1XR6A

Crystal structure of rna-dependent rna polymerase 3d from human rhinovirus serotype 1b
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
460
structure length
460
Chain Sequence
GQIKISKHANECGLPTIHTPSKTKLQPSVFYDVFPGSKEPAVLTDNDPRLKVNFKEALFSKYKGNTECSLNQHMEIAIAHYSAQLITLDIDSKPIALEDSVFGIEGLEALDLNTSAGFPYVTMGIKKRDLINNKTKDISRLKEALDKYGVDLPMITFLKDELRKKEKISAGKTRVIEASSINDTILFRTTFGNLFSKFHLNPGVVTGSAVGCDPETFWSKIPVMLDGDCIMAFDYTNYDGSIHPVWFQALKKVLENLSFQSNLIDRLCYSKHLFKSTYYEVAGGVPSGCSGTSIFNTMINNIIIRTLVLDAYKNIDLDKLKIIAYGDDVIFSYKYTLDMEAIANEGKKYGLTITPADKSTEFKKLDYNNVTFLKRGFKQDEKHTFLIHPTFPVEEIYESIRWTKKPSQMQEHVLSLCHLMWHNGRKVYEDFSSKIRSVSAGRALYIPPYDLLKHEWYEKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the RNA-Dependent RNA Polymerase from Human Rhinovirus: A Dual-Function Target for Common Cold Antiviral Therapy
pubmed doi rcsb
source organism Human rhinovirus 1b
molecule tags Transferase
molecule keywords Genome polyprotein
total genus 136
structure length 460
sequence length 460
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1xr6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xr6A02
4RW9A 2ZKUA 2JC0A 2OPQB 4WXWA 3V4IA 4R5PB 2FJVA 1RT2A 1TV6A 3MEDB 4NLUA 2HNDB 2WB4A 3DOLB 4H4OB 4LSNB 2AX1A 2RF2B 2UUTA 3DOKA 4JV1A 3C6UB 1IKVB 4RNNA 5KT4A 4NLYA 3ITHA 4Q8EA 4MKBA 5KFZA 5KFCA 1J5OB 1JX4A 1DTTB 3G86A 3BR9A 4KO0B 2E9ZA 1LWFA 4KFBA 2WK4A 1S9GB 3IS9B 4IR1A 3I5CA 3OL9A 2WOMB 5C42B 4FS2A 4LQ9A 4MKAA 4IQXA 4ECSA 1KLMA 1N4LA 4QWBA 4DG1A 3JSMB 3RB0A 3D28A 1JLAB 4O44A 3BQ0A 1GX6A 4I2PB 4TQSA 5DLGA 1KHVA 4DL4A 2VG6B 5KFJA 4MFBB 1RTIB 4IFVB 4NLTA 4TXSA 1C1CB 3CJ3A 3M8PA 1S49A 1TKTA 2BANA 2XCAA 1JLGB 5CYMA 3NBPB 4J9NA 3MFHA 4KKOA 2AQ4A 5KFXA 5D3GA 5KFSA 3H5UA 4RNMA 5CYQB 3IN5A 1HQUA 3KK3B 1IKWA 3BGRB 3V6KA 1S6PB 3HHKA 3NL0A 1QE1B 3HVAA 5J2MB 1RTDB 2BRLA 1KHWA 1UWBA 5KG1A 3KHRA 2UVWA 4WXOA 3DLKA 2XI3A 3LP0B 1BQMB 5DQHA 2AWZA 4ECZA 4R8UA 1JLEB 3RBEA 1QAJA 1RT5A 1T05A 3CO9A 3LALA 4ED0A 1REVA 5HBMB 3GILA 1D1UA 4NLXA 3CDUA 2FJWA 2IM1A 4B3OA 4K4SA 2QV6A 5JXSA 4J9RA 4TLRA 4YQWA 3KK1B 2ASLA 1IM4A 3I5BA 3MR6A 4PQUB 5HROA 4JUZA 2B5JB 3QLHB 1TVRB 1S1UA 3KMSA 5KFDA 2C22A 4IRCA 1IKYA 4YR3A 3SI8A 4RNFA 5DGBA 3Q8PB 5DG9A 1C2PA 1RTJA 3LP2B 2V4RA 1HMVB 2GC8A 1S0NA 3DI6A 5F8HA 2OPPA 1TL1B 1XR6A 4Q44A 3KJVB 3TQ1A 4NLWA 1JKHA 3RB6A 2JEIA 3LAMA 1JLBA 1RT3A 5KFPA 3KLIA 1SH3A 2YNGA 2R8KA 5F9NA 4MH8A 3Q8QB 3NGDA 4RW4A 5I3UA 4KHMA 2HNZB 4IDKB 1RYSA 4ZP8A 4ECWA 5J2NB 2BQUA 4IG3A 4PUOA 2OPRB 5KG0A 5HP1A 4U7CA 4NLSA 3QGHA 2HWHA 5HLFB 2AGPA 3DLEB 4WFXA 3LAKA 3QIPB 4RZRA 2BQ3A 3I0SB 3BSAA 5KFEA 4K4VA 1JLFA 2VG5B 1XR7A 1FK9B 4H4MA 3ISND 5C5JA 4DL5A 4NRUA 3C6TA 2I5JA 2FVRA 5F8JA 2ILYA 3GIMA 3T5JA 4KHRA 3DRSB 1S6QA 2OPSB 3RB4A 4Y2AA 3OHBA 5DQIA 4ZVEA 4U6PA 1FKOB 5KT3A 1JLCB 2W9BB 2YNIB 3UDLA 5K14A 4Y3CA 3FFIB 3RBDA 2JC1A 2B6AB 3GIKA 3PJXA 1LW0A 4MIBA 4ZHRB 4EO8A 1SUQB 5L1KA 1S1TA 2W9CB 5FDLB 2HNYB 3H5SA 4J9KA 4Q0BA 4EO6A 1TP7A 4NLPA 3DM2A 1RT6B 2IC3B 2O5DA 3RAXA 1K1SA 4RNOA 1S9EB 2IMWP 1RT7A 4RW7B 2W7PA 3DRRA 1FKPB 2I1RA 1NNDA 4RW9B 1S1WB 3DRPB 2BE2A 4MK9A 4WZMA 1EP4A 3MEDA 4IH7A 2R8HA 2IJFA 4JV0A 1C0UA 2J6TA 4TQRA 1RDRA 1HPZA 3CJ2A 1C1BA 3MECA 4IFYA 4O4GB 5KG3A 3RAQA 1VRTA 1T03B 2C2RA 2VA3A 3KHLA 4KO0A 4K4TA 3M8QB 2C2EA 4EYHB 4ZVFA 3KLEB 3KK2B 3IRXA 4I2QA 5KG5A 2YKMB 1HYSB 3D5MA 2XGPA 4IOBA 5KFAA 2ZD1B 5DQGA 2YNFB 2CKWA 3QO9B 4O44B 3GIIA 2FVQA 1TKXB 3BQ2A 1R0AB 2HMIA 4ID5A 4TYAA 2VG6A 4KV8A 3LP1A 4RU9A 5F9LA 2AGQA 5KG4A 2UVVA 2YNHA 4M94A 1N6QB 1JLGA 5CYMB 2JLEA 2FLNA 3V6HA 1U09A 5KT5A 2RKIA 2WCXA 1DTQB 4F4XA 4NLVA 4RW6A 4ED7A 4ECXA 3T1AA 3FQKA 4IH6A 5F8GA 4R5PA 1MU2B 1VRUA 1W25A 2XC9A 2XWYA 4GC6A 4Y34A 4ZP9A 1NHUA 4IG0B 3KLGB 3OLAA 3G6YA 3KHHA 4TY8B 1JLEA 4Q45A 4ED8A 1JLQA 4ZPAA 2IBKA 4K4UA 4YP3A 1QUVA 3KLVA 2AU0A 1WNEA 2VG7A 4YR2A 1JIHA 4EBCA 2JEGA 4NLQA 4PWDB 3KNAA 3H4DA 4RNHA 4DL3A 1DLOB 1LWEA 2HWIA 5C25B 3GQCA 2W8LA 3MF5A 3V81A 2BQRA 1RT4B 2IAJB 3I0RA 1SH0A 4ED3A 3DLGB 3TAMA 1TL3B 4DEZA 4DL7A 5I42B 3DMJA 3PW0A 3SFGA 5KFFA 3KHGA 2OPQA 1RT1B 4HYKA 2J6UA 4RW8A 3H98A 3DOLA 5KT7A 4WE1A 5KFKA 3OSNA 4URGA 2ILZA 5CYQA 1LW2B 3HVTA 5I3UB 4IR9A 1LWFB 2HNZA 4IDKA 4ZVHA 4ZVGA 1UWBB 4K50A 3NKYA 3FQLA 4I7FB 4YR0A 4URQU 1BQMA 4ICLB 5KT2A 4ZPBA 4Q43A 3ICLA 5J2QA 2CJQA 2R2TA 4O3SA 1SV5A 1JLFB 3EZUA 4DL6A 3ITHB 3PHEA 4DG1B 1NHVA 4R0EA 1S1VB 1C0TA 3HKWA 4I2PA 4ED6A 5J1EB 3T5LA 1EETB 3DYAB 1BQNB 4EBDA 2D3UA 3KLHA 1S9GA 3IS9A 3DRSA 3BQ1A 3UR0A 4ZPDA 2WOMA 3BREA 4QWAA 3E01B 1S4FA 5C24A 4JV2A 1HQEA 3T5HA 4K4YA 2W9BA 2D3ZA 1IKWB 3JSMA 2ASJA 3MEGA 2BR0A 1RTJB 2R8GA 3IG1A 1S1XA 4IFVA 4RUCA 4LSNA 3V6DB 2HNDA 1LW0B 4ZHRA 3KJVA 3M8PB 4IKAA 3JYTB 4WFYA 4K4WA 4NZ0A 1OS5A 1TKZA 2WONB 3KLIB 2DPJA 4ECYA 1RT6A 4J9SA 2ZE2B 3BGRA 3CWJA 2V4QA 3GV5B 4ECTA 1RTDA 4KFBB 5KFNA 3T5KA 2FVSA 1S1WA 2OPRA 1HNVB 3MFIA 5HP1B 1Z4UA 3LP0A 4H4OA 3RB3A 1RTHA 4IH5A 3TVKA 5EWGA 4NLOA 5L1JA 3G6XA 4LSLA 3I0SA 1TVRA 5KFVA 4J9PA 2QE5A 5J2PA 2R8IA 1DTTA 4X2BA 1RTIA 1QAIA 3M8QA 4B3OB 3KLEA 5KFLA 3IRXB 1HARA 