1MUAA

Structure and energetics of a non-proline cis-peptidyl linkage in an engineered protein
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
Knots found
sequence length
256
structure length
256
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPALLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase(oxo-acid)
molecule keywords CARBONIC ANHYDRASE II
publication title Structure and energetics of a non-proline cis-peptidyl linkage in a proline-202-->alanine carbonic anhydrase II variant.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 256
sequence length 256
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1993-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 1muaA00
3JXGA 4L5VA 4QSBA 4Z1JA 4XZ5A 4YGNA 3UYQA 1I90A 3M5SA 3CZVA 4JS6A 1XPZA 1FLJA 3IBIA 4ITPA 4LP6A 5LMDA 1CRMA 1UGGA 3M3XA 3N4BA 1I91A 4QK1A 3L14A 3P3HA 4E3HA 1URTA 5DSPA 5JG3B 4HF3A 1UGBA 1KOPA 5BRUA 2X7UA 1ZE8A 4QJMA 1UGAA 1TB0X 3M2YA 3F7BA 4XIWA 4FL7A 4R5AA 1Z97A 3P4VA 3OIMA 1CVHA 4MDLA 1XEGA 3PJJA 5DSKA 4BF6A 4Z1NA 1FSRA 1CAYA 1CVEA 1CNXA 4MDMA 3TVOX 1CALA 1CANA 1G4JA 1BV3A 4KUWA 2EZ7A 3V5GA 2POWA 2EU2A 3DAZA 3MZCA 3JXHC 1MOOA 1RJ5A 4XIXA 3F7UA 4QSAA 2O4ZA 4N16A 4KP5A 4YVYA 3VBDA 3T85A 1ZFQA 1YDCA 1BNNA 2NXSA 3DCSA 3MHIA 1JCZA 3SBIA 1UGEA 5DSNA 3V3JA 3M1KA 2HD6A 1Z9YA 1FQNA 3BL1A 3T5UA 4E3FA 1IF8A 3S8XA 5E2KA 1RJ6A 2F14A 3IEOA 3S9TA 2CBCA 2CBDA 4QK3A 5EHEA 3W6IA 1G6VA 3V7XA 1ZH9A 3M1JA 1F2WA 3QYKA 3P44A 3IGPA 4PXXA 3M2NA 1JV0A 1IF9A 4YGLA 5A6HA 1UGFA 3S75B 1I9NA 3KOIA 4Q6DA 2AW1A 2WD2A 1CINA 1CAIA 3KONA 4JSZA 4KNJA 3MHMA 5JEGB 5DRSA 4QIZA 2WEHA 2FNKA 1HUHA 5EH7A 3SAPA 5JG5B 4QJ0A 5SZ2A 3DD8A 5FNLA 4WUPA 3MNKA 3RZ0B 4BF1A 3ML2A 1AM6A 1G53A 4BCWA 3DA2A 5DSRA 4Y0JA 3K2FA 1G45A 4R59A 5BRVA 4CNWA 1CILA 2POVA 1TBTX 5JQ0A 2QP6A 2NMXA 3CAJA 2NNSA 2FMGA 4QSJA 1I9PA 1J9WA 5SZ0A 3M14A 2AX2A 3PYKA 5SZ3A 2NWZA 5FL5A 5G03A 4KAPA 3KS3A 1KOQA 4COQA 1FQMA 3BETA 5L3OA 2NXTA 5FLSA 1CVAA 3IAIA 1CRAA 3GZ0A 2OSMA 1HEBA 3DCWA 6CA2A 2ILIA 3P55A 4RN4A 4XFWA 4YGJA 3ZNCA 4E3DA 4Q7WA 2FOSA 1CVDA 9CA2A 4Q0LA 1YDBA 5FLPA 4PYYA 1CAKA 5FNHA 4WL4A 5JGSB 1ZGEA 1FQLA 2QO8A 1HCBA 8CA2A 5SZ7A 5DSOA 1RAYA 3DC9A 5FLTA 3CA2A 3EFIA 3U47A 1OKNA 4TWLA 4YXOA 2H15A 3T84A 4E5QA 2VVBX 1XQ0A 1CNHA 4MLTA 4RFCA 4QY3A 1RZBA 3HKNA 3MHLA 1BZMA 3Q31A 4KUVA 1LG5A 3P5AA 4PQ7A 2NNOA 3M1WA 4PYXA 1IF7A 4HT0A 2HL4A 4KUYA 5HPJA 4Q83A 3T83A 4Q09A 4QK2A 4YYTA 5DSIA 5SZ1A 2FOQA 1YO1A 4UOVA 1CNYA 3M1QA 1BNQA 5CLUA 5E2NA 4KNIA 5JESB 5FNIA 3JXFA 3MHCA 2OSFA 2W2JA 1CVBA 3KLDB 1Y7WA 5FL4A 4MDGA 3S76A 3OYSA 1Z93A 1ZFKA 3U45X 3B4FA 4FU5A 3KOKA 3RJ7A 5E5UA 4RUZA 3M98A 4M2VA 5J8ZA 2NWPA 4HU1A 4KNNA 4QJPA 1HCAA 4K0ZA 3CYUA 1BNWA 1TG9A 4Q7VA 4QJXA 4RUXA 4Q7PA 1CAMA 2NN1A 4HEYA 3ZP9A 4Q06A 1RAZA 3F8EA 4ZWIA 3RGEA 5SZ5A 1ZSAA 4WUQA 2NWOA 1LG6A 3K34A 3MHOA 3UYNA 5DSMA 1H9NA 4PZHA 4Q07A 4QIYA 4E49A 4ETQC 1BNVA 4YGKA 4JSAA 5FLOA 4Q8ZA 2POUA 3D92A 1V9EA 1G46A 1YDAA 3KIGA 5JEHB 1CIMA 5AMDA 5A25A 5DSJA 4WW8A 5DOHA 4Q99A 3U7CA 4ZWZA 1DCAA 5JEPB 5EOIA 4JSSA 3RZ8A 1CCTA 3RZ7A 1OQ5A 3OKUA 5DVXA 2HFWA 5CJFA 5C8IA 1HEDA 2CBAA 3U3AX 3NJ9A 4ZX1A 1CNWA 3EFTA 4TWMA 4DZ9A 5JQTA 3RZ5A 1HUGA 3V3IB 1CCUA 2FMZA 4FVNA 3OILA 5E2RA 5BRWA 1LGDA 1RZDA 3SBHA 1HVAA 2FOVA 2GEHA 3IBNA 1DCBA 3V3FA 1CAZA 1H9QA 1G1DA 2WEOA 4Q9YA 5DSQA 3V2MA 1ZGFA 4HT2A 1IF4A 5AMLA 4FIKA 1BN3A 1BN1A 3NI5A 12CAA 2WEJA 2X7TA 1I9QA 4IDRX 1CA2A 4K1QA 1HEAA 3S97A 3V2JA 2HNCA 3R17B 3F4XA 5G0BA 3P5LA 1RZAA 3RYYA 4M2WA 5CACA 3N3JA 4Q6EA 1A42A 4Q49A 3D0NA 3R16A 2WD3A 1OKMA 2FNMA 5BYIA 4Q90A 3T5ZA 3TVNX 1TE3X 2CA2A 5AMGA 4E9OX 4RIUA 2Q1BA 3LXEA 4K0TA 3N0NA 1I9OA 3RYZA 1YO2A 3B1BA 1CNKA 3MNIA 2ABEA 3HKTA 5JGTB 4Z0QA 5FLRA 1BN4A 3OY0A 5FNKA 4HEZA 4QEFA 3HKUA 4CNXA 4QTLA 3K7KA 4LU3A 2NNVA 5FNGA 4MO8A 3KWAA 4WR7A 2FW4A 3RZ1B 3OKVA 2GD8A 3DV7A 5FLQA 3MWOA 1FR4A 1H4NA 1EOUA 4E3GA 3RLDA 1FSQA 3P58A 1BCDA 2CBBA 3DC3A 1CNIA 3RYJB 4QSIA 3KNEA 4CNVA 1I9LA 4Q8YA 4RIVA 1FQRA 1CAOA 1YO0A 4KV0A 4FRCA 1I8ZA 5E2SA 1XEVA 3FW3A 3N2PA 3C7PA 3D9ZA 4YX4A 1G0FA 3ML5A 1FSNA 3FE4A 4L5WA 3RYVB 4G7AA 5EH8A 5CA2A 3M40A 4DZ7A 3M2ZA 4QJWA 3S72B 5E28A 2CABA 4ILXA 3V3GB 4RFDA 3W6HA 1I9MA 1DMXA 3SAXA 1TH9A 3HLJA 2Q38A 3MDZA 4Q7SA 3TMJA 4C3TA 3OIKA 1HECA 1IF5A 1CVFA 2WEGA 2CBEA 4KNMA 3M96A 4YHAA 3DVBA 3DVCA 5JDVB 3S73B 1LUGA 5EKJA 5DOGA 1CNGA 4YWPA 3DBUA 1G4OA 2VVAX 2FOUA 2NWYA 4MTYA 4HEWA 3MNHA 5G01A 1IF6A 5FL6A 5FNMA 3HFPA 4CQ0A 4M2RA 5EHVA 4L5UA 2H4NA 4ITOA 1BICA 3D93A 1CAJA 3M67A 5FDIA 1YDDA 4Q81A 4LHIA 