1CNJA

X-ray crystallographic studies of engineered hydrogen bond networks in a protein-zinc binding site
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
Knots found
sequence length
257
structure length
257
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLINFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Crystallographic Studies of Engineered Hydrogen Bond Networks in a Protein-Zinc Binding Site
pubmed rcsb
source organism Homo sapiens
molecule tags Lyase (oxo-acid)
molecule keywords CARBONIC ANHYDRASE II
total genus 78
structure length 257
sequence length 257
other databases KnotProt 2.0: K +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1995-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1cnjA00
1G0EA 3MNKA 4Q07A 2NNGA 2X7TA 1ZGFA 4RUXA 5EKHA 5FNLA 4WR7A 2FMZA 3MNUA 2POWA 4E3HA 1FSRA 1BNTA 1CAIA 4QK3A 5C8IA 4ZWYA 4YHAA 3D9ZA 4HBAA 3M1JA 4RN4A 4Y0JA 3S73B 3DCSA 4KNIA 1DCBA 2WEGA 3M2ZA 5FLOA 5CLUA 2WD3A 4Q7VA 12CAA 1UGFA 1CAYA 1CAHA 1G0FA 2AX2A 3U3AX 4YVYA 4PZHA 3HKQA 1RJ6A 2OSMA 5DSRA 1DMXA 3DCCA 2POVA 3DC3A 4QJOA 4GL1X 3S75B 2NWOA 4PXXA 1ZH9A 2NNSA 3S78B 4COQA 3KLDB 1EOUA 1OKNA 3T5ZA 1URTA 3D8WA 4Q78A 3ZP9A 3FFPX 3PO6A 5EZTX 5CA2A 4E3DA 1UGBA 3HS4A 4CNWA 3M5SA 1BNVA 4WL4A 2QO8A 7CA2A 4LU3A 2Q1BA 5JG5B 1CVBA 4ILXA 1YO1A 1CILA 2H15A 3PJJA 3V3FA 3IBUA 3MNJA 3M1QA 3U7CA 4WUQA 2CBCA 3HKUA 1I9LA 3KKXA 4L5UA 4E3FA 1RZCA 4RIUA 2NN7A 5G0BA 3RYZA 4XE1A 4FRCA 4M2RA 1THKA 1CAMA 1CA2A 3BETA 3P44A 1LUGA 1Z93A 3BL1A 3MZCA 4Q8YA 1ZFQA 4RFDA 1XQ0A 2WEOA 3SAPA 5SZ4A 2HL4A 4HEZA 2NXTA 2FNNA 4XZ5A 4G0CA 4ZWIA 1XEGA 1CIMA 4Q83A 4RUYA 4X5SA 4HT0A 5E2KA 1KWRA 4ZWXA 4DZ9A 4HT2A 3M67A 2HOCA 5FNMA 1H4NA 5DVXA 4YGFA 4LHIA 4FPTA 4RH2A 4YX4A 4JSAA 3V5GA 1CALA 3OYQA 4XIWA 1ZSAA 4YXOA 5EHVA 1G6VA 2FNMA 5CACA 1TEUX 2HFWA 4XIXA 5DSKA 4QK2A 3K2FA 3S74B 3MWOA 5BRVA 4QJPA 5FL5A 5CJFA 5FLSA 5JESB 1AZMA 2CBAA 2QP6A 1BNQA 1TG9A 5E5UA 5JGTB 4L5VA 4Q87A 4QJWA 1CCTA 5EH5A 1HCBA 3CYUA 1RZEA 3R16A 3S8XA 3M2XA 4MLXA 1RZBA 1XEVA 5DSNA 2CBBA 4KUWA 1BNNA 3BL0A 5L3OA 1ZGEA 2EZ7A 3EFIA 4XFWA 4BF1A 4PQ7A 5JEHB 1I9MA 4QJMA 3MHOA 1G3ZA 5EH7A 3M3XA 1RZDA 2WEJA 3RYYA 1Y7WA 3DVCA 5L6KA 1XPZA 5SZ5A 4YGKA 4Q99A 1RJ5A 1FQLA 5JGSB 3S9TA 1I9OA 4K1QA 4QIZA 5G03A 4Z1NA 4M2VA 1BNWA 3UYNA 4YGNA 5FLQA 4K0TA 4YGLA 1FQNA 4RUZA 1V9EA 5FL4A 3OKUA 4FU5A 1TG3A 3OIMA 1H9NA 3V3GB 4YXUA 1MOOA 4PYYA 3T5UA 2VVBX 5E2MA 1OQ5A 4L5WA 1IF4A 1A42A 1UGGA 3CAJA 4YGJA 5E2NA 5JG3B 5SZ1A 3F4XA 3L14A 4RFCA 2FOYA 1HECA 3IEOA 5FDCA 4KP5A 3M2NA 5FL6A 3V3IB 3RZ7A 1CNBA 1I9NA 5JDVB 5JEPB 5LMDA 3RYVB 3V2JA 1RZAA 3D93A 3ML5A 1CNYA 1IF5A 4IWZA 5DSLA 4E3GA 1ZSBA 3RZ0B 1CNXA 9CA2A 5AMGA 2FW4A 5SZ2A 3TVOX 5AMDA 3MNHA 3T85A 3MHLA 3TMJA 3P5AA 1HVAA 3T84A 5EKMA 2CBDA 1CNGA 3RYXB 3M1WA 3D0NA 1TEQX 3UYQA 5EKJA 5E2SA 1BN4A 1UGEA 3KONA 4Q06A 2ILIA 3DC9A 6CA2A 4N16A 4C3TA 2GD8A 1YDDA 1JCZA 3KNEA 3P5LA 1G4JA 4M2WA 1KOQA 1CCSA 1G1DA 3M5EA 4MO8A 3NB5A 4K0SA 4Q7SA 4Z0QA 2NMXA 2NXSA 4ETQC 3TVNX 3QYKA 3M2YA 3DVBA 4QSJA 3MHMA 3LXEA 4BF6A 3DAZA 4Q90A 1F2WA 3T82A 1CVAA 2X7UA 4E9OX 4RIVA 5FDIA 3M14A 1TBTX 3M04A 2ZNCA 5J8ZA 5DSPA 5G01A 1HUGA 3MNAA 5SZ6A 1CNCA 3JXHC 1CVHA 1HEDA 4N0XB 2WD2A 3RJ7A 1AM6A 3S72B 2HNCA 3GZ0A 1KWQA 1ZE8A 4ZAOA 4CNVA 3P4VA 1CVCA 5JEGB 2ABEA 1CCUA 3Q31A 3RG4A 2X7SA 1LG6A 4ZWZA 1CANA 3RZ1B 3OKVA 3N2PA 4Q9YA 4MDLA 1CAOA 4ITOA 4JSZA 4YWPA 3HLJA 3S71B 1BNMA 3CZVA 2FNKA 4G7AA 3FW3A 5EH8A 3RZ8A 5HPJA 1ZFKA 3HKTA 4QTLA 5DOGA 4MDMA 1T9NA 3F7UA 1LGDA 3M40A 5FNIA 2Q1QA 4QJ0A 1I91A 1HEAA 3U45X 1G54A 5SZ0A 3DA2A 1ZNCA 3IBNA 3KOKA 4E4AA 5BRWA 2QOAA 4KAPA 4WUPA 4LP6A 2O4ZA 1G46A 2IT4A 5EHEA 4Q7PA 1UGAA 1CNWA 3C7PA 4R59A 1BN3A 4Z1JA 1G48A 5SZ7A 1FR7A 1CNJA 4K0ZA 2HD6A 2POUA 3N4BA 3S97A 2F14A 3S76A 4KNNA 1V9IC 5DRSA 1BZMA 3RGEA 3SBHA 4HF3A 4KUYA 4KNMA 3V3HB 3DV7A 3DD0A 1FLJA 3JXGA 4QJXA 5FNHA 5BRUA 2GEHA 2NWYA 4KP8A 1TB0X 3FE4A 1RAYA 3V7XA 1CZMA 3T83A 4Q7WA 1I9QA 1TE3X 5FLPA 5EOIA 3RLDA 4QY3A 4R5BA 4IDRX 3MHCA 2AW1A 1CVDA 1CAKA 1ZSCA 4YXIA 4FVOA 4TWMA 4YYTA 5E5RA 3ML2A 1YDAA 1Z97A 4Q81A 1CAZA 4MTYA 5FNJA 2NWZA 3V3JA 4CNXA 3JXFA 1BN1A 4CA2A 3N3JA 1CA3A 4MLTA 1I90A 3DD8A 3W6HA 3OYSA 5AMLA 4E5QA 4QK1A 3SBIA 4KNJA 1I9PA 3U47A 4WW8A 3B4FA 3MYQA 4Z1EA 2NWPA 2EU2A 5BYIA 1FQRA 4BCWA 1DMYA 1I8ZA 5FNGA 3F7BA 3R17B 3SAXA 5FLTA 1Z9YA 3P3HA 1G53A 4ITPA 4E49A 1CINA 1JD0A 5DSIA 4Q09A 8CA2A 3OY0A 3RYJB 1UGDA 5JQ0A 1LZVA 4CACA 1FSNA 3KWAA 4Q0LA 4Q6DA 5FLRA 1BNUA 4QEFA 5E28A 2CA2A 1YDCA 3P55A 3DCWA 4Q6EA 1UGCA 2FOVA 3M96A 3P58A 