1FQNA

X-ray crystal structure of metal-free f93i/f95m/w97v carbonic anhydrase (caii) variant
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
Knots found
sequence length
257
structure length
257
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQIHMHVGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords CARBONIC ANHYDRASE
publication title Structural influence of hydrophobic core residues on metal binding and specificity in carbonic anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 257
sequence length 257
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2000-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1fqnA00
4G7AA 3N0NA 5A25A 2FMZA 2WEJA 4LU3A 4KP8A 4XE1A 4Q49A 3W6HA 4ITPA 4K13A 1IF4A 1V9EA 1RAYA 1T9NA 3MHCA 3MNKA 5DOHA 5DSNA 3RG3A 4QK3A 4IDRX 1CRMA 1G53A 4YGJA 4MTYA 3V7XA 3HFPA 3V3GB 4DZ7A 1G1DA 3L14A 4M2VA 3RLDA 3F8EA 3EFIA 1IF8A 3Q31A 4N16A 4UOVA 4BF1A 12CAA 1Z9YA 4KUWA 5JGSB 3DVBA 5JESB 4KP5A 4RFCA 1CNBA 5CACA 4ZWIA 4CA2A 1UGBA 4R59A 3M5EA 4M2RA 1BN4A 5EKHA 5C8IA 4HBAA 1I90A 2FMGA 4QSIA 4JSWA 2HFWA 4E5QA 5JG3B 3BETA 5JG5B 4K0SA 2CBDA 1CCSA 1RJ5A 1UGDA 5DOGA 3N4BA 4PXXA 5FNJA 4YX4A 5EZTX 5FNMA 1I91A 3NI5A 1CA3A 3S78B 1G48A 4FVOA 3KIGA 3U47A 3DVCA 5EH7A 4CNVA 2FNNA 1LG5A 4Q6DA 5BRWA 2FNKA 5E2SA 3F7UA 1CINA 5SZ5A 4YGLA 3P4VA 1ZE8A 3RZ7A 3M1QA 2FOVA 2FOYA 1YDBA 4Q7PA 3OYSA 5BNLA 1YO1A 5DRSA 2CABA 5E5UA 4QK2A 3SAXA 1I9MA 3RZ0B 2POVA 1BNMA 5SZ4A 5JDVB 4HEZA 1ZH9A 1CALA 3KLDB 4YXUA 1IF7A 3PO6A 5BRVA 4MLTA 3T5UA 5E2MA 1RZAA 4QEFA 4QIZA 2ILIA 3DCWA 3RZ1B 1OKMA 1UGFA 4MDLA 3D9ZA 3MNHA 2NWYA 1TBTX 2NN1A 1G6VA 5CA2A 2EU3A 3HS4A 4Q83A 3KOIA 1CNWA 3M2ZA 4YXOA 5DSLA 5DSQA 5EH8A 3OY0A 4QJ0A 5JQTA 4Q9YA 3OYQA 3SBHA 1ZSCA 4Q99A 5G0CA 2WD3A 3M2NA 3QYKA 1RZBA 3D93A 1DCAA 1I9PA 4QSBA 1FSRA 1DCBA 1RAZA 2GD8A 1ZSAA 4YVYA 3S97A 4MDGA 1BNWA 3KONA 1CRAA 3P58A 5G0BA 3S75B 1CAMA 5G03A 4L5WA 4KAPA 1HUGA 2NMXA 1CAKA 1IF5A 4RUZA 4Q7VA 2HNCA 5FLSA 4M2WA 4KV0A 1CNKA 4QJPA 3M98A 3MHMA 1G46A 3M1WA 4RUYA 1I9LA 3V3JA 5FLRA 4KNNA 3MHLA 4Q7SA 5FNIA 5DSIA 1FQLA 4RUXA 1KOPA 2FOUA 2CA2A 2ZNCA 2QO8A 5J8ZA 2FOQA 1YDAA 4E4AA 3M67A 2EZ7A 1CVFA 1CVDA 1FQNA 3V3HB 1CNCA 4Q8YA 1BNNA 4K1QA 2CBAA 5E2RA 1CAHA 3KNEA 1AVNA 1HVAA 3DCSA 4K0TA 5FNGA 5SZ7A 3V5GA 5FLOA 4HU1A 4QSAA 3RZ8A 2POWA 1G0FA 1CVCA 1ZGFA 4R5AA 1TB0X 4E3FA 1FSNA 3DD8A 5CJFA 3T5ZA 1OKLA 4E3GA 3OKUA 2NXRA 2WEHA 5FNKA 5SZ6A 3OIKA 1Z97A 5DSOA 3V2MA 3PJJA 2NNVA 3KOKA 4ITOA 3V3FA 4MDMA 4PQ7A 5E28A 3MZCA 1YDCA 3M2YA 1UGAA 1RJ6A 1UGGA 3S73B 2H4NA 5FNLA 1TH9A 3IBNA 4ZWYA 1BNTA 1H9NA 5BYIA 3S9TA 4FRCA 1CNYA 3EFTA 1HEDA 3R17B 5FL4A 3RYVB 5EHWA 2HOCA 1IF6A 3IBIA 1CNJA 2NWPA 3P3HA 3RG4A 1CAIA 4N0XB 8CA2A 1CZMA 5AMLA 1HUHA 3MDZA 4ZWXA 4XFWA 3SBIA 4HEWA 1CANA 5FLQA 2WEOA 1MUAA 3M04A 4L5UA 5JEHB 4Q7WA 3DAZA 4Q06A 3UYQA 1BNUA 3HKTA 5DVXA 1CAZA 2FOSA 1CVAA 3S8XA 1CIMA 1CILA 1BNVA 4FPTA 9CA2A 1YDDA 1CCTA 1XPZA 1G4JA 3MMFA 3P44A 5E2KA 3VBDA 4Z1JA 5DSJA 3U3AX 3OKVA 1ZFKA 3RGEA 1CAOA 4Q0LA 4QJOA 4Q08A 4ETQC 3RYXB 3TVNX 3DCCA 3TVOX 3JXGA 4CNXA 3F4XA 4FU5A 5AMGA 3P5AA 3W6IA 4HT0A 4X5SA 1EOUA 4FVNA 3D8WA 2NNOA 5DSMA 4C3TA 3HLJA 4M2UA 1CAYA 1YO0A 1CVBA 1LUGA 3LXEA 4KNMA 3DC3A 3JXHC 1TE3X 3D92A 3SAPA 4CACA 4DZ9A 5E5RA 3JXFA 2FW4A 4COQA 1CNXA 5EKMA 3S77B 2QOAA 4PYYA 5JGTB 3GZ0A 1IF9A 4Z1EA 2OSFA 4LHIA 1RZDA 3P5LA 1I9OA 4YXIA 1G54A 4K0ZA 1RZEA 5DSRA 1Y7WA 3PYKA 3M1JA 2IT4A 1YO2A 1OKNA 3S71B 1G52A 4YGFA 1BZMA 3MNUA 3N2PA 4JSSA 1H9QA 3CA2A 3ML2A 4CNWA 1F2WA 3R16A 4Z0QA 4RIVA 5L6KA 1JD0A 2Q1BA 3M40A 4CQ0A 1G4OA 3M5TA 3MHOA 3V2JA 2NNGA 4RFDA 3M1KA 3BL1A 2VVBX 1KWQA 3N3JA 1G3ZA 3ZNCA 4QIYA 4QSJA 3DC9A 5SZ3A 3KWAA 1CNHA 4GL1X 4KNIA 3MNAA 4WR7A 4QTLA 4E3DA 1TG3A 4HT2A 4Z1KA 4YWPA 3ZP9A 4PYXA 4JSAA 3M3XA 1DMXA 3BL0A 4BF6A 3V3IB 4RIUA 3DD0A 3KKXA 1CCUA 3DV7A 4WL4A 3IEOA 5CLUA 3MHIA 3D0NA 5LMDA 3NJ9A 5FDCA 4RH2A 1FSQA 4KUVA 4WUQA 2VVAX 2Q1QA 2HD6A 4RN4A 5SZ0A 2EU2A 3M5SA 3M96A 3HKQA 3RJ7A 1FR7A 1BN1A 3S76A 1KWRA 1BNQA 4TWLA 1ZNCA 4E3HA 1KOQA 3F7BA 4Q6EA 5EHEA 3CYUA 1I8ZA 4MLXA 2X7TA 3S74B 1J9WA 3RYJB 3T83A 5JQ0A 1JCZA 3P3JA 3KS3A 4KNJA 1UGCA 4E9OX 4WW6A 5EKJA 3T82A 3FFPX 3RYYA 1ZGEA 3P55A 4LP6A 2OSMA 3C7PA 3U45X 4QJMA 1TEUX 5JEGB 4XZ5A 4Q87A 2O4ZA 5HPJA 1FQMA 3RYZA 1THKA 4ZWZA 5AMDA 2X7UA 2NXTA 4ZX1A 1AM6A 3M2XA 1V9IC 1HECA 5EHVA 1BV3A 5JEPB 5SZ2A 5EIJA 3B1BA 2GEHA 4FL7A 2HKKA 1I9QA 2ABEA 2WEGA 1RZCA 3DVDA 4Q8ZA 3U7CA 1AZMA 3OIMA 2FNMA 2NWZA 2NXSA 4Y0JA 5SZ1A 2F14A 3FE4A 3IAIA 4IWZA 1LGDA 4R5BA 4QJWA 3MYQA 