4Q8XA 2FOYA 3MYQA 2HKKA 1G48A 5EKMA 2EU3A 3M5TA 1OKLA 4Q78A 1TG3A 2IT4A 1CZMA 3HS4A 4X5SA 3V3HB 2QOAA 5L6KA 2X7SA 1UGCA 3PO6A 3MMFA 4XE1A 5IPZA 1BNTA 1CA3A 3FFPX 1BNMA 1ZSBA 4ZAOA 1CCSA 4G0CA 1G0EA 5EHWA 3BL0A 1FR7A 5FDCA 4R5BA 3S71B 4HBAA 4Z1KA 4Q08A 3RG3A 2Q1QA 3IBLA 5DSLA 4QJOA 3M2XA 5EIJA 3HKQA 1ZNCA 2NN7A 4YXIA 3DVDA 3P3JA 1KWQA 4K0SA 1CNBA 1KEQA 1JD0A 1CNCA 1V9IC 4FVOA 4CNRA 1UGDA 3T82A 5EKHA 3S78B 1TEUX 4E4AA 5G0CA 1AZMA 3M5EA 3DCCA 4ZWXA 3IBUA 4N0XB 3NB5A 1G52A 1MUAA 4WW6A 4RH2A 2FNNA 4ZWYA 3M04A 7CA2A 4YXUA 4Q87A 4YGFA 1G3ZA 4K13A 1RZEA 1LZVA 1T9NA 4MLXA 5FNJA 4Z1EA 4FPTA 3KKXA 3MNUA 4IWZA 1CAHA 3S77B 4M2UA 4JSWA 5E5RA 1BNUA 1AVNA 1G54A 2HOCA 3RG4A 2NNGA 3D8WA 5SZ4A 1CNJA 1DMYA 4CACA 1RZCA 2ZNCA 1ZSCA 5EZTX 5BNLA 5E2MA 4CA2A 3OYQA 4ZX0A 4RUYA 2NXRA 5EH5A 1TTMA 3RYXB 1TEQX 3DD0A 3MNAA 1THKA 1KWRA 4KP8A 3S74B 1CVCA 4GL1X 5SZ6A 3MNJA
chains in the Genus database with same CATH superfamily
3JXGA 4L5VA 4QSBA 4Z1JA 4XZ5A 4YGNA 3UYQA 1I90A 3M5SA 3CZVA 4JS6A 1XPZA 1FLJA 3IBIA 4ITPA 4LP6A 5LMDA 1CRMA 1UGGA 3M3XA 3N4BA 1I91A 4QK1A 3L14A 3P3HA 4E3HA 1URTA 5DSPA 5JG3B 4HF3A 1UGBA 1KOPA 5BRUA 2X7UA 1ZE8A 4QJMA 1UGAA 1TB0X 3M2YA 3F7BA 4XIWA 4FL7A 4R5AA 1Z97A 3P4VA 3OIMA 1CVHA 4MDLA 1XEGA 3PJJA 5DSKA 4BF6A 4Z1NA 1FSRA 1CAYA 1CVEA 1CNXA 4MDMA 3TVOX 1CALA 1CANA 1G4JA 1BV3A 4KUWA 2EZ7A 3V5GA 2POWA 2EU2A 3DAZA 3MZCA 3JXHC 1MOOA 1RJ5A 4XIXA 3F7UA 4QSAA 2O4ZA 4N16A 4KP5A 4YVYA 3VBDA 3T85A 1ZFQA 1YDCA 1BNNA 2NXSA 3DCSA 3MHIA 1JCZA 3SBIA 1UGEA 5DSNA 3V3JA 3M1KA 2HD6A 1Z9YA 1FQNA 3BL1A 3T5UA 4E3FA 1IF8A 3S8XA 5E2KA 1RJ6A 2F14A 3IEOA 3S9TA 2CBCA 2CBDA 4QK3A 5EHEA 3W6IA 1G6VA 3V7XA 1ZH9A 3M1JA 1F2WA 3QYKA 3P44A 3IGPA 4PXXA 3M2NA 1JV0A 1IF9A 4YGLA 5A6HA 1UGFA 3S75B 1I9NA 3KOIA 4Q6DA 2AW1A 2WD2A 1CINA 1CAIA 3KONA 4JSZA 4KNJA 3MHMA 5JEGB 5DRSA 4QIZA 2WEHA 2FNKA 1HUHA 5EH7A 3SAPA 5JG5B 4QJ0A 5SZ2A 3DD8A 5FNLA 4WUPA 3MNKA 3RZ0B 4BF1A 3ML2A 1AM6A 1G53A 4BCWA 3DA2A 5DSRA 4Y0JA 3K2FA 1G45A 4R59A 5BRVA 4CNWA 1CILA 2POVA 1TBTX 5JQ0A 2QP6A 2NMXA 3CAJA 2NNSA 2FMGA 4QSJA 1I9PA 1J9WA 5SZ0A 3M14A 2AX2A 3PYKA 5SZ3A 2NWZA 5FL5A 5G03A 4KAPA 3KS3A 1KOQA 4COQA 1FQMA 3BETA 5L3OA 2NXTA 5FLSA 1CVAA 3IAIA 1CRAA 3GZ0A 2OSMA 1HEBA 3DCWA 6CA2A 2ILIA 3P55A 4RN4A 4XFWA 4YGJA 3ZNCA 4E3DA 4Q7WA 2FOSA 1CVDA 9CA2A 4Q0LA 1YDBA 5FLPA 4PYYA 1CAKA 5FNHA 4WL4A 5JGSB 1ZGEA 1FQLA 2QO8A 1HCBA 8CA2A 5SZ7A 5DSOA 1RAYA 3DC9A 5FLTA 3CA2A 3EFIA 3U47A 1OKNA 4TWLA 4YXOA 2H15A 3T84A 4E5QA 2VVBX 1XQ0A 1CNHA 4MLTA 4RFCA 4QY3A 1RZBA 3HKNA 3MHLA 1BZMA 3Q31A 4KUVA 1LG5A 3P5AA 4PQ7A 2NNOA 3M1WA 4PYXA 1IF7A 4HT0A 2HL4A 4KUYA 5HPJA 4Q83A 3T83A 4Q09A 4QK2A 4YYTA 5DSIA 5SZ1A 2FOQA 1YO1A 4UOVA 1CNYA 3M1QA 1BNQA 5CLUA 5E2NA 4KNIA 5JESB 5FNIA 3JXFA 3MHCA 2OSFA 2W2JA 1CVBA 3KLDB 1Y7WA 5FL4A 4MDGA 3S76A 3OYSA 1Z93A 1ZFKA 3U45X 3B4FA 4FU5A 3KOKA 3RJ7A 5E5UA 4RUZA 3M98A 4M2VA 5J8ZA 2NWPA 4HU1A 4KNNA 4QJPA 1HCAA 4K0ZA 3CYUA 1BNWA 1TG9A 4Q7VA 4QJXA 4RUXA 4Q7PA 1CAMA 2NN1A 4HEYA 3ZP9A 4Q06A 1RAZA 3F8EA 4ZWIA 3RGEA 5SZ5A 1ZSAA 4WUQA 2NWOA 1LG6A 3K34A 3MHOA 3UYNA 5DSMA 1H9NA 4PZHA 4Q07A 4QIYA 4E49A 4ETQC 1BNVA 4YGKA 4JSAA 5FLOA 4Q8ZA 2POUA 3D92A 1V9EA 1G46A 1YDAA 3KIGA 5JEHB 1CIMA 5AMDA 5A25A 5DSJA 4WW8A 5DOHA 4Q99A 3U7CA 4ZWZA 1DCAA 5JEPB 5EOIA 4JSSA 3RZ8A 1CCTA 3RZ7A 1OQ5A 3OKUA 5DVXA 2HFWA 5CJFA 5C8IA 1HEDA 2CBAA 3U3AX 3NJ9A 4ZX1A 1CNWA 3EFTA 4TWMA 4DZ9A 5JQTA 3RZ5A 1HUGA 3V3IB 1CCUA 2FMZA 4FVNA 3OILA 5E2RA 5BRWA 1LGDA 1RZDA 3SBHA 1HVAA 2FOVA 2GEHA 3IBNA 1DCBA 3V3FA 1CAZA 1H9QA 1G1DA 2WEOA 4Q9YA 5DSQA 3V2MA 1ZGFA 4HT2A 1IF4A 5AMLA 4FIKA 1BN3A 1BN1A 3NI5A 12CAA 2WEJA 2X7TA 1I9QA 4IDRX 1CA2A 4K1QA 1HEAA 3S97A 3V2JA 2HNCA 3R17B 3F4XA 5G0BA 3P5LA 1RZAA 3RYYA 4M2WA 5CACA 3N3JA 4Q6EA 1A42A 4Q49A 3D0NA 3R16A 2WD3A 1OKMA 2FNMA 5BYIA 4Q90A 3T5ZA 3TVNX 1TE3X 2CA2A 5AMGA 4E9OX 4RIUA 2Q1BA 3LXEA 4K0TA 3N0NA 1I9OA 3RYZA 1YO2A 3B1BA 1CNKA 3MNIA 2ABEA 3HKTA 5JGTB 4Z0QA 5FLRA 1BN4A 3OY0A 5FNKA 4HEZA 4QEFA 3HKUA 4CNXA 4QTLA 3K7KA 4LU3A 2NNVA 5FNGA 4MO8A 3KWAA 4WR7A 2FW4A 3RZ1B 3OKVA 2GD8A 3DV7A 5FLQA 3MWOA 1FR4A 1H4NA 1EOUA 4E3GA 3RLDA 1FSQA 3P58A 1BCDA 2CBBA 3DC3A 1CNIA 3RYJB 4QSIA 3KNEA 4CNVA 1I9LA 4Q8YA 4RIVA 1FQRA 1CAOA 1YO0A 4KV0A 4FRCA 1I8ZA 5E2SA 1XEVA 3FW3A 3N2PA 3C7PA 3D9ZA 4YX4A 1G0FA 3ML5A 1FSNA 3FE4A 4L5WA 3RYVB 4G7AA 5EH8A 5CA2A 3M40A 4DZ7A 3M2ZA 4QJWA 3S72B 5E28A 2CABA 4ILXA 3V3GB 4RFDA 3W6HA 1I9MA 1DMXA 3SAXA 1TH9A 3HLJA 2Q38A 3MDZA 4Q7SA 3TMJA 4C3TA 3OIKA 1HECA 1IF5A 1CVFA 2WEGA 2CBEA 4KNMA 3M96A 4YHAA 3DVBA 