1XR6A

Crystal structure of rna-dependent rna polymerase 3d from human rhinovirus serotype 1b
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
460
structure length
460
Chain Sequence
GQIKISKHANECGLPTIHTPSKTKLQPSVFYDVFPGSKEPAVLTDNDPRLKVNFKEALFSKYKGNTECSLNQHMEIAIAHYSAQLITLDIDSKPIALEDSVFGIEGLEALDLNTSAGFPYVTMGIKKRDLINNKTKDISRLKEALDKYGVDLPMITFLKDELRKKEKISAGKTRVIEASSINDTILFRTTFGNLFSKFHLNPGVVTGSAVGCDPETFWSKIPVMLDGDCIMAFDYTNYDGSIHPVWFQALKKVLENLSFQSNLIDRLCYSKHLFKSTYYEVAGGVPSGCSGTSIFNTMINNIIIRTLVLDAYKNIDLDKLKIIAYGDDVIFSYKYTLDMEAIANEGKKYGLTITPADKSTEFKKLDYNNVTFLKRGFKQDEKHTFLIHPTFPVEEIYESIRWTKKPSQMQEHVLSLCHLMWHNGRKVYEDFSSKIRSVSAGRALYIPPYDLLKHEWYEKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the RNA-Dependent RNA Polymerase from Human Rhinovirus: A Dual-Function Target for Common Cold Antiviral Therapy
pubmed doi rcsb
source organism Human rhinovirus 1b
molecule tags Transferase
molecule keywords Genome polyprotein
total genus 136
structure length 460
sequence length 460
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1xr6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xr6A02
1RDRA 4K4VA 4EBEA 4MFBB 4WFZA 5EWGA 4RW7A 4NLVA 4O4GB 3KMSA 1T03A 3H4DA 5KFVA 4ECTA 4KFBB 3JYTA 4NLUA 5K14A 1UWBA 4J9MA 5KFEA 1C2PA 1QE1B 1TVRA 2E9ZA 1VRUB 3C6TB 3CWJA 5DGAA 2UVUA 1RA7A 2WOMB 4PWDA 3UPFA 2XGPA 1DTQA 2D41A 2OPRA 4ZVGA 2BR0A 3V81B 2IM2A 4GC7A 4IFYB 5J2MA 3DOKB 3QLHB 3FRZA 4LSLB 4RUCA 1T94A 3MR3A 1JLBB 4RZRA 2W7OA 1RTIA 2VG7B 2W8LA 3T5HA 1LW2A 4IR9A 2IJNA 1J5OB 3MEGA 3MTKA 5KFIA 5C25A 1SH0A 3M8QB 4KBIA 4LSNB 4B3OA 4RNMA 3KK1A 3QIDA 4OL8A 3CDUA 3FQKA 4TYAA 4WFYA 1FK9B 4IRDA 3NMAA 5KT4A 1K1QA 4KV8B 3IG1A 4MK8A 2ZD1B 5F9LA 2HNZA 1IKWB 1S48A 2IM3A 2B6AB 1HYSB 2YNIB 3GIJA 3G6YA 2J6SA 3LAMA 4QW8A 5KFSA 4EEYA 1RA6A 1RTJB 4ED8A 3NBPB 5EUHA 4DL2A 1S9EB 3DRRB 3IS9B 5KFJA 2UVRA 2XWYA 4ID5A 3RB3A 2JEJA 4DL7A 4WYWA 2AWZA 3KLHB 4M94A 4J9NA 3BGRB 4ECXA 1TL3B 3RB6A 5F8MA 1VRTA 5L1KA 2OPSA 1C1CB 3QGIA 3ISND 4ECYA 1HQUA 5J2PB 4IH5A 3PVXA 3I0SA 4PUOB 2ZE2B 2I5JA 3NAHA 4O3OA 1LWCB 3DLEA 4ZP7A 2F8EX 3MECB 1SV5B 1YVFA 3SI8A 2D3ZA 4TY8B 3CVKA 3QO9B 3Q8QB 2J6TA 4ZP8A 5HP1A 2W9BB 1EETA 2AGOA 2RF2A 1U09A 4J9QA 1FKPA 3V6KA 1S6QB 2ATLA 5FDLA 1JLEA 1R0AB 5KFRA 3I5CA 1SH2A 1JLFB 5DG9A 4FBUA 4K4WA 2W7PA 4ZHRA 2AGPA 2DPIA 4F50A 4I2QB 2OPPB 4IRCA 4RW8A 1QUVA 5C42B 1TV6B 1K1SA 3MEDA 2VA3A 4MK7A 1SUQB 1RAJA 4O44B 3ISNC 1S1WB 2XGQA 1RT2A 2D7SA 1FKOA 3TVKA 2XCPA 3KJVB 2R8IA 2WTFA 3OL7A 3OL8A 2FVQA 2R8KA 1QAJA 4MIAA 2XI2A 4MKAA 4J9KA 1S1TA 2OH2A 3KLIB 5KFCA 2IAJA 4F4WA 4JV0A 5DLGA 2IMWP 5KFQA 2WONB 5I42B 3UR0A 1N6QB 3PHEA 3LANA 4KAIA 3DOLB 4KO0A 2WHOA 2R8JA 1EP4A 1JLAB 3G86A 1RYRA 2VG6B 4RNFA 1RT1A 3Q8SB 1C1BA 1IKXA 3E01B 5KG7A 2WRMA 3GILA 1D1UA 4HYKA 1RT3A 3QIPB 1HQEA 3PW0A 5T14A 1RT5A 4Y34A 2HAIA 2C2RA 2R8GA 3I0RA 4ZP6A 1C0UA 3GYNA 4YR0A 2RF2B 4WE1B 3KK3A 3CJ5A 3HVTA 3IRXB 3PW5A 2YNHB 1S1UB 3DRPA 3JSMB 4ECUA 4R5PB 2WK4A 2AX0A 5KT7A 3ITHB 1IKXB 4HKQA 1BQNB 2ZE2A 5C5JA 1HNVA 4J9LA 1HNVB 4IDKB 1RT7B 4IG3A 4TQSA 3N6MA 4ZPDA 3H5YA 3QYYA 5KG0A 5L1IA 3T5KA 2AGQA 3BREA 3T19A 1C0TA 1S1VA 4XO0A 1RYSA 1N6QA 4H4MA 3BSNA 4ZMMA 5I42A 5KFBA 1N5YB 4Q0BA 3DRPB 3HVAA 3IRXA 2JLEA 3LAKA 2BQUA 1NNDA 2V4QA 2AX1A 3CJ4A 1JLQA 2FVSA 3KHRA 1JXLA 3G6VA 4NLXA 5D3GA 3TQ1A 1HQEB 3GIKA 5KFUA 2YNIA 5J1EA 4RU9A 2C22A 4Y2CA 4DG1A 1HYSA 5KFOA 3CJ3A 3FSIA 3MR2A 3CIZA 5L1LA 4RW6A 4ZPBA 2W9AA 3MEDB 5KFXA 4RW6B 3GQCA 2OPPA 1T3NA 4URSA 3FDSA 4ECWA 2UVVA 5D3GB 1TKTB 2UUTA 5FDLB 5DG8A 4NLQA 2I1RA 3GV8B 5KT3A 1EETB 1IKYB 4I2PB 2J6UA 1S1XB 2JEGA 5KFWA 4H4MB 1S1TB 4Q8EA 1LWCA 3RAXA 3NAIA 2I5JB 1TQLA 4IG3B 4IDKA 4PWDB 4DEZA 2WOMA 3HHKA 2E9TA 1S0MA 4NRUA 2RKIB 4JUZA 3BGRA 3KLHA 3ITHA 1WNEA 3ICLA 3KHGA 3NL0A 1TV6A 4O3NA 4RNOA 4QWCA 4ED2A 1JX4A 4GC6A 1UWBB 4YP3A 1S1XA 4Q8FA 3QGGA 4I2QA 1IKYA 4I2PA 3NGDA 3KK3B 3HVWA 2GIQA 2BRKA 3I0RB 4Q45A 4EYIB 3RAQA 5KT5A 4IQXA 1DTTB 3DYAB 3QIPA 4TQRA 3TAMB 3V4IA 1S9GB 4TY8A 1IM4A 5F8HA 5KT2A 5F8LA 3MECA 4ZVEA 5KFAA 1FK9A 4XPCA 1N4LA 3BQ0A 2UUWA 2ALZA 1C1BB 3PR5B 4QWBA 3CO9A 1RT1B 2ASDA 4DG1B 4IH7A 5KG1A 4EBCA 4ECZA 4IR1A 3M9NB 1HPZB 2WB4A 1VRTB 2XCAA 4NLYA 4KO0B 4YQWA 4NLGA 3T5JA 1LW2B 2V9WA 4H4OA 3EPGA 1REVA 4NLSA 5L9XA 3DRRA 3OLAA 3BSAA 3IS9A 4H4OB 4IFYA 3NBPA 4Q43A 3OL6A 4K4YA 4ZVHA 3GV5B 5KG6A 2R2RA 4F4ZA 1RT7A 1FKOB 3N6NA 5KG2A 2ILZA 3OHBA 3KJVA 4DL6A 1LW0A 4NLRA 1IKWA 1SUQA 2ILYA 1QE1A 2ASLA 4R5PA 3V6DB 1S1UA 3TAMA 2YNHA 2B43A 3JSMA 3V4IB 3HVTB 3DYAA 4J9SA 5C25B 1S97A 1DTTA 2JC1A 4U7CA 1JLEB 4RW7B 1R0AA 1JLQB 4JV1A 1S6QA 5F8JA 1FKPB 3GV7B 1S10A 2W9BA 1RT6B 2DPJA 3H5UA 4KHMA 1RT3B 3GIMA 5I3UB 5L1JA 3E01A 1SV5A 4KE5A 3H5XA 3PZPA 1C0TB 1S1VB 3SFGA 3I5BA 2RKIA 2VG6A 3I0SB 4PUOA 1S9FA 5JUMA 1QAIA 2JEIA 1JLAA 3MFHA 2V4RA 3BQ2A 1BQMB 2E9RX 4KHRA 1BQNA 3LP0A 2D3UA 2WONA 5EWEA 1MMLA 5K14B 5EWFA 1XR5A 3PJWA 4J9OA 4WE1A 4ZP9A 2QV6A 2BRLA 1C0UB 2RDJA 3HKWA 2VG5A 4ED1A 3OSNA 3KNAA 1TKTA 4J9PA 1RT5B 2GC8A 4QWDA 3BQ1A 2WCXA 4ZPCA 4JV2A 5KFZA 4O44A 5C24B 2ZD1A 2OPQA 1ZTTA 1S4FA 4ZPAA 4KV8A 2YNFB 1XR6A 2IM0A 2R2TA 5KFGA 3Q8PB 2C2DA 1D0EA 4LQ9A 5J1EB 3C6UA 1JLFA 