1XR6A

Crystal structure of rna-dependent rna polymerase 3d from human rhinovirus serotype 1b
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
460
structure length
460
Chain Sequence
GQIKISKHANECGLPTIHTPSKTKLQPSVFYDVFPGSKEPAVLTDNDPRLKVNFKEALFSKYKGNTECSLNQHMEIAIAHYSAQLITLDIDSKPIALEDSVFGIEGLEALDLNTSAGFPYVTMGIKKRDLINNKTKDISRLKEALDKYGVDLPMITFLKDELRKKEKISAGKTRVIEASSINDTILFRTTFGNLFSKFHLNPGVVTGSAVGCDPETFWSKIPVMLDGDCIMAFDYTNYDGSIHPVWFQALKKVLENLSFQSNLIDRLCYSKHLFKSTYYEVAGGVPSGCSGTSIFNTMINNIIIRTLVLDAYKNIDLDKLKIIAYGDDVIFSYKYTLDMEAIANEGKKYGLTITPADKSTEFKKLDYNNVTFLKRGFKQDEKHTFLIHPTFPVEEIYESIRWTKKPSQMQEHVLSLCHLMWHNGRKVYEDFSSKIRSVSAGRALYIPPYDLLKHEWYEKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Genome polyprotein
publication title The Crystal Structure of the RNA-Dependent RNA Polymerase from Human Rhinovirus: A Dual-Function Target for Common Cold Antiviral Therapy
pubmed doi rcsb
source organism Human rhinovirus 1b
total genus 136
structure length 460
sequence length 460
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1xr6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xr6A02
1RT1B 4RW7B 5KFIA 4XPCA 3H4DA 4MH8A 4O3PA 3DOKB 4QW9A 3LAKA 3OLAA 1C1CA 3T5JA 3FSIA 1JLBA 4ID5B 4Q8FA 3BQ0A 3T5KA 3KMQA 4ZPAA 4ZPBA 2HAIA 3M9NB 1TKTB 1TVRB 4ECSA 3D5MA 3OSNA 4O3QA 1S9EA 3KK3A 3KHGA 2V4RA 5HLFB 5CYMA 3ITHA 4J9NA 4ZPCA 5CYQA 5KFEA 4RW4B 3QO9A 3ISND 4KV8A 1LWCB 3GV7B 4NYZA 4TN2A 3HVTB 1DTQA 1RT2A 3FDSA 1C1BA 2HNZA 4O4GB 1DTTA 2JC1A 3IN5A 4ZMMA 3I0RA 3H98A 4DG1B 4Q0BB 1T94A 2OPPA 1SH2A 1N5YB 2D3ZA 2R8IA 1J5OB 1S1UA 4RW8B 4M95A 3V6DA 1TL1A 2UVRA 3QGGA 2BE2A 5EWFA 3GV8B 3MEGA 2VG5B 4EYHB 3DDKA 4NLPA 4ZP8A 1LWEA 4ZP7A 4IH7A 3T1AA 3CWJA 2JC0A 3RB3A 3I0SA 5KFHA 2WONA 1R0AA 4ZVGA 3V6KA 4Q44A 2FVQA 3DRSB 4LSLA 3SI8A 2QV6A 4LQ3A 1MU2A 3KLHB 4IFYA 1REVA 3G6YA 1HNVB 2AX0A 4EBDA 1NHUA 4RUCA 3GQCA 4NCGB 3CJ2A 2ZE2B 5KFRA 3T5LA 4FBTA 1XR7A 4ZPDA 3CO9A 1S48A 4KFBA 1RTDB 1Z4UA 1YVFA 1ZTTA 4I7FA 3DRPB 3KJVA 4NLGA 1K1QA 5J2NB 1T05B 4K4ZA 3CDEA 5C24A 2D41A 4NRUA 1KLMA 2C28A 3IS9A 3NBPA 3HVWA 1TL1B 5JXSA 2YNGB 1JKHB 2IM3A 3BGRA 5J2QA 4ECZA 2HNDB 3I5AA 2IAJA 3BSCA 2IC3A 2QE5A 3QLHA 1FK9B 3V81B 1C2PA 3GIMA 1S4FA 3NMAA 1FKPA 4ZHRB 3RB6A 5F8JA 3MR5A 5DLGA 3C6UA 3DOLB 5F8NA 5DGAA 3RB4A 5T14A 3E51A 4RNMA 3UQSA 2R2RA 3Q8PB 5J2PA 3PW7A 2ZD1B 5C25B 2IM2A 5KG3A 2AGPA 2AX1A 3KLEA 4IDKA 3LP2A 3KK2A 3NAHA 4IFVA 3KNAA 1TKZA 4IG0A 2E9ZA 3MEDA 5F8MA 1XR6A 4K4SA 4YMEA 5EWEA 1RT3B 1OS5A 2B5JA 4ECRA 4ICLA 3BQ1A 1S6QA 5HP1A 1S9FA 1EP4A 3IGNA 3NAIA 1HARA 5KT6A 2YKMB 3T5HA 1JX4A 4IRDA 4F4ZA 4PQUB 1QE1B 1T3NA 4Y2AA 5F8LA 2RKIA 4ED1A 2C2EA 1C0TA 3OL8A 3H5UA 1S1WA 2HNYA 4JV0A 3NGDA 3RB0A 2UVWA 1RTIB 4RW9B 1RT7A 2WRMA 4KB7A 1TV6B 5KFFA 3H2LA 5EDWA 2BR0A 1QAJA 3C6UB 2IBKA 1IKWA 1S6PA 1QUVA 2UVVA 5KFQA 1TKXB 4DL2A 3MF5A 3DLKB 4ECTA 4MKBA 4LSNB 4K4XA 5DQGA 1RT6B 2HWIA 4G1QB 4TYBA 2JEFA 1S9GA 4XPEA 2OPQB 4IG0B 3KHHA 3TQ1A 4KHRA 4WXOA 5KFZA 1LW0A 5J2MA 1IKXA 4Y2CA 4EYIB 2UVUA 4H4MA 1SUQA 3BJYA 2R2SA 4I2QA 5KT7A 1UWBB 1JLFB 1XR5A 1RAJA 4FBUA 2C2DA 3ICLA 5I3UB 3MECB 4KO0B 4MIAA 4F4YA 1KHWA 3M8PA 2ASLA 1S0MA 3KLIB 1HYSA 5K14A 2WOMA 2OPRA 2W9AA 1BQNB 3H59A 3KHRA 2IM1A 3C6TB 3I5CA 3MEEA 4PUOB 2W9BB 3DMJA 2I5JB 1RT4A 3KLGA 3OSPA 1VRTA 2XGQA 2OPSB 1RA6A 4I2PA 3GIKA 4ED8A 2YNIA 4G3IA 3CJ3A 2JEIA 1WNEA 3FQKA 4O44A 2CKWA 3HKWA 1HNIB 4KKOA 5DG8A 5DLFA 1W25A 4JV1A 4HKQA 1HQUA 3M8QB 2IJFA 3TAMA 3VQSA 5DQHA 3EPGA 4NLOA 3BSOA 1EETB 2AGQA 4Q8EA 4NLTA 4NLVA 5HROA 1IKVA 1HMVA 1S1VA 3OL6A 1NNDA 2XC9A 4ZP6A 4R5PB 1TQLA 4DEZA 3PJWA 2E9RX 4NLWA 3HVAA 3LP1A 2ALZA 2FLLA 2R8KA 3RBEA 5HBMB 4FS1A 1JLQB 2XGPA 3Q8QB 1BQMA 2OH2A 4ED3A 4QWAA 1N4LA 3UPFA 4J9RA 5KG6A 3FFIA 4KE5A 4H4OB 3MR3A 4FS2A 2ASJA 2DPJA 2AQ4A 2WCXA 2XCPA 5KT4A 1VRTB 3G6XA 2RF2A 3CJ5A 2XWYA 1C1CB 1S10A 1VRUA 1JLBB 5FDLA 5DG7A 3LP0A 4IH6A 4IOBA 5KT2A 2ASDA 5L1JA 2YNFA 3DM2A 1FKOA 2XI2A 1S9EB 3KK3B 1DLOA 1RTJA 2VG6A 3QIPA 5CYMB 3ITHB 3LAMA 4EO6A 4O3SA 5CYQB 2R8JA 3QO9B 3PW4A 4KV8B 1RTHA 3LALA 5L1LA 1DTQB 1RT2B 4RZRA 3G6VA 4WFZA 1C1BB 2HNZB 1DTTB 3JSMA 3RBDA 4GC6A 3I0RB 1S0OA 1JLCA 2BRKA 2OPPB 4TQRA 2FJVA 4EBEA 3M9MB 5KFSA 5D3GA 3H4BA 1S1UB 3PR5B 5C42A 3V6DB 2BE2B 1N6QA 3MEGB 2CJQA 1JLEA 3PW0A 3H40A 1LWEB 3QYYA 3DI6A 4MKAA 4RNNA 4YR3A 4NLYA 2EC0A 2B6AA 1JLGA 3I0SB 2WONB 1R0AB 5F8IA 4H54A 4LSLB 3Q8RB 2D3UA 3PZPA 2AWZA 4QPXA 1MU2B 4IFYB 1REVB 3IG1A 5I42A 1S49A 1RT5A 3UR0A 3DLGA 3IGVA 4OL8A 3CIZA 3BREA 4IH5A 2IMWP 3JYTA 2V4QA 1TL3A 5KFAA 4KFBB 3FRZA 4DL7A 1C0UA 2VG7A 4I7FB 4TY8A 2WHOA 2XCAA 3KJVB 3JSMB 1D1UA 1SH0A 4K4VA 5C24B 2FVSA 3DLEA 2WK4A 1KLMB 1LW2A 4X2BA 2BRLA 3CVKA 3SFGA 3IS9B 3NBPB 3PJXA 2BANA 3G86A 5KFCA 5KG4A 3BGRB 3CJ0A 4ED6A 5J2QB 1N6QB 3GYNA 2IAJB 2IC3B 4IG3A 4RNOA 4J9KA 3KK1A 3QLHB 3V4IA 2HMIA 3DRRA 4KHMA 1FKPB 2FLNA 5EUHA 4DL4A 5KFLA 4MK8A 1HPZA 3QGHA 5J2PB 5I42B 4ECXA 1ZETA 4LQ9A 4Y34A 2O5DA 3I5BA 4TY9A 1T03A 2IA6A 2JEGA 3KLEB 4IDKB 3LP2B 1GX5A 4RNHA 4IFVB 3DYAA 5KFUA 1HQEA 1TKZB 5J1EA 3KK2B 3PR4A 3MEDB 4TYAA 3KLVA 4HYKA 4K4UA 4EEYA 4WE1A 2B5JB 4J9PA 4ICLB 3KLFA 1S6QB 3E01A 4O3OA 1EP4B 2YNHA 5HP1B 1RYSA 