4FIKA 1KEQA 3K34A 4Q90A 3DBUA 1JV0A 1ZSBA 5FDIA 4ZX0A 4YYTA 5FL6A 4KUYA 5E2NA 1CNGA 1CAJA 4CNRA 5FNHA 1G0EA 1LZVA 4ZAOA 3IGPA 3UYNA 1BICA 3T85A 3OILA 5FL5A 2CBBA 5DSPA 2QP6A 2H15A 4WW8A 4WUPA 4Q78A 3M14A 4XIWA 3K2FA 2AX2A 4MO8A 5IPZA 1Z93A 1BCDA 2NN7A 4Z1NA 5EH5A 3HKUA 4YGKA 7CA2A 1BN3A 1URTA 2WD2A 1FQRA 3K7KA 4JSZA 3CZVA 1ZFQA 1G45A 2NNSA 4PZHA 4QK1A 1FR4A 4YHAA 5BRUA 3NB5A 3RZ5A 5FLPA 3MNJA 1XEGA 4BCWA 4G0CA 5G01A 3FW3A 1CVHA 1FLJA 1A42A 1XEVA 2HL4A 3IBLA 4HF3A 1CVEA 3S72B 5L3OA 3TMJA 4YGNA 1I9NA 1HCBA 1HCAA 5FLTA 1LG6A 2CBCA 2AW1A 3MWOA 1CNIA 4Q8XA 5DSKA 2NWOA 1TG9A 2X7SA 3B4FA 5EOIA 2POUA 3DA2A 1H4NA 2CBEA 4JS6A 3CAJA 4QY3A 4XIXA 4HEYA 3MNIA 4E49A 1XQ0A 2W2JA 4ILXA 4L5VA 3IBUA 6CA2A 4QJXA 3T84A 1TTMA 1DMYA 3ML5A 5A6HA 4Q81A 1HEAA 1CA2A 1HEBA 1TEQX 1OQ5A 1MOOA 3HKNA 2Q38A 4Q07A 1UGEA 4TWMA 4Q09A
chains in the Genus database with same CATH superfamily
4G7AA 3N0NA 5A25A 2FMZA 2WEJA 4LU3A 4KP8A 4XE1A 4Q49A 3W6HA 4ITPA 4K13A 1IF4A 1V9EA 1RAYA 1T9NA 3MHCA 3MNKA 5DOHA 5DSNA 3RG3A 4QK3A 4IDRX 1CRMA 1G53A 4YGJA 4MTYA 3V7XA 3HFPA 3V3GB 4DZ7A 1G1DA 3L14A 4M2VA 3RLDA 3F8EA 3EFIA 1IF8A 3Q31A 4N16A 4UOVA 4BF1A 12CAA 1Z9YA 4KUWA 5JGSB 3DVBA 5JESB 4KP5A 4RFCA 1CNBA 5CACA 4ZWIA 4CA2A 1UGBA 4R59A 3M5EA 4M2RA 1BN4A 5EKHA 5C8IA 4HBAA 1I90A 2FMGA 4QSIA 4JSWA 2HFWA 4E5QA 5JG3B 3BETA 5JG5B 4K0SA 2CBDA 1CCSA 1RJ5A 1UGDA 5DOGA 3N4BA 4PXXA 5FNJA 4YX4A 5EZTX 5FNMA 1I91A 3NI5A 1CA3A 3S78B 1G48A 4FVOA 3KIGA 3U47A 3DVCA 5EH7A 4CNVA 2FNNA 1LG5A 4Q6DA 5BRWA 2FNKA 5E2SA 3F7UA 1CINA 5SZ5A 4YGLA 3P4VA 1ZE8A 3RZ7A 3M1QA 2FOVA 2FOYA 1YDBA 4Q7PA 3OYSA 5BNLA 1YO1A 5DRSA 2CABA 5E5UA 4QK2A 3SAXA 1I9MA 3RZ0B 2POVA 1BNMA 5SZ4A 5JDVB 4HEZA 1ZH9A 1CALA 3KLDB 4YXUA 1IF7A 3PO6A 5BRVA 4MLTA 3T5UA 5E2MA 1RZAA 4QEFA 4QIZA 2ILIA 3DCWA 3RZ1B 1OKMA 1UGFA 4MDLA 3D9ZA 3MNHA 2NWYA 1TBTX 2NN1A 1G6VA 5CA2A 2EU3A 3HS4A 4Q83A 3KOIA 1CNWA 3M2ZA 4YXOA 5DSLA 5DSQA 5EH8A 3OY0A 4QJ0A 5JQTA 4Q9YA 3OYQA 3SBHA 1ZSCA 4Q99A 5G0CA 2WD3A 3M2NA 3QYKA 1RZBA 3D93A 1DCAA 1I9PA 4QSBA 1FSRA 1DCBA 1RAZA 2GD8A 1ZSAA 4YVYA 3S97A 4MDGA 1BNWA 3KONA 1CRAA 3P58A 5G0BA 3S75B 1CAMA 5G03A 4L5WA 4KAPA 1HUGA 2NMXA 1CAKA 1IF5A 4RUZA 4Q7VA 2HNCA 5FLSA 4M2WA 4KV0A 1CNKA 4QJPA 3M98A 3MHMA 1G46A 3M1WA 4RUYA 1I9LA 3V3JA 5FLRA 4KNNA 3MHLA 4Q7SA 5FNIA 5DSIA 1FQLA 4RUXA 1KOPA 2FOUA 2CA2A 2ZNCA 2QO8A 5J8ZA 2FOQA 1YDAA 4E4AA 3M67A 2EZ7A 1CVFA 1CVDA 1FQNA 3V3HB 1CNCA 4Q8YA 1BNNA 4K1QA 2CBAA 5E2RA 1CAHA 3KNEA 1AVNA 1HVAA 3DCSA 4K0TA 5FNGA 5SZ7A 3V5GA 5FLOA 4HU1A 4QSAA 3RZ8A 2POWA 1G0FA 1CVCA 1ZGFA 4R5AA 1TB0X 4E3FA 1FSNA 3DD8A 5CJFA 3T5ZA 1OKLA 4E3GA 3OKUA 2NXRA 2WEHA 5FNKA 5SZ6A 3OIKA 1Z97A 5DSOA 3V2MA 3PJJA 2NNVA 3KOKA 4ITOA 3V3FA 4MDMA 4PQ7A 5E28A 3MZCA 1YDCA 3M2YA 1UGAA 1RJ6A 1UGGA 3S73B 2H4NA 5FNLA 1TH9A 3IBNA 4ZWYA 1BNTA 1H9NA 5BYIA 3S9TA 4FRCA 1CNYA 3EFTA 1HEDA 3R17B 5FL4A 3RYVB 5EHWA 2HOCA 1IF6A 3IBIA 1CNJA 2NWPA 3P3HA 3RG4A 1CAIA 4N0XB 8CA2A 1CZMA 5AMLA 1HUHA 3MDZA 4ZWXA 4XFWA 3SBIA 4HEWA 1CANA 5FLQA 2WEOA 1MUAA 3M04A 4L5UA 5JEHB 4Q7WA 3DAZA 4Q06A 3UYQA 1BNUA 3HKTA 5DVXA 1CAZA 2FOSA 1CVAA 3S8XA 1CIMA 1CILA 1BNVA 4FPTA 9CA2A 1YDDA 1CCTA 1XPZA 1G4JA 3MMFA 3P44A 5E2KA 3VBDA 4Z1JA 5DSJA 3U3AX 3OKVA 1ZFKA 3RGEA 1CAOA 4Q0LA 4QJOA 4Q08A 4ETQC 3RYXB 3TVNX 3DCCA 3TVOX 3JXGA 4CNXA 3F4XA 4FU5A 5AMGA 3P5AA 3W6IA 4HT0A 4X5SA 1EOUA 4FVNA 3D8WA 2NNOA 5DSMA 4C3TA 3HLJA 4M2UA 1CAYA 1YO0A 1CVBA 1LUGA 3LXEA 4KNMA 3DC3A 3JXHC 1TE3X 3D92A 3SAPA 4CACA 4DZ9A 5E5RA 3JXFA 2FW4A 4COQA 1CNXA 5EKMA 3S77B 2QOAA 4PYYA 5JGTB 3GZ0A 1IF9A 4Z1EA 2OSFA 4LHIA 1RZDA 3P5LA 1I9OA 4YXIA 1G54A 4K0ZA 1RZEA 5DSRA 1Y7WA 3PYKA 3M1JA 2IT4A 1YO2A 1OKNA 3S71B 1G52A 4YGFA 1BZMA 3MNUA 3N2PA 4JSSA 1H9QA 3CA2A 3ML2A 4CNWA 1F2WA 3R16A 4Z0QA 4RIVA 5L6KA 1JD0A 2Q1BA 3M40A 4CQ0A 1G4OA 3M5TA 3MHOA 3V2JA 2NNGA 4RFDA 3M1KA 3BL1A 2VVBX 1KWQA 3N3JA 1G3ZA 3ZNCA 4QIYA 4QSJA 3DC9A 5SZ3A 3KWAA 1CNHA 4GL1X 4KNIA 3MNAA 4WR7A 4QTLA 4E3DA 1TG3A 4HT2A 4Z1KA 4YWPA 3ZP9A 4PYXA 4JSAA 3M3XA 1DMXA 3BL0A 4BF6A 3V3IB 4RIUA 3DD0A 3KKXA 1CCUA 3DV7A 4WL4A 3IEOA 5CLUA 3MHIA 3D0NA 5LMDA 3NJ9A 5FDCA 4RH2A 1FSQA 4KUVA 4WUQA 2VVAX 2Q1QA 2HD6A 4RN4A 5SZ0A 2EU2A 3M5SA 3M96A 3HKQA 3RJ7A 1FR7A 1BN1A 3S76A 1KWRA 1BNQA 4TWLA 1ZNCA 4E3HA 1KOQA 3F7BA 4Q6EA 5EHEA 3CYUA 1I8ZA 4MLXA 2X7TA 3S74B 1J9WA 3RYJB 3T83A 5JQ0A 1JCZA 3P3JA 3KS3A 4KNJA 1UGCA 4E9OX 4WW6A 5EKJA 3T82A 3FFPX 3RYYA 1ZGEA 3P55A 4LP6A 2OSMA 3C7PA 3U45X 4QJMA 1TEUX 5JEGB 4XZ5A 4Q87A 2O4ZA 5HPJA 1FQMA 3RYZA 1THKA 4ZWZA 5AMDA 2X7UA 2NXTA 4ZX1A 