1CNJA

X-ray crystallographic studies of engineered hydrogen bond networks in a protein-zinc binding site
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
Knots found
sequence length
257
structure length
257
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLINFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase (oxo-acid)
molecule keywords CARBONIC ANHYDRASE II
publication title X-Ray Crystallographic Studies of Engineered Hydrogen Bond Networks in a Protein-Zinc Binding Site
pubmed rcsb
source organism Homo sapiens
total genus 78
structure length 257
sequence length 257
other databases KnotProt 2.0: K +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1995-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1cnjA00
1CNKA 3MNKA 1G3ZA 1IF7A 3M67A 1BN1A 3F4XA 4HT2A 1CAZA 4M2WA 1FR4A 1LG5A 1RZDA 4ZAOA 1FSNA 2X7TA 3MNHA 3HKTA 3M5SA 1AM6A 3FFPX 3P5LA 3RYZA 3MHLA 4R59A 4E3DA 2AX2A 2NNOA 4JSZA 4RN4A 2O4ZA 1FQNA 1CAMA 1FR7A 9CA2A 4Q90A 4XE1A 5CA2A 2WD3A 1ZSAA 4QSAA 1HUGA 5FLSA 5SZ7A 2CBAA 5SZ4A 3N4BA 1BCDA 2HKKA 3F7BA 3OYSA 4FRCA 5SZ1A 1G46A 2POWA 4JSAA 3RYYA 1DCBA 1XEGA 2NXSA 4RFCA 4E5QA 3RZ7A 4JSWA 3V3HB 4E49A 5DSMA 2HFWA 4ZWIA 1IF9A 5L3OA 5DSNA 3D92A 5AMDA 4HEYA 5DSIA 2CA2A 2FOYA 1I9OA 3IBUA 1CNYA 1G1DA 5FNKA 1KWQA 4PZHA 4WUPA 4Q7WA 3K7KA 5E2KA 3DVBA 1ZFQA 4YGLA 5DSKA 3UYQA 1ZFKA 4Q7PA 5FNLA 4Y0JA 4ZX0A 5BRWA 4HEZA 3M98A 5DSRA 3DA2A 3KS3A 3JXFA 3HKUA 4Q6EA 3T82A 4LHIA 3SBHA 1I91A 1CNHA 5E2NA 4YX4A 5JDVB 3S72B 4Q09A 5C8IA 3MMFA 1CA2A 1BNWA 3OIKA 4Q99A 4YHAA 5SZ2A 5DVXA 4COQA 2NN1A 8CA2A 1I9LA 5AMGA 4LU3A 1UGEA 4E3FA 1CAKA 3MNJA 4M2UA 2NWOA 1Z9YA 3IBLA 1CAHA 1LUGA 2ABEA 5G03A 2OSMA 4QY3A 3DCCA 4PQ7A 1FQMA 1FSRA 1I9PA 5FNMA 5FDCA 2QP6A 3TVOX 1G0FA 2IT4A 1T9NA 4XIXA 4RIUA 3T5UA 4QIZA 3MHCA 3C7PA 1FQRA 1FQLA 3RJ7A 4ILXA 4QSJA 1ZNCA 3DVDA 3U3AX 3OY0A 1BZMA 4HBAA 4Q78A 1JCZA 1YO0A 3P55A 2F14A 4YXUA 3M14A 4KP5A 4RUYA 1HECA 3BL0A 3MHMA 3MZCA 2VVBX 1JV0A 3FW3A 5LMDA 4KNMA 4CA2A 2WD2A 2CBEA 1CAIA 2X7SA 4N16A 3M5EA 1UGAA 3W6HA 2Q38A 1CCTA 1CNBA 3IGPA 2NWZA 1G4JA 2WEGA 4DZ9A 2WEHA 1ZGFA 1CNIA 5A25A 1BNNA 4DZ7A 3RYVB 1V9IC 4MLXA 3FE4A 4Q07A 1HCAA 1TG3A 1G4OA 1BNUA 3RGEA 4KUVA 3ZP9A 1IF6A 1KEQA 4Q49A 1ZSCA 3RZ0B 1G52A 3CZVA 4WR7A 1UGBA 3V5GA 2NNGA 5JEHB 1UGCA 1XPZA 2FNMA 4YYTA 4HEWA 3M2ZA 4BF1A 3M96A 4ZX1A 1JD0A 3M2XA 4X5SA 5E2RA 3OIMA 2FMGA 3T84A 3V2MA 5BNLA 5IPZA 4Q9YA 3MWOA 1YDDA 5FNJA 1CRAA 4MO8A 4QEFA 1RJ5A 4QJOA 4WUQA 4CNWA 4Q7SA 1CAYA 1H4NA 3VBDA 6CA2A 4QJXA 3V3GB 3HKNA 1XQ0A 3K2FA 3M2YA 3RZ5A 2ZNCA 5FLQA 2FW4A 5JG3B 1I8ZA 3RYXB 5FNHA 3Q31A 1H9QA 4JSSA 4ETQC 2NXTA 3MYQA 5JGSB 5CACA 4XZ5A 1CANA 3B4FA 3V2JA 4MDGA 1THKA 3U7CA 2POVA 2EU2A 3DV7A 5BRVA 4FIKA 1OQ5A 3PYKA 1TEUX 4IWZA 3DVCA 2NMXA 2WEJA 4GL1X 1J9WA 4YGJA 1DCAA 4QJPA 3HKQA 4HF3A 3V3JA 1G54A 2FOUA 3TVNX 4Q87A 1AZMA 3DD0A 2HOCA 2NN7A 1CALA 3CAJA 4FPTA 4KNNA 4Q0LA 1OKMA 1TG9A 3RLDA 12CAA 2NWPA 3N0NA 5E2MA 3KWAA 4CNXA 5FLRA 3KNEA 1IF4A 4RH2A 4LP6A 3SAPA 4YGNA 3D93A 3BL1A 3MNIA 4KUYA 1CVHA 1OKNA 3F8EA 3DBUA 2H15A 1URTA 1BICA 3S9TA 4M2RA 1CA3A 2CBBA 2NXRA 3KLDB 4K13A 3M40A 5DSOA 4K0SA 3PJJA 1CCUA 3KOIA 4WW8A 3M04A 1CRMA 3V7XA 5DSJA 3CYUA 3UYNA 3RG4A 1CZMA 5JQTA 5EKJA 4Z1KA 5EKHA 1KOQA 1OKLA 3U45X 4K0ZA 4Q7VA 5G0CA 4CNVA 2GD8A 1CVBA 3N2PA 3IBNA 4QK2A 4E3GA 4RFDA 4R5AA 4TWMA 4UOVA 2FMZA 1CVCA 3DD8A 3IAIA 1CNWA 5DSQA 4BCWA 1UGGA 3S77B 5FNGA 4QIYA 3HS4A 4MDLA 3DCSA 5E28A 4YGFA 4HU1A 5EHEA 2ILIA 3D9ZA 1I90A 4Q6DA 3TMJA 5CLUA 1I9QA 1TB0X 4KAPA 5DOGA 4YXOA 4CACA 2NWYA 4TWLA 4QSBA 3PO6A 4E9OX 1LG6A 3JXHC 5DOHA 5SZ5A 1DMXA 1G0EA 5DSLA 3NJ9A 4Q8XA 4Z0QA 4PXXA 4RIVA 3P5AA 3OILA 3RYJB 3N3JA 4G0CA 4KNJA 1FSQA 1RZAA 5FDIA 2AW1A 2NNVA 5JEGB 1YDBA 5G01A 4WL4A 3SAXA 5EH5A 1Z97A 4QJ0A 3S8XA 3BETA 2OSFA 5EH7A 2QO8A 5L6KA 2FOQA 3P44A 3R16A 5E5RA 3D0NA 5SZ3A 3P3HA 3ZNCA 1CAJA 2HD6A 3MHOA 4MDMA 3KIGA 3ML5A 3KKXA 1MOOA 3JXGA 1G48A 3M1QA 1ZH9A 4FL7A 3RG3A 4K0TA 3S78B 1BN3A 4KUWA 3DAZA 3KONA 5JGTB 5FLOA 4ZWYA 4PYYA 1RZEA 3MNUA 4YGKA 4QTLA 7CA2A 3S71B 4Q81A 2X7UA 1KWRA 4ITOA 4Z1NA 1A42A 2CBDA 3D8WA 2NNSA 4WW6A 4CQ0A 1I9NA 1DMYA 3LXEA 2FOVA 4N0XB 4PYXA 5DRSA 1CIMA 2FOSA 3M1JA 5CJFA 5FL6A 2H4NA 5AMLA 1CNXA 4FVNA 1KOPA 1AVNA 3M3XA 5SZ6A 3NI5A 3F7UA 4M2VA 1CVEA 1CINA 1MUAA 3IBIA 4HT0A 3R17B 4QJWA 3DC9A 4KP8A 1IF8A 1YO1A 2HL4A 3P3JA 3S76A 1UGFA 5JEPB 1LZVA 1G53A 4Q06A 4QSIA 3W6IA 4E3HA 5JESB 4CNRA 4E4AA 2HNCA 2Q1BA 1RZCA 5HPJA 2QOAA 2CABA 3P58A 3DCWA 3U47A 4Q83A 3M1WA 4K1QA 1XEVA 1BNTA 4Q08A 3RZ1B 2Q1QA 1UGDA 