1CVEA

Structural consequences of redesigning a protein-zinc binding site
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
Knots found
sequence length
255
structure length
255
Chain Sequence
WGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELDLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase(oxo-acid)
molecule keywords CARBONIC ANHYDRASE II
publication title Structural consequences of redesigning a protein-zinc binding site.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 255
sequence length 255
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1994-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1cveA00
3JXFA 3S97A 1IF9A 1BV3A 4RFCA 1G46A 3RLDA 5EH8A 4QK2A 3MHLA 5FNLA 1OQ5A 3S75B 4RUYA 5EIJA 3HKQA 4Q06A 3M1WA 1BZMA 5BRUA 4PYXA 3MNUA 3P55A 3PYKA 3IBNA 3HKNA 5E2NA 1FLJA 1G0EA 1I90A 1CRAA 3KOKA 4WW8A 3T5ZA 3M1KA 4JS6A 3P5LA 4KAPA 4E3DA 3M2XA 2ZNCA 3N2PA 3F7UA 5DSLA 5CA2A 1G52A 3HKTA 1EOUA 4HT2A 2IT4A 3HKUA 2FW4A 1FQLA 5FLTA 1ZGFA 4ILXA 2WEOA 1CCSA 2O4ZA 4XIWA 5FLSA 3M14A 5EH5A 1I9PA 4QEFA 3RYZA 2OSFA 1MOOA 4Q49A 3P5AA 4K13A 3V2JA 4G0CA 3LXEA 3S71B 7CA2A 2NNSA 4R5BA 4Z1JA 4R59A 1LGDA 5EOIA 1KWQA 4QTLA 3V3IB 2NXTA 3S76A 4BCWA 1CVEA 4DZ7A 3D0NA 4PQ7A 1KOQA 4QY3A 4QJMA 1URTA 1IF4A 5C8IA 2CBBA 4Q9YA 5JDVB 3D8WA 4HEYA 4KUWA 5SZ6A 4YHAA 5DVXA 1I8ZA 1KWRA 1CNCA 1UGEA 1YDDA 3KIGA 4ZWZA 5DSPA 4HF3A 4QJPA 1KEQA 1XEVA 4QIYA 2WD2A 4Q7PA 4C3TA 4CA2A 3RZ0B 1I9QA 1BNWA 1HVAA 5SZ1A 3V3HB 4UOVA 4ZWYA 1JCZA 5JQTA 3RG4A 5E5RA 4QK1A 4QSIA 1CNIA 3V5GA 3OILA 1ZE8A 4Q8ZA 4KNMA 3ZNCA 1BN4A 4KNIA 3S78B 5L6KA 1HUGA 4FPTA 3P4VA 3MHOA 1G6VA 2FMZA 3DA2A 4WL4A 5BRWA 3IBUA 1BICA 4HU1A 3RYXB 4Q6DA 3SAPA 1IF6A 3L14A 4ZX1A 3P44A 4PYYA 4QSBA 1UGDA 4L5VA 1CNWA 2Q38A 3S73B 4R5AA 1FSQA 4QJWA 1DCBA 3NJ9A 4KNNA 4JSZA 4Q08A 4WUQA 1YDBA 3K34A 5FNKA 3MNIA 3PJJA 4Q09A 3KS3A 4YXOA 1ZSAA 4L5UA 1F2WA 1G3ZA 1TE3X 4XZ5A 1G45A 1I9OA 4GL1X 4Q8YA 3M2NA 2HL4A 1CVHA 3OKUA 5AMDA 5JESB 1HUHA 3DC3A 3OIMA 1RZAA 1FQMA 5EKHA 5FNGA 3PO6A 3DV7A 3DVBA 2NN1A 4JSWA 1ZH9A 2FNKA 2ILIA 2NXRA 1G53A 1RAYA 4HBAA 4Q83A 5JEHB 5E28A 1H4NA 3BL1A 1I9LA 1RZBA 4ZAOA 3ML2A 3RYYA 4FU5A 3JXGA 4MLTA 1IF8A 3P3JA 1CAKA 4WR7A 5CACA 5G03A 2POVA 1TB0X 4RN4A 1CZMA 1YO1A 3T5UA 5FL4A 5J8ZA 5EHVA 5G0CA 2F14A 4YVYA 2X7UA 3FE4A 5EKJA 5DRSA 1HEAA 1YDAA 5JG5B 2NMXA 4Q7SA 4YXUA 2NXSA 4CNVA 4KNJA 2Q1QA 2WD3A 3RZ5A 3MHCA 1G48A 2FMGA 5AMGA 5DSRA 5DSMA 3TVOX 4ETQC 12CAA 4HEZA 1XEGA 4Q07A 1CVFA 5DSOA 3M04A 1AVNA 3D9ZA 4YX4A 3R17B 3S74B 1OKMA 2GEHA 5FL5A 6CA2A 1BNUA 3MWOA 1HEDA 2FNNA 3MDZA 1J9WA 4MO8A 1CNYA 5LMDA 3HS4A 1TG3A 3CA2A 1TH9A 1TTMA 4K1QA 5JG3B 1CNHA 2FOSA 3UYQA 2GD8A 1BNNA 1AM6A 4HEWA 1CILA 3CAJA 3UYNA 5E2RA 2HOCA 1CANA 4L5WA 4LP6A 4TWMA 1IF7A 5EHWA 3TMJA 3T83A 1G4JA 4N16A 4Q7VA 1CA3A 3B4FA 2EZ7A 2EU2A 4XFWA 2POUA 3KOIA 1FR4A 1CNGA 1G0FA 1TEQX 3M5TA 3T85A 1FSRA 1CIMA 3U45X 4YGKA 4YGNA 3KNEA 3CZVA 3HLJA 4FVOA 1TEUX 1V9EA 3QYKA 4XE1A 3F4XA 5HPJA 4Q7WA 3M3XA 1RAZA 1CA2A 1CNKA 1ZNCA 4M2WA 1ZFQA 2AW1A 3P58A 5DSIA 2Q1BA 4FVNA 3W6IA 1XPZA 2POWA 4KP8A 1CVCA 4PZHA 3OIKA 2AX2A 3M5EA 3M98A 1RJ5A 3OKVA 1TG9A 1BN3A 4Z1NA 1CAHA 3NB5A 4WW6A 2CA2A 4QSAA 3MZCA 4E3HA 3B1BA 1RZCA 5JEGB 5CLUA 4MLXA 5FDIA 5EKMA 3KLDB 3IGPA 1ZFKA 1CVAA 4YGFA 5AMLA 4MDLA 3M67A 4E5QA 1CCTA 2HFWA 3SBIA 1ZSBA 5SZ5A 4YGJA 5FNHA 1JD0A 3IEOA 4ITPA 3KKXA 5FLQA 1RZEA 3P3HA 4KV0A 3K7KA 4RIUA 3M1JA 3M2YA 3S72B 4MTYA 5JEPB 3R16A 1UGGA 3V3FA 4Z1EA 5CJFA 3TVNX 1CAIA 2CBEA 3MMFA 5G01A 3S9TA 4Q90A 1BNMA 1HCAA 1CAOA 1XQ0A 1I9NA 1I91A 1BN1A 4DZ9A 2NWYA 2NWPA 4M2VA 2WEJA 3MNAA 4N0XB 3RJ7A 4IWZA 5BNLA 3DCCA 3C7PA 2WEGA 3IBIA 5JGTB 5A25A 4RH2A 3D92A 1Z93A 2ABEA 3DCWA 1OKLA 1FR7A 3RGEA 3V3GB 3M5SA 4CNWA 3S8XA 1G1DA 3F7BA 5FNJA 2CBCA 4LU3A 1G54A 5EZTX 2FOUA 4QSJA 1CNJA 1HCBA 4FRCA 1CAYA 2VVBX 5DSKA 5A6HA 1T9NA 3MHIA 3IBLA 4M2UA 3NI5A 3ZP9A 4MDGA 3KWAA 1THKA 2NNOA 3U3AX 1HECA 2QOAA 4RUZA 1CAMA 1CINA 3RZ8A 4CNRA 5IPZA 1KOPA 4QJ0A 1CALA 3MNKA 1Z9YA 1BNVA 2HD6A 4COQA 4Q6EA 4Z1KA 4K0TA 4KP5A 4QK3A 3U47A 3OYSA 4XIXA 4K0ZA 4IDRX 2X7SA 4CACA 3BETA 1FSNA 2NN7A 5E5UA 1YDCA 3D93A 1AZMA 4MDMA 1JV0A 2FOVA 3DBUA 3RG3A 5DSQA 4QIZA 4E3FA 2FOQA 5DSJA 2CBDA 2VVAX 1BCDA 4Q8XA 3M40A 4ZWIA 5SZ4A 1BNQA 1FQNA 5FNMA 1I9MA 5SZ3A 1H9QA 3DC9A 4QJXA 4RFDA 4LHIA 1LG6A 4ZX0A 1BNTA 3BL0A 5FLPA 4ITOA 3DD8A 4BF1A 9CA2A 3T84A 3U7CA 4CQ0A 3MHMA 4Q0LA 3HFPA 2QO8A 4YYTA 3N0NA 1DMYA 4RIVA 4Q81A 1TBTX 5JQ0A 4JSAA 2H4NA 3S77B 1H9NA 2HKKA 3M2ZA 1RZDA 3GZ0A 2OSMA 3MNHA 3VBDA 2NNGA 