2R2TA 3CDWA 4J9OA 4IR1A 2W9CA 2RKIB 4WZQA 5KT3A 1C0TB 2FVCA 1S1WB 2HNYB 2ATLA 5KG5A 4RW6A 1GX6A 4ZVEA 4MFBA 3GILA 1IM4A 2FVRA 2YKNA 1RT7B 5KFOA 4PWDA 4WFXA 1S1TA 5EWGA 1SV5A 1IKWB 1LWFA 1S6PB 3BSAA 1S1XA 1RT1A 4RW7A 4QWEA 2C22A 4K4WA 4NLSA 3N6LA 3DOKA 5KT5A 4ED7A 2W8KA 4EBCA 3PW5A 4TLRA 1JXLA 4ID5A 4NLXA 2FLPA 5KG2A 1D0EA 4B3OA 1TKTA 1S9GB 1TVRA 2V0NA 5KFPA 4NLQA 4ECUA 5L1KA 2XI3A 2W7PA 5HLFA 4ECQA 1LW0B 5J2MB 2W7OA 1IKXB 4RW4A 4F50A 3PVXA 1LWCA 4NLDA 3TVKA 3MR2A 3EZUA 3HVTA 4H4MB 1SUQB 4O4GA 4I2QB 4NRTA 2UUWA 2W9CB 4ECWA 4DG1A 4Q0BA 5F9NA 2WTFA 1QAIA 1I6JA 1N5YA 2VA2A 4IRKA 1J5OA 3H5XA 4RW8A 4ECVA 2GIQA 4YR2A 2VG5A 2B43A 5L1IA 4WYLA 3OLBA 2JEJA 2GC8A 4Q43A 3M8PB 3MR6A 4QWDA 2WB4A 1HYSB 4IKAA 1RA7A 1KHVA 2ILYA 2WOMB 2OPRB 5K14B 1S97A 3DRSA 3T19A 3MEEB 4ZVHA 3DMJB 5KFXA 3KLHA 1RT4B 1HNVA 3KLGB 4ECYA 3BSNA 4WXWA 4B3OB 4MIBA 4I2PB 4M94A 4NCGA 1MMLA 2YNIB 4YR0A 5KG1A 2ZE2A 3FQLA 4O44B 2VA3A 4IQXA 3QIDA 4KKOB 4QWCA 4R0EA 1HQUB 1RTDA 3TAMB 4Y3CA 3DRPA 3IRXA 4Q45A 1NHVA 5J2NA 1T05A 4IR9A 5HROB 1IKVB 1HMVB 1S1VB 3M9OB 4KBIA 4J9QA 4WYWA 3QZ8A 2YNGA 3LP1B 1JKHA 4MK7A 3EPIA 2HNDA 4F4WA 2AU0A 2J6UA 4RUAA 3OHBA 4ED2A 3H5SA 4XO0A 1FK9A 3V81A 2ILZA 5KFKA 3BQ2A 2BQ3A 1BQMB 2ZKUA 4ZHRA 3DOLA 3BR9A 2DPIA 3FFIB 2IJNA 4QWBA 3NKYA 2J6SA 2R8HA 2RF2B 4J9MA 2ZD1A 5C25A 3QZ7A 4TXSA 2JLEA 4MK9A 4URQU 4F4XA 4ED0A 1VRUB 5FDLB 3UDLA 3LP0B 3SFUA 5KFWA 3NL0A 3GIJA 1N56A 4WZMA 2FVPA 2YNFB 3DM2B 5KFDA 4DL6A 1FKOB 3IRXB 1DLOB 1RTJB 1RT3A 2VG6B 3QIPB 5KFGA 5KFNA 4J9SA 4K4YA 2YKMA 5L9XA 4PQUA 1RTHB 2UUTA 4NZ0A 1QE1A 5F8HA 5KG0A 1IKYA 3RAQA 5KFMA 1JLCB 3OL7A 3GV5B 1RTIA 5D3GB 4RW9A 1ZTWA 5C42B 1TV6A 5KFVA 4J9LA 2BQRA 1JIHA 1JLEB 2AGOA 3DI6B 1RYRA 5F8GA 1TKXA 4U6PA 3PW2A 3DLKA 2B6AB 1JLGB 4LSNA 3MTKA 1RT6A 4ZP9A 4WFYA 3IG1B 4G1QA 3CJ4A 1RDRA 1RT5B 2OPQA 3OL9A 3DLGB 5KFJA 4GC7A 4KSEB 3PHEA 3H5YA 2FJXA 4O3RA 2BQUA 1U09A 3QGIA 5KG7A 3JYTB 4JUZA 1TL3B 2C2RA 4O4RA 4K50A 1C0UB 2VG7B 4TY8B 1JLAA 4K4TA 1IKYB 1UWBA 1JLFA 4ZVFA 4QW8A 3V6JA 4IRCA 3DLEB 4R8UB 1LW2B 2RDIA 5I3UA 2J6TA 4NLRA 3MECA 4EO8A 5JUMA 2BANB 4RU9A 2RDJA 4KO0A 5KFBA 4IG3B 3KLIA 3V4IB 3KK1B 5KFTA 2HWHA 1N48A 3HHKA 2HMIB 3DRRB 5DQIA 1BQNA 3RAXA 3GIIA 3KHLA 3C6TA 4PUOA 2W9BA 2I5JA 3MFIA 3N6MA 3KMSA 1SH3A 3OHAA 4URGA 5C5JA 4JV2A 1HPZB 1TP7A 4URSA 2OPSA 3CDUA 4DL5A 3N6NA 1T03B 2F8EX 2R8GA 2GIRA 3ISNC 1HNIA 5J1EB 3DYAB 5F9LA 1HQEB 3M8QA 4R8UA 4TQSA 4YQWA 1EETA 1CSJA 4YP3A 2V9WA 4U7CA 2IM0A 1JLAB 4WE1B 2D7SA 4RNFA 3KLFB 3E01B 4R5PA 3KOAA 2YNHB 4KAIA 3LANA 3MFHA 2R2UA 5HBMA 2E9TA 5KFYA 1JLQA 5DGBA 1K1SA 3Q8SB 4DL3A 1S0NA 2I1RA 3D28A 4RW6B 5DG9A 4MFBB 4O3NA 2FJWA 2YKNB 4NLUA 3V6HA 4PWDB 1S1TB 1SV5B 4H4OA 2W8LA 1LWFB 1S1XB
chains in the Genus database with same CATH superfamily
3QRRA 4O3PA 4AXJA 2F4VJ 3KMQA 2FD2A 3SCKE 1TKTB 3BKUA 3C15B 3FSXA 3CULA 5HMZA 2VASA 1TU0B 1UKUA 4NA1A 3IR5B 1R0BG 3K57A 3N5FA 1UEUA 2VICA 4I64A 1Q8BA 4ZVQB 5KFHA 4M1KA 5F0WA 4DV0F 3W60A 1RHQB 1MLAA 4G6VB 4K2JA 5JJBA 4N8NA 2NUUG 3CD5A 4GKKF 4PYAA 1VBXA 1M1KT 2YKOA 3EYZA 5BYRA 3V81B 1CS4B 1PAUB 2DRBA 1TZ0A 2V6AA 5E5NA 3UQSA 3QSYB 7FDRA 5DO2A 4C97A 1YJ7A 3VAGA 2NUHA 2ZH9A 2RQKA 3W9IA 1U1NA 1JX4A 4DV5J 1MN7A 2QN6B 4ZIVA 1Q8LA 5FIIA 1U4BA 5K8PA 4DI6A 2MJUA 2HFVA 1TUWA 5KFQA 4DV1J 2RRBA 5A0YA 2ZH6A 4WIIA 5D77A 3RYLA 1N88A 5J2MA 2I6WA 2OGUA 4DPYA 3TZYA 3EVOA 3PO4A 3SDEA 3GLJA 5I3UB 4C8YA 1RI7A 3ZTPA 1RCXB 3LF0A 3KLIB 4WK1A 2UXBJ 1RHRB 2BJ7A 5AE1A 2ZM6J 2B8QA 1QDUB 3FSYA 2HRYA 5M2PA 2NXUA 4NLWA 2ALZA 2R8KA 5ETNA 5A76A 4FS1A 2DKOB 2XQCA 1VHIA 5HAOA 4HH0A 3WIUA 1UEKA 5ADZA 5GAHI 4PXCA 1RHUB 1WKJA 3H42A 3PW4A 3UN5A 2HS0A 4TQRA 2FGOA 5KFSA 1NDPA 3H40A 2GJIA 3SQOP 2XYHB 2YX7A 1P8GA 3K8WA 3L95X 3ENWA 1WF2A 4UUWA 2P9GA 3K5OA 5LOQA 3JSMB 4MTPA 1LEOA 1BLUA 3DLEA 2X1FA 4DF4A 3BGRB 2HMIA 3TQEA 4KHMA 1LWXA 2WVBA 1I94F 4QJVA 2IA6A 5J1EA 4ALZA 2G2OA 3PR4A 3AX2A 2IBOA 3HK2A 2CWXA 5GAGI 2K1RB 1RACB 4LMZA 3UCZP 1W2IA 4DN0A 2AYBA 1G1XA 1PJ6A 1S6PB 3CT9A 3W66A 1ZZNA 4LREA 5KT5A 2AT1B 4RUHA 3EXYA 2RDDA 2XZTB 3CCUS 4ECUA 5KTQA 1IKXB 3BBFA 2ZBCA 2CPXA 3FBBA 2U2FA 4WYLA 4UQTA 2FHKA 2A1BA 2WOMB 2CYYA 2YWEA 3KLGB 1NH7A 4MIBA 4ZN1A 5KG1A 1HNZJ 4F8RA 5H9FK 4IR9A 1HMVB 3PRBA 2GMLA 3LP1B 3WX4A 4ZLPA 2CQ3A 3WC0A 1NKCA 2PIIA 3HSJA 4CLWA 4EFAC 2BOPA 2RF2B 2UZAA 1X9SA 3I32A 2VDHA 1U0HA 2VQEF 4JI3F 1HBUB 2HLTA 5HVGA 4DL6A 2AJ2A 4K4YA 2O1PA 2UUTA 3C14B 1AROP 2XMTA 3S1TA 5MLCV 1MROA 2LCWA 2KHCA 3QAUA 4ZLNA 1NU4A 2DISA 3IG1B 4OYXA 3UWTA 2VDIA 3J7YU 2VG7B 2B9WA 1JNZB 2DD8S 2DBBA 3V6JA 3UDCA 2PC6A 4CYUB 4NZ6A 3TRGA 3B78A 2P8IA 5EX3A 1ZA2B 2PDAA 4I0WA 2GIRA 4NYOA 4DZDA 1CSJA 2FPHX 4WE1B 3HT0A 3MFHA 2V4JB 2Q3PA 4K59A 1T9XA 5KFYA 1GAOA 3Q8SB 1LV5A 2H51B 3OXGA 4NLUA 3QGPA 3FK4A 3L9ZA 2LLZA 4EUVA 1EQ0A 1NDKA 1RT2A 3FVYA 2FVQA 3SI8A 2KN4A 4JI7F 3GTYX 3NWGA 4NCGB 1NAQA 5AE3A 3PJ9A 1ZTTA 1R8CA 4DZ6A 4DPWA 2DXFA 3NOCA 2NCKL 1CULB 1Y11A 2BYCA 3QLHA 1X5PA 4CO3A 5F8JA 1F2GA 4F3QA 3PW7A 2NXJA 3TAQA 1SVDA 3OT9A 3C66A 3T6BA 5F8MA 1HLWA 5EWEA 3R3TA 1QE1B 4B3RJ 4P10A 3D0IE 3GPAA 4YB6A 5K9FA 2G0JA 4IO9Q 3C6UB 2DGUA 3IRWP 3DLKB 1U1MA 2QZ8A 4X64F 1DQ8A 3FKBA 3JSBA 5DM7Q 3D67A 2CPFA 