1FQMA

X-ray crystal structure of zinc-bound f93i/f95m/w97v carbonic anhydrase (caii) variant
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
Knots found
sequence length
256
structure length
256
Chain Sequence
WGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQIHMHVGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords CARBONIC ANHYDRASE
publication title Structural influence of hydrophobic core residues on metal binding and specificity in carbonic anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 256
sequence length 256
other databases KnotProt 2.0: K +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2000-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1fqmA00
5FNGA 1CAYA 4PYXA 5JGTB 1IF5A 5FLPA 4Z0QA 1CIMA 4XZ5A 5FNKA 3DCWA 1AM6A 3OYQA 2QO8A 3IBLA 5FNMA 1BNQA 2EZ7A 4RFDA 1FR4A 5DSQA 2HFWA 3IGPA 1XPZA 4ZWIA 3N2PA 4N16A 7CA2A 4KUWA 4Q6EA 1TG9A 1BNVA 3SBIA 3TMJA 4WR7A 1CRMA 1V9EA 3P4VA 5DSIA 1FQRA 1DCAA 4Q8YA 5L6KA 5EHWA 2NN7A 1FQMA 3RJ7A 2H4NA 5CACA 5G0BA 3F7BA 1YDBA 4RIUA 5EZTX 5JQ0A 5DVXA 3RYYA 3M96A 4FU5A 1BN4A 4QJPA 4RUXA 3N0NA 1G4JA 1TEQX 3MNAA 2EU3A 3K7KA 3R17B 1CNBA 1G53A 4WL4A 5FL4A 4TWLA 3V3GB 1FSQA 5FNIA 3D9ZA 2FOSA 3KONA 4G0CA 3MHLA 4DZ7A 1OQ5A 5E28A 1HUHA 1MOOA 4IDRX 3S74B 1AVNA 1RZAA 2NXTA 4FVNA 3RG3A 4UOVA 1URTA 1XEGA 5JEHB 2O4ZA 4YGLA 4QEFA 1ZE8A 3MHOA 3MMFA 1BCDA 5EKJA 1CNGA 1T9NA 1JCZA 2HNCA 1KWQA 4QJWA 4MLTA 4Q9YA 4QSIA 4M2UA 3V2JA 1IF6A 1ZFKA 1DCBA 4IWZA 3OY0A 3KIGA 2AX2A 3MYQA 3P3JA 2WD2A 5G0CA 5BNLA 2FOUA 5FLSA 4Q8ZA 2Q1BA 3R16A 2HKKA 4Q7PA 2X7SA 4MDLA 4RFCA 4E3GA 5SZ2A 1HCAA 4RIVA 1FQLA 4YGFA 3FFPX 1KOQA 1G6VA 1I90A 5E2MA 4JSWA 3S97A 1TBTX 1G0EA 3EFTA 3IBIA 3LXEA 1RJ6A 3JXHC 4QK1A 4K0ZA 4YXOA 1HUGA 3DV7A 1THKA 4QIYA 1UGDA 5BYIA 5J8ZA 4E5QA 3DD8A 4QJOA 1Y7WA 2GEHA 1CNWA 3DVDA 3M2YA 2ABEA 1BZMA 3EFIA 1I9MA 4QSAA 3T84A 5JG5B 5EOIA 5EKHA 2NNGA 3FW3A 3MHMA 3ML2A 4K1QA 3CAJA 3KWAA 4Z1EA 5CJFA 2NMXA 3MNJA 4Q08A 3M40A 4BF6A 4E4AA 2NXRA 5FLRA 3DCSA 4KNMA 1H4NA 3MNIA 5FLTA 1G4OA 3RYVB 5FDIA 3F4XA 4XFWA 1IF4A 2AW1A 3HS4A 1I9PA 1CILA 5EKMA 3T83A 1TH9A 1Z93A 3OILA 2FMGA 2FOYA 1CINA 4Q6DA 5DSOA 1CALA 2X7TA 5JEGB 1TEUX 3M14A 1YDCA 3KNEA 3DCCA 4BF1A 3SAXA 3M1JA 1YO0A 5E2NA 3L14A 4E3DA 1G0FA 4CNXA 5JESB 1A42A 3S78B 4E49A 1H9NA 1KWRA 4Q7SA 4GL1X 3DVBA 4JS6A 4WW6A 1G52A 1OKNA 5DSRA 4ZWYA 3V7XA 3RZ0B 5JG3B 1FSRA 3ZNCA 2H15A 5DSPA 4CNRA 4ITPA 4CACA 1UGAA 4QK3A 5JEPB 4QSBA 2QP6A 2ZNCA 3DAZA 3IAIA 4QTLA 5E5RA 3HKQA 3D8WA 4FIKA 3NI5A 1XEVA 3M3XA 3OYSA 2CBAA 3U7CA 4MO8A 5AMGA 4ZX0A 1ZFQA 1CAZA 1CVFA 4KP8A 4Z1KA 2NWPA 5EH8A 1I9NA 2WEJA 3DC9A 5EHVA 4X5SA 4YXUA 4Z1NA 4KUVA 2POUA 5AMLA 3KS3A 4QIZA 1UGCA 5AMDA 4M2WA 1LG6A 4ETQC 4HF3A 1FLJA 3ML5A 1RZEA 4E9OX 2OSMA 3NJ9A 4RUZA 5EH5A 4Q07A 5IPZA 3V2MA 4JSZA 4FVOA 3ZP9A 1CVCA 5CA2A 5DSJA 3HKNA 1G45A 2NNSA 5DOHA 4JSSA 4LU3A 2EU2A 1I91A 3HKTA 3U45X 1BN1A 1FR7A 4ZWZA 1RZCA 2NN1A 1CAMA 2Q1QA 1CZMA 2CBBA 1CANA 4QJMA 5L3OA 4L5VA 3UYNA 4HEZA 5FDCA 5BRWA 1HEBA 3C7PA 1CRAA 1IF8A 3F8EA 4PXXA 1BNUA 2WEGA 2VVBX 5SZ0A 4Q0LA 4R59A 5G01A 1HEDA 3N4BA 2IT4A 2OSFA 3S72B 9CA2A 3W6HA 2HD6A 1G46A 1AZMA 1V9IC 2NXSA 4YGJA 4YWPA 3M67A 4QSJA 3IEOA 1LGDA 1H9QA 2FOVA 3FE4A 1CNKA 4KNIA 1RAZA 5E2SA 2NWOA 1ZSBA 1UGEA 1YO2A 1KOPA 4Q7VA 3BETA 4Q8XA 2CABA 1BNTA 1G48A 5SZ6A 3RZ1B 5DOGA 12CAA 2Q38A 3T82A 4CNWA 3T5UA 4ILXA 3RZ7A 3K34A 3S73B 2FNNA 4PQ7A 4K13A 3KOIA 4PYYA 5SZ7A 4E3FA 1G54A 4YYTA 3DBUA 4JSAA 1CA3A 2W2JA 1FQNA 2QOAA 4M2RA 4RN4A 4Q99A 4Q83A 3RGEA 5FL6A 3V3IB 3V3FA 1CNCA 4Q49A 3RYXB 1LZVA 3RYJB 1CAKA 1CVBA 3BL0A 2NWYA 1Z9YA 3HKUA 2CBEA 2WEOA 4QY3A 2FW4A 1CAOA 4BCWA 5SZ5A 3MHIA 3MNKA 1CAIA 2FOQA 4YHAA 1YDDA 5FNJA 3M2ZA 4L5UA 4Q7WA 4Q78A 3M98A 3CA2A 1CCTA 5LMDA 4COQA 5JQTA 1ZGFA 1UGFA 1CNHA 1CA2A 4ZX1A 3RZ8A 5HPJA 1HECA 3P58A 4LHIA 5SZ3A 3M5EA 3P3HA 3T5ZA 1I8ZA 1CNYA 4HBAA 1IF9A 3V3HB 4XIWA 4M2VA 1HCBA 1HVAA 4K0SA 4YGNA 4TWMA 4HT0A 4N0XB 3P44A 3RG4A 4QJ0A 3IBUA 4FPTA 1BNWA 4QJXA 3KOKA 1OKMA 1RZDA 1RZBA 3QYKA 3TVNX 4LP6A 1KEQA 3S77B 1I9QA 4C3TA 1G3ZA 5FNLA 3N3JA 1CVHA 2FNKA 5FNHA 5BRVA 4YGKA 2NNOA 3PJJA 4KV0A 1OKLA 1CAHA 3M04A 1TB0X 3RYZA 4YXIA 1Z97A 2WEHA 3U47A 3RLDA 1I9LA 1YO1A 3DD0A 3V5GA 1LUGA 1CNIA 3TVOX 3M2XA 4MLXA 1ZH9A 5A6HA 4CQ0A 1BN3A 1BNNA 1UGBA 3S8XA 4KNJA 1CAJA 3S71B 3D0NA 3MZCA 3HLJA 4CNVA 3SBHA 2FMZA 1JD0A 4Y0JA 3OIMA 2VVAX 1BV3A 5JGSB 3MHCA 4HT2A 4QK2A 3B1BA 3W6IA 5EIJA 1BICA 1XQ0A 4WUPA 5DSNA 5FL5A 4ITOA 4Q87A 1CNXA 3U3AX 3OKUA 1YDAA 1ZGEA 5DSMA 3BL1A 3GZ0A 4R5AA 4DZ9A 