV A;  3TWW A;  2OVF A;  1QQE A;  3LS8 A;  3CK9 A;  1TNZ A;  5FIO A;  4I6J A;  4GPK A;  4JVS A;  2XCB A;  4I2Z A;  4B0Z A;  5AQA A;  5ENR D;  5EIB E;  1TNU A;  2F8Y A;  4MRU A;  3DST A;  4BFR A;  3HVE A;  2VSY A;  4WNG A;  4HLL A;  1BD8 A;  4GA1 A;  2GW1 A;  4JXT A;  4BWR A;  3D9J A;  1JCS A;  4MKT A;  2YHE A;  2RKK A;  4ZHB A;  3AAA C;  4WWP A;  4CT0 A;  4U07 A;  3SFY A;  4L7T A;  3SFX A;  3FH8 A;  2KC7 A;  4EZL A;  4XIF A;  4A1S A;  3N3U A;  3CVL A;  1OCR E;  1FT2 A;  3CKC A;  3QJZ A;  3G2V A;  4APO A;  2VGE A;  2CG2 A;  3Q7F A;  3AG4 E;  4HRN A;  4BTB A;  3TWU A;  2WXI A;  3TJP A;  2P9I G;  5ENQ D;  3TWS A;  2B6C A;  3MA5 A;  2IO3 C;  1TR4 A;  3CGH A;  3HXD A;  3NBN B;  3BG1 B;  1ELK A;  4FHK A;  4OVV A;  1HX8 A;  2NSZ A;  2FO7 A;  4N5C A;  3OTN A;  4G8L A;  2IJG X;  1SVX A;  3C3R A;  3UM0 A;  4U8H A;  1KLX A;  2I9C A;  3PZ3 A;  3HDX A;  3SQV A;  2BED A;  3P2B A;  4YDY A;  1PY1 A;  2GRN B;  3MKR A;  5J90 A;  4DX5 D;  4M16 A;  4PY3 A;  3DXK G;  2ZGG A;  4ATG A;  3GYZ A;  3PVL A;  3U3W A;  5G04 C;  2GRR B;  4UWG A;  2CFU A;  1HU3 A;  3EHQ A;  2QY7 A;  5LCW C;  1OY3 D;  5ARF A;  4AOF A;  4KXK B;  5CRV A;  1HO8 A;  3RJV A;  4F1S A;  2HR2 A;  4GTT A;  3D9M A;  3APF A;  4EBA A;  2OEW A;  3Q15 A;  2DIW A;  2X3M A;  5AAR A;  2C0M A;  1H2U A;  2FBN A;  4LER A;  5ANR A;  2GRP B;  2GGF A;  2J8S D;  4WUY A;  4C48 B;  4Q69 A;  3V79 K;  2LO6 A;  4A55 A;  3DSU A;  3IBE A;  3QOU A;  3AG1 E;  1Q2Z A;  4JZY A;  3LYA A;  1K1B A;  3TXN A;  2A5E A;  4CGV A;  3LJ3 A;  1VDY A;  3MV3 B;  2KZT A;  4L23 A;  3KAE A;  1TN6 A;  1E8Y A;  2J4D A;  1Z3Y A;  4W9R A;  3FUK A;  1TEZ A;  1JCQ A;  5JMN D;  2YHC A;  3SGH A;  2CHZ A;  4B8A A;  2KCK A;  5CRU A;  3T8K A;  2PQR A;  3DSV A;  3D9O A;  4A1G A;  4LRZ A;  3PDN A;  1TNO A;  3B95 A;  3ULE G;  3URZ A;  1H2T C;  2I1K A;  4YDO A;  4GYY A;  2WQH A;  4J7W A;  3V2X A;  1YMP A;  2WMO A;  4ACK A;  4ACL A;  2X38 A;  4M7C A;  4GZD A;  4HI9 A;  2R05 A;  2ETB A;  4GTQ A;  4NUR A;  4ANU A;  3CK8 A;  2M63 A;  2XEV A;  1BPO A;  2VZA A;  4HB5 A;  4HS2 A;  4JEU A;  3AS5 A;  3SI5 A;  3PH0 C;  3FU5 A;  2BKK B;  4CRW A;  2VTB A;  