3KK2A 4ZP7A 4G1QB 1ZTTA 3Q8SB 3N6NA 2FVCA 5HROB 5F8LA 5D3GB 4NYZA 5KFRA 4WYLA 1S1UB 2YNGB 1HQUB 2W7OA 5K14B 3CVKA 4NLGA 4ZP6A 1QE1A 4IG3B 3DI6B 4MFBA 3OSPA 1RT2B 1TV6B 3LP1B 2AGOA 2EC0A 1TL1A 2YKNA 3DLEA 1N5YB 1C1CA 3Q8RB 3OL7A 3KOAA 5KFUA 2HNYA 4DL2A 3M9NB 4J9LA 1ZETA 3NBPA 1IKVA 3H59A 3QZ7A 4XPEA 4J9QA 3PR5B 3QIDA 3DM2B 4NCGB 3CJ0A 3VQSA 3KK3A 2FVPA 1S9FA 2IM2A 3IGNA 5KFGA 4QWCA 1IKXB 4WYWA 3KLFB 3MR2A 3DLKB 2F8EX 1EP4B 1N56A 5KG7A 4PQUA 3E51A 5C42A 3MTKA 3QLHA 4TY9A 1JLQB 1KLMB 2R2SA 2YNIA 2VG5A 1JLAA 5KFMA 3GYNA 4H54A 2UUWA 3NMAA 4KB7A 2W8KA 1D0EA 3MEEB 2I5JB 5DLFA 2WTFA 4EEYA 1S97A 5KFYA 4M95A 2W9CA 1JKHB 2C28A 1K1QA 3OLBA 3OL8A 4MK7A 2OPSA 4O3PA 1S10A 2D7SA 2JEJA 1RT4A 3NAHA 1LWCA 4ECVA 2JEFA 5KFBA 3KMQA 5EWFA 2IJNA 1HNIB 4RUAA 5KT6A 2HAIA 1S6PA 4IRKA 5J2MA 3QO9A 3H5XA 4O3OA 4ED1A 5J2NA 5L1LA 3CIZA 4MK8A 3H40A 1YVFA 3V4IB 4FBUA 2IM0A 3PW2A 2XI2A 3I5AA 4RW8B 5HLFA 2RF2A 1S1TB 3DOKB 5FDLA 3EPIA 2V0NA 3C6UA 2C2DA 1C1BB 1N6QA 2J6SA 1JLBB 1RT3B 1RT5B 4NLDA 3ISNC 1T05B 1J5OA 2R2UA 2UVUA 3FSIA 2UVRA 3LANA 1RA7A 4RW4B 3N6MA 3DRRB 1FKPA 3GV8B 2IA6A 3QGIA 4O3QA 4FS1A 3CDWA 2BE2B 3PVXA 3FDSA 4IRDA 1S6QB 5J2QB 4ICLA 4HKQA 4Q8FA 3QIPA 3BSOA 4TY8A 3BJYA 3BSNA 2ZD1A 3MECB 4IFYB 3GV7B 1IKYB 1T03A 4WFZA 5F8NA 1FK9A 4H4MB 3LP2A 2GIQA 1HMVA 4ECQA 4MIAA 4ID5B 3C6TB 2B6AA 4PWDA 3UQSA 4ZMMA 3KLHB 1TKTB 2BANB 4WZQA 4Y2CA 2WHOA 2YKMA 4EBEA 5KFTA 4ECUA 3PW5A 4F4YA 4KKOB 3E01A 2IM3A 5C24B 3TAMB 1DTQA 2IC3A 4URSA 2VA2A 3DMJB 3FFIA 3IGVA 3V6JA 2DPIA 4PUOB 2FLPA 1S1XB 4F4ZA 3PZPA 4XPCA 1SUQA 1C0UB 4QPXA 3N6LA 2YNHB 4R8UB 1HPZB 4OL8A 5KFIA 5KFWA 1REVB 4KAIA 2VG7B 5HBMA 1T3NA 1JXLA 2R2RA 5F8IA 2ZE2A 1GX5A 1SH2A 4RW6B 2ASDA 1S48A 3OHAA 4QWDA 4I2QB 3DRPA 1HNVA 3KK1A 3M9OB 3OL6A 3GIJA 4G3IA 1RTHB 2B5JA 3DLGA 4O4GA 1JLCA 3PW4A 3H5YA 1XR5A 1SV5B 5I42A 2RDJA 5J2PB 4O3RA 4J9MA 4TYBA 1C0TB 5KFOA 5T14A 3QGGA 1RA6A 1R0AA 2HMIB 5J1EA 2OPPB 4F50A 1ZTWA 2BRKA 4FBTA 1BQNA 5DGAA 3PW7A 3MR5A 3MR3A 3HVWA 3FRZA 4G1QA 4YMEA 2B43A 2OH2A 5EWEA 5JUMA 4Q0BB 1HYSA 4K4ZA 1TQLA 3DDKA 2D41A 5F8MA 1S0OA 4K4XA 1LW2A 3HVTB 1S9EA 1RT7B 1RAJA 4RW7A 2XCPA 3CJ5A 3UPFA 5KG6A 3H4BA 1MU2A 1VRUB 4J9OA 2RDIA 2FLLA 2YKNB 3T19A 1N5YA 2V9WA 4IG0A 3PJWA 2FJXA 4QWEA 3JYTA 4KSEB 5L1IA 1VRTB 2AX0A 1TKZB 2WONA 3BSCA 1S1VA 2RKIB 3CDEA 4O3NA 2XGQA 4NCGA 5KFHA 3M9MB 2W9AA 4GC7A 4NRTA 4KE5A 2R8JA 4ZPCA 2WRMA 3DYAA 5KG2A 4ECRA 3KLFA 1S0MA 1IKXA 3PR4A 4EYIB 4I7FA 1I6JA 1DLOA 1LWEB 4QW8A 5C25A 3SFUA 4QW9A 2GIRA 3KLGA 5L9XA 1FKOA 4LSLB 1HQEB 2E9TA 5DG7A 4NLRA 2YNFA 2ATLA 1MMLA 3MEGB 5EUHA 1TKXA 3QYYA 3IG1B 3NAIA 4TN2A 5KFQA 1RT1A 5DG8A 4KV8B 3MEEA 4XO0A 4F4WA 1EETA 3V6DA 2E9RX 1N48A 4WE1B 3V81B 3EPGA 1RYRA 4O4RA 3H2LA 4KBIA 2IAJA 3I0RB 4LQ3A 1LWCB 3QZ8A 4ED2A 2ALZA 1CSJA 1T94A 1TL3A 3CJ4A 1HNIA 3G6VA 5EDWA
chains in the Genus database with same CATH superfamily
4RW9A 2ZKUA 2OPQB 3QRQA 4R5PB 3C15A 3MEDB 2Y0SD 2HNDB 4F7VA 1S79A 2B4UA 3DOLB 4M5IA 2RF2B 2UUTA 2LXFA 1X0PA 3F56A 5J1NA 2W24A 4UOFA 1IXKA 4NWBA 4BCAA 5KT4A 4Q8EA 5KFZA 2BW7A 1UZHA 2CJYB 2OD4A 2GV1A 1O51A 3IXQA 3THPA 2PT0A 1Q1KA 5D4NA 4B08A 2XLJA 3TA0A 4AE5A 1A6LA 4IR1A 5F3ZA 1RBOB 2B9XA 2CZVC 2EW9A 5C42B 2ZNZA 4ZVTB 4LQ9A 3TEGA 4MKAA 4AYBD 1X4HA 1N4LA 2R42A 1EKSA 1JLAB 3ELHA 1N5QA 5DLGA 1KHVA 1UUJA 4AQYF 2ZVIA 1HW8A 2FC9A 2KM8C 2GVDA 2QN6B 1TKTA 2QJ3A 3NBPB 1AROP 2CVIA 2GZOA 4LR8A 1N0VC 3DHXA 2W4DA 2CYYA 4J9NA 2V1TA 3K0JA 3D0GE 3QWUA 4RNMA 5CYQB 4FN5A 1YZ6A 1FRMA 3K8WA 2ZH8A 3V6KA 3BGRB 3TR5A 1H3DA 1RWVB 2V6AA 4ZN1A 1S77D 3HHKA 2HZVA 4PCQA 3AB2B 4A8OA 1KHWA 1UWBA 3GYXB 5D0GA 2WSFC 1Q0NA 3DLKA 1QVGR 2XI3A 2MSSA 1XNRJ 5ETSA 1OQ6A 2HEKA 2QIFA 3WZ0A 1MMDA 1ULRA 1UKUA 4R8UA 3FRYA 4J9VA 3RBEA 1FRKA 3UVJB 3VQTA 4UQGA 4IO9Q 3LALA 4L6V3 1P8GA 5A6PA 2VHGA 1D1UA 1RJJA 4OLPA 2FJWA 3T1YJ 4Q5VA 4B3OA 2KJWA 2EC2A 4W4MA 2Y1IA 3ZZ0A 1NJIT 4JV5J 1N0UA 4YQWA 5HK4A 3KK1B 2HURA 1IM4A 3I5BA 4QIVA 2ASLA 4X84A 2YPZA 4WFBQ 2CQ2A 1X4EA 3CMQA 3EXCX 5KFDA 4ER8A 1IKYA 1UFWA 2CQHA 2KHDA 4Y28C 2AP6A 3MAAA 3Q8PB 1RTJA 3LP2B 2HK3A 1P1LA 3MPWA 3NNHA 4WP9A 1Y3JA 1DQ8A 2VBXA 2HWTA 3CJKB 2ZH3A 2GJFA 4OI1A 3OJUA 1CEZA 3WQPA 1WWHA 1ZA2B 2WVDA 1U0HA 3AD7C 2NZCA 3RUBL 2AYGA 1VQOS 3D66A 4JV5F 1NH7A 3BKTA 5CD4H 1W2IA 3NWGA 3P45B 2DNYA 2YWWA 4KHMA 3GFZA 3FK4A 4IDKB 1RYSA 2YKAA 3L95X 5J2NB 4KTQA 3OV7A 2VPWB 3M8WA 1EX8A 3R7NB 2BJ7A 4U7CA 1GTEA 1ACMB 5HP1A 4JI6F 3EJMA 1MNEA 5IT9Y 3LAKA 4RZRA 2OO4A 3PKMA 2F9DA 3I0SB 5K8OA 2IY5B 1Q81T 2EK1A 4ZIVA 1OSDA 1TELA 1FK9B 5CAAA 4H4MA 4DR2J 1HR0F 4G1PA 4DL5A 3UD5A 4OLOA 2VFSA 3SCLE 2FVRA 2HFUA 5F8JA 2BEFA 3GIMA 3MHYA 3RBXA 5H1SV 1GMWA 3MPDA 2HK2A 4NYOA 1S6QA 2OPSB 4OX9F 3RB4A 1Q95G 3AJDA 4U6PA 2ADBA 4YDXA 2HYIB 2YNIB 1WEYA 3CTRA 3ET6A 4JB8B 3UDLA 1U8WA 4Y3CA 3FFIB 1T95A 3W2WA 1NJYA 2HHHJ 1R3NA 3QPIA 3UN2A 3W62A 4YB1P 2B6AB 3GIKA 4QCLA 2QLFB 2V63A 3GLJA 2DGQA 4EO8A 1SUQB 4ZHRB 1S1TA 4DUYJ 2Z57B 1Q5YA 2XY6A 2XNQA 2F4VF 5IM0B 4Q0BA 5GAEU 2ROEA 4X4OA 2EVZA 1VR6A 1TP7A 2B4OA 1OYDA 2KXFA 3CNQP 3T41A 4CO1A 2O5DA 2VF3A 4C8YA 3U27A 1X31C 2FY8A 