4K0TA 1TTMA 1TE3X 3JXGA 3HFPA 3JXFA 5E5UA 3M1WA 4Z1JA 5C8IA 5SZ4A 3M1QA 3OKVA 1TG3A 2POWA 3MNHA 1ZNCA 2WD3A 1IF7A 4CA2A 3P55A 3OIKA 5EH7A 2CA2A 4HEWA 5DSLA 5E2KA 3VBDA 3S9TA 2FNMA 4E3HA 1UGGA 4Q81A 2NNVA 3V3JA 4ZAOA 4MDGA 1EOUA 2POVA 3KKXA 4R5BA 3B4FA 4YX4A 3D92A 3KLDB 3RZ5A 4WUQA 5FLOA 5SZ1A 4Q90A 1ZSAA 5CLUA 1I9OA 1CVAA 4HU1A 3IBNA 1RJ5A 4RH2A 5E2RA 4G7AA 1G1DA 4MDMA 3M5SA 4Q09A 1BNMA 2CBCA 3MDZA 1JV0A 3DC3A 4FRCA 2ILIA 4ZWXA 6CA2A 5JDVB 4Q06A 5A25A 3CZVA 2HL4A 1DMYA 4MTYA 4KAPA 4FL7A 1CVEA 1DMXA 3M2NA 1LG5A 4KUYA 4KNNA 3DVCA 3S76A 3Q31A 2HOCA 1HEAA 4YVYA 4XE1A 3UYQA 3DA2A 3PYKA 1MUAA 3D93A 2CBDA 2X7UA 1CNJA 1F2WA 4L5WA 4PZHA 1RAYA 3F7UA 1ZSCA 3PO6A 5EHEA 3SAPA 4RUYA 5BRUA 3M1KA 4XIXA 8CA2A 3MWOA 3CYUA 5FLQA 1J9WA 2NWZA 5G03A 3NB5A 3P5LA 3K2FA 3M5TA 4KP5A 3S75B 5DRSA 1CVDA 1FSNA 2F14A 3P5AA 2GD8A 3T85A 1CCUA 4HEYA 5DSKA 4WW8A 3MNUA 1CCSA
chains in the Genus database with same CATH superfamily
5FNGA 1CAYA 4PYXA 5JGTB 1IF5A 5FLPA 4Z0QA 1CIMA 4XZ5A 5FNKA 3DCWA 1AM6A 3OYQA 2QO8A 3IBLA 5FNMA 1BNQA 2EZ7A 4RFDA 1FR4A 5DSQA 2HFWA 3IGPA 1XPZA 4ZWIA 3N2PA 4N16A 7CA2A 4KUWA 4Q6EA 1TG9A 1BNVA 3SBIA 3TMJA 4WR7A 1CRMA 1V9EA 3P4VA 5DSIA 1FQRA 1DCAA 4Q8YA 5L6KA 5EHWA 2NN7A 1FQMA 3RJ7A 2H4NA 5CACA 5G0BA 3F7BA 1YDBA 4RIUA 5EZTX 5JQ0A 5DVXA 3RYYA 3M96A 4FU5A 1BN4A 4QJPA 4RUXA 3N0NA 1G4JA 1TEQX 3MNAA 2EU3A 3K7KA 3R17B 1CNBA 1G53A 4WL4A 5FL4A 4TWLA 3V3GB 1FSQA 5FNIA 3D9ZA 2FOSA 3KONA 4G0CA 3MHLA 4DZ7A 1OQ5A 5E28A 1HUHA 1MOOA 4IDRX 3S74B 1AVNA 1RZAA 2NXTA 4FVNA 3RG3A 4UOVA 1URTA 1XEGA 5JEHB 2O4ZA 4YGLA 4QEFA 1ZE8A 3MHOA 3MMFA 1BCDA 5EKJA 1CNGA 1T9NA 1JCZA 2HNCA 1KWQA 4QJWA 4MLTA 4Q9YA 4QSIA 4M2UA 3V2JA 1IF6A 1ZFKA 1DCBA 4IWZA 3OY0A 3KIGA 2AX2A 3MYQA 3P3JA 2WD2A 5G0CA 5BNLA 2FOUA 5FLSA 4Q8ZA 2Q1BA 3R16A 2HKKA 4Q7PA 2X7SA 4MDLA 4RFCA 4E3GA 5SZ2A 1HCAA 4RIVA 1FQLA 4YGFA 3FFPX 1KOQA 1G6VA 1I90A 5E2MA 4JSWA 3S97A 1TBTX 1G0EA 3EFTA 3IBIA 3LXEA 1RJ6A 3JXHC 4QK1A 4K0ZA 4YXOA 1HUGA 3DV7A 1THKA 4QIYA 1UGDA 5BYIA 5J8ZA 4E5QA 3DD8A 4QJOA 1Y7WA 2GEHA 1CNWA 3DVDA 3M2YA 2ABEA 1BZMA 3EFIA 1I9MA 4QSAA 3T84A 5JG5B 5EOIA 5EKHA 2NNGA 3FW3A 3MHMA 3ML2A 4K1QA 3CAJA 3KWAA 4Z1EA 5CJFA 2NMXA 3MNJA 4Q08A 3M40A 4BF6A 4E4AA 2NXRA 5FLRA 3DCSA 4KNMA 1H4NA 3MNIA 5FLTA 1G4OA 3RYVB 5FDIA 3F4XA 4XFWA 1IF4A 2AW1A 3HS4A 1I9PA 1CILA 5EKMA 3T83A 1TH9A 1Z93A 3OILA 2FMGA 2FOYA 1CINA 4Q6DA 5DSOA 1CALA 2X7TA 5JEGB 1TEUX 3M14A 1YDCA 3KNEA 3DCCA 4BF1A 3SAXA 3M1JA 1YO0A 5E2NA 3L14A 4E3DA 1G0FA 4CNXA 5JESB 1A42A 3S78B 4E49A 1H9NA 1KWRA 4Q7SA 4GL1X 3DVBA 4JS6A 4WW6A 1G52A 1OKNA 5DSRA 4ZWYA 3V7XA 3RZ0B 5JG3B 1FSRA 3ZNCA 2H15A 5DSPA 4CNRA 4ITPA 4CACA 1UGAA 4QK3A 5JEPB 4QSBA 2QP6A 2ZNCA 3DAZA 3IAIA 4QTLA 5E5RA 3HKQA 3D8WA 4FIKA 3NI5A 1XEVA 3M3XA 3OYSA 2CBAA 3U7CA 4MO8A 5AMGA 4ZX0A 1ZFQA 1CAZA 1CVFA 4KP8A 4Z1KA 2NWPA 5EH8A 1I9NA 2WEJA 3DC9A 5EHVA 4X5SA 4YXUA 4Z1NA 4KUVA 2POUA 5AMLA 3KS3A 4QIZA 1UGCA 5AMDA 4M2WA 1LG6A 4ETQC 4HF3A 1FLJA 3ML5A 1RZEA 4E9OX 2OSMA 3NJ9A 4RUZA 5EH5A 4Q07A 5IPZA 3V2MA 4JSZA 4FVOA 3ZP9A 1CVCA 5CA2A 5DSJA 3HKNA 1G45A 2NNSA 5DOHA 4JSSA 4LU3A 2EU2A 1I91A 3HKTA 3U45X 1BN1A 1FR7A 4ZWZA 1RZCA 2NN1A 1CAMA 2Q1QA 1CZMA 2CBBA 1CANA 4QJMA 5L3OA 4L5VA 3UYNA 4HEZA 5FDCA 5BRWA 1HEBA 3C7PA 1CRAA 1IF8A 3F8EA 4PXXA 1BNUA 2WEGA 2VVBX 5SZ0A 4Q0LA 4R59A 5G01A 1HEDA 3N4BA 2IT4A 2OSFA 3S72B 9CA2A 3W6HA 2HD6A 1G46A 1AZMA 1V9IC 2NXSA 4YGJA 4YWPA 3M67A 4QSJA 3IEOA 1LGDA 1H9QA 2FOVA 3FE4A 1CNKA 4KNIA 1RAZA 5E2SA 2NWOA 1ZSBA 1UGEA 1YO2A 1KOPA 4Q7VA 3BETA 4Q8XA 2CABA 1BNTA 1G48A 5SZ6A 3RZ1B 5DOGA 12CAA 2Q38A 3T82A 4CNWA 3T5UA 4ILXA 3RZ7A 3K34A 3S73B 2FNNA 4PQ7A 4K13A 3KOIA 4PYYA 5SZ7A 4E3FA 1G54A 4YYTA 3DBUA 4JSAA 1CA3A 2W2JA 1FQNA 2QOAA 4M2RA 4RN4A 4Q99A 4Q83A 3RGEA 5FL6A 3V3IB 3V3FA 1CNCA 4Q49A 3RYXB 1LZVA 3RYJB 1CAKA 1CVBA 3BL0A 2NWYA 1Z9YA 3HKUA 2CBEA 2WEOA 4QY3A 2FW4A 1CAOA 4BCWA 5SZ5A 3MHIA 3MNKA 1CAIA 2FOQA 4YHAA 1YDDA 5FNJA 3M2ZA 4L5UA 4Q7WA 4Q78A 3M98A 3CA2A 1CCTA 5LMDA 4COQA 5JQTA 1ZGFA 1UGFA 1CNHA 1CA2A 4ZX1A 3RZ8A 5HPJA 1HECA 3P58A 4LHIA 5SZ3A 3M5EA 3P3HA 3T5ZA 1I8ZA 1CNYA 4HBAA 1IF9A 3V3HB 4XIWA 4M2VA 1HCBA 1HVAA 4K0SA 4YGNA 4TWMA 4HT0A 4N0XB 3P44A 3RG4A 4QJ0A 3IBUA 4FPTA 1BNWA 4QJXA 3KOKA 1OKMA 1RZDA 1RZBA 3QYKA 3TVNX 4LP6A 1KEQA 3S77B 1I9QA 4C3TA 1G3ZA 5FNLA 3N3JA 1CVHA 2FNKA 5FNHA 5BRVA 4YGKA 2NNOA 3PJJA 4KV0A 1OKLA 1CAHA 3M04A 1TB0X 3RYZA 4YXIA 1Z97A 2WEHA 3U47A 3RLDA 1I9LA 1YO1A 3DD0A 3V5GA 1LUGA 1CNIA 3TVOX 3M2XA 4MLXA 1ZH9A 5A6HA 4CQ0A 1BN3A 1BNNA 1UGBA 3S8XA 4KNJA 1CAJA 3S71B 3D0NA 