1AM6A 3M2XA 1V9IC 1HECA 5EHVA 1BV3A 5JEPB 5SZ2A 5EIJA 3B1BA 2GEHA 4FL7A 2HKKA 1I9QA 2ABEA 2WEGA 1RZCA 3DVDA 4Q8ZA 3U7CA 1AZMA 3OIMA 2FNMA 2NWZA 2NXSA 4Y0JA 5SZ1A 2F14A 3FE4A 3IAIA 4IWZA 1LGDA 4R5BA 4QJWA 3MYQA 4FIKA 1KEQA 3K34A 4Q90A 3DBUA 1JV0A 1ZSBA 5FDIA 4ZX0A 4YYTA 5FL6A 4KUYA 5E2NA 1CNGA 1CAJA 4CNRA 5FNHA 1G0EA 1LZVA 4ZAOA 3IGPA 3UYNA 1BICA 3T85A 3OILA 5FL5A 2CBBA 5DSPA 2QP6A 2H15A 4WW8A 4WUPA 4Q78A 3M14A 4XIWA 3K2FA 2AX2A 4MO8A 5IPZA 1Z93A 1BCDA 2NN7A 4Z1NA 5EH5A 3HKUA 4YGKA 7CA2A 1BN3A 1URTA 2WD2A 1FQRA 3K7KA 4JSZA 3CZVA 1ZFQA 1G45A 2NNSA 4PZHA 4QK1A 1FR4A 4YHAA 5BRUA 3NB5A 3RZ5A 5FLPA 3MNJA 1XEGA 4BCWA 4G0CA 5G01A 3FW3A 1CVHA 1FLJA 1A42A 1XEVA 2HL4A 3IBLA 4HF3A 1CVEA 3S72B 5L3OA 3TMJA 4YGNA 1I9NA 1HCBA 1HCAA 5FLTA 1LG6A 2CBCA 2AW1A 3MWOA 1CNIA 4Q8XA 5DSKA 2NWOA 1TG9A 2X7SA 3B4FA 5EOIA 2POUA 3DA2A 1H4NA 2CBEA 4JS6A 3CAJA 4QY3A 4XIXA 4HEYA 3MNIA 4E49A 1XQ0A 2W2JA 4ILXA 4L5VA 3IBUA 6CA2A 4QJXA 3T84A 1TTMA 1DMYA 3ML5A 5A6HA 4Q81A 1HEAA 1CA2A 1HEBA 1TEQX 1OQ5A 1MOOA 3HKNA 2Q38A 4Q07A 1UGEA 4TWMA 4Q09A
chains in the Genus database with same CATH topology
4G7AA 3N0NA 5A25A 2FMZA 2WEJA 4LU3A 4KP8A 4XE1A 4Q49A 3W6HA 4ITPA 4K13A 1IF4A 1V9EA 1RAYA 1T9NA 3MHCA 3MNKA 5DOHA 5DSNA 3RG3A 4QK3A 4IDRX 1CRMA 1G53A 4YGJA 4MTYA 3V7XA 3HFPA 3V3GB 4DZ7A 1G1DA 3L14A 4M2VA 3RLDA 3F8EA 3EFIA 1IF8A 3Q31A 4N16A 4UOVA 4BF1A 12CAA 1Z9YA 4KUWA 5JGSB 3DVBA 5JESB 4KP5A 4RFCA 1CNBA 5CACA 4ZWIA 4CA2A 1UGBA 4R59A 3M5EA 4M2RA 1BN4A 5EKHA 5C8IA 4HBAA 1I90A 2FMGA 4QSIA 4JSWA 2HFWA 4E5QA 5JG3B 3BETA 5JG5B 4K0SA 2CBDA 1CCSA 1RJ5A 1UGDA 5DOGA 3N4BA 4PXXA 5FNJA 4YX4A 5EZTX 5FNMA 1I91A 3NI5A 1CA3A 3S78B 1G48A 4FVOA 3KIGA 3U47A 3DVCA 5EH7A 4CNVA 2FNNA 1LG5A 4Q6DA 5BRWA 2FNKA 5E2SA 3F7UA 1CINA 5SZ5A 4YGLA 3P4VA 1ZE8A 3RZ7A 3M1QA 2FOVA 2FOYA 1YDBA 4Q7PA 3OYSA 5BNLA 1YO1A 5DRSA 2CABA 5E5UA 4QK2A 3SAXA 1I9MA 3RZ0B 2POVA 1BNMA 5SZ4A 5JDVB 4HEZA 1ZH9A 1CALA 3KLDB 4YXUA 1IF7A 3PO6A 5BRVA 4MLTA 3T5UA 5E2MA 1RZAA 4QEFA 4QIZA 2ILIA 3DCWA 3RZ1B 1OKMA 1UGFA 4MDLA 3D9ZA 3MNHA 2NWYA 1TBTX 2NN1A 1G6VA 5CA2A 2EU3A 3HS4A 4Q83A 3KOIA 1CNWA 3M2ZA 4YXOA 5DSLA 5DSQA 5EH8A 3OY0A 4QJ0A 5JQTA 4Q9YA 3OYQA 3SBHA 1ZSCA 4Q99A 5G0CA 2WD3A 3M2NA 3QYKA 1RZBA 3D93A 1DCAA 1I9PA 4QSBA 1FSRA 1DCBA 1RAZA 2GD8A 1ZSAA 4YVYA 3S97A 4MDGA 1BNWA 3KONA 1CRAA 3P58A 5G0BA 3S75B 1CAMA 5G03A 4L5WA 4KAPA 1HUGA 2NMXA 1CAKA 1IF5A 4RUZA 4Q7VA 2HNCA 5FLSA 4M2WA 4KV0A 1CNKA 4QJPA 3M98A 3MHMA 1G46A 3M1WA 4RUYA 1I9LA 3V3JA 5FLRA 4KNNA 3MHLA 4Q7SA 5FNIA 5DSIA 1FQLA 4RUXA 1KOPA 2FOUA 2CA2A 2ZNCA 2QO8A 5J8ZA 2FOQA 1YDAA 4E4AA 3M67A 2EZ7A 1CVFA 1CVDA 1FQNA 3V3HB 1CNCA 4Q8YA 1BNNA 4K1QA 2CBAA 5E2RA 1CAHA 3KNEA 1AVNA 1HVAA 3DCSA 4K0TA 5FNGA 5SZ7A 3V5GA 5FLOA 4HU1A 4QSAA 3RZ8A 2POWA 1G0FA 1CVCA 1ZGFA 4R5AA 1TB0X 4E3FA 1FSNA 3DD8A 5CJFA 3T5ZA 1OKLA 4E3GA 3OKUA 2NXRA 2WEHA 5FNKA 5SZ6A 3OIKA 1Z97A 5DSOA 3V2MA 3PJJA 2NNVA 3KOKA 4ITOA 3V3FA 4MDMA 4PQ7A 5E28A 3MZCA 1YDCA 3M2YA 1UGAA 1RJ6A 1UGGA 3S73B 2H4NA 5FNLA 1TH9A 3IBNA 4ZWYA 1BNTA 1H9NA 5BYIA 3S9TA 4FRCA 1CNYA 3EFTA 1HEDA 3R17B 5FL4A 3RYVB 5EHWA 2HOCA 1IF6A 3IBIA 1CNJA 2NWPA 3P3HA 3RG4A 1CAIA 4N0XB 8CA2A 1CZMA 5AMLA 1HUHA 3MDZA 4ZWXA 4XFWA 3SBIA 4HEWA 1CANA 5FLQA 2WEOA 1MUAA 3M04A 4L5UA 5JEHB 4Q7WA 3DAZA 4Q06A 3UYQA 1BNUA 3HKTA 5DVXA 1CAZA 2FOSA 1CVAA 3S8XA 1CIMA 1CILA 1BNVA 4FPTA 9CA2A 1YDDA 1CCTA 1XPZA 1G4JA 3MMFA 3P44A 5E2KA 3VBDA 4Z1JA 5DSJA 3U3AX 3OKVA 1ZFKA 3RGEA 1CAOA 4Q0LA 4QJOA 4Q08A 4ETQC 3RYXB 3TVNX 3DCCA 3TVOX 3JXGA 4CNXA 3F4XA 4FU5A 5AMGA 3P5AA 3W6IA 4HT0A 4X5SA 1EOUA 4FVNA 3D8WA 2NNOA 5DSMA 4C3TA 3HLJA 4M2UA 1CAYA 1YO0A 1CVBA 1LUGA 3LXEA 4KNMA 3DC3A 3JXHC 1TE3X 3D92A 3SAPA 4CACA 4DZ9A 5E5RA 3JXFA 2FW4A 4COQA 1CNXA 5EKMA 3S77B 2QOAA 4PYYA 5JGTB 3GZ0A 1IF9A 4Z1EA 2OSFA 4LHIA 1RZDA 3P5LA 1I9OA 4YXIA 1G54A 4K0ZA 1RZEA 5DSRA 1Y7WA 3PYKA 3M1JA 2IT4A 1YO2A 1OKNA 3S71B 1G52A 4YGFA 1BZMA 3MNUA 3N2PA 4JSSA 1H9QA 3CA2A 3ML2A 4CNWA 1F2WA 3R16A 4Z0QA 4RIVA 5L6KA 1JD0A 2Q1BA 3M40A 4CQ0A 1G4OA 3M5TA 3MHOA 3V2JA 2NNGA 4RFDA 3M1KA 3BL1A 2VVBX 1KWQA 3N3JA 1G3ZA 3ZNCA 4QIYA 4QSJA 3DC9A 5SZ3A 3KWAA 1CNHA 4GL1X 4KNIA 3MNAA 4WR7A 4QTLA 4E3DA 1TG3A 4HT2A 4Z1KA 4YWPA 3ZP9A 4PYXA 4JSAA 3M3XA 1DMXA 3BL0A 4BF6A 3V3IB 4RIUA 3DD0A 3KKXA 1CCUA 3DV7A 4WL4A 3IEOA 5CLUA 3MHIA 3D0NA 5LMDA 3NJ9A 5FDCA 4RH2A 1FSQA 4KUVA 4WUQA 2VVAX 2Q1QA 2HD6A 4RN4A 5SZ0A 2EU2A 3M5SA 3M96A 3HKQA 3RJ7A 1FR7A 1BN1A 3S76A 1KWRA 1BNQA 4TWLA 1ZNCA 4E3HA 1KOQA 3F7BA 4Q6EA 5EHEA 3CYUA 1I8ZA 4MLXA 2X7TA 3S74B 1J9WA 