1RT7A 2W7PA 1N34J 2EFVA 2XSJB 4RW9B 1M5HA 2OP5A 3DRPB 1DFDA 1EP4A 2QSFA 3MEDA 4JV0A 1M90T 4NA1A 3RAMA 1YTYA 3TAPA 2HFVA 5A8RB 1GMVA 5AJ3J 1IJEB 2FHJD 5KG3A 3T6BA 1UPMB 3Q2SC 3HPOA 1TMJA 3EGVA 3O44A 2VQFF 2EG2A 4N7TA 5BYQA 5K8MA 5KAKA 4PWUA 2O1PA 2ZUAA 3KHLA 1FDAA 4KO0A 4TNOA 4K4TA 3A3PB 4QR2A 4OMFG 5B09A 2V2VA 2KRBA 4OHWA 3PACA 5KG5A 2Y9HA 1X0FA 5C2GA 2RAQA 1K44A 4F0MA 3ZZRA 5IV4A 4F3MA 1D9DA 4IOBA 3SQGB 1PAUB 2I2YA 3QJJA 4A47A 2ZD1B 3MTJA 4CI0B 4HHUA 3Q8YA 3GIIA 1TKXB 3BQ2A 1D9FA 1J2VA 2XYPB 5H9EK 2KJVA 2XMUA 4RU9A 4WCEQ 2HQIA 2AGQA 3A8KA 1X4AA 3HHLB 5DDPC 3PNIA 5CCMA 5KTQA 5CYMB 1K73T 2FLNA 1U09A 2WCXA 2BACA 4M8LA 1YJNS 3JTPA 3A8EA 4DR7F 3PHTA 4RX6A 5HVGA 4RW6A 4ED7A 3T1AA 1YSJA 2CG8A 3EZOA 3JTNA 4M5LA 4IH6A 1HNZF 1RAOA 3D4JA 2XC9A 3CE8A 3UDEA 4PRFA 1VCTA 4WIQA 1NHUA 2XZ2A 1R0CB 3OLAA 3FEXB 4F67A 3KHHA 2PA3A 1ZM2A 2MB0B 2VV5A 3AQPA 1H0HB 1VQYA 4CM0A 4GMKA 2PMWA 4YS2A 2ASYA 1WHXA 3H4DA 2EWHA 3M32A 1H6KX 1X5OA 4RNHA 4DL3A 4DUZJ 2PI5A 2KI2A 1VQ5S 1LWEA 3W5XA 4B3MJ 1VQPS 1HNXF 1ZH5A 3MF5A 4CLSA 3UN3A 4J37A 1HNZJ 1SH0A 2CA9A 3POTA 1GMWD 3ENVA 3BO4A 1TL3B 2AKWB 2C2KB 1V5VA 5I42B 4AQYJ 3AD9C 4DL7A 3SFGA 4Q7AA 5ETQA 4DSIA 2Z2YB 1NKBA 3L7PA 1YLXA 3GB0A 3UDVA 4LFAJ 3ENAA 2V69A 1FDDA 4URGA 3HZGA 2ILZA 3NCQA 5CYQA 4BC7A 3PRDA 4N76A 6FDRA 2UXCF 1KFDA 2H65B 1S76D 4U9RA 2KT2A 4TLQA 3FZBA 1UWBB 1T9TA 3E8OA 4CCHA 4YR0A 3BDPA 3M2RB 2XQCA 2W2MP 2C3MA 5GAEI 4ZPBA 2ZJPQ 1RKJA 3LOUA 1KKHA 2PGCA 4O3SA 2J0QD 1WC0A 3D3CJ 1SV5A 3PHEA 4DG1B 4X66F 4QYZK 2WSCC 1C0TA 4X65J 1XMOF 4I2PA 3OXFA 4CO4A 4NZ7A 2QA4S 4I67A 3K59A 5IT9U 2Z4PA 3I82A 3IS9A 5ETVA 2UUCF 2WVBA 4OZ3A 5DDOC 4ZPDA 2EPIA 2PSZA 2RRBA 1KVIA 4ZLLA 1S4FA 4YHHF 2XY5A 1UEUA 4PXBA 3SYZA 3PX6A 4PG5A 2OI2A 3W8GA 3ENWA 3HCXA 2W9BA 2EEYA 3MEGA 1GK8A 3RRKA 7FD1A 3SXLA 2R8GA 5LM7E 2BOPA 4DXLA 1UVIA 4IFVA 1YITS 1LW0B 2YKOA 2ZH2A 1XMOJ 1FKAF 3TUIC 2F8HA 1E6VB 1FO1A 3D6TB 4IKAA 4F26A 1HLWA 4WFYA 1U1QA 1FJCA 2LKZA 1U6BA 2ZDOA 5HQMA 2VL1A 1FRHA 1RT6A 2OHDA 4GVBB 1CULA 5KFNA 4PPDA 1S1WA 5A0YA 2OPRA 3O3LA 3MFIA 4JI5J 1Z4UA 3R8YA 2BXJA 1Q5VA 2P9GA 5EWGA 1FNXH 3GP9A 4JI0F 5L1JA 3G6XA 2QMXA 4ZVPB 2PEBA 2MZTA 3I0SA 4LSLA 3D54A 1KLNA 2LMIA 1RHUB 1BWVA 5J2PA 1I1GA 3KTQA 4P10A 4K59A 4DU7A 1BHNA 1T03B 1T9VA 2GQCA 1T11A 2NSBA 3IRXB 3NCRA 5KFLA 1HBUB 4RBUA 4I68A 2BJDA 3LF0A 3PDNA 4USVA 5DO2A 5GMKa 3CULA 2IIHA 5HROB 5F8LA 5D3GB 4GRSA 2HAFA 4IO1A 3W65A 2BM0A 3MR7A 5E5NA 4NLGA 1NPRA 1QE1A 1F5AA 5IWAJ 2UUAJ 2H5JB 3DI6B 4FNIA 3G2XA 3IBWA 3OSPA 2AGOA 2EC0A 4OI2A 3G96A 2RUGA 1HHQA 3GPAA 3HHLA 3KOAA 5ADZA 1NK9A 1I94F 3ZZUA 2XS7A 3TI0A 1VQ4S 2LDIA 1ZAWA 1U48A 2R4FA 4DBQA 3QIDA 1EB0A 4CO2A 1UFLA 3VQSA 1SJ4P 4M5MA 4W98A 2WW4A 1S9FA 4FF2A 5KFGA 5HQLA 2BX6A 2NPFA 1FRIA 2F8EX 3CD0A 4OHZA 5IWAF 1RHMB 2CQIA 4FP9A 4PG6A 3WHIA 4F04B 4AL6A 2AJ1A 2JVOA 4JI4J 2PN6A 2UUBJ 4ELTA 4TY9A 1JLQB 1G2EA 1L3SA 1BE4A 2RRNA 2VG5A 1I51B 1JLAA 1RAAB 3NGRA 4R0JA 1MROA 4GKJJ 3TJ8A 2K2PA 2HRTA 3IR7B 4D3GA 1AYEA 1CG2A 4ZPTR 3ZNUA 3SDEA 3GIRA 3H7HB 3UWTA 1URRA 4NOHA 1TKDA 4LF8J 2W9CA 4DV4J 1JKHB 1VFJA 4A8YA 1RQ0A 2C28A 2JEJA 4MK7A 4O3PA 5CHCB 2P5VA 5KFBA 3GMGA 2HVIA 2Q79A 1F9FA 1HWIA 1YK9A 3HHLC 4DQQA 3ZO7A 1U49A 1JB0C 2GHWA 2HAIA 3AH6A 1SC4B 2IYIA 4I6AA 2VONA 1CLFA 4ED1A 1MG7A 5J2NA 4MK8A 2G0CA 1YVFA 1YWXA 2W01A 3DFEA 5G0RB 3RYLA 3H40A 3V4IB 2J5AA 2XI2A 4RW8B 1EAYC 1BUXA 3B8HA 5EHHA 4X4PA 2LU2A 2QGFB 4WIIA 2C2DA 2KFYA 2E66A 4NEZA 1LNQA 4DZ6A 3UVJA 3FCWA 3OUYB 3ISNC 1J5OA 2CQ3A 1CJKB 5AE1A 2UVRA 1U02A 4GKKJ 1Y5IB 3OVBA 1RA7A 4H4KA 4DV3J 1ZM4A 3N6MA 3DU5A 3DRRB 1CQMA 1FKPA 4KGZB 2VJUA 2D3OR 5D15A 2IA6A 1C4CA 2W4CA 4XAKA 2GHVC 4FS1A 1Q7LB 1TK5A 1U4BA 4F2RA 4IOAQ 2CDQA 1RADB 3NGSA 4LF6F 3QIPA 3J81U 1S6UA 1CVJA 3BSNA 4IFYB 1FVQA 2F3JA 1IKYB 3TA1A 4DSEA 4P75A 4QQBA 2N3LA 5IFMA 3CDAA 2GIQA 2MLXA 2HVHA 1HBOB 2B6AA 2BKOA 3C6TB 4RBVA 4WK1A 3CJKA 5LMUJ 2AJ0A 2DXEA 3FJ2A 4PWDA 3G8QA 3BO3A 1WC6A 2RS8A 1U0SA 3IP0A 1ZM9A 3R9LA 3PW5A 3N0VA 2VKZG 4KKOB 3U1MA 2IM3A 1IWAA 1SXLA 2F63A 2EFQA 1EARA 1FERA 1SQGA 2ATCB 4URSA 4YEAA 4BWMA 2VA2A 4U96A 3IGVA 4PUOB 3JB9k 1VQMS 1IBKJ 2B8QA 2FLPA 2J8SA 2ZBCA 4WPAA 4ILLA 3VAMA 1B0PA 4AXIA 4QPXA 1Q86T 2UXCJ 4LF7F 4OL8A 2G2YA 1HIYA 2BJEA 3LA0A 5KFIA 2VC1A 4ZITA 1NSKL 2DY1A 3TZWA 4HT5A 5E0OA 5HBMA 3A3OB 1T3NA 2KN4A 2MEWA 3LW5C 4DR5J 1YI2S 1GX5A 5CXTA 4DQIA 1S48A 3CC2S 2JOQA 3DU6A 3BBCA 4QWDA 5A0YB 1B7FA 1OYEA 3G82B 3OL6A 3BGUA 2R7TA 2C42A 1WI8A 4UW2A 2V5HG 2VDIA 1JLCA 1WEXA 1SV5B 1NH8A 5B0EA 3KYLA 2G0JA 2B56A 2ZDPA 4YOEA 3I6PA 5J2PB 1RAIB 2ZH9A 4J9MA 1C0TB 5D4LA 1SL2A 4YY3J 5J1EA 4KRWA 1LQ9A 3K7RA 1SC1B 3TANA 4NA3A 3CB4A 3PW7A 4FBTA 1TL4A 4I6WA 1UL3A 3D6FB 3FRZA 3BPDA 5EWEA 4P73A 4Q0BB 4OZLA 2KT3A 3IFEA 3NMRA 1NB7A 2IFXA 1S0OA 2BDPA 3FEYB 5GAGI 1PYSB 2JFKA 3HVTB 5A2QU 4X62F 1QTMA 2V50A 3TARA 2Z8QA 4C0OC 1S59A 8AT1B 2WVEA 3OFEA 4DSFA 2DCUB 2QTWA 2JH3A 4ZVUB 5THWA 4ZVRB 4DN9A 3D0HE 2N3OA 3T19A 4CWBA 3M2VA 4EZ9A 2MZ1A 1R43A 5A8RA 4QWEA 1QY7A 2VC0A 1KQKA 5L1IA 2HZAA 1KTQA 5GVQA 5C7PA 4DFKA 1QSYA 4P72A 3M9MB 3CDEA 2RKIB 4FF1A 