1KOPA 1OKMA 3P3JA 4ZX0A 3RZ5A 3B1BA 4K13A 4WW6A 5DOHA 2H4NA 4QSIA 3V2MA 1YO0A 3OIKA 3W6IA 1IF7A 1BICA 2EU3A 3M98A 2NN1A 1TH9A 4KV0A 3MNIA 1CNIA 3K7KA 1JV0A 1BCDA 3NI5A 3VBDA 2CABA 3DBUA 1HUHA 2NXRA 3KIGA 1OKLA 4MDGA 3N0NA 4ZX1A 2FOSA 1YO2A 1LG5A 3MDZA 1G52A 2W2JA 4FVNA 2Q38A 1CNHA 4M2UA 1HCAA 4DZ7A 1RAZA 5G0CA 2VVAX 3KOIA 4PYXA 1CVFA 1AVNA 2CBEA 3IBIA 3D92A 5DSJA 1MUAA 1FSQA 2OSFA 3OILA 1IF8A 1FQMA 1BV3A 1CAJA 4JSWA 1G45A 1H9QA 1G4OA 1CRMA 5JQTA 3MHIA 3DVDA 3NJ9A 4R5AA 2NNVA 5SZ3A 4Q8ZA 5EHWA 3M5TA 3CA2A 3HFPA 5FNKA 5BNLA 4Q8XA 5A6HA 3K34A 5E2RA 4HEYA 5DSOA 4JSSA 1CNKA 3EFTA 4Q08A 3RG3A 2HKKA 1TTMA 1J9WA 2NNOA 4CNRA 1IF9A 4QSAA 2FOUA 1HEBA 4FIKA 4Q49A 4UOVA 3M1KA 4HEWA 4CQ0A 3MMFA 1KEQA 3HKNA 2FOQA 4TWLA 5EIJA 1CRAA 1DCAA 5A25A 4KUVA 5IPZA 2FMGA 5DSMA 3IGPA 4QIYA 1FR4A 1IF6A 3F8EA 3IAIA 1CVEA 4HU1A 2WEHA 3PYKA 3S77B 4Z1KA 3IBLA 4FL7A 3KS3A 3ZNCA 5DSQA 1YDBA 4QSBA 4JS6A
chains in the Genus database with same CATH superfamily
1G0EA 3MNKA 4Q07A 2NNGA 2X7TA 1ZGFA 4RUXA 5EKHA 5FNLA 4WR7A 2FMZA 3MNUA 2POWA 4E3HA 1FSRA 1BNTA 1CAIA 4QK3A 5C8IA 4ZWYA 4YHAA 3D9ZA 4HBAA 3M1JA 4RN4A 4Y0JA 3S73B 3DCSA 4KNIA 1DCBA 2WEGA 3M2ZA 5FLOA 5CLUA 2WD3A 4Q7VA 12CAA 1UGFA 1CAYA 1CAHA 1G0FA 2AX2A 3U3AX 4YVYA 4PZHA 3HKQA 1RJ6A 2OSMA 5DSRA 1DMXA 3DCCA 2POVA 3DC3A 4QJOA 4GL1X 3S75B 2NWOA 4PXXA 1ZH9A 2NNSA 3S78B 4COQA 3KLDB 1EOUA 1OKNA 3T5ZA 1URTA 3D8WA 4Q78A 3ZP9A 3FFPX 3PO6A 5EZTX 5CA2A 4E3DA 1UGBA 3HS4A 4CNWA 3M5SA 1BNVA 4WL4A 2QO8A 7CA2A 4LU3A 2Q1BA 5JG5B 1CVBA 4ILXA 1YO1A 1CILA 2H15A 3PJJA 3V3FA 3IBUA 3MNJA 3M1QA 3U7CA 4WUQA 2CBCA 3HKUA 1I9LA 3KKXA 4L5UA 4E3FA 1RZCA 4RIUA 2NN7A 5G0BA 3RYZA 4XE1A 4FRCA 4M2RA 1THKA 1CAMA 1CA2A 3BETA 3P44A 1LUGA 1Z93A 3BL1A 3MZCA 4Q8YA 1ZFQA 4RFDA 1XQ0A 2WEOA 3SAPA 5SZ4A 2HL4A 4HEZA 2NXTA 2FNNA 4XZ5A 4G0CA 4ZWIA 1XEGA 1CIMA 4Q83A 4RUYA 4X5SA 4HT0A 5E2KA 1KWRA 4ZWXA 4DZ9A 4HT2A 3M67A 2HOCA 5FNMA 1H4NA 5DVXA 4YGFA 4LHIA 4FPTA 4RH2A 4YX4A 4JSAA 3V5GA 1CALA 3OYQA 4XIWA 1ZSAA 4YXOA 5EHVA 1G6VA 2FNMA 5CACA 1TEUX 2HFWA 4XIXA 5DSKA 4QK2A 3K2FA 3S74B 3MWOA 5BRVA 4QJPA 5FL5A 5CJFA 5FLSA 5JESB 1AZMA 2CBAA 2QP6A 1BNQA 1TG9A 5E5UA 5JGTB 4L5VA 4Q87A 4QJWA 1CCTA 5EH5A 1HCBA 3CYUA 1RZEA 3R16A 3S8XA 3M2XA 4MLXA 1RZBA 1XEVA 5DSNA 2CBBA 4KUWA 1BNNA 3BL0A 5L3OA 1ZGEA 2EZ7A 3EFIA 4XFWA 4BF1A 4PQ7A 5JEHB 1I9MA 4QJMA 3MHOA 1G3ZA 5EH7A 3M3XA 1RZDA 2WEJA 3RYYA 1Y7WA 3DVCA 5L6KA 1XPZA 5SZ5A 4YGKA 4Q99A 1RJ5A 1FQLA 5JGSB 3S9TA 1I9OA 4K1QA 4QIZA 5G03A 4Z1NA 4M2VA 1BNWA 3UYNA 4YGNA 5FLQA 4K0TA 4YGLA 1FQNA 4RUZA 1V9EA 5FL4A 3OKUA 4FU5A 1TG3A 3OIMA 1H9NA 3V3GB 4YXUA 1MOOA 4PYYA 3T5UA 2VVBX 5E2MA 1OQ5A 4L5WA 1IF4A 1A42A 1UGGA 3CAJA 4YGJA 5E2NA 5JG3B 5SZ1A 3F4XA 3L14A 4RFCA 2FOYA 1HECA 3IEOA 5FDCA 4KP5A 3M2NA 5FL6A 3V3IB 3RZ7A 1CNBA 1I9NA 5JDVB 5JEPB 5LMDA 3RYVB 3V2JA 1RZAA 3D93A 3ML5A 1CNYA 1IF5A 4IWZA 5DSLA 4E3GA 1ZSBA 3RZ0B 1CNXA 9CA2A 5AMGA 2FW4A 5SZ2A 3TVOX 5AMDA 3MNHA 3T85A 3MHLA 3TMJA 3P5AA 1HVAA 3T84A 5EKMA 2CBDA 1CNGA 3RYXB 3M1WA 3D0NA 1TEQX 3UYQA 5EKJA 5E2SA 1BN4A 1UGEA 3KONA 4Q06A 2ILIA 3DC9A 6CA2A 4N16A 4C3TA 2GD8A 1YDDA 1JCZA 3KNEA 3P5LA 1G4JA 4M2WA 1KOQA 1CCSA 1G1DA 3M5EA 4MO8A 3NB5A 4K0SA 4Q7SA 4Z0QA 2NMXA 2NXSA 4ETQC 3TVNX 3QYKA 3M2YA 3DVBA 4QSJA 3MHMA 3LXEA 4BF6A 3DAZA 4Q90A 1F2WA 3T82A 1CVAA 2X7UA 4E9OX 4RIVA 5FDIA 3M14A 1TBTX 3M04A 2ZNCA 5J8ZA 5DSPA 5G01A 1HUGA 3MNAA 5SZ6A 1CNCA 3JXHC 1CVHA 1HEDA 4N0XB 2WD2A 3RJ7A 1AM6A 3S72B 2HNCA 3GZ0A 1KWQA 1ZE8A 4ZAOA 4CNVA 3P4VA 1CVCA 5JEGB 2ABEA 1CCUA 3Q31A 3RG4A 2X7SA 1LG6A 4ZWZA 1CANA 3RZ1B 3OKVA 3N2PA 4Q9YA 4MDLA 1CAOA 4ITOA 4JSZA 4YWPA 3HLJA 3S71B 1BNMA 3CZVA 2FNKA 4G7AA 3FW3A 5EH8A 3RZ8A 5HPJA 1ZFKA 3HKTA 4QTLA 5DOGA 4MDMA 1T9NA 3F7UA 1LGDA 3M40A 5FNIA 2Q1QA 4QJ0A 1I91A 1HEAA 3U45X 1G54A 5SZ0A 3DA2A 1ZNCA 3IBNA 3KOKA 4E4AA 5BRWA 2QOAA 4KAPA 4WUPA 4LP6A 2O4ZA 1G46A 2IT4A 5EHEA 4Q7PA 1UGAA 1CNWA 3C7PA 4R59A 1BN3A 4Z1JA 1G48A 5SZ7A 1FR7A 1CNJA 4K0ZA 2HD6A 2POUA 3N4BA 3S97A 2F14A 3S76A 4KNNA 1V9IC 5DRSA 1BZMA 3RGEA 3SBHA 4HF3A 4KUYA 4KNMA 3V3HB 3DV7A 3DD0A 1FLJA 3JXGA 4QJXA 5FNHA 5BRUA 2GEHA 2NWYA 4KP8A 1TB0X 3FE4A 1RAYA 3V7XA 1CZMA 3T83A 4Q7WA 1I9QA 1TE3X 5FLPA 5EOIA 3RLDA 4QY3A 4R5BA 4IDRX 3MHCA 2AW1A 1CVDA 1CAKA 1ZSCA 4YXIA 4FVOA 4TWMA 4YYTA 5E5RA 3ML2A 1YDAA 1Z97A 4Q81A 1CAZA 4MTYA 5FNJA 2NWZA 3V3JA 4CNXA 3JXFA 1BN1A 4CA2A 3N3JA 1CA3A 4MLTA 1I90A 3DD8A 3W6HA 3OYSA 5AMLA 4E5QA 4QK1A 3SBIA 4KNJA 1I9PA 3U47A 4WW8A 3B4FA 3MYQA 4Z1EA 2NWPA 2EU2A 5BYIA 1FQRA 4BCWA 1DMYA 1I8ZA 5FNGA 3F7BA 3R17B 3SAXA 