5EDWA 4Y3CA 5DQIA 4WXOA 4IH6A 4QWEA 1JLBA 4IKAA 1RTIB 2VG7A 3EPIA 5KFKA 3RB4A 1N5YA 3QO9A 2FJWA 2FVPA 4Q0BB 4IRKA 2AU0A 3MF5A 3KLIA 4URQU 3V6JA 4I7FB 4IFVB 3V81A 5HROA 4WZQA 1HARA 2JC0A 1MU2B 5J2NB 1ZETA 5J2PA 3LP2B 3DI6B 3KK2B 1C1CA 3UDLA 4NLTA 1JLGB 3C6TA 5CYQA 2BQ3A 2IBKA 2IC3B 4QW9A 1DLOA 2XC9A 4NZ0A 4YR2A 1KLMB 1TKXA 3BJYA 5C42A 5F8GA 3CJ0A 4F4XA 4RW8B 4TYBA 1IKVA 1RTDB 1S9EA 3BR9A 4NLDA 4O3RA 1T03B 1JIHA 2IM1A 4O4GA 4G1QA 4MFBA 3KLGB 3NKYA 1GX6A 3BSCA 5KFTA 2ASJA 4G3IA 2GIRA 2B6AA 1I6JA 3RB0A 3V6HA 4ECRA 4K4XA 3IG1B 4QPXA 3M8PB 3KOAA 4RW4A 1JKHB 3DLEB 3DM2B 3QZ7A 3QGHA 4H54A 4MIBA 4F4YA 4FS1A 4ECSA 4ECVA 2FLPA 1N56A 1S0OA 1EP4B 2VA2A 1RT4A 4O3QA 4R0EA 3MR6A 1Z4UA 2BQRA 1HMVB 4K4ZA 2RDIA 4PQUA 3CDWA 3DOLA 1TL3A 5KFNA 3VQSA 3MEEA 1KHVA 4O3PA 2FLNA 2BE2A 4IG0A 4DL4A 1XR7A 1OS5A 3EZUA 4ED7A 3DOKA 4LSLA 5DGBA 4RNNA 2IAJB 5J2MB 5HBMA 2OPRB 3N6LA 5KFPA 3LP1B 2HNDB 3DLGB 2C2EA 4ED0A 2QE5A 3FFIA 3M9OB 1RT2B 1S1WA 3T5LA 4NRTA 3Q8RB 4NCGB 1T05A 2CJQA 4KKOB 2W8KA 3JYTB 4ZHRB 3I5AA 3DLKA 4KFBA 2B5JA 1LWEB 4QWAA 5J2QB 2R2UA 1J5OA 2V0NA 4ZVFA 1ZTWA 4K4TA 4K4SA 3IN5A 5HP1B 4ECQA 5KFDA 1HNIB 4K4UA 2CKWA 5F8NA 3UQSA 1IKVB 3DMJB 1LWFB 4KKOA 4TXSA 4DL3A 1RTDA 2YKMA 2BANB 1DTQB 4WYLA 1S6PB 1CSJA 1TL1B 2YKNB 3DRSB 3D28A 3M9MB 1HQUB 1JLGA 5CYQB 2FLLA 2OPSB 1KHWA 5DQGA 3LP2A 3KLEA 3KK2A 3GIIA 3PW7A 2YKNA 4Q44A 1TVRB 1MU2A 5J2NA 3LP1A 4URGA 3H2LA 4ID5B 3PW2A 2IJFA 4RW9A 4DL5A 1NHUA 5DLFA 4LQ3A 3DMJA 3MR5A 1HNIA 2JEFA 3FQLA 4IG0B 1RTJA 4MK9A 4ICLB 2R8HA 4R8UB 5HLFA 3PR4A 1NHVA 4X2BA 4WXWA 4TN2A 5KFLA 4ED3A 4FS2A 5DQHA 3KLFA 3DLKB 3C6UB 2HNZB 2O5DA 2FJXA 2YNGA 3IGNA 3DDKA 3CDEA 1JKHA 3DM2A 4KB7A 4YMEA 2W9CB 2YNGB 3KK1B 3M8QA 3SFUA 2HNYB 4LSNA 4B3OB 4ED6A 3G6XA 4NLOA 3MEGB 3FFIB 4EO6A 5KT6A 3KLGA 3KLFB 2FJVA 4G1QB 3KMQA 4R8UA 3MFIA 5F8IA 4ICLA 3H98A 5HLFB 4MKBA 1TP7A 2HMIA 5KFFA 4NLWA 3QLHA 3OL9A 1JLCA 1GX5A 3LP0B 3KHLA 1KLMA 1TKXB 3OSPA 1RTHA 1N48A 4TLRA 1DLOB 3KLEB 1BQMA 1HMVA 3PW4A 5CYMA 3QZ8A 1RT4B 4PQUB 5CYMB 4FBTA 2HWHA 3PJXA 1VRUA 5JXSA 3DRSA 5DG7A 1S6PA 1TL1A 2HWIA 2YKMB 4I7FA 4IFVA 2BANA 4MH8A 4EO8A 3M8PA 4RW4B 1JLCB 4RNHA 3OHAA 4O3SA 2HMIB 1RT6A 1SH3A 3IGVA 4TY9A 5J2QA 1LWEA 4NYZA 2B5JB 4EYHB 1TKZA 2HNYA 5KFHA 3KHHA 2IA6A 3V6DA 4NCGA 4WFXA 3D5MA 5KG3A 2W9CA 1T05B 2UVWA 2YNFA 3OLBA 2FVCA 5C24A 2IC3A 4KSEB 3T1AA 4U6PA 4YR3A 3DI6A 1LW0B 3RBDA 3KLVA 4WZMA 2HNDA 1W25A 2VG5B 3CJ2A 4M95A 3DLGA 5HBMB 5HROB 3RBEA 1RTHB 4O4RA 2EC0A 4EBDA 4RUAA 5KG5A 2FVRA 5KFYA 3E51A 4RW9B 1REVB 1S0NA 4K50A 2XI3A 2BE2B 3MEEB 5F9NA 1S49A 5KG4A 2C28A 4IOBA 3BSOA 4Y2AA 5KFMA 1HPZA 3H4BA 4XPEA 3H40A 4NLPA 2ZKUA 2AQ4A 3H59A 3LALA 2R2SA 3H5SA 2OPQB 4J9RA 1LWFA 5I3UA 1S9GA 1TKZB
chains in the Genus database with same CATH superfamily
1RDRA 1KQSR 4AD6A 4U8VA 4MFBB 2E5JA 1LXJA 4O4GB 4ZVPB 3UDVA 4OX9F 2GQCA 3KMSA 3H4DA 2VASA 5KFVA 2R3VA 3CUNA 1ACMB 4DR5J 1VHIA 4YUDA 1YJNS 2YWWA 4J9MA 4MTPA 4ATNA 2KT3A 1GT8A 3PYFA 1QE1B 1VRUB 2IYGA 2NSCA 3AJ2A 4MMOA 4N77A 4X66F 4FF2A 1VBKA 2WOMB 3UNYA 3MOZA 4PWDA 2W25A 2P8IA 2BYCA 3G82A 1U45A 2D41A 1FWLA 2ZBCA 2DRAA 3AA8A 5E3QA 2X3DA 4IFYB 4FF3A 3QLHB 5HMYA 3THPA 4YHHJ 2WBMA 1NJXA 2DRBA 1LW2A 4V19J 1MMDA 3VAHA 2LMIA 1QSSA 3TUJC 1W2BR 4JI8F 1O8BA 3H90A 1FX2A 4OIXA 2FQQB 5H9FK 3TJAA 1Q79A 1G7CB 3R6LB 1FK9B 5DJBA 4USKA 4DV0J 1BHNA 4MK8A 2EPIA 3IC1A 1T0TV 2ZD1B 2ZKTA 1X7VA 2XS2A 1IKWB 4HH0A 3MD1A 3SYZA 2K1RB 1FNOA 2X1FA 1UJ4A 2W24A 4NA1A 1KONA 1Q8IA 1MW7A 4CO4A 5EUHA 1GK8A 1S9EB 2ZZTA 3EM1A 3RTVA 2KYZA 1X8DA 3CD0A 5AXMA 1HR0J 2V8PA 4MKYA 4ID5A 4DL7A 2Y8YA 5BYQA 3MDFA 2Z2MA 2FZKB 2RB7A 3A4TA 3POTB 4FDFA 2XMTA 2RUSA 4DN0A 3SZ2A 4ECXA 4B9TA 5ETTA 5IT9Y 3ISND 4F0KA 4ECYA 1S72S 1X5PA 3R5GA 5DRKA 5G0RB 1KP6A 1CS4B 2BUNA 3AJDA 3KKFA 4FVCA 4O3OA 3GFYA 1Q5YA 3ULHA 1PILA 5GAEU 4UY8T 2GVZA 2PFDA 1SV5B 1YVFA 2CPFA 4DPXA 2D3ZA 4TY8B 3AX5A 1EQ0A 3MMAB 4OHZA 3VAKA 1VQMS 1JX4A 4RNHA 3HSDA 3VAGA 1L3UA 1U09A 1FRIA 1VQNS 1S6QB 3D6HB 2ATLA 5KFRA 2V68A 5HQ8A 2LDIA 2XYPB 1KR4A 1JLFB 2AZ3A 3TEHB 4DR3F 1FT8A 3SV3A 4FBUA 4IRCA 4C9DA 1WHXA 3CDBA 2RQMA 3OQ2A 5ITHA 3CCWA 1TELA 1TV6B 3MEDA 5D4LA 2RE1A 1D9DA 1OJ4A 1Y4ZB 2VA3A 4DR6F 2ZITA 4OZJA 3QGPA 2F65A 2C1EB 1LK7A 3WX4A 2XGQA 2M70A 4H4KC 2AJQA 4B9MA 4CO3A 2WTFA 2GA7A 1TFWA 3KG4A 5A6WA 5DZ6A 2CUYA 2XI2A 2QC3A 3BN7A 4J9KA 1K0VA 4UZCA 1RAOA 2IAJA 2OEMA 3R27A 4F4WA 1CULA 1U24A 5B0AA 2KG1A 2QLWA 3MMBA 2WONB 3CE8A 4LRBA 4WFAQ 1FE4A 3UR0A 4OLOA 3P8BB 3CT9A 5K9FA 1X4DA 3LO3A 2R8JA 1JLAB 4E2FB 3BH6B 1RYRA 1RWWB 5M2PA 1T95A 2VBYA 5DO2A 3Q8SB 1C1BA 1F3FA 4DMZA 1WEZA 2DNRA 5KG7A 1FRLA 3LQVA 2HURA 3D0GE 1DZ5A 4DSLA 1EAYC 3VF0B 2M2BA 2OFHX 2BKPA 2RHSB 1BE4A 2BE9B 5T14A 1K8AT 2J0QD 2VFTA 3NLCA 2R8GA 4OZ2A 4YY3F 4ZP6A 3QFWA 2NPFA 4DV2J 4YR0A 3D67A 2K8GA 2D3O1 1N36F 3TRGA 2YNHB 1FXDA 1Q7LB 4A46A 2MSTA 3MMAA 4ECUA 2FY8A 2AYBA 4OYZA 3UD5A 4IO1A 1OPZA 2DO4A 4OV6A 3ZTPA 2WK4A 3BGUA 3NGTA 1HBMA 3ITHB 2RS2A 1BQNB 5CZVA 2FLOA 2R42A 2GNKA 2GQ2A 3BV8A 2DISA 3MPWA 1CS4A 5C5JA 3PCOB 2ZJQQ 1HNVA 3RUBL 3OJSA 1KTVA 4J9LA 4IDKB 4IG3A 3AOBA 3MPDA 1RABB 5B0EA 4B08A 2CJAA 1VS3A 2J7WA 3KJQB 3DRPB 1IUJA 4ZJLA 2CWKA 2BABA 4QR0A 3BM7A 