2IMOA 2KI2A 4OYZA 2L48A 1SPBP 3H59A 2AP6A 2AMCB 2XGQA 4G3IA 4ZP6A 1GXLA 2E9RX 3BGUA 4DJBA 2V50A 3M8ZA 1IR1A 2V8VA 3HHLA 4QWAA 2WCXA 3PFEA 1M5OC 4IH6A 3B8HA 2F5GA 3DM2A 2Y1IA 3PX4A 3BM7A 1F3FA 1WUUA 2KYZA 1N5SA 5CHCB 4GC6A 4OFZA 4J9VA 4DSEA 5D3GA 4FYWB 2H4YB 3QYYA 3DI6A 2XYGB 4OI2A 4L76A 5F8IA 4HH1A 3Q8RB 4X84A 4ZVUB 1MU2B 2E1PA 1PIEA 1ITPA 1DBDA 1VDHA 1WEZA 3QT8A 3JYTA 4X4RA 3N0VA 3NBPB 4LSZB 1WJ9A 2MHEA 1JXVA 4IG3A 1NJWA 4CQ1A 2RH3A 3EGNA 2W24A 5GVQA 1U24A 2D9OA 1GX5A 3AQOA 1TKZB 3OV7A 3W3SA 4EEYA 2HEKA 4PQAA 2GVZA 5GAEI 2OELA 3ZTRA 4ANEA 5E41A 3KUEA 3VZIA 5ETPA 4WFXA 3JQKA 1NK6A 4P73A 4JI2J 2XNRA 4KPCA 1ZBTA 4PPZA 1LWCA 4U7UD 4P6QA 1TK0A 4ELVA 2UUWA 2LU2A 4YEAA 5L1IA 2OMOA 2AZ3A 4Q43A 1VK3A 4QWDA 4C3MA 1PC5A 3H20A 4WCEQ 3MEEB 1VQPS 3D1QA 4HHHA 4N41A 1F5CA 2VQFJ 4R0EA 2CJBA 5LL6d 3IRXA 5J2NA 3UFCX 3R27A 2ATCB 2C42A 1Y00A 3CCJS 2ZD1A 5C25A 2MXYA 3CDAA 2OFGX 3ILLA 4DR2F 5KFDA 2EFPA 4J9SA 3HM9A 3UCUP 1IKYA 1R8BA 3JQMA 1JLEB 1TKXA 2HQCA 4PG4A 1RB0A 2XB2D 4IUFA 4XIUA 3DKDA 1NK8A 2DHGA 4MJKA 2DH7A 1R89A 3M32B 4NYPA 5EX0A 3TJAA 2Y1RI 2XS2A 4GC7A 3PHEA 4O3RA 5DRKA 3VGSA 1R7IA 3W2VA 1JLFA 4NLRA 4RU9A 2P9CA 3Q2SC 1UP1A 3WC2A 1FJ7A 4F25A 3KHLA 4FNHA 3VR1A 4KGMA 2C3YA 4DV7J 1T03B 2R8GA 1IWGA 1FF2A 4OJ1A 1GEHA 1SC6A 4USJC 5E3AA 4FPRA 2VPZB 4DL3A 3VZHA 2ZHAA 3NGRA 4AYBD 3UDEA 1C1CA 2QL7B 3AA9A 2VOPA 2LU1A 4KGKA 2ZOFA 4ECSA 1LK5A 3ITHA 4RW4B 7AT1B 2HZCA 2ZNYA 2R7VA 3L7UA 2PD1A 2QMUB 1IBLJ 2DIUA 3FZBA 3A12A 2XO7A 3TJ9A 3KJFB 1T9UA 4LQ3A 4ZJQA 1N36J 4YDDB 1WG1A 3D6FB 2WAQD 5L46A 2DR8A 1S48A 5CD4A 2VPYB 3MPDA 3X3UA 3CDEA 4RL1A 4NRUA 3PTWA 2HBZB 2M8DB 2YNGB 2V1SA 1VS3A 3HFKA 1XNRF 1F9HA 1YQHA 2IM2A 2AX1A 1XERA 3A8IA 3LP2A 4PRFA 4IG0A 4CO0A 3MEDA 5IT9Y 3EDQB 1NEEA 1X60A 2ZH4A 1TKDA 1ZM9A 1V6HA 2W2OP 2YKMB 1T3OA 2HZAA 1Q4RA 1RHJB 3HKZD 2HNYA 4D3HA 2UVWA 1RTIB 2QEXS 3POTA 1S77D 1NKEA 3FC9A 1Z2ZA 4ZS6A 4WXOA 3SQGA 4OZNA 2DNKA 2HRUA 2K06A 3TZWA 2VPXB 4ZN3A 3KHRA 3C6TB 3SSQA 2W9BB 3DMJA 2MEWA 3RRHA 3P49B 2RHQB 3TO8A 2J5AA 3A13A 5IV3A 2PI4A 1F2HA 4KKOA 5DLFA 1VR6A 4NLOA 1X0PA 3OBIA 4NLVA 2WSCC 1IKVA 1S1VA 2FLLA 1FDBA 1EQMA 2DPJA 2MLYA 2ZBQA 5FDLA 5I3PA 4FYYB 4LFBJ 1BWVA 4L74A 2BEFA 2IVMA 4BLGA 4WFZA 3TANA 4RLEA 2IVFB 1UUJA 4KHPJ 2BJ9A 1Q5YA 4FYVB 3GSIA 1Q79A 4RO0A 1VQMS 3CEDA 1Q8KA 3MMJA 3GFYA 1C0UA 1D3WA 1KR4A 4N8OA 2BX6A 3AJDA 4J9KA 1HW8A 3AB4B 3KFWX 3BGLA 2XS7A 3QGHA 5E3PA 4DUZF 4TYAA 1CJVB 3KWMA 1PSDA 4O3OA 3Q83A 3ENVA 4LRAA 5LT5A 4GO7X 3UN3A 3HJFA 3J81j 2GNKA 2YBVA 1LWFA 2AYEA 2HRTA 1S1XA 4RW7A 2HBRB 1H74A 3Q8VA 5A0YB 2DGTA 2FLPA 4I6WA 2KZMA 2ZDOA 2HFOA 2HGLA 1FRHA 5HLFA 1VQNS 3OR2A 5J2MB 4O4GA 4IRKA 5FJ4A 3SDEB 1NB2A 2GIQA 4ERDA 4Y0FA 1D9DA 1UA1A 3QRQA 4L72B 3T19A 4LFCJ 4ECYA 3AFGA 3ZTQA 1ZOTA 1B0TA 2F4VF 1RTDA 2F9DA 1IUJA 2PSZA 5IS2A 3BZQA 1EIYB 1JKHA 4M5GA 1N8RT 4TNOA 2M52A 1GK8A 1FE4A 2DT9A 2Y1LB 2ZFHA 2VHGA 2KRBA 3BGFA 1SXLA 4DQRA 4NASA 3NL0A 4HTIA 8AT1B 3GG1A 1DZ5A 1DHMA 2C1EB 4PQUA 4X4VA 5DS7A 4OX9J 3E2EA 2ZBPA 4U96A 2IRUA 2DJWA 4CO1A 1NSPA 3C16A 4FDFA 4M5NA 2N82B 1TUGB 1DURA 1NH8A 2RVJA 2X7IA 2FHOB 4JI6J 2HFSA 1M5HA 2D74B 4QW8A 3CMQA 3DLEB 2RDJA 2B4UA 2P9EA 4DCPB 5KFBA 2HMIB 2G2YA 4DV5F 3JTNA 2COLA 3GZ7A 4C3LA 3MFIA 1ACMB 1LXJA 4QOTA 5J1EB 4DV1F 2OSRA 2DR5A 4YP3A 4LF9J 4CWBA 3VWSA 3MPUB 3C46A 1K1SA 2I1RA 2HHHJ 2QSFA 1M5KC 1UVKA 4ZPAA 1FO1A 2UXBF 3ZC4A 4F0MA 4QPTA 2R7SA 2ZM6F 1J5EJ 1LK7A 3GV7B 3Q8YA 4PXEA 2D3ZA 4TVAB 4EYHB 5HMWA 3P5TL 2MSTA 4LSLA 2F3JA 4L3KA 1PYTA 2AX0A 4ZLJA 3CJ2A 4F2RA 1WC0A 2XYPB 1RBOB 2JDJA 2WVEA 2BJDA 3TA2A 4I7FA 3NEKA 3HFVA 4K4ZA 3OTCA 3VAMA 2VF3A 4QYZJ 2XTEA 1DFDA 5CZVA 3NMAA 2FZGB 3J7AN 2F1FA 2B7BB 4HTJA 4P72A 5KG3A 2HFUA 2UP1A 1U0HB 1PGZA 3I82A 1UFKA 2G13A 4YMEA 3BQ1A 2RB7A 2WW8A 4Y2AA 1FTCA 1MROB 4JV0A 2PT0A 1SKWA 3FEYB 2RNEA 3M6VA 3DHWC 3MTJA 3GR1A 2CQ2A 4RBTA 4LT6A 4XPEA 1Y7PA 3OVBA 1S0VA 2OTJS 2GW8A 3A3OB 4ETZA 1HWIA 4A8KA 4UTGA 3R5BA 4DR7J 5E2QA 1HYSA 4USHA 1CJKA 3NCPA 1H73A 1FX2A 5JMNA 3Q23A 3HI9A 2GHWA 3TAMA 4GVBA 3HCXA 2A2CA 3MGJA 3PJWA 2I0XA 3WHIA 4A8QA 5DDRC 2RU9A 4CLUA 1SL0A 3CJ5A 3HXMA 2LDYA 1S10A 3TP2A 1U47A 5KT2A 4ZJLA 3E8OA 2HHVA 3QIPA 2R8JA 1RU2A 5CQGA 1RT2B 1HNZF 1WHVA 3RBDA 2BUNA 3R5JB 1N6QA 2VBXA 3CD7A 2E1CA 1FEHA 3DDNA 3BREA 2IMWP 1FRKA 1FRLA 4BDPA 2YH0A 2IHR1 1TFYA 1F9FA 2ZNZA 2PFDA 3LGMA 4WTYA 3SEOA 2O3DA 3UR3C 2ACYA 3QLHB 1NHKL 5LXYA 3DRRA 4MIWA 1ZM3A 4OLPA 1N32J 3T9ZA 2KVIA 3J81U 3CCQS 2FLOA 4J9PA 4OZ3A 4EK2A 4RW6A 4XK8C 3R97A 5HO4A 2Y0SD 5KFOA 3TOQA 4TU9A 1VRQC 4ED7A 1YJTA 3OR1A 1QSLA 3KTQA 4QR2A 2EW9A 4NRTA 4AXIA 1FESA 4DG1A 2YKPA 3R2DJ 3L7OA 1RWPB 2UU9J 4IKAA 4LF4J 4ZVHA 3KLHA 2CQHA 3PHTA 3BSNA 5ETOA 3I6PA 2ZE2A 1H6KX 1M1HA 4B02A 3GYGA 1NK4A 2HNDA 4OJHA 3LTOA 2GQ2A 3HHLB 4J90A 3M8YA 1URRA 1MSWD 3A3NB 1EB0A 5KFWA 4UF4A 2DO4A 3DM2B 3IWXA 1RT3A 1SJ3P 1DARA 1HBNA 2KH9A 2LMIA 5D3GB 4USKA 2BQRA 1RBAA 3VGVA 4FXWA 5E3QA 3DI6B 1ZAXA 1NB7A 2MZTA 3T1HJ 1I5OB 2IPOB 2G1HA 3HHLC 5FLXU 1FT8A 1V3RA 1E6YB 3JYTB 4LVNP 4JUZA 1CG2A 1XMBA 3I9V9 1AFIA 4ZVFA 1S12A 4J5OA 2EFGA 4IG3B 1YZ6A 1DRZA 4B3RF 4PUOA 2LDIA 3TVYA 1D9FA 2QA4G 4DR1J 5BYQA 1K9MT 1NBEB 2YX1A 2Y3YA 2MKSA 2GVZB 2HVHA 