5FLTA 1Z9YA 3P3HA 1G53A 4ITPA 4E49A 1CINA 1JD0A 5DSIA 4Q09A 8CA2A 3OY0A 3RYJB 1UGDA 5JQ0A 1LZVA 4CACA 1FSNA 3KWAA 4Q0LA 4Q6DA 5FLRA 1BNUA 4QEFA 5E28A 2CA2A 1YDCA 3P55A 3DCWA 4Q6EA 1UGCA 2FOVA 3M96A 3P58A 1KOPA 1OKMA 3P3JA 4ZX0A 3RZ5A 3B1BA 4K13A 4WW6A 5DOHA 2H4NA 4QSIA 3V2MA 1YO0A 3OIKA 3W6IA 1IF7A 1BICA 2EU3A 3M98A 2NN1A 1TH9A 4KV0A 3MNIA 1CNIA 3K7KA 1JV0A 1BCDA 3NI5A 3VBDA 2CABA 3DBUA 1HUHA 2NXRA 3KIGA 1OKLA 4MDGA 3N0NA 4ZX1A 2FOSA 1YO2A 1LG5A 3MDZA 1G52A 2W2JA 4FVNA 2Q38A 1CNHA 4M2UA 1HCAA 4DZ7A 1RAZA 5G0CA 2VVAX 3KOIA 4PYXA 1CVFA 1AVNA 2CBEA 3IBIA 3D92A 5DSJA 1MUAA 1FSQA 2OSFA 3OILA 1IF8A 1FQMA 1BV3A 1CAJA 4JSWA 1G45A 1H9QA 1G4OA 1CRMA 5JQTA 3MHIA 3DVDA 3NJ9A 4R5AA 2NNVA 5SZ3A 4Q8ZA 5EHWA 3M5TA 3CA2A 3HFPA 5FNKA 5BNLA 4Q8XA 5A6HA 3K34A 5E2RA 4HEYA 5DSOA 4JSSA 1CNKA 3EFTA 4Q08A 3RG3A 2HKKA 1TTMA 1J9WA 2NNOA 4CNRA 1IF9A 4QSAA 2FOUA 1HEBA 4FIKA 4Q49A 4UOVA 3M1KA 4HEWA 4CQ0A 3MMFA 1KEQA 3HKNA 2FOQA 4TWLA 5EIJA 1CRAA 1DCAA 5A25A 4KUVA 5IPZA 2FMGA 5DSMA 3IGPA 4QIYA 1FR4A 1IF6A 3F8EA 3IAIA 1CVEA 4HU1A 2WEHA 3PYKA 3S77B 4Z1KA 3IBLA 4FL7A 3KS3A 3ZNCA 5DSQA 1YDBA 4QSBA 4JS6A
chains in the Genus database with same CATH topology
1G0EA 3MNKA 4Q07A 2NNGA 2X7TA 1ZGFA 4RUXA 5EKHA 5FNLA 4WR7A 2FMZA 3MNUA 2POWA 4E3HA 1FSRA 1BNTA 1CAIA 4QK3A 5C8IA 4ZWYA 4YHAA 3D9ZA 4HBAA 3M1JA 4RN4A 4Y0JA 3S73B 3DCSA 4KNIA 1DCBA 2WEGA 3M2ZA 5FLOA 5CLUA 2WD3A 4Q7VA 12CAA 1UGFA 1CAYA 1CAHA 1G0FA 2AX2A 3U3AX 4YVYA 4PZHA 3HKQA 1RJ6A 2OSMA 5DSRA 1DMXA 3DCCA 2POVA 3DC3A 4QJOA 4GL1X 3S75B 2NWOA 4PXXA 1ZH9A 2NNSA 3S78B 4COQA 3KLDB 1EOUA 1OKNA 3T5ZA 1URTA 3D8WA 4Q78A 3ZP9A 3FFPX 3PO6A 5EZTX 5CA2A 4E3DA 1UGBA 3HS4A 4CNWA 3M5SA 1BNVA 4WL4A 2QO8A 7CA2A 4LU3A 2Q1BA 5JG5B 1CVBA 4ILXA 1YO1A 1CILA 2H15A 3PJJA 3V3FA 3IBUA 3MNJA 3M1QA 3U7CA 4WUQA 2CBCA 3HKUA 1I9LA 3KKXA 4L5UA 4E3FA 1RZCA 4RIUA 2NN7A 5G0BA 3RYZA 4XE1A 4FRCA 4M2RA 1THKA 1CAMA 1CA2A 3BETA 3P44A 1LUGA 1Z93A 3BL1A 3MZCA 4Q8YA 1ZFQA 4RFDA 1XQ0A 2WEOA 3SAPA 5SZ4A 2HL4A 4HEZA 2NXTA 2FNNA 4XZ5A 4G0CA 4ZWIA 1XEGA 1CIMA 4Q83A 4RUYA 4X5SA 4HT0A 5E2KA 1KWRA 4ZWXA 4DZ9A 4HT2A 3M67A 2HOCA 5FNMA 1H4NA 5DVXA 4YGFA 4LHIA 4FPTA 4RH2A 4YX4A 4JSAA 3V5GA 1CALA 3OYQA 4XIWA 1ZSAA 4YXOA 5EHVA 1G6VA 2FNMA 5CACA 1TEUX 2HFWA 4XIXA 5DSKA 4QK2A 3K2FA 3S74B 3MWOA 5BRVA 4QJPA 5FL5A 5CJFA 5FLSA 5JESB 1AZMA 2CBAA 2QP6A 1BNQA 1TG9A 5E5UA 5JGTB 4L5VA 4Q87A 4QJWA 1CCTA 5EH5A 1HCBA 3CYUA 1RZEA 3R16A 3S8XA 3M2XA 4MLXA 1RZBA 1XEVA 5DSNA 2CBBA 4KUWA 1BNNA 3BL0A 5L3OA 1ZGEA 2EZ7A 3EFIA 4XFWA 4BF1A 4PQ7A 5JEHB 1I9MA 4QJMA 3MHOA 1G3ZA 5EH7A 3M3XA 1RZDA 2WEJA 3RYYA 1Y7WA 3DVCA 5L6KA 1XPZA 5SZ5A 4YGKA 4Q99A 1RJ5A 1FQLA 5JGSB 3S9TA 1I9OA 4K1QA 4QIZA 5G03A 4Z1NA 4M2VA 1BNWA 3UYNA 4YGNA 5FLQA 4K0TA 4YGLA 1FQNA 4RUZA 1V9EA 5FL4A 3OKUA 4FU5A 1TG3A 3OIMA 1H9NA 3V3GB 4YXUA 1MOOA 4PYYA 3T5UA 2VVBX 5E2MA 1OQ5A 4L5WA 1IF4A 1A42A 1UGGA 3CAJA 4YGJA 5E2NA 5JG3B 5SZ1A 3F4XA 3L14A 4RFCA 2FOYA 1HECA 3IEOA 5FDCA 4KP5A 3M2NA 5FL6A 3V3IB 3RZ7A 1CNBA 1I9NA 5JDVB 5JEPB 5LMDA 3RYVB 3V2JA 1RZAA 3D93A 3ML5A 1CNYA 1IF5A 4IWZA 5DSLA 4E3GA 1ZSBA 3RZ0B 1CNXA 9CA2A 5AMGA 2FW4A 5SZ2A 3TVOX 5AMDA 3MNHA 3T85A 3MHLA 3TMJA 3P5AA 1HVAA 3T84A 5EKMA 2CBDA 1CNGA 3RYXB 3M1WA 3D0NA 1TEQX 3UYQA 5EKJA 5E2SA 1BN4A 1UGEA 3KONA 4Q06A 2ILIA 3DC9A 6CA2A 4N16A 4C3TA 2GD8A 1YDDA 1JCZA 3KNEA 3P5LA 1G4JA 4M2WA 1KOQA 1CCSA 1G1DA 3M5EA 4MO8A 3NB5A 4K0SA 4Q7SA 4Z0QA 2NMXA 2NXSA 4ETQC 3TVNX 3QYKA 3M2YA 3DVBA 4QSJA 3MHMA 3LXEA 4BF6A 3DAZA 4Q90A 1F2WA 3T82A 1CVAA 2X7UA 4E9OX 4RIVA 5FDIA 3M14A 1TBTX 3M04A 2ZNCA 5J8ZA 5DSPA 5G01A 1HUGA 3MNAA 5SZ6A 1CNCA 3JXHC 1CVHA 1HEDA 4N0XB 2WD2A 3RJ7A 1AM6A 3S72B 2HNCA 3GZ0A 1KWQA 1ZE8A 4ZAOA 4CNVA 3P4VA 1CVCA 5JEGB 2ABEA 1CCUA 3Q31A 3RG4A 2X7SA 1LG6A 4ZWZA 1CANA 3RZ1B 3OKVA 3N2PA 4Q9YA 4MDLA 1CAOA 4ITOA 4JSZA 4YWPA 3HLJA 3S71B 1BNMA 3CZVA 2FNKA 4G7AA 3FW3A 5EH8A 3RZ8A 5HPJA 1ZFKA 3HKTA 4QTLA 5DOGA 4MDMA 1T9NA 3F7UA 1LGDA 3M40A 5FNIA 2Q1QA 4QJ0A 1I91A 1HEAA 3U45X 1G54A 5SZ0A 3DA2A 1ZNCA 3IBNA 3KOKA 4E4AA 5BRWA 2QOAA 4KAPA 4WUPA 4LP6A 2O4ZA 1G46A 2IT4A 5EHEA 4Q7PA 1UGAA 1CNWA 3C7PA 4R59A 1BN3A 4Z1JA 1G48A 5SZ7A 1FR7A 1CNJA 4K0ZA 2HD6A 2POUA 3N4BA 3S97A 2F14A 3S76A 4KNNA 1V9IC 5DRSA 1BZMA 3RGEA 3SBHA 4HF3A 4KUYA 4KNMA 3V3HB 3DV7A 3DD0A 1FLJA 3JXGA 4QJXA 5FNHA 5BRUA 2GEHA 2NWYA 4KP8A 1TB0X 3FE4A 1RAYA 3V7XA 1CZMA 3T83A 4Q7WA 1I9QA 1TE3X 5FLPA 5EOIA 3RLDA 4QY3A 4R5BA 4IDRX 3MHCA 2AW1A 1CVDA 1CAKA 1ZSCA 4YXIA 4FVOA 4TWMA 4YYTA 5E5RA 3ML2A 1YDAA 1Z97A 4Q81A 1CAZA 4MTYA 5FNJA 2NWZA 3V3JA 