3DVCA 5JDVB 3S73B 1LUGA 5EKJA 5DOGA 1CNGA 4YWPA 3DBUA 1G4OA 2VVAX 2FOUA 2NWYA 4MTYA 4HEWA 3MNHA 5G01A 1IF6A 5FL6A 5FNMA 3HFPA 4CQ0A 4M2RA 5EHVA 4L5UA 2H4NA 4ITOA 1BICA 3D93A 1CAJA 3M67A 5FDIA 1YDDA 4Q81A 4LHIA 4Q8XA 2FOYA 3MYQA 2HKKA 1G48A 5EKMA 2EU3A 3M5TA 1OKLA 4Q78A 1TG3A 2IT4A 1CZMA 3HS4A 4X5SA 3V3HB 2QOAA 5L6KA 2X7SA 1UGCA 3PO6A 3MMFA 4XE1A 5IPZA 1BNTA 1CA3A 3FFPX 1BNMA 1ZSBA 4ZAOA 1CCSA 4G0CA 1G0EA 5EHWA 3BL0A 1FR7A 5FDCA 4R5BA 3S71B 4HBAA 4Z1KA 4Q08A 3RG3A 2Q1QA 3IBLA 5DSLA 4QJOA 3M2XA 5EIJA 3HKQA 1ZNCA 2NN7A 4YXIA 3DVDA 3P3JA 1KWQA 4K0SA 1CNBA 1KEQA 1JD0A 1CNCA 1V9IC 4FVOA 4CNRA 1UGDA 3T82A 5EKHA 3S78B 1TEUX 4E4AA 5G0CA 1AZMA 3M5EA 3DCCA 4ZWXA 3IBUA 4N0XB 3NB5A 1G52A 1MUAA 4WW6A 4RH2A 2FNNA 4ZWYA 3M04A 7CA2A 4YXUA 4Q87A 4YGFA 1G3ZA 4K13A 1RZEA 1LZVA 1T9NA 4MLXA 5FNJA 4Z1EA 4FPTA 3KKXA 3MNUA 4IWZA 1CAHA 3S77B 4M2UA 4JSWA 5E5RA 1BNUA 1AVNA 1G54A 2HOCA 3RG4A 2NNGA 3D8WA 5SZ4A 1CNJA 1DMYA 4CACA 1RZCA 2ZNCA 1ZSCA 5EZTX 5BNLA 5E2MA 4CA2A 3OYQA 4ZX0A 4RUYA 2NXRA 5EH5A 1TTMA 3RYXB 1TEQX 3DD0A 3MNAA 1THKA 1KWRA 4KP8A 3S74B 1CVCA 4GL1X 5SZ6A 3MNJA
chains in the Genus database with same CATH topology
3JXGA 4L5VA 4QSBA 4Z1JA 4XZ5A 4YGNA 3UYQA 1I90A 3M5SA 3CZVA 4JS6A 1XPZA 1FLJA 3IBIA 4ITPA 4LP6A 5LMDA 1CRMA 1UGGA 3M3XA 3N4BA 1I91A 4QK1A 3L14A 3P3HA 4E3HA 1URTA 5DSPA 5JG3B 4HF3A 1UGBA 1KOPA 5BRUA 2X7UA 1ZE8A 4QJMA 1UGAA 1TB0X 3M2YA 3F7BA 4XIWA 4FL7A 4R5AA 1Z97A 3P4VA 3OIMA 1CVHA 4MDLA 1XEGA 3PJJA 5DSKA 4BF6A 4Z1NA 1FSRA 1CAYA 1CVEA 1CNXA 4MDMA 3TVOX 1CALA 1CANA 1G4JA 1BV3A 4KUWA 2EZ7A 3V5GA 2POWA 2EU2A 3DAZA 3MZCA 3JXHC 1MOOA 1RJ5A 4XIXA 3F7UA 4QSAA 2O4ZA 4N16A 4KP5A 4YVYA 3VBDA 3T85A 1ZFQA 1YDCA 1BNNA 2NXSA 3DCSA 3MHIA 1JCZA 3SBIA 1UGEA 5DSNA 3V3JA 3M1KA 2HD6A 1Z9YA 1FQNA 3BL1A 3T5UA 4E3FA 1IF8A 3S8XA 5E2KA 1RJ6A 2F14A 3IEOA 3S9TA 2CBCA 2CBDA 4QK3A 5EHEA 3W6IA 1G6VA 3V7XA 1ZH9A 3M1JA 1F2WA 3QYKA 3P44A 3IGPA 4PXXA 3M2NA 1JV0A 1IF9A 4YGLA 5A6HA 1UGFA 3S75B 1I9NA 3KOIA 4Q6DA 2AW1A 2WD2A 1CINA 1CAIA 3KONA 4JSZA 4KNJA 3MHMA 5JEGB 5DRSA 4QIZA 2WEHA 2FNKA 1HUHA 5EH7A 3SAPA 5JG5B 4QJ0A 5SZ2A 3DD8A 5FNLA 4WUPA 3MNKA 3RZ0B 4BF1A 3ML2A 1AM6A 1G53A 4BCWA 3DA2A 5DSRA 4Y0JA 3K2FA 1G45A 4R59A 5BRVA 4CNWA 1CILA 2POVA 1TBTX 5JQ0A 2QP6A 2NMXA 3CAJA 2NNSA 2FMGA 4QSJA 1I9PA 1J9WA 5SZ0A 3M14A 2AX2A 3PYKA 5SZ3A 2NWZA 5FL5A 5G03A 4KAPA 3KS3A 1KOQA 4COQA 1FQMA 3BETA 5L3OA 2NXTA 5FLSA 1CVAA 3IAIA 1CRAA 3GZ0A 2OSMA 1HEBA 3DCWA 6CA2A 2ILIA 3P55A 4RN4A 4XFWA 4YGJA 3ZNCA 4E3DA 4Q7WA 2FOSA 1CVDA 9CA2A 4Q0LA 1YDBA 5FLPA 4PYYA 1CAKA 5FNHA 4WL4A 5JGSB 1ZGEA 1FQLA 2QO8A 1HCBA 8CA2A 5SZ7A 5DSOA 1RAYA 3DC9A 5FLTA 3CA2A 3EFIA 3U47A 1OKNA 4TWLA 4YXOA 2H15A 3T84A 4E5QA 2VVBX 1XQ0A 1CNHA 4MLTA 4RFCA 4QY3A 1RZBA 3HKNA 3MHLA 1BZMA 3Q31A 4KUVA 1LG5A 3P5AA 4PQ7A 2NNOA 3M1WA 4PYXA 1IF7A 4HT0A 2HL4A 4KUYA 5HPJA 4Q83A 3T83A 4Q09A 4QK2A 4YYTA 5DSIA 5SZ1A 2FOQA 1YO1A 4UOVA 1CNYA 3M1QA 1BNQA 5CLUA 5E2NA 4KNIA 5JESB 5FNIA 3JXFA 3MHCA 2OSFA 2W2JA 1CVBA 3KLDB 1Y7WA 5FL4A 4MDGA 3S76A 3OYSA 1Z93A 1ZFKA 3U45X 3B4FA 4FU5A 3KOKA 3RJ7A 5E5UA 4RUZA 3M98A 4M2VA 5J8ZA 2NWPA 4HU1A 4KNNA 4QJPA 1HCAA 4K0ZA 3CYUA 1BNWA 1TG9A 4Q7VA 4QJXA 4RUXA 4Q7PA 1CAMA 2NN1A 4HEYA 3ZP9A 4Q06A 1RAZA 3F8EA 4ZWIA 3RGEA 5SZ5A 1ZSAA 4WUQA 2NWOA 1LG6A 3K34A 3MHOA 3UYNA 5DSMA 1H9NA 4PZHA 4Q07A 4QIYA 4E49A 4ETQC 1BNVA 4YGKA 4JSAA 5FLOA 4Q8ZA 2POUA 3D92A 1V9EA 1G46A 1YDAA 3KIGA 5JEHB 1CIMA 5AMDA 5A25A 5DSJA 4WW8A 5DOHA 4Q99A 3U7CA 4ZWZA 1DCAA 5JEPB 5EOIA 4JSSA 3RZ8A 1CCTA 3RZ7A 1OQ5A 3OKUA 5DVXA 2HFWA 5CJFA 5C8IA 1HEDA 2CBAA 3U3AX 3NJ9A 4ZX1A 1CNWA 3EFTA 4TWMA 4DZ9A 5JQTA 3RZ5A 1HUGA 3V3IB 1CCUA 2FMZA 4FVNA 3OILA 5E2RA 5BRWA 1LGDA 1RZDA 3SBHA 1HVAA 2FOVA 2GEHA 3IBNA 1DCBA 3V3FA 1CAZA 1H9QA 1G1DA 2WEOA 4Q9YA 5DSQA 3V2MA 1ZGFA 4HT2A 1IF4A 5AMLA 4FIKA 1BN3A 1BN1A 3NI5A 12CAA 2WEJA 2X7TA 1I9QA 4IDRX 1CA2A 4K1QA 1HEAA 3S97A 3V2JA 2HNCA 3R17B 3F4XA 5G0BA 3P5LA 1RZAA 3RYYA 4M2WA 5CACA 3N3JA 4Q6EA 1A42A 4Q49A 3D0NA 3R16A 2WD3A 1OKMA 2FNMA 5BYIA 4Q90A 3T5ZA 3TVNX 1TE3X 2CA2A 5AMGA 4E9OX 4RIUA 2Q1BA 3LXEA 4K0TA 3N0NA 1I9OA 3RYZA 1YO2A 3B1BA 1CNKA 3MNIA 2ABEA 3HKTA 5JGTB 4Z0QA 5FLRA 1BN4A 3OY0A 5FNKA 4HEZA 4QEFA 3HKUA 4CNXA 4QTLA 3K7KA 4LU3A 2NNVA 5FNGA 4MO8A 3KWAA 4WR7A 2FW4A 3RZ1B 3OKVA 2GD8A 3DV7A 5FLQA 3MWOA 1FR4A 1H4NA 1EOUA 4E3GA 3RLDA 1FSQA 3P58A 1BCDA 2CBBA 3DC3A 1CNIA 3RYJB 4QSIA 3KNEA 4CNVA 1I9LA 4Q8YA 4RIVA 1FQRA 1CAOA 1YO0A 4KV0A 4FRCA 1I8ZA 5E2SA 1XEVA 3FW3A 3N2PA 3C7PA 3D9ZA 4YX4A 1G0FA 3ML5A 1FSNA 3FE4A 4L5WA 3RYVB 