4F1RA

Structure analysis of the global metabolic regulator crc from pseudomonas aeruginos
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
259
structure length
259
Chain Sequence
MRIISVNVNGIQAAAERGLLSWLQAQNADVICLQDTRASAFDLDDPSFQLDGYFLYACDAELPEQGGVALYSRLQPKAVISGLGFETADRYGRYLQADFDKVSIATLLLPSGQSGDESLNQKFKFMDDFTHYLSKQRRKRREYIYCGSLYVAHQKMDVKNWRECQQMPGFLAPERAWLDEVFGNLGYADALREVSREGDQFSWWPDSEQAEMLNLGWRFDYQVLTPGLRRFVRNAKLPRQPRFSQHAPLIVDYDWQLSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Catabolite repression control protein
publication title Structure analysis of the global metabolic regulator Crc from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 81
structure length 259
sequence length 259
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.10.10 Alpha Beta 4-Layer Sandwich Deoxyribonuclease I; Chain A Endonuclease/exonuclease/phosphatase 4f1rA00
5J3ZA 4L1ZA 4QH9A 5INQA 3MPRA 3U8UA 1HD7A 2IMQX 4CMNA 5INOA 2F1NA 5J3PA 3L1WA 2JC5A 4GZ2A 3I41A 5DV4A 2DNJA 2DDRA 3G0RA 3GA6A 5CFGA 3K55A 3TEBA 2A41B 3G00A 4K6LF 1DE8A 4F1HA 4L20A 4B5MA 3G4TA 2UYRX 2A42B 2XSWA 3G3YA 2EI9A 4F1HB 3I48A 4L1YA 4FPVA 5INLA 1VYBA 2O3HA 3G1KA 3MTCA 4IEMA 5DG0A 4AWNA 3W2XA 4C1RA 3DNIA 5DFJA 2F2FB 3G8VA 2JC4A 1SI6X 3FZIA 2V0RA 1DE9A 2A3ZB 5DFIA 3G0AA 1E9NA 1ATND 1NTFA 4B5GA 4GZ0A 4L21A 5A7JA 2DDTA 3W2YA 5DFHA 5INPA 3G2CA 3G38A 2ISIA 3CJCD 5INKA 5J3SA 5HT2A 2J63A 3NGNA 4B5JA 4RUWA 3G3CA 4FVAA 2V0SA 5INNA 4B5HA 1WDUA 5DFFA 4QHEA 4F1RA 2O3CA 1SR4B 1ZWXA 2D1KB 1AKOA 3WCXA 1DNKA 4B5FA 3G91A 3NR8A 4GYZA 3G2DA 3I5VA 3I46A 1DEWA 5J8NA 1YJHA 3NGQA 3G6SA 2A40B 5J42A 2DDSA 1BIXA 4QHDA 3NGOA 5INMA 1I9YA 4CMLA 1I9ZA 5A7IA 3W3DB 4PUQA 5DV2A 4B5IA 5CFEA 4GZ1A 3N9VA 4A9CA 2VOAA 4F1IA 5EWTA 4JG3A 1Y21A 4GEWA 4LNDA
chains in the Genus database with same CATH superfamily
5J3ZA 4L1ZA 4QH9A 5INQA 3MPRA 3U8UA 1HD7A 2IMQX 4CMNA 5INOA 2F1NA 5J3PA 3L1WA 2JC5A 4GZ2A 3I41A 5DV4A 2DNJA 2DDRA 3G0RA 3GA6A 5CFGA 3K55A 3TEBA 2A41B 3G00A 4K6LF 1DE8A 4F1HA 4L20A 4B5MA 3G4TA 2UYRX 2A42B 2XSWA 3G3YA 2EI9A 4F1HB 3I48A 4L1YA 4FPVA 5INLA 1VYBA 2O3HA 3G1KA 3MTCA 4IEMA 5DG0A 4AWNA 3W2XA 4C1RA 3DNIA 5DFJA 2F2FB 3G8VA 2JC4A 1SI6X 3FZIA 2V0RA 1DE9A 2A3ZB 5DFIA 3G0AA 1E9NA 1ATND 1NTFA 4B5GA 4GZ0A 4L21A 5A7JA 2DDTA 3W2YA 5DFHA 5INPA 3G2CA 3G38A 2ISIA 3CJCD 5INKA 5J3SA 5HT2A 2J63A 3NGNA 4B5JA 4RUWA 3G3CA 4FVAA 2V0SA 5INNA 4B5HA 1WDUA 5DFFA 4QHEA 4F1RA 2O3CA 1SR4B 1ZWXA 2D1KB 1AKOA 3WCXA 1DNKA 4B5FA 3G91A 3NR8A 4GYZA 3G2DA 3I5VA 3I46A 1DEWA 5J8NA 1YJHA 3NGQA 3G6SA 2A40B 5J42A 2DDSA 1BIXA 4QHDA 3NGOA 5INMA 1I9YA 4CMLA 1I9ZA 5A7IA 3W3DB 4PUQA 5DV2A 4B5IA 5CFEA 4GZ1A 3N9VA 4A9CA 2VOAA 4F1IA 5EWTA 4JG3A 1Y21A 4GEWA 4LNDA