4CNXA 3JXFA 1BN1A 4CA2A 3N3JA 1CA3A 4MLTA 1I90A 3DD8A 3W6HA 3OYSA 5AMLA 4E5QA 4QK1A 3SBIA 4KNJA 1I9PA 3U47A 4WW8A 3B4FA 3MYQA 4Z1EA 2NWPA 2EU2A 5BYIA 1FQRA 4BCWA 1DMYA 1I8ZA 5FNGA 3F7BA 3R17B 3SAXA 5FLTA 1Z9YA 3P3HA 1G53A 4ITPA 4E49A 1CINA 1JD0A 5DSIA 4Q09A 8CA2A 3OY0A 3RYJB 1UGDA 5JQ0A 1LZVA 4CACA 1FSNA 3KWAA 4Q0LA 4Q6DA 5FLRA 1BNUA 4QEFA 5E28A 2CA2A 1YDCA 3P55A 3DCWA 4Q6EA 1UGCA 2FOVA 3M96A 3P58A 1KOPA 1OKMA 3P3JA 4ZX0A 3RZ5A 3B1BA 4K13A 4WW6A 5DOHA 2H4NA 4QSIA 3V2MA 1YO0A 3OIKA 3W6IA 1IF7A 1BICA 2EU3A 3M98A 2NN1A 1TH9A 4KV0A 3MNIA 1CNIA 3K7KA 1JV0A 1BCDA 3NI5A 3VBDA 2CABA 3DBUA 1HUHA 2NXRA 3KIGA 1OKLA 4MDGA 3N0NA 4ZX1A 2FOSA 1YO2A 1LG5A 3MDZA 1G52A 2W2JA 4FVNA 2Q38A 1CNHA 4M2UA 1HCAA 4DZ7A 1RAZA 5G0CA 2VVAX 3KOIA 4PYXA 1CVFA 1AVNA 2CBEA 3IBIA 3D92A 5DSJA 1MUAA 1FSQA 2OSFA 3OILA 1IF8A 1FQMA 1BV3A 1CAJA 4JSWA 1G45A 1H9QA 1G4OA 1CRMA 5JQTA 3MHIA 3DVDA 3NJ9A 4R5AA 2NNVA 5SZ3A 4Q8ZA 5EHWA 3M5TA 3CA2A 3HFPA 5FNKA 5BNLA 4Q8XA 5A6HA 3K34A 5E2RA 4HEYA 5DSOA 4JSSA 1CNKA 3EFTA 4Q08A 3RG3A 2HKKA 1TTMA 1J9WA 2NNOA 4CNRA 1IF9A 4QSAA 2FOUA 1HEBA 4FIKA 4Q49A 4UOVA 3M1KA 4HEWA 4CQ0A 3MMFA 1KEQA 3HKNA 2FOQA 4TWLA 5EIJA 1CRAA 1DCAA 5A25A 4KUVA 5IPZA 2FMGA 5DSMA 3IGPA 4QIYA 1FR4A 1IF6A 3F8EA 3IAIA 1CVEA 4HU1A 2WEHA 3PYKA 3S77B 4Z1KA 3IBLA 4FL7A 3KS3A 3ZNCA 5DSQA 1YDBA 4QSBA 4JS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G0E A;  3MNK A;  4Q07 A;  2NNG A;  2X7T A;  1ZGF A;  4RUX A;  5EKH A;  5FNL A;  4WR7 A;  2FMZ A;  3MNU A;  2POW A;  4E3H A;  1FSR A;  1BNT A;  1CAI A;  4QK3 A;  5C8I A;  4ZWY A;  4YHA A;  3D9Z A;  4HBA A;  3M1J A;  4RN4 A;  4Y0J A;  3S73 B;  3DCS A;  4KNI A;  1DCB A;  2WEG A;  3M2Z A;  5FLO A;  5CLU A;  2WD3 A;  4Q7V A;  12CA A;  1UGF A;  1CAY A;  1CAH A;  1G0F A;  2AX2 A;  3U3A X;  4YVY A;  4PZH A;  3HKQ A;  1RJ6 A;  2OSM A;  5DSR A;  1DMX A;  3DCC A;  2POV A;  3DC3 A;  4QJO A;  4GL1 X;  3S75 B;  2NWO A;  4PXX A;  1ZH9 A;  2NNS A;  3S78 B;  4COQ A;  3KLD B;  1EOU A;  1OKN A;  3T5Z A;  1URT A;  3D8W A;  4Q78 A;  3ZP9 A;  3FFP X;  3PO6 A;  5EZT X;  5CA2 A;  4E3D A;  1UGB A;  3HS4 A;  4CNW A;  3M5S A;  1BNV A;  4WL4 A;  2QO8 A;  7CA2 A;  4LU3 A;  2Q1B A;  5JG5 B;  1CVB A;  4ILX A;  1YO1 A;  1CIL A;  2H15 A;  3PJJ A;  3V3F A;  3IBU A;  3MNJ A;  3M1Q A;  3U7C A;  4WUQ A;  2CBC A;  3HKU A;  1I9L A;  3KKX A;  4L5U A;  4E3F A;  1RZC A;  4RIU A;  2NN7 A;  5G0B A;  3RYZ A;  4XE1 A;  4FRC A;  4M2R A;  1THK A;  1CAM A;  1CA2 A;  3BET A;  3P44 A;  1LUG A;  1Z93 A;  3BL1 A;  3MZC A;  4Q8Y A;  1ZFQ A;  4RFD A;  1XQ0 A;  2WEO A;  3SAP A;  5SZ4 A;  2HL4 A;  4HEZ A;  2NXT A;  2FNN A;  4XZ5 A;  4G0C A;  4ZWI A;  1XEG A;  1CIM A;  4Q83 A;  4RUY A;  4X5S A;  4HT0 A;  5E2K A;  1KWR A;  4ZWX A;  4DZ9 A;  4HT2 A;  3M67 A;  2HOC A;  5FNM A;  1H4N A;  5DVX A;  4YGF A;  4LHI A;  4FPT A;  4RH2 A;  4YX4 A;  4JSA A;  3V5G A;  1CAL A;  3OYQ A;  4XIW A;  1ZSA A;  4YXO A;  5EHV A;  1G6V A;  2FNM A;  5CAC A;  1TEU X;  2HFW A;  4XIX A;  5DSK A;  4QK2 A;  3K2F A;  3S74 B;  3MWO A;  5BRV A;  4QJP A;  5FL5 A;  5CJF A;  5FLS A;  5JES B;  1AZM A;  2CBA A;  2QP6 A;  1BNQ A;  1TG9 A;  5E5U A;  5JGT B;  4L5V A;  4Q87 A;  4QJW A;  1CCT A;  5EH5 A;  1HCB A;  3CYU A;  1RZE A;  3R16 A;  3S8X A;  3M2X A;  4MLX A;  1RZB A;  1XEV A;  5DSN A;  2CBB A;  4KUW A;  1BNN A;  3BL0 A;  5L3O A;  1ZGE A;  2EZ7 A;  3EFI A;  4XFW A;  4BF1 A;  4PQ7 A;  5JEH B;  1I9M A;  4QJM A;  3MHO A;  1G3Z A;  5EH7 A;  3M3X A;  1RZD A;  2WEJ A;  3RYY A;  1Y7W A;  3DVC A;  5L6K A;  1XPZ A;  5SZ5 A;  4YGK A;  4Q99 A;  1RJ5 A;  1FQL A;  5JGS B;  3S9T A;  1I9O A;  4K1Q A;  4QIZ A;  5G03 A;  4Z1N A;  4M2V A;  1BNW A;  3UYN A;  4YGN A;  5FLQ A;  4K0T A;  4YGL A;  1FQN A;  4RUZ A;  1V9E A;  5FL4 A;  3OKU A;  4FU5 A;  1TG3 A;  3OIM A;  1H9N A;  3V3G B;  4YXU A;  1MOO A;  4PYY A;  3T5U A;  2VVB X;  5E2M A;  1OQ5 A;  4L5W A;  1IF4 A;  1A42 A;  1UGG A;  3CAJ A;  4YGJ A;  5E2N A;  5JG3 B;  5SZ1 A;  3F4X A;  3L14 A;  4RFC A;  2FOY A;  1HEC A;  3IEO A;  5FDC A;  4KP5 A;  3M2N A;  5FL6 A;  3V3I B;  3RZ7 A;  1CNB A;  1I9N A;  5JDV B;  5JEP B;  5LMD A;  3RYV B;  3V2J A;  1RZA A;  3D93 A;  3ML5 A;  1CNY A;  1IF5 A;  4IWZ A;  5DSL A;  4E3G A;  1ZSB A;  3RZ0 B;  1CNX A;  9CA2 A;  5AMG A;  2FW4 A;  5SZ2 A;  3TVO X;  5AMD A;  3MNH A;  3T85 A;  3MHL A;  3TMJ A;  3P5A A;  1HVA A;  3T84 A;  5EKM A;  2CBD A;  1CNG A;  3RYX B;  3M1W A;  3D0N A;  1TEQ X;  3UYQ A;  5EKJ A;  5E2S A;  1BN4 A;  1UGE A;  3KON A;  4Q06 A;  2ILI