3LGNA 1OY9A 1PAEX 5IC6B 2AX1A 2HS4A 1JLQA 3OXGA 4ED4A 1XERA 4FZVA 2XO6A 2BBEA 1K9MT 1JXLA 4NLXA 1NB2A 1ZS6A 2XMVA 2X1AA 3GONA 1UW9A 5KFUA 3OVAA 1HBNA 2UV8A 3GIKA 4Y2CA 2C22A 2PFFB 4PYAA 3TJ9A 3CJ3A 3GIRA 5KFOA 1VQ9S 3ETMA 5L1LA 1L3TA 5E3AA 2DHXA 3MEDB 3W61A 1B64A 5AE2A 3NRBA 4DUZF 2OSRA 1WHYA 2DO0A 4Z7CA 3MM9B 4WK3A 1KFSA 3HK2A 2CADA 3OPKA 4C8YA 2I0XA 4NLQA 2I1RA 2MZJA 5KT3A 1EETB 3ILJA 4PG8A 5F0WA 3KUHA 4DV1J 1HI8A 4J37A 4EU0A 3ZFVA 2VOOA 5KFWA 1QDUB 1RHRB 4Q8EA 3PTWA 4FPIA 1DJ0A 3DRYA 4PAAA 2W4DA 4CYUB 2DNGA 1WC6A 4DR5F 2RU3A 1CBKA 2CZ9A 2JH3A 4IG3B 4IDKA 2L41A 4PWDB 3QATA 3JB9k 1PYTA 2HBYB 2EFOA 3RR8A 2JNJA 3BGRA 4H4KA 1HBMB 3ITHA 4RBTA 4CM2A 1HI0P 4O3NA 4ED2A 4YP3A 1S1XA 5THWA 4QU7A 4I2QA 3ENWA 2GMHA 4I2PA 1H38A 3W65A 1AB8A 5ETSA 5CCLA 3HVWA 5HN0A 2BRKA 3I0RB 5HQLA 4Q45A 2XQCA 4HI2A 4EYIB 3QSYB 3RAQA 4B9LA 4IQXA 3RBZA 5D4PA 2R7RA 3QIPA 2YY3A 3T1YJ 2QA2A 4JI4J 4IO9Q 2WSCC 2XMWA 1S9GB 2Z2YB 4AQYF 2ZH9A 2V8VA 1FK9A 1FESA 1RHMB 2Y1RI 3BQ0A 1IBMF 2ALZA 1GAOA 2CG4A 3PR5B 4QWBA 2DYAA 3CO9A 2XMKA 2ASDA 4HVZA 4K2JA 2KXNB 1D09B 3CC4S 2ZOFA 3MURP 2WB4A 1VRTB 2KVIA 2ZJRQ 4EGLA 4QZVB 3T5JA 1T9TA 2VJVA 3HF5A 1UTAA 2YQ3A 2K3KA 4DV1F 1EHWA 4C8KA 1REVA 2F3JA 2J7KA 3FEXB 1YGYA 3BSAA 1PBAA 3HX9A 2MB0B 2QGFB 5B09A 5F3ZA 2DR7A 1FJGF 1SJ4P 4K4YA 3NOGA 4YN3B 1YQHA 3GV5B 1VQ7S 1NK0A 2X51A 5KG2A 1RKJA 2MZRA 4X4VA 3EE3A 3MMCB 3T41A 4C8OA 1MN9A 3F73A 1AFIA 3OJUA 4DL0C 4F04B 4LF9J 4OZ5A 1LXNA 1TL4A 2DCUB 2GX8A 4WWSA 4R5PA 3HJVA 3JSMA 3V4IB 5LMUJ 4RPFA 3HVTB 1HWKA 3HPOA 5C25B 1ULRA 2L9WA 2HQ3A 1JLQB 1S10A 1PJ6A 3F0NA 5E7OB 2W9BA 2HW3A 2ZOGA 5M2UA 1Q7YT 1TMMA 1RT3B 3CNQP 2BXJA 3S1TA 2F9DA 1D9AA 2VDIA 1I94F 1S7HA 2GVZB 1KSPA 1SV5A 1U0SA 3SV4A 1GMVA 2GGPB 3SFGA 2FUG9 1YJVA 2VG6A 3H42A 5G0RA 5HJXA 1X5TA 2JEIA 1BXNA 4DPTA 1S12A 2V4RA 4LFCJ 2B7CB 1RACB 2VQEF 4OFZA 4USMA 1BQNA 1MWZA 2H54B 2C2KB 2PA3A 3F56A 1EX8A 1Q0NA 3QSIA 3ELHA 1Q81T 4PRFA 5EWFA 1XR5A 3PJWA 3VGTA 3ISZA 1TFYA 3GSIA 4JOUA 2HLUA 3HSJA 3HSZA 3WZ0A 4Q2LA 5CD4H 2RDJA 3OBIA 2XLIA 1SIWB 2PT0A 2A2DA 4J9PA 1U47A 1UFWA 4B02A 4XAKA 4CT8A 1OQ3A 4QWDA 1U8SA 1WC4A 2ZBRA 4ZPCA 3BQ1A 5KFZA 2PMWA 2O1PA 2RQKA 3BBCA 4DF4A 4JV5J 5C24B 2V67A 4OI0A 2ZD1A 2OPQA 1UKUA 2KM8C 2F8HA 2ZBQA 1LV5A 3AXKA 3ONQA 3OTOF 4I4BA 3KUEA 2R2TA 5KFGA 3ILIA 1UUJA 1FEEA 4C0BA 1CJTB 2C2DA 3C6UA 5FJ4A 5K8NA 3R5CA 4Y3CA 5AXKA 4RKUC 3B4DA 1DAXA 3TNVA 1ZH5A 2BJ7A 4IH6A 4QWEA 1JLBA 2AW0A 3GZ7A 2VG7A 5FD1A 2EKNA 3UNGC 3VHQA 5KFKA 3N0VA 2ZH2A 1VK8A 2A6MA 2QSFA 2BW2A 3MF5A 4DV3F 2DNLA 3IM8A 3KLIA 3V81A 5HROA 1FHTA 1RWKB 2MTLA 2JFKA 3LP2B 3DI6B 1JLGB 5T7LB 2FDNA 4CLLA 1DLOA 3VGSA 4DFJA 1NK6A 4B9SA 4AUKA 2HQIA 4YR2A 3BJYA 4WKRA 4ZN3A 3CGIA 3WIVA 4NLDA 2DNPA 2J0WA 4CM0A 3J7Z5 3TW0A 1JIHA 4I6WA 4JI5J 2IM1A 4LT6A 2EBGA 4O4GA 5JVHQ 4MFBA 5I4MA 4DR4F 1GX6A 2YQ1A 4R0JA 2ASJA 4G3IA 2D9OA 2GIRA 2N7YA 3O8WA 4F4AA 3K5MA 4OZNA 2A6OA 1M5KC 5B0FA 2L9NA 3M8PB 4RW4A 1R8BA 1JKHB 3R97A 4H54A 4ECVA 2KZMA 4M5GA 1N56A 4QIGA 4Y6IA 3IR5B 2YX1A 2LKZA 4R0EA 1HHQA 3JQJA 4N56A 2RDIA 2BQRA 2EW9A 3CIMA 1TL3A 3DOLA 3IM9A 3VQSA 1F2HA 1RSCA 4USHA 4O3PA 3G6ES 4USJC 1IBLJ 2FLNA 4E98A 1JMTA 3M6VA 4IG0A 1PBUA 3ZZOA 4LF4F 2XS5A 2AEMA 1OS5A 3EZUA 1NCLA 1RP5A 4LSLA 4RBVA 3HCXA 5DGBA 1U8WA 2ZDOA 3PNIA 4ED7A 2GHWA 2O3DA 1JJ4A 4QQBA 2IVYA 1OQ6A 3QJLA 2QE5A 2RSQA 3P3DA 4M63A 2IJRA 1OY6A 1NPKA 1SJQA 1I1GA 3B78A 4LF2A 5D4NA 4EK2A 1EARA 3MM8A 4J9UE 2F4VF 3R6GB 1S6OA 4NA3A 9RUBA 1T9XA 2QL7B 2XNQA 4J9VA 4RUHA 2W8KA 4A8KA 4KPYA 2L9DA 2F63A 4KFBA 1FO1A 4PQAA 2B5JA 4ZHRB 3VZHA 3JYTB 2JVOA 1QAXA 4OI1A 1J5OA 2V0NA 4ZIWA 4K4TA 4GVBB 3OT9A 4QYRA 2HK3A 4UUXA 1VMBA 4KKOA 4DL3A 2YKMA 4HLBA 2BANB 2AJ2A 4KC5A 3M9MB 1IBKF 1JLGA 1RAGB 1VQOS 3N01A 1SL0A 4CH7A 1ZM4A 3LP2A 1T11A 4FNHA 2YKNA 3OTCA 1VQKS 3LPYA 3ZZ0A 1MU2A 4URGA 2GVDA 2K7JA 1NJZA 4ID5B 2VC0A 1SKWA 4DV4J 4BLGA 5DLFA 4DQIA 3BGFA 4LBPA 1FRJA 2ZC4A 4AE5A 9ATCB 3MR5A 2E5LF 4ICLB 2BMBA 5IM0B 2M3DA 3AX3A 2YKAA 4WBFA 4WXWA 4N41A 1PO6A 1BMQB 2QT7A 1NSAA 2Z0GA 4MYUA 3HXMA 5LSRA 1MG7A 3C6UB 2HFVA 1FERA 2GQQA 3EDQB 2C3OA 2YNGA 3QWPA 1O0PA 2Y0SD 2FY1A 3CDEA 2VQFJ 1QVFR 4HTIA 4ES3A 1CJKA 2M0GB 3NXZA 1ELOA 2E7VA 3SFUA 1QTNB 3O44A 2EFQA 4L76A 2CYYA 5KT6A 4EO6A 3D3CJ 3UD3P 4GKKJ 2E29A 3VR1A 4G1QB 3KMQA 4M5NA 5CABA 5IM0A 1RI7A 3G96A 3T1HJ 2MZQA 3DLLQ 1C4CA 3EVMA 2LXUA 3R8YA 2YKPA 4DSFA 2HMIA 3S8SA 5KFFA 1O5JA 3CJRA 2B4UA 3OL9A 1GX5A 1J27A 3LP0B 1DHMA 1RE1B 2HQGA 4PXBA 2G4BA 2FJEB 1KN6A 4CLZA 1RQ0A 2F4FA 2I9SA 2R7UA 2V69A 5J1NA 3QZ8A 4B9NA 2HWHA 1WORA 1WKLA 5JXSA 2CJXB 3MCMA 1TL1A 2XB2D 1BWEA 2YKMB 3M6XA 1LK5A 1H7WA 3M8PA 4RW4B 1JLCB 3UCZP 2XLKA 3O1LA 2EFVA 2CQCA 3BBBA 1WJ9A 2DH9A 2C3YA 2IRYA 2OGUA 2UV8G 3PYEA 2M9KA 4OZLA 4DCPB 1LOUA 4A8SA 2XMUA 2NZCA 3HFVA 1U4BA 4LF4J 1YBUA 3J7A1 4ZVTB 3DKDA 2HNYA 3NCPA 4EYHB 1RHUB 3K17A 1SB6A 3DRXA 1HKAA 2V50A 1NZ8A 3A8KA 2UVWA 3IRWP 3DLHA 4LBIA 3NNHA 4PZVA 3MR7A 2FVCA 1LKZA 1H98A 1NPPA 2OMLA 5EX3A 4OHYA 4KSEB 3AQPA 2JWNA 1FDNA 2CQ2A 5AT1B 3DI6A 2VBXA 5CCMA 4U6PA 2H5EA 2ERRA 1KRPA 1YK9A 2KHCA 3B4MA 4HHUA 4M95A 2JSXA 3DLGA 5HROB 1YRXA 1GMWA 1RTHB 2EC0A 1MROA 3D3BJ 5IQQA 3RBEA 4RUAA 2GJFA 3SSRA 3K7RA 