1CCUA 3DAZA 3RZ1B 1Y7WA 4TWLA 2H15A 3N3JA 1HEBA 3RYJB 5SZ2A 5FLOA 5BYIA 4ZWXA 1FQRA 3DD0A 1CAZA 2HNCA 3FFPX 2X7TA 1CRMA 4G7AA 3DVDA 4Q78A 4KUVA 1RJ6A 3IAIA 3RZ7A 3K2FA 4Q87A 2NNVA 4E3GA 1UGFA 3EFTA 4Y0JA 1DCAA 1LUGA 3M1QA 3V7XA 3JXHC 5DOHA 4E9OX 1YO0A 4M2RA 3SAXA 5FNIA 4QJOA 5SZ0A 3FW3A 1ZGEA 1G4OA 4FIKA 3V3JA 3DVCA 5G0BA 2EU3A 3N4BA 4X5SA 1OKNA 4K0SA 5DOGA 4Z0QA 5L3OA 4YWPA 1CVBA 5E2KA 1YO2A 8CA2A 4KUYA 5FLRA 3M96A 1ZSCA 3DCSA 3EFIA 1UGCA 5SZ7A 3V2MA 1DMXA 1CNBA 1CVDA 4YGLA 3Q31A 2W2JA 3KONA 5DSNA 5FL6A 1V9IC 3MNJA 2CABA 5EH7A 1Z97A 4Q99A 2FOYA 4E49A 4WUPA 3ML5A 4CNXA 3F8EA 5E2SA 1A42A 4JSSA 2QP6A 1CNXA 4PXXA 4FL7A 5E2MA 4RUXA 2FNMA 1IF5A 5BRVA 3OYQA 1LG5A 2WEHA 3T82A 4YXIA 1LZVA 5EHEA 5FDCA 3CYUA 3SBHA 4HT0A 1UGAA 3RYVB 4BF6A 1CAJA 5JGSB 3MYQA 1MUAA 1UGBA 2NWOA 2NWZA 3OY0A 4E4AA 2CBAA 3W6HA
chains in the Genus database with same CATH superfamily
3JXFA 3S97A 1IF9A 1BV3A 4RFCA 1G46A 3RLDA 5EH8A 4QK2A 3MHLA 5FNLA 1OQ5A 3S75B 4RUYA 5EIJA 3HKQA 4Q06A 3M1WA 1BZMA 5BRUA 4PYXA 3MNUA 3P55A 3PYKA 3IBNA 3HKNA 5E2NA 1FLJA 1G0EA 1I90A 1CRAA 3KOKA 4WW8A 3T5ZA 3M1KA 4JS6A 3P5LA 4KAPA 4E3DA 3M2XA 2ZNCA 3N2PA 3F7UA 5DSLA 5CA2A 1G52A 3HKTA 1EOUA 4HT2A 2IT4A 3HKUA 2FW4A 1FQLA 5FLTA 1ZGFA 4ILXA 2WEOA 1CCSA 2O4ZA 4XIWA 5FLSA 3M14A 5EH5A 1I9PA 4QEFA 3RYZA 2OSFA 1MOOA 4Q49A 3P5AA 4K13A 3V2JA 4G0CA 3LXEA 3S71B 7CA2A 2NNSA 4R5BA 4Z1JA 4R59A 1LGDA 5EOIA 1KWQA 4QTLA 3V3IB 2NXTA 3S76A 4BCWA 1CVEA 4DZ7A 3D0NA 4PQ7A 1KOQA 4QY3A 4QJMA 1URTA 1IF4A 5C8IA 2CBBA 4Q9YA 5JDVB 3D8WA 4HEYA 4KUWA 5SZ6A 4YHAA 5DVXA 1I8ZA 1KWRA 1CNCA 1UGEA 1YDDA 3KIGA 4ZWZA 5DSPA 4HF3A 4QJPA 1KEQA 1XEVA 4QIYA 2WD2A 4Q7PA 4C3TA 4CA2A 3RZ0B 1I9QA 1BNWA 1HVAA 5SZ1A 3V3HB 4UOVA 4ZWYA 1JCZA 5JQTA 3RG4A 5E5RA 4QK1A 4QSIA 1CNIA 3V5GA 3OILA 1ZE8A 4Q8ZA 4KNMA 3ZNCA 1BN4A 4KNIA 3S78B 5L6KA 1HUGA 4FPTA 3P4VA 3MHOA 1G6VA 2FMZA 3DA2A 4WL4A 5BRWA 3IBUA 1BICA 4HU1A 3RYXB 4Q6DA 3SAPA 1IF6A 3L14A 4ZX1A 3P44A 4PYYA 4QSBA 1UGDA 4L5VA 1CNWA 2Q38A 3S73B 4R5AA 1FSQA 4QJWA 1DCBA 3NJ9A 4KNNA 4JSZA 4Q08A 4WUQA 1YDBA 3K34A 5FNKA 3MNIA 3PJJA 4Q09A 3KS3A 4YXOA 1ZSAA 4L5UA 1F2WA 1G3ZA 1TE3X 4XZ5A 1G45A 1I9OA 4GL1X 4Q8YA 3M2NA 2HL4A 1CVHA 3OKUA 5AMDA 5JESB 1HUHA 3DC3A 3OIMA 1RZAA 1FQMA 5EKHA 5FNGA 3PO6A 3DV7A 3DVBA 2NN1A 4JSWA 1ZH9A 2FNKA 2ILIA 2NXRA 1G53A 1RAYA 4HBAA 4Q83A 5JEHB 5E28A 1H4NA 3BL1A 1I9LA 1RZBA 4ZAOA 3ML2A 3RYYA 4FU5A 3JXGA 4MLTA 1IF8A 3P3JA 1CAKA 4WR7A 5CACA 5G03A 2POVA 1TB0X 4RN4A 1CZMA 1YO1A 3T5UA 5FL4A 5J8ZA 5EHVA 5G0CA 2F14A 4YVYA 2X7UA 3FE4A 5EKJA 5DRSA 1HEAA 1YDAA 5JG5B 2NMXA 4Q7SA 4YXUA 2NXSA 4CNVA 4KNJA 2Q1QA 2WD3A 3RZ5A 3MHCA 1G48A 2FMGA 5AMGA 5DSRA 5DSMA 3TVOX 4ETQC 12CAA 4HEZA 1XEGA 4Q07A 1CVFA 5DSOA 3M04A 1AVNA 3D9ZA 4YX4A 3R17B 3S74B 1OKMA 2GEHA 5FL5A 6CA2A 1BNUA 3MWOA 1HEDA 2FNNA 3MDZA 1J9WA 4MO8A 1CNYA 5LMDA 3HS4A 1TG3A 3CA2A 1TH9A 1TTMA 4K1QA 5JG3B 1CNHA 2FOSA 3UYQA 2GD8A 1BNNA 1AM6A 4HEWA 1CILA 3CAJA 3UYNA 5E2RA 2HOCA 1CANA 4L5WA 4LP6A 4TWMA 1IF7A 5EHWA 3TMJA 3T83A 1G4JA 4N16A 4Q7VA 1CA3A 3B4FA 2EZ7A 2EU2A 4XFWA 2POUA 3KOIA 1FR4A 1CNGA 1G0FA 1TEQX 3M5TA 3T85A 1FSRA 1CIMA 3U45X 4YGKA 4YGNA 3KNEA 3CZVA 3HLJA 4FVOA 1TEUX 1V9EA 3QYKA 4XE1A 3F4XA 5HPJA 4Q7WA 3M3XA 1RAZA 1CA2A 1CNKA 1ZNCA 4M2WA 1ZFQA 2AW1A 3P58A 5DSIA 2Q1BA 4FVNA 3W6IA 1XPZA 2POWA 4KP8A 1CVCA 4PZHA 3OIKA 2AX2A 3M5EA 3M98A 1RJ5A 3OKVA 1TG9A 1BN3A 4Z1NA 1CAHA 3NB5A 4WW6A 2CA2A 4QSAA 3MZCA 4E3HA 3B1BA 1RZCA 5JEGB 5CLUA 4MLXA 5FDIA 5EKMA 3KLDB 3IGPA 1ZFKA 1CVAA 4YGFA 5AMLA 4MDLA 3M67A 4E5QA 1CCTA 2HFWA 3SBIA 1ZSBA 5SZ5A 4YGJA 5FNHA 1JD0A 3IEOA 4ITPA 3KKXA 5FLQA 1RZEA 3P3HA 4KV0A 3K7KA 4RIUA 3M1JA 3M2YA 3S72B 4MTYA 5JEPB 3R16A 1UGGA 3V3FA 4Z1EA 5CJFA 3TVNX 1CAIA 2CBEA 3MMFA 5G01A 3S9TA 4Q90A 1BNMA 1HCAA 1CAOA 1XQ0A 1I9NA 1I91A 1BN1A 4DZ9A 2NWYA 2NWPA 4M2VA 2WEJA 3MNAA 4N0XB 3RJ7A 4IWZA 5BNLA 3DCCA 3C7PA 2WEGA 3IBIA 5JGTB 5A25A 4RH2A 3D92A 1Z93A 2ABEA 3DCWA 1OKLA 1FR7A 3RGEA 3V3GB 3M5SA 4CNWA 3S8XA 1G1DA 3F7BA 5FNJA 2CBCA 4LU3A 1G54A 5EZTX 2FOUA 4QSJA 1CNJA 1HCBA 4FRCA 1CAYA 2VVBX 5DSKA 5A6HA 1T9NA 3MHIA 3IBLA 4M2UA 3NI5A 3ZP9A 4MDGA 3KWAA 1THKA 2NNOA 3U3AX 1HECA 2QOAA 4RUZA 1CAMA 1CINA 3RZ8A 4CNRA 5IPZA 1KOPA 4QJ0A 1CALA 3MNKA 1Z9YA 1BNVA 2HD6A 4COQA 4Q6EA 4Z1KA 4K0TA 4KP5A 4QK3A 3U47A 3OYSA 4XIXA 4K0ZA 4IDRX 2X7SA 4CACA 3BETA 1FSNA 2NN7A 5E5UA 1YDCA 3D93A 1AZMA 4MDMA 1JV0A 2FOVA 3DBUA 3RG3A 5DSQA 4QIZA 4E3FA 2FOQA 5DSJA 2CBDA 2VVAX 1BCDA 4Q8XA 3M40A 4ZWIA 5SZ4A 1BNQA 1FQNA 5FNMA 1I9MA 5SZ3A 1H9QA 3DC9A 4QJXA 4RFDA 