4C98A 1JLQA 1KVKA 2LYVA 3CSKA 3D28A 2EBEA 2HFNA 4MH8A 1NJZA 2GHVC 1VJWA 2MY7A 3OLAA 2BXJA 3BQ0A 3ZZZA 2HAIA 3DC2A 1KOOA 2V4RA 4J9NA 1LWCB 4NYZA 3MWBA 5SUHA 4XDCA 5F3ZA 1DTTA 1U45A 3GFXA 4ZMMA 2XY5A 3QGGA 1LWEA 4ZP7A 4DUYJ 2H3EB 3V6KA 2RQ4A 5B09A 4DF8A 3W65A 1RKJA 2MQMA 3QNWB 1S7HA 3OQ2A 5J2NB 5HK4A 2RHSB 1VISA 2ZUGA 1TMMA 4DSFA 2BM0A 4DUTA 2F8HA 1P9YA 1S4FA 4DSJA 5B7WA 5DLGA 3J81Y 3RB4A 4CO4A 2ZD1B 3I55S 5C25B 2J0WA 3W2WA 3NAHA 4IFVA 3SV4A 3ILOA 1M5SA 3ENAA 4N47A 1S6QA 4K0KJ 3DCAA 4ED1A 3CCSS 1EZZB 3AX3A 1RT7A 1X9WA 1TKXB 4MKBA 5DQGA 5DM6Q 3U27A 3SBMA 4CNZA 4OI4A 4A48A 2OP5A 1ZH5A 1SUQA 5KT7A 3W2VB 4I4BA 1JLFB 1KTQA 3O5TB 2EG2A 3HMJG 4PWWA 4CLYA 1DQ9A 2Z57B 4OYIA 4JI2F 4JV1A 3VQSA 4OI0A 3AWRA 3I9ZA 4DEZA 3RR7A 2DH9A 1RGVA 4ZVRB 4FNIA 4OZ0A 1BQMA 1UWAA 2BKPA 5KG6A 2AW0A 5IV4A 4QCLA 1C1CB 1CBKA 2MKYA 4QIFA 4U8YA 2DNNA 2PEHA 2VG6A 3ITHB 4O3SA 3QRPA 2ZWPA 1SKUB 4W4MA 1FHTA 3NGTA 2KB2A 2CQ1A 2VQFF 9ATCB 3H4BA 1A6LA 3VTIA 1RT5A 4EWTA 1W2BR 3MPWA 3MUVP 4E98A 1VLYA 1D1UA 1SH0A 3PJXA 5D0GA 4ED6A 1Q86T 1FFWB 4DOZA 1XWLA 1VQ6S 2OHDA 2H4WB 4MMOA 4DL4A 4ECXA 3IO1A 4Y34A 1YIJS 1T9YA 4CDIA 3LP2B 3DYAA 3MEDB 2J8SA 1VI7A 3PIOQ 4K4UA 4N5SA 2I9SA 1IBCB 2JNJA 1EHWA 2C3OA 2HNYB 2MKHA 5IZHA 2WVCA 4M5IA 2GQQA 3POTB 5BJRA 1YWXA 3MMCA 4NEZA 2DCLA 1E6VA 2LEBA 3GMGA 2XTCA 3SCJE 3I96A 4DV2J 3MR2A 1QSSA 3SQGB 4DV7F 2H5JB 2BABA 2ZDPA 2VA2A 2GA7A 2CQ4A 4ECVA 4P52A 2VG5A 4LR7A 5D78A 2Z2ZA 3AA8A 3LOUA 3DMJB 2FZCB 2MQQA 4KGVB 2AJFE 1XMQJ 4KKOB 2ZHOA 3PKYA 1NMEB 1IKVB 1S1VB 1L5UA 3AQPA 2DRDA 4JP8A 1WC1A 1AFJA 4ED2A 4XO0A 2YKQA 5LMUJ 2NPFA 2VFUA 4FYDA 3IMQJ 1TFWA 2QA1A 2XZDB 1VYAA 1WOSA 1IBLF 3QZ7A 5FDLB 1NM2A 1GFWB 5KFGA 1KC8T 1N36F 2V9KA 2P6SA 1X4CA 3QPIA 2JWNA 3ILJA 1GXTA 1OY9A 3C19A 2KRRA 4LF6J 2AZ1A 4LSNA 1RT6A 4WFYA 1BGXT 2UV8G 4PEOA 1SKSA 1IN0A 1C0UB 3BBCA 2WSFC 4YDXA 5JUMA 1NK9A 3PIPQ 3TX0A 5KFTA 3CCLS 1T9WA 4HACA 4JV2A 3PKMA 4WF9Q 2DY9A 1HNIA 1BY9A 3JAMU 2HQFA 4NZ7A 4B3SJ 5CAAA 2H48B 4R5PA 2FY1A 2PA8D 3R5CA 3TUZC 2LQ8A 5D4PA 4FVMA 4CLKA 3FBFA 1LWFB 1S1XB 3EM1A 4RW7B 4P75A 3T5JA 4NX9A 3T5KA 4HDHA 3IM9A 3KK3A 3KHGA 5HLFB 1U1OA 3OR2B 1AYEA 4C8MA 4FPIA 1C1BA 4O4GB 3M6WA 1JJCB 1N34J 2V67A 4Q44A 1PYSB 4DPXA 2ZZTA 1REVA 4Y2KA 5IOLA 1RCOB 1RTDB 4LFBF 3HVWA 1JKHB 1ZAWA 1C4CA 2J76E 3V2UC 1X5TA 4OYBA 1RTZA 2VIHA 4KHPF 3R7NB 2AGPA 2BMBA 3I87A 4USMA 3BKTA 2DITA 2HZVA 1HHQA 2IVYA 2QMXA 4OYMA 3A3PB 3T5HA 4PQUB 2HGNA 5F8LA 3LUYA 3JSYA 1X4FA 3C16B 1NZ8A 1ROFA 4P2FA 2CZ9A 2XSJA 4PZVA 1LXNA 2CJKA 3SCIE 1S9GA 4ZITA 2XMVA 5HMXA 3V4MA 1K0VA 3K0JA 4YY3J 2R7TA 1T95A 5D4OA 1WORA 1YBAA 1UVLA 1FCAA 1WHXA 4ZLLA 1MG7A 1OM2A 1VRTA 1KLNA 1G7CB 1SI9A 3FQKA 3Q22A 1M0SA 1FJEB 1V3SA 4AL5A 3BPDA 3QT6A 1NNDA 1TQLA 1B4SA 2MZQA 4X4PA 5LM7E 4ETXA 3AD7C 4PR6A 1I3OB 5H9EJ 3PM9A 3F73A 1PCAA 1VHFA 4MKVA 2HGMA 4IOBA 3DOMA 1G4CA 2XLKA 3FCWA 2M0GB 2HQGA 1IR0A 2J9EA 2EXUA 5D8HB 3N9UC 4EBEA 5C42A 4IO1A 4X4UA 2GQCA 2JRSA 4G1PA 1WSRA 4MKAA 3NNAA 4LSLB 4A8FA 1VCTA 4QPXA 1KQFB 3PDNA 3UR0A 1FD8A 2QLJB 3L09A 2APOA 3OFEA 3FEZA 3FRZA 4DU7A 3B4DA 4I7FB 1FKAF 3R1LA 3RBXA 4Y2IA 1LW2A 1T0TV 1UPMB 2KT3A 4WKRA 3JTPA 1Q16B 4DCOB 2Q43A 1VQLS 5F0UA 2J0SD 2UXDJ 4FZVA 4OX9F 1T9TA 5I42B 3Q89A 1U0SA 2O5DA 3VALA 3AODA 4YHHJ 2KXFA 2R42A 2Z56B 3M1VA 1SL1A 3W9JA 4HYKA 2JL9A 2HHXA 4O0IA 4UOGA 1RYSA 1H72C 4FKXA 1N0VC 4B3TJ 4JI6F 3BYPA 2ACMA 1B7YB 4XTTA 3B54A 2RRAA 1LKZA 5ITHA 1VQ7S 1UVIA 3EE3A 3F41A 3M30A 3SSRA 2V0NA 1XEZA 3ETMA 5L1KA 3NLCA 4NLDA 3TVKA 2UUCJ 2OD4A 5A8WA 2WTFA 4LF9F 1D8YA 3MR6A 4RX6A 5CH7B 1RA7A 1HYSB 3DRSA 4ZPVR 1CJKB 1KKHA 5CD4H 1PJ7A 4B3OB 2HHHF 2DK2A 4IQXA 3TAMB 4GVBB 4ILMA 3QZ8A 4QIVA 2V5HG 1J5EF 3OHBA 1RWXB 3OXFA 3BQ2A 4ZHRA 4DR5J 3DOLA 3QT5A 3BKFA 4TXSA 2ABYA 4MK9A 2ZH7A 2QLBB 3PYFA 2MPUA 1SJQA 5ETLA 2VPWB 3EGVA 3QIPB 4LF1A 5EN1A 1GQEA 2U1AA 3AD9C 4HT5A 4NCBA 3MUTP 3OL7A 5DDOC 1RU1A 1RYRA 1NKBA 2MY8A 1P27B 1R8PA 4F3OA 1JK9B 3PX6A 2XLJA 1J27A 5IC6B 3IC1A 3HHNB 2HBQB 3QGIA 2L9WA 3M8WA 5HVFA 1JMTA 2HWHA 3DRRB 3TEHB 4JBCA 2GIFA 2J7KA 3OHAA 2CQ0A 4URGA 3OTOJ 2OPSA 2B7CB 2E7VA 4X4TA 3N6NA 3M8RA 3CC2S 1U26A 3ISNC 4C9DA 3M8QA 4YQWA 1EETA 1Q5VA 4U7CA 2YH1A 2XMUA 5HBMA 4DBQA 4RW6B 1R31A 1GMWA 2XY7A 5THWA 1RK8A 4DR7F 5F41A 5IT0A 2OD6A 3OR1B 3PG9A 2Z8QA 5CYQA 1AW0A 3GONA 1SC3B 2VKZG 3FDSA 4DG1B 1FDDA 1RAGB 2POKA 2UVRA 1FJGJ 4NLPA 2J9DA 5IQ6A 1M1GA 2GJFA 4RU2A 3KLHB 4EBDA 4LF2A 2QL5B 3MPVA 2ZE2B 1Q82T 1XR7A 4NL5A 3MM7A 3ZZUA 5CCLA 2M7SA 4DWIA 3CJSA 1I1GA 1DJ0A 3RTVA 2HNDB 4JYAJ 3BH6B 4CM0A 2RJZA 1U8WA 3TWZA 2CPDA 5DGAA 1UW9A 4DQIA 1YRUA 4JOUA 4GKJJ 4M5DA 3KLEA 3T41A 2EFVA 1RT3B 1HBNB 2FHJD 1EP4A 3MZIA 3HF5A 3BS9A 3GR0A 2CPJA 4USUA 2ROGA 3OJUA 3X1LB 4OLOA 4ANDA 5C2CA 1IQTA 4TYBA 3TQ1A 1N32F 1LW0A 2UVUA 4I2QA 2NQPA 2CPEA 3PACA 2V8DA 2C2DA 3CTRA 4K5SA 4I6AA 1VBZA 3ISZA 2NXEA 4PUOB 2DR6A 1HA1A 1PJ5A 2ZWOA 3U1NA 2ZKTA 2Q66A 2ZC4A 1HKAA 4ZCIA 2R9LA 1BXNA 4F3MA 2IDLA 2CQBA 3HVAA 1V5IB 5A6PA 2CPHA 1JLQB 2FYXA 2XGPA 4CNYA 1WTFA 2VC0A 3CPWR 1UFLA 3TUJC 2XMJA 2ASJA 3H2VE 2R7RA 2EK1A 4Y00A 1QAYA 2UU9F 1U48A 2A6MA 3D3CJ 3NP5A 4KTQA 4LF4F 1PBUA 2B9YA 2F8MA 3M4XA 4P2XA 4ES3A 2XTDA 1DTTB 4GMKA 4V1Ak 4FF3A 