3EGVA 1LQ9A 2Y0BB 4OYBA 4DQSA 1S4EA 4K50A 2XI3A 3GMGA 4DX5A 3G4SS 1TL5A 4QIEA 3NGRA 4Y2AA 4CTAB 5DDRC 3E8OA 3H40A 2LQ8A 2X1GA 2ZKUA 3CCES 4K7QA 3DFEA 2VKRA 3N9UC 5ETQA 3OUYA 4HH1A 4J9RA 4PG5A 5I3UA 1GMWD 1N33F 4C3KA 2NXEA 1WEYA 1IM6A 5ETKA 1SXLA 1ZAVA 1NKCA 4EBEA 2CQ3A 1Q8KA 5ADZA 4WFZA 2G9OA 2JHEA 5D6GA 4RW7A 3HSGA 5HI7A 3HHDA 1BC6A 3CCTA 1L3VA 2HKEA 3AB2B 4MYTA 3OVSA 4UOFA 3PKYA 4NLUA 4P10A 3EYZA 4DFPA 5KFEA 2DH8A 2HZAA 2OHDA 2OSQA 3F41A 5ETRA 2HZVA 2GVDB 1HHSA 3MM6B 1L5UA 3D66A 5T7LA 4DU8A 2COLA 4J91A 2CFXA 1CJUA 3UN5A 3BO2A 4LF7F 2UVUA 3UDCA 2KH9A 1RCOB 4C2MA 3HFKA 2MGZB 1K47A 4L3KA 2KKHA 2BOAA 4RUCA 1NRKA 2CZ4A 3FRZA 4KGZB 1RBAA 2HS3A 3OFGA 1T94A 4C8NA 5DDOC 2BEFA 3MR3A 1YJWS 1DQAA 1JLBB 1UEKA 1RTIA 2W7OA 2W8LA 3CC2S 2KRBA 1J5OB 1M90T 1FTRA 3CJKA 2J9DA 3K59A 2HS0A 3MTKA 1FVSA 2E1PA 5KFIA 4B3OA 4RNMA 1YJTA 3UI3A 5ETMA 3QIDA 3CDUA 2AHOB 2KJWA 1SBRA 4I64A 4DUYJ 3FCWA 5F9LA 1URRA 1S48A 1HYSB 1V3ZA 3GIJA 2M4MA 1IN0A 2KDOA 3LAMA 1IBMJ 3P49B 3K5OA 4EEYA 5LXRA 4OZ0A 1RTJB 1S6UA 3GTYX 4ED8A 1XMQJ 3EXYA 1RU2A 3IS9B 2PC6A 3M8WA 4X62J 3BF4A 3RW7A 2NZ4A 2JEJA 1PCAA 3RB3A 5GAGU 4WYWA 1RAFB 4M94A 1NK7A 1TL3B 4PCQA 4C97A 1JJ2R 3JSYA 1VRTA 3TUIC 2OPSA 4NEYA 3QGIA 1HQUA 2F9JA 3NGSA 3EZOA 2ZH6A 2RD5C 3ZTOA 3H20A 4PUOB 4YFUA 2ZE2B 3NAHA 1M1GA 1LWCB 3FBEA 3SDEB 1XJWB 4C3MA 2F8EX 3MECB 2SXLA 1VQPS 3AJ1A 3PG9A 1FFWB 3CVKA 5T41A 3NWRA 2HHSA 5HP1A 3W2WB 2XTDA 1FNXH 2W9BB 1VDHA 3G8SA 2AGOA 3V6KA 4FXWA 3CJSA 5H1SV 4NI2B 3I5CA 1P6TA 4M1KA 1SH2A 1IBCB 3EGNA 5DG9A 2AGPA 4I2QB 1AXQA 2L3MA 1RAAB 4FXDA 1X9WA 3Q8UA 5C42B 1K1SA 1XIQA 2F7VA 2ALYB 4CP5A 2ADCA 3N79A 2IFXA 1N34J 2I6WA 1X9MA 2G2OA 1MNEA 1P9YA 1RT2A 2Z8QA 2CG8A 2R8KA 3KJVB 4RL1A 3OL7A 2LQ9A 4ANCA 3PDNA 5LSLA 2RHQB 1QUPA 3SXLA 1UVNA 1AYEA 4MKAA 3KLIB 3DLJA 3DLBA 5DLGA 2BKOA 5KFQA 2YH1A 1RLCL 3D6TB 2MKJA 3MWBA 1DRZA 1F9EB 4F0HA 5A8KB 2YWFA 1B70B 3GU0A 4OI6A 4KAIA 4DWIA 1RWXB 3CW2C 4K59A 3TUZC 4UUWA 3UN2A 5C2GA 2DNNA 3HZGA 2MQPA 1A0OB 1SI9A 3G86A 3L95X 4G6VB 3O6QA 2Y1IA 2RVJA 4RNFA 1QJHA 2JRSA 3GJRB 4N47A 1IQZA 2QMWA 3L4BC 4PWWA 3E01B 4UQGA 2R7OA 2B51A 2WRMA 2W4CA 2EI5A 1V9OA 1S59A 4HEA9 4BCAA 1D1UA 1HBNB 3GFHA 3QIPB 3M2VA 1N8RT 2NREA 1HQEA 3I6PA 3PW0A 1HBUA 3ILOA 2FC9A 2MKCA 4Y34A 1VGYA 2M88A 2XTJP 3I0RA 4LRCA 2VPWB 4F7VA 4RJVA 2C2RA 2OTJS 4F26A 3S7RA 1ZOTA 1R6YA 1GXLA 3CJ5A 3K8VA 4E8UA 7FD1A 5RUBA 5BR8F 3ENVA 4NXMJ 4W98A 2NPIA 2ZH7A 3A3OB 4HKQA 2R7SA 1IKXB 1UPMB 2DNZA 4XIUA 3NCRA 3Q22A 3DGPA 2XZTB 5D15A 3QRRA 5LJ5Y 2VF3A 4ANEA 1RT7B 2FVPA 3W3SA 5L1IA 4CYUA 3KUGA 1VJQA 3MM5A 3PYGA 5H9FJ 3GSDA 1S1VA 3ZNUA 1SC3B 2DGOA 2AGQA 1N6QA 2HRTA 4H4MA 3BSNA 4ZMMA 1CPZA 5KFBA 2CIMA 4Q0BA 4J5OA 3IA0A 2UUAJ 2JLEA 2H51B 2LYVA 3BN4A 2DGQA 2BQUA 3PRVA 2N4DA 2V4QA 2FVSA 1IR1A 3KHRA 3HMJG 3DOMA 3MM7B 2RU9A 2XZDB 1VQ4S 1HQEB 1ZYQA 1JXEA 2CQHA 4Z7YA 5J1EA 4DG1A 5BJRA 1V5VA 2EG1A 3TA1A 3CMES 1VQ6S 3CIZA 2IBOA 2FB0A 5KFXA 4RW6B 2BJ1A 3DCAA 2ZH8A 4IOCQ 2DVIA 2YX4A 2OPPA 3BKUA 2OLWA 4URSA 3FDSA 1T3NA 5GAHI 4ECWA 1VQ5S 1UMJA 5B0CA 5FDLB 3K5LA 4Y0FA 3GV8B 2RJZA 1U1PA 5A8KA 4DV2F 3HP6A 1IKYB 1FD8A 2QMXA 3I56S 3C16A 4EUVA 3LWMA 2PSZA 3HVRA 3SEOA 3K57A 4LF6F 2V5HG 4DV7J 4HDHA 3RAXA 3J80Y 1NKEA 4DR6J 1TQLA 2AEFA 1T9YA 4LREA 4OYAA 3CMAS 1KNZA 2WOMA 3P96A 4CLUA 3HHKA 4JI3F 2V1TA 3UCGA 4WU3A 3FMWA 1U6ZA 2RKIB 2GHPA 1FDAA 4PEOA 2ZZMA 4DSJA 3KLHA 4JV5F 1WNEA 2BA9A 2BW7A 2KL8A 1U0HA 3NL0A 3OV7A 2FC8A 2ZVSA 4QWCA 2MSSA 5DM6Q 1UWBB 3HFZB 1FRHA 2DNYA 2DHHA 4YDXA 4U7UK 1RWMB 3SIPB 3VV2B 1NH8A 2W2MP 3DXSX 2MXYA 1YJUA 2M8HA 3M8SA 1HD0A 4G65A 2HPUA 3OW2R 3TI0A 1EJ7L 1DTTB 3I82A 3CCUS 4ZOSA 2EFPA 2V63A 4O0NA 4OYXA 1CJVA 1B0PA 1M1HA 1UAWA 2M52A 2H65B 3AD9C 3HHLB 3R5AA 5E33A 5M2RA 4EZ9A 3HJFA 1N4LA 4IUFA 1EQMA 5F8LA 3MECA 1SC1B 2YQ0A 4FNIA 4I1TA 4ZVEA 2VPXB 4ZLJA 1RT1B 4F2RA 5KG1A 4EBCA 1MSWD 3M9NB 1HPZB 1X4AA 2FD2A 3GPAA 3P5BP 3J81j 4ZCLA 3NS6A 1NJIT 3OVBA 4GVLA 1R31A 4KIAA 1R0CB 2Z2LA 1NPRA 3KG1A 4Q7AA 1RWVB 4Q5VA 2HQCA 3FGVA 2YPYA 3IBWA 1M5OC 1M5SA 3IS9A 4NMXA 4H4OB 5ETOA 4DV5J 1W2IA 4Q43A 2E5LJ 4A8XA 2R2RA 4F4ZA 1RT7A 1FKOB 3N6NA 1NH7A 2ILZA 2ABYA 2PEHA 4OX7A 1LW0A 3ZZTA 1KVJA 4DR4J 1TUWA 3I87A 4DCJB 1IKWA 1F5CA 6FDRA 3KK3A 2CQ1A 4TNOA 3OFFA 2CPEA 3MOJB 4UOGA 2HVDA 5DZ7A 4CWBA 1B4SA 4X4QA 2ZNZA 5HQMA 3V6DB 1S1UA 3TAMA 3RZAA 2B43A 4C0HA 1U1KA 2N3OA 2VBWA 3DYAA 1LFWA 3JTNA 3IP0A 1K0TA 1OSCA 4QOTA 3THTA 1R0AA 2ACMA 2VHGA 4C11A 3LF0A 1FKPB 2G2ZA 2YVSA 3UO0A 1WTBA 2DPJA 4WKYA 2OKQA 2AYEA 4UW2A 2HHVA 2YX7A 2AV5A 1XC9A 2UXCF 3HHEA 1F0XA 4IYQA 3R5JB 4TU8A 3E01A 4X66J 5A2QY 1XNQF 3H5XA 2DGVA 3VVUA 1C0TB 3PZPA 2CDRB 3CCZA 2FTRA 3I5BA 4NMLA 2HYIB 1GQEA 1RTZA 2IHR1 5JUMA 1S9FA 5A8WB 3VAMA 2P9GA 5ETPA 1HW9A 2Z58B 2IVMA 3A3PB 1BQMB 4AQYJ 2E9RX 1NDLA 1JB0C 5E3PA 1V3RA 2L48A 4HT7A 3UVJB 3W66A 4O0IA 1FJEB 1S76D 5HMXA 3TA2A 2KI2A 3TX8A 2QV6A 2BRLA 2F8MA 3FBFA 4KH0B 3CCSS 5D8HB 2CJYB 2V8GA 4ALZA 1REGX 5A0YB 2ZH3A 2DR5A 4KQZA 2N4CA 4O44A 3TZYA 1MN7A 3FUYA 1H2UX 3BPSP 1ZTTA 4NYOA 2K3IA 1P9QC 2YNFB 3C15A 2P9EA 2IM0A 4XDCA 2RMLA 2YH0A 1YITS 5IT9U 4OHWA 2V94A 3H7HB 5E3RA 1XMOJ 2LQBA 3FJ2A 1VHFA 1SJFA 4Y65A 4XDDA 1UVJA 1YX2A 2JFDA 3W2WA 