1RP5A 3BO2A 2W9AA 3L7UA 4Q2MA 3M7VA 2DHAA 4NRTA 2F1FA 1XIQA 4KE5A 3OTEA 7AT1B 4ZPCA 2JHEA 2J76E 3D1HA 4A4JA 4F4AA 5ITHA 1IKXA 5KG2A 4ECRA 1I6JA 1LWEB 1DQ9A 3PM9A 4QW8A 4QW9A 2HGLA 3CEDA 1DHMA 2FJAB 4QR1A 1SIWB 3J7YI 3PXGa 3HULA 1AT1B 5F41A 2H4WB 3Q0AA 4PAAA 1MROB 1TKXA 4KPYA 4LFCF 2FHKA 3H0PA 5DG8A 2OMOA 1OPZA 4Y2KA 4DPYA 3RW6A 5T7LB 3ZZOA 3F73A 3V6DA 2E9RX 4I4BA 1N48A 5I3UA 2DY9A 1SC6A 4FF3A 1WKKA 4YB5A 5I3QA 3DHWC 2DHHA 3P5BP 4O4RA 3H2LA 3M6XA 2L9DA 3UR3C 2DH8A 3Q83A 3QZ8A 3NNCA 1CSJA 1T94A 5HO4A 3CJ4A 3DXBA 1NU4A 2FGCA 3FSXA 4C8MA 2RS2A 5IOLA 2XO7A 1HD0A 2JC0A 3OTCA 4WXWA 3V4IA 3GCXP 3PY8A 1RT2A 4LJMA 3C16A 4H4OB 4BBYA 2IYGA 4DCPB 4ZK7M 4LF9J 5JVHQ 2BYCA 2HBZB 2OAUA 1WHWA 3KJQB 2M52A 4OYBA 1HBMB 4OQJA 3IAM9 4M5DA 2XZDB 1QAXA 1VK3A 3LUYA 3R27A 3CF5Q 1J5OB 2X1BA 5KOXA 2CPYA 4B17A 2RNEA 3GFYA 2E9ZA 4DQRA 1LWFA 3JAMU 4B9LA 3WC2A 2WK4A 1S57A 1N34F 4DPUA 3IS9B 3EGNA 2O67A 2XMMA 4RWWA 2WOMB 3NP5A 4ETXA 4DLGA 4FS2A 4KYZA 4DZDA 5AXMA 5JJBA 4DV2J 4ECSA 1KLMA 1FJ7A 3HHDA 2I6WA 4ES3A 3RB0A 3BQ0A 1GX6A 1FJEB 1X4GA 4DL4A 3IR5B 2VG6B 5KFJA 1SI9A 4C8OA 4MFBB 5BYSA 4IFVB 1N32F 4CNZA 2GAGC 4TXSA 2WBRA 3CJ3A 3GSIA 1S49A 3PX4A 3EVWA 1SB6A 2XMWA 4UY85 4PWWA 5DJBA 3BPSP 3MFHA 5KFXA 2AQ4A 4DR2F 1MSWD 3RTVA 3I31A 3H5UA 2E1PA 2V4JB 3EVMA 1IKWA 3KK3B 1YJ9S 4PZVA 1SL0A 2JWNA 3HVAA 4C11A 1VIOA 4P9SA 1IBLJ 1VJWA 1Q16B 1UAWA 2I0XA 2A2CA 5DQHA 1YJRA 3JQKA 5BR8J 2H54B 3DC2A 5FLXY 3DOMB 1QAJA 4XTTA 3U1NA 3W1YC 3QT7A 3CO9A 3M30A 4USTA 1TK0A 2E5IA 5HBMB 3MAQA 4DI6A 1N8RT 1VQ8S 4A8SA 3EYZA 3LPEA 2UXBF 4UT4A 1RBLA 3EMTA 1FT8A 2QV6A 4IYQA 4M5KA 3AOBA 4CTAB 4TLRA 4FVMA 2HS4A 3MR6A 4X64F 4ZCKA 1QM9A 4JUZA 2MXYA 1Q7YT 4RBTA 2YH0A 2XTCA 2XTEA 3W5ZA 1K8AT 4J7CA 1S0NA 2F8MA 3DI6A 5F8HA 1VBKA 2OPPA 2HPUA 3PJ9A 3SSSA 3P6YC 3H90A 1XR6A 3UO0A 4Q44A 3KJVB 3TQ1A 3J7YU 2MZRA 2ZH1A 4LIRA 1JK9B 2J9CA 3LH2S 1JLBA 4OJ3A 4P7TA 3PTWA 3CDBA 4X4UA 3NRBA 4FXDA 2YNGA 2NR0A 3FBEA 4GVBA 4MH8A 1NPPA 4UUWA 3Q8QB 2R8KA 1EJ7L 1ITPA 2BOAA 2HNZB 4PUOA 4ECWA 4HH0A 2LYVA 1RLDA 2OPRB 5B0CA 3QGHA 5HLFB 1YKWA 3DLEB 2LXUA 1ICEB 2MJNA 4DCJB 3EZ5A 5KFEA 3BSAA 3PO4A 4K4VA 1JLFA 2A1BA 1GNKA 2A6OA 2VG5B 1XR7A 2LU1A 4JI4F 1RLCL 2M0GB 3ISND 3MCSA 4HACA 5E7OB 1YJTA 2BW2A 4B9UA 2XMVA 3KDOA 4JYAF 2DJWA 2MYFA 4PG7A 4C0BA 2ILYA 4JI1J 4GKJF 4KHRA 1XQIA 1AA1B 5HMYA 2HIQA 4DV7J 1HWUA 4Y2AA 2DNPA 1RGVA 1VHIA 5DQIA 1VLYA 4CYUB 4LF8F 1JLCB 1B3TA 1AUSL 2KRRA 5K14A 2QA4G 3M4XA 4HEA9 4DR7J 4LFBJ 2C3PA 3LWMA 1ZPVA 5G0RA 4DF4A 2ZBQA 4JYAJ 5L1KA 5ETNA 2HNYB 1KR4A 2L08A 1XN9A 3M8ZA 4FPRA 4QZVB 3HP6A 2KH9A 3IBFB 4JI2F 1TK8A 4KH0B 4W90B 3AA9A 1I94J 1GQEA 2J0WA 3DM2A 4N47A 1V6HA 2MSTA 2O3DA 2CDRB 2OSQA 1K1SA 4RNOA 2DVIA 3NNAA 3DRRA 3S7RA 3OTOJ 3FMWA 2HQ3A 4WZMA 2DHSA 3C15B 4IH7A 1U1LA 2J6TA 2DCLA 2DR7A 3QATA 1IBMJ 1RXOB 4O4GB 1HPZA 3H20A 4IFYA 1XNQJ 3SEOA 1VHFA 3UE2A 1UEVA 2A18A 4DMZA 5A8KB 5E3CA 4LF6J 1JNZB 1BWEA 2QL9B 4OX8A 2BUNA 3M8QB 2DR6A 1U2RA 4M5GA 3CCVS 2L48A 1M5SA 2Q43A 2J9EA 5AXLA 3KK2B 2IVYA 1OM2A 4DR6F 2VUGA 4DV1F 4EMDA 2M8DB 1HYSB 1G3OA 2FGOA 1SJRA 1T9UA 2NXCA 1M1KT 1WORA 2YPYA 1PAEX 2GFFA 1H7XA 2YNFB 3PIOQ 2YKQA 3MAHA 3R5BA 2V2ZA 2ZBPA 4USMA 1APSA 4JP8A 2B9WA 1R0AB 4TVAB 3CJSA 2QL7B 2VG6A 2HMIA 3ONQA 4PQAA 4KV8A 4MKYA 2DNLA 3O1LA 2X3GA 3HD1A 1NDLA 5GMEA 2YNHA 4USWA 3VHQA 1BXNA 3MD3A 3Q8VA 1N6QB 2FZCB 3BH6B 1NB2A 2E7XA 4DR6J 1T0TV 1RCXB 2ZWPA 1L3KA 3OXLA 2M3DA 2ZBRA 3ZZYA 2DT9A 1NZAA 1U2FA 3ISZA 3HSDA 1N32J 1CJVB 1MU2B 1S4EA 3RAQA 1X4FA 2XWYA 3CGIA 3G82A 1KBRA 4IG0B 3W9HA 3G6YA 4ED8A 3T1HF 4M5DB 2PD1A 3OR1B 1CJUA 1FHTA 4ZPAA 1JMTA 2IBKA 4K4UA 2DNKA 4YP3A 1AXQA 3N01A 2KZMA 2J7WA 2AU0A 4YR2A 3C8YA 9RUBA 1WELA 3DCAA 1FEEA 3K2YA 3NOGA 4EBCA 1DBDA 2JEGA 3KNAA 4DQPA 3BYRA 2BABA 4PWDB 1DZ5A 4A8FA 3V81A 2H5EA 1RT4B 2FD2A 2IAJB 2IVMA 2NREA 4QR0A 3DXSX 4GO7X 4DEZA 1VC6A 2MY8A 1NDKA 2KU7A 2VZ9A 3KHGA 4C8LA 2LQBA 1RWKB 1GT8A 4WF9Q 1IUJA 3FSYA 4Y2IA 3H98A 3DOLA 4L3KA 2G0IA 2VH7A 3SSQA 1V9OA 2XY7A 4CNYA 4WE1A 4JI3F 2Y3YA 5ETTA 4X64J 1AZSB 3DKDA 1W26A 5SZTA 2V8DA 1LW2B 2D74B 4IR9A 2UUCJ 1RWNB 4IDKA 4ZVGA 3UFCX 1Z2LA 1PYOB 3NKYA 3FQLA 2CXEA 4ICLB 1NJXA 3X3UA 3ICLA 4Y6IA 4JI5F 4DU8A 4F0KA 3K5PA 1FD8A 3MUTP 4A46A 3A8JA 1UVLA 4R0EA 2P6SA 5JMNA 1YDLA 2HHXA 3WIUA 2HKEA 3NS5A 5J1EB 1WDTA 3BGLA 4F0HA 3T5LA 1OY6A 2ALYB 4QU7A 5T7LA 2MQLA 2Q6CA 2AJQA 2E1CA 1S9GA 4NXNJ 3UR0A 3HI9A 4HT7A 5CCLA 2DR5A 3ZZPA 2AHOB 1Q8BA 4JV2A 1WOPA 2LVWA 4K4YA 2U2FA 3H25A 4DS5A 2NUUG 2RQ4A 3MM8B 2RB7A 2BR0A 3TZYA 2RDDA 3IG1A 1PBUA 1HWJA 3TUJC 2ZH7A 1S1XA 2ZVSA 3C16B 4RUCA 2HNDA 4LUBA 3MMBA 4J90A 2AYMA 1MN7A 4ZHRA 4C7QA 3KJVA 1RWPB 1X60A 1R8PA 1YRUA 2LDYA 1HA1A 2RQKA 2Z58B 3M8PB 3R5GA 4PABA 5CZVA 3MD1A 3PFOA 2HGNA 3QAEA 4ZCLA 1TKZA 4DOZA 4N5SA 4A8QA 3QSYB 2DPJA 4LF9F 5IQ6A 1E6YB 2P9CA 1K9MT 2V34A 4ALZA 1O6XA 3CWJA 1GXTA 2G2ZA 1VYAA 3J80U 2ZC3A 4ECTA 3RR8A 3T5KA 2CFXA 3BN4A 2ZITA 3VAHA 3BZQA 4PYDA 3VWSA 2KVIA 1J27A 3LP0A 1XMQF 3AX2A 1NZ8A 1RTHA 1TL7A 1X5SA 2RJZA 4NLOA 2VFTA 4I6YA 1HWKA 1ZPWX 1RK8A 4WU3A 3ZZTA 4DR4F 1UZDA 2MKCA 1FTCA 4CH0S 