2XTDA

Structure of the tbl1 tetramerisation domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
68
structure length
68
Chain Sequence
MSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Assembly of the Smrt/Ncor Core Transcriptional Repression Machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TBL1 F-BOX-LIKE/WD REPEAT-CONTAINING PROTEIN TBL1X
total genus 21
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08513 LisH LisH
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.30 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 2xtdA00
2XTCA 2XTDA 1UUJA 2XTEA
chains in the Genus database with same CATH superfamily
4LQ3A 1WNEA 1KHWA 4WYWA 4R0EA 4WZQA 4K4YA 1RA6A 3KNAA 3AX5A 5F8MA 3OLBA 4NLQA 1SH0A 1TP7A 3NAHA 2IM2A 2F8EX 4NLUA 4NLTA 2XTDA 1KHVA 1SH2A 1XR7A 4NLRA 3N6NA 4ZP7A 1TQLA 4NLWA 4NLOA 2XTCA 3AWRA 2E9TA 2B43A 2IJFA 5F8HA 2V1SA 2XTEA 3AX3A 3NKYA 1RDRA 1UUJA 4QPXA 4NLYA 3NAIA 4K4WA 2D7SA 4NRUA 3NMAA 4ZP8A 2ILZA 3CDUA 3BSOA 4K4VA 3UQSA 2IM3A 3AX2A 4WYLA 3OL6A 4K50A 3H5XA 4Y2CA 3DDKA 1SH3A 4NLPA 3N6MA 2WK4A 3OL9A 2E9RX 5F8IA 4Y2AA 1XR6A 3KMQA 5F8LA 3KLVA 2IM1A 4NLSA 2IM0A 4WZMA 4WFXA 1OM2A 2XZ2A 4NLVA 4ZP9A 3OL8A 4NLXA 2CKWA 4ZPAA 1U09A 3SFUA 4K4TA 3OLAA 1RA7A 4NRTA 2D68A 4ZP6A 4Y3CA 2UUTA 4WFYA 4NYZA 4ZPBA 4IKAA 4ZPDA 4LQ9A 5JXSA 3BSNA 5F8NA 4NZ0A 4X2BA 2V1TA 3QIDA 4WFZA 3UPFA 2ILYA 5F8JA 1XR5A 3N6LA 3KOAA 4K4UA 4K4SA 3CDWA 3H5YA 2EC0A 3SFGA 2UUWA 3NL0A 4Y34A 3OL7A 4O4RA 3UR0A 4K4XA 4IQXA 2E9ZA 1RAJA 3KMSA 4ZPCA 5F8GA 4K4ZA
chains in the Genus database with same CATH topology
4LQ3A 1WNEA 1KHWA 4WYWA 4R0EA 4WZQA 4K4YA 1RA6A 3KNAA 5F8MA 3OLBA 4NLQA 1SH0A 1TP7A 3NAHA 2IM2A 2F8EX 4NLUA 4NLTA 2XTDA 1KHVA 1SH2A 1XR7A 4NLRA 3N6NA 4ZP7A 1TQLA 4NLWA 4NLOA 2XTCA 2E9TA 2B43A 2IJFA 5F8HA 2XTEA 3NKYA 1RDRA 1UUJA 4QPXA 4NLYA 3NAIA 4K4WA 2D7SA 4NRUA 3NMAA 4ZP8A 2ILZA 3CDUA 3BSOA 4K4VA 3UQSA 2IM3A 4WYLA 3OL6A 4K50A 3H5XA 4Y2CA 3DDKA 1SH3A 4NLPA 3N6MA 2WK4A 3OL9A 2E9RX 5F8IA 4Y2AA 1XR6A 3KMQA 5F8LA 3KLVA 2IM1A 4NLSA 2IM0A 4WZMA 4WFXA 2XZ2A 4NLVA 4ZP9A 3OL8A 4NLXA 2CKWA 4ZPAA 1U09A 3SFUA 4K4TA 3OLAA 1RA7A 4NRTA 2D68A 4ZP6A 4Y3CA 2UUTA 4WFYA 4NYZA 4ZPBA 4IKAA 4ZPDA 4LQ9A 5JXSA 3BSNA 5F8NA 4NZ0A 4X2BA 3QIDA 4WFZA 3UPFA 2ILYA 5F8JA 1XR5A 3N6LA 3KOAA 4K4UA 4K4SA 3CDWA 3H5YA 2EC0A 3SFGA 2UUWA 3NL0A 4Y34A 3OL7A 4O4RA 3UR0A 4K4XA 4IQXA 2E9ZA 1RAJA 3KMSA 4ZPCA 5F8GA 4K4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTC A;  2XTD A;  1UUJ A;  2XTE A; 
#chains in the Genus database with same CATH topology