4G7AA 5EH8A 5CA2A 3M40A 4DZ7A 3M2ZA 4QJWA 3S72B 5E28A 2CABA 4ILXA 3V3GB 4RFDA 3W6HA 1I9MA 1DMXA 3SAXA 1TH9A 3HLJA 2Q38A 3MDZA 4Q7SA 3TMJA 4C3TA 3OIKA 1HECA 1IF5A 1CVFA 2WEGA 2CBEA 4KNMA 3M96A 4YHAA 3DVBA 3DVCA 5JDVB 3S73B 1LUGA 5EKJA 5DOGA 1CNGA 4YWPA 3DBUA 1G4OA 2VVAX 2FOUA 2NWYA 4MTYA 4HEWA 3MNHA 5G01A 1IF6A 5FL6A 5FNMA 3HFPA 4CQ0A 4M2RA 5EHVA 4L5UA 2H4NA 4ITOA 1BICA 3D93A 1CAJA 3M67A 5FDIA 1YDDA 4Q81A 4LHIA 4Q8XA 2FOYA 3MYQA 2HKKA 1G48A 5EKMA 2EU3A 3M5TA 1OKLA 4Q78A 1TG3A 2IT4A 1CZMA 3HS4A 4X5SA 3V3HB 2QOAA 5L6KA 2X7SA 1UGCA 3PO6A 3MMFA 4XE1A 5IPZA 1BNTA 1CA3A 3FFPX 1BNMA 1ZSBA 4ZAOA 1CCSA 4G0CA 1G0EA 5EHWA 3BL0A 1FR7A 5FDCA 4R5BA 3S71B 4HBAA 4Z1KA 4Q08A 3RG3A 2Q1QA 3IBLA 5DSLA 4QJOA 3M2XA 5EIJA 3HKQA 1ZNCA 2NN7A 4YXIA 3DVDA 3P3JA 1KWQA 4K0SA 1CNBA 1KEQA 1JD0A 1CNCA 1V9IC 4FVOA 4CNRA 1UGDA 3T82A 5EKHA 3S78B 1TEUX 4E4AA 5G0CA 1AZMA 3M5EA 3DCCA 4ZWXA 3IBUA 4N0XB 3NB5A 1G52A 1MUAA 4WW6A 4RH2A 2FNNA 4ZWYA 3M04A 7CA2A 4YXUA 4Q87A 4YGFA 1G3ZA 4K13A 1RZEA 1LZVA 1T9NA 4MLXA 5FNJA 4Z1EA 4FPTA 3KKXA 3MNUA 4IWZA 1CAHA 3S77B 4M2UA 4JSWA 5E5RA 1BNUA 1AVNA 1G54A 2HOCA 3RG4A 2NNGA 3D8WA 5SZ4A 1CNJA 1DMYA 4CACA 1RZCA 2ZNCA 1ZSCA 5EZTX 5BNLA 5E2MA 4CA2A 3OYQA 4ZX0A 4RUYA 2NXRA 5EH5A 1TTMA 3RYXB 1TEQX 3DD0A 3MNAA 1THKA 1KWRA 4KP8A 3S74B 1CVCA 4GL1X 5SZ6A 3MNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXG A;  4L5V A;  4QSB A;  4Z1J A;  4XZ5 A;  4YGN A;  3UYQ A;  1I90 A;  3M5S A;  3CZV A;  4JS6 A;  1XPZ A;  1FLJ A;  3IBI A;  4ITP A;  4LP6 A;  5LMD A;  1CRM A;  1UGG A;  3M3X A;  3N4B A;  1I91 A;  4QK1 A;  3L14 A;  3P3H A;  4E3H A;  1URT A;  5DSP A;  5JG3 B;  4HF3 A;  1UGB A;  1KOP A;  5BRU A;  2X7U A;  1ZE8 A;  4QJM A;  1UGA A;  1TB0 X;  3M2Y A;  3F7B A;  4XIW A;  4FL7 A;  4R5A A;  1Z97 A;  3P4V A;  3OIM A;  1CVH A;  4MDL A;  1XEG A;  3PJJ A;  5DSK A;  4BF6 A;  4Z1N A;  1FSR A;  1CAY A;  1CVE A;  1CNX A;  4MDM A;  3TVO X;  1CAL A;  1CAN A;  1G4J A;  1BV3 A;  4KUW A;  2EZ7 A;  3V5G A;  2POW A;  2EU2 A;  3DAZ A;  3MZC A;  3JXH C;  1MOO A;  1RJ5 A;  4XIX A;  3F7U A;  4QSA A;  2O4Z A;  4N16 A;  4KP5 A;  4YVY A;  3VBD A;  3T85 A;  1ZFQ A;  1YDC A;  1BNN A;  2NXS A;  3DCS A;  3MHI A;  1JCZ A;  3SBI A;  1UGE A;  5DSN A;  3V3J A;  3M1K A;  2HD6 A;  1Z9Y A;  1FQN A;  3BL1 A;  3T5U A;  4E3F A;  1IF8 A;  3S8X A;  5E2K A;  1RJ6 A;  2F14 A;  3IEO A;  3S9T A;  2CBC A;  2CBD A;  4QK3 A;  5EHE A;  3W6I A;  1G6V A;  3V7X A;  1ZH9 A;  3M1J A;  1F2W A;  3QYK A;  3P44 A;  3IGP A;  4PXX A;  3M2N A;  1JV0 A;  1IF9 A;  4YGL A;  5A6H A;  1UGF A;  3S75 B;  1I9N A;  3KOI A;  4Q6D A;  2AW1 A;  2WD2 A;  1CIN A;  1CAI A;  3KON A;  4JSZ A;  4KNJ A;  3MHM A;  5JEG B;  5DRS A;  4QIZ A;  2WEH A;  2FNK A;  1HUH A;  5EH7 A;  3SAP A;  5JG5 B;  4QJ0 A;  5SZ2 A;  3DD8 A;  5FNL A;  4WUP A;  3MNK A;  3RZ0 B;  4BF1 A;  3ML2 A;  1AM6 A;  1G53 A;  4BCW A;  3DA2 A;  5DSR A;  4Y0J A;  3K2F A;  1G45 A;  4R59 A;  5BRV A;  4CNW A;  1CIL A;  2POV A;  1TBT X;  5JQ0 A;  2QP6 A;  2NMX A;  3CAJ A;  2NNS A;  2FMG A;  4QSJ A;  1I9P A;  1J9W A;  5SZ0 A;  3M14 A;  2AX2 A;  3PYK A;  5SZ3 A;  2NWZ A;  5FL5 A;  5G03 A;  4KAP A;  3KS3 A;  1KOQ A;  4COQ A;  1FQM A;  3BET A;  5L3O A;  2NXT A;  5FLS A;  1CVA A;  3IAI A;  1CRA A;  3GZ0 A;  2OSM A;  1HEB A;  3DCW A;  6CA2 A;  2ILI A;  3P55 A;  4RN4 A;  4XFW A;  4YGJ A;  3ZNC A;  4E3D A;  4Q7W A;  2FOS A;  1CVD A;  9CA2 A;  4Q0L A;  1YDB A;  5FLP A;  4PYY A;  1CAK A;  5FNH A;  4WL4 A;  5JGS B;  1ZGE A;  1FQL A;  2QO8 A;  1HCB A;  8CA2 A;  5SZ7 A;  5DSO A;  1RAY A;  3DC9 A;  5FLT A;  3CA2 A;  3EFI A;  3U47 A;  1OKN A;  4TWL A;  4YXO A;  2H15 A;  3T84 A;  4E5Q A;  2VVB X;  1XQ0 A;  1CNH A;  4MLT A;  4RFC A;  4QY3 A;  1RZB A;  3HKN A;  3MHL A;  1BZM A;  3Q31 A;  4KUV A;  1LG5 A;  3P5A A;  4PQ7 A;  2NNO A;  3M1W A;  4PYX A;  1IF7 A;  4HT0 A;  2HL4 A;  4KUY A;  5HPJ A;  4Q83 A;  3T83 A;  4Q09 A;  4QK2 A;  4YYT A;  5DSI A;  5SZ1 A;  2FOQ A;  1YO1 A;  4UOV A;  1CNY A;  3M1Q A;  1BNQ A;  5CLU A;  5E2N A;  4KNI A;  5JES B;  5FNI A;  3JXF A;  3MHC A;  2OSF A;  2W2J A;  1CVB A;  3KLD B;  1Y7W A;  5FL4 A;  4MDG A;  3S76 A;  3OYS A;  1Z93 A;  1ZFK A;  3U45 X;  3B4F A;  4FU5 A;  3KOK A;  3RJ7 A;  5E5U A;  4RUZ A;  3M98 A;  4M2V A;  5J8Z A;  2NWP A;  4HU1 A;  4KNN A;  4QJP A;  1HCA A;  4K0Z A;  3CYU A;  1BNW A;  1TG9 A;  4Q7V A;  4QJX A;  4RUX A;  4Q7P A;  1CAM A;  2NN1 A;  4HEY A;  3ZP9 A;  4Q06 A;  1RAZ A;  3F8E A;  4ZWI A;  3RGE A;  5SZ5 A;  1ZSA A;  4WUQ A;  2NWO