chains in the Genus database with same CATH topology
5J3ZA 4L1ZA 4QH9A 5INQA 3MPRA 3U8UA 1HD7A 2IMQX 4CMNA 5INOA 2F1NA 5J3PA 3L1WA 2JC5A 4GZ2A 3I41A 5DV4A 2DNJA 2DDRA 3G0RA 3GA6A 5CFGA 3K55A 3TEBA 2A41B 3G00A 4K6LF 1DE8A 4F1HA 4L20A 4B5MA 3G4TA 2UYRX 2A42B 2XSWA 3G3YA 2EI9A 4F1HB 3I48A 4L1YA 4FPVA 5INLA 1VYBA 2O3HA 3G1KA 3MTCA 4IEMA 5DG0A 4AWNA 3W2XA 4C1RA 3DNIA 5DFJA 2F2FB 3G8VA 2JC4A 1SI6X 3FZIA 2V0RA 1DE9A 2A3ZB 5DFIA 3G0AA 1E9NA 1ATND 1NTFA 4B5GA 4GZ0A 4L21A 5A7JA 2DDTA 3W2YA 5DFHA 5INPA 3G2CA 3G38A 2ISIA 3CJCD 5INKA 5J3SA 5HT2A 2J63A 3NGNA 4B5JA 4RUWA 3G3CA 4FVAA 2V0SA 5INNA 4B5HA 1WDUA 5DFFA 4QHEA 4F1RA 2O3CA 1SR4B 1ZWXA 2D1KB 1AKOA 3WCXA 1DNKA 4B5FA 3G91A 3NR8A 4GYZA 3G2DA 3I5VA 3I46A 1DEWA 5J8NA 1YJHA 3NGQA 3G6SA 2A40B 5J42A 2DDSA 1BIXA 4QHDA 3NGOA 5INMA 1I9YA 4CMLA 1I9ZA 5A7IA 3W3DB 4PUQA 5DV2A 4B5IA 5CFEA 4GZ1A 3N9VA 4A9CA 2VOAA 4F1IA 5EWTA 4JG3A 1Y21A 4GEWA 4LNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3Z A;  4L1Z A;  4QH9 A;  5INQ A;  3MPR A;  3U8U A;  1HD7 A;  2IMQ X;  4CMN A;  5INO A;  2F1N A;  5J3P A;  3L1W A;  2JC5 A;  4GZ2 A;  3I41 A;  5DV4 A;  2DNJ A;  2DDR A;  3G0R A;  3GA6 A;  5CFG A;  3K55 A;  3TEB A;  2A41 B;  3G00 A;  4K6L F;  1DE8 A;  4F1H A;  4L20 A;  4B5M A;  3G4T A;  2UYR X;  2A42 B;  2XSW A;  3G3Y A;  2EI9 A;  4F1H B;  3I48 A;  4L1Y A;  4FPV A;  5INL A;  1VYB A;  2O3H A;  3G1K A;  3MTC A;  4IEM A;  5DG0 A;  4AWN A;  3W2X A;  4C1R A;  3DNI A;  5DFJ A;  2F2F B;  3G8V A;  2JC4 A;  1SI6 X;  3FZI A;  2V0R A;  1DE9 A;  2A3Z B;  5DFI A;  3G0A A;  1E9N A;  1ATN D;  1NTF A;  4B5G A;  4GZ0 A;  4L21 A;  5A7J A;  2DDT A;  3W2Y A;  5DFH A;  5INP A;  3G2C A;  3G38 A;  2ISI A;  3CJC D;  5INK A;  5J3S A;  5HT2 A;  2J63 A;  3NGN A;  4B5J A;  4RUW A;  3G3C A;  4FVA A;  2V0S A;  5INN A;  4B5H A;  1WDU A;  5DFF A;  4QHE A;  4F1R A;  2O3C A;  1SR4 B;  1ZWX A;  2D1K B;  1AKO A;  3WCX A;  1DNK A;  4B5F A;  3G91 A;  3NR8 A;  4GYZ A;  3G2D A;  3I5V A;  3I46 A;  1DEW A;  5J8N A;  1YJH A;  3NGQ A;  3G6S A;  2A40 B;  5J42 A;  2DDS A;  1BIX A;  4QHD A;  3NGO A;  5INM A;  1I9Y A;  4CML A;  1I9Z A;  5A7I A;  3W3D B;  4PUQ A;  5DV2 A;  4B5I A;  5CFE A;  4GZ1 A;  3N9V A;  4A9C A;  2VOA A;  4F1I A;  5EWT A;  4JG3 A;  1Y21 A;  4GEW A;  4LND A; 
#chains in the Genus database with same CATH topology