 4LQ3 A;  1WNE A;  1KHW A;  4WYW A;  4R0E A;  4WZQ A;  4K4Y A;  1RA6 A;  3KNA A;  3AX5 A;  5F8M A;  3OLB A;  4NLQ A;  1SH0 A;  1TP7 A;  3NAH A;  2IM2 A;  2F8E X;  4NLU A;  4NLT A;  2XTD A;  1KHV A;  1SH2 A;  1XR7 A;  4NLR A;  3N6N A;  4ZP7 A;  1TQL A;  4NLW A;  4NLO A;  2XTC A;  3AWR A;  2E9T A;  2B43 A;  2IJF A;  5F8H A;  2V1S A;  2XTE A;  3AX3 A;  3NKY A;  1RDR A;  1UUJ A;  4QPX A;  4NLY A;  3NAI A;  4K4W A;  2D7S A;  4NRU A;  3NMA A;  4ZP8 A;  2ILZ A;  3CDU A;  3BSO A;  4K4V A;  3UQS A;  2IM3 A;  3AX2 A;  4WYL A;  3OL6 A;  4K50 A;  3H5X A;  4Y2C A;  3DDK A;  1SH3 A;  4NLP A;  3N6M A;  2WK4 A;  3OL9 A;  2E9R X;  5F8I A;  4Y2A A;  1XR6 A;  3KMQ A;  5F8L A;  3KLV A;  2IM1 A;  4NLS A;  2IM0 A;  4WZM A;  4WFX A;  1OM2 A;  2XZ2 A;  4NLV A;  4ZP9 A;  3OL8 A;  4NLX A;  2CKW A;  4ZPA A;  1U09 A;  3SFU A;  4K4T A;  3OLA A;  1RA7 A;  4NRT A;  2D68 A;  4ZP6 A;  4Y3C A;  2UUT A;  4WFY A;  4NYZ A;  4ZPB A;  4IKA A;  4ZPD A;  4LQ9 A;  5JXS A;  3BSN A;  5F8N A;  4NZ0 A;  4X2B A;  2V1T A;  3QID A;  4WFZ A;  3UPF A;  2ILY A;  5F8J A;  1XR5 A;  3N6L A;  3KOA A;  4K4U A;  4K4S A;  3CDW A;  3H5Y A;  2EC0 A;  3SFG A;  2UUW A;  3NL0 A;  4Y34 A;  3OL7 A;  4O4R A;  3UR0 A;  4K4X A;  4IQX A;  2E9Z A;  1RAJ A;  3KMS A;  4ZPC A;  5F8G A;  4K4Z A; 
#chains in the Genus database with same CATH homology
 4LQ3 A;  1WNE A;  1KHW A;  4WYW A;  4R0E A;  4WZQ A;  4K4Y A;  1RA6 A;  3KNA A;  5F8M A;  3OLB A;  4NLQ A;  1SH0 A;  1TP7 A;  3NAH A;  2IM2 A;  2F8E X;  4NLU A;  4NLT A;  2XTD A;  1KHV A;  1SH2 A;  1XR7 A;  4NLR A;  3N6N A;  4ZP7 A;  1TQL A;  4NLW A;  4NLO A;  2XTC A;  2E9T A;  2B43 A;  2IJF A;  5F8H A;  2XTE A;  3NKY A;  1RDR A;  1UUJ A;  4QPX A;  4NLY A;  3NAI A;  4K4W A;  2D7S A;  4NRU A;  3NMA A;  4ZP8 A;  2ILZ A;  3CDU A;  3BSO A;  4K4V A;  3UQS A;  2IM3 A;  4WYL A;  3OL6 A;  4K50 A;  3H5X A;  4Y2C A;  3DDK A;  1SH3 A;  4NLP A;  3N6M A;  2WK4 A;  3OL9 A;  2E9R X;  5F8I A;  4Y2A A;  1XR6 A;  3KMQ A;  5F8L A;  3KLV A;  2IM1 A;  4NLS A;  2IM0 A;  4WZM A;  4WFX A;  2XZ2 A;  4NLV A;  4ZP9 A;  3OL8 A;  4NLX A;  2CKW A;  4ZPA A;  1U09 A;  3SFU A;  4K4T A;  3OLA A;  1RA7 A;  4NRT A;  2D68 A;  4ZP6 A;  4Y3C A;  2UUT A;  4WFY A;  4NYZ A;  4ZPB A;  4IKA A;  4ZPD A;  4LQ9 A;  5JXS A;  3BSN A;  5F8N A;  4NZ0 A;  4X2B A;  3QID A;  4WFZ A;  3UPF A;  2ILY A;  5F8J A;  1XR5 A;  3N6L A;  3KOA A;  4K4U A;  4K4S A;  3CDW A;  3H5Y A;  2EC0 A;  3SFG A;  2UUW A;  3NL0 A;  4Y34 A;  3OL7 A;  4O4R A;  3UR0 A;  4K4X A;  4IQX A;  2E9Z A;  1RAJ A;  3KMS A;  4ZPC A;  5F8G A;  4K4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...