1A0OB 1GMUA 4RKUC 2ZWOA 4C98A 1K0VA 2V67A 4Y00A 4X2BA 4HACB 4ID8A 1RISA 3UW1A 5DDQC 3M8QA 1U8SA 4C9DA 1RTDB 5KOWA 3ETOA 3OT9A 2GVDB 3KK2A 3RRGA 1IQTA 2UUBF 3OFFA 5IC4B 3OJSA 2Q3PA 3Q8SB 3N6NA 1ZTTA 1XERA 2DO0A 2NXNA 4IUFA 3DNCA 2AJ4A 4M1KA 5KFRA 4CYUA 1TFYA 3MM9B 1XNQF 1YX2A 1B4SA 1C4AA 2QMUB 1PYTA 3CVKA 3NGUA 4LF2A 5K14B 4DV0F 2FC8A 3DLLQ 2WBMA 1RT2B 5M2PA 1RE1B 2YKNA 1C1CA 1EKRA 2HRYA 2VQEJ 2HNYA 1ZETA 4J9LA 3NBPA 1CC8A 2ZJRQ 2OD6A 4DV1J 3C46A 3JQJA 2JRSA 3DM2B 3KJFB 4NCGB 3CJ0A 2N4CA 3Q86A 2OFGX 1CC7A 2UV8G 2FVPA 3OQ2A 4DL0C 1RHKB 4DF8A 1FXLA 1KNZA 2BZ2A 4MIWA 2GCFA 3A4TA 3TO8A 3MR2A 3DLKB 4ZKAA 1L3VA 1VK8A 4USUA 2P6TA 5KG7A 2OGUA 4OYXA 4A8WA 3GJTB 3BBFA 4OHVA 3JAMY 2DNQA 4Z37A 4F3OA 1VQ6S 1KLMB 4C8ZA 2C3YA 3HMJG 3N79A 1HNWJ 4H54A 2UUWA 4QIFA 4KB7A 3FCHA 1H73A 5HMZA 1UJ6A 2ZJQQ 2I5JB 5D0EA 5T41A 3OD2A 1D0EA 4EEYA 5D4OA 2E1AA 3C14B 5KFYA 2XS2A 2DIVA 5BR8F 1KN6A 2DHGA 3OLBA 3QRRA 3HK2A 1LWCA 3D1QA 3VVTA 1F6TA 4ECVA 3DLBA 4DFJA 2V4JA 1FFWB 3BKFA 2MLYA 4Q2LA 3TJAA 3UD4P 4U95A 5D77A 1HQ2A 1FA0A 2VKRA 3L9ZA 4C6AA 3OTBA 5J2MA 1S72S 4ZN3A 4KJIA 5L1LA 3CIZA 5GAGU 1UETA 4OZNA 4NXMJ 2IM0A 1U6FA 3H2UB 3PW2A 1IBKF 2EKYA 3DOKB 3BV8A 5FDLA 2N7CA 1P6TA 3C6UA 4KY3A 1Y5LB 5A2QY 2G4BA 1RT3B 1HFEL 1T05B 4KQZA 2XMTA 1YHQS 2UVUA 2DGXA 3FSIA 1NSAA 1ZBTA 2Z30B 1U1MA 1T7PA 2GMLA 1UWAA 3R3TA 4NCBA 4DR5F 2GVZB 2NPIA 3QGIA 3JQMA 2BE2B 5LSRA 3UNGC 3D2WA 3PVXA 1S6QB 1WF0A 3QNWB 4ICLA 2CWKA 4HKQA 3JSYA 1PSDA 3Q24A 4Q8FA 2K1RA 3BJYA 2BKNA 3MECB 4FDFA 4RWXA 1QSLA 1DJ0A 4QPTA 5HN0A 4LF1A 4KPCA 4H4MB 2QZ8A 2B8PA 1RAEB 3M2UB 2F4FA 3BEGB 2RU3A 2QL5B 2B7BB 4ECUA 2WHOA 5D0RA 5KFTA 8RUCA 3IRWP 1UVJA 4F4YA 1DQAA 2XS5A 4AUKA 1FTRA 2CNKB 2CJ9A 2NYIA 1XJWB 3B4DA 1U1PA 1DTQA 1KQGB 4TU8A 2BJ8A 3DMJB 5IS2A 2FYXA 2VIHA 3R1HA 3M6WA 3HSJA 2MQPA 4AFFA 2HS3A 4L72B 4F4ZA 3A12A 2DRAA 4XPCA 2MKHA 1Q8IA 4A8KA 3RGIA 2J0SD 1ZZNA 4QU6A 3BS9A 4FYYB 3BBBA 3D6HB 1TZ0A 1R6YA 1F3VA 3V5RA 3HSZA 3AB4B 5KFWA 2ZC4A 3MZIA 2N4DA 1IBMF 2YWEA 2R2RA 1BC6A 3BN7A 1KTVA 4JBCA 2N7YA 2ASDA 1DARA 4C48A 3R97A 1R89A 2X7IA 2AZ3A 3DRPA 5D78A 1JJHA 2H3EB 3CCMS 1YZ7A 1OQ3A 2LCWA 2J0XA 4M5HA 4PR6A 3POTB 2D1CA 4CT9A 2BJ3A 2PA8D 3H5YA 2GQ2A 1CQNA 3K89A 3NY0A 5I42A 2HQGA 4ILRA 2QA1A 4NMXA 2R7VA 5ETOA 4DSJA 2R7OA 1R0AA 2HMIB 2M5YA 1ZTWA 5K9FA 2BRKA 4X4RA 3MR3A 2FZGB 3HVWA 2OH2A 2R9LA 1CS4B 2AEJA 5JUMA 2BVZA 1MWQA 2D9OA 4JI8J 2H51B 3MWBA 1RU1A 2FHJA 1DURA 4K4XA 1F1BB 2DGOA 1SKUB 1WF2A 2A0FB 4RW7A 7FDRA 2AEMA 4ZJQA 3U02A 5KG6A 4FXWA 3NGKA 2EFPA 2HBRB 1MU2A 1OWXA 2E7WA 2GW8A 4I0WA 2YKNB 2FLLA 1P1TA 3MMBB 2EBGA 2XTJP 4IH5A 4ZPWR 5E3PA 2FDNA 4ILMA 4B3RJ 1WG4A 2XZTB 2PEHA 1TKZB 3BSCA 2QRRA 3MCOA 4NCGA 3JTOA 1E6YA 4OJGA 4OZ1A 4DV3F 2B7CB 2V68A 5DDRC 2WRMA 1U6ZA 1R31A 3BF4A 4B02A 4EYIB 4I7FA 3TRGA 1XK8A 3TX0A 2G2OA 5B0AA 2AW0A 2R7QA 3AHPA 3WC0A 3KLGA 2JL9A 4ZS6A 1FKOA 5HMWA 4UTGA 4KH1B 5B0BA 4OX6A 2YNFA 4CZCA 3MCNA 2R8JA 1WSRA 3MMAB 1UTAA 1VS3A 3FMBA 2H1YA 5EUHA 1VQ7S 1NEEA 3QYYA 5LSLA 2G1DA 4TN2A 3NEKA 4YFUA 1N54B 4F4WA 4KV8B 4Y2MA 1YBAA 1Q8LA 1U1OA 2CJKA 4DSLA 3CCLS 2ZNYA 2E5HA 1FRXA 3C14A 3CCWA 1WI6A 2IRYA 2MKSA 3R5DA 2VDHA 3KUEA 4KBIA 1LWCB 2OFHX 5L38A 4ED2A 2ALZA 3HT0A 2KFZA 2GJ2A 3ZNJ1 1TL3A 5M2UA 1NJZA 1LWXA 1OJ4A 2YX4A 1CULB 3VZIA 2XNRA 2CQ4A 1NUEA 2CAJA 2RSQA 3CCES 2E5LJ 2FJVA 4FYDA 1HNXJ 2NLWA 2DH7A 2AX1A 3DOKA 3CCQS 3TYTA 4JI6J 2HG4A 3NCPA 2V9KA 5JVGQ 2LQ9A 4KIAA 4ZCIA 4V19J 4RNNA 3R6LB 1N5VA 4NLYA 2A2DA 3US5A 4MKBA 1ZOTA 1DTTB 1QAYA 3G86A 3PRBA 4LF4J 3BR9A 3C19A 2CPHA 2G1HA 3MEKA 2QMWA 5E3AA 5DZ7A 1H98A 2GVZA 5LT5A 2CRLA 3UI3A 2VPXB 4KFBA 4C0HA 3BYPA 3GE9A 1P9QC 3I5CA 1KVKA 4JOUA 3OL9A 4XIUA 3DDNA 3HSGA 3J7ZT 3HVRA 2OEMA 3SIPB 4IQXA 3EVOA 4P7VA 2BKPA 4O44A 2FHMA 3OVAA 4TQSA 1D09B 2KYZA 2VFVA 1P27B 2DEIA 2OMLA 5CD4A 3HO1A 4NLTA 3KUHA 1PCAA 4L74A 3M8PA 4DCOB 1JLGB 2CQBA 4J5OA 4NXMF 2KYXA 1EZZB 3B6BA 4HHJA 4KKOA 3TA2A 2EK6A 3IN5A 2LFVA 1HQUA 1WHVA 2HGMA 3CJQA 5J2MB 3NL0A 5I3PA 1SIZA 4V19X 5KG1A 2HFZA 1G4CA 1HKAA 1F9HA 2K7KA 3LP0B 2R3VA 2BE9B 4ELUA 3R2DJ 1FWPA 2CNLB 2CPDA 4WFNQ 4P2MA 4E2FB 2RQMA 1RT5A 1WKLA 2YWFA 5GAHU 3VAIA 1T05A 4OHYA 3W2VA 4QBUA 4ED0A 1NKEA 4CO5A 2AYBA 2VU5A 4NLXA 3CDUA 2WZ1A 3T9ZA 4ZCMA 5BJRA 3QT6A 3CCSS 1KOHA 1U45A 4K4SA 3A3NB 2IMOA 5JXSA 3MOZA 1H2UX 4WP3A 1H38A 1HBUA 1Q4RA 3MDFA 1F2HA 4CM2A 1YRXA 5HROA 2K1RB 2ZZMA 1U1KA 3GU0A 3QLHB 1TVRB 3L09A 3KMSA 1B0TA 3MM9A 3NS6A 5LSOA 2C22A 3G4SS 4RNFA 5DGBA 2R7SA 3BR8A 2WSEC 1C2PA 1HMVB 4ZLJA 3AX5A 2DHXA 5DM6Q 2KXNB 3VV2B 4LRFA 1L3TA 1Y4ZB 4LFBF 1YBTA 4MT1A 1EQMA 3CJ8A 2AD9A 2JEIA 4CH1A 2HFSA 1P9YA 4FKYA 2EFGA 3W66A 3KG0A 2ACYA 2CNNB 3NOCA 3MPUB 3KLIA 1V5IB 5DZ6A 2QFIA 3QGPA 2DXDA 2EFNA 1Y00A 1FXDA 1NCLA 2KVQE 2P8IA 2L9WA 2FB0A 4RW4A 5F0WA 4AD6A 4TKTA 3HDSA 2M88A 2BQUA 4IG3A 5IT0A 4LIWA 4OYPA 3MM6B 4NLSA 4LVNP 2HWHA 4RLEA 2AGPA 1SQEA 3G9CA 3MGJA 1FXRA 1RWWB 3QIPB 1PJ6A 5LXRA 2BQ3A 1N52B 3WX4A 3GR0A 4CLFA 1LXJA 3EDRB 1URNA 3P49B 4O23A 5C5JA 3SMZA 2AJ2A 4ANCA 5SUHA 3IWNC 3T5JA 3IWLA 1BQXA 3HKZD 3EWGA 2VJVA 2BJ9A 3DGPA 3AA8A 1N5TA 