3RB4A 3AB4B 2G1DA 4LMZA 1AW0A 1LFPA 4IRKA 3PFOA 1VQ8S 2PA8D 2QLFB 4I7FB 3G82B 4IFVB 6AT1B 4WZQA 2JC0A 2LXIA 2FJAB 2EXUA 2JX2A 1WG5A 2ZJPQ 4PABA 3KK2B 1C1CA 4WF9Q 2EWHA 2HHHJ 4JI1F 4DXLA 2Y1LB 4QW9A 4QPTA 4DPUA 4NZ0A 3Q2TC 1RWOB 1EZZB 3AXMA 5F8GA 3CJ0A 2MLYA 4X4SA 4KT0C 3BR9A 2LEPA 4QIWD 1T03B 2CXEA 2DY9A 4TKTA 3CD7A 5IT4A 3D7SB 2FZCB 3A13A 1PG5B 2B6AA 5CA5A 3V6HA 2YXLA 1PC5A 4K4XA 2AYGA 2CPHA 2H5JB 1SJ3P 3DM2B 4ECSA 2IVFB 2B9EA 2LU2A 4I0WA 1Y7PA 2QFIA 4C4WA 2AJ1A 3SCJE 3MR6A 2LECA 1Z4UA 4BS2A 1HMVB 1YWXA 2CVIA 5KFNA 4U7UD 3IAS9 1KHVA 3MEEA 2PN6A 2BE2A 2C2NA 3B6BA 1TTHB 3NY0A 2M5YA 3VQTA 1U7LA 1MLAA 4UOHA 3GLJA 2AEJA 5J2MB 2UUBJ 5HBMA 2OPRB 3PXGa 3VCDA 5BXIA 2DB1A 3LP1B 4LFAJ 5KFPA 3QRQA 1X4GA 2C2EA 1O51A 4ED0A 2HHUA 4DFMA 3M30B 1DQ9A 1S1WA 4M5DA 2G1HA 3I32A 1CC8A 4U67Q 4NRTA 2YWEA 4MIWA 4CH1A 1GTEA 4NCGB 4CLWA 2EG2A 4CO1A 3PX4A 4K8RA 4OI3A 3I5AA 1ZPVA 2L08A 3EUNA 1FFGB 4M5HA 3SCLE 4QWAA 5MLCV 4KJIA 2HHWA 5GADU 5J2QB 3GE9A 1E6YA 1HHTP 2ZUAA 3DXBA 1E6YB 1ZTWA 4LF8F 1WI6A 4NXNJ 5L39A 1D9FA 5IWAJ 2DR6A 4K4UA 2CKWA 5F8NA 3UQSA 2K2PA 3DMJB 2W4PA 4P6QA 2J9DE 1N5SA 3PRDA 3NS5A 5CD4A 2HRYA 5IV3A 4WYLA 2WW8A 2YBVA 2DTJA 3D68A 2W2OP 2YKNB 3DRSB 3FBBA 4C8LA 5CYQB 5DQGA 3KLEA 2ATCB 1SL1A 3A8JA 4DOZA 1U49A 1T9WA 2KN4A 3IAM9 5J2NA 1Q1KA 1X4BA 3BO4A 3LGHA 2RT3A 4K2XA 2KTQA 2DHSA 1KLNA 3ZZRA 2IJFA 4RW9A 1U6BA 4LIRA 2GIFA 2E1RA 2JEFA 3DHWC 3TAPA 2Q1LA 3BYPA 3O2IA 5B0DA 2R8HA 3PR4A 5HLFA 1NHVA 3K58A 4OX9J 1KWMA 1DURA 4PPZA 2CQIA 2CAJA 2HLTA 1WEXA 1N32J 3HDSA 4PXDA 1HA1A 5BYSA 2O67A 2LFVA 4ZA1A 3DDKA 1P1LA 1B99A 1FD2A 3I4PA 4KB7A 4WU2A 3W7BA 4A47A 3U02A 2W9CB 1UWAA 3CCRS 4LFBJ 3M2UA 3KK1B 1XBWA 3M8QA 2HNYB 4LSNA 4NWBA 1KFDA 4NLOA 1WOPA 3FBCA 3FFIB 1NXIA 3LGMA 2FJVA 2OELA 2NQPA 1PSDA 1OPIA 1KQFB 1M0SA 4R8UA 4ZCIA 1DFDA 3H98A 4DPYA 4QU6A 4Y28C 2MQ8A 4MKBA 3GP9A 5BYRA 2V2VA 4Y2IA 3G87A 1ZZFA 2UXDF 4JYAJ 3RGIA 3KHLA 1KLMA 1S79A 1TKXB 3TQ1A 1C4AA 2PIIA 5K8MA 1HBOA 2MJNA 1X4FA 2RRNA 2C3PA 2RDDA 3HHLC 4KGVB 5LSOA 2UU9J 1F5AA 3PW4A 1RT4B 1IBLF 4LF5J 3MTJA 3PJXA 3CCVS 1QLNA 4GO5X 1VC5A 1S6PA 4MH8A 2HWIA 2K06A 5HL7Q 4P7TA 3H25A 3L09A 1PGZA 2QA4G 2HFNA 1JK9B 4NX9A 2VQEJ 2MYFA 2OAUA 2JVRA 3OHAA 4LFCF 4LVOP 4O3SA 3P6YC 1HWJA 1RT6A 3IGVA 4TY9A 1OSDA 5CZXA 2EFGA 4CIOA 2RQCA 1Y3JA 3OXFA 4XK8C 4YB7A 5J2QA 1LWEA 4WPAA 3A3NB 3GCWP 1TKZA 5GAHU 5GMEA 2C3UA 1F1BB 3Q83A 1T05B 2W9CA 5KG3A 2YNFA 3C15B 3OLBA 3P5TL 2NXUA 1SJ1A 2VKZG 3Q8YA 2FHOB 4RX6A 3T1AA 4YR3A 3RBDA 2HEKA 4DZ6A 3GJQB 2QYGA 1L3KA 2HNDA 2VG5B 3CJ2A 1RGVA 3EVWA 1VIOA 4C8MA 4ZLPA 1ZAXA 2DR8A 3M32B 1M5HA 3HZEA 4RW9B 1FRMA 3SCIE 2RS8A 4I6YA 3K0JA 4CRJA 4CDIA 4A8YA 2VD3A 4P74A 5F3TA 4DUYF 3BSOA 2CQDA 4DR3J 3BKFA 2Z30B 2E5HA 3H4BA 4XPEA 4JBCA 3PX6A 3QAEA 3FK4A 3KNGA 2OPQB 4WCEQ 7FDRA 3ZC4A 3H2LA 4F2SA 2GJ2A 5A2QU 3VAJA 5EWGA 1YJ7A 4NLVA 3RBXA 1OMSA 1JNRB 2J0XA 2QX0A 4CLTA 4DCOB 4B3TF 4PG6A 4DQQA 1WI8A 2ZVIA 3EICA 1OYDA 1N52B 1E6VB 4ZS6A 5K14A 3JYTA 4ECTA 1U1OA 1VR6A 3JAMY 1SL2A 3Q8VA 1TVRA 1PYOB 2E9ZA 4D3GA 3C6TB 2AIRB 4M5DB 5DGAA 5HAOA 4BC7A 2CNOB 2ROPA 3OD2A 4DV7F 1RA7A 4FXVA 3T1HF 3PRBA 1VBYA 3R9LA 4QIFA 1KTQA 2P6SA 1SQEA 3MPUB 3NCQA 5IWAF 1DTQA 2C2ZB 2XSFA 2OPRA 4K5RA 4ZVGA 2BR0A 5CYJA 3CCJS 2IM2A 5J2MA 4HR2A 2DXDA 4LSLB 2AF6A 3QWUA 2KFNA 1DY3A 3TEGA 5D4OA 3GFZA 4RZRA 3T5HA 4CT9A 3CO0P 2J8AA 3MEGA 4EMDA 5C25A 1SH0A 3M8QB 2B3TB 1XN9A 4KBIA 2GO8A 3M2UB 4LSNB 3TX0A 5LT5A 3KK1A 1SQFA 3DDNA 4OL8A 1YG0A 2MY7A 4TYAA 5LMUF 1YJ9S 4D3HA 1BLUA 1FFSB 4U9RA 5KT4A 4KV8B 5AXNA 4IRDA 1AROP 5CQGA 2HNZA 1UCNA 2Z2ZA 2B6AB 2VC1A 2M8DB 1QD1A 2YNIB 3G6YA 1PC4A 1VK3A 2LCWA 2OI2A 3RU0A 1R43A 4LR7A 2XY6A 1RWPB 2GAGC 3J7AN 1MWYA 4JI2J 1EKSA 3TVZA 4DL2A 1R0BG 5KFJA 4X4UA 4U96A 2UVRA 2V34A 4C8ZA 5LMNJ 2Q43A 3JQMA 2RUGA 2RRBA 3NG8A 1Q4RA 4CO5A 2MMYA 4ANDA 4DLEA 3TUPA 4A8QA 1FXLA 1SJRA 2HGMA 1R27B 4DV6J 5F8MA 5J1PA 3FRYA 1C1CB 3JXOA 4IH5A 3WHIA 3PVXA 2DY1A 3I0SA 3UN3A 4CNYA 2I5JA 3VZIA 2HIYA 2R4FA 1WD6A 3N4WA 1YHQS 2HHHF 3NNCA 4C3LA 1R8PA 2O01C 2BJ8A 2I8EA 2WZ1A 4EI2A 4OJ1A 2J6TA 2HHQA 2KZZA 2WB1D 3M6WA 4M5KA 3GG0A 3W1YC 4ZJQA 2NUUG 2D69A 2IA0A 2I38A 2RF2A 4Y00A 1SKRA 2UXBF 2CPJA 1JLEA 1BY9A 1WSVA 2B0GA 4LUBA 2KVQE 4B9UA 1HNWJ 1RZMA 4NA2A 2F5GA 4K4WA 4L75A 1CJTA 2OPPB 1TR0A 2WVBA 4NYPA 5F41A 3QRPA 4ZCMA 4CO2A 4MK7A 4P73A 3D9BA 1RAJA 2KM8B 2IIHA 3IMQJ 4O44B 3ISNC 3ET6A 2I2YA 4LSZB 5MAOA 4EZ6A 4EWTA 4CI0B 3TVKA 2R8IA 2XCPA 3OL8A 2VPZB 1QAJA 4MIAA 2VICA 3R2CJ 2V8HA 2OH2A 4X64J 5ETLA 4CLFA 1Y5NB 4ELVA 4GKKF 2XLJA 2B9YA 2D68A 2ZM6J 1FXRA 5I42B 4CLPA 5JVGQ 2F1FA 3KG0A 5LMNF 2GHVC 2JLFA 3EXCX 4M8LA 1V6HA 3PHEA 3L9ZA 2V4JB 1W26A 4I68A 3V2UC 1B7FA 1AZSA 1FJCA 1OYEA 4JI2F 2MJUA 5E3CA 4YEAA 1EP4A 1Z2ZA 3KXDA 2RQ4A 3N28A 3U1MA 5LL6d 2HG4A 1Q82T 3ET6B 4UTGA 1RT1A 1EIYB 5G4DA 4LF5F 2AZ1A 2OMOA 1URNA 1LWXA 2IY5B 1FEHA 3GILA 2XY5A 1YJRA 3BGOP 1RT3A 2BX6A 3OR1A 3J7ZT 1WG4A 4HYKA 1CJVB 3ZO7A 3TARA 3OR2A 4P2FA 1T02A 1XNQJ 2HAIA 3M2RA 1OY8A 2GO9A 1C0UA 3NEKA 3D1HA 3GYNA 3W2VA 4ERDA 4WE1B 4P7VA 2WVEA 3HVTA 4FKXA 3R2DJ 1IQTA 3TANA 4E0DA 1S1UB 3DRPA 4J9QA 3QT8A 3NS7B 4NPOA 4ZPWR 3MCSA 3TYTA 4R5PB 2AX0A 1IBKJ 4LF6J 3HI9A 5D0HA 3D1QA 