4LHIA 1LG6A 4ZX0A 1BNTA 3BL0A 5FLPA 4ITOA 3DD8A 4BF1A 9CA2A 3T84A 3U7CA 4CQ0A 3MHMA 4Q0LA 3HFPA 2QO8A 4YYTA 3N0NA 1DMYA 4RIVA 4Q81A 1TBTX 5JQ0A 4JSAA 2H4NA 3S77B 1H9NA 2HKKA 3M2ZA 1RZDA 3GZ0A 2OSMA 3MNHA 3VBDA 2NNGA 1CCUA 3DAZA 3RZ1B 1Y7WA 4TWLA 2H15A 3N3JA 1HEBA 3RYJB 5SZ2A 5FLOA 5BYIA 4ZWXA 1FQRA 3DD0A 1CAZA 2HNCA 3FFPX 2X7TA 1CRMA 4G7AA 3DVDA 4Q78A 4KUVA 1RJ6A 3IAIA 3RZ7A 3K2FA 4Q87A 2NNVA 4E3GA 1UGFA 3EFTA 4Y0JA 1DCAA 1LUGA 3M1QA 3V7XA 3JXHC 5DOHA 4E9OX 1YO0A 4M2RA 3SAXA 5FNIA 4QJOA 5SZ0A 3FW3A 1ZGEA 1G4OA 4FIKA 3V3JA 3DVCA 5G0BA 2EU3A 3N4BA 4X5SA 1OKNA 4K0SA 5DOGA 4Z0QA 5L3OA 4YWPA 1CVBA 5E2KA 1YO2A 8CA2A 4KUYA 5FLRA 3M96A 1ZSCA 3DCSA 3EFIA 1UGCA 5SZ7A 3V2MA 1DMXA 1CNBA 1CVDA 4YGLA 3Q31A 2W2JA 3KONA 5DSNA 5FL6A 1V9IC 3MNJA 2CABA 5EH7A 1Z97A 4Q99A 2FOYA 4E49A 4WUPA 3ML5A 4CNXA 3F8EA 5E2SA 1A42A 4JSSA 2QP6A 1CNXA 4PXXA 4FL7A 5E2MA 4RUXA 2FNMA 1IF5A 5BRVA 3OYQA 1LG5A 2WEHA 3T82A 4YXIA 1LZVA 5EHEA 5FDCA 3CYUA 3SBHA 4HT0A 1UGAA 3RYVB 4BF6A 1CAJA 5JGSB 3MYQA 1MUAA 1UGBA 2NWOA 2NWZA 3OY0A 4E4AA 2CBAA 3W6HA
chains in the Genus database with same CATH topology
3JXFA 3S97A 1IF9A 1BV3A 4RFCA 1G46A 3RLDA 5EH8A 4QK2A 3MHLA 5FNLA 1OQ5A 3S75B 4RUYA 5EIJA 3HKQA 4Q06A 3M1WA 1BZMA 5BRUA 4PYXA 3MNUA 3P55A 3PYKA 3IBNA 3HKNA 5E2NA 1FLJA 1G0EA 1I90A 1CRAA 3KOKA 4WW8A 3T5ZA 3M1KA 4JS6A 3P5LA 4KAPA 4E3DA 3M2XA 2ZNCA 3N2PA 3F7UA 5DSLA 5CA2A 1G52A 3HKTA 1EOUA 4HT2A 2IT4A 3HKUA 2FW4A 1FQLA 5FLTA 1ZGFA 4ILXA 2WEOA 1CCSA 2O4ZA 4XIWA 5FLSA 3M14A 5EH5A 1I9PA 4QEFA 3RYZA 2OSFA 1MOOA 4Q49A 3P5AA 4K13A 3V2JA 4G0CA 3LXEA 3S71B 7CA2A 2NNSA 4R5BA 4Z1JA 4R59A 1LGDA 5EOIA 1KWQA 4QTLA 3V3IB 2NXTA 3S76A 4BCWA 1CVEA 4DZ7A 3D0NA 4PQ7A 1KOQA 4QY3A 4QJMA 1URTA 1IF4A 5C8IA 2CBBA 4Q9YA 5JDVB 3D8WA 4HEYA 4KUWA 5SZ6A 4YHAA 5DVXA 1I8ZA 1KWRA 1CNCA 1UGEA 1YDDA 3KIGA 4ZWZA 5DSPA 4HF3A 4QJPA 1KEQA 1XEVA 4QIYA 2WD2A 4Q7PA 4C3TA 4CA2A 3RZ0B 1I9QA 1BNWA 1HVAA 5SZ1A 3V3HB 4UOVA 4ZWYA 1JCZA 5JQTA 3RG4A 5E5RA 4QK1A 4QSIA 1CNIA 3V5GA 3OILA 1ZE8A 4Q8ZA 4KNMA 3ZNCA 1BN4A 4KNIA 3S78B 5L6KA 1HUGA 4FPTA 3P4VA 3MHOA 1G6VA 2FMZA 3DA2A 4WL4A 5BRWA 3IBUA 1BICA 4HU1A 3RYXB 4Q6DA 3SAPA 1IF6A 3L14A 4ZX1A 3P44A 4PYYA 4QSBA 1UGDA 4L5VA 1CNWA 2Q38A 3S73B 4R5AA 1FSQA 4QJWA 1DCBA 3NJ9A 4KNNA 4JSZA 4Q08A 4WUQA 1YDBA 3K34A 5FNKA 3MNIA 3PJJA 4Q09A 3KS3A 4YXOA 1ZSAA 4L5UA 1F2WA 1G3ZA 1TE3X 4XZ5A 1G45A 1I9OA 4GL1X 4Q8YA 3M2NA 2HL4A 1CVHA 3OKUA 5AMDA 5JESB 1HUHA 3DC3A 3OIMA 1RZAA 1FQMA 5EKHA 5FNGA 3PO6A 3DV7A 3DVBA 2NN1A 4JSWA 1ZH9A 2FNKA 2ILIA 2NXRA 1G53A 1RAYA 4HBAA 4Q83A 5JEHB 5E28A 1H4NA 3BL1A 1I9LA 1RZBA 4ZAOA 3ML2A 3RYYA 4FU5A 3JXGA 4MLTA 1IF8A 3P3JA 1CAKA 4WR7A 5CACA 5G03A 2POVA 1TB0X 4RN4A 1CZMA 1YO1A 3T5UA 5FL4A 5J8ZA 5EHVA 5G0CA 2F14A 4YVYA 2X7UA 3FE4A 5EKJA 5DRSA 1HEAA 1YDAA 5JG5B 2NMXA 4Q7SA 4YXUA 2NXSA 4CNVA 4KNJA 2Q1QA 2WD3A 3RZ5A 3MHCA 1G48A 2FMGA 5AMGA 5DSRA 5DSMA 3TVOX 4ETQC 12CAA 4HEZA 1XEGA 4Q07A 1CVFA 5DSOA 3M04A 1AVNA 3D9ZA 4YX4A 3R17B 3S74B 1OKMA 2GEHA 5FL5A 6CA2A 1BNUA 3MWOA 1HEDA 2FNNA 3MDZA 1J9WA 4MO8A 1CNYA 5LMDA 3HS4A 1TG3A 3CA2A 1TH9A 1TTMA 4K1QA 5JG3B 1CNHA 2FOSA 3UYQA 2GD8A 1BNNA 1AM6A 4HEWA 1CILA 3CAJA 3UYNA 5E2RA 2HOCA 1CANA 4L5WA 4LP6A 4TWMA 1IF7A 5EHWA 3TMJA 3T83A 1G4JA 4N16A 4Q7VA 1CA3A 3B4FA 2EZ7A 2EU2A 4XFWA 2POUA 3KOIA 1FR4A 1CNGA 1G0FA 1TEQX 3M5TA 3T85A 1FSRA 1CIMA 3U45X 4YGKA 4YGNA 3KNEA 3CZVA 3HLJA 4FVOA 1TEUX 1V9EA 3QYKA 4XE1A 3F4XA 5HPJA 4Q7WA 3M3XA 1RAZA 1CA2A 1CNKA 1ZNCA 4M2WA 1ZFQA 2AW1A 3P58A 5DSIA 2Q1BA 4FVNA 3W6IA 1XPZA 2POWA 4KP8A 1CVCA 4PZHA 3OIKA 2AX2A 3M5EA 3M98A 1RJ5A 3OKVA 1TG9A 1BN3A 4Z1NA 1CAHA 3NB5A 4WW6A 2CA2A 4QSAA 3MZCA 4E3HA 3B1BA 1RZCA 5JEGB 5CLUA 4MLXA 5FDIA 5EKMA 3KLDB 3IGPA 1ZFKA 1CVAA 4YGFA 5AMLA 4MDLA 3M67A 4E5QA 1CCTA 2HFWA 3SBIA 1ZSBA 5SZ5A 4YGJA 5FNHA 1JD0A 3IEOA 4ITPA 3KKXA 5FLQA 1RZEA 3P3HA 4KV0A 3K7KA 4RIUA 3M1JA 3M2YA 3S72B 4MTYA 5JEPB 3R16A 1UGGA 3V3FA 4Z1EA 5CJFA 3TVNX 1CAIA 2CBEA 3MMFA 5G01A 3S9TA 4Q90A 1BNMA 1HCAA 1CAOA 1XQ0A 1I9NA 1I91A 1BN1A 4DZ9A 2NWYA 2NWPA 4M2VA 2WEJA 3MNAA 4N0XB 3RJ7A 4IWZA 5BNLA 3DCCA 3C7PA 2WEGA 3IBIA 5JGTB 5A25A 4RH2A 3D92A 1Z93A 2ABEA 3DCWA 1OKLA 1FR7A 3RGEA 3V3GB 3M5SA 4CNWA 3S8XA 1G1DA 3F7BA 5FNJA 2CBCA 4LU3A 1G54A 5EZTX 2FOUA 4QSJA 1CNJA 1HCBA 4FRCA 1CAYA 2VVBX 5DSKA 5A6HA 1T9NA 3MHIA 3IBLA 4M2UA 3NI5A 3ZP9A 4MDGA 3KWAA 1THKA 2NNOA 3U3AX 1HECA 2QOAA 4RUZA 1CAMA 1CINA 3RZ8A 4CNRA 5IPZA 1KOPA 4QJ0A 1CALA 3MNKA 1Z9YA 1BNVA 2HD6A 4COQA 4Q6EA 4Z1KA 4K0TA 4KP5A 4QK3A 3U47A 3OYSA 4XIXA 4K0ZA 4IDRX 2X7SA 4CACA 3BETA 1FSNA 2NN7A 5E5UA 1YDCA 3D93A 1AZMA 4MDMA 1JV0A 2FOVA 3DBUA 3RG3A 5DSQA 4QIZA 4E3FA 2FOQA 5DSJA 2CBDA 2VVAX 1BCDA 4Q8XA 3M40A 4ZWIA 5SZ4A 1BNQA 1FQNA 5FNMA 1I9MA 5SZ3A 1H9QA 3DC9A 4QJXA 4RFDA 4LHIA 1LG6A 4ZX0A 1BNTA 3BL0A 5FLPA 4ITOA 3DD8A 4BF1A 9CA2A 3T84A 3U7CA 4CQ0A 3MHMA 4Q0LA 3HFPA 2QO8A 4YYTA 3N0NA 1DMYA 4RIVA 4Q81A 1TBTX 5JQ0A 4JSAA 2H4NA 3S77B 1H9NA 2HKKA 3M2ZA 1RZDA 3GZ0A 2OSMA 3MNHA 3VBDA 2NNGA 1CCUA 3DAZA 3RZ1B 1Y7WA 4TWLA 2H15A 3N3JA 1HEBA 3RYJB 5SZ2A 5FLOA 5BYIA 4ZWXA 1FQRA 3DD0A 1CAZA 2HNCA 3FFPX 2X7TA 1CRMA 4G7AA 3DVDA 4Q78A 4KUVA 1RJ6A 3IAIA 3RZ7A 3K2FA 4Q87A 2NNVA 4E3GA 1UGFA 3EFTA 4Y0JA 1DCAA 1LUGA 3M1QA 3V7XA 3JXHC 5DOHA 4E9OX 1YO0A 4M2RA 3SAXA 5FNIA 4QJOA 5SZ0A 3FW3A 1ZGEA 1G4OA 4FIKA 3V3JA 3DVCA 5G0BA 2EU3A 3N4BA 4X5SA 1OKNA 4K0SA 5DOGA 4Z0QA 5L3OA 4YWPA 1CVBA 5E2KA 1YO2A 8CA2A 4KUYA 5FLRA 3M96A 1ZSCA 3DCSA 3EFIA 1UGCA 5SZ7A 3V2MA 1DMXA 1CNBA 1CVDA 4YGLA 3Q31A 2W2JA 3KONA 5DSNA 5FL6A 1V9IC 3MNJA 2CABA 5EH7A 1Z97A 4Q99A 2FOYA 4E49A 4WUPA 3ML5A 4CNXA 3F8EA 5E2SA 1A42A 4JSSA 2QP6A 1CNXA 4PXXA 4FL7A 5E2MA 4RUXA 2FNMA 1IF5A 5BRVA 3OYQA 1LG5A 2WEHA 3T82A 4YXIA 1LZVA 5EHEA 5FDCA 3CYUA 3SBHA 4HT0A 1UGAA 3RYVB 4BF6A 1CAJA 5JGSB 3MYQA 1MUAA 1UGBA 2NWOA 2NWZA 3OY0A 4E4AA 2CBAA 3W6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXF A;  3S97 A;  1IF9 A;  1BV3 A;  4RFC A;  1G46 A;  3RLD A;  5EH8 A;  4QK2 A;  3MHL A;  5FNL A;  1OQ5 A;  3S75 B;  4RUY A;  5EIJ A;  3HKQ A;  4Q06 A;  3M1W A;  1BZM A;  5BRU A;  4PYX A;  3MNU A;  3P55 A;  3PYK A;  3IBN A;  3HKN A;  5E2N A;  1FLJ A;  1G0E A;  1I90 A;  1CRA A;  3KOK A;  4WW8 A;  3T5Z A;  3M1K A;  4JS6 A;  3P5L A;  4KAP A;  4E3D A;  3M2X A;  2ZNC A;  3N2P A;  3F7U A;  5DSL A;  5CA2 A;  1G52 A;  3HKT A;  1EOU A;  4HT2 A;  2IT4 A;  3HKU A;  2FW4 A;  1FQL A;  5FLT A;  1ZGF A;  4ILX A;  2WEO A;  1CCS A;  2O4Z A;  4XIW A;  5FLS A;  3M14 A;  5EH5 A;  1I9P A;  4QEF A;  3RYZ A;  2OSF A;  1MOO A;  4Q49 A;  3P5A A;  4K13 A;  3V2J A;  4G0C A;  3LXE A;  3S71 B;  7CA2 A;  2NNS A;  4R5B A;  4Z1J A;  4R59 A;  1LGD A;  5EOI A;  1KWQ A;  4QTL A;  3V3I B;  2NXT A;  3S76 A;  4BCW A;  1CVE A;  4DZ7 A;  3D0N A;  4PQ7 A;  1KOQ A;  4QY3 A;  4QJM A;  1URT A;  1IF4 A;  5C8I A;  2CBB A;  4Q9Y A;  5JDV B;  3D8W A;  4HEY A;  4KUW A;  5SZ6 A;  4YHA A;  5DVX A;  1I8Z A;  1KWR A;  1CNC A;  1UGE A;  1YDD A;  3KIG A;  4ZWZ A;  5DSP A;  4HF3 A;  4QJP A;  1KEQ A;  1XEV A;  4QIY A;  2WD2 A;  4Q7P A;  4C3T A;  4CA2 A;  3RZ0 B;  1I9Q A;  1BNW A;  1HVA A;  5SZ1 A;  3V3H B;  4UOV A;  4ZWY A;  1JCZ A;  5JQT A;  3RG4 A;  5E5R A;  4QK1 A;  4QSI A;  1CNI A;  3V5G A;  3OIL A;  1ZE8 A;  4Q8Z A;  4KNM A;  3ZNC A;  1BN4 A;  4KNI A;  3S78 B;  5L6K A;  1HUG A;  4FPT A;  3P4V A;  3MHO A;  1G6V A;  2FMZ A;  3DA2 A;  4WL4 A;  5BRW A;  3IBU A;  1BIC A;  4HU1 A;  3RYX B;  4Q6D A;  3SAP A;  1IF6 A;  3L14 A;  4ZX1 A;  3P44 A;  4PYY A;  4QSB A;  1UGD A;  4L5V A;  1CNW A;  2Q38 A;  3S73 B;  4R5A A;  1FSQ A;  4QJW A;  1DCB A;  3NJ9 A;  4KNN A;  4JSZ A;  4Q08 A;  4WUQ A;  1YDB A;  3K34 A;  5FNK A;  3MNI A;  3PJJ A;  4Q09 A;  3KS3 A;  4YXO A;  1ZSA A;  4L5U A;  1F2W A;  1G3Z A;  1TE3 X;  4XZ5 A;  1G45 A;  1I9O A;  4GL1 X;  4Q8Y A;  3M2N A;  2HL4 A;  1CVH A;  3OKU A;  5AMD A;  5JES B;  1HUH A;  3DC3 A;  3OIM A;  1RZA A;  1FQM A;  5EKH A;  5FNG A;  3PO6 A;  3DV7 A;  3DVB A;  2NN1 A;  4JSW A;  1ZH9 A;  2FNK A;  2ILI A;  2NXR A;  1G53 A;  1RAY A;  4HBA A;  4Q83 A;  5JEH B;  5E28 A;  1H4N A;  3BL1 A;  1I9L A;  1RZB A;  4ZAO A;  3ML2 A;  3RYY A;  4FU5 A;  3JXG A;  4MLT A;  1IF8 A;  3P3J A;  1CAK A;  4WR7 A;  5CAC A;  5G03 A;  2POV A;  1TB0 X;  4RN4 A;  1CZM A;  1YO1 A;  3T5U A;  5FL4 A;  5J8Z A;  5EHV A;  5G0C A;  2F14 A;  4YVY A;  2X7U A;  3FE4 A;  5EKJ A;  5DRS A;  1HEA A;  1YDA A;  5JG5 B;  2NMX A;  4Q7S A;  4YXU A;  2NXS A;  4CNV A;  4KNJ A;  2Q1Q A;  2WD3 A;  3RZ5 A;  3MHC A;  1G48 A;  2FMG A;  5AMG A;  5DSR A;  5DSM A;  3TVO X;  4ETQ C;  12CA A;  4HEZ A;  1XEG A;  4Q07 A;  1CVF A;  5DSO A;  3M04 A;  1AVN A;  3D9Z A;  4YX4 A;  3R17 B;  3S74 B;  1OKM A;  2GEH A;  5FL5 A;  6CA2 A;  1BNU A;  3MWO A;  1HED A;  2FNN A;  3MDZ A;  1J9W A;  4MO8 A;  1CNY A;  5LMD A;  3HS4 A;  1TG3 A;  3CA2 A;  1TH9 A;  1TTM A;  4K1Q A;  5JG3 B;  1CNH A;  2FOS A;  3UYQ A;  2GD8 A;  1BNN A;  1AM6 A;  4HEW A;  1CIL A;  3CAJ A;  3UYN A;  5E2R A;  2HOC A;  1CAN A;  4L5W A;  4LP6 A;  4TWM A;  1IF7 A;  5EHW A;  3TMJ A;  3T83 A;  1G4J A;  4N16 A;  