1KT1 A;  1E8Z A;  1E7V A;  4N5Q A;  5G2N A;  3PUK A;  3NZS A;  3ZYM A;  2A5U A;  4I43 A;  1KPS B;  1MZC A;  3F6Q A;  5ANL A;  4WGJ A;  5FT9 A;  4J8D A;  2P9N G;  3N71 A;  5DIZ A;  4GZ5 A;  5DBK A;  4N3C A;  2L0I A;  2ZGD A;  5BNW A;  1YA0 A;  3PRE A;  3IHV A;  4CCA A;  3JCK C;  2JEK A;  2UY1 A;  3TWR A;  4RSY A;  2OOE A;  3MKQ B;  5AQB A;  5BW8 C;  3RRM B;  1UN8 A;  2AW6 A;  4KMO A;  2NUN A;  2V4H C;  4FHJ A;  3C5R A;  3FY4 A;  3CSF A;  4DX7 D;  4LNB A;  3GW4 A;  3SNX A;  3B7T A;  4DLQ A;  3QAQ A;  1N54 A;  2LXL A;  1G3N B;  2FUL A;  3PZ1 A;  3ULQ A;  3ZIM A;  3ZKJ A;  4CDM A;  1MX2 A;  4DRX E;  4F7A A;  3KEA A;  2IOL A;  2XEN A;  3S6A A;  2IQC A;  3ZHE B;  3G2T A;  5JJ6 A;  3Q4A B;  4ITR A;  1OCZ E;  4K5C A;  4AY5 A;  4DX6 D;  1N0Q A;  2IF4 A;  3AS8 A;  2AXU A;  1BLX B;  4J8Y A;  2X6F A;  3Q49 B;  3L08 A;  3WG7 E;  4B93 B;  2RD0 A;  3CR3 A;  1GW6 A;  2PM6 A;  4G8K A;  1BI7 B;  4HOU A;  3E37 A;  1WM5 A;  3SZ7 A;  4FJZ A;  1N94 A;  2WXR A;  1H19 A;  3CHR A;  4JW1 A;  3BUA A;  3VTY A;  3L16 A;  4GPM A;  3ZXP A;  2C0L A;  2XPI A;  3Q5M A;  4MBG A;  4G11 A;  5HS0 A;  3QK0 A;  2BTD A;  3S7B A;  2PZI A;  1OWL A;  4KZ0 A;  3CVV A;  5KJK A;  3PE4 A;  2EIN E;  3RK6 A;  4GZC A;  4UWL A;  5D0Q D;  4WWN A;  4RQI A;  4F1P A;  3HHM A;  4LCT A;  4MLP A;  3IEG A;  3SFZ A;  2QYJ A;  1LD8 A;  4C0M A;  4PS7 A;  3VLE A;  3FH5 A;  5G55 A;  1A17 A;  4XEI G;  4OYS A;  2X6J A;  4I9E A;  5CMY A;  4J6I A;  1HG2 A;  3FDH A;  4YVQ C;  1O1S A;  3E32 A;  3FEY A;  3HXF A;  3MYV A;  5CEC B;  4FP7 A;  3EJN A;  2H6G A;  4G23 A; 
#chains in the Genus database with same CATH homology
 3SD5 A;  3G2W A;  4A1S A;  2WXK A;  5FTP A;  3N3U A;  3CVL A;  2PM7 A;  1HG5 A;  3FUF A;  1UN9 A;  2YIN A;  2KM4 A;  2LSV A;  4UWH A;  3ONL A;  2WXG A;  5EU0 A;  1PC2 A;  4G26 A;  5G05 J;  3TL5 A;  1Y6I A;  3CKC A;  3QJZ A;  1JWF A;  1KT0 A;  3G2V A;  4APO A;  3MKQ A;  5CMT A;  5FQ6 A;  4RVB A;  2WXN A;  5A6C A;  2WXJ A;  5BUZ A;  3CLJ A;  4WND A;  2Y3A A;  3EIJ A;  3GZ1 A;  3JUI A;  3ZPJ A;  4AXH A;  2CG2 A;  3FUE A;  4N2Q A;  3LXU X;  4U63 A;  5BV1 A;  4BTB A;  4I6G A;  2V0P A;  1N52 