A;  3DC9 A;  6CA2 A;  4N16 A;  4C3T A;  2GD8 A;  1YDD A;  1JCZ A;  3KNE A;  3P5L A;  1G4J A;  4M2W A;  1KOQ A;  1CCS A;  1G1D A;  3M5E A;  4MO8 A;  3NB5 A;  4K0S A;  4Q7S A;  4Z0Q A;  2NMX A;  2NXS A;  4ETQ C;  3TVN X;  3QYK A;  3M2Y A;  3DVB A;  4QSJ A;  3MHM A;  3LXE A;  4BF6 A;  3DAZ A;  4Q90 A;  1F2W A;  3T82 A;  1CVA A;  2X7U A;  4E9O X;  4RIV A;  5FDI A;  3M14 A;  1TBT X;  3M04 A;  2ZNC A;  5J8Z A;  5DSP A;  5G01 A;  1HUG A;  3MNA A;  5SZ6 A;  1CNC A;  3JXH C;  1CVH A;  1HED A;  4N0X B;  2WD2 A;  3RJ7 A;  1AM6 A;  3S72 B;  2HNC A;  3GZ0 A;  1KWQ A;  1ZE8 A;  4ZAO A;  4CNV A;  3P4V A;  1CVC A;  5JEG B;  2ABE A;  1CCU A;  3Q31 A;  3RG4 A;  2X7S A;  1LG6 A;  4ZWZ A;  1CAN A;  3RZ1 B;  3OKV A;  3N2P A;  4Q9Y A;  4MDL A;  1CAO A;  4ITO A;  4JSZ A;  4YWP A;  3HLJ A;  3S71 B;  1BNM A;  3CZV A;  2FNK A;  4G7A A;  3FW3 A;  5EH8 A;  3RZ8 A;  5HPJ A;  1ZFK A;  3HKT A;  4QTL A;  5DOG A;  4MDM A;  1T9N A;  3F7U A;  1LGD A;  3M40 A;  5FNI A;  2Q1Q A;  4QJ0 A;  1I91 A;  1HEA A;  3U45 X;  1G54 A;  5SZ0 A;  3DA2 A;  1ZNC A;  3IBN A;  3KOK A;  4E4A A;  5BRW A;  2QOA A;  4KAP A;  4WUP A;  4LP6 A;  2O4Z A;  1G46 A;  2IT4 A;  5EHE A;  4Q7P A;  1UGA A;  1CNW A;  3C7P A;  4R59 A;  1BN3 A;  4Z1J A;  1G48 A;  5SZ7 A;  1FR7 A;  1CNJ A;  4K0Z A;  2HD6 A;  2POU A;  3N4B A;  3S97 A;  2F14 A;  3S76 A;  4KNN A;  1V9I C;  5DRS A;  1BZM A;  3RGE A;  3SBH A;  4HF3 A;  4KUY A;  4KNM A;  3V3H B;  3DV7 A;  3DD0 A;  1FLJ A;  3JXG A;  4QJX A;  5FNH A;  5BRU A;  2GEH A;  2NWY A;  4KP8 A;  1TB0 X;  3FE4 A;  1RAY A;  3V7X A;  1CZM A;  3T83 A;  4Q7W A;  1I9Q A;  1TE3 X;  5FLP A;  5EOI A;  3RLD A;  4QY3 A;  4R5B A;  4IDR X;  3MHC A;  2AW1 A;  1CVD A;  1CAK A;  1ZSC A;  4YXI A;  4FVO A;  4TWM A;  4YYT A;  5E5R A;  3ML2 A;  1YDA A;  1Z97 A;  4Q81 A;  1CAZ A;  4MTY A;  5FNJ A;  2NWZ A;  3V3J A;  4CNX A;  3JXF A;  1BN1 A;  4CA2 A;  3N3J A;  1CA3 A;  4MLT A;  1I90 A;  3DD8 A;  3W6H A;  3OYS A;  5AML A;  4E5Q A;  4QK1 A;  3SBI A;  4KNJ A;  1I9P A;  3U47 A;  4WW8 A;  3B4F A;  3MYQ A;  4Z1E A;  2NWP A;  2EU2 A;  5BYI A;  1FQR A;  4BCW A;  1DMY A;  1I8Z A;  5FNG A;  3F7B A;  3R17 B;  3SAX A;  5FLT A;  1Z9Y A;  3P3H A;  1G53 A;  4ITP A;  4E49 A;  1CIN A;  1JD0 A;  5DSI A;  4Q09 A;  8CA2 A;  3OY0 A;  3RYJ B;  1UGD A;  5JQ0 A;  1LZV A;  4CAC A;  1FSN A;  3KWA A;  4Q0L A;  4Q6D A;  5FLR A;  1BNU A;  4QEF A;  5E28 A;  2CA2 A;  1YDC A;  3P55 A;  3DCW A;  4Q6E A;  1UGC A;  2FOV A;  3M96 A;  3P58 A;  1KOP A;  1OKM A;  3P3J A;  4ZX0 A;  3RZ5 A;  3B1B A;  4K13 A;  4WW6 A;  5DOH A;  2H4N A;  4QSI A;  3V2M A;  1YO0 A;  3OIK A;  3W6I A;  1IF7 A;  1BIC A;  2EU3 A;  3M98 A;  2NN1 A;  1TH9 A;  4KV0 A;  3MNI A;  1CNI A;  3K7K A;  1JV0 A;  1BCD A;  3NI5 A;  3VBD A;  2CAB A;  3DBU A;  1HUH A;  2NXR A;  3KIG A;  1OKL A;  4MDG A;  3N0N A;  4ZX1 A;  2FOS A;  1YO2 A;  1LG5 A;  3MDZ A;  1G52 A;  2W2J A;  4FVN A;  2Q38 A;  1CNH A;  4M2U A;  1HCA A;  4DZ7 A;  1RAZ A;  5G0C A;  2VVA X;  3KOI A;  4PYX A;  1CVF A;  1AVN A;  2CBE A;  3IBI A;  3D92 A;  5DSJ A;  1MUA A;  1FSQ A;  2OSF A;  3OIL A;  1IF8 A;  1FQM A;  1BV3 A;  1CAJ A;  4JSW A;  1G45 A;  1H9Q A;  1G4O A;  1CRM A;  5JQT A;  3MHI A;  3DVD A;  3NJ9 A;  4R5A A;  2NNV A;  5SZ3 A;  4Q8Z A;  5EHW A;  3M5T A;  3CA2 A;  3HFP A;  5FNK A;  5BNL A;  4Q8X A;  5A6H A;  3K34 A;  5E2R A;  4HEY A;  5DSO A;  4JSS A;  1CNK A;  3EFT A;  4Q08 A;  3RG3 A;  2HKK A;  1TTM A;  1J9W A;  2NNO A;  4CNR A;  1IF9 A;  4QSA A;  2FOU A;  1HEB A;  4FIK A;  4Q49 A;  4UOV A;  3M1K A;  4HEW A;  4CQ0 A;  3MMF A;  1KEQ A;  3HKN A;  2FOQ A;  4TWL A;  5EIJ A;  1CRA A;  1DCA A;  5A25 A;  4KUV A;  5IPZ A;  2FMG A;  5DSM A;  3IGP A;  4QIY A;  1FR4 A;  1IF6 A;  3F8E A;  3IAI A;  1CVE A;  4HU1 A;  2WEH A;  3PYK A;  3S77 B;  4Z1K A;  3IBL A;  4FL7 A;  3KS3 A;  3ZNC A;  5DSQ A;  1YDB A;  4QSB A;  4JS6 A; 
#chains in the Genus database with same CATH topology