4Q7V A;  1CA3 A;  3B4F A;  2EZ7 A;  2EU2 A;  4XFW A;  2POU A;  3KOI A;  1FR4 A;  1CNG A;  1G0F A;  1TEQ X;  3M5T A;  3T85 A;  1FSR A;  1CIM A;  3U45 X;  4YGK A;  4YGN A;  3KNE A;  3CZV A;  3HLJ A;  4FVO A;  1TEU X;  1V9E A;  3QYK A;  4XE1 A;  3F4X A;  5HPJ A;  4Q7W A;  3M3X A;  1RAZ A;  1CA2 A;  1CNK A;  1ZNC A;  4M2W A;  1ZFQ A;  2AW1 A;  3P58 A;  5DSI A;  2Q1B A;  4FVN A;  3W6I A;  1XPZ A;  2POW A;  4KP8 A;  1CVC A;  4PZH A;  3OIK A;  2AX2 A;  3M5E A;  3M98 A;  1RJ5 A;  3OKV A;  1TG9 A;  1BN3 A;  4Z1N A;  1CAH A;  3NB5 A;  4WW6 A;  2CA2 A;  4QSA A;  3MZC A;  4E3H A;  3B1B A;  1RZC A;  5JEG B;  5CLU A;  4MLX A;  5FDI A;  5EKM A;  3KLD B;  3IGP A;  1ZFK A;  1CVA A;  4YGF A;  5AML A;  4MDL A;  3M67 A;  4E5Q A;  1CCT A;  2HFW A;  3SBI A;  1ZSB A;  5SZ5 A;  4YGJ A;  5FNH A;  1JD0 A;  3IEO A;  4ITP A;  3KKX A;  5FLQ A;  1RZE A;  3P3H A;  4KV0 A;  3K7K A;  4RIU A;  3M1J A;  3M2Y A;  3S72 B;  4MTY A;  5JEP B;  3R16 A;  1UGG A;  3V3F A;  4Z1E A;  5CJF A;  3TVN X;  1CAI A;  2CBE A;  3MMF A;  5G01 A;  3S9T A;  4Q90 A;  1BNM A;  1HCA A;  1CAO A;  1XQ0 A;  1I9N A;  1I91 A;  1BN1 A;  4DZ9 A;  2NWY A;  2NWP A;  4M2V A;  2WEJ A;  3MNA A;  4N0X B;  3RJ7 A;  4IWZ A;  5BNL A;  3DCC A;  3C7P A;  2WEG A;  3IBI A;  5JGT B;  5A25 A;  4RH2 A;  3D92 A;  1Z93 A;  2ABE A;  3DCW A;  1OKL A;  1FR7 A;  3RGE A;  3V3G B;  3M5S A;  4CNW A;  3S8X A;  1G1D A;  3F7B A;  5FNJ A;  2CBC A;  4LU3 A;  1G54 A;  5EZT X;  2FOU A;  4QSJ A;  1CNJ A;  1HCB A;  4FRC A;  1CAY A;  2VVB X;  5DSK A;  5A6H A;  1T9N A;  3MHI A;  3IBL A;  4M2U A;  3NI5 A;  3ZP9 A;  4MDG A;  3KWA A;  1THK A;  2NNO A;  3U3A X;  1HEC A;  2QOA A;  4RUZ A;  1CAM A;  1CIN A;  3RZ8 A;  4CNR A;  5IPZ A;  1KOP A;  4QJ0 A;  1CAL A;  3MNK A;  1Z9Y A;  1BNV A;  2HD6 A;  4COQ A;  4Q6E A;  4Z1K A;  4K0T A;  4KP5 A;  4QK3 A;  3U47 A;  3OYS A;  4XIX A;  4K0Z A;  4IDR X;  2X7S A;  4CAC A;  3BET A;  1FSN A;  2NN7 A;  5E5U A;  1YDC A;  3D93 A;  1AZM A;  4MDM A;  1JV0 A;  2FOV A;  3DBU A;  3RG3 A;  5DSQ A;  4QIZ A;  4E3F A;  2FOQ A;  5DSJ A;  2CBD A;  2VVA X;  1BCD A;  4Q8X A;  3M40 A;  4ZWI A;  5SZ4 A;  1BNQ A;  1FQN A;  5FNM A;  1I9M A;  5SZ3 A;  1H9Q A;  3DC9 A;  4QJX A;  4RFD A;  4LHI A;  1LG6 A;  4ZX0 A;  1BNT A;  3BL0 A;  5FLP A;  4ITO A;  3DD8 A;  4BF1 A;  9CA2 A;  3T84 A;  3U7C A;  4CQ0 A;  3MHM A;  4Q0L A;  3HFP A;  2QO8 A;  4YYT A;  3N0N A;  1DMY A;  4RIV A;  4Q81 A;  1TBT X;  5JQ0 A;  4JSA A;  2H4N A;  3S77 B;  1H9N A;  2HKK A;  3M2Z A;  1RZD A;  3GZ0 A;  2OSM A;  3MNH A;  3VBD A;  2NNG A;  1CCU A;  3DAZ A;  3RZ1 B;  1Y7W A;  4TWL A;  2H15 A;  3N3J A;  1HEB A;  3RYJ B;  5SZ2 A;  5FLO A;  5BYI A;  4ZWX A;  1FQR A;  3DD0 A;  1CAZ A;  2HNC A;  3FFP X;  2X7T A;  1CRM A;  4G7A A;  3DVD A;  4Q78 A;  4KUV A;  1RJ6 A;  3IAI A;  3RZ7 A;  3K2F A;  4Q87 A;  2NNV A;  4E3G A;  1UGF A;  3EFT A;  4Y0J A;  1DCA A;  1LUG A;  3M1Q A;  3V7X A;  3JXH C;  5DOH A;  4E9O X;  1YO0 A;  4M2R A;  3SAX A;  5FNI A;  4QJO A;  5SZ0 A;  3FW3 A;  1ZGE A;  1G4O A;  4FIK A;  3V3J A;  3DVC A;  5G0B A;  2EU3 A;  3N4B A;  4X5S A;  1OKN A;  4K0S A;  5DOG A;  4Z0Q A;  5L3O A;  4YWP A;  1CVB A;  5E2K A;  1YO2 A;  8CA2 A;  4KUY A;  5FLR A;  3M96 A;  1ZSC A;  3DCS A;  3EFI A;  1UGC A;  5SZ7 A;  3V2M A;  1DMX A;  1CNB A;  1CVD A;  4YGL A;  3Q31 A;  2W2J A;  3KON A;  5DSN A;  5FL6 A;  1V9I C;  3MNJ A;  2CAB A;  5EH7 A;  1Z97 A;  4Q99 A;  2FOY A;  4E49 A;  4WUP A;  3ML5 A;  4CNX A;  3F8E A;  5E2S A;  1A42 A;  4JSS A;  2QP6 A;  1CNX A;  4PXX A;  4FL7 A;  5E2M A;  4RUX A;  2FNM A;  1IF5 A;  5BRV A;  3OYQ A;  1LG5 A;  2WEH A;  3T82 A;  4YXI A;  1LZV A;  5EHE A;  5FDC A;  3CYU A;  3SBH A;  4HT0 A;  1UGA A;  3RYV B;  4BF6 A;  1CAJ A;  5JGS B;  3MYQ A;  1MUA A;  1UGB A;  2NWO A;  2NWZ A;  3OY0 A;  4E4A A;  2CBA A;  3W6H A; 
#chains in the Genus database with same CATH topology