A;  1LG6 A;  3K34 A;  3MHO A;  3UYN A;  5DSM A;  1H9N A;  4PZH A;  4Q07 A;  4QIY A;  4E49 A;  4ETQ C;  1BNV A;  4YGK A;  4JSA A;  5FLO A;  4Q8Z A;  2POU A;  3D92 A;  1V9E A;  1G46 A;  1YDA A;  3KIG A;  5JEH B;  1CIM A;  5AMD A;  5A25 A;  5DSJ A;  4WW8 A;  5DOH A;  4Q99 A;  3U7C A;  4ZWZ A;  1DCA A;  5JEP B;  5EOI A;  4JSS A;  3RZ8 A;  1CCT A;  3RZ7 A;  1OQ5 A;  3OKU A;  5DVX A;  2HFW A;  5CJF A;  5C8I A;  1HED A;  2CBA A;  3U3A X;  3NJ9 A;  4ZX1 A;  1CNW A;  3EFT A;  4TWM A;  4DZ9 A;  5JQT A;  3RZ5 A;  1HUG A;  3V3I B;  1CCU A;  2FMZ A;  4FVN A;  3OIL A;  5E2R A;  5BRW A;  1LGD A;  1RZD A;  3SBH A;  1HVA A;  2FOV A;  2GEH A;  3IBN A;  1DCB A;  3V3F A;  1CAZ A;  1H9Q A;  1G1D A;  2WEO A;  4Q9Y A;  5DSQ A;  3V2M A;  1ZGF A;  4HT2 A;  1IF4 A;  5AML A;  4FIK A;  1BN3 A;  1BN1 A;  3NI5 A;  12CA A;  2WEJ A;  2X7T A;  1I9Q A;  4IDR X;  1CA2 A;  4K1Q A;  1HEA A;  3S97 A;  3V2J A;  2HNC A;  3R17 B;  3F4X A;  5G0B A;  3P5L A;  1RZA A;  3RYY A;  4M2W A;  5CAC A;  3N3J A;  4Q6E A;  1A42 A;  4Q49 A;  3D0N A;  3R16 A;  2WD3 A;  1OKM A;  2FNM A;  5BYI A;  4Q90 A;  3T5Z A;  3TVN X;  1TE3 X;  2CA2 A;  5AMG A;  4E9O X;  4RIU A;  2Q1B A;  3LXE A;  4K0T A;  3N0N A;  1I9O A;  3RYZ A;  1YO2 A;  3B1B A;  1CNK A;  3MNI A;  2ABE A;  3HKT A;  5JGT B;  4Z0Q A;  5FLR A;  1BN4 A;  3OY0 A;  5FNK A;  4HEZ A;  4QEF A;  3HKU A;  4CNX A;  4QTL A;  3K7K A;  4LU3 A;  2NNV A;  5FNG A;  4MO8 A;  3KWA A;  4WR7 A;  2FW4 A;  3RZ1 B;  3OKV A;  2GD8 A;  3DV7 A;  5FLQ A;  3MWO A;  1FR4 A;  1H4N A;  1EOU A;  4E3G A;  3RLD A;  1FSQ A;  3P58 A;  1BCD A;  2CBB A;  3DC3 A;  1CNI A;  3RYJ B;  4QSI A;  3KNE A;  4CNV A;  1I9L A;  4Q8Y A;  4RIV A;  1FQR A;  1CAO A;  1YO0 A;  4KV0 A;  4FRC A;  1I8Z A;  5E2S A;  1XEV A;  3FW3 A;  3N2P A;  3C7P A;  3D9Z A;  4YX4 A;  1G0F A;  3ML5 A;  1FSN A;  3FE4 A;  4L5W A;  3RYV B;  4G7A A;  5EH8 A;  5CA2 A;  3M40 A;  4DZ7 A;  3M2Z A;  4QJW A;  3S72 B;  5E28 A;  2CAB A;  4ILX A;  3V3G B;  4RFD A;  3W6H A;  1I9M A;  1DMX A;  3SAX A;  1TH9 A;  3HLJ A;  2Q38 A;  3MDZ A;  4Q7S A;  3TMJ A;  4C3T A;  3OIK A;  1HEC A;  1IF5 A;  1CVF A;  2WEG A;  2CBE A;  4KNM A;  3M96 A;  4YHA A;  3DVB A;  3DVC A;  5JDV B;  3S73 B;  1LUG A;  5EKJ A;  5DOG A;  1CNG A;  4YWP A;  3DBU A;  1G4O A;  2VVA X;  2FOU A;  2NWY A;  4MTY A;  4HEW A;  3MNH A;  5G01 A;  1IF6 A;  5FL6 A;  5FNM A;  3HFP A;  4CQ0 A;  4M2R A;  5EHV A;  4L5U A;  2H4N A;  4ITO A;  1BIC A;  3D93 A;  1CAJ A;  3M67 A;  5FDI A;  1YDD A;  4Q81 A;  4LHI A;  4Q8X A;  2FOY A;  3MYQ A;  2HKK A;  1G48 A;  5EKM A;  2EU3 A;  3M5T A;  1OKL A;  4Q78 A;  1TG3 A;  2IT4 A;  1CZM A;  3HS4 A;  4X5S A;  3V3H B;  2QOA A;  5L6K A;  2X7S A;  1UGC A;  3PO6 A;  3MMF A;  4XE1 A;  5IPZ A;  1BNT A;  1CA3 A;  3FFP X;  1BNM A;  1ZSB A;  4ZAO A;  1CCS A;  4G0C A;  1G0E A;  5EHW A;  3BL0 A;  1FR7 A;  5FDC A;  4R5B A;  3S71 B;  4HBA A;  4Z1K A;  4Q08 A;  3RG3 A;  2Q1Q A;  3IBL A;  5DSL A;  4QJO A;  3M2X A;  5EIJ A;  3HKQ A;  1ZNC A;  2NN7 A;  4YXI A;  3DVD A;  3P3J A;  1KWQ A;  4K0S A;  1CNB A;  1KEQ A;  1JD0 A;  1CNC A;  1V9I C;  4FVO A;  4CNR A;  1UGD A;  3T82 A;  5EKH A;  3S78 B;  1TEU X;  4E4A A;  5G0C A;  1AZM A;  3M5E A;  3DCC A;  4ZWX A;  3IBU A;  4N0X B;  3NB5 A;  1G52 A;  1MUA A;  4WW6 A;  4RH2 A;  2FNN A;  4ZWY A;  3M04 A;  7CA2 A;  4YXU A;  4Q87 A;  4YGF A;  1G3Z A;  4K13 A;  1RZE A;  1LZV A;  1T9N A;  4MLX A;  5FNJ A;  4Z1E A;  4FPT A;  3KKX A;  3MNU A;  4IWZ A;  1CAH A;  3S77 B;  4M2U A;  4JSW A;  5E5R A;  1BNU A;  1AVN A;  1G54 A;  2HOC A;  3RG4 A;  2NNG A;  3D8W A;  5SZ4 A;  1CNJ A;  1DMY A;  4CAC A;  1RZC A;  2ZNC A;  1ZSC A;  5EZT X;  5BNL A;  5E2M A;  4CA2 A;  3OYQ A;  4ZX0 A;  4RUY A;  2NXR A;  5EH5 A;  1TTM A;  3RYX B;  1TEQ X;  3DD0 A;  3MNA A;  1THK A;  1KWR A;  4KP8 A;  3S74 B;  1CVC A;  4GL1 X;  5SZ6 A;  3MNJ A; 
#chains in the Genus database with same CATH topology