3GZ0A 1CAOA 1TEQX 3OKUA 3RZ8A 5JG5B 5EHVA 1G6VA 5EKMA 1HVAA 3L14A 3OYQA 1CCSA 4ITPA 1ZGEA 1G45A 1HCBA 4Z1JA 5EHWA 5FLPA 3P4VA 1BNMA 4C3TA 3IEOA 4MLTA 1HUHA 4Q8ZA 2FNNA 2CBCA 4L5WA 1BNQA 4KV0A 3NB5A 4KNIA 2FNKA 1CNJA 2EZ7A 1IF5A 1LGDA 5EOIA 3EFTA 1TE3X 5BRUA 2POUA 1Z93A 3OKVA 1ZE8A 1HEAA 4XFWA 1RAYA 3T83A 1BV3A 4L5VA 4QK1A 4RUZA 4XIWA 3HFPA 1V9EA 3HLJA 1CVAA 1HEBA 4RUXA 3SBIA 3T85A 4Z1EA 4QK3A 4R5BA 4YXIA 1YO2A 3CA2A 3MHIA 1YDAA 5SZ0A 3MNAA 1TH9A 5FL4A 1BN4A 1ZSBA 4ZWXA 4YWPA 3T5ZA 4FVOA 5JQ0A 4BF6A 3M2NA 3M5TA 4ZWZA 3QYKA 1EOUA 3B1BA 2GEHA 3S75B 2WEOA 5G0BA 5EH8A 1CNCA 5E5UA 3V3FA 4JS6A 3K34A 1RZBA 1H9NA 1TTMA 1CILA 1FLJA 1Y7WA 3DC3A 1CNGA 4FU5A 5FNIA 1F2WA 1RJ6A 4L5UA 3S74B 5BYIA 3S73B 5J8ZA 3S97A 3M1KA 1YDCA 4QJMA 4MTYA 3KOKA 1BNVA 4IDRX 4Q8YA 3EFIA 1I9MA 5E2SA 1CVFA 2VVAX 1RAZA 5EZTX 3MDZA 4G7AA 4YVYA 5FL5A 5DSPA 2EU3A 5FLTA 2W2JA 3ML2A 5A6HA 1TBTX 5EIJA 3V3IB 1CVDA 1HEDA
chains in the Genus database with same CATH superfamily
1CNKA 3MNKA 1G3ZA 1IF7A 3M67A 1BN1A 3F4XA 4HT2A 1CAZA 4M2WA 1FR4A 1LG5A 1RZDA 4ZAOA 1FSNA 2X7TA 3MNHA 3HKTA 3M5SA 1AM6A 3FFPX 3P5LA 3RYZA 3MHLA 4R59A 4E3DA 2AX2A 2NNOA 4JSZA 4RN4A 2O4ZA 1FQNA 1CAMA 1FR7A 9CA2A 4Q90A 4XE1A 5CA2A 2WD3A 1ZSAA 4QSAA 1HUGA 5FLSA 5SZ7A 2CBAA 5SZ4A 3N4BA 1BCDA 2HKKA 3F7BA 3OYSA 4FRCA 5SZ1A 1G46A 2POWA 4JSAA 3RYYA 1DCBA 1XEGA 2NXSA 4RFCA 4E5QA 3RZ7A 4JSWA 3V3HB 4E49A 5DSMA 2HFWA 4ZWIA 1IF9A 5L3OA 5DSNA 3D92A 5AMDA 4HEYA 5DSIA 2CA2A 2FOYA 1I9OA 3IBUA 1CNYA 1G1DA 5FNKA 1KWQA 4PZHA 4WUPA 4Q7WA 3K7KA 5E2KA 3DVBA 1ZFQA 4YGLA 5DSKA 3UYQA 1ZFKA 4Q7PA 5FNLA 4Y0JA 4ZX0A 5BRWA 4HEZA 3M98A 5DSRA 3DA2A 3KS3A 3JXFA 3HKUA 4Q6EA 3T82A 4LHIA 3SBHA 1I91A 1CNHA 5E2NA 4YX4A 5JDVB 3S72B 4Q09A 5C8IA 3MMFA 1CA2A 1BNWA 3OIKA 4Q99A 4YHAA 5SZ2A 5DVXA 4COQA 2NN1A 8CA2A 1I9LA 5AMGA 4LU3A 1UGEA 4E3FA 1CAKA 3MNJA 4M2UA 2NWOA 1Z9YA 3IBLA 1CAHA 1LUGA 2ABEA 5G03A 2OSMA 4QY3A 3DCCA 4PQ7A 1FQMA 1FSRA 1I9PA 5FNMA 5FDCA 2QP6A 3TVOX 1G0FA 2IT4A 1T9NA 4XIXA 4RIUA 3T5UA 4QIZA 3MHCA 3C7PA 1FQRA 1FQLA 3RJ7A 4ILXA 4QSJA 1ZNCA 3DVDA 3U3AX 3OY0A 1BZMA 4HBAA 4Q78A 1JCZA 1YO0A 3P55A 2F14A 4YXUA 3M14A 4KP5A 4RUYA 1HECA 3BL0A 3MHMA 3MZCA 2VVBX 1JV0A 3FW3A 5LMDA 4KNMA 4CA2A 2WD2A 2CBEA 1CAIA 2X7SA 4N16A 3M5EA 1UGAA 3W6HA 2Q38A 1CCTA 1CNBA 3IGPA 2NWZA 1G4JA 2WEGA 4DZ9A 2WEHA 1ZGFA 1CNIA 5A25A 1BNNA 4DZ7A 3RYVB 1V9IC 4MLXA 3FE4A 4Q07A 1HCAA 1TG3A 1G4OA 1BNUA 3RGEA 4KUVA 3ZP9A 1IF6A 1KEQA 4Q49A 1ZSCA 3RZ0B 1G52A 3CZVA 4WR7A 1UGBA 3V5GA 2NNGA 5JEHB 1UGCA 1XPZA 2FNMA 4YYTA 4HEWA 3M2ZA 4BF1A 3M96A 4ZX1A 1JD0A 3M2XA 4X5SA 5E2RA 3OIMA 2FMGA 3T84A 3V2MA 5BNLA 5IPZA 4Q9YA 3MWOA 1YDDA 5FNJA 1CRAA 4MO8A 4QEFA 1RJ5A 4QJOA 4WUQA 4CNWA 4Q7SA 1CAYA 1H4NA 3VBDA 6CA2A 4QJXA 3V3GB 3HKNA 1XQ0A 3K2FA 3M2YA 3RZ5A 2ZNCA 5FLQA 2FW4A 5JG3B 1I8ZA 3RYXB 5FNHA 3Q31A 1H9QA 4JSSA 4ETQC 2NXTA 3MYQA 5JGSB 5CACA 4XZ5A 1CANA 3B4FA 3V2JA 4MDGA 1THKA 3U7CA 2POVA 2EU2A 3DV7A 5BRVA 4FIKA 1OQ5A 3PYKA 1TEUX 4IWZA 3DVCA 2NMXA 2WEJA 4GL1X 1J9WA 4YGJA 1DCAA 4QJPA 3HKQA 4HF3A 3V3JA 1G54A 2FOUA 3TVNX 4Q87A 1AZMA 3DD0A 2HOCA 2NN7A 1CALA 3CAJA 4FPTA 4KNNA 4Q0LA 1OKMA 1TG9A 3RLDA 12CAA 2NWPA 3N0NA 5E2MA 3KWAA 4CNXA 5FLRA 3KNEA 1IF4A 4RH2A 4LP6A 3SAPA 4YGNA 3D93A 3BL1A 3MNIA 4KUYA 1CVHA 1OKNA 3F8EA 3DBUA 2H15A 1URTA 1BICA 3S9TA 4M2RA 1CA3A 2CBBA 2NXRA 3KLDB 4K13A 3M40A 5DSOA 4K0SA 3PJJA 1CCUA 3KOIA 4WW8A 3M04A 1CRMA 3V7XA 5DSJA 3CYUA 3UYNA 3RG4A 1CZMA 5JQTA 5EKJA 4Z1KA 5EKHA 1KOQA 1OKLA 3U45X 4K0ZA 4Q7VA 5G0CA 4CNVA 2GD8A 1CVBA 3N2PA 3IBNA 4QK2A 4E3GA 4RFDA 4R5AA 4TWMA 4UOVA 2FMZA 1CVCA 3DD8A 3IAIA 1CNWA 5DSQA 4BCWA 1UGGA 3S77B 5FNGA 4QIYA 3HS4A 4MDLA 3DCSA 5E28A 4YGFA 4HU1A 5EHEA 2ILIA 3D9ZA 1I90A 4Q6DA 3TMJA 5CLUA 1I9QA 1TB0X 4KAPA 5DOGA 4YXOA 4CACA 2NWYA 4TWLA 4QSBA 3PO6A 4E9OX 1LG6A 3JXHC 5DOHA 5SZ5A 1DMXA 1G0EA 5DSLA 3NJ9A 4Q8XA 4Z0QA 4PXXA 4RIVA 3P5AA 3OILA 3RYJB 3N3JA 4G0CA 4KNJA 1FSQA 1RZAA 5FDIA 2AW1A 2NNVA 5JEGB 1YDBA 5G01A 4WL4A 3SAXA 5EH5A 1Z97A 4QJ0A 3S8XA 3BETA 2OSFA 5EH7A 2QO8A 5L6KA 2FOQA 3P44A 3R16A 5E5RA 3D0NA 5SZ3A 3P3HA 3ZNCA 1CAJA 2HD6A 3MHOA 4MDMA 3KIGA 3ML5A 3KKXA 1MOOA 3JXGA 1G48A 3M1QA 1ZH9A 4FL7A 3RG3A 4K0TA 3S78B 1BN3A 4KUWA 3DAZA 3KONA 5JGTB 5FLOA 4ZWYA 4PYYA 1RZEA 3MNUA 4YGKA 4QTLA 7CA2A 3S71B 4Q81A 2X7UA 1KWRA 4ITOA 4Z1NA 1A42A 2CBDA 3D8WA 2NNSA 4WW6A 4CQ0A 1I9NA 1DMYA 3LXEA 2FOVA 4N0XB 4PYXA 5DRSA 1CIMA 2FOSA 3M1JA 5CJFA 5FL6A 2H4NA 5AMLA 1CNXA 4FVNA 1KOPA 1AVNA 3M3XA 5SZ6A 3NI5A 3F7UA 4M2VA 1CVEA 1CINA 1MUAA 3IBIA 4HT0A 3R17B 4QJWA 3DC9A 4KP8A 