3AQOA 3BDEA 4WKYA 2PFFB 3OHBA 3BGOP 2C1EB 4ZVEA 1FKOB 2IBOA 2PI4A 3IO1A 1WKJA 3GYGA 1B99A 3OFGA 4MMOA 1F3FA 4YDDB 2ZH4A 3RBDA 3FBBA 2MHEA 4P71A 2JZ5A 2DEJA 3BB5A 3MMJA 2BE7D 2HS0A 3D0IE 3PJXA 4USKA 1A9NB 1LKZA 2NXJA 4P74A 4DR3F 5FDLB 3KJNB 4MJKA 2I38A 4B9SA 2CZ9A 2XG8A 3VGSA 3I9ZA 4J9KA 2R7UA 3H2VE 4EO6A 2DNGA 5A8WA 1SKSA 3LQVA 2QLXA 5ETMA 1VMBA 4HTJA 3CCJS 4ATNA 3RAXA 1NM2A 5B0FA 4RW7B 2IMWP 1FKPB 2I1RA 1BY9A 1NHKL 2POKA 3EGZA 4RO0A 2AZ1A 4MK9A 2R8HA 2VASA 1JXEA 2F40A 1C0UA 1I3OB 1MWZA 3T9NA 3PYFA 4U7UK 4X4VA 4TQRA 3CJ2A 1NK0A 1C1BA 3MECA 3PCOB 1VRTA 3A13A 5ETPA 1M5VC 2OEJA 3MI7X 4GVLA 3N9UC 5LMNJ 3L4BC 2VA3A 2RRAA 3LGMA 3HJVA 2UXBJ 3ADAC 4RUHA 1N6QA 4ZVFA 1W7WA 3KLEB 1HNWF 1ZAXA 1VDHA 4I2QA 4J91A 3L3CA 3D5MA 2XGPA 2FZKB 4ES1A 1F2GA 5KFAA 2MQQA 1CJTB 2K06A 2DK2A 3H8YA 2CKWA 3QO9B 4O44B 2PC6A 4OZ5A 4M5JA 5F3TA 4DDFA 4ID5A 1Q78A 1TMMA 3VALA 1L3UA 1S0VA 1LEOA 3LP1A 1R8HA 4NEYA 5F9LA 2F4VJ 2FHOB 2GS8A 4X66J 2B9EA 1WEZA 4M94A 3CJRA 4OJHA 1LFPA 4TU7A 2RKIA 1VQLS 1SC3B 2Y8YA 2MLZA 1YG0A 4F4XA 2B51A 3M6UA 1SKWA 1VRQC 4X4QA 3K8VA 1KWMA 1TL5A 3CJTA 1R6VA 3FQKA 3NLCA 5D6GA 4TU9A 2ZHAA 5ETRA 2LECA 1W25A 2C2ZB 2DGUA 4KGKA 4EWTA 4GC6A 2CQCA 4Y34A 2B3TB 2DGTA 3FBCA 1PGZA 2XZWA 1PIEA 1O8BA 1Y5NB 1VBYA 1VQSA 3R5JB 1KRPA 3KLVA 3FCVA 1WNEA 1RHJB 2DNHA 2VG7A 3MMCA 1VJQA 3LWLA 1JIHA 3AX3A 2CPZA 4DV7F 2M9KA 1REGX 2FJDB 5HSPA 3SV3A 4BWJA 4A8XA 4RU2A 2CJAA 1DLOB 1TU0B 2HWIA 3AXKA 3GQCA 3V4MA 4LSZB 2W8LA 3EX7B 2BQRA 1PILA 3I0RA 2CJBA 1Y0HA 3TZXA 4ED3A 3DLGB 4NXNF 1AFIA 3QT5A 3FZ2A 2M8HA 3DMJA 3PW0A 1T02A 4EFAC 1TUVA 2AT1B 4ZPVR 3MOJB 4QYZJ 2OPQA 1RT1B 3R7BB 4FYVB 3C66A 2X1AA 2J6UA 3VAJA 1K47A 1X5PA 3M2VB 3TZZA 2D9PA 4HL9A 4CP5A 5KFKA 1Q82T 1JQGA 2BJ1A 3L7OA 3TP2A 4OV1A 3OFHA 3HVTA 4CLUA 1CBKA 2HNZA 4ZVHA 1I5OB 4K50A 3P96A 1AUDA 4URQU 1BQMA 5J2QA 4Q43A 4DSKA 5AJ3F 4RJVA 2L41A 2CJQA 3M8SA 3KWMA 2CJXB 4K5SA 3TX8A 5DM7Q 3W3SA 1JLFB 2D69A 1F0XA 2M7SA 2QO3A 2IHR1 3ITHB 3NS7B 3FVYA 1NHVA 1S1VB 1FVSA 2APOA 2J7KA 2MPUA 3HKWA 1N36J 4AL5A 3GFHA 4PEOA 4ED6A 2FIUA 3DYAB 4EBDA 5IQQA 1MW7A 4UZBA 1Y3KA 2W7AA 3BQ1A 5ETLA 2MZJA 1AFJA 3BREA 1EHWA 1U26A 1N5SA 2CQPA 1PBAA 3MM5B 2MKKA 4DL6A 1HQEA 2N82B 3T5HA 2D3ZA 3J81Y 1IM6A 3NGTA 3JSMA 4WK3A 4JI8F 5L46A 1OSCA 3T1YF 1RTZA 4WU2A 1S12A 3V6DB 4DR4J 1NK8A 4XDDA 1TAUA 2AYEA 1GXUA 3M05A 3ZXWA 1VQ9S 1NDPA 2WONB 1B70B 3TNVA 3KLIB 3M30B 3I56S 4DUZF 1GXLA 2FQQB 3DN9A 4G65A 4ENOA 4ECYA 3UD3P 2QX0A 2V8VA 2ZE2B 1HHTP 3CMES 2QLWA 4OYZA 2XB2D 4QYRA 5CYJA 1RTDA 2E5GA 1HNVB 2WVCA 1RKIA 1S99A 4H4OA 5I4MA 4HI2A 3TVKA 3CD7A 3GWCA 2RIJA 1GFWB 2QEXS 2RUSA 4DX6A 3QWPA 1Z1ZA 2ZOGA 9ATCB 1RSCA 4J9PA 1NKCA 3MAAB 5HJYA 1LOUA 2A10A 2J9DA 2KG0A 3K5MA 2E44A 2HHPA 3PV8A 3ZTPA 2XLIA 4LMZA 2KKHA 2XMJA 4ZVQB 3KLEA 1QVFR 3B78A 1HARA 2DD8S 2AV5A 3ILIA 4G1QB 3I32A 3SV4A 5AT1B 2JSXA 4P52A 1XC9A 2FVCA 4G3IA 1GH8A 1UVNA 3W64A 3B82A 4WYLA 1B0VA 1S1UB 3KG1A 5L39A 1HQUB 3AXMA 2G13A 2W7OA 4MTPA 2YQ1A 3HT3A 4UUXA 2NCKL 4K2JA 4MFBA 4HVZA 5HAOA 4LR9A 3W63A 2NXEA 1TL1A 1KS2A 3DLEA 4OYOA 3OL7A 4DL2A 1S6OA 2XULA 1IKVA 2HSEB 3JXOA 1HI1A 4L3NA 4W92B 4J9QA 3KK3A 1UA1A 3Q2TC 2LEPA 3PEHA 3VGVA 1ZM3A 1RU2A 3IGNA 3RJMB 4Z7YA 4WYWA 3OVSA 3CPWR 5B7WA 1UA0A 4C4WA 1CJVA 1QTNB 1WD6A 2VPZB 5E3QA 2KT5A 3KLGB 1FFGB 3Q22A 2MDAA 2XMAA 3OR1A 2YNIA 4WTOB 4C2MA 4C3MA 4I56A 2CUYA 3NMAA 3PX0A 2JVRA 2W8KA 3MEEB 3MM7A 3H42A 4CLKA 4ZDNA 5DLFA 2QT7A 4M95A 1MN9A 2O66A 2ROGA 4CTAA 1K1QA 1S10A 3OL8A 1NRKA 3AJ2A 1LK5A 3N4WA 4OX7A 3DDIA 1RT4A 2RU9A 3NAHA 2H5IB 3IR6B 4PXEA 4ZLPA 2JLGA 2CVEA 1VQKS 2JEFA 1CPZA 5EWFA 2IJNA 1HNIB 4ZVOB 2MY7A 3GCWP 2JFDA 4RUAA 2R7WA 4IRKA 1NK5A 3QO9A 4ZVSB 5CABA 1LK7A 1RWMB 2K3KA 4DX7A 1U1RA 4FBUA 2DISA 4MYUA 5HLFA 3I5AA 4QIEA 2XMKA 1VBXA 3EPIA 1S1TB 2F5GA 1VQNS 1OPIA 2V0NA 2ZM6F 4B9MA 3S01A 2J6SA 1RT5B 2FPHX 4KC5A 4NA2A 2R2UA 1UW9A 3KG4A 2W4PA 2XBPA 3LANA 2NSCA 2KB2A 5IV3A 2X1FA 1FDNA 2CNOB 2GGPA 4HR2A 2XSJA 3VGUA 1SJFA 3DGPB 3Q23A 1GTHA 3HD2A 2HQFA 1SKRA 2HHTA 3BSOA 4WFAQ 1KOOA 2ZD1A 3M8RA 3GV7B 1FRJA 1U24A 2W25A 2W2OP 3CD5A 4XDCA 2ZM6J 3CUNA 2CQDA 1FK9A 3QMQA 1GEHA 3V2UC 1VI7A 1HMVA 2J9DE 1NAQA 2LQ5A 1ROFA 4MIAA 5CZXA 3SBMA 4ECQA 1UEKA 4IOCQ 1KD1T 2BM1A 2HVEA 1JXVA 1WG5A 2BANB 4WZQA 4Y2CA 3HM9A 2YKMA 3WDOA 4EBEA 5LXYA 1OO0B 4CQ1A 3IM9A 3TAMB 4LF5J 4WKRA 1KDNA 3S1TA 4USIA 3VTIA 1QDUB 1UJ5A 3MPYA 3FFIA 3W2WB 4BDPA 3AODA 3I4PA 1LXNA 4DUTA 4X62J 2DNMA 1MWYA 2DB1A 1S1XB 3MM6A 4DS4A 1X9MA 3PZPA 1SUQA 3P3DA 1UMJA 4R8UB 2NQPA 1HPZB 1RCOB 2AIRB 5IC6B 1YRTA 5AXKA 5E41A 4DV4F 4DV6J 1WC4A 1HR0J 1RWOB 1REVB 6AT1B 1TAQA 4N77A 5F8IA 2MQ8A 4L73A 4RW6B 4DR3J 3GFXA 2MKYA 2VBYA 2VB6A 5LMNF 1S0MA 2DIUA 4X4TA 3CC4S 4B3TF 3KK1A 1UP1A 3NXZA 3QSIA 3M9OB 3J81j 3GIJA 1RTHB 1TL7B 4B9TA 2B5JA 5F0UA 3RG6A 4KHPJ 5CA5A 2A3JA 4UOHA 3PW4A 1XR5A 5MAOA 4E8UA 5A8KA 6FD1A 4O3RA 3O8WA 3FNNA 2C2NA 4H4KC 2V1SA 2GJIA 3QJPA 1RA6A 4B3MF 4BLGA 3M1VB 3VAFA 3SZ2A 4GKKF 2OUGA 2Q6BA 2H48B 1JJCB 1M1GA 4C8NA 4YMEA 5HI7A 5E3RA 4LF4F 4K4ZA 2Z2ZA 1T9WA 1TQLA 3D7SB 2LA6A 3DDKA 1AB8A 2VOOA 2V8GA 2RHSB 