 3JXG A;  4L5V A;  4QSB A;  4Z1J A;  4XZ5 A;  4YGN A;  3UYQ A;  1I90 A;  3M5S A;  3CZV A;  4JS6 A;  1XPZ A;  1FLJ A;  3IBI A;  4ITP A;  4LP6 A;  5LMD A;  1CRM A;  1UGG A;  3M3X A;  3N4B A;  1I91 A;  4QK1 A;  3L14 A;  3P3H A;  4E3H A;  1URT A;  5DSP A;  5JG3 B;  4HF3 A;  1UGB A;  1KOP A;  5BRU A;  2X7U A;  1ZE8 A;  4QJM A;  1UGA A;  1TB0 X;  3M2Y A;  3F7B A;  4XIW A;  4FL7 A;  4R5A A;  1Z97 A;  3P4V A;  3OIM A;  1CVH A;  4MDL A;  1XEG A;  3PJJ A;  5DSK A;  4BF6 A;  4Z1N A;  1FSR A;  1CAY A;  1CVE A;  1CNX A;  4MDM A;  3TVO X;  1CAL A;  1CAN A;  1G4J A;  1BV3 A;  4KUW A;  2EZ7 A;  3V5G A;  2POW A;  2EU2 A;  3DAZ A;  3MZC A;  3JXH C;  1MOO A;  1RJ5 A;  4XIX A;  3F7U A;  4QSA A;  2O4Z A;  4N16 A;  4KP5 A;  4YVY A;  3VBD A;  3T85 A;  1ZFQ A;  1YDC A;  1BNN A;  2NXS A;  3DCS A;  3MHI A;  1JCZ A;  3SBI A;  1UGE A;  5DSN A;  3V3J A;  3M1K A;  2HD6 A;  1Z9Y A;  1FQN A;  3BL1 A;  3T5U A;  4E3F A;  1IF8 A;  3S8X A;  5E2K A;  1RJ6 A;  2F14 A;  3IEO A;  3S9T A;  2CBC A;  2CBD A;  4QK3 A;  5EHE A;  3W6I A;  1G6V A;  3V7X A;  1ZH9 A;  3M1J A;  1F2W A;  3QYK A;  3P44 A;  3IGP A;  4PXX A;  3M2N A;  1JV0 A;  1IF9 A;  4YGL A;  5A6H A;  1UGF A;  3S75 B;  1I9N A;  3KOI A;  4Q6D A;  2AW1 A;  2WD2 A;  1CIN A;  1CAI A;  3KON A;  4JSZ A;  4KNJ A;  3MHM A;  5JEG B;  5DRS A;  4QIZ A;  2WEH A;  2FNK A;  1HUH A;  5EH7 A;  3SAP A;  5JG5 B;  4QJ0 A;  5SZ2 A;  3DD8 A;  5FNL A;  4WUP A;  3MNK A;  3RZ0 B;  4BF1 A;  3ML2 A;  1AM6 A;  1G53 A;  4BCW A;  3DA2 A;  5DSR A;  4Y0J A;  3K2F A;  1G45 A;  4R59 A;  5BRV A;  4CNW A;  1CIL A;  2POV A;  1TBT X;  5JQ0 A;  2QP6 A;  2NMX A;  3CAJ A;  2NNS A;  2FMG A;  4QSJ A;  1I9P A;  1J9W A;  5SZ0 A;  3M14 A;  2AX2 A;  3PYK A;  5SZ3 A;  2NWZ A;  5FL5 A;  5G03 A;  4KAP A;  3KS3 A;  1KOQ A;  4COQ A;  1FQM A;  3BET A;  5L3O A;  2NXT A;  5FLS A;  1CVA A;  3IAI A;  1CRA A;  3GZ0 A;  2OSM A;  1HEB A;  3DCW A;  6CA2 A;  2ILI A;  3P55 A;  4RN4 A;  4XFW A;  4YGJ A;  3ZNC A;  4E3D A;  4Q7W A;  2FOS A;  1CVD A;  9CA2 A;  4Q0L A;  1YDB A;  5FLP A;  4PYY A;  1CAK A;  5FNH A;  4WL4 A;  5JGS B;  1ZGE A;  1FQL A;  2QO8 A;  1HCB A;  8CA2 A;  5SZ7 A;  5DSO A;  1RAY A;  3DC9 A;  5FLT A;  3CA2 A;  3EFI A;  3U47 A;  1OKN A;  4TWL A;  4YXO A;  2H15 A;  3T84 A;  4E5Q A;  2VVB X;  1XQ0 A;  1CNH A;  4MLT A;  4RFC A;  4QY3 A;  1RZB A;  3HKN A;  3MHL A;  1BZM A;  3Q31 A;  4KUV A;  1LG5 A;  3P5A A;  4PQ7 A;  2NNO A;  3M1W A;  4PYX A;  1IF7 A;  4HT0 A;  2HL4 A;  4KUY A;  5HPJ A;  4Q83 A;  3T83 A;  4Q09 A;  4QK2 A;  4YYT A;  5DSI A;  5SZ1 A;  2FOQ A;  1YO1 A;  4UOV A;  1CNY A;  3M1Q A;  1BNQ A;  5CLU A;  5E2N A;  4KNI A;  5JES B;  5FNI A;  3JXF A;  3MHC A;  2OSF A;  2W2J A;  1CVB A;  3KLD B;  1Y7W A;  5FL4 A;  4MDG A;  3S76 A;  3OYS A;  1Z93 A;  1ZFK A;  3U45 X;  3B4F A;  4FU5 A;  3KOK A;  3RJ7 A;  5E5U A;  4RUZ A;  3M98 A;  4M2V A;  5J8Z A;  2NWP A;  4HU1 A;  4KNN A;  4QJP A;  1HCA A;  4K0Z A;  3CYU A;  1BNW A;  1TG9 A;  4Q7V A;  4QJX A;  4RUX A;  4Q7P A;  1CAM A;  2NN1 A;  4HEY A;  3ZP9 A;  4Q06 A;  1RAZ A;  3F8E A;  4ZWI A;  3RGE A;  5SZ5 A;  1ZSA A;  4WUQ A;  2NWO A;  1LG6 A;  3K34 A;  3MHO A;  3UYN A;  5DSM A;  1H9N A;  4PZH A;  4Q07 A;  4QIY A;  4E49 A;  4ETQ C;  1BNV A;  4YGK A;  4JSA A;  5FLO A;  4Q8Z A;  2POU A;  3D92 A;  1V9E A;  1G46 A;  1YDA A;  3KIG A;  5JEH B;  1CIM A;  5AMD A;  5A25 A;  5DSJ A;  4WW8 A;  5DOH A;  4Q99 A;  3U7C A;  4ZWZ A;  1DCA A;  5JEP B;  5EOI A;  4JSS A;  3RZ8 A;  1CCT A;  3RZ7 A;  1OQ5 A;  3OKU A;  5DVX A;  2HFW A;  5CJF A;  5C8I A;  1HED A;  2CBA A;  3U3A X;  3NJ9 A;  4ZX1 A;  1CNW A;  3EFT A;  4TWM A;  4DZ9 A;  5JQT A;  3RZ5 A;  1HUG A;  3V3I B;  1CCU A;  2FMZ A;  4FVN A;  3OIL A;  5E2R A;  5BRW A;  1LGD A;  1RZD A;  3SBH A;  1HVA A;  2FOV A;  2GEH A;  3IBN A;  1DCB A;  3V3F A;  1CAZ A;  1H9Q A;  1G1D A;  2WEO A;  4Q9Y A;  5DSQ A;  3V2M A;  1ZGF A;  4HT2 A;  1IF4 A;  5AML A;  4FIK A;  1BN3 A;  1BN1 A;  3NI5 A;  12CA A;  2WEJ A;  2X7T A;  1I9Q A;  4IDR X;  1CA2 A;  4K1Q A;  1HEA A;  3S97 A;  3V2J A;  2HNC A;  3R17 B;  3F4X A;  5G0B A;  3P5L A;  1RZA A;  3RYY A;  4M2W A;  5CAC A;  3N3J A;  4Q6E A;  1A42 A;  4Q49 A;  3D0N A;  3R16 A;  2WD3 A;  1OKM A;  2FNM A;  5BYI A;  4Q90 A;  3T5Z A;  3TVN X;  1TE3 X;  2CA2 A;  5AMG A;  4E9O X;  4RIU A;  2Q1B A;  3LXE A;  4K0T A;  3N0N A;  1I9O A;  3RYZ A;  1YO2 A;  3B1B A;  1CNK A;  3MNI A;  2ABE A;  3HKT A;  5JGT B;  4Z0Q A;  5FLR A;  1BN4 A;  3OY0 A;  5FNK A;  4HEZ A;  4QEF A;  3HKU A;  4CNX A;  4QTL A;  3K7K A;  4LU3 A;  2NNV A;  5FNG A;  4MO8 A;  3KWA A;  4WR7 A;  2FW4 A;  3RZ1 B;  3OKV A;  2GD8 A;  3DV7 A;  5FLQ A;  3MWO A;  1FR4 A;  1H4N A;  1EOU A;  4E3G A;  3RLD A;  1FSQ A;  3P58 A;  1BCD A;  2CBB A;  3DC3 A;  1CNI A;  3RYJ B;  4QSI A;  3KNE A;  4CNV A;  1I9L A;  4Q8Y A;  4RIV A;  1FQR A;  1CAO A;  1YO0 A;  4KV0 A;  4FRC A;  1I8Z A;  5E2S A;  1XEV A;  3FW3 A;  3N2P A;  3C7P A;  3D9Z A;  4YX4 A;  1G0F A;  3ML5 A;  1FSN A;  3FE4 A;  4L5W A;  3RYV B;  4G7A A;  5EH8 A;  5CA2 A;  3M40 A;  4DZ7 A;  3M2Z A;  4QJW A;  3S72 B;  5E28 