 1G0E A;  3MNK A;  4Q07 A;  2NNG A;  2X7T A;  1ZGF A;  4RUX A;  5EKH A;  5FNL A;  4WR7 A;  2FMZ A;  3MNU A;  2POW A;  4E3H A;  1FSR A;  1BNT A;  1CAI A;  4QK3 A;  5C8I A;  4ZWY A;  4YHA A;  3D9Z A;  4HBA A;  3M1J A;  4RN4 A;  4Y0J A;  3S73 B;  3DCS A;  4KNI A;  1DCB A;  2WEG A;  3M2Z A;  5FLO A;  5CLU A;  2WD3 A;  4Q7V A;  12CA A;  1UGF A;  1CAY A;  1CAH A;  1G0F A;  2AX2 A;  3U3A X;  4YVY A;  4PZH A;  3HKQ A;  1RJ6 A;  2OSM A;  5DSR A;  1DMX A;  3DCC A;  2POV A;  3DC3 A;  4QJO A;  4GL1 X;  3S75 B;  2NWO A;  4PXX A;  1ZH9 A;  2NNS A;  3S78 B;  4COQ A;  3KLD B;  1EOU A;  1OKN A;  3T5Z A;  1URT A;  3D8W A;  4Q78 A;  3ZP9 A;  3FFP X;  3PO6 A;  5EZT X;  5CA2 A;  4E3D A;  1UGB A;  3HS4 A;  4CNW A;  3M5S A;  1BNV A;  4WL4 A;  2QO8 A;  7CA2 A;  4LU3 A;  2Q1B A;  5JG5 B;  1CVB A;  4ILX A;  1YO1 A;  1CIL A;  2H15 A;  3PJJ A;  3V3F A;  3IBU A;  3MNJ A;  3M1Q A;  3U7C A;  4WUQ A;  2CBC A;  3HKU A;  1I9L A;  3KKX A;  4L5U A;  4E3F A;  1RZC A;  4RIU A;  2NN7 A;  5G0B A;  3RYZ A;  4XE1 A;  4FRC A;  4M2R A;  1THK A;  1CAM A;  1CA2 A;  3BET A;  3P44 A;  1LUG A;  1Z93 A;  3BL1 A;  3MZC A;  4Q8Y A;  1ZFQ A;  4RFD A;  1XQ0 A;  2WEO A;  3SAP A;  5SZ4 A;  2HL4 A;  4HEZ A;  2NXT A;  2FNN A;  4XZ5 A;  4G0C A;  4ZWI A;  1XEG A;  1CIM A;  4Q83 A;  4RUY A;  4X5S A;  4HT0 A;  5E2K A;  1KWR A;  4ZWX A;  4DZ9 A;  4HT2 A;  3M67 A;  2HOC A;  5FNM A;  1H4N A;  5DVX A;  4YGF A;  4LHI A;  4FPT A;  4RH2 A;  4YX4 A;  4JSA A;  3V5G A;  1CAL A;  3OYQ A;  4XIW A;  1ZSA A;  4YXO A;  5EHV A;  1G6V A;  2FNM A;  5CAC A;  1TEU X;  2HFW A;  4XIX A;  5DSK A;  4QK2 A;  3K2F A;  3S74 B;  3MWO A;  5BRV A;  4QJP A;  5FL5 A;  5CJF A;  5FLS A;  5JES B;  1AZM A;  2CBA A;  2QP6 A;  1BNQ A;  1TG9 A;  5E5U A;  5JGT B;  4L5V A;  4Q87 A;  4QJW A;  1CCT A;  5EH5 A;  1HCB A;  3CYU A;  1RZE A;  3R16 A;  3S8X A;  3M2X A;  4MLX A;  1RZB A;  1XEV A;  5DSN A;  2CBB A;  4KUW A;  1BNN A;  3BL0 A;  5L3O A;  1ZGE A;  2EZ7 A;  3EFI A;  4XFW A;  4BF1 A;  4PQ7 A;  5JEH B;  1I9M A;  4QJM A;  3MHO A;  1G3Z A;  5EH7 A;  3M3X A;  1RZD A;  2WEJ A;  3RYY A;  1Y7W A;  3DVC A;  5L6K A;  1XPZ A;  5SZ5 A;  4YGK A;  4Q99 A;  1RJ5 A;  1FQL A;  5JGS B;  3S9T A;  1I9O A;  4K1Q A;  4QIZ A;  5G03 A;  4Z1N A;  4M2V A;  1BNW A;  3UYN A;  4YGN A;  5FLQ A;  4K0T A;  4YGL A;  1FQN A;  4RUZ A;  1V9E A;  5FL4 A;  3OKU A;  4FU5 A;  1TG3 A;  3OIM A;  1H9N A;  3V3G B;  4YXU A;  1MOO A;  4PYY A;  3T5U A;  2VVB X;  5E2M A;  1OQ5 A;  4L5W A;  1IF4 A;  1A42 A;  1UGG A;  3CAJ A;  4YGJ A;  5E2N A;  5JG3 B;  5SZ1 A;  3F4X A;  3L14 A;  4RFC A;  2FOY A;  1HEC A;  3IEO A;  5FDC A;  4KP5 A;  3M2N A;  5FL6 A;  3V3I B;  3RZ7 A;  1CNB A;  1I9N A;  5JDV B;  5JEP B;  5LMD A;  3RYV B;  3V2J A;  1RZA A;  3D93 A;  3ML5 A;  1CNY A;  1IF5 A;  4IWZ A;  5DSL A;  4E3G A;  1ZSB A;  3RZ0 B;  1CNX A;  9CA2 A;  5AMG A;  2FW4 A;  5SZ2 A;  3TVO X;  5AMD A;  3MNH A;  3T85 A;  3MHL A;  3TMJ A;  3P5A A;  1HVA A;  3T84 A;  5EKM A;  2CBD A;  1CNG A;  3RYX B;  3M1W A;  3D0N A;  1TEQ X;  3UYQ A;  5EKJ A;  5E2S A;  1BN4 A;  1UGE A;  3KON A;  4Q06 A;  2ILI A;  3DC9 A;  6CA2 A;  4N16 A;  4C3T A;  2GD8 A;  1YDD A;  1JCZ A;  3KNE A;  3P5L A;  1G4J A;  4M2W A;  1KOQ A;  1CCS A;  1G1D A;  3M5E A;  4MO8 A;  3NB5 A;  4K0S A;  4Q7S A;  4Z0Q A;  2NMX A;  2NXS A;  4ETQ C;  3TVN X;  3QYK A;  3M2Y A;  3DVB A;  4QSJ A;  3MHM A;  3LXE A;  4BF6 A;  3DAZ A;  4Q90 A;  1F2W A;  3T82 A;  1CVA A;  2X7U A;  4E9O X;  4RIV A;  5FDI A;  3M14 A;  1TBT X;  3M04 A;  2ZNC A;  5J8Z A;  5DSP A;  5G01 A;  1HUG A;  3MNA A;  5SZ6 A;  1CNC A;  3JXH C;  1CVH A;  1HED A;  4N0X B;  2WD2 A;  3RJ7 A;  1AM6 A;  3S72 B;  2HNC A;  3GZ0 A;  1KWQ A;  1ZE8 A;  4ZAO A;  4CNV A;  3P4V A;  1CVC A;  5JEG B;  2ABE A;  1CCU A;  3Q31 A;  3RG4 A;  2X7S A;  1LG6 A;  4ZWZ A;  1CAN A;  3RZ1 B;  3OKV A;  3N2P A;  4Q9Y A;  4MDL A;  1CAO A;  4ITO A;  4JSZ A;  4YWP A;  3HLJ A;  3S71 B;  1BNM A;  3CZV A;  2FNK A;  4G7A A;  3FW3 A;  5EH8 A;  3RZ8 A;  5HPJ A;  1ZFK A;  3HKT A;  4QTL A;  5DOG A;  4MDM A;  1T9N A;  3F7U A;  1LGD A;  3M40 A;  5FNI A;  2Q1Q A;  4QJ0 A;  1I91 A;  1HEA A;  3U45 X;  1G54 A;  5SZ0 A;  3DA2 A;  1ZNC A;  3IBN A;  3KOK A;  4E4A A;  5BRW A;  2QOA A;  4KAP A;  4WUP A;  4LP6 A;  2O4Z A;  1G46 A;  2IT4 A;  5EHE A;  4Q7P A;  1UGA A;  1CNW A;  3C7P A;  4R59 A;  1BN3 A;  4Z1J A;  1G48 A;  5SZ7 A;  1FR7 A;  1CNJ A;  4K0Z A;  2HD6 A;  2POU A;  3N4B A;  3S97 A;  2F14 A;  3S76 A;  4KNN A;  1V9I C;  5DRS A;  1BZM A;  3RGE A;  3SBH A;  4HF3 A;  4KUY A;  4KNM A;  3V3H B;  3DV7 A;  3DD0 A;  1FLJ A;  3JXG A;  4QJX A;  5FNH A;  5BRU A;  2GEH A;  2NWY A;  4KP8 A;  1TB0 X;  3FE4 A;  1RAY A;  3V7X A;  1CZM A;  3T83 A;  4Q7W A;  1I9Q A;  1TE3 X;  5FLP A;  5EOI A;  3RLD A;  4QY3 A;  4R5B A;  4IDR X;  3MHC A;  2AW1 A;  1CVD A;  1CAK A;  1ZSC A;  4YXI A;  4FVO A;  4TWM A;  4YYT A;  5E5R A;  3ML2 A;  1YDA A;  1Z97 A;  4Q81 A;  1CAZ A;  4MTY A;  5FNJ A;  2NWZ A;  3V3J A;  4CNX A;  3JXF A;  1BN1 A;  4CA2 A;  3N3J A;  1CA3 A;  4MLT A;  1I90 A;  3DD8 A;  3W6H A;  3OYS