 5J3Z A;  4L1Z A;  4QH9 A;  5INQ A;  3MPR A;  3U8U A;  1HD7 A;  2IMQ X;  4CMN A;  5INO A;  2F1N A;  5J3P A;  3L1W A;  2JC5 A;  4GZ2 A;  3I41 A;  5DV4 A;  2DNJ A;  2DDR A;  3G0R A;  3GA6 A;  5CFG A;  3K55 A;  3TEB A;  2A41 B;  3G00 A;  4K6L F;  1DE8 A;  4F1H A;  4L20 A;  4B5M A;  3G4T A;  2UYR X;  2A42 B;  2XSW A;  3G3Y A;  2EI9 A;  4F1H B;  3I48 A;  4L1Y A;  4FPV A;  5INL A;  1VYB A;  2O3H A;  3G1K A;  3MTC A;  4IEM A;  5DG0 A;  4AWN A;  3W2X A;  4C1R A;  3DNI A;  5DFJ A;  2F2F B;  3G8V A;  2JC4 A;  1SI6 X;  3FZI A;  2V0R A;  1DE9 A;  2A3Z B;  5DFI A;  3G0A A;  1E9N A;  1ATN D;  1NTF A;  4B5G A;  4GZ0 A;  4L21 A;  5A7J A;  2DDT A;  3W2Y A;  5DFH A;  5INP A;  3G2C A;  3G38 A;  2ISI A;  3CJC D;  5INK A;  5J3S A;  5HT2 A;  2J63 A;  3NGN A;  4B5J A;  4RUW A;  3G3C A;  4FVA A;  2V0S A;  5INN A;  4B5H A;  1WDU A;  5DFF A;  4QHE A;  4F1R A;  2O3C A;  1SR4 B;  1ZWX A;  2D1K B;  1AKO A;  3WCX A;  1DNK A;  4B5F A;  3G91 A;  3NR8 A;  4GYZ A;  3G2D A;  3I5V A;  3I46 A;  1DEW A;  5J8N A;  1YJH A;  3NGQ A;  3G6S A;  2A40 B;  5J42 A;  2DDS A;  1BIX A;  4QHD A;  3NGO A;  5INM A;  1I9Y A;  4CML A;  1I9Z A;  5A7I A;  3W3D B;  4PUQ A;  5DV2 A;  4B5I A;  5CFE A;  4GZ1 A;  3N9V A;  4A9C A;  2VOA A;  4F1I A;  5EWT A;  4JG3 A;  1Y21 A;  4GEW A;  4LND A; 
#chains in the Genus database with same CATH homology
 5J3Z A;  4L1Z A;  4QH9 A;  5INQ A;  3MPR A;  3U8U A;  1HD7 A;  2IMQ X;  4CMN A;  5INO A;  2F1N A;  5J3P A;  3L1W A;  2JC5 A;  4GZ2 A;  3I41 A;  5DV4 A;  2DNJ A;  2DDR A;  3G0R A;  3GA6 A;  5CFG A;  3K55 A;  3TEB A;  2A41 B;  3G00 A;  4K6L F;  1DE8 A;  4F1H A;  4L20 A;  4B5M A;  3G4T A;  2UYR X;  2A42 B;  2XSW A;  3G3Y A;  2EI9 A;  4F1H B;  3I48 A;  4L1Y A;  4FPV A;  5INL A;  1VYB A;  2O3H A;  3G1K A;  3MTC A;  4IEM A;  5DG0 A;  4AWN A;  3W2X A;  4C1R A;  3DNI A;  5DFJ A;  2F2F B;  3G8V A;  2JC4 A;  1SI6 X;  3FZI A;  2V0R A;  1DE9 A;  2A3Z B;  5DFI A;  3G0A A;  1E9N A;  1ATN D;  1NTF A;  4B5G A;  4GZ0 A;  4L21 A;  5A7J A;  2DDT A;  3W2Y A;  5DFH A;  5INP A;  3G2C A;  3G38 A;  2ISI A;  3CJC D;  5INK A;  5J3S A;  5HT2 A;  2J63 A;  3NGN A;  4B5J A;  4RUW A;  3G3C A;  4FVA A;  2V0S A;  5INN A;  4B5H A;  1WDU A;  5DFF A;  4QHE A;  4F1R A;  2O3C A;  1SR4 B;  1ZWX A;  2D1K B;  1AKO A;  3WCX A;  1DNK A;  4B5F A;  3G91 A;  3NR8 A;  4GYZ A;  3G2D A;  3I5V A;  3I46 A;  1DEW A;  5J8N A;  1YJH A;  3NGQ A;  3G6S A;  2A40 B;  5J42 A;  2DDS A;  1BIX A;  4QHD A;  3NGO A;  5INM A;  1I9Y A;  4CML A;  1I9Z A;  5A7I A;  3W3D B;  4PUQ A;  5DV2 A;  4B5I A;  5CFE A;  4GZ1 A;  3N9V A;  4A9C A;  2VOA A;  4F1I A;  5EWT A;  4JG3 A;  1Y21 A;  4GEW A;  4LND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...