A;  2CAB A;  4ILX A;  3V3G B;  4RFD A;  3W6H A;  1I9M A;  1DMX A;  3SAX A;  1TH9 A;  3HLJ A;  2Q38 A;  3MDZ A;  4Q7S A;  3TMJ A;  4C3T A;  3OIK A;  1HEC A;  1IF5 A;  1CVF A;  2WEG A;  2CBE A;  4KNM A;  3M96 A;  4YHA A;  3DVB A;  3DVC A;  5JDV B;  3S73 B;  1LUG A;  5EKJ A;  5DOG A;  1CNG A;  4YWP A;  3DBU A;  1G4O A;  2VVA X;  2FOU A;  2NWY A;  4MTY A;  4HEW A;  3MNH A;  5G01 A;  1IF6 A;  5FL6 A;  5FNM A;  3HFP A;  4CQ0 A;  4M2R A;  5EHV A;  4L5U A;  2H4N A;  4ITO A;  1BIC A;  3D93 A;  1CAJ A;  3M67 A;  5FDI A;  1YDD A;  4Q81 A;  4LHI A;  4Q8X A;  2FOY A;  3MYQ A;  2HKK A;  1G48 A;  5EKM A;  2EU3 A;  3M5T A;  1OKL A;  4Q78 A;  1TG3 A;  2IT4 A;  1CZM A;  3HS4 A;  4X5S A;  3V3H B;  2QOA A;  5L6K A;  2X7S A;  1UGC A;  3PO6 A;  3MMF A;  4XE1 A;  5IPZ A;  1BNT A;  1CA3 A;  3FFP X;  1BNM A;  1ZSB A;  4ZAO A;  1CCS A;  4G0C A;  1G0E A;  5EHW A;  3BL0 A;  1FR7 A;  5FDC A;  4R5B A;  3S71 B;  4HBA A;  4Z1K A;  4Q08 A;  3RG3 A;  2Q1Q A;  3IBL A;  5DSL A;  4QJO A;  3M2X A;  5EIJ A;  3HKQ A;  1ZNC A;  2NN7 A;  4YXI A;  3DVD A;  3P3J A;  1KWQ A;  4K0S A;  1CNB A;  1KEQ A;  1JD0 A;  1CNC A;  1V9I C;  4FVO A;  4CNR A;  1UGD A;  3T82 A;  5EKH A;  3S78 B;  1TEU X;  4E4A A;  5G0C A;  1AZM A;  3M5E A;  3DCC A;  4ZWX A;  3IBU A;  4N0X B;  3NB5 A;  1G52 A;  1MUA A;  4WW6 A;  4RH2 A;  2FNN A;  4ZWY A;  3M04 A;  7CA2 A;  4YXU A;  4Q87 A;  4YGF A;  1G3Z A;  4K13 A;  1RZE A;  1LZV A;  1T9N A;  4MLX A;  5FNJ A;  4Z1E A;  4FPT A;  3KKX A;  3MNU A;  4IWZ A;  1CAH A;  3S77 B;  4M2U A;  4JSW A;  5E5R A;  1BNU A;  1AVN A;  1G54 A;  2HOC A;  3RG4 A;  2NNG A;  3D8W A;  5SZ4 A;  1CNJ A;  1DMY A;  4CAC A;  1RZC A;  2ZNC A;  1ZSC A;  5EZT X;  5BNL A;  5E2M A;  4CA2 A;  3OYQ A;  4ZX0 A;  4RUY A;  2NXR A;  5EH5 A;  1TTM A;  3RYX B;  1TEQ X;  3DD0 A;  3MNA A;  1THK A;  1KWR A;  4KP8 A;  3S74 B;  1CVC A;  4GL1 X;  5SZ6 A;  3MNJ A; 
#chains in the Genus database with same CATH homology
 3JXG A;  4L5V A;  4QSB A;  4Z1J A;  4XZ5 A;  4YGN A;  3UYQ A;  1I90 A;  3M5S A;  3CZV A;  4JS6 A;  1XPZ A;  1FLJ A;  3IBI A;  4ITP A;  4LP6 A;  5LMD A;  1CRM A;  1UGG A;  3M3X A;  3N4B A;  1I91 A;  4QK1 A;  3L14 A;  3P3H A;  4E3H A;  1URT A;  5DSP A;  5JG3 B;  4HF3 A;  1UGB A;  1KOP A;  5BRU A;  2X7U A;  1ZE8 A;  4QJM A;  1UGA A;  1TB0 X;  3M2Y A;  3F7B A;  4XIW A;  4FL7 A;  4R5A A;  1Z97 A;  3P4V A;  3OIM A;  1CVH A;  4MDL A;  1XEG A;  3PJJ A;  5DSK A;  4BF6 A;  4Z1N A;  1FSR A;  1CAY A;  1CVE A;  1CNX A;  4MDM A;  3TVO X;  1CAL A;  1CAN A;  1G4J A;  1BV3 A;  4KUW A;  2EZ7 A;  3V5G A;  2POW A;  2EU2 A;  3DAZ A;  3MZC A;  3JXH C;  1MOO A;  1RJ5 A;  4XIX A;  3F7U A;  4QSA A;  2O4Z A;  4N16 A;  4KP5 A;  4YVY A;  3VBD A;  3T85 A;  1ZFQ A;  1YDC A;  1BNN A;  2NXS A;  3DCS A;  3MHI A;  1JCZ A;  3SBI A;  1UGE A;  5DSN A;  3V3J A;  3M1K A;  2HD6 A;  1Z9Y A;  1FQN A;  3BL1 A;  3T5U A;  4E3F A;  1IF8 A;  3S8X A;  5E2K A;  1RJ6 A;  2F14 A;  3IEO A;  3S9T A;  2CBC A;  2CBD A;  4QK3 A;  5EHE A;  3W6I A;  1G6V A;  3V7X A;  1ZH9 A;  3M1J A;  1F2W A;  3QYK A;  3P44 A;  3IGP A;  4PXX A;  3M2N A;  1JV0 A;  1IF9 A;  4YGL A;  5A6H A;  1UGF A;  3S75 B;  1I9N A;  3KOI A;  4Q6D A;  2AW1 A;  2WD2 A;  1CIN A;  1CAI A;  3KON A;  4JSZ A;  4KNJ A;  3MHM A;  5JEG B;  5DRS A;  4QIZ A;  2WEH A;  2FNK A;  1HUH A;  5EH7 A;  3SAP A;  5JG5 B;  4QJ0 A;  5SZ2 A;  3DD8 A;  5FNL A;  4WUP A;  3MNK A;  3RZ0 B;  4BF1 A;  3ML2 A;  1AM6 A;  1G53 A;  4BCW A;  3DA2 A;  5DSR A;  4Y0J A;  3K2F A;  1G45 A;  4R59 A;  5BRV A;  4CNW A;  1CIL A;  2POV A;  1TBT X;  5JQ0 A;  2QP6 A;  2NMX A;  3CAJ A;  2NNS A;  2FMG A;  4QSJ A;  1I9P A;  1J9W A;  5SZ0 A;  3M14 A;  2AX2 A;  3PYK A;  5SZ3 A;  2NWZ A;  5FL5 A;  5G03 A;  4KAP A;  3KS3 A;  1KOQ A;  4COQ A;  1FQM A;  3BET A;  5L3O A;  2NXT A;  5FLS A;  1CVA A;  3IAI A;  1CRA A;  3GZ0 A;  2OSM A;  1HEB A;  3DCW A;  6CA2 A;  2ILI A;  3P55 A;  4RN4 A;  4XFW A;  4YGJ A;  3ZNC A;  4E3D A;  4Q7W A;  2FOS A;  1CVD A;  9CA2 A;  4Q0L A;  1YDB A;  5FLP A;  4PYY A;  1CAK A;  5FNH A;  4WL4 A;  5JGS B;  1ZGE A;  1FQL A;  2QO8 A;  1HCB A;  8CA2 A;  5SZ7 A;  5DSO A;  1RAY A;  3DC9 A;  5FLT A;  3CA2 A;  3EFI A;  3U47 A;  1OKN A;  4TWL A;  4YXO A;  2H15 A;  3T84 A;  4E5Q A;  2VVB X;  1XQ0 A;  1CNH A;  4MLT A;  4RFC A;  4QY3 A;  1RZB A;  3HKN A;  3MHL A;  1BZM A;  3Q31 A;  4KUV A;  1LG5 A;  3P5A A;  4PQ7 A;  2NNO A;  3M1W A;  4PYX A;  1IF7 A;  4HT0 A;  2HL4 A;  4KUY A;  5HPJ A;  4Q83 A;  3T83 A;  4Q09 A;  4QK2 A;  