 3JXF A;  3S97 A;  1IF9 A;  1BV3 A;  4RFC A;  1G46 A;  3RLD A;  5EH8 A;  4QK2 A;  3MHL A;  5FNL A;  1OQ5 A;  3S75 B;  4RUY A;  5EIJ A;  3HKQ A;  4Q06 A;  3M1W A;  1BZM A;  5BRU A;  4PYX A;  3MNU A;  3P55 A;  3PYK A;  3IBN A;  3HKN A;  5E2N A;  1FLJ A;  1G0E A;  1I90 A;  1CRA A;  3KOK A;  4WW8 A;  3T5Z A;  3M1K A;  4JS6 A;  3P5L A;  4KAP A;  4E3D A;  3M2X A;  2ZNC A;  3N2P A;  3F7U A;  5DSL A;  5CA2 A;  1G52 A;  3HKT A;  1EOU A;  4HT2 A;  2IT4 A;  3HKU A;  2FW4 A;  1FQL A;  5FLT A;  1ZGF A;  4ILX A;  2WEO A;  1CCS A;  2O4Z A;  4XIW A;  5FLS A;  3M14 A;  5EH5 A;  1I9P A;  4QEF A;  3RYZ A;  2OSF A;  1MOO A;  4Q49 A;  3P5A A;  4K13 A;  3V2J A;  4G0C A;  3LXE A;  3S71 B;  7CA2 A;  2NNS A;  4R5B A;  4Z1J A;  4R59 A;  1LGD A;  5EOI A;  1KWQ A;  4QTL A;  3V3I B;  2NXT A;  3S76 A;  4BCW A;  1CVE A;  4DZ7 A;  3D0N A;  4PQ7 A;  1KOQ A;  4QY3 A;  4QJM A;  1URT A;  1IF4 A;  5C8I A;  2CBB A;  4Q9Y A;  5JDV B;  3D8W A;  4HEY A;  4KUW A;  5SZ6 A;  4YHA A;  5DVX A;  1I8Z A;  1KWR A;  1CNC A;  1UGE A;  1YDD A;  3KIG A;  4ZWZ A;  5DSP A;  4HF3 A;  4QJP A;  1KEQ A;  1XEV A;  4QIY A;  2WD2 A;  4Q7P A;  4C3T A;  4CA2 A;  3RZ0 B;  1I9Q A;  1BNW A;  1HVA A;  5SZ1 A;  3V3H B;  4UOV A;  4ZWY A;  1JCZ A;  5JQT A;  3RG4 A;  5E5R A;  4QK1 A;  4QSI A;  1CNI A;  3V5G A;  3OIL A;  1ZE8 A;  4Q8Z A;  4KNM A;  3ZNC A;  1BN4 A;  4KNI A;  3S78 B;  5L6K A;  1HUG A;  4FPT A;  3P4V A;  3MHO A;  1G6V A;  2FMZ A;  3DA2 A;  4WL4 A;  5BRW A;  3IBU A;  1BIC A;  4HU1 A;  3RYX B;  4Q6D A;  3SAP A;  1IF6 A;  3L14 A;  4ZX1 A;  3P44 A;  4PYY A;  4QSB A;  1UGD A;  4L5V A;  1CNW A;  2Q38 A;  3S73 B;  4R5A A;  1FSQ A;  4QJW A;  1DCB A;  3NJ9 A;  4KNN A;  4JSZ A;  4Q08 A;  4WUQ A;  1YDB A;  3K34 A;  5FNK A;  3MNI A;  3PJJ A;  4Q09 A;  3KS3 A;  4YXO A;  1ZSA A;  4L5U A;  1F2W A;  1G3Z A;  1TE3 X;  4XZ5 A;  1G45 A;  1I9O A;  4GL1 X;  4Q8Y A;  3M2N A;  2HL4 A;  1CVH A;  3OKU A;  5AMD A;  5JES B;  1HUH A;  3DC3 A;  3OIM A;  1RZA A;  1FQM A;  5EKH A;  5FNG A;  3PO6 A;  3DV7 A;  3DVB A;  2NN1 A;  4JSW A;  1ZH9 A;  2FNK A;  2ILI A;  2NXR A;  1G53 A;  1RAY A;  4HBA A;  4Q83 A;  5JEH B;  5E28 A;  1H4N A;  3BL1 A;  1I9L A;  1RZB A;  4ZAO A;  3ML2 A;  3RYY A;  4FU5 A;  3JXG A;  4MLT A;  1IF8 A;  3P3J A;  1CAK A;  4WR7 A;  5CAC A;  5G03 A;  2POV A;  1TB0 X;  4RN4 A;  1CZM A;  1YO1 A;  3T5U A;  5FL4 A;  5J8Z A;  5EHV A;  5G0C A;  2F14 A;  4YVY A;  2X7U A;  3FE4 A;  5EKJ A;  5DRS A;  1HEA A;  1YDA A;  5JG5 B;  2NMX A;  4Q7S A;  4YXU A;  2NXS A;  4CNV A;  4KNJ A;  2Q1Q A;  2WD3 A;  3RZ5 A;  3MHC A;  1G48 A;  2FMG A;  5AMG A;  5DSR A;  5DSM A;  3TVO X;  4ETQ C;  12CA A;  4HEZ A;  1XEG A;  4Q07 A;  1CVF A;  5DSO A;  3M04 A;  1AVN A;  3D9Z A;  4YX4 A;  3R17 B;  3S74 B;  1OKM A;  2GEH A;  5FL5 A;  6CA2 A;  1BNU A;  3MWO A;  1HED A;  2FNN A;  3MDZ A;  1J9W A;  4MO8 A;  1CNY A;  5LMD A;  3HS4 A;  1TG3 A;  3CA2 A;  1TH9 A;  1TTM A;  4K1Q A;  5JG3 B;  1CNH A;  2FOS A;  3UYQ A;  2GD8 A;  1BNN A;  1AM6 A;  4HEW A;  1CIL A;  3CAJ A;  3UYN A;  5E2R A;  2HOC A;  1CAN A;  4L5W A;  4LP6 A;  4TWM A;  1IF7 A;  5EHW A;  3TMJ A;  3T83 A;  1G4J A;  4N16 A;  4Q7V A;  1CA3 A;  3B4F A;  2EZ7 A;  2EU2 A;  4XFW A;  2POU A;  3KOI A;  1FR4 A;  1CNG A;  1G0F A;  1TEQ X;  3M5T A;  3T85 A;  1FSR A;  1CIM A;  3U45 X;  4YGK A;  4YGN A;  3KNE A;  3CZV A;  3HLJ A;  4FVO A;  1TEU X;  1V9E A;  3QYK A;  4XE1 A;  3F4X A;  5HPJ A;  4Q7W A;  3M3X A;  1RAZ A;  1CA2 A;  1CNK A;  1ZNC A;  4M2W A;  1ZFQ A;  2AW1 A;  3P58 A;  5DSI A;  2Q1B A;  4FVN A;  3W6I A;  1XPZ A;  2POW A;  4KP8 A;  1CVC A;  4PZH A;  3OIK A;  2AX2 A;  3M5E A;  3M98 A;  1RJ5 A;  3OKV A;  1TG9 A;  1BN3 A;  4Z1N A;  1CAH A;  3NB5 A;  4WW6 A;  2CA2 A;  4QSA A;  3MZC A;  4E3H A;  3B1B A;  1RZC A;  5JEG B;  5CLU A;  4MLX A;  5FDI A;  5EKM A;  3KLD B;  3IGP A;  1ZFK A;  1CVA A;  4YGF A;  5AML A;  4MDL A;  3M67 A;  4E5Q A;  1CCT A;  2HFW A;  3SBI A;  1ZSB A;  5SZ5 A;  4YGJ A;  5FNH A;  1JD0 A;  3IEO A;  4ITP A;  3KKX A;  5FLQ A;  1RZE A;  3P3H A;  4KV0 A;  3K7K A;  4RIU A;  3M1J A;  3M2Y A;  3S72 B;  4MTY A;  5JEP B;  3R16 A;  1UGG A;  3V3F A;  4Z1E A;  5CJF A;  3TVN X;  1CAI A;  2CBE A;  3MMF A;  5G01 A;  3S9T A;  4Q90 A;  1BNM A;  1HCA A;  1CAO A;  1XQ0 A;  1I9N A;  1I91 A;  1BN1 A;  4DZ9 A;  2NWY A;  2NWP A;  4M2V A;  2WEJ A;  3MNA A;  4N0X B;  3RJ7 A;  4IWZ A;  5BNL A;  3DCC A;  3C7P A;  2WEG A;  3IBI A;  5JGT B;  5A25 A;  4RH2 A;  3D92 A;  1Z93 A;  2ABE A;  3DCW A;  1OKL A;  1FR7 A;  3RGE A;  3V3G B;  3M5S A;  4CNW A;  3S8X A;  1G1D A;  3F7B A;  5FNJ A;  2CBC A;  4LU3 A;  1G54 A;  5EZT X;  2FOU A;  4QSJ A;  1CNJ A;  1HCB A;  4FRC A;  1CAY A;  2VVB X;  5DSK A;  5A6H A;  1T9N A;  3MHI A;  3IBL A;  4M2U A;  3NI5 A;  3ZP9 A;  4MDG A;  3KWA A;  1THK A;  2NNO A;  3U3A X;  1HEC A;  2QOA A;  4RUZ A;  1CAM A;  1CIN A;  3RZ8 A;  4CNR A;  5IPZ A;  1KOP A;  4QJ0 A;  1CAL A;  3MNK A;  1Z9Y A;  1BNV A;  2HD6 A;  4COQ A;  4Q6E A;  4Z1K A;  4K0T A;  4KP5 A;  4QK3 A;  3U47 A;  3OYS A;  4XIX A;  4K0Z A;  4IDR X;  2X7S A;  4CAC A;  3BET A;  1FSN A;  