5EN1A 1NM2A 4OYIA 3U27A 2G13A 3I55S 1U2RA 1KOHA 3RRHA 1NJYA 1TL7A 2QIFA 5D0RA 1HNVB 3DC2A 1GH8A 4TQSA 3N6MA 4ZPDA 3QYYA 5KG0A 2FGOA 2ZBIA 4RO0A 1RYSA 1JXVA 4XO0A 1HNZJ 1VLYA 2VOPA 2XBPA 3VWSA 3NNAA 5I42A 3SSQA 3M8YA 1N5YB 1RADB 2ZDPA 4OYPA 1TU0B 3CD6S 3CJ8A 2KT5A 3EX7B 4KPCA 4B9VA 3FCHA 2BJDA 4HACA 4ZKAA 3J81Y 1NNDA 3BO3A 3AAWB 3CJ4A 4LRFA 4HT5A 1T7PA 3G6VA 2QLXA 4Y2KA 4OV1A 5D3GA 3LOUA 1YI2S 1XMBA 2ZC3A 3CD5A 4RU9A 1DARA 1XQIA 2QYCA 3IWLA 3IO1A 2BKNA 5IC4B 3MR2A 3UR3C 2UUAF 3AOCA 1R89A 3BEGB 2DGWA 4C48A 1IJEB 2KXFA 2NCKL 4USVA 5L9NA 1Q5VA 5A0YA 5D3GB 2UVVA 1XNRJ 1TKTB 4TU9A 2UUTA 4OJ3A 4OI2A 4USWA 2MQNA 4O23A 3TJ8A 1OWXA 3MXHP 2RAQA 1NK9A 1FWKA 2PI5A 4A4JA 3VVTA 2JEGA 2KB2A 2VDHA 2OP5A 3EJMA 1YIJS 3GR0A 1S1TB 4ES2A 3NAIA 1QSYA 2I5JB 2ZOMA 2BJEA 3MM5B 2BOPA 1UFLA 4WIQA 5BR8J 4NXMF 2HFSA 2E9TA 1FJ7A 4NRUA 4NZ6A 2MDAA 2MZ1A 3JTPA 2W7AA 2EC2A 2LLZA 4DV4F 3QMQA 2XM3A 2MZSA 4P2XA 3RAMA 1TV6A 1NDCA 1FWPA 1VQYA 1UPPA 3D6MB 3KHGA 4PWUA 2R7TA 4ZIVA 3QGGA 3MCOA 1IKYA 1RHKB 2IRXA 3NGDA 3CTRA 2KG0A 3GR1A 2C2OB 3W2VB 4FVMA 3U1NA 5KT5A 3EMTA 3D4JA 3OR2B 3DYAB 3MM9A 2NR0A 3TAMB 3C2PA 2E1AA 2X3GA 1UVMA 4TY8A 1IM4A 5KTQA 4XPCA 5KFAA 3CULA 3FKBA 3PY8A 2UUWA 4M5IA 4B17A 1HWIA 5D0EA 3DHXA 1NLKL 3IBFB 4I56A 1WWHA 4I6AA 4IH7A 4DG1B 5KAKA 4ECZA 2HQDA 3DU6A 4OJGA 2XCAA 4KO0B 2WVCA 4ZVUB 1WF1A 1EKRA 5C7PA 3KYLA 2V4JA 1U1QA 4ETZA 2CPZA 2CQ4A 4H4OA 2XMJA 1U48A 2H4WB 1KQKA 2A2CA 5HMZA 5L9XA 3QT7A 4C98A 1X4CA 1VQSA 1YRUA 2A3JA 1RUSA 2MLXA 3FSXA 3NBPA 4ILRA 4F8RA 4JI7J 1GFWB 4DR2J 3EDRB 4HL9A 3OHBA 2HVHA 3MAAA 3R5DA 4DDFA 2Y8WA 1U1NA 3H2VE 4NLRA 2HSEB 2VV5A 1SUQA 2ILYA 4ZDNA 4PKDB 1UZDA 1G1XA 3MM6A 1Y0HA 3R3TA 2KFZA 1NJWA 3AY0A 4DHVA 4FF1A 4DF8A 4B3RJ 2V8DA 2YNHA 2LEAA 1S97A 2NLWA 1N0VC 2AMCB 4JI6F 3B8HA 4U7CA 1NKBA 4NI2A 4JI8J 1RCXB 4JV1A 5GAEI 5F8JA 2C2MB 4ELTA 1SKUB 3H5UA 3M2VB 3R5BA 1HL6A 3CJTA 3GIMA 2PI4A 2VFUA 5L1JA 4DI6A 1X0FA 1FA0A 1PKUA 1ZM3A 3PKMA 4JYAF 2UXDJ 4OYOA 3SDEA 2FHJA 2ZH4A 3I0SB 3IBCB 4ITSA 4P2SA 2HBZB 3HULA 5JJBA 2R7WA 1JLAA 3GYXB 1AT1B 3KFWX 3T6BA 2QA4S 1TK0A 4ZPVR 3BQ2A 2V1SA 4J90A 3R1LA 4GO7X 4LF9F 2W01A 4DZDA 4FF4A 4DUZJ 2G0JA 1GMUA 1VFJA 2CZVC 3MMBB 4QJVA 4K0KF 4J9OA 1CULB 2V6AA 4ZJOA 3MD3A 4RR5A 1QY7A 3KDOA 1Z2LA 4WIIA 1C0UB 4ED1A 3HKWA 2VG5A 4F67A 1TKTA 3OSNA 2NXJA 4P2MA 1RT5B 2FPHX 2GC8A 1NZAA 4C6AA 4JV2A 1QM9A 3RYLA 1BQXA 2KU7A 2XTCA 5SZTA 4LJMA 4ZPAA 4KV8A 3W5ZA 1XR6A 4NZ7A 2UUCF 4B3RF 4CLSA 1D0EA 1UEVA 3NMRA 3W9JA 3AT1B 3VAFA 1JLFA 3X3UA 2XY7A 2LXFA 1ZA2B 4WXOA 3RB0A 4PXCA 4X62F 1ROFA 4IKAA 1RTIB 3BS9A 3QAUA 2Z57B 2LA6A 2ZWPA 2H9ZA 3T1YF 1UL3A 2ASYA 1N5YA 1AUDA 2MHEA 1D8YA 2LVWA 2UUBF 1F9FA 1ZZNA 3OTEA 1GXTA 2QJ3A 2HFZA 2J76E 1VJWA 4UOCA 4URQU 2BZ2A 1HARA 5AXLA 2MZTA 3M05A 5J2NB 4KGMA 4X65F 2MGZA 1TL7B 1UW4A 2XSJB 3KDNA 2HRUA 4ES1A 2BQ3A 2IBKA 2IC3B 2GZOA 2CPIA 1PAUB 1YRTA 1I5OB 2OJ3A 4M5LA 1KDNA 1KLMB 1TKXA 4LIWA 2PDAA 2R9LA 3I9V9 4P52A 4S0MA 4RW8B 2IPOB 2OO4A 3U1LA 1IKVA 1DBDA 1S9EA 4DV5F 1RTDB 3IWNC 4O3RA 3JQKA 2LU1A 1T9UA 1X31C 4X4TA 4G1QA 2VFVA 1HBUB 3BSCA 3C14B 3LPEA 2LEBA 2D1CA 4F02A 4DX7A 3BPDA 2XHWA 2VIHA 1KD1T 4QPXA 4UF4A 3QZ7A 3DLEB 3OUYB 2GMLA 4MIBA 2CPXA 2BVZA 1TUVA 4CNZA 1S0OA 3FNNA 1EP4B 4PQUA 1RK8A 4B3SF 4K4ZA 1NAQA 2DD8S 3CDAA 4JP8A 4YHHF 2DPIA 1GEHA 3CCLS 2NXCA 2HQFA 3JSBA 1RISA 2MLZA 2HWTA 5A8RB 2R7QA 2MKSA 4RNNA 2H1YA 4JI6J 2CPDA 2H5IB 1YTYA 1R7IA 2HNDB 3DLGB 3KJNB 4CH0S 2DNOA 2H4YB 3B82A 3M9OB 1RT2B 1WHWA 3VGVA 5GVQA 4CLKA 1CJUB 2XG8A 3NOCA 4OYMA 1XEZA 1YLXA 4LVNP 1YBAA 3WX8A 5E5NA 3T5LA 1Y00A 2DXFA 3RR7A 1H0HB 3MPVA 4JI3J 3FC9A 2EKYA 2ZUGA 2CJQA 1TAUA 1WACA 2C42A 4KKOB 1APSA 3QBCA 2BM1A 1LWEB 5JMNA 1KC8T 3CXCR 3RRGA 1Q16B 4KY3A 4M5MA 1TK5A 2CQBA 4JI7F 2WVFA 4OHVA 1OIAA 4ZVFA 4FYDA 1HD1A 4OYWA 3IN5A 1LNQA 3UWTA 1HNIB 2D9PA 3Q2SC 1IKVB 1RTDA 4TXSA 2VODA 1LWFB 4CLYA 3PO4A 4I67A 2AJ0A 4LR9A 3SQGA 5FLXY 2G0CA 3X1LB 2F40A 3T9NA 1EB0A 1S6PB 1CSJA 2QLBB 3D28A 3I9ZA 4L72B 3RRKA 2FLLA 2OEJA 3GIIA 1KHWA 1UZHA 2E7XA 1IWGA 3HLUA 4CTAA 3KK2A 7AT1B 2C3MA 2M7SA 4Q44A 4ELUA 3LP1A 4CO0A 1WC0A 2OFGX 3SQGB 1RHQB 1RWUA 4F25A 4LQ3A 1IR2A 2B4PA 1WKKA 1TUGB 4FYYB 1YZ6A 1NUEA 1WDDA 3P4UB 2J5AA 1PIEA 1F3VA 4DSKA 1T8EA 1WC5A 4PG7A 3UE2A 1OM2A 3EWGA 3PHTA 4TN2A 5KFLA 1S5ZA 4ED3A 4FS2A 5H9EJ 4JB8B 3ZZYA 4ENOA 3DLKB 2HNZB 1N5VA 3HD2A 4PPDA 3I31A 3AWRA 3W60A 2DR9A 2FJXA 5HANA 5A6PA 2VPYB 3IGNA 5HJYA 3DM2A 3VTIA 4P75A 5CH7B 1XWLA 2DJWA 1CLFA 3R7SB 4ZN1A 2DIVA 4B3OB 4DSIA 4Q2MA 4ED6A 1RXOB 3JSRA 2P6TA 3MEGB 3G6XA 3HM9A 2RH3A 4ID8A 4JI5F 1LEOA 3PM9A 2VFSA 3MUTP 5F8IA 3E3XA 3R7NB 2DHAA 5HLFB 1Y11A 1TP7A 4FYXB 1JNZB 4NLWA 4DUTA 5K8PA 2WVDA 5GMKa 1P8GA 3M6UA 2ZH1A 1JLCA 3OSPA 2OUGA 3BH7B 2YWHA 3RJMB 1N48A 1ZM9A 1DLOB 2J9EA 1YKWA 2UXCJ 4ETXA 2BM0A 4PQUB 2DIUA 1PJ5A 3DRSA 4DV3J 2QO3A 5DG7A 3HO1A 1F9HA 2YKOA 4I7FA 4IFVA 2BANA 4P71A 5HK4A 4EO8A 6FD1A 1UVIA 2XULA 4PR6A 2G0IA 3MCNA 2HMIB 2NXNA 1FF2A 1U2CA 3C14A 3DNCA 3PIPQ 2R7XA 2QSWA 1SH3A 5K8OA 3KTQA 2BJ9A 3K2YA 2VJUA 2ZZNA 3GFXA 4N5SA 3QPIA 5ETNA 2AP6A 3KHHA 4BHQA 1XK8A 4U95A 8AT1B 3UW1A 3WIUA 1NK5A 1J5EJ 4P9SA 3EGWB 3F44A 4OZ1A 3DDIA 1H72C 4BWJA 1KOOA 2EFNA 3THVA 