3KJNB 3G96A 4KH0B 1LWEB 3T9NA 4RNNA 4YR3A 4NLYA 4FN5A 2QRRA 3BYRA 3MAQA 1Y3JA 2KFYA 4UT4A 3D68A 1X4BA 4U95A 1BE4A 2WK4A 2BRLA 1WI6A 3NWRA 2YQ3A 2P6TA 4GVLA 4DPTA 2V69A 2XEXA 5L39A 4ED4A 4LBHA 3W2WB 1Y5LB 1GMVA 4IFVB 5KFUA 3T1HF 1RWKB 4B3MJ 2MDAA 1S6QB 2I38A 2KL8A 4HHUA 2R2TA 2Z2MA 4WZQA 1U1RA 1G6BA 3ZZPA 3GILA 1IM4A 1RT7B 2LP4A 1DY3A 4NLSA 2D3OR 2W8KA 3RGIA 4ID5A 4M5KA 1TVRA 3TARA 2HYIB 1SB6A 1MN9A 1PYOB 3HVTA 1SUQB 4DR1F 2W9CB 5A2QU 3S6EA 3H5XA 1DAXA 2FJDB 4CLLA 2B43A 1FXLA 2FC9A 1S57A 4DFMA 1WG4A 1UVJA 4PCQA 2C2OB 1MMLA 5G0RA 1U6BA 4KGZB 1NXIA 1RJJA 3CW2C 1CJTA 1BQMB 3BF4A 2DPIA 4W92B 2J6SA 4J9MA 3THVA 3PNIA 3CIMA 4DUYF 5KOXA 4C2MA 2VG6B 2DNQA 2W2QP 4OHXA 3AX5A 5F8GA 3GJSB 1HNXJ 1BD6A 3W63A 1Y5IB 1NO8A 1RT5B 5KFJA 1PILA 2BQUA 2DNRA 4UZCA 2C2RA 4O4RA 1N0UA 4U67Q 3D1HA 5H9FJ 4QZVB 4K0KF 1UL3A 4KQZA 2J9DE 1RWNB 3RAXA 4Y2MA 2I5JA 1VQ8S 1URNA 1NJYA 1VQ9S 4EGLA 3DYAB 4DR4J 2V9WA 2D7SA 4DXLA 1L3KA 1X0FA 3J7A1 3CDBA 4CLPA 2X3GA 4IOAQ 1WDTA 3W5YA 2PE8A 4ES2A 2R7QA 1JLBA 3MMCB 1T8EA 1X4DA 3M9NB 4ES1A 1E6VB 4FXVA 2LXUA 4CLZA 4O3QA 3GE9A 3TYTA 1H2VZ 1DQAA 4LBIA 1VJQA 3I0RA 1WOPA 2MYFA 2ZHBA 5EWFA 2VG5B 2RMLA 4BC9A 4FP9A 4DFKA 4RUCA 3U1LA 4C0HA 3UCGA 3BO3A 3P8BB 5AXNA 3IA0A 2FJEB 5ETVA 5C24A 3J80Y 3AOCA 1X4AA 3JSRA 3I5AA 3K17A 5BR8J 1TL4A 2W4DA 2HVZA 4C7QA 3IBFB 4RNMA 2VFSA 3DGPA 5IM0B 1OYDA 1GTHA 1TR0A 2NSBA 3R8YA 2HVIA 2V63A 2QT7A 1GT8A 1F5AA 2KHDA 1T3NA 1SC1B 2ZOGA 2DHHA 5B0FA 2VONA 1ZAVA 1RQ0A 3G6ES 3I4HX 2K7KA 4LSNB 4QQBA 4K4XA 1RT6B 2DCUB 2QO3A 4MT1A 1B99A 3AXKA 4MAKA 2JEFA 2CVIA 5A2QY 2Z2LA 3CCES 1K44A 2HHPA 9RUBA 2CJYB 4LR9A 1HW9A 2HW3A 1XR5A 2CNNB 4MIAA 4M63A 2A0FB 1MWZA 2IFXA 4HR2A 2CJXB 4HACB 2O66A 4I2PA 3GIKA 3GSDA 1P1TA 5BYSA 1HNIB 4CIOA 4Z37A 4NLTA 3OL6A 4R5PB 5GADI 1X5OA 4DV2F 3JXOA 3TZXA 1HWLA 3EUNA 2CFXA 1X4HA 3RUBL 2HQ3A 3G6XA 5KT4A 3G4SS 1U2RA 2CNLB 2JX2A 1FRXA 2KT2A 3KK3B 1JWWA 1C1BB 2MMYA 4TU8A 3JSMA 1XMQF 3LGNA 1REVB 3K7RA 2LVWA 3DLLQ 1S49A 5DDPC 5LMUF 2QFJA 2FIUA 3BO2A 4ZVPB 3Q2TC 3DN9A 2BV3A 2CADA 5KFCA 4RNOA 3V4IA 1CQNA 4E0DA 1KQKA 3KXDA 3PYDA 3RRGA 1YSJA 2DEJA 1NJIT 3I5BA 4TY9A 4LF6F 3RAMA 2JOQA 2DHSA 1B0VA 3RJMB 1HL6A 2BBEA 3BGOP 4C0BA 1R6VA 4ZPWR 3T1YJ 3GFHA 1T02A 3CO0P 1UPPA 3MURP 2WSEC 4B17A 4MFBA 2QMWA 3A8EA 4P71A 2DVIA 5EWGA 1G3OA 2L3MA 3BBBA 2CA9A 1KFSA 3NS5A 3PW5A 2XSJB 4NLXA 3R7BB 1B0PA 4I69A 1S9GB 2KU7A 2K3KA 4NA3A 5RUBA 4CT9A 3GB0A 3NNCA 4B3SF 1I6JA 1N5YA 4OX7A 4YR2A 3QWUA 1IXKA 2ZVIA 1S97A 1XIQA 5KFXA 1HNVA 3TI0A 1Y0HA 1WTBA 3G8SA 2IIHA 4YR0A 2DHAA 5C7PA 4ZJOA 4S0MA 2MKCA 1U1LA 4MK7A 2V8GA 5CYJA 2ZKUA 2KTQA 2R8HA 3KDOA 2AV5A 2MZSA 4F4XA 2M2BA 1N34F 3WBZA 5EGYA 4X65J 3DOMB 1MWQA 3EXCX 3P5BP 1BHNA 5AXKA 2GCFA 5L9XA 1MWYA 3CE8A 3DNCA 5KG0A 2ZH3A 3B82A 4RW9A 5C42B 2AHOB 5K5MA 2EWHA 4QR0A 4CH1A 3HO1A 1Q81T 4PKDB 4G1QA 4LF5J 2QLFB 5MAOA 1NPPA 2DTJA 3KG4A 4CCHA 4GRSA 4HVZA 5B08A 2JSXA 1FX4A 4UUXA 3H90A 1FVQA 4QIGA 1LW2B 4OYWA 1AB8A 4PG5A 1HBMA 3CCZA 5AXMA 1RSCA 1S76D 2V94A 4N77A 1SH3A 2W1BA 4B9LA 1TP7A 1N5VA 4J9UE 1NZAA 3ZZ0A 3M1VB 4RR5A 1JLAB 3OTEA 4NMLA 2CQGA 1NK5A 2E9TA 1R6YA 5HSPA 2KXNB 1D8ZA 4OZ1A 4YY3F 3LO3A 3M30B 3D5MA 1F5BA 4ZPCA 1GMUA 1DTQA 4L75A 5A8WB 3M2UA 2ZH5A 3I4PA 2BE2A 3EMTA 3GV8B 1UZHA 5G4DA 5F3TA 3DRSB 1IJEB 4IFYA 2L08A 5D4NA 2DYAA 3UW1A 4V19X 1SJ1A 1VMBA 2ZVSA 1L3SA 1YJNS 1TL1B 2UV8A 5D6GA 1HHTP 5A8KA 3R9LA 3OTBA 2X1BA 4ZHRB 3RB6A 4E8UA 2UUBJ 3C6UA 3DOLB 5T14A 5J2PA 4A8MP 2JVOA 2IRXA 3KK2A 2MLXA 3K89A 2E5GA 1OS5A 2B5JA 4WBFA 1QVGR 2R7WA 1NDLA 3RB0A 4Z7CA 2HHQA 1IKWA 2UVVA 3ZTSA 4NXMJ 3GU0A 1PBAA 4DR3J 1H38A 1P9QC 3TJ8A 2UXDF 1KDNA 3BJYA 4YHHF 2KVQE 5D15A 2GGPA 1U25A 4ELUA 2ASLA 5K14A 4B3TF 1LFPA 1RT4A 4LVOP 4LF7J 2OPSB 4G65A 2YNIA 4ED8A 4OIXA 5LMNJ 1FDAA 1VOMA 3UVJA 5DG8A 3M8QB 3AB2B 3BSOA 1EETB 1VQ5S 2NYHA 1UEVA 4O23A 5HBMB 2XHWA 2GZOA 2UUCF 2MQOA 2M3DA 2XSFA 1N4LA 3UPFA 4DPUA 4EZ6A 3A8KA 1VRUA 1S7IA 3LP0A 1YI2S 2YNFA 1AZSB 2G0CA 3SIPB 1IM6A 2H5IB 3D0HE 5CYQB 3FBEA 5IFMA 2C2NA 3IAM9 2YWHA 2RUGA 2CJQA 1LQ9A 4JI4J 3K5PA 1S6UA 1VK8A 3J7YI 4NEYA 2HQIA 4PG6A 1APSA 4DR5F 3CIZA 4IH5A 4X62J 3MM7B 4WWSA 1WSVA 2NYIA 2PMHA 2LFVA 2BJ1A 4X2BA 2BANA 5KG4A 3CJ0A 2D68A 2E66A 2LEPA 1JJ4A 2DH8A 2EKNA 3HZGA 4DS5A 2BE9B 5EUHA 1FXRA 3G9CA 3BR8A 3LQVA 4M5DB 2KYXA 3KLEB 1NPKA 1HQEA 2E7XA 3KLVA 1EP4B 2YNHA 2KO1A 3AAWB 1WEYA 3G87A 1OY8A 1YJ9S 4HI1A 3W1YC 3NGSA 4TLRA 2RU3A 1LW0B 3OTOF 3MXHP 1FRJA 4I2QB 2CRLA 4CO5A 4RW8A 4NI2A 4RWXA 4I67A 4LBPA 4JI1J 4P2MA 3LGHA 1OY6A 3VAKA 4WXWA 2P2CB 4M94A 1MMDA 1TL5A 3DLBA 3W64A 2X51A 4KBIA 2OIHA 3CUNA 4F4WA 4RUAA 3ZZYA 2BQ3A 3QFHA 3M2RA 1FJGF 1JQGA 1N56A 1XMOJ 4C8LA 4G1IA 4NCAA 3ENQA 5ETKA 1EAYC 5GAHU 3EZ5A 4NZ0A 1RADB 1U2FA 2E1RA 1QD1A 2I8EA 3NY0A 3IAS9 1YJRA 3P4UB 3RW7A 4JYAF 2VBYA 3G82A 3LWLA 1RDRA 2QSWA 4TKTA 2JLGA 3Q0AA 3EGWB 4GKJF 1UW4A 5LSLA 1CC8A 2OSQA 5B0EA 2NR0A 4F67A 1H98A 3QAEA 2B4PA 1BQNA 4QR1A 2E1MC 4KGXB 5C5JA 3CDUA 1W7WA 3MPYA 4OQJA 2F8EX 4DX6A 4LR8A 3I31A 4AL7A 4OYOA 3MD1A 1AUDA 3HULA 2FZKB 5D0EA 3QQCD 4O3NA 2VKRA 5GAGU 3IP0A 1I51B 5U47A 2SXLA 4ID5B 4ZPBA 1TVRB 3P45B 4ILLA 4TU7A 2RSQA 1Y3KA 2YX4A 3F44A 3HVTB 2MSSA 1H2UX 2RQMA 3W9HA 