2NN7 A;  5E5U A;  1YDC A;  3D93 A;  1AZM A;  4MDM A;  1JV0 A;  2FOV A;  3DBU A;  3RG3 A;  5DSQ A;  4QIZ A;  4E3F A;  2FOQ A;  5DSJ A;  2CBD A;  2VVA X;  1BCD A;  4Q8X A;  3M40 A;  4ZWI A;  5SZ4 A;  1BNQ A;  1FQN A;  5FNM A;  1I9M A;  5SZ3 A;  1H9Q A;  3DC9 A;  4QJX A;  4RFD A;  4LHI A;  1LG6 A;  4ZX0 A;  1BNT A;  3BL0 A;  5FLP A;  4ITO A;  3DD8 A;  4BF1 A;  9CA2 A;  3T84 A;  3U7C A;  4CQ0 A;  3MHM A;  4Q0L A;  3HFP A;  2QO8 A;  4YYT A;  3N0N A;  1DMY A;  4RIV A;  4Q81 A;  1TBT X;  5JQ0 A;  4JSA A;  2H4N A;  3S77 B;  1H9N A;  2HKK A;  3M2Z A;  1RZD A;  3GZ0 A;  2OSM A;  3MNH A;  3VBD A;  2NNG A;  1CCU A;  3DAZ A;  3RZ1 B;  1Y7W A;  4TWL A;  2H15 A;  3N3J A;  1HEB A;  3RYJ B;  5SZ2 A;  5FLO A;  5BYI A;  4ZWX A;  1FQR A;  3DD0 A;  1CAZ A;  2HNC A;  3FFP X;  2X7T A;  1CRM A;  4G7A A;  3DVD A;  4Q78 A;  4KUV A;  1RJ6 A;  3IAI A;  3RZ7 A;  3K2F A;  4Q87 A;  2NNV A;  4E3G A;  1UGF A;  3EFT A;  4Y0J A;  1DCA A;  1LUG A;  3M1Q A;  3V7X A;  3JXH C;  5DOH A;  4E9O X;  1YO0 A;  4M2R A;  3SAX A;  5FNI A;  4QJO A;  5SZ0 A;  3FW3 A;  1ZGE A;  1G4O A;  4FIK A;  3V3J A;  3DVC A;  5G0B A;  2EU3 A;  3N4B A;  4X5S A;  1OKN A;  4K0S A;  5DOG A;  4Z0Q A;  5L3O A;  4YWP A;  1CVB A;  5E2K A;  1YO2 A;  8CA2 A;  4KUY A;  5FLR A;  3M96 A;  1ZSC A;  3DCS A;  3EFI A;  1UGC A;  5SZ7 A;  3V2M A;  1DMX A;  1CNB A;  1CVD A;  4YGL A;  3Q31 A;  2W2J A;  3KON A;  5DSN A;  5FL6 A;  1V9I C;  3MNJ A;  2CAB A;  5EH7 A;  1Z97 A;  4Q99 A;  2FOY A;  4E49 A;  4WUP A;  3ML5 A;  4CNX A;  3F8E A;  5E2S A;  1A42 A;  4JSS A;  2QP6 A;  1CNX A;  4PXX A;  4FL7 A;  5E2M A;  4RUX A;  2FNM A;  1IF5 A;  5BRV A;  3OYQ A;  1LG5 A;  2WEH A;  3T82 A;  4YXI A;  1LZV A;  5EHE A;  5FDC A;  3CYU A;  3SBH A;  4HT0 A;  1UGA A;  3RYV B;  4BF6 A;  1CAJ A;  5JGS B;  3MYQ A;  1MUA A;  1UGB A;  2NWO A;  2NWZ A;  3OY0 A;  4E4A A;  2CBA A;  3W6H A; 
#chains in the Genus database with same CATH homology
 3JXF A;  3S97 A;  1IF9 A;  1BV3 A;  4RFC A;  1G46 A;  3RLD A;  5EH8 A;  4QK2 A;  3MHL A;  5FNL A;  1OQ5 A;  3S75 B;  4RUY A;  5EIJ A;  3HKQ A;  4Q06 A;  3M1W A;  1BZM A;  5BRU A;  4PYX A;  3MNU A;  3P55 A;  3PYK A;  3IBN A;  3HKN A;  5E2N A;  1FLJ A;  1G0E A;  1I90 A;  1CRA A;  3KOK A;  4WW8 A;  3T5Z A;  3M1K A;  4JS6 A;  3P5L A;  4KAP A;  4E3D A;  3M2X A;  2ZNC A;  3N2P A;  3F7U A;  5DSL A;  5CA2 A;  1G52 A;  3HKT A;  1EOU A;  4HT2 A;  2IT4 A;  3HKU A;  2FW4 A;  1FQL A;  5FLT A;  1ZGF A;  4ILX A;  2WEO A;  1CCS A;  2O4Z A;  4XIW A;  5FLS A;  3M14 A;  5EH5 A;  1I9P A;  4QEF A;  3RYZ A;  2OSF A;  1MOO A;  4Q49 A;  3P5A A;  4K13 A;  3V2J A;  4G0C A;  3LXE A;  3S71 B;  7CA2 A;  2NNS A;  4R5B A;  4Z1J A;  4R59 A;  1LGD A;  5EOI A;  1KWQ A;  4QTL A;  3V3I B;  2NXT A;  3S76 A;  4BCW A;  1CVE A;  4DZ7 A;  3D0N A;  4PQ7 A;  1KOQ A;  4QY3 A;  4QJM A;  1URT A;  1IF4 A;  5C8I A;  2CBB A;  4Q9Y A;  5JDV B;  3D8W A;  4HEY A;  4KUW A;  5SZ6 A;  4YHA A;  5DVX A;  1I8Z A;  1KWR A;  1CNC A;  1UGE A;  1YDD A;  3KIG A;  4ZWZ A;  5DSP A;  4HF3 A;  4QJP A;  1KEQ A;  1XEV A;  4QIY A;  2WD2 A;  4Q7P A;  4C3T A;  4CA2 A;  3RZ0 B;  1I9Q A;  1BNW A;  1HVA A;  5SZ1 A;  3V3H B;  4UOV A;  4ZWY A;  1JCZ A;  5JQT A;  3RG4 A;  5E5R A;  4QK1 A;  4QSI A;  1CNI A;  3V5G A;  3OIL A;  1ZE8 A;  4Q8Z A;  4KNM A;  3ZNC A;  1BN4 A;  4KNI A;  3S78 B;  5L6K A;  1HUG A;  4FPT A;  3P4V A;  3MHO A;  1G6V A;  2FMZ A;  3DA2 A;  4WL4 A;  5BRW A;  3IBU A;  1BIC A;  4HU1 A;  3RYX B;  4Q6D A;  3SAP A;  1IF6 A;  3L14 A;  4ZX1 A;  3P44 A;  4PYY A;  4QSB A;  1UGD A;  4L5V A;  1CNW A;  2Q38 A;  3S73 B;  4R5A A;  1FSQ A;  4QJW A;  1DCB A;  3NJ9 A;  4KNN A;  4JSZ A;  4Q08 A;  4WUQ A;  1YDB A;  3K34 A;  5FNK A;  3MNI A;  3PJJ A;  4Q09 A;  3KS3 A;  4YXO A;  1ZSA A;  4L5U A;  1F2W A;  1G3Z A;  1TE3 X;  4XZ5 A;  1G45 A;  1I9O A;  4GL1 X;  4Q8Y A;  3M2N A;  2HL4 A;  1CVH A;  3OKU A;  5AMD A;  5JES B;  1HUH A;  3DC3 A;  3OIM A;  1RZA A;  1FQM A;  5EKH A;  5FNG A;  3PO6 A;  3DV7 A;  3DVB A;  2NN1 A;  4JSW A;  1ZH9 A;  2FNK A;  2ILI A;  2NXR A;  1G53 A;  1RAY A;  4HBA A;  4Q83 A;  5JEH B;  5E28 A;  1H4N A;  3BL1 A;  1I9L A;  1RZB A;  4ZAO A;  3ML2 A;  3RYY A;  4FU5 A;  3JXG A;  4MLT A;  1IF8 A;  3P3J A;  1CAK A;  4WR7 A;  5CAC A;  5G03 A;  2POV A;  1TB0 X;  4RN4 A;  1CZM A;  1YO1 A;  3T5U A;  5FL4 A;  5J8Z A;  5EHV A;  5G0C A;  2F14 A;  4YVY A;  2X7U A;  3FE4 A;  5EKJ A;  5DRS A;  1HEA A;  1YDA A;  5JG5 B;  2NMX A;  4Q7S A;  4YXU A;  2NXS A;  4CNV A;  4KNJ A;  