3MZCA 3HLJA 4CNVA 3SBHA 2FMZA 1JD0A 4Y0JA 3OIMA 2VVAX 1BV3A 5JGSB 3MHCA 4HT2A 4QK2A 3B1BA 3W6IA 5EIJA 1BICA 1XQ0A 4WUPA 5DSNA 5FL5A 4ITOA 4Q87A 1CNXA 3U3AX 3OKUA 1YDAA 1ZGEA 5DSMA 3BL1A 3GZ0A 4R5AA 4DZ9A 4K0TA 1TTMA 1TE3X 3JXGA 3HFPA 3JXFA 5E5UA 3M1WA 4Z1JA 5C8IA 5SZ4A 3M1QA 3OKVA 1TG3A 2POWA 3MNHA 1ZNCA 2WD3A 1IF7A 4CA2A 3P55A 3OIKA 5EH7A 2CA2A 4HEWA 5DSLA 5E2KA 3VBDA 3S9TA 2FNMA 4E3HA 1UGGA 4Q81A 2NNVA 3V3JA 4ZAOA 4MDGA 1EOUA 2POVA 3KKXA 4R5BA 3B4FA 4YX4A 3D92A 3KLDB 3RZ5A 4WUQA 5FLOA 5SZ1A 4Q90A 1ZSAA 5CLUA 1I9OA 1CVAA 4HU1A 3IBNA 1RJ5A 4RH2A 5E2RA 4G7AA 1G1DA 4MDMA 3M5SA 4Q09A 1BNMA 2CBCA 3MDZA 1JV0A 3DC3A 4FRCA 2ILIA 4ZWXA 6CA2A 5JDVB 4Q06A 5A25A 3CZVA 2HL4A 1DMYA 4MTYA 4KAPA 4FL7A 1CVEA 1DMXA 3M2NA 1LG5A 4KUYA 4KNNA 3DVCA 3S76A 3Q31A 2HOCA 1HEAA 4YVYA 4XE1A 3UYQA 3DA2A 3PYKA 1MUAA 3D93A 2CBDA 2X7UA 1CNJA 1F2WA 4L5WA 4PZHA 1RAYA 3F7UA 1ZSCA 3PO6A 5EHEA 3SAPA 4RUYA 5BRUA 3M1KA 4XIXA 8CA2A 3MWOA 3CYUA 5FLQA 1J9WA 2NWZA 5G03A 3NB5A 3P5LA 3K2FA 3M5TA 4KP5A 3S75B 5DRSA 1CVDA 1FSNA 2F14A 3P5AA 2GD8A 3T85A 1CCUA 4HEYA 5DSKA 4WW8A 3MNUA 1CCSA
chains in the Genus database with same CATH topology
5FNGA 1CAYA 4PYXA 5JGTB 1IF5A 5FLPA 4Z0QA 1CIMA 4XZ5A 5FNKA 3DCWA 1AM6A 3OYQA 2QO8A 3IBLA 5FNMA 1BNQA 2EZ7A 4RFDA 1FR4A 5DSQA 2HFWA 3IGPA 1XPZA 4ZWIA 3N2PA 4N16A 7CA2A 4KUWA 4Q6EA 1TG9A 1BNVA 3SBIA 3TMJA 4WR7A 1CRMA 1V9EA 3P4VA 5DSIA 1FQRA 1DCAA 4Q8YA 5L6KA 5EHWA 2NN7A 1FQMA 3RJ7A 2H4NA 5CACA 5G0BA 3F7BA 1YDBA 4RIUA 5EZTX 5JQ0A 5DVXA 3RYYA 3M96A 4FU5A 1BN4A 4QJPA 4RUXA 3N0NA 1G4JA 1TEQX 3MNAA 2EU3A 3K7KA 3R17B 1CNBA 1G53A 4WL4A 5FL4A 4TWLA 3V3GB 1FSQA 5FNIA 3D9ZA 2FOSA 3KONA 4G0CA 3MHLA 4DZ7A 1OQ5A 5E28A 1HUHA 1MOOA 4IDRX 3S74B 1AVNA 1RZAA 2NXTA 4FVNA 3RG3A 4UOVA 1URTA 1XEGA 5JEHB 2O4ZA 4YGLA 4QEFA 1ZE8A 3MHOA 3MMFA 1BCDA 5EKJA 1CNGA 1T9NA 1JCZA 2HNCA 1KWQA 4QJWA 4MLTA 4Q9YA 4QSIA 4M2UA 3V2JA 1IF6A 1ZFKA 1DCBA 4IWZA 3OY0A 3KIGA 2AX2A 3MYQA 3P3JA 2WD2A 5G0CA 5BNLA 2FOUA 5FLSA 4Q8ZA 2Q1BA 3R16A 2HKKA 4Q7PA 2X7SA 4MDLA 4RFCA 4E3GA 5SZ2A 1HCAA 4RIVA 1FQLA 4YGFA 3FFPX 1KOQA 1G6VA 1I90A 5E2MA 4JSWA 3S97A 1TBTX 1G0EA 3EFTA 3IBIA 3LXEA 1RJ6A 3JXHC 4QK1A 4K0ZA 4YXOA 1HUGA 3DV7A 1THKA 4QIYA 1UGDA 5BYIA 5J8ZA 4E5QA 3DD8A 4QJOA 1Y7WA 2GEHA 1CNWA 3DVDA 3M2YA 2ABEA 1BZMA 3EFIA 1I9MA 4QSAA 3T84A 5JG5B 5EOIA 5EKHA 2NNGA 3FW3A 3MHMA 3ML2A 4K1QA 3CAJA 3KWAA 4Z1EA 5CJFA 2NMXA 3MNJA 4Q08A 3M40A 4BF6A 4E4AA 2NXRA 5FLRA 3DCSA 4KNMA 1H4NA 3MNIA 5FLTA 1G4OA 3RYVB 5FDIA 3F4XA 4XFWA 1IF4A 2AW1A 3HS4A 1I9PA 1CILA 5EKMA 3T83A 1TH9A 1Z93A 3OILA 2FMGA 2FOYA 1CINA 4Q6DA 5DSOA 1CALA 2X7TA 5JEGB 1TEUX 3M14A 1YDCA 3KNEA 3DCCA 4BF1A 3SAXA 3M1JA 1YO0A 5E2NA 3L14A 4E3DA 1G0FA 4CNXA 5JESB 1A42A 3S78B 4E49A 1H9NA 1KWRA 4Q7SA 4GL1X 3DVBA 4JS6A 4WW6A 1G52A 1OKNA 5DSRA 4ZWYA 3V7XA 3RZ0B 5JG3B 1FSRA 3ZNCA 2H15A 5DSPA 4CNRA 4ITPA 4CACA 1UGAA 4QK3A 5JEPB 4QSBA 2QP6A 2ZNCA 3DAZA 3IAIA 4QTLA 5E5RA 3HKQA 3D8WA 4FIKA 3NI5A 1XEVA 3M3XA 3OYSA 2CBAA 3U7CA 4MO8A 5AMGA 4ZX0A 1ZFQA 1CAZA 1CVFA 4KP8A 4Z1KA 2NWPA 5EH8A 1I9NA 2WEJA 3DC9A 5EHVA 4X5SA 4YXUA 4Z1NA 4KUVA 2POUA 5AMLA 3KS3A 4QIZA 1UGCA 5AMDA 4M2WA 1LG6A 4ETQC 4HF3A 1FLJA 3ML5A 1RZEA 4E9OX 2OSMA 3NJ9A 4RUZA 5EH5A 4Q07A 5IPZA 3V2MA 4JSZA 4FVOA 3ZP9A 1CVCA 5CA2A 5DSJA 3HKNA 1G45A 2NNSA 5DOHA 4JSSA 4LU3A 2EU2A 1I91A 3HKTA 3U45X 1BN1A 1FR7A 4ZWZA 1RZCA 2NN1A 1CAMA 2Q1QA 1CZMA 2CBBA 1CANA 4QJMA 5L3OA 4L5VA 3UYNA 4HEZA 5FDCA 5BRWA 1HEBA 3C7PA 1CRAA 1IF8A 3F8EA 4PXXA 1BNUA 2WEGA 2VVBX 5SZ0A 4Q0LA 4R59A 5G01A 1HEDA 3N4BA 2IT4A 2OSFA 3S72B 9CA2A 3W6HA 2HD6A 1G46A 1AZMA 1V9IC 2NXSA 4YGJA 4YWPA 3M67A 4QSJA 3IEOA 1LGDA 1H9QA 2FOVA 3FE4A 1CNKA 4KNIA 1RAZA 5E2SA 2NWOA 1ZSBA 1UGEA 1YO2A 1KOPA 4Q7VA 3BETA 4Q8XA 2CABA 1BNTA 1G48A 5SZ6A 3RZ1B 5DOGA 12CAA 2Q38A 3T82A 4CNWA 3T5UA 4ILXA 3RZ7A 3K34A 3S73B 2FNNA 4PQ7A 4K13A 3KOIA 4PYYA 5SZ7A 4E3FA 1G54A 4YYTA 3DBUA 4JSAA 1CA3A 2W2JA 1FQNA 2QOAA 4M2RA 4RN4A 4Q99A 4Q83A 3RGEA 5FL6A 3V3IB 3V3FA 1CNCA 4Q49A 3RYXB 1LZVA 3RYJB 1CAKA 1CVBA 3BL0A 2NWYA 1Z9YA 3HKUA 2CBEA 2WEOA 4QY3A 2FW4A 1CAOA 4BCWA 5SZ5A 3MHIA 3MNKA 1CAIA 2FOQA 4YHAA 1YDDA 5FNJA 3M2ZA 4L5UA 4Q7WA 4Q78A 3M98A 3CA2A 1CCTA 5LMDA 4COQA 5JQTA 1ZGFA 1UGFA 1CNHA 1CA2A 4ZX1A 3RZ8A 5HPJA 1HECA 3P58A 4LHIA 5SZ3A 3M5EA 3P3HA 3T5ZA 1I8ZA 1CNYA 4HBAA 1IF9A 3V3HB 4XIWA 4M2VA 1HCBA 1HVAA 4K0SA 4YGNA 4TWMA 4HT0A 4N0XB 3P44A 3RG4A 4QJ0A 3IBUA 4FPTA 1BNWA 4QJXA 3KOKA 1OKMA 1RZDA 1RZBA 3QYKA 3TVNX 4LP6A 1KEQA 3S77B 1I9QA 4C3TA 1G3ZA 5FNLA 3N3JA 1CVHA 2FNKA 5FNHA 