2X1GA 2LEAA 3ZTSA 5J1PA 2CZ4A 4D3HA 2YBVA 4F8RA 1RAJA 2C2MB 1NK4A 3CJ5A 3CSKA 1PG5B 3UPFA 3CCZA 3H4BA 4QIWD 1KFSA 3CO0P 4DV5F 2V9WA 2RDIA 4C8KA 1M0SA 4PPZA 4IG0A 3PJWA 3WBZA 4LF7J 2MZQA 3HFKA 3JYTA 4KSEB 1XWLA 1VRTB 5K20B 2WONA 3AFGA 4FKXA 1TR0A 4AT1B 2XGQA 4F2SA 1B7YB 1PC4A 5DS7A 4ANDA 4GC7A 4A8MP 3ILLA 3LGNA 1VBZA 1VOMA 3RBZA 1BD6A 1RAHB 2MQMA 3LO3A 1NO8A 3D3BJ 1DLOA 2ROPA 2NZ4A 4E0DA 4NPOA 4OYIA 2GIRA 2LLZA 5FD1A 1H2VZ 2E9TA 4OI6A 1IBLF 5DG7A 2PMZD 3GZ7A 2RE1A 2ATLA 1SQFA 3EICA 3MEGB 1SJ3P 4QOTA 4YB6A 1L5UA 4LVOP 2CPFA 3KXDA 3IG1B 3TW0A 5E33A 1RT1A 4CLYA 2GO9A 3EE3A 1EETA 4E98A 2UVWA 3M32B 2QFJA 3OXGA 3GTYX 1E6VA 4WE1B 3HFZB 3G71S 3V81B 3TJ9A 3SCJE 5IM0A 2ZH5A 1Y9OA 2IAJA 4N8NA 4LQ3A 2QC3A 4OI4A 1M5PC 4K0KJ 4JI3J 3G6VA 4L75A 1UVKA 1KP6A 1M1HA 1VLOA 2RQCA 1FJGJ 4LRCA 4OYAA 2R7RA 1TV6A 4LSNB 4NLUA 2WB4A 3FKBA 3EXYA 5CQGA 2F7VA 1RAFB 3ZZZA 1U25A 2EFOA 5BXIA 2HQDA 2F65A 2KO1A 4PG4A 2UP1A 3C6UB 4JV1A 1IKVB 1NMEB 2QG9B 5L8RC 3P4UB 4FF4A 3ITHA 5KFCA 4EUVA 2CQ1A 1JX4A 5EN1A 4HHHA 1Q53A 2SXLA 1WC1A 3S6EA 4DPXA 4KO0B 4UOGA 4HI1A 4PXDA 5IXUA 1HWLA 1TTHB 1J5EF 1VC5A 5EGYA 1S9GB 2X3DA 3EGWB 4LBIA 4NYPA 3MXHP 1F60B 2CQGA 3KNGA 1G7CB 3A8IA 2V2KA 3Q8UA 1FE4A 2BBEA 4QWBA 4DG1A 3JSMB 3D28A 2HBYB 4YY3F 2FJBB 1FRLA 4I2PB 1UVMA 3M2UA 3EUNA 3OTDA 5MLCV 1RTIB 1NBEB 2OJ3A 1RZMA 4DX5A 1C1CB 2XSFA 3J80Y 2BANA 4HDGA 2XCAA 5D0HA 5CYMA 1ZZFA 1U47A 2UZAA 1QD1A 5D3GA 5KFSA 1NDCA 2GMJA 2FY1A 4JI1F 4ES2A 4NI2B 5HATA 4AXJA 4CT8A 2UXDF 5U47A 1RI7A 1S6PB 1QE1B 2BRLA 3KHRA 2OKQA 4CDIA 2YH1A 1NK6A 4WXOA 3R2CJ 4AL7A 2HHUA 1BQMB 4ZOSA 2AWZA 2ZHBA 4P6QA 2DRDA 1H74A 2RMLA 4ECZA 1W2BR 1JLEB 4K5RA 1X9WA 1WDDA 3CCRS 4DHVA 4OZ2A 1XMQJ 3ETMA 2DNOA 4LR7A 1REVA 3GILA 4BS2A 2V94A 3IM8A 2QSWA 1WF1A 3QRPA 2IM1A 2E7VA 4KGXB 4RPFA 1Y10A 1ZYQA 1HI8A 1QUPA 2QLBB 3BM7A 5EX0A 1N36F 4J9RA 2KXHA 2BMBA 3OBIA 4PQUB 2DKOB 2EKNA 5IT4A 3MM5A 1DY3A 2B5JB 2BA9A 1QSSA 1UCNA 2VFUA 2ZHOA 2XHCA 1S1UA 1UJ4A 4IRCA 1Y7PA 5D8HB 3HX9A 4YR3A 4N56A 3SI8A 2UU9F 2ZKTA 5DG9A 2MHNA 2V4RA 5AE2A 2V2QA 2GC8A 3NWRA 2HZCA 2VBZA 1X4BA 2VBWA 4WJBA 4V1Ak 5HVFA 4CLWA 2RVJA 1TL1B 5E2QA 3SDEB 4JI7F 4ED5A 3OR2B 4NLWA 1JKHA 4WWSA 2HLUA 3RB6A 3ILJA 3LAMA 3OUYA 2VICA 1RT3A 4B3SF 1V3RA 2L9NA 5KFPA 2KM8B 1BLUA 1CJKA 5H9FJ 2E1MC 1SH3A 2ACMA 2WB1D 2DGVA 2GO8A 4ANEA 4ETZA 1IBCB 5F9NA 1IR2A 4DPTA 3NGDA 4BHQA 1YJVA 2Y0BB 4P2FA 3MURP 3MUMP 4ZP8A 3OW2R 1XNRF 2Z56B 3P8BB 1YJUA 2VFRA 4O0NA 1IR0A 5KG0A 5LMUF 2GIFA 4DV6F 1X7VA 2IJRA 4WFXA 3K57A 3QFWA 3J7Z5 1WTFA 2D68A 3HF5A 5LJ5Y 4FZVA 4ELVA 1OMSA 4I69A 3TVYA 3WX8A 1ZA1B 2MTLA 4F4KA 3THVA 4NRUA 3BGFA 2MGZA 1EQ0A 1HBOA 1SPBP 3C6TA 3MM7B 2I5JA 1N56A 1VISA 3QT8A 1NSPA 3DRSB 4DR1F 1VGYA 2EG1A 2E1RA 2YX7A 2YY3A 4KR0B 2IVFB 4DV2F 5H9FK 3HHLD 4C97A 2GMHA 5KT3A 2W9BB 2HHWA 1OY8A 1R8BA 5B08A 2CPXA 1NK7A 4C3LA 3K58A 1Q8KA 2JC1A 1F5CA 4WTYA 2DR8A 3GJRB 1WOSA 1LW0A 1ZS6A 4MIBA 4ZLNA 4M63A 2MKIA 2W9CB 4N41A 2VOPA 1D8ZA 4I1TA 2A6MA 4OIXA 5D4PA 3H5SA 2ERRA 4DJBA 3KKFA 1N33F 4HH1A 2BV3A 4NLPA 1BGXT 1RT6B 5AXNA 2IC3B 4DV5J 1XBWA 1X4DA 3E3XA 1T8EA 2XHWA 5AE3A 1S9EB 1Y11A 1R0BG 2GGPB 1DRZA 1NNDA 2W2QP 3U1LA 1MLAA 1S1WB 3W5YA 2BE2A 3ILOA 1PC5A 2IJFA 2CQ0A 2WAQD 3RU0A 2HBQB 4EGLA 2ZZTA 1RDRA 3QFHA 2Q1LA 3JSRA 3AD8C 2XYHB 5DETA 1FD2A 2QA2A 2ZFHA 3EM1A 4ZA1A 2C2RA 4QJVA 3P5TL 1PJ7A 3CD6S 1WOOA 3CCTA 2J8AA 4R25A 3VVUA 2C2EA 4EYHB 1GAOA 3IRXA 2YKMB 1B64A 2XYGB 1CS4A 3QBCA 2DGSA 3PFEA 4K2XA 4MKVA 5K8NA 2B4PA 5GADU 1RHQB 1KEKA 3HFVA 1ELOA 3MPVA 4MAKA 2C3OA 3ZTOA 5DQGA 3OPKA 3RRHA 1R27B 3GG1A 1WHYA 2Z2MA 4FYXB 1X9SA 4RR5A 3HJFA 3UN5A 1U7LA 4TYAA 3Q89A 2GA7A 3VZHA 3W61A 3TEHB 1KVJA 3C2PA 4FXVA 5KG4A 2UVVA 3VCDA 1JLGA 2JLEA 3FGVA 2DTJA 2IPOB 2DH9A 2MKJA 2ZH6A 2CWXA 5KT5A 3V6HA 8ATCB 3VR1A 4OJ1A 2NUHA 1DTQB 2LEBA 2CPJA 4OX9J 4NLVA 4USHA 1H7WA 4ECXA 3OTOF 2HW3A 3TUZC 4N8OA 2YWGA 5HL7Q 4ZIWA 5F8GA 1S7IA 1JWWA 4R5PA 1VRUA 2M70A 1WC5A 3D68A 5HMXA 4ZP9A 1UFKA 2RT3A 2V8PA 4Y65A 5A6WA 3UCGA 4TY8B 1JLEA 4Q45A 4OYMA 1JLQA 1RACB 3CMAS 3G8SA 2VQFJ 3TAQA 2LQJA 1F9EB 3CCUS 4LFCJ 1QUVA 2F9JA 4ZJOA 2MMYA 1WTBA 4RL1A 4C3KA 2FVQA 5L9NA 1NPKA 2C2OB 3HHNB 5ETKA 4NLQA 3LTOA 1FNOA 3M6VA 2I9SA 5C25B 4PYAA 1ZAVA 2PMHA 1PJ5A 4A48A 2GNKA 4Z2XA 2EI5A 2KDOA 3K5LA 3TAMA 2Z0GA 1Q79A 3QAUA 2LP4A 5KFFA 2JLFA 2HVDA 2OLWA 3TUPA 4L76A 4HYKA 4B9VA 3R7SB 2LXIA 3IA0A 4OYWA 4RW8A 2CADA 5HJXA 4CLPA 3FUYA 2C3UA 3OR2A 5KT7A 1HBMA 2UXDJ 3THTA 4G1IA 3RZAA 4USJC 3OSNA 1YQHA 3PIPQ 5CH7B 2Y1JA 3DGVA 4YUDA 3K17A 5I3UB 1FWLA 3FEZA 2UU9J 1LWFB 1H2TZ 2ZBIA 5IZHA 4I7FB 4M5NA 5GAHI 5KT2A 3HXMA 2H4YB 2R2TA 4DV0J 3BKUA 1SL1A 2HHSA 4OZJA 1SVDA 4B3SJ 3LGHA 3EZUA 3GONA 3QJLA 4F3QA 2NS1B 3MMAA 4CO3A 4KHPF 2DGWA 3SSRA 3M1VA 4DUYF 2DNRA 2YVSA 5RUBA 3GR1A 1EETB 2EXUA 2VD3A 1WACA 1BQNB 2D3UA 3KLHA 1D3WA 3B54A 2GX8A 2YXLA 4F25A 3DRSA 4LBPA 1LFWA 2WOMA 2LQ8A 2WVFA 4QWAA 3E01B 5C24A 1R8CA 2DYAA 3HHEA 3O5TB 4LRAA 2HIYA 1IKWB 2ASJA 3T1HJ 1IN0A 5FLXU 1HBNB 2LA4A 3TQEA 1RTJB 2MJUA 4ITSA 3N28A 2R7XA 2OIHA 1RWUA 3JS9A 1M5KC 2V8HA 4LSNA 5GADI 1RABB 3A1YG 4CH7A 