1IF8A 1YO1A 2HL4A 3P3JA 3S76A 1UGFA 5JEPB 1LZVA 1G53A 4Q06A 4QSIA 3W6IA 4E3HA 5JESB 4CNRA 4E4AA 2HNCA 2Q1BA 1RZCA 5HPJA 2QOAA 2CABA 3P58A 3DCWA 3U47A 4Q83A 3M1WA 4K1QA 1XEVA 1BNTA 4Q08A 3RZ1B 2Q1QA 1UGDA 3GZ0A 1CAOA 1TEQX 3OKUA 3RZ8A 5JG5B 5EHVA 1G6VA 5EKMA 1HVAA 3L14A 3OYQA 1CCSA 4ITPA 1ZGEA 1G45A 1HCBA 4Z1JA 5EHWA 5FLPA 3P4VA 1BNMA 4C3TA 3IEOA 4MLTA 1HUHA 4Q8ZA 2FNNA 2CBCA 4L5WA 1BNQA 4KV0A 3NB5A 4KNIA 2FNKA 1CNJA 2EZ7A 1IF5A 1LGDA 5EOIA 3EFTA 1TE3X 5BRUA 2POUA 1Z93A 3OKVA 1ZE8A 1HEAA 4XFWA 1RAYA 3T83A 1BV3A 4L5VA 4QK1A 4RUZA 4XIWA 3HFPA 1V9EA 3HLJA 1CVAA 1HEBA 4RUXA 3SBIA 3T85A 4Z1EA 4QK3A 4R5BA 4YXIA 1YO2A 3CA2A 3MHIA 1YDAA 5SZ0A 3MNAA 1TH9A 5FL4A 1BN4A 1ZSBA 4ZWXA 4YWPA 3T5ZA 4FVOA 5JQ0A 4BF6A 3M2NA 3M5TA 4ZWZA 3QYKA 1EOUA 3B1BA 2GEHA 3S75B 2WEOA 5G0BA 5EH8A 1CNCA 5E5UA 3V3FA 4JS6A 3K34A 1RZBA 1H9NA 1TTMA 1CILA 1FLJA 1Y7WA 3DC3A 1CNGA 4FU5A 5FNIA 1F2WA 1RJ6A 4L5UA 3S74B 5BYIA 3S73B 5J8ZA 3S97A 3M1KA 1YDCA 4QJMA 4MTYA 3KOKA 1BNVA 4IDRX 4Q8YA 3EFIA 1I9MA 5E2SA 1CVFA 2VVAX 1RAZA 5EZTX 3MDZA 4G7AA 4YVYA 5FL5A 5DSPA 2EU3A 5FLTA 2W2JA 3ML2A 5A6HA 1TBTX 5EIJA 3V3IB 1CVDA 1HEDA
chains in the Genus database with same CATH topology
1CNKA 3MNKA 1G3ZA 1IF7A 3M67A 1BN1A 3F4XA 4HT2A 1CAZA 4M2WA 1FR4A 1LG5A 1RZDA 4ZAOA 1FSNA 2X7TA 3MNHA 3HKTA 3M5SA 1AM6A 3FFPX 3P5LA 3RYZA 3MHLA 4R59A 4E3DA 2AX2A 2NNOA 4JSZA 4RN4A 2O4ZA 1FQNA 1CAMA 1FR7A 9CA2A 4Q90A 4XE1A 5CA2A 2WD3A 1ZSAA 4QSAA 1HUGA 5FLSA 5SZ7A 2CBAA 5SZ4A 3N4BA 1BCDA 2HKKA 3F7BA 3OYSA 4FRCA 5SZ1A 1G46A 2POWA 4JSAA 3RYYA 1DCBA 1XEGA 2NXSA 4RFCA 4E5QA 3RZ7A 4JSWA 3V3HB 4E49A 5DSMA 2HFWA 4ZWIA 1IF9A 5L3OA 5DSNA 3D92A 5AMDA 4HEYA 5DSIA 2CA2A 2FOYA 1I9OA 3IBUA 1CNYA 1G1DA 5FNKA 1KWQA 4PZHA 4WUPA 4Q7WA 3K7KA 5E2KA 3DVBA 1ZFQA 4YGLA 5DSKA 3UYQA 1ZFKA 4Q7PA 5FNLA 4Y0JA 4ZX0A 5BRWA 4HEZA 3M98A 5DSRA 3DA2A 3KS3A 3JXFA 3HKUA 4Q6EA 3T82A 4LHIA 3SBHA 1I91A 1CNHA 5E2NA 4YX4A 5JDVB 3S72B 4Q09A 5C8IA 3MMFA 1CA2A 1BNWA 3OIKA 4Q99A 4YHAA 5SZ2A 5DVXA 4COQA 2NN1A 8CA2A 1I9LA 5AMGA 4LU3A 1UGEA 4E3FA 1CAKA 3MNJA 4M2UA 2NWOA 1Z9YA 3IBLA 1CAHA 1LUGA 2ABEA 5G03A 2OSMA 4QY3A 3DCCA 4PQ7A 1FQMA 1FSRA 1I9PA 5FNMA 5FDCA 2QP6A 3TVOX 1G0FA 2IT4A 1T9NA 4XIXA 4RIUA 3T5UA 4QIZA 3MHCA 3C7PA 1FQRA 1FQLA 3RJ7A 4ILXA 4QSJA 1ZNCA 3DVDA 3U3AX 3OY0A 1BZMA 4HBAA 4Q78A 1JCZA 1YO0A 3P55A 2F14A 4YXUA 3M14A 4KP5A 4RUYA 1HECA 3BL0A 3MHMA 3MZCA 2VVBX 1JV0A 3FW3A 5LMDA 4KNMA 4CA2A 2WD2A 2CBEA 1CAIA 2X7SA 4N16A 3M5EA 1UGAA 3W6HA 2Q38A 1CCTA 1CNBA 3IGPA 2NWZA 1G4JA 2WEGA 4DZ9A 2WEHA 1ZGFA 1CNIA 5A25A 1BNNA 4DZ7A 3RYVB 1V9IC 4MLXA 3FE4A 4Q07A 1HCAA 1TG3A 1G4OA 1BNUA 3RGEA 4KUVA 3ZP9A 1IF6A 1KEQA 4Q49A 1ZSCA 3RZ0B 1G52A 3CZVA 4WR7A 1UGBA 3V5GA 2NNGA 5JEHB 1UGCA 1XPZA 2FNMA 4YYTA 4HEWA 3M2ZA 4BF1A 3M96A 4ZX1A 1JD0A 3M2XA 4X5SA 5E2RA 3OIMA 2FMGA 3T84A 3V2MA 5BNLA 5IPZA 4Q9YA 3MWOA 1YDDA 5FNJA 1CRAA 4MO8A 4QEFA 1RJ5A 4QJOA 4WUQA 4CNWA 4Q7SA 1CAYA 1H4NA 3VBDA 6CA2A 4QJXA 3V3GB 3HKNA 1XQ0A 3K2FA 3M2YA 3RZ5A 2ZNCA 5FLQA 2FW4A 5JG3B 1I8ZA 3RYXB 5FNHA 3Q31A 1H9QA 4JSSA 4ETQC 2NXTA 3MYQA 5JGSB 5CACA 4XZ5A 1CANA 3B4FA 3V2JA 4MDGA 1THKA 3U7CA 2POVA 2EU2A 3DV7A 5BRVA 4FIKA 1OQ5A 3PYKA 1TEUX 4IWZA 3DVCA 2NMXA 2WEJA 4GL1X 1J9WA 4YGJA 1DCAA 4QJPA 3HKQA 4HF3A 3V3JA 1G54A 2FOUA 3TVNX 4Q87A 1AZMA 3DD0A 2HOCA 2NN7A 1CALA 3CAJA 4FPTA 4KNNA 4Q0LA 1OKMA 1TG9A 3RLDA 12CAA 2NWPA 3N0NA 5E2MA 3KWAA 4CNXA 5FLRA 3KNEA 1IF4A 4RH2A 4LP6A 3SAPA 4YGNA 3D93A 3BL1A 3MNIA 4KUYA 1CVHA 1OKNA 3F8EA 3DBUA 2H15A 1URTA 1BICA 3S9TA 4M2RA 1CA3A 2CBBA 2NXRA 3KLDB 4K13A 3M40A 5DSOA 4K0SA 3PJJA 1CCUA 3KOIA 4WW8A 3M04A 1CRMA 3V7XA 5DSJA 3CYUA 3UYNA 3RG4A 1CZMA 5JQTA 5EKJA 4Z1KA 5EKHA 1KOQA 1OKLA 3U45X 4K0ZA 4Q7VA 5G0CA 4CNVA 2GD8A 1CVBA 3N2PA 3IBNA 4QK2A 4E3GA 4RFDA 4R5AA 4TWMA 4UOVA 2FMZA 1CVCA 3DD8A 3IAIA 1CNWA 5DSQA 4BCWA 1UGGA 3S77B 5FNGA 4QIYA 3HS4A 4MDLA 3DCSA 5E28A 4YGFA 4HU1A 5EHEA 2ILIA 3D9ZA 1I90A 4Q6DA 3TMJA 5CLUA 1I9QA 1TB0X 4KAPA 5DOGA 4YXOA 4CACA 2NWYA 4TWLA 4QSBA 3PO6A 4E9OX 1LG6A 3JXHC 5DOHA 5SZ5A 1DMXA 1G0EA 5DSLA 3NJ9A 4Q8XA 4Z0QA 4PXXA 4RIVA 3P5AA 3OILA 3RYJB 3N3JA 4G0CA 4KNJA 1FSQA 1RZAA 5FDIA 2AW1A 2NNVA 5JEGB 1YDBA 5G01A 4WL4A 3SAXA 5EH5A 1Z97A 4QJ0A 3S8XA 3BETA 2OSFA 5EH7A 2QO8A 5L6KA 2FOQA 3P44A 3R16A 5E5RA 3D0NA 5SZ3A 3P3HA 3ZNCA 1CAJA 2HD6A 3MHOA 4MDMA 3KIGA 3ML5A 3KKXA 1MOOA 3JXGA 1G48A 3M1QA 1ZH9A 4FL7A 3RG3A 4K0TA 3S78B 1BN3A 4KUWA 3DAZA 3KONA 5JGTB 5FLOA 4ZWYA 4PYYA 1RZEA 3MNUA 4YGKA 4QTLA 7CA2A 3S71B 4Q81A 2X7UA 1KWRA 4ITOA 4Z1NA 1A42A 2CBDA 3D8WA 2NNSA 4WW6A 