5BRVA 4YGKA 2NNOA 3PJJA 4KV0A 1OKLA 1CAHA 3M04A 1TB0X 3RYZA 4YXIA 1Z97A 2WEHA 3U47A 3RLDA 1I9LA 1YO1A 3DD0A 3V5GA 1LUGA 1CNIA 3TVOX 3M2XA 4MLXA 1ZH9A 5A6HA 4CQ0A 1BN3A 1BNNA 1UGBA 3S8XA 4KNJA 1CAJA 3S71B 3D0NA 3MZCA 3HLJA 4CNVA 3SBHA 2FMZA 1JD0A 4Y0JA 3OIMA 2VVAX 1BV3A 5JGSB 3MHCA 4HT2A 4QK2A 3B1BA 3W6IA 5EIJA 1BICA 1XQ0A 4WUPA 5DSNA 5FL5A 4ITOA 4Q87A 1CNXA 3U3AX 3OKUA 1YDAA 1ZGEA 5DSMA 3BL1A 3GZ0A 4R5AA 4DZ9A 4K0TA 1TTMA 1TE3X 3JXGA 3HFPA 3JXFA 5E5UA 3M1WA 4Z1JA 5C8IA 5SZ4A 3M1QA 3OKVA 1TG3A 2POWA 3MNHA 1ZNCA 2WD3A 1IF7A 4CA2A 3P55A 3OIKA 5EH7A 2CA2A 4HEWA 5DSLA 5E2KA 3VBDA 3S9TA 2FNMA 4E3HA 1UGGA 4Q81A 2NNVA 3V3JA 4ZAOA 4MDGA 1EOUA 2POVA 3KKXA 4R5BA 3B4FA 4YX4A 3D92A 3KLDB 3RZ5A 4WUQA 5FLOA 5SZ1A 4Q90A 1ZSAA 5CLUA 1I9OA 1CVAA 4HU1A 3IBNA 1RJ5A 4RH2A 5E2RA 4G7AA 1G1DA 4MDMA 3M5SA 4Q09A 1BNMA 2CBCA 3MDZA 1JV0A 3DC3A 4FRCA 2ILIA 4ZWXA 6CA2A 5JDVB 4Q06A 5A25A 3CZVA 2HL4A 1DMYA 4MTYA 4KAPA 4FL7A 1CVEA 1DMXA 3M2NA 1LG5A 4KUYA 4KNNA 3DVCA 3S76A 3Q31A 2HOCA 1HEAA 4YVYA 4XE1A 3UYQA 3DA2A 3PYKA 1MUAA 3D93A 2CBDA 2X7UA 1CNJA 1F2WA 4L5WA 4PZHA 1RAYA 3F7UA 1ZSCA 3PO6A 5EHEA 3SAPA 4RUYA 5BRUA 3M1KA 4XIXA 8CA2A 3MWOA 3CYUA 5FLQA 1J9WA 2NWZA 5G03A 3NB5A 3P5LA 3K2FA 3M5TA 4KP5A 3S75B 5DRSA 1CVDA 1FSNA 2F14A 3P5AA 2GD8A 3T85A 1CCUA 4HEYA 5DSKA 4WW8A 3MNUA 1CCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FNG A;  1CAY A;  4PYX A;  5JGT B;  1IF5 A;  5FLP A;  4Z0Q A;  1CIM A;  4XZ5 A;  5FNK A;  3DCW A;  1AM6 A;  3OYQ A;  2QO8 A;  3IBL A;  5FNM A;  1BNQ A;  2EZ7 A;  4RFD A;  1FR4 A;  5DSQ A;  2HFW A;  3IGP A;  1XPZ A;  4ZWI A;  3N2P A;  4N16 A;  7CA2 A;  4KUW A;  4Q6E A;  1TG9 A;  1BNV A;  3SBI A;  3TMJ A;  4WR7 A;  1CRM A;  1V9E A;  3P4V A;  5DSI A;  1FQR A;  1DCA A;  4Q8Y A;  5L6K A;  5EHW A;  2NN7 A;  1FQM A;  3RJ7 A;  2H4N A;  5CAC A;  5G0B A;  3F7B A;  1YDB A;  4RIU A;  5EZT X;  5JQ0 A;  5DVX A;  3RYY A;  3M96 A;  4FU5 A;  1BN4 A;  4QJP A;  4RUX A;  3N0N A;  1G4J A;  1TEQ X;  3MNA A;  2EU3 A;  3K7K A;  3R17 B;  1CNB A;  1G53 A;  4WL4 A;  5FL4 A;  4TWL A;  3V3G B;  1FSQ A;  5FNI A;  3D9Z A;  2FOS A;  3KON A;  4G0C A;  3MHL A;  4DZ7 A;  1OQ5 A;  5E28 A;  1HUH A;  1MOO A;  4IDR X;  3S74 B;  1AVN A;  1RZA A;  2NXT A;  4FVN A;  3RG3 A;  4UOV A;  1URT A;  1XEG A;  5JEH B;  2O4Z A;  4YGL A;  4QEF A;  1ZE8 A;  3MHO A;  3MMF A;  1BCD A;  5EKJ A;  1CNG A;  1T9N A;  1JCZ A;  2HNC A;  1KWQ A;  4QJW A;  4MLT A;  4Q9Y A;  4QSI A;  4M2U A;  3V2J A;  1IF6 A;  1ZFK A;  1DCB A;  4IWZ A;  3OY0 A;  3KIG A;  2AX2 A;  3MYQ A;  3P3J A;  2WD2 A;  5G0C A;  5BNL A;  2FOU A;  5FLS A;  4Q8Z A;  2Q1B A;  3R16 A;  2HKK A;  4Q7P A;  2X7S A;  4MDL A;  4RFC A;  4E3G A;  5SZ2 A;  1HCA A;  4RIV A;  1FQL A;  4YGF A;  3FFP X;  1KOQ A;  1G6V A;  1I90 A;  5E2M A;  4JSW A;  3S97 A;  1TBT X;  1G0E A;  3EFT A;  3IBI A;  3LXE A;  1RJ6 A;  3JXH C;  4QK1 A;  4K0Z A;  4YXO A;  1HUG A;  3DV7 A;  1THK A;  4QIY A;  1UGD A;  5BYI A;  5J8Z A;  4E5Q A;  3DD8 A;  4QJO A;  1Y7W A;  2GEH A;  1CNW A;  3DVD A;  3M2Y A;  2ABE A;  1BZM A;  3EFI A;  1I9M A;  4QSA A;  3T84 A;  5JG5 B;  5EOI A;  5EKH A;  2NNG A;  3FW3 A;  3MHM A;  3ML2 A;  4K1Q A;  3CAJ A;  3KWA A;  4Z1E A;  5CJF A;  2NMX A;  3MNJ A;  4Q08 A;  3M40 A;  4BF6 A;  4E4A A;  2NXR A;  5FLR A;  3DCS A;  4KNM A;  1H4N A;  3MNI A;  5FLT A;  1G4O A;  3RYV B;  5FDI A;  3F4X A;  4XFW A;  1IF4 A;  2AW1 A;  3HS4 A;  1I9P A;  1CIL A;  5EKM A;  3T83 A;  1TH9 A;  1Z93 A;  3OIL A;  2FMG A;  2FOY A;  1CIN A;  4Q6D A;  5DSO A;  1CAL A;  2X7T A;  5JEG B;  1TEU X;  3M14 A;  1YDC A;  3KNE A;  3DCC A;  4BF1 A;  3SAX A;  3M1J A;  1YO0 A;  5E2N A;  3L14 A;  4E3D A;  1G0F A;  4CNX A;  5JES B;  1A42 A;  3S78 B;  4E49 A;  1H9N A;  1KWR A;  4Q7S A;  4GL1 X;  3DVB A;  4JS6 A;  4WW6 A;  1G52 A;  1OKN A;  5DSR A;  4ZWY A;  3V7X A;  3RZ0 B;  5JG3 B;  1FSR A;  3ZNC A;  2H15 A;  5DSP A;  4CNR A;  4ITP A;  4CAC A;  1UGA A;  4QK3 A;  5JEP B;  4QSB A;  2QP6 A;  2ZNC A;  3DAZ A;  3IAI A;  4QTL A;  5E5R A;  3HKQ A;  3D8W A;  4FIK A;  3NI5 A;  1XEV A;  3M3X A;  3OYS A;  2CBA A;  3U7C A;  4MO8 A;  5AMG A;  4ZX0 A;  1ZFQ A;  1CAZ A;  1CVF A;  4KP8 A;  4Z1K A;  2NWP A;  5EH8 A;  1I9N A;  2WEJ A;  3DC9 A;  5EHV A;  4X5S A;  4YXU A;  4Z1N A;  4KUV A;  2POU A;  5AML A;  3KS3 A;  4QIZ A;  1UGC A;  5AMD A;  4M2W A;  1LG6 A;  4ETQ C;  4HF3 A;  1FLJ A;  3ML5 A;  1RZE A;  4E9O X;  2OSM A;  3NJ9 A;  4RUZ A;  5EH5 A;  4Q07 A;  5IPZ A;  3V2M A;  4JSZ A;  4FVO A;  3ZP9 A;  1CVC A;  5CA2 