3RYJB 3T83A 5JQ0A 1JCZA 3P3JA 3KS3A 4KNJA 1UGCA 4E9OX 4WW6A 5EKJA 3T82A 3FFPX 3RYYA 1ZGEA 3P55A 4LP6A 2OSMA 3C7PA 3U45X 4QJMA 1TEUX 5JEGB 4XZ5A 4Q87A 2O4ZA 5HPJA 1FQMA 3RYZA 1THKA 4ZWZA 5AMDA 2X7UA 2NXTA 4ZX1A 1AM6A 3M2XA 1V9IC 1HECA 5EHVA 1BV3A 5JEPB 5SZ2A 5EIJA 3B1BA 2GEHA 4FL7A 2HKKA 1I9QA 2ABEA 2WEGA 1RZCA 3DVDA 4Q8ZA 3U7CA 1AZMA 3OIMA 2FNMA 2NWZA 2NXSA 4Y0JA 5SZ1A 2F14A 3FE4A 3IAIA 4IWZA 1LGDA 4R5BA 4QJWA 3MYQA 4FIKA 1KEQA 3K34A 4Q90A 3DBUA 1JV0A 1ZSBA 5FDIA 4ZX0A 4YYTA 5FL6A 4KUYA 5E2NA 1CNGA 1CAJA 4CNRA 5FNHA 1G0EA 1LZVA 4ZAOA 3IGPA 3UYNA 1BICA 3T85A 3OILA 5FL5A 2CBBA 5DSPA 2QP6A 2H15A 4WW8A 4WUPA 4Q78A 3M14A 4XIWA 3K2FA 2AX2A 4MO8A 5IPZA 1Z93A 1BCDA 2NN7A 4Z1NA 5EH5A 3HKUA 4YGKA 7CA2A 1BN3A 1URTA 2WD2A 1FQRA 3K7KA 4JSZA 3CZVA 1ZFQA 1G45A 2NNSA 4PZHA 4QK1A 1FR4A 4YHAA 5BRUA 3NB5A 3RZ5A 5FLPA 3MNJA 1XEGA 4BCWA 4G0CA 5G01A 3FW3A 1CVHA 1FLJA 1A42A 1XEVA 2HL4A 3IBLA 4HF3A 1CVEA 3S72B 5L3OA 3TMJA 4YGNA 1I9NA 1HCBA 1HCAA 5FLTA 1LG6A 2CBCA 2AW1A 3MWOA 1CNIA 4Q8XA 5DSKA 2NWOA 1TG9A 2X7SA 3B4FA 5EOIA 2POUA 3DA2A 1H4NA 2CBEA 4JS6A 3CAJA 4QY3A 4XIXA 4HEYA 3MNIA 4E49A 1XQ0A 2W2JA 4ILXA 4L5VA 3IBUA 6CA2A 4QJXA 3T84A 1TTMA 1DMYA 3ML5A 5A6HA 4Q81A 1HEAA 1CA2A 1HEBA 1TEQX 1OQ5A 1MOOA 3HKNA 2Q38A 4Q07A 1UGEA 4TWMA 4Q09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7A A;  3N0N A;  5A25 A;  2FMZ A;  2WEJ A;  4LU3 A;  4KP8 A;  4XE1 A;  4Q49 A;  3W6H A;  4ITP A;  4K13 A;  1IF4 A;  1V9E A;  1RAY A;  1T9N A;  3MHC A;  3MNK A;  5DOH A;  5DSN A;  3RG3 A;  4QK3 A;  4IDR X;  1CRM A;  1G53 A;  4YGJ A;  4MTY A;  3V7X A;  3HFP A;  3V3G B;  4DZ7 A;  1G1D A;  3L14 A;  4M2V A;  3RLD A;  3F8E A;  3EFI A;  1IF8 A;  3Q31 A;  4N16 A;  4UOV A;  4BF1 A;  12CA A;  1Z9Y A;  4KUW A;  5JGS B;  3DVB A;  5JES B;  4KP5 A;  4RFC A;  1CNB A;  5CAC A;  4ZWI A;  4CA2 A;  1UGB A;  4R59 A;  3M5E A;  4M2R A;  1BN4 A;  5EKH A;  5C8I A;  4HBA A;  1I90 A;  2FMG A;  4QSI A;  4JSW A;  2HFW A;  4E5Q A;  5JG3 B;  3BET A;  5JG5 B;  4K0S A;  2CBD A;  1CCS A;  1RJ5 A;  1UGD A;  5DOG A;  3N4B A;  4PXX A;  5FNJ A;  4YX4 A;  5EZT X;  5FNM A;  1I91 A;  3NI5 A;  1CA3 A;  3S78 B;  1G48 A;  4FVO A;  3KIG A;  3U47 A;  3DVC A;  5EH7 A;  4CNV A;  2FNN A;  1LG5 A;  4Q6D A;  5BRW A;  2FNK A;  5E2S A;  3F7U A;  1CIN A;  5SZ5 A;  4YGL A;  3P4V A;  1ZE8 A;  3RZ7 A;  3M1Q A;  2FOV A;  2FOY A;  1YDB A;  4Q7P A;  3OYS A;  5BNL A;  1YO1 A;  5DRS A;  2CAB A;  5E5U A;  4QK2 A;  3SAX A;  1I9M A;  3RZ0 B;  2POV A;  1BNM A;  5SZ4 A;  5JDV B;  4HEZ A;  1ZH9 A;  1CAL A;  3KLD B;  4YXU A;  1IF7 A;  3PO6 A;  5BRV A;  4MLT A;  3T5U A;  5E2M A;  1RZA A;  4QEF A;  4QIZ A;  2ILI A;  3DCW A;  3RZ1 B;  1OKM A;  1UGF A;  4MDL A;  3D9Z A;  3MNH A;  2NWY A;  1TBT X;  2NN1 A;  1G6V A;  5CA2 A;  2EU3 A;  3HS4 A;  4Q83 A;  3KOI A;  1CNW A;  3M2Z A;  4YXO A;  5DSL A;  5DSQ A;  5EH8 A;  3OY0 A;  4QJ0 A;  5JQT A;  4Q9Y A;  3OYQ A;  3SBH A;  1ZSC A;  4Q99 A;  5G0C A;  2WD3 A;  3M2N A;  3QYK A;  1RZB A;  3D93 A;  1DCA A;  1I9P A;  4QSB A;  1FSR A;  1DCB A;  1RAZ A;  2GD8 A;  1ZSA A;  4YVY A;  3S97 A;  4MDG A;  1BNW A;  3KON A;  1CRA A;  3P58 A;  5G0B A;  3S75 B;  1CAM A;  5G03 A;  4L5W A;  4KAP A;  1HUG A;  2NMX A;  1CAK A;  1IF5 A;  4RUZ A;  4Q7V A;  2HNC A;  5FLS A;  4M2W A;  4KV0 A;  1CNK A;  4QJP A;  3M98 A;  3MHM A;  1G46 A;  3M1W A;  4RUY A;  1I9L A;  3V3J A;  5FLR A;  4KNN A;  3MHL A;  4Q7S A;  5FNI A;  5DSI A;  1FQL A;  4RUX A;  1KOP A;  2FOU A;  2CA2 A;  2ZNC A;  2QO8 A;  5J8Z A;  2FOQ A;  1YDA A;  4E4A A;  3M67 A;  2EZ7 A;  1CVF A;  1CVD A;  1FQN A;  3V3H B;  1CNC A;  4Q8Y A;  1BNN A;  4K1Q A;  2CBA A;  5E2R A;  1CAH A;  3KNE A;  1AVN A;  1HVA A;  3DCS A;  4K0T A;  5FNG A;  5SZ7 A;  3V5G A;  5FLO A;  4HU1 A;  4QSA A;  3RZ8 A;  2POW A;  1G0F A;  1CVC A;  1ZGF A;  4R5A A;  1TB0 X;  4E3F A;  1FSN A;  3DD8 A;  5CJF A;  3T5Z A;  1OKL A;  4E3G A;  3OKU A;  2NXR A;  2WEH A;  5FNK A;  5SZ6 A;  3OIK A;  1Z97 A;  5DSO A;  3V2M A;  3PJJ A;  2NNV A;  3KOK A;  4ITO A;  3V3F A;  4MDM A;  4PQ7 A;  5E28 A;  3MZC A;  1YDC A;  3M2Y A;  1UGA A;  1RJ6 A;  1UGG A;  3S73 B;  2H4N A;  5FNL A;  1TH9 A;  3IBN A;  4ZWY A;  1BNT A;  1H9N A;  5BYI A;  3S9T A;  4FRC A;  1CNY A;  3EFT A;  1HED A;  3R17 B;  5FL4 A;  3RYV B;  5EHW A;  2HOC A;  1IF6 A;  3IBI A;  1CNJ A;  2NWP A;  3P3H A;  3RG4 A;  1CAI A;  4N0X B;  8CA2 A;  1CZM A;  5AML A;  1HUH A;  3MDZ A;  4ZWX A;  4XFW A;  3SBI A;  4HEW A;  1CAN A;  5FLQ A;  2WEO A;  1MUA A;  3M04 