A;  2WXI A;  4WNF A;  3CVW A;  3TJP A;  4URK A;  1NZN A;  3EDT B;  1EF1 C;  3MA5 A;  3ASD A;  3FP3 A;  2I2O A;  3CGH A;  2CG3 A;  4L2L A;  1DVP A;  5FZS A;  4GML A;  4AJW A;  2XRZ A;  2DCP A;  1ELK A;  4U0Z A;  3BG1 B;  4FHK A;  2L9B A;  4UWK A;  4OVV A;  3ZYK A;  3U66 A;  1HX8 A;  1XGW A;  2FO7 A;  2KCV A;  2NSZ A;  2X6I A;  2EQX A;  3CHQ A;  3OTN A;  4N5C A;  1Z6T A;  3FUI A;  5FZR A;  1OUV A;  3CQG B;  3LCA A;  2G03 A;  5AEN A;  2IJG X;  3FTX A;  1ZU2 A;  2HYZ A;  4GZ6 A;  4U8H A;  3TAX A;  4FUL A;  1KLX A;  3ZYQ A;  3FUH A;  2WXQ A;  5D0O D;  3ML8 A;  2I9C A;  1HFA A;  1P5Q A;  1ELW A;  4I1O B;  4XKB A;  1DNP A;  3DPD A;  3HDX A;  3UQ3 A;  3EHN A;  4IUL A;  3CVY A;  1IHG A;  3IKO B;  3P2B A;  4I1A A;  1PY1 A;  3ZHE A;  4N3A A;  3MKR A;  5J90 A;  4PS8 A;  5LCW J;  4XI9 A;  3C98 A;  1QZ2 A;  3B7R L;  4M16 A;  4KBQ A;  5T4Y A;  3U4T A;  5CCL A;  4PY3 A;  2VGX B;  3ASF A;  3ASH A;  3I4R B;  4I2W A;  4BT8 A;  4HOT A;  1H6K A;  3GYZ A;  4ATG A;  2GRL A;  2XPZ A;  2VSN A;  3LY9 A;  3PVL A;  2AXZ A;  3U3W A;  1MQS A;  4Q96 A;  1HXI A;  4ANV A;  5G04 C;  1JUQ A;  4UWG A;  3ZCB A;  1FVF A;  5C2Y A;  3U64 A;  3K9I A;  2CFU A;  1HU3 A;  1TJF A;  4RG9 A;  4M3O A;  1HS6 A;  2QY7 A;  3RO3 A;  5LCW C;  4JA7 A;  3MCX A;  1UJK A;  4FAD A;  4J8E A;  5ARF A;  3CST A;  5T3R A;  2L6J A;  2YNQ A;  2WM9 A;  4AEZ C;  4AOF A;  3L54 A;  3LY8 A;  2UY1 B;  4KXK B;  3FUJ A;  2WVI A;  4HOR A;  2V8S E;  3TXM A;  4EEC A;  1HO8 A;  4JC8 A;  3T5X A;  3D3M A;  4V3I A;  3ZRH A;  3RJV A;  3FWV A;  3APD A;  4F1S A;  1OWP A;  4XIF A;  2HR2 A;  4N67 A;  3VLF A;  3ZN3 A;  4UQY A;  4B89 A;  3D9M A;  3APF A;  2PQN A;  3FU0 A;  3OXL A;  4EBA A;  3Q15 A;  3MEK A;  2DIW A;  2X3M A;  3CEQ A;  1U3D A;  4WNE A;  4EPZ A;  2C0M A;  1H2U A;  1H2V C;  2FBN A;  4JHK A;  4LER A;  5ANR A;  5ARG A;  1NP7 A;  2GGF A;  4Q69 A;  4WUY A;  3UT4 A;  4L2Y A;  1S0P A;  1WY6 A;  2LO6 A;  4A55 A;  4BX9 A;  4HXI A;  3IBE A;  2HM8 A;  5CCM A;  4HFG A;  3CK7 A;  3LET A;  3QOU A;  4Y6C A;  4UQX A;  1E90 A;  2I6H A;  5C1D A;  3QWP A;  1QNF A;  3ONK A;  5HQ8 A;  2KCL A;  2WQ6 A;  1HZ4 A;  5M72 A;  