A;  5DSJ A;  3HKN A;  1G45 A;  2NNS A;  5DOH A;  4JSS A;  4LU3 A;  2EU2 A;  1I91 A;  3HKT A;  3U45 X;  1BN1 A;  1FR7 A;  4ZWZ A;  1RZC A;  2NN1 A;  1CAM A;  2Q1Q A;  1CZM A;  2CBB A;  1CAN A;  4QJM A;  5L3O A;  4L5V A;  3UYN A;  4HEZ A;  5FDC A;  5BRW A;  1HEB A;  3C7P A;  1CRA A;  1IF8 A;  3F8E A;  4PXX A;  1BNU A;  2WEG A;  2VVB X;  5SZ0 A;  4Q0L A;  4R59 A;  5G01 A;  1HED A;  3N4B A;  2IT4 A;  2OSF A;  3S72 B;  9CA2 A;  3W6H A;  2HD6 A;  1G46 A;  1AZM A;  1V9I C;  2NXS A;  4YGJ A;  4YWP A;  3M67 A;  4QSJ A;  3IEO A;  1LGD A;  1H9Q A;  2FOV A;  3FE4 A;  1CNK A;  4KNI A;  1RAZ A;  5E2S A;  2NWO A;  1ZSB A;  1UGE A;  1YO2 A;  1KOP A;  4Q7V A;  3BET A;  4Q8X A;  2CAB A;  1BNT A;  1G48 A;  5SZ6 A;  3RZ1 B;  5DOG A;  12CA A;  2Q38 A;  3T82 A;  4CNW A;  3T5U A;  4ILX A;  3RZ7 A;  3K34 A;  3S73 B;  2FNN A;  4PQ7 A;  4K13 A;  3KOI A;  4PYY A;  5SZ7 A;  4E3F A;  1G54 A;  4YYT A;  3DBU A;  4JSA A;  1CA3 A;  2W2J A;  1FQN A;  2QOA A;  4M2R A;  4RN4 A;  4Q99 A;  4Q83 A;  3RGE A;  5FL6 A;  3V3I B;  3V3F A;  1CNC A;  4Q49 A;  3RYX B;  1LZV A;  3RYJ B;  1CAK A;  1CVB A;  3BL0 A;  2NWY A;  1Z9Y A;  3HKU A;  2CBE A;  2WEO A;  4QY3 A;  2FW4 A;  1CAO A;  4BCW A;  5SZ5 A;  3MHI A;  3MNK A;  1CAI A;  2FOQ A;  4YHA A;  1YDD A;  5FNJ A;  3M2Z A;  4L5U A;  4Q7W A;  4Q78 A;  3M98 A;  3CA2 A;  1CCT A;  5LMD A;  4COQ A;  5JQT A;  1ZGF A;  1UGF A;  1CNH A;  1CA2 A;  4ZX1 A;  3RZ8 A;  5HPJ A;  1HEC A;  3P58 A;  4LHI A;  5SZ3 A;  3M5E A;  3P3H A;  3T5Z A;  1I8Z A;  1CNY A;  4HBA A;  1IF9 A;  3V3H B;  4XIW A;  4M2V A;  1HCB A;  1HVA A;  4K0S A;  4YGN A;  4TWM A;  4HT0 A;  4N0X B;  3P44 A;  3RG4 A;  4QJ0 A;  3IBU A;  4FPT A;  1BNW A;  4QJX A;  3KOK A;  1OKM A;  1RZD A;  1RZB A;  3QYK A;  3TVN X;  4LP6 A;  1KEQ A;  3S77 B;  1I9Q A;  4C3T A;  1G3Z A;  5FNL A;  3N3J A;  1CVH A;  2FNK A;  5FNH A;  5BRV A;  4YGK A;  2NNO A;  3PJJ A;  4KV0 A;  1OKL A;  1CAH A;  3M04 A;  1TB0 X;  3RYZ A;  4YXI A;  1Z97 A;  2WEH A;  3U47 A;  3RLD A;  1I9L A;  1YO1 A;  3DD0 A;  3V5G A;  1LUG A;  1CNI A;  3TVO X;  3M2X A;  4MLX A;  1ZH9 A;  5A6H A;  4CQ0 A;  1BN3 A;  1BNN A;  1UGB A;  3S8X A;  4KNJ A;  1CAJ A;  3S71 B;  3D0N A;  3MZC A;  3HLJ A;  4CNV A;  3SBH A;  2FMZ A;  1JD0 A;  4Y0J A;  3OIM A;  2VVA X;  1BV3 A;  5JGS B;  3MHC A;  4HT2 A;  4QK2 A;  3B1B A;  3W6I A;  5EIJ A;  1BIC A;  1XQ0 A;  4WUP A;  5DSN A;  5FL5 A;  4ITO A;  4Q87 A;  1CNX A;  3U3A X;  3OKU A;  1YDA A;  1ZGE A;  5DSM A;  3BL1 A;  3GZ0 A;  4R5A A;  4DZ9 A;  4K0T A;  1TTM A;  1TE3 X;  3JXG A;  3HFP A;  3JXF A;  5E5U A;  3M1W A;  4Z1J A;  5C8I A;  5SZ4 A;  3M1Q A;  3OKV A;  1TG3 A;  2POW A;  3MNH A;  1ZNC A;  2WD3 A;  1IF7 A;  4CA2 A;  3P55 A;  3OIK A;  5EH7 A;  2CA2 A;  4HEW A;  5DSL A;  5E2K A;  3VBD A;  3S9T A;  2FNM A;  4E3H A;  1UGG A;  4Q81 A;  2NNV A;  3V3J A;  4ZAO A;  4MDG A;  1EOU A;  2POV A;  3KKX A;  4R5B A;  3B4F A;  4YX4 A;  3D92 A;  3KLD B;  3RZ5 A;  4WUQ A;  5FLO A;  5SZ1 A;  4Q90 A;  1ZSA A;  5CLU A;  1I9O A;  1CVA A;  4HU1 A;  3IBN A;  1RJ5 A;  4RH2 A;  5E2R A;  4G7A A;  1G1D A;  4MDM A;  3M5S A;  4Q09 A;  1BNM A;  2CBC A;  3MDZ A;  1JV0 A;  3DC3 A;  4FRC A;  2ILI A;  4ZWX A;  6CA2 A;  5JDV B;  4Q06 A;  5A25 A;  3CZV A;  2HL4 A;  1DMY A;  4MTY A;  4KAP A;  4FL7 A;  1CVE A;  1DMX A;  3M2N A;  1LG5 A;  4KUY A;  4KNN A;  3DVC A;  3S76 A;  3Q31 A;  2HOC A;  1HEA A;  4YVY A;  4XE1 A;  3UYQ A;  3DA2 A;  3PYK A;  1MUA A;  3D93 A;  2CBD A;  2X7U A;  1CNJ A;  1F2W A;  4L5W A;  4PZH A;  1RAY A;  3F7U A;  1ZSC A;  3PO6 A;  5EHE A;  3SAP A;  4RUY A;  5BRU A;  3M1K A;  4XIX A;  8CA2 A;  3MWO A;  3CYU A;  5FLQ A;  1J9W A;  2NWZ A;  5G03 A;  3NB5 A;  3P5L A;  3K2F A;  3M5T A;  4KP5 A;  3S75 B;  5DRS A;  1CVD A;  1FSN A;  2F14 A;  3P5A A;  2GD8 A;  3T85 A;  1CCU A;  4HEY A;  5DSK A;  4WW8 A;  3MNU A;  1CCS A; 
#chains in the Genus database with same CATH topology