A;  4L5U A;  5JEH B;  4Q7W A;  3DAZ A;  4Q06 A;  3UYQ A;  1BNU A;  3HKT A;  5DVX A;  1CAZ A;  2FOS A;  1CVA A;  3S8X A;  1CIM A;  1CIL A;  1BNV A;  4FPT A;  9CA2 A;  1YDD A;  1CCT A;  1XPZ A;  1G4J A;  3MMF A;  3P44 A;  5E2K A;  3VBD A;  4Z1J A;  5DSJ A;  3U3A X;  3OKV A;  1ZFK A;  3RGE A;  1CAO A;  4Q0L A;  4QJO A;  4Q08 A;  4ETQ C;  3RYX B;  3TVN X;  3DCC A;  3TVO X;  3JXG A;  4CNX A;  3F4X A;  4FU5 A;  5AMG A;  3P5A A;  3W6I A;  4HT0 A;  4X5S A;  1EOU A;  4FVN A;  3D8W A;  2NNO A;  5DSM A;  4C3T A;  3HLJ A;  4M2U A;  1CAY A;  1YO0 A;  1CVB A;  1LUG A;  3LXE A;  4KNM A;  3DC3 A;  3JXH C;  1TE3 X;  3D92 A;  3SAP A;  4CAC A;  4DZ9 A;  5E5R A;  3JXF A;  2FW4 A;  4COQ A;  1CNX A;  5EKM A;  3S77 B;  2QOA A;  4PYY A;  5JGT B;  3GZ0 A;  1IF9 A;  4Z1E A;  2OSF A;  4LHI A;  1RZD A;  3P5L A;  1I9O A;  4YXI A;  1G54 A;  4K0Z A;  1RZE A;  5DSR A;  1Y7W A;  3PYK A;  3M1J A;  2IT4 A;  1YO2 A;  1OKN A;  3S71 B;  1G52 A;  4YGF A;  1BZM A;  3MNU A;  3N2P A;  4JSS A;  1H9Q A;  3CA2 A;  3ML2 A;  4CNW A;  1F2W A;  3R16 A;  4Z0Q A;  4RIV A;  5L6K A;  1JD0 A;  2Q1B A;  3M40 A;  4CQ0 A;  1G4O A;  3M5T A;  3MHO A;  3V2J A;  2NNG A;  4RFD A;  3M1K A;  3BL1 A;  2VVB X;  1KWQ A;  3N3J A;  1G3Z A;  3ZNC A;  4QIY A;  4QSJ A;  3DC9 A;  5SZ3 A;  3KWA A;  1CNH A;  4GL1 X;  4KNI A;  3MNA A;  4WR7 A;  4QTL A;  4E3D A;  1TG3 A;  4HT2 A;  4Z1K A;  4YWP A;  3ZP9 A;  4PYX A;  4JSA A;  3M3X A;  1DMX A;  3BL0 A;  4BF6 A;  3V3I B;  4RIU A;  3DD0 A;  3KKX A;  1CCU A;  3DV7 A;  4WL4 A;  3IEO A;  5CLU A;  3MHI A;  3D0N A;  5LMD A;  3NJ9 A;  5FDC A;  4RH2 A;  1FSQ A;  4KUV A;  4WUQ A;  2VVA X;  2Q1Q A;  2HD6 A;  4RN4 A;  5SZ0 A;  2EU2 A;  3M5S A;  3M96 A;  3HKQ A;  3RJ7 A;  1FR7 A;  1BN1 A;  3S76 A;  1KWR A;  1BNQ A;  4TWL A;  1ZNC A;  4E3H A;  1KOQ A;  3F7B A;  4Q6E A;  5EHE A;  3CYU A;  1I8Z A;  4MLX A;  2X7T A;  3S74 B;  1J9W A;  3RYJ B;  3T83 A;  5JQ0 A;  1JCZ A;  3P3J A;  3KS3 A;  4KNJ A;  1UGC A;  4E9O X;  4WW6 A;  5EKJ A;  3T82 A;  3FFP X;  3RYY A;  1ZGE A;  3P55 A;  4LP6 A;  2OSM A;  3C7P A;  3U45 X;  4QJM A;  1TEU X;  5JEG B;  4XZ5 A;  4Q87 A;  2O4Z A;  5HPJ A;  1FQM A;  3RYZ A;  1THK A;  4ZWZ A;  5AMD A;  2X7U A;  2NXT A;  4ZX1 A;  1AM6 A;  3M2X A;  1V9I C;  1HEC A;  5EHV A;  1BV3 A;  5JEP B;  5SZ2 A;  5EIJ A;  3B1B A;  2GEH A;  4FL7 A;  2HKK A;  1I9Q A;  2ABE A;  2WEG A;  1RZC A;  3DVD A;  4Q8Z A;  3U7C A;  1AZM A;  3OIM A;  2FNM A;  2NWZ A;  2NXS A;  4Y0J A;  5SZ1 A;  2F14 A;  3FE4 A;  3IAI A;  4IWZ A;  1LGD A;  4R5B A;  4QJW A;  3MYQ A;  4FIK A;  1KEQ A;  3K34 A;  4Q90 A;  3DBU A;  1JV0 A;  1ZSB A;  5FDI A;  4ZX0 A;  4YYT A;  5FL6 A;  4KUY A;  5E2N A;  1CNG A;  1CAJ A;  4CNR A;  5FNH A;  1G0E A;  1LZV A;  4ZAO A;  3IGP A;  3UYN A;  1BIC A;  3T85 A;  3OIL A;  5FL5 A;  2CBB A;  5DSP A;  2QP6 A;  2H15 A;  4WW8 A;  4WUP A;  4Q78 A;  3M14 A;  4XIW A;  3K2F A;  2AX2 A;  4MO8 A;  5IPZ A;  1Z93 A;  1BCD A;  2NN7 A;  4Z1N A;  5EH5 A;  3HKU A;  4YGK A;  7CA2 A;  1BN3 A;  1URT A;  2WD2 A;  1FQR A;  3K7K A;  4JSZ A;  3CZV A;  1ZFQ A;  1G45 A;  2NNS A;  4PZH A;  4QK1 A;  1FR4 A;  4YHA A;  5BRU A;  3NB5 A;  3RZ5 A;  5FLP A;  3MNJ A;  1XEG A;  4BCW A;  4G0C A;  5G01 A;  3FW3 A;  1CVH A;  1FLJ A;  1A42 A;  1XEV A;  2HL4 A;  3IBL A;  4HF3 A;  1CVE A;  3S72 B;  5L3O A;  3TMJ A;  4YGN A;  1I9N A;  1HCB A;  1HCA A;  5FLT A;  1LG6 A;  2CBC A;  2AW1 A;  3MWO A;  1CNI A;  4Q8X A;  5DSK A;  2NWO A;  1TG9 A;  2X7S A;  3B4F A;  5EOI A;  2POU A;  3DA2 A;  1H4N A;  2CBE A;  4JS6 A;  3CAJ A;  4QY3 A;  4XIX A;  4HEY A;  3MNI A;  4E49 A;  1XQ0 A;  2W2J A;  4ILX A;  4L5V A;  3IBU A;  6CA2 A;  4QJX A;  3T84 A;  1TTM A;  1DMY A;  3ML5 A;  5A6H A;  4Q81 A;  1HEA A;  1CA2 A;  1HEB A;  1TEQ X;  1OQ5 A;  1MOO A;  3HKN A;  2Q38 A;  4Q07 A;  1UGE A;  4TWM A;  4Q09 A; 
#chains in the Genus database with same CATH topology