3TEGA 1T94A 1LFWA 3MEGA 4BS2A 3TAPA 3DDKA 4ZP8A 2DR7A 4EMDA 3I0SA 4ZVGA 3PRDA 2XWXA 3G6YA 3K5NA 2EBGA 5G0RB 1S5ZA 2QX0A 4DR6J 2CPYA 1MW7A 4WU2A 4TLQA 2C28A 3DXSX 1CJTB 3DXBA 1GTEA 5JVGQ 5HQ8A 5F8NA 2D9PA 1VLOA 4JI5J 3MM5A 1VBKA 2DXDA 2HS3A 1OMSA 1WG5A 1KN6A 5A8RA 3CC4S 1FVSA 5HP1A 3NAIA 1NRKA 3IBCB 4DDFA 4F7VA 1FJCA 5KFFA 4ECTA 3KHHA 1BMQB 3KUHA 2ZJPQ 3SYZA 2MGZA 1KP6A 3HX9A 3ICLA 3CC7S 4USWA 4YS2A 4B3MF 2OPRA 2W9AA 2BJEA 2I5JB 2W2NP 1RA6A 3CCTA 2CZ4A 1RZMA 1W25A 1HQUA 1FFSB 2Y8YA 3U1MA 2V34A 3WQPA 4P74A 2A2DA 4WP3A 4P2SA 2ADBA 3CJKA 3MM6A 4NXNJ 4C8ZA 3UNYA 1KVIA 2YWKA 2ZBRA 1WF0A 2XWYA 1JLBB 3DU5A 5DZ6A 3DDIA 3W8PA 4OHWA 3BN4A 2XI2A 3NGKA 1DLOA 4EO6A 2QFIA 4KJIA 4N7TA 5L1LA 3G6VA 2O67A 3I0RB 1KQGB 2FJVA 2DO0A 4B9TA 4A8SA 3PW0A 2EC0A 2B6AA 1HNWJ 1RKIA 5CXTA 4F04B 2GJ2A 5A6WA 3HSGA 4DMZA 4CTAA 2J8AA 5GMDA 5SZTA 1CJVA 2DRAA 1XTZA 2WHOA 2MQ8A 5C24B 2FVSA 2IA0A 4ILRA 1RLDA 4HL9A 4AL6A 4LQ9A 3DGPB 1U6ZA 2JEGA 3D66A 1HNXF 3RR8A 3FEXB 1ZM4A 4A8WA 2PI5A 4DV3J 4EI2A 1R27B 2B8PA 3KUGA 2MLZA 3N6LA 1QSYA 3C2PA 2CNOB 4A8YA 3EWGA 4OYPA 4X4QA 4Q0BA 2GO8A 4DR4F 1MNEA 1J5OA 2OKQA 3D4JA 1X4EA 2GC8A 3MUMP 3OTDA 1NSQA 3BEGB 4I2PB 3CMES 2KJWA 1R8AA 1T05A 1OPZA 1YK9A 2AU0A 3R1HA 1FK9A 3NGUA 2RIJA 3UE2A 2GVDA 2AEJA 4USIA 2Q6BA 4WZMA 3LH2S 1L3TA 4I6YA 4K5RA 1Q1KA 5IC4B 1YJVA 4PG7A 3CCWA 3MTKA 4ZP9A 5BR8F 4DSIA 5J1PA 2QC3A 3BPSP 3N5BA 4CT8A 4KY3A 3KNGA 1PAEX 1UWBA 2MQLA 1L3UA 1FA0A 1FDNA 1M90T 3V4IB 1N52B 2JFDA 2K7JA 3GIIA 1XJWB 1FRIA 1VIXA 4URSA 2ZJRQ 2HHSA 2FQQB 3HD1A 3HDSA 1QUPA 2NSCA 2IM0A 3K5MA 3LPEA 2Z58B 4A47A 2C2KB 3QSIA 4KYZA 1RAEB 4MFBB 3HHDA 3V6HA 1HWJA 4XPCA 5GAEU 3M2VA 4QW9A 1SIWB 2VOOA 2VBWA 4WPAA 2J0XA 1P6TA 2LXFA 1U2CA 1N5YB 3O8WA 4WFBQ 1U02A 4IH7A 2JC0A 2CIMA 2WONA 1R0AA 2QJ3A 1QAXA 4C48A 1HNVB 2OMLA 4B9SA 4FBTA 3CO9A 1WKLA 3TNVA 4KFBA 4L3NA 2XHCA 1OSDA 7FD1A 2D41A 5HI7A 2PEBA 1KLMA 3FMBA 2HFZA 2IM3A 1FI4A 3GIMA 4BBYA 2HK2A 3AH6A 4E2FB 1R43A 1ZZFA 1HQ2A 3LPYA 1HFEL 4IDKA 2VU5A 4K4SA 4OV6A 5J1NA 1KRPA 4ICLA 2KZZA 4F4ZA 3DFEA 3E3XA 1VQKS 3D6MB 3ZZRA 1VGYA 4RW9B 2BR0A 2DGVA 4DL2A 5AJ3J 4G1QB 2JHEA 4KHRA 2DNZA 4CZCA 6FD1A 4H4MA 3Q8UA 2R2SA 1HBMB 1G2EA 3M8PA 3T1YF 5CCMA 2LXIA 2IM1A 3I5CA 1HD0A 2WZ1A 3CJ3A 2VZ9A 4O44A 2CKWA 4HKQA 4DFJA 3PX0A 1Q8IA 5HROA 3CCRS 1NSKL 4FF4A 3VF0B 1EJ7L 4N56A 2BKOA 1NDCA 4X66J 1VC5A 4KIAA 3MMAA 2XCPA 5DG7A 2OJ3A 2DB1A 1RTHA 1DTQB 2R3VA 1UVMA 4DSKA 3EGZA 5E3CA 1S0OA 2BRKA 3M2UB 4DHVA 4K2XA 2BE2B 4J37A 1BWEA 2DNOA 2AYMA 3GP9A 2E44A 4IFYB 3A8JA 3DLGA 2C3MA 2C3UA 4M5HA 2EPIA 2RAQA 3VVUA 1RWVB 2UUAJ 2YPZA 4X65F 3CVKA 5A8KB 1S99A 1QTMA 1RBLA 2WB1D 1VFJA 1HPZA 5J2PB 4DFPA 1OQ3A 1X31C 1RWUA 3KK2B 3KJQB 2BE7D 5DJBA 2B5JB 4LF5F 2FHMA 4UY85 2OFHX 2FGCA 4UW2A 1VC6A 3FZ2A 3R6LB 1KWMA 5KG5A 1RAHB 2YKNA 1Y5NB 2CG4A 1IKWB 4C11A 4QYRA 3DOKA 3GJRB 3AJ1A 3IWLA 4KC5A 1RLCL 5KFPA 3V5RA 3PVXA 5K8MA 2XZ2A 2RS2A 2GGPB 2BACA 4A8OA 1WKKA 2R4FA 3QATA 5K14B 3MAAA 1RT4B 3MM9A 2YNIB 2NZCA 1TAQA 2VA3A 3UVJB 2KXHA 4QWCA 4CP5A 5JVHQ 3I56S 5D0RA 4USVA 4WYWA 1M5PC 3TR5A 2ILZA 3BR9A 1U6FA 3D9BA 2CDQA 1VRUB 1OIAA 3LP0B 3HLUA 2ZH8A 2BZ2A 1YDLA 2YNFB 3AT1B 3IRXB 1E6YA 4KPYA 1U8SA 2VV5A 4PPDA 3RAQA 2K8GA 2XMMA 3M8SA 3GG0A 3PW2A 2YXLA 4M5JA 4QIWD 1S79A 1UJ5A 3RG6A 2UUBF 1R0CB 4AT1B 1IKYB 2OO4A 4I68A 1VIOA 4WTOB 4EO8A 2BANB 2WVFA 2MJNA 1Y4ZB 3RW6A 5IT9U 3P6YC 2OUGA 2H1YA 4W90B 5HQMA 2PFFB 1D09B 1TMJA 2A18A 3HHLD 4NXMF 1HQEB 4TQSA 2EKYA 4DR3F 2LECA 4H4KA 1X4GA 2YNHB 4KAIA 3NCRA 1FXDA 2CUYA 1A0OB 4U9RA 4ZIWA 1YJUA 4H4OA 3CCMS 2XZWA 3LAKA 1M5VC 4Q8FA 2XLIA 4V19J 2B9XA 1S9EA 1EARA 5EHHA 2PMWA 2XM3A 4LF7F 3QO9A 3G8QA 5LMNF 2JC1A 2XMWA 1SH2A 1S1UA 4RW8B 3V6DA 1S4EA 3VVTA 2AYGA 4NI2B 3T1AA 3CWJA 3MCMA 3K58A 4ZPDA 3PCOB 3PV8A 4DCJB 4DV6J 2BVZA 3IS9A 4FXDA 4MYTA 5FLXY 4DLGA 1WI8A 1C2PA 3UO0A 3MR5A 4L73A 2XBPA 4DV4J 2VFVA 3NRBA 2R2RA 3M2RB 4F2SA 3H2UB 4JI4F 1QJHA 4OJGA 5B0AA 2AKWB 2BJ8A 4EU0A 3QJJA 1RAIB 3O6QA 5KT6A 1CJUA 4DQSA 4X62F 2A10A 2NZ4A 3S01A 1QAJA 1VC0A 4UOFA 4JV5J 3IXQA 3DGVA 2DGSA 5K8NA 3G82B 4IG0B 2ROEA 2AEMA 3D6HB 2MQNA 4MKYA 3GCXP 2YQ1A 1Q7YT 1Q78A 2VFRA 1IQZA 2GHPA 1TTHB 2YPYA 2EI5A 2CQDA 3HZEA 5HANA 3QT7A 1IBMJ 1BQNB 2M70A 2DNMA 1TL7A 3HKWA 2DNLA 1B3TA 3EPGA 6FDRA 2IJFA 2AGQA 2LQJA 4YB1P 4HLBA 4UOHA 1UMJA 1ZPVA 2E5LJ 1H7XA 3MMBA 5GMEA 1RE1B 5D0HA 1OO0B 4IYQA 2CQIA 3HP6A 4OYAA 2N4CA 3CJRA 4JI1F 3JQJA 3SV3A 3AHPA 2RQCA 2DIVA 2A3JA 3CJQA 4NPOA 2CPZA 1F1BB 1UJ4A 4YB5A 4WKYA 3MEGB 3I0SB 1YG0A 1KTVA 4H54A 2DGXA 2HS4A 2IYGA 4F0KA 1WC3A 2QLXA 4FKYA 2C3PA 4ZK7M 3CGIA 2UXCJ 3FNNA 3LA0A 2HKEA 4LF8J 2RS8A 1XMOF 3SFGA 3OUYA 3TA0A 2RE1A 2X1AA 1HI0P 1A9NB 4ID8A 3CD6S 1UZDA 4Q2MA 1JJHA 3L4BC 3MM5B 2GO9A 2E7WA 5A8RB 3OW2R 3NS6A 4YN3B 4WIQA 4YOEA 1S59A 5HP1B 2EC2A 2ZBIA 2KT5A 2AJQA 2WVDA 4ZVEA 2FVRA 4PWDA 2HBYB 3BSAA 3DRXA 4XDDA 4K4WA 2DNHA 1D0EA 2ZEJA 5HVHA 2W7PA 4ECQA 2W7OA 2MGZB 1UTAA 3HFZB 2IJRA 2R7UA 1EKSA 1U1PA 2E5JA 4QIEA 2C2ZB 2ILYA 1KHVA 2OPRB 1YBUA 2IDEA 3CD0A 1YTYA 4AQYJ 1SQGA 4CLFA 2HQDA 4OX8A 1HQUB 1F0XA 3DRPA 3WDOA 4DSLA 2MZJA 3QBCA 1H3DA 2J6UA 1Z1ZA 2AD9A 3CJKB 3MM6B 2N7YA 3VAHA 4OX6A 1FE0A 3JS9A 1CQMA 3UDLA 4GO5X 3MM8A 