 5FNG A;  1CAY A;  4PYX A;  5JGT B;  1IF5 A;  5FLP A;  4Z0Q A;  1CIM A;  4XZ5 A;  5FNK A;  3DCW A;  1AM6 A;  3OYQ A;  2QO8 A;  3IBL A;  5FNM A;  1BNQ A;  2EZ7 A;  4RFD A;  1FR4 A;  5DSQ A;  2HFW A;  3IGP A;  1XPZ A;  4ZWI A;  3N2P A;  4N16 A;  7CA2 A;  4KUW A;  4Q6E A;  1TG9 A;  1BNV A;  3SBI A;  3TMJ A;  4WR7 A;  1CRM A;  1V9E A;  3P4V A;  5DSI A;  1FQR A;  1DCA A;  4Q8Y A;  5L6K A;  5EHW A;  2NN7 A;  1FQM A;  3RJ7 A;  2H4N A;  5CAC A;  5G0B A;  3F7B A;  1YDB A;  4RIU A;  5EZT X;  5JQ0 A;  5DVX A;  3RYY A;  3M96 A;  4FU5 A;  1BN4 A;  4QJP A;  4RUX A;  3N0N A;  1G4J A;  1TEQ X;  3MNA A;  2EU3 A;  3K7K A;  3R17 B;  1CNB A;  1G53 A;  4WL4 A;  5FL4 A;  4TWL A;  3V3G B;  1FSQ A;  5FNI A;  3D9Z A;  2FOS A;  3KON A;  4G0C A;  3MHL A;  4DZ7 A;  1OQ5 A;  5E28 A;  1HUH A;  1MOO A;  4IDR X;  3S74 B;  1AVN A;  1RZA A;  2NXT A;  4FVN A;  3RG3 A;  4UOV A;  1URT A;  1XEG A;  5JEH B;  2O4Z A;  4YGL A;  4QEF A;  1ZE8 A;  3MHO A;  3MMF A;  1BCD A;  5EKJ A;  1CNG A;  1T9N A;  1JCZ A;  2HNC A;  1KWQ A;  4QJW A;  4MLT A;  4Q9Y A;  4QSI A;  4M2U A;  3V2J A;  1IF6 A;  1ZFK A;  1DCB A;  4IWZ A;  3OY0 A;  3KIG A;  2AX2 A;  3MYQ A;  3P3J A;  2WD2 A;  5G0C A;  5BNL A;  2FOU A;  5FLS A;  4Q8Z A;  2Q1B A;  3R16 A;  2HKK A;  4Q7P A;  2X7S A;  4MDL A;  4RFC A;  4E3G A;  5SZ2 A;  1HCA A;  4RIV A;  1FQL A;  4YGF A;  3FFP X;  1KOQ A;  1G6V A;  1I90 A;  5E2M A;  4JSW A;  3S97 A;  1TBT X;  1G0E A;  3EFT A;  3IBI A;  3LXE A;  1RJ6 A;  3JXH C;  4QK1 A;  4K0Z A;  4YXO A;  1HUG A;  3DV7 A;  1THK A;  4QIY A;  1UGD A;  5BYI A;  5J8Z A;  4E5Q A;  3DD8 A;  4QJO A;  1Y7W A;  2GEH A;  1CNW A;  3DVD A;  3M2Y A;  2ABE A;  1BZM A;  3EFI A;  1I9M A;  4QSA A;  3T84 A;  5JG5 B;  5EOI A;  5EKH A;  2NNG A;  3FW3 A;  3MHM A;  3ML2 A;  4K1Q A;  3CAJ A;  3KWA A;  4Z1E A;  5CJF A;  2NMX A;  3MNJ A;  4Q08 A;  3M40 A;  4BF6 A;  4E4A A;  2NXR A;  5FLR A;  3DCS A;  4KNM A;  1H4N A;  3MNI A;  5FLT A;  1G4O A;  3RYV B;  5FDI A;  3F4X A;  4XFW A;  1IF4 A;  2AW1 A;  3HS4 A;  1I9P A;  1CIL A;  5EKM A;  3T83 A;  1TH9 A;  1Z93 A;  3OIL A;  2FMG A;  2FOY A;  1CIN A;  4Q6D A;  5DSO A;  1CAL A;  2X7T A;  5JEG B;  1TEU X;  3M14 A;  1YDC A;  3KNE A;  3DCC A;  4BF1 A;  3SAX A;  3M1J A;  1YO0 A;  5E2N A;  3L14 A;  4E3D A;  1G0F A;  4CNX A;  5JES B;  1A42 A;  3S78 B;  4E49 A;  1H9N A;  1KWR A;  4Q7S A;  4GL1 X;  3DVB A;  4JS6 A;  4WW6 A;  1G52 A;  1OKN A;  5DSR A;  4ZWY A;  3V7X A;  3RZ0 B;  5JG3 B;  1FSR A;  3ZNC A;  2H15 A;  5DSP A;  4CNR A;  4ITP A;  4CAC A;  1UGA A;  4QK3 A;  5JEP B;  4QSB A;  2QP6 A;  2ZNC A;  3DAZ A;  3IAI A;  4QTL A;  5E5R A;  3HKQ A;  3D8W A;  4FIK A;  3NI5 A;  1XEV A;  3M3X A;  3OYS A;  2CBA A;  3U7C A;  4MO8 A;  5AMG A;  4ZX0 A;  1ZFQ A;  1CAZ A;  1CVF A;  4KP8 A;  4Z1K A;  2NWP A;  5EH8 A;  1I9N A;  2WEJ A;  3DC9 A;  5EHV A;  4X5S A;  4YXU A;  4Z1N A;  4KUV A;  2POU A;  5AML A;  3KS3 A;  4QIZ A;  1UGC A;  5AMD A;  4M2W A;  1LG6 A;  4ETQ C;  4HF3 A;  1FLJ A;  3ML5 A;  1RZE A;  4E9O X;  2OSM A;  3NJ9 A;  4RUZ A;  5EH5 A;  4Q07 A;  5IPZ A;  3V2M A;  4JSZ A;  4FVO A;  3ZP9 A;  1CVC A;  5CA2 A;  5DSJ A;  3HKN A;  1G45 A;  2NNS A;  5DOH A;  4JSS A;  4LU3 A;  2EU2 A;  1I91 A;  3HKT A;  3U45 X;  1BN1 A;  1FR7 A;  4ZWZ A;  1RZC A;  2NN1 A;  1CAM A;  2Q1Q A;  1CZM A;  2CBB A;  1CAN A;  4QJM A;  5L3O A;  4L5V A;  3UYN A;  4HEZ A;  5FDC A;  5BRW A;  1HEB A;  3C7P A;  1CRA A;  1IF8 A;  3F8E A;  4PXX A;  1BNU A;  2WEG A;  2VVB X;  5SZ0 A;  4Q0L A;  4R59 A;  5G01 A;  1HED A;  3N4B A;  2IT4 A;  2OSF A;  3S72 B;  9CA2 A;  3W6H A;  2HD6 A;  1G46 A;  1AZM A;  1V9I C;  2NXS A;  4YGJ A;  4YWP A;  3M67 A;  4QSJ A;  3IEO A;  1LGD A;  1H9Q A;  2FOV A;  3FE4 A;  1CNK A;  4KNI A;  1RAZ A;  5E2S A;  2NWO A;  1ZSB A;  1UGE A;  1YO2 A;  1KOP A;  4Q7V A;  3BET A;  4Q8X A;  2CAB A;  1BNT A;  1G48 A;  5SZ6 A;  3RZ1 B;  5DOG A;  12CA A;  2Q38 A;  3T82 A;  4CNW A;  3T5U A;  4ILX A;  3RZ7 A;  3K34 A;  3S73 B;  2FNN A;  4PQ7 A;  4K13 A;  3KOI A;  4PYY A;  5SZ7 A;  4E3F A;  1G54 A;  4YYT A;  3DBU A;  4JSA A;  1CA3 A;  2W2J A;  1FQN A;  2QOA A;  4M2R A;  4RN4 A;  4Q99 A;  4Q83 A;  3RGE A;  5FL6 A;  3V3I B;  3V3F A;  1CNC A;  4Q49 A;  3RYX B;  1LZV A;  3RYJ B;  1CAK A;  1CVB A;  3BL0 A;  2NWY A;  1Z9Y A;  3HKU A;  2CBE A;  2WEO A;  4QY3 A;  2FW4 A;  1CAO A;  4BCW A;  5SZ5 A;  3MHI A;  3MNK A;  1CAI A;  2FOQ A;  4YHA A;  1YDD A;  5FNJ A;  3M2Z A;  4L5U A;  4Q7W A;  4Q78 A;  3M98 A;  3CA2 A;  1CCT A;  5LMD A;  4COQ A;  5JQT A;  1ZGF A;  1UGF A;  1CNH A;  1CA2 A;  4ZX1 A;  3RZ8 A;  5HPJ A;  1HEC A;  3P58 A;  4LHI A;  5SZ3 A;  3M5E A;  3P3H A;  3T5Z A;  1I8Z A;  1CNY A;  4HBA A;  1IF9 A;  3V3H B;  4XIW A;  4M2V A;  1HCB A;  1HVA A;  4K0S A;  4YGN A;  4TWM A;  4HT0 A;  4N0X B;  3P44 A;  3RG4 A;  4QJ0 A;  3IBU A;  4FPT A;  1BNW A;  4QJX A;  3KOK A;  1OKM A;  1RZD A;  1RZB A;  3QYK A;  3TVN X;  4LP6 A;  1KEQ A;  3S77 B;  1I9Q A;  4C3T A;  1G3Z A;  5FNL A;  3N3J A;  1CVH A;  2FNK A;  5FNH A;  5BRV A;  4YGK A;  2NNO A;  3PJJ A;  4KV0 A;  1OKL A;  1CAH A;  3M04 A;  1TB0 