2Q3PA 3RW6A 4BWMA 4DJBA 2XSJA 3MAAB 3TP2A 4ILMA 1X5SA 5D78A 1J2VA 3QT5A 1HBOB 1CVJA 2BDPA 1Q8BA 1BGXT 1RLDA 4TVAB 3D2WA 5DM7Q 2E5GA 3E51A 2GV1A 1VC0A 2QMUB 2AD9A 4DS4A 1S0NA 1IR0A 2BE2B 4MJKA 1JJCB 1S49A 5KG4A 2C28A 3NGUA 1SCJB 2UZAA 4IOBA 4ZLNA 3GB0A 2HK2A 4ZVRB 1HPZA 2EVZA 3J7YU 2PD1A 1WDTA 4DU7A 4Z37A 4NLPA 3UFCX 2QEXS 2XNRA 2CWXA 1X0PA 1DQ8A 2R2SA 3H5SA 2UU9F 5IZHA 3SQOP 1TKZB 4YOEA 3G2XA 2QRRA 2EBEA 4K4VA 3C3LA 5AJ3J 4NE9C 2GW8A 2XYHB 1M1KT 3LA0A 3N5FA 2LQJA 3W8GA 1T03A 2CJKA 3G9CA 1NU4A 2KYXA 4KFBB 2A0FB 2MKYA 1UWBA 2JLGA 1Y3KA 3TA0A 1C2PA 2E44A 2CQ0A 3CWJA 4MKVA 2JJ4D 1NSKL 2B8QA 3ADAC 3ZXWA 5IXUA 5FLXU 4PG4A 4HHHA 1AA1B 3BDPA 1W7WA 2FJDB 3L7OA 3NP5A 3TQEA 3UPFA 1S57A 4PYDA 2VFRA 3W9IA 2XGPA 2ADBA 4B3MF 3LH2S 4KRWA 2KRRA 4GC7A 2CJBA 4LRAA 3HT0A 3V81B 1HNWF 3DOKB 1IWAA 5GADI 3O3LA 3IR6B 2VG7B 3HD1A 1R8HA 4IR9A 2HVZA 1X5OA 2IJNA 5A76A 4B3TJ 1S7IA 4MAKA 3CMQA 2N82B 4AYBD 2F4VJ 4FYWB 1B0TA 4ZVSB 3FQKA 4GKJJ 4WFYA 3NMAA 1UVLA 1K1QA 3PEJA 3BB5A 3IG1A 2XTEA 2MKKA 4DSEA 4DV6F 1QVGR 3LWLA 3C19A 2IM3A 1NDPA 3Q86A 2J6SA 4GRSA 3IR7B 1JWWA 3M7VA 4W4MA 2JL9A 5DS7A 4USTA 4QW8A 1WF2A 4ZVQB 5KFSA 1CQNA 1RA6A 2A1BA 2CNLB 1AUSL 3NBPB 1MMNA 2MY8A 2XHCA 4KR0B 3DRRB 1VLOA 3K89A 4OHXA 5L38A 3MUVP 1QAYA 2XWYA 3Q24A 5EHHA 2NYIA 2DGSA 2AWZA 3CSKA 4DR7F 4OLPA 1NMEB 4A8OA 3KLHB 3BGRB 4J9NA 1VOMA 2IDEA 3D1OA 4YB1P 3W5YA 3GJTB 3CCMS 3RB6A 1KEKA 5L1KA 1WOSA 1H6KX 4C7QA 5J2PB 4KHPF 4UT4A 2QLJB 3AQOA 3DGPB 3S01A 4K0KJ 4DPWA 3CCQS 1FJGJ 2GGPA 3DLEA 4ZP7A 2CPYA 3H8YA 3HHLD 1T9VA 3SI8A 1XMQF 3AH6A 3IXQA 3TZWA 3QO9B 3Q8QB 5I3QA 4LFAF 1D8ZA 4ZP8A 4ED5A 2DGUA 1EETA 5IV4A 2KHDA 4I69A 2U1AA 4OJHA 4WK1A 1FKPA 2K7KA 3TOQA 1P27B 2RIJA 3PEHA 5FDLA 4ZVOB 4X4PA 3PX0A 1R0AB 5GMDA 5K5MA 1G4CA 3RG6A 3L7PA 4ZHRA 4NASA 3KJFB 1Q95G 3OR1B 5U47A 2W7PA 4F50A 4RW8A 1SC4B 1QUVA 4AL7A 1PYSB 5HATA 4Q0BB 1N32F 1D3WA 4AL6A 1U1MA 1CQMA 4LRDA 1SUQB 5IT0A 3G8QA 1RAHB 1S1WB 2J8SA 5B0BA 4Z2XA 2D7SA 1FKOA 3FEZA 2FVQA 2B56A 2XZWA 2QFJA 5B08A 1HNXF 5HVHA 1S1TA 5KFCA 2P2CB 4JV0A 5H9EK 4A48A 4X65J 1X4HA 2IMWP 3W62A 2MQMA 4WJBA 2GJIA 3T9ZA 5IQ6A 1KVKA 2V2KA 2OIHA 3OXLA 2HBQB 1IXKA 4G1PA 1IVZA 3LANA 4Y2MA 5KOWA 1S77D 3DOLB 4KO0A 1G6BA 2WHOA 2O66A 1VQLS 2VG6B 3FZBA 3WC2A 1BD6A 1WHVA 1HNZF 1IKXA 1N5QA 3D0HE 3M4XA 2QZ8A 4W90B 4ILLA 1N5TA 4QR1A 1WTFA 3T6JA 2H48B 2BACA 3HKZD 1RT5A 1V5IB 1A7GE 4AL5A 1I94J 1N33J 2AYMA 3Q23A 2V2ZA 2RF2B 3MAQA 3PW5A 2DGXA 3I4HX 3IRXB 3U7JA 2GMJA 3JSMB 4RU2A 4LF1A 3UVJA 1KVIA 1UP1A 1UJ6A 1U0HB 4TLQA 1RBOB 2GFFA 5KT7A 5AJ3F 3ENAA 1Z1ZA 4P72A 1BWVA 2MKIA 4AFFA 3AA9A 1HIYA 2DEJA 2Z4PA 2ZE2A 2PE8A 3MMCA 4DBQA 3MUMP 1N34F 2A18A 1UEUA 4TU7A 3T5KA 3H5YA 3N5BA 3V5RA 2IMOA 2N7CA 4NEZA 3HT3A 2EEYA 3BREA 1C0TA 4NL5A 4XTTA 3T19A 4LF7J 1O6XA 2MEWA 1KS2A 3W63A 1FX4A 2V9KA 4M5JA 1NEEA 1Y5IB 4YB5A 4EFAC 1VBZA 1R8CA 2CQPA 1HW8A 3HVAA 3IRXA 2YWKA 1ZM2A 3LAKA 3MMJA 4G1IA 2CDQA 1N0UA 2E5IA 3UDEA 1VCTA 5LXYA 2YNIA 4J7CA 3BZQA 1HYSA 3MHYA 3VGUA 5EGYA 3FSIA 4DLGA 3PV8A 2RILA 2OD6A 3R7BB 4RW6A 4ZPBA 4UZBA 2W9AA 1TK8A 3GQCA 3K5PA 1NK4A 4A8FA 2HVEA 2AT1B 1U02A 4OMFG 1F60B 3GYGA 2CJ9A 5K20B 5DG8A 4C0OC 1NDKA 1RHJB 1WKJA 2XYGB 2Y3YA 4HACB 1NBEB 3BDEA 3TR5A 8RUCA 3TO8A 4I2PB 1SIZA 1WF0A 2HBRB 2AJFE 3L7UA 1S1XB 2QTWA 2J6UA 2GAHC 3ZZUA 4KYZA 2PMZD 2DH7A 2UXBJ 4H4MB 1LWCA 2CVEA 4OX6A 1K44A 2UUCJ 3MPYA 1FI4A 4DEZA 2W2NP 4N8NA 4WP8A 1S0MA 3V4MA 2DNKA 2VB6A 2ZNYA 3A1YG 3POTA 2PO4A 5SUHA 4JUZA 1R3NA 3ICLA 3W64A 4C11B 4CQ1A 2ROGA 1RWNB 4RNOA 1VBXA 2ZBPA 1FKAF 4GC6A 4Q8FA 2HHPA 3J81U 1E6VA 1VIXA 1Y9OA 4ZCKA 3KK3B 1YZ7A 1FE0A 1UJ5A 2GIQA 2B8PA 2YKQA 3M2RB 1XMOF 1H2VZ 2LDYA 1U2FA 2V9WA 3ZZPA 1F6TA 4OI4A 4QCLA 3TVYA 1ICEB 4TQRA 2FHJD 4A8WA 3V4IA 2LA4A 4DV0F 1F5BA 5IFMA 1HLWA 1B7YB 1HQ2A 5F8HA 1RU1A 2HFOA 2MPUA 4WP3A 5KT2A 2WAQD 4HHJA 3JS9A 3HHNB 2NUHA 1C1BB 2OEKA 3SBMA 3J80U 2DITA 3EZ5A 1SQGA 4X4NA 4L74A 4IR1A 3BBFA 5KOXA 1N54B 2QG9B 2DGTA 4JI1J 4NLYA 1AZSB 4YQWA 2NSBA 3BYRA 5DDQC 4NLGA 1LW2B 1CEZA 2VU5A 1N36J 4NCBA 3EPGA 3MGJA 4NLSA 2VBZA 3DRRA 3OLAA 4IFYA 4FPRA 1YDLA 2HFUA 1VI7A 3M32A 3UD4P 2XZ2A 4ZPTR 5LM7E 4V1Ak 3OL6A 4X4RA 1TZ0A 4LR8A 4ZVHA 5KG6A 4DL6A 4ZLLA 3KJVA 3ZNJ1 1HWLA 3K5NA 3BR8A 1U1RA 3DU5A 3OTBA 1QE1A 2ASLA 3P45B 3WC0A 1I3OB 3BKTA 1NSQA 2HZCA 2Y1JA 2HAFA 1HI1A 1NO8A 1VYAA 2RNEA 3HHLA 3ZTRA 2CNKB 4GKJF 2N3LA 4DX6A 1M5VC 4J9SA 1DTTA 2JC1A 3DOMB 1JLEB 3MEKA 3MI7X 3MM7A 4RW7B 3QJPA 5B7WA 1S6QA 3K8WA 3GV7B 1RT6B 2KJVA 4KH1B 4KHMA 3ILLA 2KO1A 3QT6A 5I3UB 3AD7C 3ZTSA 2W2PP 4ER8A 2U2FA 4KE5A 2AJ4A 2FYXA 1GXUA 1S1VB 2XMMA 4LBHA 3PJ9A 1HR0F 2RKIA 4PUOA 3OTOJ 1AFJA 1JJHA 4WFBQ 1QAIA 1NHKL 3IFEA 1V3SA 3GCXP 3MFHA 4DR1F 1PJ7A 2ZH5A 3W5XA 2X7IA 2QN6B 1X9SA 3W9HA 2MHNA 1FVQA 1H2TZ 4KHRA 2PMHA 3C16B 1KQGB 2Q66A 3FMBA 2D3UA 2DNHA 2WONA 1MMLA 3LP0A 5K14B 1FDDA 1ZA1B 5EWEA 4W92B 2VQFF 3AFGA 2PGCA 4WE1A 4ZP9A 1FCAA 3LUYA 3WBZA 3H0PA 2OTLS 2PEBA 3KNAA 1WUUA 3GJSB 4FN5A 1RAEB 4NOHA 3PO5A 2B9WA 2WCXA 1L3SA 1H74A 5I3PA 4QYZK 1S4FA 3TWZA 1GNKA 1IJFB 1HFEL 2B7BB 3NWGA 1G2EA 1FDBA 2D74B 5CAAA 2BV3A 2YPZA 1T3OA 4OQJA 4QBUA 3Q8PB 1VC6A 4LQ9A 2MKHA 5J1EB 2R7VA 3B54A 3WQPA 5EDWA 4AT1B 1CG2A 1SC6A 