1DLOB 4ELTA 5KFNA 1RWWB 1O6XA 2HURA 5IQQA 8ATCB 2QG9B 1UJ6A 2V8PA 3G2XA 4DR6F 5IT4A 1ZTWA 2MHNA 1TV6A 4LRDA 5KFVA 2NXNA 1WC5A 4U6PA 2B6AB 2HPUA 2DXEA 1VQ4S 1VBYA 4UY8T 5HMYA 3H5YA 1U1QA 4CTAB 2XNQA 4JI5F 3ADAC 4CO2A 3GJTB 3AXMA 2LA4A 3MECA 3HHKA 5B0BA 1RABB 3CB4A 2V2QA 1YGYA 3M6XA 2GX8A 1KSPA 1D9AA 1FRMA 2GFFA 2MB0B 1X5SA 2CJ9A 2MKJA 4PWUA 4RNFA 2PMZD 1TAUA 1R3NA 1RHKB 3AOAA 5ETSA 1T7PA 5DGBA 4A46A 3PO5A 2NXCA 2W8LA 3H25A 3H4DA 1AA1B 3Q86A 4DX8H 2N7CA 2B51A 1WHWA 4L6V3 3ZNJ1 2GV1A 3US5A 1ZS6A 2E29A 1RWOB 4Q0BB 4X4SA 1J5OB 3SXLA 3ZXWA 5L9NA 2FDNA 2G2ZA 3DHXA 4LJMA 3ETOA 4NXNF 4LFCF 1Q95G 1GXUA 2RRNA 1YVFA 3UNGC 5IWAJ 1SJRA 1T05B 4ZVTB 1BQXA 2IAJA 2IC3A 1QLNA 1FK9B 1YITS 4F0HA 5C2GA 3U7JA 3MHYA 3E51A 1SCJB 2Z30B 4W98A 2J7UA 4PYDA 3IBWA 2GVDB 3KNAA 1HNWF 1LOUA 4WFNQ 3LWMA 5D4LA 1X9MA 3D2WA 1S9FA 4ZCKA 2RKIA 2FTRA 1C0TA 2C2EA 1S1WA 3RBZA 2CDRB 2WRMA 3JAMY 2B0GA 1QUVA 3UDVA 3DRYA 2HWIA 3U02A 2OAUA 2ZITA 3ET6A 4ITSA 4ZOSA 3CF5Q 2D3O1 1UWBB 4OZ2A 1J2VA 3PEJA 4C8KA 2CAJA 4JI8J 4DV3F 1NK0A 3OSPA 4LIWA 1WNEA 2ZH1A 2B4OA 4OI1A 4Q8EA 2D1CA 2E1AA 3W5XA 3D0GE 4ZKAA 2J7WA 4NWBA 2RUSA 4FS2A 4KE5A 5E7OB 1HBOA 3ILIA 4Z2XA 2K3IA 3M2VB 3SSSA 2B56A 1PO6A 3O44A 5I3QA 2N3OA 2ASDA 5L1JA 1FKOA 2XMKA 2OLWA 2PN6A 2ROPA 2CG8A 1JLCA 3TW0A 5DDQC 1Z2LA 4OV1A 1SL2A 1Y9OA 2WONB 1R0AB 3BDEA 4X4NA 2AWZA 2DHXA 5I42A 2VB6A 1WACA 2V4QA 4KFBB 4A8XA 4DL7A 1F9EB 4TY8A 3MR7A 3EX7B 1KLMB 4R8UA 3FMWA 1N6QB 3KK1A 1AXQA 4C3KA 4MK8A 2V8HA 4IDKB 4RNHA 4UQGA 1IBKJ 4ICLB 3KLFA 3CDWA 1ZPWX 1B7FA 4OI3A 4ZCLA 3BV8A 2F4FA 4R0JA 1SQEA 2KFZA 3PYEA 4OMFG 1S1TA 1SV5A 2C22A 1RT1A 1HR0J 2M8HA 1JXLA 2FHJA 4B3OA 1SBRA 2VUGA 4NLQA 3R7SB 3EZUA 4H4MB 4HHJA 4ECWA 3C3LA 3GFZA 2JEJA 1WC6A 3M8PB 1LNQA 3NXZA 5E0OA 2H65B 5E3RA 3FQLA 4O44B 1N33J 3QIDA 1Q0NA 2VH7A 4WU3A 4Q45A 1NHVA 5HROB 3M9OB 2BW2A 3D3BJ 5HN0A 3NCQA 2MTLA 3BDPA 3EPIA 2FJBB 3H5SA 3O2IA 3MMAB 5B0CA 2M9KA 2KFNA 5LSOA 3ZO7A 3PYGA 2FVPA 4M8LA 2LA6A 1RTHB 2QTWA 4ZDNA 1KQSR 1XNQJ 1SJFA 5KFMA 4AUKA 3MDFA 3GIRA 2VJVA 3THPA 1YZ7A 4PXBA 4J91A 3N4WA 2OPQA 3ZFVA 3DLGB 3QWPA 3W61A 3OJSA 1U1KA 1XC9A 4ENOA 2DGQA 2RDIA 2HHTA 4KO0A 5I4MA 3FCHA 1N48A 3TX8A 5DQIA 3M7VA 3BH7B 1HPZB 4CLSA 3K59A 1RAAB 2G1DA 2CPIA 5F9LA 4QYZK 4OZLA 5AJ3F 4DPOA 1U49A 1OJ4A 2O01C 2YWWA 2R2UA 1K0TA 1AT1B 2FB0A 2YKNB 4C11B 3DOKB 1KD1T 5L38A 3KYLA 1K73T 4N76A 5CYMA 3ISND 4KV8A 4LUBA 4TN2A 4NOHA 3K5LA 2HNZA 2ZUAA 4ZCMA 3H0PA 2OPPA 2R8IA 2ZZMA 3A4TA 3RB3A 1PG5B 3MAAB 3NOGA 3T6JA 1NPRA 5KOWA 4X66F 1NHUA 3GQCA 3MM9B 2WBMA 3VHQA 2KG0A 5KFRA 5KAKA 3T5LA 1OSCA 3HJVA 4LRBA 4HT7A 1Z4UA 3KJVA 2W2MP 3W5ZA 1GNKA 5J2QA 2QE5A 2YVSA 1FKPA 3IFEA 4F4KA 3NMRA 2W7AA 3HD2A 3Q8PB 4LFAJ 2LEAA 4OJ3A 4F36A 1N54B 3W8GA 1ULRA 2HIYA 3O1LA 3B6BA 4HDGA 3CMAS 4CM2A 4IRDA 1HARA 1FWPA 4FF1A 1OYEA 4AD6A 2I2YA 3OL8A 3H5UA 2OTLS 2Y9HA 1S72S 5M2UA 2UUAF 1HIYA 3J7Z5 4Q7AA 2FC8A 1KOHA 5KFZA 4JI0J 1ELOA 3HVRA 2JVRA 2QGFB 3NG8A 4UOCA 2EFQA 1O51A 4M5LA 3FRYA 3HHEA 4QBUA 2Z0GA 2JEIA 2XG8A 1WEXA 3R5DA 4LIRA 1HWKA 2G4BA 2CQCA 1RUSA 3VCDA 2XC9A 2K2PA 2ALYB 2QL9B 2FJAB 2DGOA 4DV0J 2HHWA 5BXIA 3Q8QB 4ATNA 2OH2A 4RPFA 4RBUA 3FFIA 4KH1B 4H4OB 3M05A 5B0DA 3M6UA 3MR3A 1TK5A 2EG1A 2HG4A 4EZ9A 2EFOA 2F40A 1QM9A 5T7LA 4GKKJ 1S9EB 1RTJA 4QU7A 3QO9B 1RAOA 4RZRA 2ZJQQ 4BWJA 2QYCA 1S1UB 3PR5B 4H4KC 3V6DB 2R7XA 2YKAA 1W26A 3SZ2A 1JLGA 3ZTOA 1ZYQA 4DU8A 3IR6B 1O0PA 4OL8A 3TUPA 3A1YG 3D7SB 3OPKA 1TL3A 2IRYA 2DEIA 2NS1B 3IS9B 2HWTA 4F4AA 3JTOA 3CJTA 5CABA 2DNYA 3HSZA 4IOCQ 5KFLA 1TUVA 1HHSA 2AJ1A 2Q1LA 3SCLE 1KVJA 2DNGA 2XO6A 3E01A 1FFGB 1Q7LB 1EKRA 2JFKA 1CJUB 3LW5C 3EZOA 4P7TA 2W9CA 2DR9A 4FYXB 1YBTA 1WC4A 3DU6A 1V5VA 2Y0BB 4X4OA 3KDNA 5KG2A 3BN7A 6AT1B 1TKTA 4DX5A 3C15A 1F6TA 2XI3A 3EDRB 3Q24A 4F50A 1ICEB 1WF1A 2CJAA 2VL1A 3RZAA 2PA3A 1NLKL 3OLBA 1Q53A 2WB4A 3GCWP 2NREA 3GWCA 1FTRA 1QY7A 1YX2A 1NK7A 3DLJA 1TL7B 1U7LA 1K47A 5CA5A 4DQPA 4Y3CA 2AEFA 3P3DA 2HIQA 3THTA 2X3DA 4YB7A 2WBRA 2R7OA 4YFUA 2P5VA 1CVJA 2EEYA 1CS4A 3MMBB 5DZ7A 3V81A 2HVDA 2M4MA 2B3TB 4I56A 2IJNA 3NKYA 2RD5C 4ED0A 2BDPA 4ZVOB 1YRXA 1WDDA 2QLWA 2BA9A 4HEA9 2A6OA 1WWHA 5GMKa 2DNPA 1I94J 4DV6F 2KJVA 2G0IA 4M5MA 1SQFA 2IY5B 4D3GA 5IXUA 1JB0C 2WW4A 2QYGA 3IM8A 5LJ3Y 3OL9A 3R6GB 4WK3A 2H54B 4DV4F 4ER8A 1IVZA 2XTJP 1SIZA 1HI8A 1SC4B 4IRCA 5I3UA 4PG8A 2CQPA 3OUYB 2BM1A 4KT0C 3KLIA 2Y1JA 2GMJA 3KMSA 2OEMA 3EICA 3OFFA 5AXLA 4JV5F 2CZVC 3VGTA 4Y65A 2VC1A 3EVMA 1XN9A 2HHUA 1S0NA 3ZNUA 3MEKA 4AFFA 4PWDB 3FGVA 5KFIA 2L9DA 3VAFA 3N01A 1FD2A 2ADCA 2EK6A 1IBMF 4FF2A 3OSNA 1A7GE 3AY0A 3H98A 2Q79A 1CC7A 2MZ1A 4M95A 2CWKA 3JB9k 3MOZA 2VQEJ 5ETTA 4JI3J 1EX8A 2QV6A 4DQQA 2E5LF 2CXEA 4ZPTR 5IM0A 2NPIA 3WIVA 3DRPB 4C4WA 3H7HB 1REGX 3BGRA 3HT3A 1X7VA 3BSCA 4BWMA 4OZ5A 5CZXA 2HAFA 1RWMB 4B08A 1UVNA 1FWKA 1XR6A 3MM8B 4ECRA 3AJ2A 2K1RA 3OFHA 1FEEA 1T11A 4B9VA 3NGDA 2UXCF 5EDWA 1TV6B 1S6PA 4LF8F 2XMAA 3PY8A 1FNOA 4OHYA 3MF5A 1CPZA 4F02A 2YY3A 1YJWS 2MZRA 2W01A 1IKXA 2W4PA 1OWXA 5HJYA 1VQOS 2J9CA 4NMXA 1RAJA 3N79A 1WOOA 4Z7YA 1X8DA 4DLEA 3MECB 4F26A 4F4YA 1KHWA 1S0MA 3MOJB 1HWUA 2WOMA 3PFOA 2EVZA 3EVWA 3KLGA 1F60B 5E33A 1KS2A 5DQHA 2MKIA 1YKWA 5HQLA 3ELHA 1SJ4P 1HMVA 