X;  3RYZ A;  4YXI A;  1Z97 A;  2WEH A;  3U47 A;  3RLD A;  1I9L A;  1YO1 A;  3DD0 A;  3V5G A;  1LUG A;  1CNI A;  3TVO X;  3M2X A;  4MLX A;  1ZH9 A;  5A6H A;  4CQ0 A;  1BN3 A;  1BNN A;  1UGB A;  3S8X A;  4KNJ A;  1CAJ A;  3S71 B;  3D0N A;  3MZC A;  3HLJ A;  4CNV A;  3SBH A;  2FMZ A;  1JD0 A;  4Y0J A;  3OIM A;  2VVA X;  1BV3 A;  5JGS B;  3MHC A;  4HT2 A;  4QK2 A;  3B1B A;  3W6I A;  5EIJ A;  1BIC A;  1XQ0 A;  4WUP A;  5DSN A;  5FL5 A;  4ITO A;  4Q87 A;  1CNX A;  3U3A X;  3OKU A;  1YDA A;  1ZGE A;  5DSM A;  3BL1 A;  3GZ0 A;  4R5A A;  4DZ9 A;  4K0T A;  1TTM A;  1TE3 X;  3JXG A;  3HFP A;  3JXF A;  5E5U A;  3M1W A;  4Z1J A;  5C8I A;  5SZ4 A;  3M1Q A;  3OKV A;  1TG3 A;  2POW A;  3MNH A;  1ZNC A;  2WD3 A;  1IF7 A;  4CA2 A;  3P55 A;  3OIK A;  5EH7 A;  2CA2 A;  4HEW A;  5DSL A;  5E2K A;  3VBD A;  3S9T A;  2FNM A;  4E3H A;  1UGG A;  4Q81 A;  2NNV A;  3V3J A;  4ZAO A;  4MDG A;  1EOU A;  2POV A;  3KKX A;  4R5B A;  3B4F A;  4YX4 A;  3D92 A;  3KLD B;  3RZ5 A;  4WUQ A;  5FLO A;  5SZ1 A;  4Q90 A;  1ZSA A;  5CLU A;  1I9O A;  1CVA A;  4HU1 A;  3IBN A;  1RJ5 A;  4RH2 A;  5E2R A;  4G7A A;  1G1D A;  4MDM A;  3M5S A;  4Q09 A;  1BNM A;  2CBC A;  3MDZ A;  1JV0 A;  3DC3 A;  4FRC A;  2ILI A;  4ZWX A;  6CA2 A;  5JDV B;  4Q06 A;  5A25 A;  3CZV A;  2HL4 A;  1DMY A;  4MTY A;  4KAP A;  4FL7 A;  1CVE A;  1DMX A;  3M2N A;  1LG5 A;  4KUY A;  4KNN A;  3DVC A;  3S76 A;  3Q31 A;  2HOC A;  1HEA A;  4YVY A;  4XE1 A;  3UYQ A;  3DA2 A;  3PYK A;  1MUA A;  3D93 A;  2CBD A;  2X7U A;  1CNJ A;  1F2W A;  4L5W A;  4PZH A;  1RAY A;  3F7U A;  1ZSC A;  3PO6 A;  5EHE A;  3SAP A;  4RUY A;  5BRU A;  3M1K A;  4XIX A;  8CA2 A;  3MWO A;  3CYU A;  5FLQ A;  1J9W A;  2NWZ A;  5G03 A;  3NB5 A;  3P5L A;  3K2F A;  3M5T A;  4KP5 A;  3S75 B;  5DRS A;  1CVD A;  1FSN A;  2F14 A;  3P5A A;  2GD8 A;  3T85 A;  1CCU A;  4HEY A;  5DSK A;  4WW8 A;  3MNU A;  1CCS A; 
#chains in the Genus database with same CATH homology
 5FNG A;  1CAY A;  4PYX A;  5JGT B;  1IF5 A;  5FLP A;  4Z0Q A;  1CIM A;  4XZ5 A;  5FNK A;  3DCW A;  1AM6 A;  3OYQ A;  2QO8 A;  3IBL A;  5FNM A;  1BNQ A;  2EZ7 A;  4RFD A;  1FR4 A;  5DSQ A;  2HFW A;  3IGP A;  1XPZ A;  4ZWI A;  3N2P A;  4N16 A;  7CA2 A;  4KUW A;  4Q6E A;  1TG9 A;  1BNV A;  3SBI A;  3TMJ A;  4WR7 A;  1CRM A;  1V9E A;  3P4V A;  5DSI A;  1FQR A;  1DCA A;  4Q8Y A;  5L6K A;  5EHW A;  2NN7 A;  1FQM A;  3RJ7 A;  2H4N A;  5CAC A;  5G0B A;  3F7B A;  1YDB A;  4RIU A;  5EZT X;  5JQ0 A;  5DVX A;  3RYY A;  3M96 A;  4FU5 A;  1BN4 A;  4QJP A;  4RUX A;  3N0N A;  1G4J A;  1TEQ X;  3MNA A;  2EU3 A;  3K7K A;  3R17 B;  1CNB A;  1G53 A;  4WL4 A;  5FL4 A;  4TWL A;  3V3G B;  1FSQ A;  5FNI A;  3D9Z A;  2FOS A;  3KON A;  4G0C A;  3MHL A;  4DZ7 A;  1OQ5 A;  5E28 A;  1HUH A;  1MOO A;  4IDR X;  3S74 B;  1AVN A;  1RZA A;  2NXT A;  4FVN A;  3RG3 A;  4UOV A;  1URT A;  1XEG A;  5JEH B;  2O4Z A;  4YGL A;  4QEF A;  1ZE8 A;  3MHO A;  3MMF A;  1BCD A;  5EKJ A;  1CNG A;  1T9N A;  1JCZ A;  2HNC A;  1KWQ A;  4QJW A;  4MLT A;  4Q9Y A;  4QSI A;  4M2U A;  3V2J A;  1IF6 A;  1ZFK A;  1DCB A;  4IWZ A;  3OY0 A;  3KIG A;  2AX2 A;  3MYQ A;  3P3J A;  2WD2 A;  5G0C A;  5BNL A;  2FOU A;  5FLS A;  4Q8Z A;  2Q1B A;  3R16 A;  2HKK A;  4Q7P A;  2X7S A;  4MDL A;  4RFC A;  4E3G A;  5SZ2 A;  1HCA A;  4RIV A;  1FQL A;  4YGF A;  3FFP X;  1KOQ A;  1G6V A;  1I90 A;  5E2M A;  4JSW A;  3S97 A;  1TBT X;  1G0E A;  3EFT A;  3IBI A;  3LXE A;  1RJ6 A;  3JXH C;  4QK1 A;  4K0Z A;  4YXO A;  1HUG A;  3DV7 A;  1THK A;  4QIY A;  1UGD A;  5BYI A;  5J8Z A;  4E5Q A;  3DD8 A;  4QJO A;  1Y7W A;  2GEH A;  1CNW A;  3DVD A;  3M2Y A;  2ABE A;  1BZM A;  3EFI A;  1I9M A;  4QSA A;  3T84 A;  5JG5 B;  5EOI A;  5EKH A;  2NNG A;  3FW3 A;  3MHM A;  3ML2 A;  4K1Q A;  3CAJ A;  3KWA A;  4Z1E A;  5CJF A;  2NMX A;  3MNJ A;  4Q08 A;  3M40 A;  4BF6 A;  4E4A A;  2NXR A;  5FLR A;  3DCS A;  4KNM A;  1H4N A;  3MNI A;  5FLT A;  1G4O A;  3RYV B;  5FDI A;  3F4X A;  4XFW A;  1IF4 A;  2AW1 A;  3HS4 A;  1I9P A;  1CIL A;  5EKM A;  3T83 A;  1TH9 A;  1Z93 A;  3OIL A;  2FMG A;  2FOY A;  1CIN A;  4Q6D A;  5DSO A;  1CAL A;  2X7T A;  5JEG B;  1TEU X;  3M14 A;  1YDC A;  3KNE A;  3DCC A;  4BF1 A;  3SAX A;  3M1J A;  1YO0 A;  5E2N A;  3L14 A;  4E3D A;  1G0F A;  4CNX A;  5JES B;  1A42 A;  3S78 B;  4E49 A;  1H9N A;  1KWR A;  4Q7S A;  4GL1 X;  3DVB A;  4JS6 A;  4WW6 A;  1G52 A;  1OKN A;  5DSR A;  4ZWY A;  3V7X A;  3RZ0 B;  5JG3 B;  1FSR A;  3ZNC A;  2H15 A;  5DSP A;  4CNR A;  4ITP A;  4CAC A;  