4JZY A;  3D9I A;  3LYA A;  5CGL A;  1EPU A;  1W3B A;  4A3V A;  3TXN A;  3L17 A;  4CGV A;  3S7D A;  4CT4 A;  2UWJ G;  3LJ3 A;  2IOS A;  1VDY A;  3MV3 B;  2KZT A;  4L23 A;  4BX8 A;  2J07 A;  4OVU A;  4WWO A;  1B89 A;  3KAE A;  3QDN A;  2AWI A;  3FUN A;  3QKY A;  1E8Y A;  2FEZ A;  2L0T B;  2J4D A;  4E6H A;  1Z3Y A;  4UWF A;  4W9R A;  3FUK A;  2F6S A;  2WXH A;  1TEZ A;  4GU5 A;  5ENN A;  4LU4 A;  2VGY A;  2XGO A;  3CVU A;  1U3C A;  3DBS A;  3FEX A;  4K03 A;  5LX8 A;  2LNI A;  2YHC A;  3SBT B;  1TJC A;  2CHZ A;  3SGH A;  5A23 A;  4B8A A;  5KJN A;  4J8S A;  4X2D A;  1FCH A;  3L13 A;  3QC1 A;  2XRY A;  3FUM A;  4FLH A;  3LEW A;  3E4B A;  2KCK A;  3NF1 A;  3I4G A;  2CHW A;  2PQR A;  2QFC A;  2NXP A;  1Y8M A;  3D9O A;  3UT8 A;  4A1G A;  1OWN A;  2WMN A;  3CUC A;  2RG8 A;  3D9L A;  4LRZ A;  4BTA A;  4CEM A;  3PDN A;  4GCO A;  3SN9 A;  2VSO E;  2XHE A;  4XZ4 A;  1IYG A;  2XGM A;  3KD7 A;  4JA9 A;  3U9W A;  1SQM A;  3ESK A;  2R59 A;  5E76 A;  5JJT A;  4FLB A;  3URZ A;  3JYS A;  3P1U A;  4HVB A;  4KVO A;  1H2T C;  4HOS A;  3OAW A;  4GAA A;  3LDZ A;  3O4Z A;  2I1K A;  4NRH B;  4GYY A;  2AXV A;  2WB2 A;  2WQH A;  4J0U A;  3SBS A;  1E8X A;  3UUX A;  4DPR A;  4U0S A;  3MZL B;  2LAI A;  4BY6 A;  4EQF A;  2WMO A;  2JLB A;  4BT9 A;  4ACK A;  5BPP A;  4G24 A;  3AU4 A;  1ZBP A;  4ACL A;  2CHX A;  2AVP A;  2X38 A;  3RU0 A;  1HE8 A;  4GZD A;  2XGS A;  4ME2 A;  2FF4 A;  5JHA A;  4J8F A;  2I1J A;  4AM9 A;  3CV0 A;  5EKQ D;  5G04 J;  3LVR E;  3LPZ A;  3O48 A;  4NUR A;  3B13 A;  4I1M A;  3VLD A;  4ANU A;  3Q47 B;  3D9P A;  1UJJ A;  3CQC B;  3BEE A;  3PRZ A;  3ZGQ A;  3CK8 A;  2M63 A;  2Q7F A;  3FHE A;  4CDN A;  2XEV A;  1BPO A;  3ZXS A;  2VZA A;  3QWV A;  2Y4T A;  3QAR A;  2OV8 A;  4PS3 A;  4XI0 A;  4EZK A;  4NQ0 A;  2WXL A;  4HS2 A;  5FJY A;  3PUJ A;  4JEU A;  3AS5 A;  3PEU B;  4Y6W A;  3SI5 A;  1H0A A;  5HI7 A;  4LUN U;  3PH0 C;  3FU5 A;  3FUL A;  2MRI A;  2LAH A;  2ZU6 B;  4ANX A;  4CRW A;  5AIJ A;  3D9N A;  2VTB A;  4NPS A;  1JWG A;  1KT1 A;  1E8Z A;  5CMW A;  4KT6 B;  4XKC A;  1E7V A;  4R7L A;  4JPS A;  3EIQ C;  3ASG A;  2XPY A;  3HVE B;  5G2N A;  3ZFW