4CQ0A 1I9NA 1DMYA 3LXEA 2FOVA 4N0XB 4PYXA 5DRSA 1CIMA 2FOSA 3M1JA 5CJFA 5FL6A 2H4NA 5AMLA 1CNXA 4FVNA 1KOPA 1AVNA 3M3XA 5SZ6A 3NI5A 3F7UA 4M2VA 1CVEA 1CINA 1MUAA 3IBIA 4HT0A 3R17B 4QJWA 3DC9A 4KP8A 1IF8A 1YO1A 2HL4A 3P3JA 3S76A 1UGFA 5JEPB 1LZVA 1G53A 4Q06A 4QSIA 3W6IA 4E3HA 5JESB 4CNRA 4E4AA 2HNCA 2Q1BA 1RZCA 5HPJA 2QOAA 2CABA 3P58A 3DCWA 3U47A 4Q83A 3M1WA 4K1QA 1XEVA 1BNTA 4Q08A 3RZ1B 2Q1QA 1UGDA 3GZ0A 1CAOA 1TEQX 3OKUA 3RZ8A 5JG5B 5EHVA 1G6VA 5EKMA 1HVAA 3L14A 3OYQA 1CCSA 4ITPA 1ZGEA 1G45A 1HCBA 4Z1JA 5EHWA 5FLPA 3P4VA 1BNMA 4C3TA 3IEOA 4MLTA 1HUHA 4Q8ZA 2FNNA 2CBCA 4L5WA 1BNQA 4KV0A 3NB5A 4KNIA 2FNKA 1CNJA 2EZ7A 1IF5A 1LGDA 5EOIA 3EFTA 1TE3X 5BRUA 2POUA 1Z93A 3OKVA 1ZE8A 1HEAA 4XFWA 1RAYA 3T83A 1BV3A 4L5VA 4QK1A 4RUZA 4XIWA 3HFPA 1V9EA 3HLJA 1CVAA 1HEBA 4RUXA 3SBIA 3T85A 4Z1EA 4QK3A 4R5BA 4YXIA 1YO2A 3CA2A 3MHIA 1YDAA 5SZ0A 3MNAA 1TH9A 5FL4A 1BN4A 1ZSBA 4ZWXA 4YWPA 3T5ZA 4FVOA 5JQ0A 4BF6A 3M2NA 3M5TA 4ZWZA 3QYKA 1EOUA 3B1BA 2GEHA 3S75B 2WEOA 5G0BA 5EH8A 1CNCA 5E5UA 3V3FA 4JS6A 3K34A 1RZBA 1H9NA 1TTMA 1CILA 1FLJA 1Y7WA 3DC3A 1CNGA 4FU5A 5FNIA 1F2WA 1RJ6A 4L5UA 3S74B 5BYIA 3S73B 5J8ZA 3S97A 3M1KA 1YDCA 4QJMA 4MTYA 3KOKA 1BNVA 4IDRX 4Q8YA 3EFIA 1I9MA 5E2SA 1CVFA 2VVAX 1RAZA 5EZTX 3MDZA 4G7AA 4YVYA 5FL5A 5DSPA 2EU3A 5FLTA 2W2JA 3ML2A 5A6HA 1TBTX 5EIJA 3V3IB 1CVDA 1HEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CNK A;  3MNK A;  1G3Z A;  1IF7 A;  3M67 A;  1BN1 A;  3F4X A;  4HT2 A;  1CAZ A;  4M2W A;  1FR4 A;  1LG5 A;  1RZD A;  4ZAO A;  1FSN A;  2X7T A;  3MNH A;  3HKT A;  3M5S A;  1AM6 A;  3FFP X;  3P5L A;  3RYZ A;  3MHL A;  4R59 A;  4E3D A;  2AX2 A;  2NNO A;  4JSZ A;  4RN4 A;  2O4Z A;  1FQN A;  1CAM A;  1FR7 A;  9CA2 A;  4Q90 A;  4XE1 A;  5CA2 A;  2WD3 A;  1ZSA A;  4QSA A;  1HUG A;  5FLS A;  5SZ7 A;  2CBA A;  5SZ4 A;  3N4B A;  1BCD A;  2HKK A;  3F7B A;  3OYS A;  4FRC A;  5SZ1 A;  1G46 A;  2POW A;  4JSA A;  3RYY A;  1DCB A;  1XEG A;  2NXS A;  4RFC A;  4E5Q A;  3RZ7 A;  4JSW A;  3V3H B;  4E49 A;  5DSM A;  2HFW A;  4ZWI A;  1IF9 A;  5L3O A;  5DSN A;  3D92 A;  5AMD A;  4HEY A;  5DSI A;  2CA2 A;  2FOY A;  1I9O A;  3IBU A;  1CNY A;  1G1D A;  5FNK A;  1KWQ A;  4PZH A;  4WUP A;  4Q7W A;  3K7K A;  5E2K A;  3DVB A;  1ZFQ A;  4YGL A;  5DSK A;  3UYQ A;  1ZFK A;  4Q7P A;  5FNL A;  4Y0J A;  4ZX0 A;  5BRW A;  4HEZ A;  3M98 A;  5DSR A;  3DA2 A;  3KS3 A;  3JXF A;  3HKU A;  4Q6E A;  3T82 A;  4LHI A;  3SBH A;  1I91 A;  1CNH A;  5E2N A;  4YX4 A;  5JDV B;  3S72 B;  4Q09 A;  5C8I A;  3MMF A;  1CA2 A;  1BNW A;  3OIK A;  4Q99 A;  4YHA A;  5SZ2 A;  5DVX A;  4COQ A;  2NN1 A;  8CA2 A;  1I9L A;  5AMG A;  4LU3 A;  1UGE A;  4E3F A;  1CAK A;  3MNJ A;  4M2U A;  2NWO A;  1Z9Y A;  3IBL A;  1CAH A;  1LUG A;  2ABE A;  5G03 A;  2OSM A;  4QY3 A;  3DCC A;  4PQ7 A;  1FQM A;  1FSR A;  1I9P A;  5FNM A;  5FDC A;  2QP6 A;  3TVO X;  1G0F A;  2IT4 A;  1T9N A;  4XIX A;  4RIU A;  3T5U A;  4QIZ A;  3MHC A;  3C7P A;  1FQR A;  1FQL A;  3RJ7 A;  4ILX A;  4QSJ A;  1ZNC A;  3DVD A;  3U3A X;  3OY0 A;  1BZM A;  4HBA A;  4Q78 A;  1JCZ A;  1YO0 A;  3P55 A;  2F14 A;  4YXU A;  3M14 A;  4KP5 A;  4RUY A;  1HEC A;  3BL0 A;  3MHM A;  3MZC A;  2VVB X;  1JV0 A;  3FW3 A;  5LMD A;  4KNM A;  4CA2 A;  2WD2 A;  2CBE A;  1CAI A;  2X7S A;  4N16 A;  3M5E A;  1UGA A;  3W6H A;  2Q38 A;  1CCT A;  1CNB A;  3IGP A;  2NWZ A;  1G4J A;  2WEG A;  4DZ9 A;  2WEH A;  1ZGF A;  1CNI A;  5A25 A;  1BNN A;  4DZ7 A;  3RYV B;  1V9I C;  4MLX A;  3FE4 A;  4Q07 A;  1HCA A;  1TG3 A;  1G4O A;  1BNU A;  3RGE A;  4KUV A;  3ZP9 A;  1IF6 A;  1KEQ A;  4Q49 A;  1ZSC A;  3RZ0 B;  1G52 A;  3CZV A;  4WR7 A;  1UGB A;  3V5G A;  2NNG A;  5JEH B;  1UGC A;  1XPZ A;  2FNM A;  4YYT A;  4HEW A;  3M2Z A;  4BF1 A;  3M96 A;  4ZX1 A;  1JD0 A;  3M2X A;  4X5S A;  5E2R A;  3OIM A;  2FMG A;  3T84 A;  3V2M A;  5BNL A;  5IPZ A;  4Q9Y A;  3MWO A;  1YDD A;  5FNJ A;  1CRA A;  4MO8 A;  4QEF A;  1RJ5 A;  4QJO A;  4WUQ A;  4CNW A;  4Q7S A;  1CAY A;  1H4N A;  3VBD A;  6CA2 A;  4QJX A;  3V3G B;  3HKN A;  1XQ0 A;  3K2F A;  3M2Y A;  3RZ5 A;  2ZNC A;  5FLQ A;  2FW4 A;  5JG3 B;  1I8Z A;  3RYX B;  5FNH A;  3Q31 A;  1H9Q A;  4JSS A;  4ETQ C;  2NXT A;  3MYQ A;  5JGS B;  5CAC A;  4XZ5 A;  1CAN A;  3B4F A;  3V2J A;  4MDG A;  1THK A;  3U7C A;  2POV A;  2EU2 A;  3DV7 A;  5BRV A;  4FIK A;  1OQ5 A;  3PYK A;  1TEU X;  4IWZ A;  3DVC A;  2NMX A;  2WEJ A;  4GL1 X;  1J9W A;  4YGJ A;  1DCA A;  4QJP A;  3HKQ A;  4HF3 A;  3V3J A;  1G54 A;  2FOU A;  3TVN X;  4Q87 A;  1AZM A;  3DD0 