A;  5AML A;  4E5Q A;  4QK1 A;  3SBI A;  4KNJ A;  1I9P A;  3U47 A;  4WW8 A;  3B4F A;  3MYQ A;  4Z1E A;  2NWP A;  2EU2 A;  5BYI A;  1FQR A;  4BCW A;  1DMY A;  1I8Z A;  5FNG A;  3F7B A;  3R17 B;  3SAX A;  5FLT A;  1Z9Y A;  3P3H A;  1G53 A;  4ITP A;  4E49 A;  1CIN A;  1JD0 A;  5DSI A;  4Q09 A;  8CA2 A;  3OY0 A;  3RYJ B;  1UGD A;  5JQ0 A;  1LZV A;  4CAC A;  1FSN A;  3KWA A;  4Q0L A;  4Q6D A;  5FLR A;  1BNU A;  4QEF A;  5E28 A;  2CA2 A;  1YDC A;  3P55 A;  3DCW A;  4Q6E A;  1UGC A;  2FOV A;  3M96 A;  3P58 A;  1KOP A;  1OKM A;  3P3J A;  4ZX0 A;  3RZ5 A;  3B1B A;  4K13 A;  4WW6 A;  5DOH A;  2H4N A;  4QSI A;  3V2M A;  1YO0 A;  3OIK A;  3W6I A;  1IF7 A;  1BIC A;  2EU3 A;  3M98 A;  2NN1 A;  1TH9 A;  4KV0 A;  3MNI A;  1CNI A;  3K7K A;  1JV0 A;  1BCD A;  3NI5 A;  3VBD A;  2CAB A;  3DBU A;  1HUH A;  2NXR A;  3KIG A;  1OKL A;  4MDG A;  3N0N A;  4ZX1 A;  2FOS A;  1YO2 A;  1LG5 A;  3MDZ A;  1G52 A;  2W2J A;  4FVN A;  2Q38 A;  1CNH A;  4M2U A;  1HCA A;  4DZ7 A;  1RAZ A;  5G0C A;  2VVA X;  3KOI A;  4PYX A;  1CVF A;  1AVN A;  2CBE A;  3IBI A;  3D92 A;  5DSJ A;  1MUA A;  1FSQ A;  2OSF A;  3OIL A;  1IF8 A;  1FQM A;  1BV3 A;  1CAJ A;  4JSW A;  1G45 A;  1H9Q A;  1G4O A;  1CRM A;  5JQT A;  3MHI A;  3DVD A;  3NJ9 A;  4R5A A;  2NNV A;  5SZ3 A;  4Q8Z A;  5EHW A;  3M5T A;  3CA2 A;  3HFP A;  5FNK A;  5BNL A;  4Q8X A;  5A6H A;  3K34 A;  5E2R A;  4HEY A;  5DSO A;  4JSS A;  1CNK A;  3EFT A;  4Q08 A;  3RG3 A;  2HKK A;  1TTM A;  1J9W A;  2NNO A;  4CNR A;  1IF9 A;  4QSA A;  2FOU A;  1HEB A;  4FIK A;  4Q49 A;  4UOV A;  3M1K A;  4HEW A;  4CQ0 A;  3MMF A;  1KEQ A;  3HKN A;  2FOQ A;  4TWL A;  5EIJ A;  1CRA A;  1DCA A;  5A25 A;  4KUV A;  5IPZ A;  2FMG A;  5DSM A;  3IGP A;  4QIY A;  1FR4 A;  1IF6 A;  3F8E A;  3IAI A;  1CVE A;  4HU1 A;  2WEH A;  3PYK A;  3S77 B;  4Z1K A;  3IBL A;  4FL7 A;  3KS3 A;  3ZNC A;  5DSQ A;  1YDB A;  4QSB A;  4JS6 A; 
#chains in the Genus database with same CATH homology
 1G0E A;  3MNK A;  4Q07 A;  2NNG A;  2X7T A;  1ZGF A;  4RUX A;  5EKH A;  5FNL A;  4WR7 A;  2FMZ A;  3MNU A;  2POW A;  4E3H A;  1FSR A;  1BNT A;  1CAI A;  4QK3 A;  5C8I A;  4ZWY A;  4YHA A;  3D9Z A;  4HBA A;  3M1J A;  4RN4 A;  4Y0J A;  3S73 B;  3DCS A;  4KNI A;  1DCB A;  2WEG A;  3M2Z A;  5FLO A;  5CLU A;  2WD3 A;  4Q7V A;  12CA A;  1UGF A;  1CAY A;  1CAH A;  1G0F A;  2AX2 A;  3U3A X;  4YVY A;  4PZH A;  3HKQ A;  1RJ6 A;  2OSM A;  5DSR A;  1DMX A;  3DCC A;  2POV A;  3DC3 A;  4QJO A;  4GL1 X;  3S75 B;  2NWO A;  4PXX A;  1ZH9 A;  2NNS A;  3S78 B;  4COQ A;  3KLD B;  1EOU A;  1OKN A;  3T5Z A;  1URT A;  3D8W A;  4Q78 A;  3ZP9 A;  3FFP X;  3PO6 A;  5EZT X;  5CA2 A;  4E3D A;  1UGB A;  3HS4 A;  4CNW A;  3M5S A;  1BNV A;  4WL4 A;  2QO8 A;  7CA2 A;  4LU3 A;  2Q1B A;  5JG5 B;  1CVB A;  4ILX A;  1YO1 A;  1CIL A;  2H15 A;  3PJJ A;  3V3F A;  3IBU A;  3MNJ A;  3M1Q A;  3U7C A;  4WUQ A;  2CBC A;  3HKU A;  1I9L A;  3KKX A;  4L5U A;  4E3F A;  1RZC A;  4RIU A;  2NN7 A;  5G0B A;  3RYZ A;  4XE1 A;  4FRC A;  4M2R A;  1THK A;  1CAM A;  1CA2 A;  3BET A;  3P44 A;  1LUG A;  1Z93 A;  3BL1 A;  3MZC A;  4Q8Y A;  1ZFQ A;  4RFD A;  1XQ0 A;  2WEO A;  3SAP A;  5SZ4 A;  2HL4 A;  4HEZ A;  2NXT A;  2FNN A;  4XZ5 A;  4G0C A;  4ZWI A;  1XEG A;  1CIM A;  4Q83 A;  4RUY A;  4X5S A;  4HT0 A;  5E2K A;  1KWR A;  4ZWX A;  4DZ9 A;  4HT2 A;  3M67 A;  2HOC A;  5FNM A;  1H4N A;  5DVX A;  4YGF A;  4LHI A;  4FPT A;  4RH2 A;  4YX4 A;  4JSA A;  3V5G A;  1CAL A;  3OYQ A;  4XIW A;  1ZSA A;  4YXO A;  5EHV A;  1G6V A;  2FNM A;  5CAC A;  1TEU X;  2HFW A;  4XIX A;  5DSK A;  4QK2 A;  3K2F A;  3S74 B;  3MWO A;  5BRV A;  4QJP A;  5FL5 A;  5CJF A;  5FLS A;  5JES B;  1AZM A;  2CBA A;  2QP6 A;  1BNQ A;  1TG9 A;  5E5U A;  5JGT B;  4L5V A;  4Q87 A;  4QJW A;  1CCT A;  5EH5 A;  1HCB A;  3CYU A;  1RZE A;  3R16 A;  3S8X A;  3M2X A;  4MLX A;  1RZB A;  1XEV A;  5DSN A;  2CBB A;  4KUW A;  1BNN A;  3BL0 A;  5L3O A;  1ZGE A;  2EZ7 A;  3EFI A;  4XFW A;  4BF1 A;  4PQ7 A;  5JEH B;  1I9M A;  4QJM A;  3MHO A;  1G3Z A;  5EH7 A;  3M3X A;  1RZD A;  2WEJ A;  3RYY A;  1Y7W A;  3DVC A;  5L6K A;  1XPZ A;  5SZ5 A;  4YGK A;  4Q99 A;  1RJ5 A;  1FQL A;  5JGS B;  3S9T A;  1I9O A;  4K1Q A;  4QIZ A;  5G03 A;  4Z1N A;  4M2V A;  1BNW A;  3UYN A;  4YGN A;  5FLQ A;  4K0T A;  4YGL A;  1FQN A;  4RUZ A;  1V9E A;  5FL4 A;  3OKU A;  4FU5 A;  1TG3 A;  3OIM A;  1H9N A;  3V3G B;  4YXU A;  1MOO A;  4PYY A;  3T5U A;  2VVB X;  5E2M A;  1OQ5 A;  4L5W A;  1IF4 A;  1A42 A;  1UGG A;  3CAJ A;  4YGJ A;  5E2N A;  5JG3 B;  5SZ1 A;  3F4X A;  3L14 A;  4RFC A;  2FOY A;  1HEC A;  3IEO A;  5FDC A;  4KP5 A;  3M2N A;  5FL6 A;  3V3I B;  3RZ7 A;  1CNB A;  1I9N A;  5JDV B;  5JEP B;  5LMD A;  3RYV B;  3V2J A;  1RZA A;  3D93 A;  3ML5 A;  1CNY A;  1IF5 A;  4IWZ A;  5DSL A;  4E3G A;  1ZSB A;  3RZ0 B;  1CNX A;  9CA2 A;  5AMG A;  2FW4 A;  5SZ2 A;  3TVO X;  5AMD A;  3MNH A;  3T85 A;  3MHL A;  3TMJ A;  3P5A A;  1HVA A;  3T84 A;  5EKM A;  2CBD A;  1CNG A;  3RYX B;  3M1W A;  3D0N A;  1TEQ X;  3UYQ A;  5EKJ A;  5E2S A;  1BN4 A;  1UGE A;  3KON A;  4Q06 A;  2ILI A;  3DC9 A;  6CA2 A;  4N16 A;  4C3T A;  2GD8 A;  1YDD A;  1JCZ A;  3KNE A;  3P5L A;  1G4J A;  4M2W A;  1KOQ A;  1CCS A;  1G1D A;  3M5E A;  4MO8 A;  3NB5 A;  4K0S A;  4Q7S A;  4Z0Q A;  2NMX A;  2NXS A;  4ETQ C;  3TVN X;  3QYK A;  3M2Y A;  3DVB A;  4QSJ A;  3MHM A;  3LXE A;  4BF6 A;  3DAZ A;  4Q90 A;  1F2W A;  3T82 A;  1CVA A;  2X7U A;  4E9O X;  4RIV A;  5FDI A;  3M14 A;  1TBT X;  3M04 A;  2ZNC A;  5J8Z A;  5DSP A;  5G01 A;  1HUG A;  3MNA A;  5SZ6 A;  1CNC A;  3JXH C;  1CVH A;  1HED A;  4N0X B;  2WD2 A;  3RJ7 A;  1AM6 A;  3S72 B;  2HNC A;  3GZ0 A;  1KWQ A;  1ZE8 A;  4ZAO A;  4CNV A;  3P4V A;  1CVC A;  5JEG B;  2ABE A;  1CCU A;  3Q31 A;  3RG4 A;  2X7S A;  1LG6 A;  4ZWZ A;  1CAN A;  3RZ1 B;  3OKV A;  3N2P A;  4Q9Y A;  4MDL A;  1CAO A;  4ITO A;  4JSZ A;  4YWP A;  3HLJ A;  3S71 B;  1BNM A;  3CZV A;  2FNK A;  4G7A A;  3FW3 A;  5EH8 A;  3RZ8 A;  5HPJ A;  1ZFK A;  3HKT A;  4QTL A;  5DOG A;  4MDM A;  1T9N A;  3F7U A;  1LGD A;  3M40 A;  5FNI A;  2Q1Q A;  4QJ0 A;  1I91 A;  1HEA A;  3U45 X;  1G54 A;  5SZ0 A;  3DA2 A;  1ZNC A;  3IBN A;  3KOK A;  4E4A A;  5BRW A;  2QOA A;  4KAP A;  4WUP A;  4LP6 A;  2O4Z A;  1G46 A;  2IT4 A;  5EHE A;  4Q7P A;  1UGA A;  1CNW A;  3C7P A;  4R59 A;  1BN3 A;  4Z1J A;  1G48 A;  5SZ7 A;  1FR7 A;  1CNJ A;  4K0Z A;  2HD6 A;  2POU A;  3N4B A;  3S97 A;  2F14 A;  3S76 A;  4KNN A;  1V9I C;  5DRS A;  1BZM A;  3RGE A;  3SBH A;  4HF3 A;  4KUY A;  4KNM A;  3V3H B;  3DV7 A;  3DD0 A;  1FLJ A;  3JXG A;  4QJX A;  5FNH A;  5BRU A;  2GEH A;  2NWY A;  4KP8 A;  1TB0 X;  3FE4 A;  1RAY A;  3V7X A;  1CZM A;  3T83 A;  4Q7W A;  1I9Q A;  1TE3 X;  5FLP A;  5EOI A;  3RLD A;  4QY3 A;  4R5B A;  4IDR X;  3MHC A;  2AW1 A;  1CVD A;  1CAK A;  1ZSC A;  4YXI A;  4FVO A;  4TWM A;  4YYT A;  5E5R A;  3ML2 A;  1YDA A;  1Z97 A;  4Q81 A;  1CAZ A;  4MTY A;  5FNJ A;  2NWZ A;  3V3J A;  4CNX A;  3JXF A;  1BN1 A;  4CA2 A;  3N3J A;  1CA3 A;  4MLT A;  1I90 A;  3DD8 A;  3W6H A;  3OYS A;  5AML A;  4E5Q A;  4QK1 A;  3SBI A;  4KNJ A;  1I9P A;  3U47 A;  4WW8 A;  3B4F A;  3MYQ A;  4Z1E A;  2NWP A;  2EU2 A;  5BYI A;  1FQR A;  4BCW A;  1DMY A;  1I8Z A;  5FNG A;  3F7B A;  3R17 B;  3SAX A;  5FLT A;  1Z9Y A;  3P3H A;  1G53 A;  4ITP A;  4E49 A;  1CIN A;  1JD0 A;  5DSI A;  4Q09 A;  8CA2 A;  3OY0 A;  3RYJ B;  1UGD A;  5JQ0 A;  1LZV A;  4CAC A;  1FSN A;  3KWA A;  4Q0L A;  4Q6D A;  5FLR A;  1BNU A;  4QEF A;  5E28 A;  2CA2 A;  1YDC A;  3P55 A;  3DCW A;  4Q6E A;  1UGC A;  2FOV A;  3M96 A;  3P58 A;  1KOP A;  1OKM A;  3P3J A;  4ZX0 A;  3RZ5 A;  3B1B A;  4K13 A;  4WW6 A;  5DOH A;  2H4N A;  4QSI A;  3V2M A;  1YO0 A;  3OIK A;  3W6I A;  1IF7 A;  1BIC A;  2EU3 A;  3M98 A;  2NN1 A;  1TH9 A;  4KV0 A;  3MNI A;  1CNI A;  3K7K A;  1JV0 A;  1BCD A;  3NI5 A;  3VBD A;  2CAB A;  3DBU A;  1HUH A;  2NXR A;  3KIG A;  1OKL A;  4MDG A;  3N0N A;  4ZX1 A;  2FOS A;  1YO2 A;  1LG5 A;  3MDZ A;  1G52 A;  2W2J A;  4FVN A;  2Q38 A;  1CNH A;  4M2U A;  1HCA A;  4DZ7 A;  1RAZ A;  5G0C A;  2VVA X;  3KOI A;  4PYX A;  1CVF A;  1AVN A;  2CBE A;  3IBI A;  3D92 A;  5DSJ A;  1MUA A;  1FSQ A;  2OSF A;  3OIL A;  1IF8 A;  1FQM A;  1BV3 A;  1CAJ A;  4JSW A;  1G45 A;  1H9Q A;  1G4O A;  1CRM A;  5JQT A;  3MHI A;  3DVD A;  3NJ9 A;  4R5A A;  2NNV A;  5SZ3 A;  4Q8Z A;  5EHW A;  3M5T A;  3CA2 A;  3HFP A;  5FNK A;  5BNL A;  4Q8X A;  5A6H A;  3K34 A;  5E2R A;  4HEY A;  5DSO A;  4JSS A;  1CNK A;  3EFT A;  4Q08 A;  3RG3 A;  2HKK A;  1TTM A;  1J9W A;  2NNO A;  4CNR A;  1IF9 A;  4QSA A;  2FOU A;  1HEB A;  4FIK A;  4Q49 A;  4UOV A;  3M1K A;  4HEW A;  4CQ0 A;  3MMF A;  1KEQ A;  3HKN A;  2FOQ A;  4TWL A;  5EIJ A;  1CRA A;  1DCA A;  5A25 A;  4KUV A;  5IPZ A;  2FMG A;  5DSM A;  3IGP A;  4QIY A;  1FR4 A;  1IF6 A;  3F8E A;  3IAI A;  1CVE A;  4HU1 A;  2WEH A;  3PYK A;  3S77 B;  4Z1K A;  3IBL A;  4FL7 A;  3KS3 A;  3ZNC A;  5DSQ A;  1YDB A;  4QSB A;  4JS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...