4YYT A;  5DSI A;  5SZ1 A;  2FOQ A;  1YO1 A;  4UOV A;  1CNY A;  3M1Q A;  1BNQ A;  5CLU A;  5E2N A;  4KNI A;  5JES B;  5FNI A;  3JXF A;  3MHC A;  2OSF A;  2W2J A;  1CVB A;  3KLD B;  1Y7W A;  5FL4 A;  4MDG A;  3S76 A;  3OYS A;  1Z93 A;  1ZFK A;  3U45 X;  3B4F A;  4FU5 A;  3KOK A;  3RJ7 A;  5E5U A;  4RUZ A;  3M98 A;  4M2V A;  5J8Z A;  2NWP A;  4HU1 A;  4KNN A;  4QJP A;  1HCA A;  4K0Z A;  3CYU A;  1BNW A;  1TG9 A;  4Q7V A;  4QJX A;  4RUX A;  4Q7P A;  1CAM A;  2NN1 A;  4HEY A;  3ZP9 A;  4Q06 A;  1RAZ A;  3F8E A;  4ZWI A;  3RGE A;  5SZ5 A;  1ZSA A;  4WUQ A;  2NWO A;  1LG6 A;  3K34 A;  3MHO A;  3UYN A;  5DSM A;  1H9N A;  4PZH A;  4Q07 A;  4QIY A;  4E49 A;  4ETQ C;  1BNV A;  4YGK A;  4JSA A;  5FLO A;  4Q8Z A;  2POU A;  3D92 A;  1V9E A;  1G46 A;  1YDA A;  3KIG A;  5JEH B;  1CIM A;  5AMD A;  5A25 A;  5DSJ A;  4WW8 A;  5DOH A;  4Q99 A;  3U7C A;  4ZWZ A;  1DCA A;  5JEP B;  5EOI A;  4JSS A;  3RZ8 A;  1CCT A;  3RZ7 A;  1OQ5 A;  3OKU A;  5DVX A;  2HFW A;  5CJF A;  5C8I A;  1HED A;  2CBA A;  3U3A X;  3NJ9 A;  4ZX1 A;  1CNW A;  3EFT A;  4TWM A;  4DZ9 A;  5JQT A;  3RZ5 A;  1HUG A;  3V3I B;  1CCU A;  2FMZ A;  4FVN A;  3OIL A;  5E2R A;  5BRW A;  1LGD A;  1RZD A;  3SBH A;  1HVA A;  2FOV A;  2GEH A;  3IBN A;  1DCB A;  3V3F A;  1CAZ A;  1H9Q A;  1G1D A;  2WEO A;  4Q9Y A;  5DSQ A;  3V2M A;  1ZGF A;  4HT2 A;  1IF4 A;  5AML A;  4FIK A;  1BN3 A;  1BN1 A;  3NI5 A;  12CA A;  2WEJ A;  2X7T A;  1I9Q A;  4IDR X;  1CA2 A;  4K1Q A;  1HEA A;  3S97 A;  3V2J A;  2HNC A;  3R17 B;  3F4X A;  5G0B A;  3P5L A;  1RZA A;  3RYY A;  4M2W A;  5CAC A;  3N3J A;  4Q6E A;  1A42 A;  4Q49 A;  3D0N A;  3R16 A;  2WD3 A;  1OKM A;  2FNM A;  5BYI A;  4Q90 A;  3T5Z A;  3TVN X;  1TE3 X;  2CA2 A;  5AMG A;  4E9O X;  4RIU A;  2Q1B A;  3LXE A;  4K0T A;  3N0N A;  1I9O A;  3RYZ A;  1YO2 A;  3B1B A;  1CNK A;  3MNI A;  2ABE A;  3HKT A;  5JGT B;  4Z0Q A;  5FLR A;  1BN4 A;  3OY0 A;  5FNK A;  4HEZ A;  4QEF A;  3HKU A;  4CNX A;  4QTL A;  3K7K A;  4LU3 A;  2NNV A;  5FNG A;  4MO8 A;  3KWA A;  4WR7 A;  2FW4 A;  3RZ1 B;  3OKV A;  2GD8 A;  3DV7 A;  5FLQ A;  3MWO A;  1FR4 A;  1H4N A;  1EOU A;  4E3G A;  3RLD A;  1FSQ A;  3P58 A;  1BCD A;  2CBB A;  3DC3 A;  1CNI A;  3RYJ B;  4QSI A;  3KNE A;  4CNV A;  1I9L A;  4Q8Y A;  4RIV A;  1FQR A;  1CAO A;  1YO0 A;  4KV0 A;  4FRC A;  1I8Z A;  5E2S A;  1XEV A;  3FW3 A;  3N2P A;  3C7P A;  3D9Z A;  4YX4 A;  1G0F A;  3ML5 A;  1FSN A;  3FE4 A;  4L5W A;  3RYV B;  4G7A A;  5EH8 A;  5CA2 A;  3M40 A;  4DZ7 A;  3M2Z A;  4QJW A;  3S72 B;  5E28 A;  2CAB A;  4ILX A;  3V3G B;  4RFD A;  3W6H A;  1I9M A;  1DMX A;  3SAX A;  1TH9 A;  3HLJ A;  2Q38 A;  3MDZ A;  4Q7S A;  3TMJ A;  4C3T A;  3OIK A;  1HEC A;  1IF5 A;  1CVF A;  2WEG A;  2CBE A;  4KNM A;  3M96 A;  4YHA A;  3DVB A;  3DVC A;  5JDV B;  3S73 B;  1LUG A;  5EKJ A;  5DOG A;  1CNG A;  4YWP A;  3DBU A;  1G4O A;  2VVA X;  2FOU A;  2NWY A;  4MTY A;  4HEW A;  3MNH A;  5G01 A;  1IF6 A;  5FL6 A;  5FNM A;  3HFP A;  4CQ0 A;  4M2R A;  5EHV A;  4L5U A;  2H4N A;  4ITO A;  1BIC A;  3D93 A;  1CAJ A;  3M67 A;  5FDI A;  1YDD A;  4Q81 A;  4LHI A;  4Q8X A;  2FOY A;  3MYQ A;  2HKK A;  1G48 A;  5EKM A;  2EU3 A;  3M5T A;  1OKL A;  4Q78 A;  1TG3 A;  2IT4 A;  1CZM A;  3HS4 A;  4X5S A;  3V3H B;  2QOA A;  5L6K A;  2X7S A;  1UGC A;  3PO6 A;  3MMF A;  4XE1 A;  5IPZ A;  1BNT A;  1CA3 A;  3FFP X;  1BNM A;  1ZSB A;  4ZAO A;  1CCS A;  4G0C A;  1G0E A;  5EHW A;  3BL0 A;  1FR7 A;  5FDC A;  4R5B A;  3S71 B;  4HBA A;  4Z1K A;  4Q08 A;  3RG3 A;  2Q1Q A;  3IBL A;  5DSL A;  4QJO A;  3M2X A;  5EIJ A;  3HKQ A;  1ZNC A;  2NN7 A;  4YXI A;  3DVD A;  3P3J A;  1KWQ A;  4K0S A;  1CNB A;  1KEQ A;  1JD0 A;  1CNC A;  1V9I C;  4FVO A;  4CNR A;  1UGD A;  3T82 A;  5EKH A;  3S78 B;  1TEU X;  4E4A A;  5G0C A;  1AZM A;  3M5E A;  3DCC A;  4ZWX A;  3IBU A;  4N0X B;  3NB5 A;  1G52 A;  1MUA A;  4WW6 A;  4RH2 A;  2FNN A;  4ZWY A;  3M04 A;  7CA2 A;  4YXU A;  4Q87 A;  4YGF A;  1G3Z A;  4K13 A;  1RZE A;  1LZV A;  1T9N A;  4MLX A;  5FNJ A;  4Z1E A;  4FPT A;  3KKX A;  3MNU A;  4IWZ A;  1CAH A;  3S77 B;  4M2U A;  4JSW A;  5E5R A;  1BNU A;  1AVN A;  1G54 A;  2HOC A;  3RG4 A;  2NNG A;  3D8W A;  5SZ4 A;  1CNJ A;  1DMY A;  4CAC A;  1RZC A;  2ZNC A;  1ZSC A;  5EZT X;  5BNL A;  5E2M A;  4CA2 A;  3OYQ A;  4ZX0 A;  4RUY A;  2NXR A;  5EH5 A;  1TTM A;  3RYX B;  1TEQ X;  3DD0 A;  3MNA A;  1THK A;  1KWR A;  4KP8 A;  3S74 B;  1CVC A;  4GL1 X;  5SZ6 A;  3MNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...