A;  2HOC A;  2NN7 A;  1CAL A;  3CAJ A;  4FPT A;  4KNN A;  4Q0L A;  1OKM A;  1TG9 A;  3RLD A;  12CA A;  2NWP A;  3N0N A;  5E2M A;  3KWA A;  4CNX A;  5FLR A;  3KNE A;  1IF4 A;  4RH2 A;  4LP6 A;  3SAP A;  4YGN A;  3D93 A;  3BL1 A;  3MNI A;  4KUY A;  1CVH A;  1OKN A;  3F8E A;  3DBU A;  2H15 A;  1URT A;  1BIC A;  3S9T A;  4M2R A;  1CA3 A;  2CBB A;  2NXR A;  3KLD B;  4K13 A;  3M40 A;  5DSO A;  4K0S A;  3PJJ A;  1CCU A;  3KOI A;  4WW8 A;  3M04 A;  1CRM A;  3V7X A;  5DSJ A;  3CYU A;  3UYN A;  3RG4 A;  1CZM A;  5JQT A;  5EKJ A;  4Z1K A;  5EKH A;  1KOQ A;  1OKL A;  3U45 X;  4K0Z A;  4Q7V A;  5G0C A;  4CNV A;  2GD8 A;  1CVB A;  3N2P A;  3IBN A;  4QK2 A;  4E3G A;  4RFD A;  4R5A A;  4TWM A;  4UOV A;  2FMZ A;  1CVC A;  3DD8 A;  3IAI A;  1CNW A;  5DSQ A;  4BCW A;  1UGG A;  3S77 B;  5FNG A;  4QIY A;  3HS4 A;  4MDL A;  3DCS A;  5E28 A;  4YGF A;  4HU1 A;  5EHE A;  2ILI A;  3D9Z A;  1I90 A;  4Q6D A;  3TMJ A;  5CLU A;  1I9Q A;  1TB0 X;  4KAP A;  5DOG A;  4YXO A;  4CAC A;  2NWY A;  4TWL A;  4QSB A;  3PO6 A;  4E9O X;  1LG6 A;  3JXH C;  5DOH A;  5SZ5 A;  1DMX A;  1G0E A;  5DSL A;  3NJ9 A;  4Q8X A;  4Z0Q A;  4PXX A;  4RIV A;  3P5A A;  3OIL A;  3RYJ B;  3N3J A;  4G0C A;  4KNJ A;  1FSQ A;  1RZA A;  5FDI A;  2AW1 A;  2NNV A;  5JEG B;  1YDB A;  5G01 A;  4WL4 A;  3SAX A;  5EH5 A;  1Z97 A;  4QJ0 A;  3S8X A;  3BET A;  2OSF A;  5EH7 A;  2QO8 A;  5L6K A;  2FOQ A;  3P44 A;  3R16 A;  5E5R A;  3D0N A;  5SZ3 A;  3P3H A;  3ZNC A;  1CAJ A;  2HD6 A;  3MHO A;  4MDM A;  3KIG A;  3ML5 A;  3KKX A;  1MOO A;  3JXG A;  1G48 A;  3M1Q A;  1ZH9 A;  4FL7 A;  3RG3 A;  4K0T A;  3S78 B;  1BN3 A;  4KUW A;  3DAZ A;  3KON A;  5JGT B;  5FLO A;  4ZWY A;  4PYY A;  1RZE A;  3MNU A;  4YGK A;  4QTL A;  7CA2 A;  3S71 B;  4Q81 A;  2X7U A;  1KWR A;  4ITO A;  4Z1N A;  1A42 A;  2CBD A;  3D8W A;  2NNS A;  4WW6 A;  4CQ0 A;  1I9N A;  1DMY A;  3LXE A;  2FOV A;  4N0X B;  4PYX A;  5DRS A;  1CIM A;  2FOS A;  3M1J A;  5CJF A;  5FL6 A;  2H4N A;  5AML A;  1CNX A;  4FVN A;  1KOP A;  1AVN A;  3M3X A;  5SZ6 A;  3NI5 A;  3F7U A;  4M2V A;  1CVE A;  1CIN A;  1MUA A;  3IBI A;  4HT0 A;  3R17 B;  4QJW A;  3DC9 A;  4KP8 A;  1IF8 A;  1YO1 A;  2HL4 A;  3P3J A;  3S76 A;  1UGF A;  5JEP B;  1LZV A;  1G53 A;  4Q06 A;  4QSI A;  3W6I A;  4E3H A;  5JES B;  4CNR A;  4E4A A;  2HNC A;  2Q1B A;  1RZC A;  5HPJ A;  2QOA A;  2CAB A;  3P58 A;  3DCW A;  3U47 A;  4Q83 A;  3M1W A;  4K1Q A;  1XEV A;  1BNT A;  4Q08 A;  3RZ1 B;  2Q1Q A;  1UGD A;  3GZ0 A;  1CAO A;  1TEQ X;  3OKU A;  3RZ8 A;  5JG5 B;  5EHV A;  1G6V A;  5EKM A;  1HVA A;  3L14 A;  3OYQ A;  1CCS A;  4ITP A;  1ZGE A;  1G45 A;  1HCB A;  4Z1J A;  5EHW A;  5FLP A;  3P4V A;  1BNM A;  4C3T A;  3IEO A;  4MLT A;  1HUH A;  4Q8Z A;  2FNN A;  2CBC A;  4L5W A;  1BNQ A;  4KV0 A;  3NB5 A;  4KNI A;  2FNK A;  1CNJ A;  2EZ7 A;  1IF5 A;  1LGD A;  5EOI A;  3EFT A;  1TE3 X;  5BRU A;  2POU A;  1Z93 A;  3OKV A;  1ZE8 A;  1HEA A;  4XFW A;  1RAY A;  3T83 A;  1BV3 A;  4L5V A;  4QK1 A;  4RUZ A;  4XIW A;  3HFP A;  1V9E A;  3HLJ A;  1CVA A;  1HEB A;  4RUX A;  3SBI A;  3T85 A;  4Z1E A;  4QK3 A;  4R5B A;  4YXI A;  1YO2 A;  3CA2 A;  3MHI A;  1YDA A;  5SZ0 A;  3MNA A;  1TH9 A;  5FL4 A;  1BN4 A;  1ZSB A;  4ZWX A;  4YWP A;  3T5Z A;  4FVO A;  5JQ0 A;  4BF6 A;  3M2N A;  3M5T A;  4ZWZ A;  3QYK A;  1EOU A;  3B1B A;  2GEH A;  3S75 B;  2WEO A;  5G0B A;  5EH8 A;  1CNC A;  5E5U A;  3V3F A;  4JS6 A;  3K34 A;  1RZB A;  1H9N A;  1TTM A;  1CIL A;  1FLJ A;  1Y7W A;  3DC3 A;  1CNG A;  4FU5 A;  5FNI A;  1F2W A;  1RJ6 A;  4L5U A;  3S74 B;  5BYI A;  3S73 B;  5J8Z A;  3S97 A;  3M1K A;  1YDC A;  4QJM A;  4MTY A;  3KOK A;  1BNV A;  4IDR X;  4Q8Y A;  3EFI A;  1I9M A;  5E2S A;  1CVF A;  2VVA X;  1RAZ A;  5EZT X;  3MDZ A;  4G7A A;  4YVY A;  5FL5 A;  5DSP A;  2EU3 A;  5FLT A;  2W2J A;  3ML2 A;  5A6H A;  1TBT X;  5EIJ A;  3V3I B;  1CVD A;  1HED A; 
#chains in the Genus database with same CATH topology