A;  1XNF A;  3PUK A;  3NZS A;  3T8M A;  2XQ0 A;  3ZVV A;  3ZYM A;  2HO1 A;  2A5U A;  4I43 A;  3FUD A;  1HH8 A;  3L6A A;  3MGB A;  4F3V A;  4IYP A;  2VSX E;  2J9Q A;  3TGO A;  3CVX A;  2FI7 A;  3OXF A;  4X2E A;  2IFU A;  3CIA A;  3CKB A;  2GRM A;  3GZ2 A;  4JEH A;  5LOZ A;  2J4B A;  3I5P A;  5FWQ A;  4AVX A;  5FQ8 A;  4X2C A;  2VGX A;  4JL0 A;  4XX5 A;  5KJL A;  2YQ8 A;  3CVN A;  2WPV A;  3L22 A;  3WXX A;  5ANL A;  4WGJ A;  5FT9 A;  3FTS A;  4J8D A;  3HIZ A;  5CHE E;  3SF4 A;  2LSU A;  5BV0 A;  3MV2 B;  2CFZ A;  3N71 A;  5DIZ A;  4G1T A;  4QFV A;  4GZ5 A;  5DBK A;  2VY3 A;  4KYO B;  4N3C A;  2OND A;  2L0I A;  5BNW A;  3CVQ A;  5JFZ A;  4UI9 J;  4PDX A;  4E85 A;  4ILG A;  1YA0 A;  3QWW A;  1MHQ A;  3PEV B;  4RG6 A;  5BT1 A;  3PRE A;  3IHV A;  3HYM B;  4CCA A;  3JCK C;  3LVQ E;  2JEK A;  2UY1 A;  3UMV A;  4GB9 A;  3AU5 A;  4RSY A;  4FA6 A;  2OOE A;  3MKQ B;  3QNK A;  5BW8 C;  3RRM B;  3SHF A;  5LFA A;  4GCN A;  2V4L A;  4UI9 K;  3RRU A;  3ZYL A;  4WAF A;  3RO2 A;  1UN8 A;  2AW6 A;  4GYO A;  3RIB A;  4KMO A;  3PS6 A;  2ION A;  2BF0 X;  1IQR A;  3FU3 A;  3LY7 A;  4UI9 C;  4FHJ A;  3FY4 A;  3CSF A;  3NQP A;  3SHG A;  3PNT B;  3SNX A;  3GW4 A;  5T8I A;  4PUC A;  4PH4 B;  3ZC7 A;  3B7T A;  3ML9 A;  4GA2 A;  4DLQ A;  4DK5 A;  3QAQ A;  4GMJ A;  1N54 A;  4L1B A;  4H7X A;  1SZA A;  5EX0 A;  2NC9 A;  2FUL A;  3ULQ A;  3FFL A;  4KZC A;  4A3T A;  4XE0 A;  3BG0 B;  4P29 A;  3ZIM A;  3UPV A;  4TUU A;  4HOQ A;  2VJ8 A;  4CDM A;  3S7F A;  3OXG A;  2DBA A;  4F7A A;  5FZQ A;  4AIF A;  4TV3 A;  4DLO A;  2WXF A;  3UT7 A;  1X5B A;  1UW4 B;  4D10 C;  2IOL A;  3S6A A;  1EYH A;  2IQC A;  2JK8 A;  4N3B A;  3ZHE B;  5KJM A;  5EDS A;  5AJL A;  3FU6 A;  2E2E A;  3CHO A;  5KCM A;  3G2T A;  2Y4U A;  5JJ6 A;  3B7U X;  1IQU A;  2PL2 A;  3FTU A;  2J49 A;  3Q4A B;  4ITR A;  4C0E A;  4AY5 A;  5FQ4 A;  2VYI A;  4AY6 A;  1E96 B;  2IF4 A;  2WXO A;  2AXU A;  3AS8 A;  2BUG A;  3D9K A;  5G05 C;  2R5S A;  2R17 C;  2X6F A;  2WXP A;  3Q49 B;  3T5V A;  4AV7 A;  3L08 A;  4EZJ A;  2J08 A;  2RD0 A;  3CR3 A;  3EHM A;  4LEU A;  1GW6 A;  2X6H A;  4GYW A;  4YVO A;  3ZEF A;  5J08 A;  2PM6 A;  1E7U A;  3S7J A;  2KAT A;  4I9C A;  3KS2 A;  3FTW A;  4N39 A;  3PE3 A;  4C9B B;  2VTB B;  3UX4 A;  3I3N A;  1OWO A;  3R9A B;  4HOU A;  5JJ7 A;  3SE5 A;  1WM5 A;  3SZ7 A;  4ABN A;  4MS6 A;  3AS4 A;  4N2S A;  3ZLM A;  4FJZ A;  4GA0 A;  2C2L A;  4UQZ A;  1Z3X A;  4U04 A;  4XI8 A;  5CKL A;  3MJW A;  4JHR A;  4K0R A;  4AP2 A;  5EX3 A;  4BSX A;  4GZ3 A;  1NA0 A;  3ZW3 A;  4NAC A;  2WXR A;  4Q94 A;  4FJY A;  1H19 A;  3VTX A;  5A7D B;  4CGW A;  3CHR A;  3R7R A;  4JW1 A;  5E75 A;  1JPL A;  3VTY A;  3TG5 A;  3L16 A;  2OVB A;  3LKU A;  2MHK A;  3RKV A;  1OWM A;  2IU1 A;  3FTV A;  1E8W A;  1SZ9 A;  1UG3 A;  2C0L A;  2OVF A;  1QQE A;  4DI3 A;  2XPI A;  4G25 A;  3Q5M A;  3LS8 A;  3CK9 A;  3CHP A;  4G11 A;  3QK0 A;  4DJA A;  3CVP A;  4I6J A;  5LP0 A;  2A4Z A;  4GPK A;  4JVS A;  2XCB A;  5AYW D;  3PNL B;  2BTD A;  2X6K A;  1PAQ A;  3ESL A;  3KEZ A;  3S7B A;  3QB2 A;  1FVH A;  2KZT B;  2PZI A;  2J09 A;  3ENE A;  3TG4 A;  4APF A;  1HF8 A;  3PZD A;  4HLE A;  1OWL A;  2V5F A;  4I2Z A;  4KZ0 A;  3CVV A;  4B0Z A;  4FU3 A;  5KJK A;  1NA3 A;  3PE4 A;  4ILI A;  4YND A;  3FH7 A;  2ILR A;  1LF8 A;  4KVM A;  1WAO 1;  5FQ7 A;  4U0U A;  3FTY A;  3RK6 A;  4MRU A;  4B8C B;  4GZC A;  4UWL A;  3IV0 A;  3CHM A;  5D0Q D;  4WWN A;  3CHS A;  4ANW A;  4IRU A;  4B94 A;  4BFR A;  3NZU A;  4I17 A;  3HHM A;  2MOW A;  3JQ0 A;  4LCT A;  4MLP A;  1L5J A;  3FTZ A;  3HVE A;  3IEG A;  3SFZ A;  2VSY A;  4WNG A;  2XCC A;  4JHJ A;  3R7Q A;  4IN3 B;  3S2A A;  4EBA G;  4C0M A;  3IHY A;  5JHB A;  2WQ7 A;  4GA1 A;  2GW1 A;  4TRQ A;  4PS7 A;  4JXT A;  3VLE A;  4BWR A;  3D9J A;  3FH5 A;  5G55 A;  3APC A;  1A17 A;  4CDR A;  3JQ1 A;  1ELR A;  1EDU A;  4MKT A;  3RRN B;  5JFF A;  4G2V A;  2YHE A;  1INZ A;  4F53 A;  4FC8 A;  2X6J A;  4I9E A;  4OYS A;  4WWP A;  5CMY A;  4CT0 A;  4I6E A;  4U07 A;  2E0I A;  5AJD A;  4J6I A;  3GZS A;  1HG2 A;  3FDH A;  4H7Y A;  4L7T A;  4ILH B;  4YVQ C;  3FEY A;  3G2U A;  3G2S A;  4DI4 A;  3MYV A;  3MX3 A;  4FP7 A;  3FH8 A;  2KC7 A;  2P58 C;  3EJN A;  2VQ2 A;  2WXM A;  4EZL A;  4O6F A;  4G23 A;  3B7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...