2Q1Q A;  2WD3 A;  3RZ5 A;  3MHC A;  1G48 A;  2FMG A;  5AMG A;  5DSR A;  5DSM A;  3TVO X;  4ETQ C;  12CA A;  4HEZ A;  1XEG A;  4Q07 A;  1CVF A;  5DSO A;  3M04 A;  1AVN A;  3D9Z A;  4YX4 A;  3R17 B;  3S74 B;  1OKM A;  2GEH A;  5FL5 A;  6CA2 A;  1BNU A;  3MWO A;  1HED A;  2FNN A;  3MDZ A;  1J9W A;  4MO8 A;  1CNY A;  5LMD A;  3HS4 A;  1TG3 A;  3CA2 A;  1TH9 A;  1TTM A;  4K1Q A;  5JG3 B;  1CNH A;  2FOS A;  3UYQ A;  2GD8 A;  1BNN A;  1AM6 A;  4HEW A;  1CIL A;  3CAJ A;  3UYN A;  5E2R A;  2HOC A;  1CAN A;  4L5W A;  4LP6 A;  4TWM A;  1IF7 A;  5EHW A;  3TMJ A;  3T83 A;  1G4J A;  4N16 A;  4Q7V A;  1CA3 A;  3B4F A;  2EZ7 A;  2EU2 A;  4XFW A;  2POU A;  3KOI A;  1FR4 A;  1CNG A;  1G0F A;  1TEQ X;  3M5T A;  3T85 A;  1FSR A;  1CIM A;  3U45 X;  4YGK A;  4YGN A;  3KNE A;  3CZV A;  3HLJ A;  4FVO A;  1TEU X;  1V9E A;  3QYK A;  4XE1 A;  3F4X A;  5HPJ A;  4Q7W A;  3M3X A;  1RAZ A;  1CA2 A;  1CNK A;  1ZNC A;  4M2W A;  1ZFQ A;  2AW1 A;  3P58 A;  5DSI A;  2Q1B A;  4FVN A;  3W6I A;  1XPZ A;  2POW A;  4KP8 A;  1CVC A;  4PZH A;  3OIK A;  2AX2 A;  3M5E A;  3M98 A;  1RJ5 A;  3OKV A;  1TG9 A;  1BN3 A;  4Z1N A;  1CAH A;  3NB5 A;  4WW6 A;  2CA2 A;  4QSA A;  3MZC A;  4E3H A;  3B1B A;  1RZC A;  5JEG B;  5CLU A;  4MLX A;  5FDI A;  5EKM A;  3KLD B;  3IGP A;  1ZFK A;  1CVA A;  4YGF A;  5AML A;  4MDL A;  3M67 A;  4E5Q A;  1CCT A;  2HFW A;  3SBI A;  1ZSB A;  5SZ5 A;  4YGJ A;  5FNH A;  1JD0 A;  3IEO A;  4ITP A;  3KKX A;  5FLQ A;  1RZE A;  3P3H A;  4KV0 A;  3K7K A;  4RIU A;  3M1J A;  3M2Y A;  3S72 B;  4MTY A;  5JEP B;  3R16 A;  1UGG A;  3V3F A;  4Z1E A;  5CJF A;  3TVN X;  1CAI A;  2CBE A;  3MMF A;  5G01 A;  3S9T A;  4Q90 A;  1BNM A;  1HCA A;  1CAO A;  1XQ0 A;  1I9N A;  1I91 A;  1BN1 A;  4DZ9 A;  2NWY A;  2NWP A;  4M2V A;  2WEJ A;  3MNA A;  4N0X B;  3RJ7 A;  4IWZ A;  5BNL A;  3DCC A;  3C7P A;  2WEG A;  3IBI A;  5JGT B;  5A25 A;  4RH2 A;  3D92 A;  1Z93 A;  2ABE A;  3DCW A;  1OKL A;  1FR7 A;  3RGE A;  3V3G B;  3M5S A;  4CNW A;  3S8X A;  1G1D A;  3F7B A;  5FNJ A;  2CBC A;  4LU3 A;  1G54 A;  5EZT X;  2FOU A;  4QSJ A;  1CNJ A;  1HCB A;  4FRC A;  1CAY A;  2VVB X;  5DSK A;  5A6H A;  1T9N A;  3MHI A;  3IBL A;  4M2U A;  3NI5 A;  3ZP9 A;  4MDG A;  3KWA A;  1THK A;  2NNO A;  3U3A X;  1HEC A;  2QOA A;  4RUZ A;  1CAM A;  1CIN A;  3RZ8 A;  4CNR A;  5IPZ A;  1KOP A;  4QJ0 A;  1CAL A;  3MNK A;  1Z9Y A;  1BNV A;  2HD6 A;  4COQ A;  4Q6E A;  4Z1K A;  4K0T A;  4KP5 A;  4QK3 A;  3U47 A;  3OYS A;  4XIX A;  4K0Z A;  4IDR X;  2X7S A;  4CAC A;  3BET A;  1FSN A;  2NN7 A;  5E5U A;  1YDC A;  3D93 A;  1AZM A;  4MDM A;  1JV0 A;  2FOV A;  3DBU A;  3RG3 A;  5DSQ A;  4QIZ A;  4E3F A;  2FOQ A;  5DSJ A;  2CBD A;  2VVA X;  1BCD A;  4Q8X A;  3M40 A;  4ZWI A;  5SZ4 A;  1BNQ A;  1FQN A;  5FNM A;  1I9M A;  5SZ3 A;  1H9Q A;  3DC9 A;  4QJX A;  4RFD A;  4LHI A;  1LG6 A;  4ZX0 A;  1BNT A;  3BL0 A;  5FLP A;  4ITO A;  3DD8 A;  4BF1 A;  9CA2 A;  3T84 A;  3U7C A;  4CQ0 A;  3MHM A;  4Q0L A;  3HFP A;  2QO8 A;  4YYT A;  3N0N A;  1DMY A;  4RIV A;  4Q81 A;  1TBT X;  5JQ0 A;  4JSA A;  2H4N A;  3S77 B;  1H9N A;  2HKK A;  3M2Z A;  1RZD A;  3GZ0 A;  2OSM A;  3MNH A;  3VBD A;  2NNG A;  1CCU A;  3DAZ A;  3RZ1 B;  1Y7W A;  4TWL A;  2H15 A;  3N3J A;  1HEB A;  3RYJ B;  5SZ2 A;  5FLO A;  5BYI A;  4ZWX A;  1FQR A;  3DD0 A;  1CAZ A;  2HNC A;  3FFP X;  2X7T A;  1CRM A;  4G7A A;  3DVD A;  4Q78 A;  4KUV A;  1RJ6 A;  3IAI A;  3RZ7 A;  3K2F A;  4Q87 A;  2NNV A;  4E3G A;  1UGF A;  3EFT A;  4Y0J A;  1DCA A;  1LUG A;  3M1Q A;  3V7X A;  3JXH C;  5DOH A;  4E9O X;  1YO0 A;  4M2R A;  3SAX A;  5FNI A;  4QJO A;  5SZ0 A;  3FW3 A;  1ZGE A;  1G4O A;  4FIK A;  3V3J A;  3DVC A;  5G0B A;  2EU3 A;  3N4B A;  4X5S A;  1OKN A;  4K0S A;  5DOG A;  4Z0Q A;  5L3O A;  4YWP A;  1CVB A;  5E2K A;  1YO2 A;  8CA2 A;  4KUY A;  5FLR A;  3M96 A;  1ZSC A;  3DCS A;  3EFI A;  1UGC A;  5SZ7 A;  3V2M A;  1DMX A;  1CNB A;  1CVD A;  4YGL A;  3Q31 A;  2W2J A;  3KON A;  5DSN A;  5FL6 A;  1V9I C;  3MNJ A;  2CAB A;  5EH7 A;  1Z97 A;  4Q99 A;  2FOY A;  4E49 A;  4WUP A;  3ML5 A;  4CNX A;  3F8E A;  5E2S A;  1A42 A;  4JSS A;  2QP6 A;  1CNX A;  4PXX A;  4FL7 A;  5E2M A;  4RUX A;  2FNM A;  1IF5 A;  5BRV A;  3OYQ A;  1LG5 A;  2WEH A;  3T82 A;  4YXI A;  1LZV A;  5EHE A;  5FDC A;  3CYU A;  3SBH A;  4HT0 A;  1UGA A;  3RYV B;  4BF6 A;  1CAJ A;  5JGS B;  3MYQ A;  1MUA A;  1UGB A;  2NWO A;  2NWZ A;  3OY0 A;  4E4A A;  2CBA A;  3W6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...