 1CNK A;  3MNK A;  1G3Z A;  1IF7 A;  3M67 A;  1BN1 A;  3F4X A;  4HT2 A;  1CAZ A;  4M2W A;  1FR4 A;  1LG5 A;  1RZD A;  4ZAO A;  1FSN A;  2X7T A;  3MNH A;  3HKT A;  3M5S A;  1AM6 A;  3FFP X;  3P5L A;  3RYZ A;  3MHL A;  4R59 A;  4E3D A;  2AX2 A;  2NNO A;  4JSZ A;  4RN4 A;  2O4Z A;  1FQN A;  1CAM A;  1FR7 A;  9CA2 A;  4Q90 A;  4XE1 A;  5CA2 A;  2WD3 A;  1ZSA A;  4QSA A;  1HUG A;  5FLS A;  5SZ7 A;  2CBA A;  5SZ4 A;  3N4B A;  1BCD A;  2HKK A;  3F7B A;  3OYS A;  4FRC A;  5SZ1 A;  1G46 A;  2POW A;  4JSA A;  3RYY A;  1DCB A;  1XEG A;  2NXS A;  4RFC A;  4E5Q A;  3RZ7 A;  4JSW A;  3V3H B;  4E49 A;  5DSM A;  2HFW A;  4ZWI A;  1IF9 A;  5L3O A;  5DSN A;  3D92 A;  5AMD A;  4HEY A;  5DSI A;  2CA2 A;  2FOY A;  1I9O A;  3IBU A;  1CNY A;  1G1D A;  5FNK A;  1KWQ A;  4PZH A;  4WUP A;  4Q7W A;  3K7K A;  5E2K A;  3DVB A;  1ZFQ A;  4YGL A;  5DSK A;  3UYQ A;  1ZFK A;  4Q7P A;  5FNL A;  4Y0J A;  4ZX0 A;  5BRW A;  4HEZ A;  3M98 A;  5DSR A;  3DA2 A;  3KS3 A;  3JXF A;  3HKU A;  4Q6E A;  3T82 A;  4LHI A;  3SBH A;  1I91 A;  1CNH A;  5E2N A;  4YX4 A;  5JDV B;  3S72 B;  4Q09 A;  5C8I A;  3MMF A;  1CA2 A;  1BNW A;  3OIK A;  4Q99 A;  4YHA A;  5SZ2 A;  5DVX A;  4COQ A;  2NN1 A;  8CA2 A;  1I9L A;  5AMG A;  4LU3 A;  1UGE A;  4E3F A;  1CAK A;  3MNJ A;  4M2U A;  2NWO A;  1Z9Y A;  3IBL A;  1CAH A;  1LUG A;  2ABE A;  5G03 A;  2OSM A;  4QY3 A;  3DCC A;  4PQ7 A;  1FQM A;  1FSR A;  1I9P A;  5FNM A;  5FDC A;  2QP6 A;  3TVO X;  1G0F A;  2IT4 A;  1T9N A;  4XIX A;  4RIU A;  3T5U A;  4QIZ A;  3MHC A;  3C7P A;  1FQR A;  1FQL A;  3RJ7 A;  4ILX A;  4QSJ A;  1ZNC A;  3DVD A;  3U3A X;  3OY0 A;  1BZM A;  4HBA A;  4Q78 A;  1JCZ A;  1YO0 A;  3P55 A;  2F14 A;  4YXU A;  3M14 A;  4KP5 A;  4RUY A;  1HEC A;  3BL0 A;  3MHM A;  3MZC A;  2VVB X;  1JV0 A;  3FW3 A;  5LMD A;  4KNM A;  4CA2 A;  2WD2 A;  2CBE A;  1CAI A;  2X7S A;  4N16 A;  3M5E A;  1UGA A;  3W6H A;  2Q38 A;  1CCT A;  1CNB A;  3IGP A;  2NWZ A;  1G4J A;  2WEG A;  4DZ9 A;  2WEH A;  1ZGF A;  1CNI A;  5A25 A;  1BNN A;  4DZ7 A;  3RYV B;  1V9I C;  4MLX A;  3FE4 A;  4Q07 A;  1HCA A;  1TG3 A;  1G4O A;  1BNU A;  3RGE A;  4KUV A;  3ZP9 A;  1IF6 A;  1KEQ A;  4Q49 A;  1ZSC A;  3RZ0 B;  1G52 A;  3CZV A;  4WR7 A;  1UGB A;  3V5G A;  2NNG A;  5JEH B;  1UGC A;  1XPZ A;  2FNM A;  4YYT A;  4HEW A;  3M2Z A;  4BF1 A;  3M96 A;  4ZX1 A;  1JD0 A;  3M2X A;  4X5S A;  5E2R A;  3OIM A;  2FMG A;  3T84 A;  3V2M A;  5BNL A;  5IPZ A;  4Q9Y A;  3MWO A;  1YDD A;  5FNJ A;  1CRA A;  4MO8 A;  4QEF A;  1RJ5 A;  4QJO A;  4WUQ A;  4CNW A;  4Q7S A;  1CAY A;  1H4N A;  3VBD A;  6CA2 A;  4QJX A;  3V3G B;  3HKN A;  1XQ0 A;  3K2F A;  3M2Y A;  3RZ5 A;  2ZNC A;  5FLQ A;  2FW4 A;  5JG3 B;  1I8Z A;  3RYX B;  5FNH A;  3Q31 A;  1H9Q A;  4JSS A;  4ETQ C;  2NXT A;  3MYQ A;  5JGS B;  5CAC A;  4XZ5 A;  1CAN A;  3B4F A;  3V2J A;  4MDG A;  1THK A;  3U7C A;  2POV A;  2EU2 A;  3DV7 A;  5BRV A;  4FIK A;  1OQ5 A;  3PYK A;  1TEU X;  4IWZ A;  3DVC A;  2NMX A;  2WEJ A;  4GL1 X;  1J9W A;  4YGJ A;  1DCA A;  4QJP A;  3HKQ A;  4HF3 A;  3V3J A;  1G54 A;  2FOU A;  3TVN X;  4Q87 A;  1AZM A;  3DD0 A;  2HOC A;  2NN7 A;  1CAL A;  3CAJ A;  4FPT A;  4KNN A;  4Q0L A;  1OKM A;  1TG9 A;  3RLD A;  12CA A;  2NWP A;  3N0N A;  5E2M A;  3KWA A;  4CNX A;  5FLR A;  3KNE A;  1IF4 A;  4RH2 A;  4LP6 A;  3SAP A;  4YGN A;  3D93 A;  3BL1 A;  3MNI A;  4KUY A;  1CVH A;  1OKN A;  3F8E A;  3DBU A;  2H15 A;  1URT A;  1BIC A;  3S9T A;  4M2R A;  1CA3 A;  2CBB A;  2NXR A;  3KLD B;  4K13 A;  3M40 A;  5DSO A;  4K0S A;  3PJJ A;  1CCU A;  3KOI A;  4WW8 A;  3M04 A;  1CRM A;  3V7X A;  5DSJ A;  3CYU A;  3UYN A;  3RG4 A;  1CZM A;  5JQT A;  5EKJ A;  4Z1K A;  5EKH A;  1KOQ A;  1OKL A;  3U45 X;  4K0Z A;  4Q7V A;  5G0C A;  4CNV A;  2GD8 A;  1CVB A;  3N2P A;  3IBN A;  4QK2 A;  4E3G A;  4RFD A;  4R5A A;  4TWM A;  4UOV A;  2FMZ A;  1CVC A;  3DD8 A;  3IAI A;  1CNW A;  5DSQ A;  4BCW A;  1UGG A;  3S77 B;  5FNG A;  4QIY A;  3HS4 A;  4MDL A;  3DCS A;  5E28 A;  4YGF A;  4HU1 A;  5EHE A;  2ILI A;  3D9Z A;  1I90 A;  4Q6D A;  3TMJ A;  5CLU A;  1I9Q A;  1TB0 X;  4KAP A;  5DOG A;  4YXO A;  4CAC A;  2NWY A;  4TWL A;  4QSB A;  3PO6 A;  4E9O X;  1LG6 A;  3JXH C;  5DOH A;  5SZ5 A;  1DMX A;  1G0E A;  5DSL A;  3NJ9 A;  4Q8X A;  4Z0Q A;  4PXX A;  4RIV A;  3P5A A;  3OIL A;  3RYJ B;  3N3J A;  4G0C A;  4KNJ A;  1FSQ A;  1RZA A;  5FDI A;  2AW1 A;  2NNV A;  5JEG B;  1YDB A;  5G01 A;  4WL4 A;  3SAX A;  5EH5 A;  1Z97 A;  4QJ0 A;  3S8X A;  3BET A;  2OSF A;  5EH7 A;  2QO8 A;  5L6K A;  2FOQ A;  3P44 A;  3R16 A;  5E5R A;  3D0N A;  5SZ3 A;  3P3H A;  3ZNC A;  1CAJ A;  2HD6 A;  3MHO A;  4MDM A;  3KIG A;  3ML5 A;  3KKX A;  1MOO A;  3JXG A;  1G48 A;  3M1Q A;  1ZH9 A;  4FL7 A;  3RG3 A;  4K0T A;  3S78 B;  1BN3 A;  4KUW A;  3DAZ A;  3KON A;  5JGT B;  5FLO A;  4ZWY A;  4PYY A;  1RZE A;  3MNU A;  4YGK A;  4QTL A;  7CA2 A;  3S71 B;  4Q81 A;  2X7U A;  1KWR A;  4ITO A;  4Z1N A;  1A42 A;  2CBD A;  3D8W A;  2NNS A;  4WW6 A;  4CQ0 A;  1I9N A;  1DMY A;  3LXE A;  2FOV A;  4N0X B;  4PYX A;  5DRS A;  1CIM A;  2FOS A;  3M1J A;  5CJF