 4G7A A;  3N0N A;  5A25 A;  2FMZ A;  2WEJ A;  4LU3 A;  4KP8 A;  4XE1 A;  4Q49 A;  3W6H A;  4ITP A;  4K13 A;  1IF4 A;  1V9E A;  1RAY A;  1T9N A;  3MHC A;  3MNK A;  5DOH A;  5DSN A;  3RG3 A;  4QK3 A;  4IDR X;  1CRM A;  1G53 A;  4YGJ A;  4MTY A;  3V7X A;  3HFP A;  3V3G B;  4DZ7 A;  1G1D A;  3L14 A;  4M2V A;  3RLD A;  3F8E A;  3EFI A;  1IF8 A;  3Q31 A;  4N16 A;  4UOV A;  4BF1 A;  12CA A;  1Z9Y A;  4KUW A;  5JGS B;  3DVB A;  5JES B;  4KP5 A;  4RFC A;  1CNB A;  5CAC A;  4ZWI A;  4CA2 A;  1UGB A;  4R59 A;  3M5E A;  4M2R A;  1BN4 A;  5EKH A;  5C8I A;  4HBA A;  1I90 A;  2FMG A;  4QSI A;  4JSW A;  2HFW A;  4E5Q A;  5JG3 B;  3BET A;  5JG5 B;  4K0S A;  2CBD A;  1CCS A;  1RJ5 A;  1UGD A;  5DOG A;  3N4B A;  4PXX A;  5FNJ A;  4YX4 A;  5EZT X;  5FNM A;  1I91 A;  3NI5 A;  1CA3 A;  3S78 B;  1G48 A;  4FVO A;  3KIG A;  3U47 A;  3DVC A;  5EH7 A;  4CNV A;  2FNN A;  1LG5 A;  4Q6D A;  5BRW A;  2FNK A;  5E2S A;  3F7U A;  1CIN A;  5SZ5 A;  4YGL A;  3P4V A;  1ZE8 A;  3RZ7 A;  3M1Q A;  2FOV A;  2FOY A;  1YDB A;  4Q7P A;  3OYS A;  5BNL A;  1YO1 A;  5DRS A;  2CAB A;  5E5U A;  4QK2 A;  3SAX A;  1I9M A;  3RZ0 B;  2POV A;  1BNM A;  5SZ4 A;  5JDV B;  4HEZ A;  1ZH9 A;  1CAL A;  3KLD B;  4YXU A;  1IF7 A;  3PO6 A;  5BRV A;  4MLT A;  3T5U A;  5E2M A;  1RZA A;  4QEF A;  4QIZ A;  2ILI A;  3DCW A;  3RZ1 B;  1OKM A;  1UGF A;  4MDL A;  3D9Z A;  3MNH A;  2NWY A;  1TBT X;  2NN1 A;  1G6V A;  5CA2 A;  2EU3 A;  3HS4 A;  4Q83 A;  3KOI A;  1CNW A;  3M2Z A;  4YXO A;  5DSL A;  5DSQ A;  5EH8 A;  3OY0 A;  4QJ0 A;  5JQT A;  4Q9Y A;  3OYQ A;  3SBH A;  1ZSC A;  4Q99 A;  5G0C A;  2WD3 A;  3M2N A;  3QYK A;  1RZB A;  3D93 A;  1DCA A;  1I9P A;  4QSB A;  1FSR A;  1DCB A;  1RAZ A;  2GD8 A;  1ZSA A;  4YVY A;  3S97 A;  4MDG A;  1BNW A;  3KON A;  1CRA A;  3P58 A;  5G0B A;  3S75 B;  1CAM A;  5G03 A;  4L5W A;  4KAP A;  1HUG A;  2NMX A;  1CAK A;  1IF5 A;  4RUZ A;  4Q7V A;  2HNC A;  5FLS A;  4M2W A;  4KV0 A;  1CNK A;  4QJP A;  3M98 A;  3MHM A;  1G46 A;  3M1W A;  4RUY A;  1I9L A;  3V3J A;  5FLR A;  4KNN A;  3MHL A;  4Q7S A;  5FNI A;  5DSI A;  1FQL A;  4RUX A;  1KOP A;  2FOU A;  2CA2 A;  2ZNC A;  2QO8 A;  5J8Z A;  2FOQ A;  1YDA A;  4E4A A;  3M67 A;  2EZ7 A;  1CVF A;  1CVD A;  1FQN A;  3V3H B;  1CNC A;  4Q8Y A;  1BNN A;  4K1Q A;  2CBA A;  5E2R A;  1CAH A;  3KNE A;  1AVN A;  1HVA A;  3DCS A;  4K0T A;  5FNG A;  5SZ7 A;  3V5G A;  5FLO A;  4HU1 A;  4QSA A;  3RZ8 A;  2POW A;  1G0F A;  1CVC A;  1ZGF A;  4R5A A;  1TB0 X;  4E3F A;  1FSN A;  3DD8 A;  5CJF A;  3T5Z A;  1OKL A;  4E3G A;  3OKU A;  2NXR A;  2WEH A;  5FNK A;  5SZ6 A;  3OIK A;  1Z97 A;  5DSO A;  3V2M A;  3PJJ A;  2NNV A;  3KOK A;  4ITO A;  3V3F A;  4MDM A;  4PQ7 A;  5E28 A;  3MZC A;  1YDC A;  3M2Y A;  1UGA A;  1RJ6 A;  1UGG A;  3S73 B;  2H4N A;  5FNL A;  1TH9 A;  3IBN A;  4ZWY A;  1BNT A;  1H9N A;  5BYI A;  3S9T A;  4FRC A;  1CNY A;  3EFT A;  1HED A;  3R17 B;  5FL4 A;  3RYV B;  5EHW A;  2HOC A;  1IF6 A;  3IBI A;  1CNJ A;  2NWP A;  3P3H A;  3RG4 A;  1CAI A;  4N0X B;  8CA2 A;  1CZM A;  5AML A;  1HUH A;  3MDZ A;  4ZWX A;  4XFW A;  3SBI A;  4HEW A;  1CAN A;  5FLQ A;  2WEO A;  1MUA A;  3M04 A;  4L5U A;  5JEH B;  4Q7W A;  3DAZ A;  4Q06 A;  3UYQ A;  1BNU A;  3HKT A;  5DVX A;  1CAZ A;  2FOS A;  1CVA A;  3S8X A;  1CIM A;  1CIL A;  1BNV A;  4FPT A;  9CA2 A;  1YDD A;  1CCT A;  1XPZ A;  1G4J A;  3MMF A;  3P44 A;  5E2K A;  3VBD A;  4Z1J A;  5DSJ A;  3U3A X;  3OKV A;  1ZFK A;  3RGE A;  1CAO A;  4Q0L A;  4QJO A;  4Q08 A;  4ETQ C;  3RYX B;  3TVN X;  3DCC A;  3TVO X;  3JXG A;  4CNX A;  3F4X A;  4FU5 A;  5AMG A;  3P5A A;  3W6I A;  4HT0 A;  4X5S A;  1EOU A;  4FVN A;  3D8W A;  2NNO A;  5DSM A;  4C3T A;  3HLJ A;  4M2U A;  1CAY A;  1YO0 A;  1CVB A;  1LUG A;  3LXE A;  4KNM A;  3DC3 A;  3JXH C;  1TE3 X;  3D92 A;  3SAP A;  4CAC A;  4DZ9 A;  5E5R A;  3JXF A;  2FW4 A;  4COQ A;  1CNX A;  5EKM A;  3S77 B;  2QOA A;  4PYY A;  5JGT B;  3GZ0 A;  1IF9 A;  4Z1E A;  2OSF A;  4LHI A;  1RZD A;  3P5L A;  1I9O A;  4YXI A;  1G54 A;  4K0Z A;  1RZE A;  5DSR A;  1Y7W A;  3PYK A;  3M1J A;  2IT4 A;  1YO2 A;  1OKN A;  3S71 B;  1G52 A;  4YGF A;  1BZM A;  3MNU A;  3N2P A;  4JSS A;  1H9Q A;  3CA2 A;  3ML2 A;  4CNW A;  1F2W A;  3R16 A;  4Z0Q A;  4RIV A;  5L6K A;  1JD0 A;  2Q1B A;  3M40 A;  4CQ0 A;  1G4O A;  3M5T A;  3MHO A;  3V2J A;  2NNG A;  4RFD A;  3M1K A;  3BL1 A;  2VVB X;  1KWQ A;  3N3J A;  1G3Z A;  3ZNC A;  4QIY A;  4QSJ A;  3DC9 A;  5SZ3 A;  3KWA A;  1CNH A;  4GL1 X;  4KNI A;  3MNA A;  4WR7 A;  4QTL A;  4E3D A;  1TG3 A;  4HT2 A;  4Z1K A;  4YWP A;  3ZP9 A;  4PYX A;  4JSA A;  3M3X A;  1DMX A;  3BL0 A;  4BF6 A;  3V3I B;  4RIU A;  3DD0 A;  3KKX A;  1CCU A;  3DV7 A;  4WL4 A;  3IEO A;  5CLU A;  3MHI A;  3D0N A;  5LMD A;  3NJ9 A;  5FDC A;  4RH2 A;  1FSQ A;  4KUV A;  4WUQ A;  2VVA X;  2Q1Q A;  2HD6 A;  4RN4 A;  5SZ0 A;  2EU2 A;  3M5S A;  3M96 A;  3HKQ A;  3RJ7 A;  1FR7 A;  1BN1 A;  3S76 A;  1KWR A;  1BNQ A;  4TWL A;  1ZNC A;  4E3H A;  1KOQ A;  3F7B A;  4Q6E A;  5EHE A;  3CYU A;  1I8Z A;  4MLX A;  2X7T A;  3S74 B;  1J9W A;  3RYJ B;  3T83 A;  5JQ0 A;  1JCZ A;  