5DQIA 2XO7A 3ZZZA 1A6LA 3AD8C 1N88A 1B3TA 4DQRA 3TAQA 3EPIA 3VALA 4RBUA 1UA0A 3PACA 5C2CA 3QO9A 5IOLA 3W8PA 5HO4A 3L3CA 4YS2A 2FJWA 5ETVA 2AU0A 2XS7A 1A9NB 3V6JA 4JI0J 1Q78A 1UVKA 4QR2A 4USIA 2OD4A 1MU2B 1U25A 3PYDA 4K5SA 4BBYA 3CPWR 1ZETA 5LJ3Y 5J2PA 4UQTA 1BUXA 3AODA 1S0VA 3UDLA 4AXJA 4NLTA 4WTYA 3C6TA 2FJBB 4FKYA 1U26A 3FSYA 1OO0B 5CYQA 2POKA 4NCAA 2HGNA 1SVDA 4F3MA 2XC9A 3PIOQ 3QNWB 2B4OA 2VUGA 5C42A 4DQPA 4F4XA 2W2QP 3AOAA 1HWUA 3A12A 4TYBA 3T3FA 4QYZJ 1JQGA 3FEYB 4GMKA 2P9CA 4GVBA 2QL9B 4QIVA 3AX2A 5IS2A 4X4OA 4DR1J 3CEDA 1K73T 2Q6BA 2IYIA 1QSLA 4A8MP 5HVFA 2DBBA 3NKYA 3KLGB 1NB7A 5KFTA 3CC7S 1U6FA 5D0GA 1I6JA 1KBRA 1YBTA 2V2QA 3CB4A 4L3NA 1VISA 4DX8H 3J7YI 3BGLA 3IG1B 2APOA 2IRUA 3KOAA 3OFEA 4ECRA 4FBTA 4FS1A 1R8AA 3QGHA 2FLPA 3SMZA 4F4YA 2HHXA 3WDOA 1U1LA 2MQOA 2J7UA 3LTOA 2P5VA 4DN9A 4ZK7M 4WTOB 4OZ3A 2VA2A 1RT4A 4O3QA 3JAMU 1WOOA 2ZFHA 2NS1B 5GAGI 1HNXJ 2E1CA 2HHTA 3CDWA 1RBLA 1WG1A 2CQGA 4CCHA 2J0SD 3R1HA 2FZGB 1H73A 2LP4A 3ETOA 3TZZA 4DL4A 1XR7A 1KKHA 3UCUP 2JZ5A 3DOKA 4B3MJ 2BE7D 2IAJB 2CA9A 2HIQA 1QTMA 3N6LA 2JDJA 4RWWA 5F0UA 3GWCA 4N76A 3E2EA 4YDDB 4LFBF 3OTDA 4U8YA 2DEIA 3FFIA 3M1VB 4RUBA 2G2YA 2ZWOA 2DNQA 5HVGA 2QL5B 2VL1A 3IWXA 3MZIA 1SKSA 3QJJA 1H7XA 2VH7A 3D0IE 4WFNQ 2J9CA 3Q8RB 2D3OR 1FNMA 1T05A 2Y9HA 1NSPA 3DLKA 3EGZA 3CF5Q 4L73A 5HSPA 4B3SJ 1FTCA 2ACYA 4R25A 3CJKB 2R2UA 5L8RC 2W1BA 5B0GA 4K4SA 2LQ5A 5HP1B 4ECQA 5KFDA 3KWMA 1ITPA 2FHKA 3QFHA 1FRKA 2WSFC 2X1BA 5DDPC 3PFEA 1UA1A 1N6QB 4BDPA 4DPOA 1ZAWA 3ENQA 1DTQB 1MWQA 4FP9A 1TL1B 4PXEA 2XMAA 2BJ3A 2IDLA 1HQUB 2VONA 2RRAA 2OPSB 1WSRA 1NK8A 4N8OA 4AXIA 3PW7A 1TVRB 2KT2A 3D54A 4F3QA 1RB0A 4LF8J 1TMJA 3PW2A 4DS5A 1TAQA 4DL5A 1NHUA 4F0MA 3DMJA 3US5A 3ZTQA 1HNIA 3FQLA 4HTJA 1H3DA 1RTJA 2EK1A 4IG0B 4MK9A 1M5PC 4F36A 2VZ9A 3Q0AA 2DCLA 4R8UB 2Q79A 3JTOA 4X2BA 2K1RA 2XWXA 1RKIA 3I96A 5AE1A 1R6VA 3OFHA 1Q8LA 5E41A 5DQHA 3KLFA 2FIUA 3SCKE 2Q6CA 2O5DA 2XEXA 2Z56B 3A8IA 3QQCD 4OX8A 3M8RA 1J5EF 4DFKA 1CJKB 5EX0A 4F4KA 4ZITA 3C8YA 2E66A 2MQLA 1JKHA 2DHGA 4DR2F 4JI4F 4YMEA 2DKOB 2FHMA 1RAIB 2YNGB 1WELA 2MQQA 2GS8A 1FRXA 5E0OA 1ZPWX 2CNNB 2WSEC 3KLFB 4X84A 3KLGA 3LW5C 2HGLA 2WBRA 3MFIA 4ICLA 4NXNF 2JOQA 1GTHA 3QLHA 5DETA 5A8RA 1WC3A 5FIIA 8ATCB 4KGKA 3CJQA 3FCVA 1RTHA 3FVYA 4TLRA 5L46A 2KFYA 3KLEB 1BQMA 1HMVA 3DGVA 5CYMA 5CHCB 1Q53A 3VAIA 5CYMB 2E1MC 4JI0F 4F3OA 2E7WA 5A8WA 1VRUA 1S99A 4CZCA 3S6EA 2DXEA 4RWXA 2DT9A 2AKWB 2EK6A 2GCFA 1F2GA 2ROEA 4RLEA 3AHPA 5AE3A 4V19X 1ZBTA 1SPBP 3NGKA 1UFKA 3C66A 1B0VA 4NYZA 2B5JB 3GG1A 2YTCA 4HI1A 5KFHA 2ZHBA 2IA6A 4KHPJ 3V6DA 2HVIA 4NCGA 4WFXA 3D5MA 5E2QA 1P1TA 3M8ZA 1I51B 2NYHA 3O5TB 2ZM6F 1XTZA 3MM8B 5HMWA 1XNRF 2A10A 2IC3A 5C24A 4DR7J 3Q89A 2ZHOA 4KGXB 2CRLA 2DRDA 2B4VA 2KXHA 4X64F 1LW0B 3M30A 3KLVA 3M1VA 4KTQA 4WZMA 3MAHA 1W25A 1G3OA 1Y10A 4IOAQ 5HBMB 2FGCA 1YSJA 4O4RA 3C46A 2YWGA 1Y5LB 4HDGA 4EBDA 5CXTA 1CC7A 5KG5A 2FVRA 1UETA 2DK2A 5KFYA 1REVB 3TZXA 1MROB 1Q86T 3DN9A 3FZ2A 3MEEB 4IQMA 2WW4A 2B9XA 1X60A 4FYVB 4WP9A 3SSSA 5F9NA 2ZHAA 2H3EB 2UP1A 1VRQC 2QA1A 3D6FB 1X4EA 3EVOA 4USUA 3H2UB 4MT1A 5KFMA 3G8TA 2DNMA 3A8EA 5LOQA 2AQ4A 3H59A 1WC1A 4N7TA 3LALA 1TKDA 4YB6A 2ZEJA 4UY85 3G71S 1RJJA 4L6V3 5D77A 4BC9A 1LWFA 1S9GA 4YY3J
chains in the Genus database with same CATH topology
1RDRA 1KQSR 4MFBB 2E5JA 1LXJA 4O4GB 4OX9F 2GQCA 3KMSA 3H4DA 2VASA 5KFVA 3CUNA 4YUDA 1YJNS 4J9MA 4MTPA 4ATNA 2KT3A 1GT8A 1QE1B 1VRUB 2IYGA 2NSCA 3AJ2A 4MMOA 4N77A 4X66F 4FF2A 2WOMB 3MOZA 4PWDA 2W25A 2BYCA 1U45A 2D41A 2ZBCA 2DRAA 3AA8A 5E3QA 4IFYB 4FF3A 3QLHB 5HMYA 3THPA 2WBMA 2DRBA 1LW2A 4V19J 1MMDA 3VAHA 2LMIA 1QSSA 3TUJC 1W2BR 4JI8F 1O8BA 4OIXA 1Q79A 1G7CB 1FK9B 5DJBA 4MK8A 2EPIA 3IC1A 2ZD1B 2ZKTA 1X7VA 2XS2A 1IKWB 4HH0A 3MD1A 3SYZA 2K1RB 1FNOA 2X1FA 1UJ4A 2W24A 4NA1A 1KONA 1Q8IA 1MW7A 4CO4A 5EUHA 1S9EB 3RTVA 4MKYA 2KYZA 1X8DA 3CD0A 5AXMA 4ID5A 4DL7A 5BYQA 3MDFA 2Z2MA 2RB7A 3POTB 4DN0A 4ECXA 1JJ2R 2XMTA 3SZ2A 5IT9Y 4B9TA 3ISND 4ECYA 1S72S 1X5PA 5DRKA 5G0RB 2BUNA 3KKFA 4FVCA 4O3OA 3GFYA 5GAEU 3ULHA 1PILA 4UY8T 1SV5B 1YVFA 2CPFA 2D3ZA 4TY8B 3MMAB 4OHZA 3VAKA 1VQMS 3VAGA 1L3UA 1U09A 1FRIA 1VQNS 1S6QB 2ATLA 5KFRA 5HQ8A 2LDIA 1KR4A 1JLFB 4DR3F 4FBUA 4IRCA 1FT8A 3SV3A 4C9DA 1WHXA 3CDBA 2RQMA 3OQ2A 5ITHA 3CCWA 1TV6B 3MEDA 5D4LA 1D9DA 2RE1A 1Y4ZB 2VA3A 4DR6F 2ZITA 4OZJA 3QGPA 3WX4A 2AJQA 1LK7A 2XGQA 2M70A 4H4KC 4B9MA 4CO3A 2WTFA 2GA7A 1TFWA 3KG4A 5A6WA 1K0VA 2XI2A 3BN7A 4J9KA 2IAJA 4F4WA 3R27A 1U24A 5B0AA 2KG1A 2QLWA 3MMBA 2WONB 3CE8A 4WFAQ 1FE4A 3UR0A 4OLOA 3CT9A 5K9FA 1X4DA 3LO3A 2R8JA 1JLAB 1RYRA 5M2PA 1T95A 2VBYA 5DO2A 3Q8SB 1C1BA 4DMZA 1WEZA 2DNRA 5KG7A 1FRLA 3LQVA 3D0GE 1DZ5A 4DSLA 3VF0B 2M2BA 2OFHX 5T14A 1K8AT 2J0QD 2VFTA 3NLCA 2R8GA 4YY3F 4ZP6A 2NPFA 4YR0A 2K8GA 1N36F 3TRGA 2YNHB 1FXDA 1Q7LB 4A46A 2MSTA 3MMAA 4ECUA 2AYBA 4IO1A 1OPZA 2DO4A 2WK4A 3BGUA 1HBMA 3ITHB 2RS2A 1BQNB 5CZVA 2FLOA 1KVIA 2GNKA 2GQ2A 3MPWA 2DISA 5C5JA 2ZJQQ 1HNVA 3OJSA 4J9LA 1KTVA 4IDKB 4IG3A 5B0EA 4B08A 2CJAA 1VS3A 2J7WA 3DRPB 1IUJA 2BABA 4QR0A 3BM7A 3LGNA 2AX1A 2HS4A 1JLQA 3OXGA 1K9MT 1XERA 4FZVA 1JXLA 2BBEA 4NLXA 2XMVA 3TQ1A 2X1AA 3GIKA 5KFUA 3OVAA 1HBNA 2UV8A