1UGA A;  4QK3 A;  5JEP B;  4QSB A;  2QP6 A;  2ZNC A;  3DAZ A;  3IAI A;  4QTL A;  5E5R A;  3HKQ A;  3D8W A;  4FIK A;  3NI5 A;  1XEV A;  3M3X A;  3OYS A;  2CBA A;  3U7C A;  4MO8 A;  5AMG A;  4ZX0 A;  1ZFQ A;  1CAZ A;  1CVF A;  4KP8 A;  4Z1K A;  2NWP A;  5EH8 A;  1I9N A;  2WEJ A;  3DC9 A;  5EHV A;  4X5S A;  4YXU A;  4Z1N A;  4KUV A;  2POU A;  5AML A;  3KS3 A;  4QIZ A;  1UGC A;  5AMD A;  4M2W A;  1LG6 A;  4ETQ C;  4HF3 A;  1FLJ A;  3ML5 A;  1RZE A;  4E9O X;  2OSM A;  3NJ9 A;  4RUZ A;  5EH5 A;  4Q07 A;  5IPZ A;  3V2M A;  4JSZ A;  4FVO A;  3ZP9 A;  1CVC A;  5CA2 A;  5DSJ A;  3HKN A;  1G45 A;  2NNS A;  5DOH A;  4JSS A;  4LU3 A;  2EU2 A;  1I91 A;  3HKT A;  3U45 X;  1BN1 A;  1FR7 A;  4ZWZ A;  1RZC A;  2NN1 A;  1CAM A;  2Q1Q A;  1CZM A;  2CBB A;  1CAN A;  4QJM A;  5L3O A;  4L5V A;  3UYN A;  4HEZ A;  5FDC A;  5BRW A;  1HEB A;  3C7P A;  1CRA A;  1IF8 A;  3F8E A;  4PXX A;  1BNU A;  2WEG A;  2VVB X;  5SZ0 A;  4Q0L A;  4R59 A;  5G01 A;  1HED A;  3N4B A;  2IT4 A;  2OSF A;  3S72 B;  9CA2 A;  3W6H A;  2HD6 A;  1G46 A;  1AZM A;  1V9I C;  2NXS A;  4YGJ A;  4YWP A;  3M67 A;  4QSJ A;  3IEO A;  1LGD A;  1H9Q A;  2FOV A;  3FE4 A;  1CNK A;  4KNI A;  1RAZ A;  5E2S A;  2NWO A;  1ZSB A;  1UGE A;  1YO2 A;  1KOP A;  4Q7V A;  3BET A;  4Q8X A;  2CAB A;  1BNT A;  1G48 A;  5SZ6 A;  3RZ1 B;  5DOG A;  12CA A;  2Q38 A;  3T82 A;  4CNW A;  3T5U A;  4ILX A;  3RZ7 A;  3K34 A;  3S73 B;  2FNN A;  4PQ7 A;  4K13 A;  3KOI A;  4PYY A;  5SZ7 A;  4E3F A;  1G54 A;  4YYT A;  3DBU A;  4JSA A;  1CA3 A;  2W2J A;  1FQN A;  2QOA A;  4M2R A;  4RN4 A;  4Q99 A;  4Q83 A;  3RGE A;  5FL6 A;  3V3I B;  3V3F A;  1CNC A;  4Q49 A;  3RYX B;  1LZV A;  3RYJ B;  1CAK A;  1CVB A;  3BL0 A;  2NWY A;  1Z9Y A;  3HKU A;  2CBE A;  2WEO A;  4QY3 A;  2FW4 A;  1CAO A;  4BCW A;  5SZ5 A;  3MHI A;  3MNK A;  1CAI A;  2FOQ A;  4YHA A;  1YDD A;  5FNJ A;  3M2Z A;  4L5U A;  4Q7W A;  4Q78 A;  3M98 A;  3CA2 A;  1CCT A;  5LMD A;  4COQ A;  5JQT A;  1ZGF A;  1UGF A;  1CNH A;  1CA2 A;  4ZX1 A;  3RZ8 A;  5HPJ A;  1HEC A;  3P58 A;  4LHI A;  5SZ3 A;  3M5E A;  3P3H A;  3T5Z A;  1I8Z A;  1CNY A;  4HBA A;  1IF9 A;  3V3H B;  4XIW A;  4M2V A;  1HCB A;  1HVA A;  4K0S A;  4YGN A;  4TWM A;  4HT0 A;  4N0X B;  3P44 A;  3RG4 A;  4QJ0 A;  3IBU A;  4FPT A;  1BNW A;  4QJX A;  3KOK A;  1OKM A;  1RZD A;  1RZB A;  3QYK A;  3TVN X;  4LP6 A;  1KEQ A;  3S77 B;  1I9Q A;  4C3T A;  1G3Z A;  5FNL A;  3N3J A;  1CVH A;  2FNK A;  5FNH A;  5BRV A;  4YGK A;  2NNO A;  3PJJ A;  4KV0 A;  1OKL A;  1CAH A;  3M04 A;  1TB0 X;  3RYZ A;  4YXI A;  1Z97 A;  2WEH A;  3U47 A;  3RLD A;  1I9L A;  1YO1 A;  3DD0 A;  3V5G A;  1LUG A;  1CNI A;  3TVO X;  3M2X A;  4MLX A;  1ZH9 A;  5A6H A;  4CQ0 A;  1BN3 A;  1BNN A;  1UGB A;  3S8X A;  4KNJ A;  1CAJ A;  3S71 B;  3D0N A;  3MZC A;  3HLJ A;  4CNV A;  3SBH A;  2FMZ A;  1JD0 A;  4Y0J A;  3OIM A;  2VVA X;  1BV3 A;  5JGS B;  3MHC A;  4HT2 A;  4QK2 A;  3B1B A;  3W6I A;  5EIJ A;  1BIC A;  1XQ0 A;  4WUP A;  5DSN A;  5FL5 A;  4ITO A;  4Q87 A;  1CNX A;  3U3A X;  3OKU A;  1YDA A;  1ZGE A;  5DSM A;  3BL1 A;  3GZ0 A;  4R5A A;  4DZ9 A;  4K0T A;  1TTM A;  1TE3 X;  3JXG A;  3HFP A;  3JXF A;  5E5U A;  3M1W A;  4Z1J A;  5C8I A;  5SZ4 A;  3M1Q A;  3OKV A;  1TG3 A;  2POW A;  3MNH A;  1ZNC A;  2WD3 A;  1IF7 A;  4CA2 A;  3P55 A;  3OIK A;  5EH7 A;  2CA2 A;  4HEW A;  5DSL A;  5E2K A;  3VBD A;  3S9T A;  2FNM A;  4E3H A;  1UGG A;  4Q81 A;  2NNV A;  3V3J A;  4ZAO A;  4MDG A;  1EOU A;  2POV A;  3KKX A;  4R5B A;  3B4F A;  4YX4 A;  3D92 A;  3KLD B;  3RZ5 A;  4WUQ A;  5FLO A;  5SZ1 A;  4Q90 A;  1ZSA A;  5CLU A;  1I9O A;  1CVA A;  4HU1 A;  3IBN A;  1RJ5 A;  4RH2 A;  5E2R A;  4G7A A;  1G1D A;  4MDM A;  3M5S A;  4Q09 A;  1BNM A;  2CBC A;  3MDZ A;  1JV0 A;  3DC3 A;  4FRC A;  2ILI A;  4ZWX A;  6CA2 A;  5JDV B;  4Q06 A;  5A25 A;  3CZV A;  2HL4 A;  1DMY A;  4MTY A;  4KAP A;  4FL7 A;  1CVE A;  1DMX A;  3M2N A;  1LG5 A;  4KUY A;  4KNN A;  3DVC A;  3S76 A;  3Q31 A;  2HOC A;  1HEA A;  4YVY A;  4XE1 A;  3UYQ A;  3DA2 A;  3PYK A;  1MUA A;  3D93 A;  2CBD A;  2X7U A;  1CNJ A;  1F2W A;  4L5W A;  4PZH A;  1RAY A;  3F7U A;  1ZSC A;  3PO6 A;  5EHE A;  3SAP A;  4RUY A;  5BRU A;  3M1K A;  4XIX A;  8CA2 A;  3MWO A;  3CYU A;  5FLQ A;  1J9W A;  2NWZ A;  5G03 A;  3NB5 A;  3P5L A;  3K2F A;  3M5T A;  4KP5 A;  3S75 B;  5DRS A;  1CVD A;  1FSN A;  2F14 A;  3P5A A;  2GD8 A;  3T85 A;  1CCU A;  4HEY A;  5DSK A;  4WW8 A;  3MNU A;  1CCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...