3P3J A;  3KS3 A;  4KNJ A;  1UGC A;  4E9O X;  4WW6 A;  5EKJ A;  3T82 A;  3FFP X;  3RYY A;  1ZGE A;  3P55 A;  4LP6 A;  2OSM A;  3C7P A;  3U45 X;  4QJM A;  1TEU X;  5JEG B;  4XZ5 A;  4Q87 A;  2O4Z A;  5HPJ A;  1FQM A;  3RYZ A;  1THK A;  4ZWZ A;  5AMD A;  2X7U A;  2NXT A;  4ZX1 A;  1AM6 A;  3M2X A;  1V9I C;  1HEC A;  5EHV A;  1BV3 A;  5JEP B;  5SZ2 A;  5EIJ A;  3B1B A;  2GEH A;  4FL7 A;  2HKK A;  1I9Q A;  2ABE A;  2WEG A;  1RZC A;  3DVD A;  4Q8Z A;  3U7C A;  1AZM A;  3OIM A;  2FNM A;  2NWZ A;  2NXS A;  4Y0J A;  5SZ1 A;  2F14 A;  3FE4 A;  3IAI A;  4IWZ A;  1LGD A;  4R5B A;  4QJW A;  3MYQ A;  4FIK A;  1KEQ A;  3K34 A;  4Q90 A;  3DBU A;  1JV0 A;  1ZSB A;  5FDI A;  4ZX0 A;  4YYT A;  5FL6 A;  4KUY A;  5E2N A;  1CNG A;  1CAJ A;  4CNR A;  5FNH A;  1G0E A;  1LZV A;  4ZAO A;  3IGP A;  3UYN A;  1BIC A;  3T85 A;  3OIL A;  5FL5 A;  2CBB A;  5DSP A;  2QP6 A;  2H15 A;  4WW8 A;  4WUP A;  4Q78 A;  3M14 A;  4XIW A;  3K2F A;  2AX2 A;  4MO8 A;  5IPZ A;  1Z93 A;  1BCD A;  2NN7 A;  4Z1N A;  5EH5 A;  3HKU A;  4YGK A;  7CA2 A;  1BN3 A;  1URT A;  2WD2 A;  1FQR A;  3K7K A;  4JSZ A;  3CZV A;  1ZFQ A;  1G45 A;  2NNS A;  4PZH A;  4QK1 A;  1FR4 A;  4YHA A;  5BRU A;  3NB5 A;  3RZ5 A;  5FLP A;  3MNJ A;  1XEG A;  4BCW A;  4G0C A;  5G01 A;  3FW3 A;  1CVH A;  1FLJ A;  1A42 A;  1XEV A;  2HL4 A;  3IBL A;  4HF3 A;  1CVE A;  3S72 B;  5L3O A;  3TMJ A;  4YGN A;  1I9N A;  1HCB A;  1HCA A;  5FLT A;  1LG6 A;  2CBC A;  2AW1 A;  3MWO A;  1CNI A;  4Q8X A;  5DSK A;  2NWO A;  1TG9 A;  2X7S A;  3B4F A;  5EOI A;  2POU A;  3DA2 A;  1H4N A;  2CBE A;  4JS6 A;  3CAJ A;  4QY3 A;  4XIX A;  4HEY A;  3MNI A;  4E49 A;  1XQ0 A;  2W2J A;  4ILX A;  4L5V A;  3IBU A;  6CA2 A;  4QJX A;  3T84 A;  1TTM A;  1DMY A;  3ML5 A;  5A6H A;  4Q81 A;  1HEA A;  1CA2 A;  1HEB A;  1TEQ X;  1OQ5 A;  1MOO A;  3HKN A;  2Q38 A;  4Q07 A;  1UGE A;  4TWM A;  4Q09 A; 
#chains in the Genus database with same CATH homology
 4G7A A;  3N0N A;  5A25 A;  2FMZ A;  2WEJ A;  4LU3 A;  4KP8 A;  4XE1 A;  4Q49 A;  3W6H A;  4ITP A;  4K13 A;  1IF4 A;  1V9E A;  1RAY A;  1T9N A;  3MHC A;  3MNK A;  5DOH A;  5DSN A;  3RG3 A;  4QK3 A;  4IDR X;  1CRM A;  1G53 A;  4YGJ A;  4MTY A;  3V7X A;  3HFP A;  3V3G B;  4DZ7 A;  1G1D A;  3L14 A;  4M2V A;  3RLD A;  3F8E A;  3EFI A;  1IF8 A;  3Q31 A;  4N16 A;  4UOV A;  4BF1 A;  12CA A;  1Z9Y A;  4KUW A;  5JGS B;  3DVB A;  5JES B;  4KP5 A;  4RFC A;  1CNB A;  5CAC A;  4ZWI A;  4CA2 A;  1UGB A;  4R59 A;  3M5E A;  4M2R A;  1BN4 A;  5EKH A;  5C8I A;  4HBA A;  1I90 A;  2FMG A;  4QSI A;  4JSW A;  2HFW A;  4E5Q A;  5JG3 B;  3BET A;  5JG5 B;  4K0S A;  2CBD A;  1CCS A;  1RJ5 A;  1UGD A;  5DOG A;  3N4B A;  4PXX A;  5FNJ A;  4YX4 A;  5EZT X;  5FNM A;  1I91 A;  3NI5 A;  1CA3 A;  3S78 B;  1G48 A;  4FVO A;  3KIG A;  3U47 A;  3DVC A;  5EH7 A;  4CNV A;  2FNN A;  1LG5 A;  4Q6D A;  5BRW A;  2FNK A;  5E2S A;  3F7U A;  1CIN A;  5SZ5 A;  4YGL A;  3P4V A;  1ZE8 A;  3RZ7 A;  3M1Q A;  2FOV A;  2FOY A;  1YDB A;  4Q7P A;  3OYS A;  5BNL A;  1YO1 A;  5DRS A;  2CAB A;  5E5U A;  4QK2 A;  3SAX A;  1I9M A;  3RZ0 B;  2POV A;  1BNM A;  5SZ4 A;  5JDV B;  4HEZ A;  1ZH9 A;  1CAL A;  3KLD B;  4YXU A;  1IF7 A;  3PO6 A;  5BRV A;  4MLT A;  3T5U A;  5E2M A;  1RZA A;  4QEF A;  4QIZ A;  2ILI A;  3DCW A;  3RZ1 B;  1OKM A;  1UGF A;  4MDL A;  3D9Z A;  3MNH A;  2NWY A;  1TBT X;  2NN1 A;  1G6V A;  5CA2 A;  2EU3 A;  3HS4 A;  4Q83 A;  3KOI A;  1CNW A;  3M2Z A;  4YXO A;  5DSL A;  5DSQ A;  5EH8 A;  3OY0 A;  4QJ0 A;  5JQT A;  4Q9Y A;  3OYQ A;  3SBH A;  1ZSC A;  4Q99 A;  5G0C A;  2WD3 A;  3M2N A;  3QYK A;  1RZB A;  3D93 A;  1DCA A;  1I9P A;  4QSB A;  1FSR A;  1DCB A;  1RAZ A;  2GD8 A;  1ZSA A;  4YVY A;  3S97 A;  4MDG A;  1BNW A;  3KON A;  1CRA A;  3P58 A;  5G0B A;  3S75 B;  1CAM A;  5G03 A;  4L5W A;  4KAP A;  1HUG A;  2NMX A;  1CAK A;  1IF5 A;  4RUZ A;  4Q7V A;  2HNC A;  5FLS A;  4M2W A;  4KV0 A;  1CNK A;  4QJP A;  3M98 A;  3MHM A;  1G46 A;  3M1W A;  4RUY A;  1I9L A;  3V3J A;  5FLR A;  4KNN A;  3MHL A;  4Q7S A;  5FNI A;  5DSI A;  1FQL A;  4RUX A;  1KOP A;  2FOU A;  2CA2 A;  2ZNC A;  2QO8 A;  5J8Z A;  2FOQ A;  1YDA A;  4E4A A;  3M67 A;  2EZ7 A;  1CVF A;  1CVD A;  1FQN A;  3V3H B;  1CNC A;  4Q8Y A;  1BNN A;  4K1Q A;  2CBA A;  5E2R A;  1CAH A;  3KNE A;  1AVN A;  1HVA A;  3DCS A;  4K0T A;  5FNG A;  5SZ7 A;  3V5G A;  5FLO A;  4HU1 A;  4QSA A;  3RZ8 A;  2POW A;  1G0F A;  1CVC A;  1ZGF A;  4R5A A;  1TB0 X;  4E3F A;  1FSN A;  3DD8 A;  5CJF A;  3T5Z A;  1OKL A;  