A;  5FL6 A;  2H4N A;  5AML A;  1CNX A;  4FVN A;  1KOP A;  1AVN A;  3M3X A;  5SZ6 A;  3NI5 A;  3F7U A;  4M2V A;  1CVE A;  1CIN A;  1MUA A;  3IBI A;  4HT0 A;  3R17 B;  4QJW A;  3DC9 A;  4KP8 A;  1IF8 A;  1YO1 A;  2HL4 A;  3P3J A;  3S76 A;  1UGF A;  5JEP B;  1LZV A;  1G53 A;  4Q06 A;  4QSI A;  3W6I A;  4E3H A;  5JES B;  4CNR A;  4E4A A;  2HNC A;  2Q1B A;  1RZC A;  5HPJ A;  2QOA A;  2CAB A;  3P58 A;  3DCW A;  3U47 A;  4Q83 A;  3M1W A;  4K1Q A;  1XEV A;  1BNT A;  4Q08 A;  3RZ1 B;  2Q1Q A;  1UGD A;  3GZ0 A;  1CAO A;  1TEQ X;  3OKU A;  3RZ8 A;  5JG5 B;  5EHV A;  1G6V A;  5EKM A;  1HVA A;  3L14 A;  3OYQ A;  1CCS A;  4ITP A;  1ZGE A;  1G45 A;  1HCB A;  4Z1J A;  5EHW A;  5FLP A;  3P4V A;  1BNM A;  4C3T A;  3IEO A;  4MLT A;  1HUH A;  4Q8Z A;  2FNN A;  2CBC A;  4L5W A;  1BNQ A;  4KV0 A;  3NB5 A;  4KNI A;  2FNK A;  1CNJ A;  2EZ7 A;  1IF5 A;  1LGD A;  5EOI A;  3EFT A;  1TE3 X;  5BRU A;  2POU A;  1Z93 A;  3OKV A;  1ZE8 A;  1HEA A;  4XFW A;  1RAY A;  3T83 A;  1BV3 A;  4L5V A;  4QK1 A;  4RUZ A;  4XIW A;  3HFP A;  1V9E A;  3HLJ A;  1CVA A;  1HEB A;  4RUX A;  3SBI A;  3T85 A;  4Z1E A;  4QK3 A;  4R5B A;  4YXI A;  1YO2 A;  3CA2 A;  3MHI A;  1YDA A;  5SZ0 A;  3MNA A;  1TH9 A;  5FL4 A;  1BN4 A;  1ZSB A;  4ZWX A;  4YWP A;  3T5Z A;  4FVO A;  5JQ0 A;  4BF6 A;  3M2N A;  3M5T A;  4ZWZ A;  3QYK A;  1EOU A;  3B1B A;  2GEH A;  3S75 B;  2WEO A;  5G0B A;  5EH8 A;  1CNC A;  5E5U A;  3V3F A;  4JS6 A;  3K34 A;  1RZB A;  1H9N A;  1TTM A;  1CIL A;  1FLJ A;  1Y7W A;  3DC3 A;  1CNG A;  4FU5 A;  5FNI A;  1F2W A;  1RJ6 A;  4L5U A;  3S74 B;  5BYI A;  3S73 B;  5J8Z A;  3S97 A;  3M1K A;  1YDC A;  4QJM A;  4MTY A;  3KOK A;  1BNV A;  4IDR X;  4Q8Y A;  3EFI A;  1I9M A;  5E2S A;  1CVF A;  2VVA X;  1RAZ A;  5EZT X;  3MDZ A;  4G7A A;  4YVY A;  5FL5 A;  5DSP A;  2EU3 A;  5FLT A;  2W2J A;  3ML2 A;  5A6H A;  1TBT X;  5EIJ A;  3V3I B;  1CVD A;  1HED A; 
#chains in the Genus database with same CATH homology
 1CNK A;  3MNK A;  1G3Z A;  1IF7 A;  3M67 A;  1BN1 A;  3F4X A;  4HT2 A;  1CAZ A;  4M2W A;  1FR4 A;  1LG5 A;  1RZD A;  4ZAO A;  1FSN A;  2X7T A;  3MNH A;  3HKT A;  3M5S A;  1AM6 A;  3FFP X;  3P5L A;  3RYZ A;  3MHL A;  4R59 A;  4E3D A;  2AX2 A;  2NNO A;  4JSZ A;  4RN4 A;  2O4Z A;  1FQN A;  1CAM A;  1FR7 A;  9CA2 A;  4Q90 A;  4XE1 A;  5CA2 A;  2WD3 A;  1ZSA A;  4QSA A;  1HUG A;  5FLS A;  5SZ7 A;  2CBA A;  5SZ4 A;  3N4B A;  1BCD A;  2HKK A;  3F7B A;  3OYS A;  4FRC A;  5SZ1 A;  1G46 A;  2POW A;  4JSA A;  3RYY A;  1DCB A;  1XEG A;  2NXS A;  4RFC A;  4E5Q A;  3RZ7 A;  4JSW A;  3V3H B;  4E49 A;  5DSM A;  2HFW A;  4ZWI A;  1IF9 A;  5L3O A;  5DSN A;  3D92 A;  5AMD A;  4HEY A;  5DSI A;  2CA2 A;  2FOY A;  1I9O A;  3IBU A;  1CNY A;  1G1D A;  5FNK A;  1KWQ A;  4PZH A;  4WUP A;  4Q7W A;  3K7K A;  5E2K A;  3DVB A;  1ZFQ A;  4YGL A;  5DSK A;  3UYQ A;  1ZFK A;  4Q7P A;  5FNL A;  4Y0J A;  4ZX0 A;  5BRW A;  4HEZ A;  3M98 A;  5DSR A;  3DA2 A;  3KS3 A;  3JXF A;  3HKU A;  4Q6E A;  3T82 A;  4LHI A;  3SBH A;  1I91 A;  1CNH A;  5E2N A;  4YX4 A;  5JDV B;  3S72 B;  4Q09 A;  5C8I A;  3MMF A;  1CA2 A;  1BNW A;  3OIK A;  4Q99 A;  4YHA A;  5SZ2 A;  5DVX A;  4COQ A;  2NN1 A;  8CA2 A;  1I9L A;  5AMG A;  4LU3 A;  1UGE A;  4E3F A;  1CAK A;  3MNJ A;  4M2U A;  2NWO A;  1Z9Y A;  3IBL A;  1CAH A;  1LUG A;  2ABE A;  5G03 A;  2OSM A;  4QY3 A;  3DCC A;  4PQ7 A;  1FQM A;  1FSR A;  1I9P A;  5FNM A;  5FDC A;  2QP6 A;  3TVO X;  1G0F A;  2IT4 A;  1T9N A;  4XIX A;  4RIU A;  3T5U A;  4QIZ A;  3MHC A;  3C7P A;  1FQR A;  1FQL A;  3RJ7 A;  4ILX A;  4QSJ A;  1ZNC A;  3DVD A;  3U3A X;  3OY0 A;  1BZM A;  4HBA A;  4Q78 A;  1JCZ A;  1YO0 A;  3P55 A;  2F14 A;  4YXU A;  3M14 A;  4KP5 A;  4RUY A;  1HEC A;  3BL0 A;  3MHM A;  3MZC A;  2VVB X;  1JV0 A;  3FW3 A;  5LMD A;  4KNM A;  4CA2 A;  2WD2 A;  2CBE A;  1CAI A;  2X7S A;  4N16 A;  3M5E A;  1UGA A;  3W6H A;  2Q38 A;  1CCT A;  1CNB A;  3IGP A;  2NWZ A;  1G4J A;  2WEG A;  4DZ9 A;  2WEH A;  1ZGF A;  1CNI A;  5A25 A;  1BNN A;  4DZ7 A;  3RYV B;  1V9I C;  4MLX A;  3FE4 A;  4Q07 A;  1HCA A;  1TG3 A;  1G4O A;  1BNU A;  3RGE A;  4KUV A;  3ZP9 A;  1IF6 A;  1KEQ A;  4Q49 A;  1ZSC A;  3RZ0 B;  1G52 A;  3CZV A;  4WR7 A;  1UGB A;  3V5G A;  2NNG A;  5JEH B;  1UGC A;  1XPZ A;  2FNM A;  4YYT A;  4HEW A;  3M2Z A;  4BF1 A;  3M96 A;  4ZX1 A;  1JD0 A;  3M2X A;  4X5S A;  5E2R A;  3OIM A;  2FMG A;  3T84 A;  3V2M A;  5BNL A;  5IPZ A;  4Q9Y A;  3MWO A;  1YDD A;  5FNJ A;  1CRA A;  4MO8 A;  4QEF A;  1RJ5 A;  4QJO A;  4WUQ A;  4CNW A;  4Q7S A;  1CAY A;  1H4N A;  3VBD A;  6CA2 A;  4QJX A;  3V3G B;  3HKN A;  1XQ0 A;  3K2F A;  3M2Y A;  3RZ5 A;  2ZNC A;  5FLQ A;  2FW4 A;  5JG3 B;  1I8Z A;  3RYX B;  5FNH A;  3Q31 A;  1H9Q A;  4JSS A;  4ETQ C;  2NXT A;  3MYQ A;  5JGS B;  5CAC A;  4XZ5 A;  1CAN A;  3B4F A;  3V2J A;  4MDG A;  1THK A;  3U7C A;  2POV A;  2EU2 A;  3DV7 A;  5BRV A;  4FIK A;  1OQ5 A;  3PYK A;  1TEU X;  4IWZ A;  3DVC A;  2NMX A;  2WEJ A;  4GL1 X;  1J9W A;  4YGJ A;  1DCA A;  4QJP A;  3HKQ A;  4HF3 A;  3V3J A;  1G54 A;  2FOU A;  3TVN X;  4Q87 A;  1AZM A;  3DD0 A;  2HOC A;  2NN7 A;  1CAL A;  3CAJ A;  4FPT A;  4KNN A;  4Q0L A;  1OKM A;  1TG9 A;  3RLD A;  12CA A;  2NWP A;  3N0N A;  5E2M A;  3KWA A;  4CNX A;  5FLR A;  3KNE A;  1IF4 A;  4RH2 A;  4LP6 A;  3SAP A;  4YGN A;  3D93 A;  3BL1 A;  3MNI A;  4KUY A;  1CVH A;  1OKN A;  3F8E A;  3DBU A;  2H15 A;  1URT A;  1BIC A;  3S9T A;  4M2R A;  1CA3 A;  2CBB A;  2NXR A;  3KLD B;  4K13 A;  3M40 A;  5DSO A;  4K0S A;  3PJJ A;  1CCU A;  3KOI A;  4WW8 A;  3M04 A;  1CRM A;  3V7X A;  5DSJ A;  3CYU A;  3UYN A;  3RG4 A;  1CZM A;  5JQT A;  5EKJ A;  4Z1K A;  5EKH A;  1KOQ A;  1OKL A;  3U45 X;  4K0Z A;  4Q7V A;  5G0C A;  4CNV A;  2GD8 A;  1CVB A;  3N2P A;  3IBN A;  4QK2 A;  4E3G A;  4RFD A;  4R5A A;  4TWM A;  4UOV A;  2FMZ A;  1CVC A;  3DD8 A;  3IAI A;  1CNW A;  5DSQ A;  4BCW A;  1UGG A;  3S77 B;  5FNG A;  4QIY A;  3HS4 A;  4MDL A;  3DCS A;  5E28 A;  4YGF A;  4HU1 A;  5EHE A;  2ILI A;  3D9Z A;  1I90 A;  4Q6D A;  3TMJ A;  5CLU A;  1I9Q A;  1TB0 X;  4KAP A;  5DOG A;  4YXO A;  4CAC A;  2NWY A;  4TWL A;  4QSB A;  3PO6 A;  4E9O X;  1LG6 A;  3JXH C;  5DOH A;  5SZ5 A;  1DMX A;  1G0E A;  5DSL A;  3NJ9 A;  4Q8X A;  4Z0Q A;  4PXX A;  4RIV A;  3P5A A;  3OIL A;  3RYJ B;  3N3J A;  4G0C A;  4KNJ A;  1FSQ A;  1RZA A;  5FDI A;  2AW1 A;  2NNV A;  5JEG B;  1YDB A;  5G01 A;  4WL4 A;  3SAX A;  5EH5 A;  1Z97 A;  4QJ0 A;  3S8X A;  3BET A;  2OSF A;  5EH7 A;  2QO8 A;  5L6K A;  2FOQ A;  3P44 A;  3R16 A;  5E5R A;  3D0N A;  5SZ3 A;  3P3H A;  3ZNC A;  1CAJ A;  2HD6 A;  3MHO A;  4MDM A;  3KIG A;  3ML5 A;  3KKX A;  1MOO A;  3JXG A;  1G48 A;  3M1Q A;  1ZH9 A;  4FL7 A;  3RG3 A;  4K0T A;  3S78 B;  1BN3 A;  4KUW A;  3DAZ A;  3KON A;  5JGT B;  5FLO A;  4ZWY A;  4PYY A;  1RZE A;  3MNU A;  4YGK A;  4QTL A;  7CA2 A;  3S71 B;  4Q81 A;  2X7U A;  1KWR A;  4ITO A;  4Z1N A;  1A42 A;  2CBD A;  3D8W A;  2NNS A;  4WW6 A;  4CQ0 A;  1I9N A;  1DMY A;  3LXE A;  2FOV A;  4N0X B;  4PYX A;  5DRS A;  1CIM A;  2FOS A;  3M1J A;  5CJF A;  5FL6 A;  2H4N A;  5AML A;  1CNX A;  4FVN A;  1KOP A;  1AVN A;  3M3X A;  5SZ6 A;  3NI5 A;  3F7U A;  4M2V A;  1CVE A;  1CIN A;  1MUA A;  3IBI A;  4HT0 A;  3R17 B;  4QJW A;  3DC9 A;  4KP8 A;  1IF8 A;  1YO1 A;  2HL4 A;  3P3J A;  3S76 A;  1UGF A;  5JEP B;  1LZV A;  1G53 A;  4Q06 A;  4QSI A;  3W6I A;  4E3H A;  5JES B;  4CNR A;  4E4A A;  2HNC A;  2Q1B A;  1RZC A;  5HPJ A;  2QOA A;  2CAB A;  3P58 A;  3DCW A;  3U47 A;  4Q83 A;  3M1W A;  4K1Q A;  1XEV A;  1BNT A;  4Q08 A;  3RZ1 B;  2Q1Q A;  1UGD A;  3GZ0 A;  1CAO A;  1TEQ X;  3OKU A;  3RZ8 A;  5JG5 B;  5EHV A;  1G6V A;  5EKM A;  1HVA A;  3L14 A;  3OYQ A;  1CCS A;  4ITP A;  1ZGE A;  1G45 A;  1HCB A;  4Z1J A;  5EHW A;  5FLP A;  3P4V A;  1BNM A;  4C3T A;  3IEO A;  4MLT A;  1HUH A;  4Q8Z A;  2FNN A;  2CBC A;  4L5W A;  1BNQ A;  4KV0 A;  3NB5 A;  4KNI A;  2FNK A;  1CNJ A;  2EZ7 A;  1IF5 A;  1LGD A;  5EOI A;  3EFT A;  1TE3 X;  5BRU A;  2POU A;  1Z93 A;  3OKV A;  1ZE8 A;  1HEA A;  4XFW A;  1RAY A;  3T83 A;  1BV3 A;  4L5V A;  4QK1 A;  4RUZ A;  4XIW A;  3HFP A;  1V9E A;  3HLJ A;  1CVA A;  1HEB A;  4RUX A;  3SBI A;  3T85 A;  4Z1E A;  4QK3 A;  4R5B A;  4YXI A;  1YO2 A;  3CA2 A;  3MHI A;  1YDA A;  5SZ0 A;  3MNA A;  1TH9 A;  5FL4 A;  1BN4 A;  1ZSB A;  4ZWX A;  4YWP A;  3T5Z A;  4FVO A;  5JQ0 A;  4BF6 A;  3M2N A;  3M5T A;  4ZWZ A;  3QYK A;  1EOU A;  3B1B A;  2GEH A;  3S75 B;  2WEO A;  5G0B A;  5EH8 A;  1CNC A;  5E5U A;  3V3F A;  4JS6 A;  3K34 A;  1RZB A;  1H9N A;  1TTM A;  1CIL A;  1FLJ A;  1Y7W A;  3DC3 A;  1CNG A;  4FU5 A;  5FNI A;  1F2W A;  1RJ6 A;  4L5U A;  3S74 B;  5BYI A;  3S73 B;  5J8Z A;  3S97 A;  3M1K A;  1YDC A;  4QJM A;  4MTY A;  3KOK A;  1BNV A;  4IDR X;  4Q8Y A;  3EFI A;  1I9M A;  5E2S A;  1CVF A;  2VVA X;  1RAZ A;  5EZT X;  3MDZ A;  4G7A A;  4YVY A;  5FL5 A;  5DSP A;  2EU3 A;  5FLT A;  2W2J A;  3ML2 A;  5A6H A;  1TBT X;  5EIJ A;  3V3I B;  1CVD A;  1HED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...