2BW7A 3LP1A 3RBEA 3ZZOA 4BHQA 4JI7J 1NCLA 4ED3A 4J9RA 1HI1A 1XK8A 3GYXB 2AQ4A 1VRTB 2RF2A 1IJFB 1F3VA 3DLHA 3ULHA 3B4MA 3BB5A 1HBUA 3LAMA 2KM8B 3LALA 4LRFA 3C14A 4WJBA 4AQYF 1UA0A 1YHQS 1K8AT 5LSRA 3IG1A 3FBCA 3IGVA 4K8RA 3KG0A 2VG7A 2XCAA 5L8RC 3J7ZT 4K4VA 2N4DA 3T3FA 3R2CJ 4NE9C 2KM8C 4ZA1A 4CYUA 4X64J 2IAJB 4QU6A 2IC3B 4P7VA 4DN9A 2FLNA 2CVEA 1ZETA 1B64A 1FERA 1NUEA 1S6OA 3UI3A 1NSAA 2DGWA 4WE1A 2Y8WA 2VODA 2V4JA 4IR1A 1XBWA 2RKIB 5KT3A 2ZOMA 1C0TB 2FVCA 1S1WB 2ATLA 1JXEA 2ZZNA 3QJPA 4DS4A 4QWEA 5T41A 5HJXA 4EBCA 4RWWA 1H0HB 3ET6B 2W25A 2PO4A 2Q6CA 1UCNA 2W2PP 3TA1A 2M88A 3PRVA 3VGUA 5F9NA 1QAIA 2BJ3A 8RUCA 2YWGA 2KG1A 4RKUC 3VAJA 1PKUA 3FJ2A 4NCGA 2VD3A 1R8HA 3D1OA 1L3VA 5HATA 2FY8A 4OHZA 1YRTA 2XY6A 2L9NA 1CULA 3OVSA 3C8YA 1CEZA 2AIRB 2H5EA 3F56A 1OQ6A 2GS8A 1JNRB 3CJ8A 2RILA 2E5IA 2QIFA 1KONA 4PXDA 1HBOB 3MCOA 4AE5A 1IR2A 4URQU 3GIJA 2XS5A 1FKOB 2JLFA 3UD4P 2RT3A 1QE1A 1VQYA 1JLCB 3D6TB 3GV5B 4B9UA 5IWAF 1JIHA 3ZZTA 3S8SA 1MMNA 2AGOA 2EFNA 3DLKA 1ZA1B 2HK3A 2GAGC 1H2TZ 5H1SV 4KSEB 2YQ0A 4PABA 1U09A 1VQSA 4K50A 4TY8B 1JLAA 4K4TA 4FVCA 2MKKA 2KKHA 4R8UB 3R5AA 3VQTA 4JB8B 3RRKA 3H8YA 3KK1B 1UETA 3N6MA 3GJQB 1B70B 4DL5A 2YWFA 1RISA 4OZJA 4USTA 4KRWA 1P1LA 1FNMA 3IR7B 2C2MB 3KLFB 2VBZA 3WX8A 2FJWA 1SKRA 1S1TB 1SV5B 2LKZA 2D3UA 1RT1B 3PEHA 3N28A 1TELA 3MCNA 3OXLA 3FSIA 1H7WA 4JI8F 2KDOA 5K8OA 1Y10A 4KR0B 5KFEA 2M5YA 1XQIA 3IN5A 4IQMA 1KEKA 2ZC3A 1TL1A 1CLFA 4DR2J 1MU2A 4Y6IA 3KKFA 4Q5VA 2ERRA 2LQ5A 3O3LA 4WFAQ 1N5QA 4OHVA 4NA2A 3MD3A 4NLGA 1K1QA 5LJ5Y 3OD2A 3ONQA 3NBPA 5JXSA 1HD1A 4ECZA 2HVEA 4K7QA 4U7UK 2AJ4A 3IWNC 4CI0B 1KNZA 2B9EA 1TKZA 2E9ZA 3QFWA 2YTCA 3G8TA 3AD8C 3OFGA 3KG1A 3IGNA 4O0NA 5H9EK 4OI6A 2B4VA 2W4CA 4KB7A 3H2LA 4C0OC 2V2VA 2IBKA 4XAKA 2Z4PA 4CLTA 2QA2A 5B0GA 2OPQB 4BCAA 4Y2CA 4EYIB 3NS7B 2F65A 3EJMA 4FBUA 1UAWA 2G9OA 1RHMB 4KO0B 1IBKF 4WP8A 3MAHA 1WELA 3W7BA 2E5HA 3MEEA 1AUSL 1WD6A 2HSEB 1HR0F 3SMZA 1AZSA 1RAFB 2DY1A 1UFWA 4U8VA 2OI2A 4UZBA 1RXOB 2F7VA 2L41A 2X1GA 3FCVA 2AF6A 1O8BA 1IWAA 4B9NA 5ETMA 3WZ0A 1YLXA 5CYMB 4RUBA 4KV8B 1XNRJ 2HNZB 2H9ZA 1N33F 4WP9A 2OPPB 3M9MB 4HI2A 2GMHA 2VFTA 3VV2B 4C8NA 1JLEA 2V2ZA 3PZPA 1T9VA 3M32A 4BC7A 5KFAA 4R25A 4I1TA 3NNHA 3KJVB 4B9MA 3G86A 5FD1A 5J2QB 3GYNA 3CCVS 4Y28C 1XNQF 1FKPB 1QVFR 1PC4A 3S7RA 2CNKB 1KBRA 4C8OA 1T03A 3PXGa 4A4JA 3HPOA 1GMWD 3AOBA 4RBVA 4J9OA 1FNXH 1RP5A 3K2YA 2V2KA 3QJLA 1GX6A 4RJVA 3L3CA 1JJ2R 1ZM2A 1O5JA 1N5TA 5M2RA 2N3LA 3OVAA 2F63A 4RW4A 2XULA 2BKNA 4Q2LA 2MQPA 2NLWA 3CXCR 3HSDA 5AT1B 2GAHC 4DX7A 2OEKA 2BOAA 3K8VA 3R5GA 2ASYA 2LQBA 4YUDA 4J9QA 2YNGA 3UD3P 1OPIA 2F9JA 5KFKA 2IYIA 3TUIC 5LXRA 3MCSA 2JZ5A 3FFIB 5DETA 4QWBA 4PAAA 4ED5A 1C4AA 5GADU 2JJ4D 3CNQP 4DL0C 1KFDA 2JLEA 4P9SA 3W62A 3SFUA 1BUXA 3UN2A 5T7LB 2LQ9A 1RTJB 2ZH2A 2YKMA 4CH0S 3D54A 3TVZA 1NJXA 5F8HA 2D69A 3RU0A 2V68A 4LRCA 2Z2YB 3UD5A 1RTIA 1V9OA 4J9LA 4ZVSB 1JLGB 4DUZJ 3J80U 2AJ0A 3G71S 2V1TA 3CJ4A 3FUYA 3L7PA 3VAIA 1TK8A 2FJXA 4J7CA 2OEJA 3MI7X 4LFAF 5KG7A 1TL3B 5ETRA 2VJUA 3P96A 4CH7A 2J0QD 1QTNB 2J6TA 1BC6A 2PGCA 1GH8A 2JH3A 3C6TA 2W9BA 3F0NA 4MYUA 5AE2A 3BO4A 2QA4S 1FWLA 2HLUA 4C6AA 5HL7Q 1V3ZA 3QMQA 4CRJA 5ETQA 1WHYA 4ANCA 3E01B 3KOAA 3LANA 2FUG9 3TZZA 4JI0F 5DG9A 5K20B
chains in the Genus database with same CATH topology
3H4DA 4OZ1A 4MH8A 4O3PA 4YY3F 1NJZA 2GHVC 1VJWA 3LO3A 2MY7A 4AXJA 3OLAA 2BXJA 3BQ0A 3ZZZA 3KMQA 4DX8H 2FD2A 2HAIA 2B51A 2N7CA 3SCKE 1TKTB 1WHWA 3M30B 4L6V3 3D5MA 3DC2A 1KOOA 2V4RA 2GV1A 1F5BA 3FSXA 4J9NA 3CULA 4ZPCA 5HMZA 2VASA 3US5A 1LWCB 4NYZA 3MWBA 5SUHA 1DTQA 2E29A 1UKUA 4XDCA 5F3ZA 1DTTA 1U45A 3GFXA 3IR5B 4NA1A 4ZMMA 5A8WB 4Q0BB 4X4SA 3M2UA 3K57A 3N5FA 2ZH5A 2XY5A 1J5OB 3I4PA 1UEUA 3QGGA 2BE2A 3GV8B 3SXLA 4I64A 1LWEA 4ZP7A 1Q8BA 5G4DA 5F3TA 5KFHA 4M1KA 5F0WA 3V6KA 3DRSB 2RQ4A 5L9NA 4DV0F 5B09A 1IJEB 4IFYA 2FDNA 2L08A 4DF8A 3DHXA 4LJMA 5D4NA 3ETOA 4NXNF 4LFCF 3UW1A 1GXUA 4V19X 4G6VB 2RRNA 1RKJA 2MQMA 1SJ1A 5JJBA 1S7HA 1YVFA 3UNGC 1SJRA 3OQ2A 5J2NB 4N8NA 1T05B 1VMBA 2ZVSA 2NUUG 3CD5A 1L3SA 1YJNS 2ZUGA 4DSFA 4GKKF 1TL1B 2UV8A 1VBXA 2BM0A 5D6GA 1M1KT 1BQXA 2IAJA 2IC3A 1HHTP 2F8HA 2YKOA 5A8KA 1QLNA 3OTBA 3EYZA 2X1BA 5BYRA 1FK9B 3V81B 1YITS 1S4FA 4ZHRB 3RB6A 4E8UA 4DSJA 5B7WA 5DLGA 3C6UA 3DOLB 3J81Y 2DRBA 1TZ0A 3U7JA 3MHYA 5E5NA 3RB4A 5T14A 3E51A 5J2PA 3UQSA 2J7UA 4CO4A 3IBWA 7FDRA 2ZD1B 5DO2A 4C97A 5C25B 3I55S 4A8MP 3VAGA 2NUHA 2J0WA 2IRXA 2JVOA 3W2WA 3KK2A 2ZH9A 3NAHA 4IFVA 3KNAA 2RQKA 1HNWF 1LOUA 4WFNQ 3SV4A 1M5SA 2E5GA 5D4LA 3LWMA 1X9MA 4N47A 1OS5A 2B5JA 3D2WA 1S9FA 1S6QA 1U1NA 1JX4A 4ZCKA 1QVGR 3DCAA 2RKIA 4ED1A 2FTRA 1C0TA 2R7WA 2C2EA 1S1WA 3RB0A 3CCSS 1Q8LA 1RT7A 2WRMA 1X9WA 2HHQA 5FIIA 3JAMY 1IKWA 2B0GA 1QUVA 1U4BA 2UVVA 5K8PA 2MJUA 5KFQA 1TKXB 4MKBA 5DQGA 3DRYA 2RRBA 5DM6Q 2HWIA 5A0YA 3U27A 3U02A 2ZH6A 4WIIA 1H38A 2OAUA 5D77A 1P9QC 3RYLA 1N88A 2ZITA 4CNZA 4OI4A 2UXDF 4A48A 2OP5A 1ZH5A 5J2MA 1SUQA 3BJYA 5KT7A 3W2VB 4ITSA 4I4BA 4ZOSA 4YHHF 3CF5Q 3PO4A 1UWBB 1JLFB 1J2VA 3SDEA 2GGPA 3PEJA 5I3UB 1KTQA 1U25A 4C8KA 1RI7A 4C8YA 4ELUA 3O5TB 2ASLA 3LF0A 3KLIB 4WK1A 5K14A 4DV3F 4B3TF 1LFPA 1RT4A 2EG2A 1NK0A 5AE1A 3HMJG 4LVOP 3OSPA 2OPSB