4E3G A;  3OKU A;  2NXR A;  2WEH A;  5FNK A;  5SZ6 A;  3OIK A;  1Z97 A;  5DSO A;  3V2M A;  3PJJ A;  2NNV A;  3KOK A;  4ITO A;  3V3F A;  4MDM A;  4PQ7 A;  5E28 A;  3MZC A;  1YDC A;  3M2Y A;  1UGA A;  1RJ6 A;  1UGG A;  3S73 B;  2H4N A;  5FNL A;  1TH9 A;  3IBN A;  4ZWY A;  1BNT A;  1H9N A;  5BYI A;  3S9T A;  4FRC A;  1CNY A;  3EFT A;  1HED A;  3R17 B;  5FL4 A;  3RYV B;  5EHW A;  2HOC A;  1IF6 A;  3IBI A;  1CNJ A;  2NWP A;  3P3H A;  3RG4 A;  1CAI A;  4N0X B;  8CA2 A;  1CZM A;  5AML A;  1HUH A;  3MDZ A;  4ZWX A;  4XFW A;  3SBI A;  4HEW A;  1CAN A;  5FLQ A;  2WEO A;  1MUA A;  3M04 A;  4L5U A;  5JEH B;  4Q7W A;  3DAZ A;  4Q06 A;  3UYQ A;  1BNU A;  3HKT A;  5DVX A;  1CAZ A;  2FOS A;  1CVA A;  3S8X A;  1CIM A;  1CIL A;  1BNV A;  4FPT A;  9CA2 A;  1YDD A;  1CCT A;  1XPZ A;  1G4J A;  3MMF A;  3P44 A;  5E2K A;  3VBD A;  4Z1J A;  5DSJ A;  3U3A X;  3OKV A;  1ZFK A;  3RGE A;  1CAO A;  4Q0L A;  4QJO A;  4Q08 A;  4ETQ C;  3RYX B;  3TVN X;  3DCC A;  3TVO X;  3JXG A;  4CNX A;  3F4X A;  4FU5 A;  5AMG A;  3P5A A;  3W6I A;  4HT0 A;  4X5S A;  1EOU A;  4FVN A;  3D8W A;  2NNO A;  5DSM A;  4C3T A;  3HLJ A;  4M2U A;  1CAY A;  1YO0 A;  1CVB A;  1LUG A;  3LXE A;  4KNM A;  3DC3 A;  3JXH C;  1TE3 X;  3D92 A;  3SAP A;  4CAC A;  4DZ9 A;  5E5R A;  3JXF A;  2FW4 A;  4COQ A;  1CNX A;  5EKM A;  3S77 B;  2QOA A;  4PYY A;  5JGT B;  3GZ0 A;  1IF9 A;  4Z1E A;  2OSF A;  4LHI A;  1RZD A;  3P5L A;  1I9O A;  4YXI A;  1G54 A;  4K0Z A;  1RZE A;  5DSR A;  1Y7W A;  3PYK A;  3M1J A;  2IT4 A;  1YO2 A;  1OKN A;  3S71 B;  1G52 A;  4YGF A;  1BZM A;  3MNU A;  3N2P A;  4JSS A;  1H9Q A;  3CA2 A;  3ML2 A;  4CNW A;  1F2W A;  3R16 A;  4Z0Q A;  4RIV A;  5L6K A;  1JD0 A;  2Q1B A;  3M40 A;  4CQ0 A;  1G4O A;  3M5T A;  3MHO A;  3V2J A;  2NNG A;  4RFD A;  3M1K A;  3BL1 A;  2VVB X;  1KWQ A;  3N3J A;  1G3Z A;  3ZNC A;  4QIY A;  4QSJ A;  3DC9 A;  5SZ3 A;  3KWA A;  1CNH A;  4GL1 X;  4KNI A;  3MNA A;  4WR7 A;  4QTL A;  4E3D A;  1TG3 A;  4HT2 A;  4Z1K A;  4YWP A;  3ZP9 A;  4PYX A;  4JSA A;  3M3X A;  1DMX A;  3BL0 A;  4BF6 A;  3V3I B;  4RIU A;  3DD0 A;  3KKX A;  1CCU A;  3DV7 A;  4WL4 A;  3IEO A;  5CLU A;  3MHI A;  3D0N A;  5LMD A;  3NJ9 A;  5FDC A;  4RH2 A;  1FSQ A;  4KUV A;  4WUQ A;  2VVA X;  2Q1Q A;  2HD6 A;  4RN4 A;  5SZ0 A;  2EU2 A;  3M5S A;  3M96 A;  3HKQ A;  3RJ7 A;  1FR7 A;  1BN1 A;  3S76 A;  1KWR A;  1BNQ A;  4TWL A;  1ZNC A;  4E3H A;  1KOQ A;  3F7B A;  4Q6E A;  5EHE A;  3CYU A;  1I8Z A;  4MLX A;  2X7T A;  3S74 B;  1J9W A;  3RYJ B;  3T83 A;  5JQ0 A;  1JCZ A;  3P3J A;  3KS3 A;  4KNJ A;  1UGC A;  4E9O X;  4WW6 A;  5EKJ A;  3T82 A;  3FFP X;  3RYY A;  1ZGE A;  3P55 A;  4LP6 A;  2OSM A;  3C7P A;  3U45 X;  4QJM A;  1TEU X;  5JEG B;  4XZ5 A;  4Q87 A;  2O4Z A;  5HPJ A;  1FQM A;  3RYZ A;  1THK A;  4ZWZ A;  5AMD A;  2X7U A;  2NXT A;  4ZX1 A;  1AM6 A;  3M2X A;  1V9I C;  1HEC A;  5EHV A;  1BV3 A;  5JEP B;  5SZ2 A;  5EIJ A;  3B1B A;  2GEH A;  4FL7 A;  2HKK A;  1I9Q A;  2ABE A;  2WEG A;  1RZC A;  3DVD A;  4Q8Z A;  3U7C A;  1AZM A;  3OIM A;  2FNM A;  2NWZ A;  2NXS A;  4Y0J A;  5SZ1 A;  2F14 A;  3FE4 A;  3IAI A;  4IWZ A;  1LGD A;  4R5B A;  4QJW A;  3MYQ A;  4FIK A;  1KEQ A;  3K34 A;  4Q90 A;  3DBU A;  1JV0 A;  1ZSB A;  5FDI A;  4ZX0 A;  4YYT A;  5FL6 A;  4KUY A;  5E2N A;  1CNG A;  1CAJ A;  4CNR A;  5FNH A;  1G0E A;  1LZV A;  4ZAO A;  3IGP A;  3UYN A;  1BIC A;  3T85 A;  3OIL A;  5FL5 A;  2CBB A;  5DSP A;  2QP6 A;  2H15 A;  4WW8 A;  4WUP A;  4Q78 A;  3M14 A;  4XIW A;  3K2F A;  2AX2 A;  4MO8 A;  5IPZ A;  1Z93 A;  1BCD A;  2NN7 A;  4Z1N A;  5EH5 A;  3HKU A;  4YGK A;  7CA2 A;  1BN3 A;  1URT A;  2WD2 A;  1FQR A;  3K7K A;  4JSZ A;  3CZV A;  1ZFQ A;  1G45 A;  2NNS A;  4PZH A;  4QK1 A;  1FR4 A;  4YHA A;  5BRU A;  3NB5 A;  3RZ5 A;  5FLP A;  3MNJ A;  1XEG A;  4BCW A;  4G0C A;  5G01 A;  3FW3 A;  1CVH A;  1FLJ A;  1A42 A;  1XEV A;  2HL4 A;  3IBL A;  4HF3 A;  1CVE A;  3S72 B;  5L3O A;  3TMJ A;  4YGN A;  1I9N A;  1HCB A;  1HCA A;  5FLT A;  1LG6 A;  2CBC A;  2AW1 A;  3MWO A;  1CNI A;  4Q8X A;  5DSK A;  2NWO A;  1TG9 A;  2X7S A;  3B4F A;  5EOI A;  2POU A;  3DA2 A;  1H4N A;  2CBE A;  4JS6 A;  3CAJ A;  4QY3 A;  4XIX A;  4HEY A;  3MNI A;  4E49 A;  1XQ0 A;  2W2J A;  4ILX A;  4L5V A;  3IBU A;  6CA2 A;  4QJX A;  3T84 A;  1TTM A;  1DMY A;  3ML5 A;  5A6H A;  4Q81 A;  1HEA A;  1CA2 A;  1HEB A;  1TEQ X;  1OQ5 A;  1MOO A;  3HKN A;  2Q38 A;  4Q07 A;  1UGE A;  4TWM A;  4Q09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...