4LRDA 4EU0A 4NE9C 3JYTB 1KC8T 4DR1J 4K4WA 3DOMA 5C2CA 4NZ0A 1OS5A 2PE8A 3SCKE 3W2VB 2DXFA 3G6ES 3PG9A 2MQOA 4J9SA 2U1AA 3BGRA 1SJQA 3WIVA 4DFPA 2V4QA 3GV5B 1G6BA 1LV5A 4C11B 4KFBB 4OHXA 2FVSA 2DNNA 3AOCA 5HP1B 3RB3A 3PO5A 2XWXA 3I9V9 3PYGA 2AMCB 1TVRA 3ENQA 1FF2A 2ABYA 3KFWX 2QE5A 4G6VB 4KGMA 4LRBA 5KFVA 2R8IA 1RWXB 3RW7A 1DTTA 4U8YA 2P9EA 4EK2A 4OFZA 1K0TA 1RTIA 1QAIA 5EX3A 4GO5X 1EIYB 3CW2C 4B3OB 5FJ4A 3AOAA 4XK8C 4ZP7A 1TUGB 4DN0A 1OY9A 1T3OA 5BYRA 3W7BA 1R7IA 3D6MB 2RH3A 4NYZA 3IC1A 3FBFA 2B4VA 2YNGB 2E5LF 2QYCA 4NI2A 2X51A 3C3LA 4UY8T 3ET6B 2VPYB 1WSVA 1UPPA 1R8AA 2YWKA 3PEJA 4ZP6A 1OIAA 2IDEA 2CG4A 4KGVB 3CXCR 1J5EJ 2HHVA 2FLOA 4IG3B 1RB0A 3GSDA 1TV6B 3LP1B 1FFSB 2ZZNA 1N5YB 3AY0A 4K7QA 1QLNA 3Q8RB 5KFUA 1H72C 1DAXA 2IDLA 1U0HB 4DX8H 1IWGA 3QZ7A 3H59A 3M9NB 2Y1LB 4XPEA 3AT1B 3PR5B 3W8PA 1KSPA 1D8YA 1A7GE 4IQMA 4CRJA 2XLKA 3ZC4A 3SCIE 2GAHC 5HVHA 2IM2A 1U1NA 2HHHF 1HI0P 2PDAA 3KLFB 4QWCA 1IKXB 1YJWS 3UCZP 3PKYA 5HANA 2CPIA 1EP4B 2Z2LA 4F02A 4PQUA 3ULHA 1MMNA 4UQTA 3E51A 3ZTQA 3MTKA 3PYDA 2Y1RI 3G87A 5B0DA 5C42A 3QLHA 2NXUA 2DR9A 4NX9A 2R2SA 1HHSA 2K3IA 3CIMA 1YJ7A 4CIOA 2DITA 5KFMA 2G9OA 1FWKA 3GYNA 3W9JA 1NSQA 3HZEA 2WTFA 2XM3A 1S97A 5K5MA 1SBRA 4BC9A 2OPSA 3VAGA 2D7SA 1O0PA 3N5FA 1FCAA 5G4DA 5A8WB 2XO6A 3I87A 3KMQA 2CPEA 4JI7J 2RHQB 5KT6A 1XEZA 1S5ZA 4YB7A 4B3TJ 1S6PA 4FVCA 4O3OA 3H5XA 2MZSA 2ZOMA 4PG8A 2B0GA 1QJHA 2W2PP 4JI2J 1V3SA 1WG1A 1X5TA 2VQEF 2RF2A 1XTZA 4I64A 4UOCA 3B4MA 4UF4A 3G8TA 4B3RF 2FUG9 1YGYA 1C1BB 1U2CA 4PKDB 1JLBB 4NLDA 2YQ3A 4U67Q 1FNMA 2YX1A 4CLLA 2KTQA 1RHRB 4WP8A 2QYGA 2YTCA 3O2IA 1S7HA 3R6GB 2I8EA 4RW4B 4LREA 2B9YA 2P2CB 3GV8B 3I55S 4DWIA 2EBEA 4O3QA 4U8VA 2RILA 3CDWA 1RAGB 4IRDA 3FDSA 4OI0A 2OELA 5J2QB 4LF5F 1G1XA 4LFAF 3I4HX 4FPIA 1JNRB 2Q66A 3X1LB 4TY8A 1NXIA 2OTJS 1CJTA 2JDJA 3I96A 1T9YA 1T03A 1AW0A 1FX4A 4WFZA 2AJFE 5F8NA 3IBCB 4X4NA 3LP2A 4EZ6A 3KDNA 4NASA 4ID5B 3O6QA 5DRKA 3MUVP 1YBUA 3GG0A 3UQSA 1UW4A 3UDCA 4ZMMA 3KLHB 1PO6A 3EDQB 1TKTB 4FYWB 3J7AN 3U7JA 2KG1A 1FX2A 4OV6A 2D3O1 3M8YA 3E01A 2XTDA 4NZ6A 2PO4A 5C24B 1KQSR 1KONA 2IC3A 4S0MA 2ZEJA 3TOQA 5A76A 4HTIA 1WC3A 4K8RA 4X65F 3V6JA 2DPIA 1TFWA 2VODA 1HW9A 2UV8A 2NYHA 3BH7B 1SJ1A 3D9BA 3DLJA 5GMDA 1O5JA 1FEHA 5HQ8A 3RR7A 1C0UB 1T9XA 3ZFVA 3J7A1 3N6LA 1WJ9A 2YNHB 3LPYA 2Y8WA 3MCMA 3E2EA 2GQQA 1JJ2R 1V3ZA 3VF0B 2KZZA 2AEFA 1X8DA 2CIMA 1JXLA 4KAIA 2VG7B 3MMCB 2RD5C 3NG8A 4DPOA 2MGZB 2ZE2A 1KQFB 1N88A 1SH2A 3F44A 4P2SA 1IQZA 1HD1A 4DQSA 3GJSB 3TVZA 3OHAA 3SQOP 4I2QB 1SCJB 1HL6A 1HNVA 4Y0FA 3M2RA 4K0KF 3AJ1A 2KFNA 4LT6A 2O01C 2QLJB 3DLGA 4O4GA 2OEKA 3R5AA 5FIIA 2IA0A 4P2XA 1FJGF 4CLZA 3KUGA 4X4SA 2RDJA 2IRUA 2IRXA 4MYTA 4TYBA 2AF6A 3IAS9 4J9UE 3QGGA 5KFOA 5T14A 4DLEA 1YIJS 1NJWA 2OPPB 4F50A 3UNYA 2HFOA 4F36A 1BQNA 5DGAA 5M2RA 1VIXA 3MR5A 2HVZA 1WUUA 4ERDA 4G1QA 2JX2A 4YN3B 2B43A 2M2BA 1D9AA 2KHCA 3S8SA 3JSBA 2ADCA 1HYSA 3K5NA 3VGTA 4UZCA 1FDBA 2D41A 5F8MA 2DNZA 2K7JA 5B0GA 3TWZA 1LW2A 2E29A 1FE0A 1FESA 1S9EA 2GHPA 1RT7B 1X4CA 1HBNA 2JNJA 2WW8A 3CT9A 3N5BA 3GJQB 3QQCD 2XCPA 1XMBA 1JJ4A 4OI3A 1VRUB 5LJ3Y 4J9OA 1N5YA 3HLUA 1IR1A 4HDHA 2YKPA 3T6JA 4NMLA 1FI4A 4QIGA 3R1LA 2FJXA 2HHQA 2JJ4D 2E5JA 2OTLS 3W60A 2FJEB 2AX0A 3PRVA 4OZ0A 1AZSA 1S1VA 2H9ZA 4O3NA 4B9NA 2HLTA 4RUBA 5KFHA 2COLA 2W1BA 3UCUP 4WBFA 1M5OC 3DRYA 4NL5A 3DYAA 3W9IA 5K8PA 3T3FA 1RBAA 3KLFA 3PR4A 1TUWA 3VAKA 4DFMA 2KL8A 2YWHA 5H9EJ 5C25A 2FTRA 3SFUA 4HLBA 2PFDA 3D67A 1N33J 3SQGA 1NLKL 2MQNA 1F5BA 5L9XA 4LSLB 1HQEB 3FC9A 2HFNA 1CJUB 3F0NA 2PIIA 4NLRA 3D1OA 2M4MA 4CLTA 3IWXA 2ZUGA 1MMLA 3MM8A 1Z2ZA 2DBBA 2ZOFA 2OSRA 3PYEA 4FNHA 4EI2A 1PKUA 3CC7S 2HRUA 3NAIA 5KFQA 1IVZA 4U7UD 2W2NP 3AAWB 2K8GA 3IMQJ 3MEEA 4Z7CA 4XO0A 1IJFB 1BMQB 3DRXA 4ZJLA 4YHHJ 2DRBA 2L3MA 4NCAA 4ED4A 3K5OA 2HQCA 1VC0A 2XEXA 3EPGA 4PXCA 3ZTRA 1RYRA 3DLHA 3I0RB 4JI0J 2UUAF 2YQ0A 3F41A 4KT0C 3AWRA 2J7UA 4CO0A 5LL6d 5LOQA 4O0IA 1HNIA 1RUSA 5EDWA 2DO4A 3R5CA 4DPWA 4LBHA
chains in the Genus database with same CATH topology
4RW9A 2ZKUA 2OPQB 4R5PB 3MEDB 2Y0SD 2HNDB 1S79A 2B4UA 3DOLB 2RF2B 2UUTA 2LXFA 1X0PA 3F56A 5J1NA 2W24A 1IXKA 4NWBA 4BCAA 5KT4A 4Q8EA 5KFZA 2OD4A 2GV1A 1O51A 3IXQA 3THPA 2PT0A 1Q1KA 5D4NA 4B08A 2XLJA 3TA0A 4AE5A 1A6LA 4IR1A 5F3ZA 2B9XA 2CZVC 2EW9A 5C42B 2ZNZA 4AYBD 4LQ9A 4MKAA 1X4HA 1N4LA 1JLAB 1N5QA 5DLGA 1KHVA 1UUJA 4AQYF 1HW8A 2FC9A 2KM8C 1TKTA 3NBPB 1AROP 2CVIA 4J9NA 1N0VC 3DHXA 2W4DA 2CYYA 3K0JA 3D0GE 3QWUA 4RNMA 5CYQB 4FN5A 1FRMA 3K8WA 2ZH8A 3V6KA 3BGRB 3TR5A 1H3DA 1S77D 3HHKA 4PCQA 3AB2B 4A8OA 1KHWA 1UWBA 3GYXB 1RTDB 2WSFC 1QVGR 3DLKA 2UVWA 2XI3A 2MSSA 1OQ6A 2QIFA 3WZ0A 1MMDA 1ULRA 1UKUA 4R8UA 3FRYA 3RBEA 1FRKA 3VQTA 4UQGA 4IO9Q 3LALA 4L6V3 1P8GA 5A6PA 1D1UA 1RJJA 4OLPA 2FJWA 4Q5VA 4B3OA 2KJWA 2Y1IA 3ZZ0A 1NJIT 1N0UA 4YQWA 3KK1B 2ASLA 1IM4A 3I5BA 4QIVA 4X84A 4WFBQ 2CQ2A 1X4EA 3EXCX 5KFDA 1IKYA 1UFWA 2CQHA 2KHDA 4Y28C 2AP6A 3Q8PB 1RTJA 3LP2B 3MPWA 1P1LA 3NNHA 1Y3JA 1DQ8A 2VBXA 2HWTA 3CJKB 2ZH3A 1CEZA 4OI1A 3OJUA 1WWHA 2AYGA 1VQOS 4JV5F 1NH7A 5CD4H 1W2IA 3NWGA 2DNYA 4KHMA 3GFZA 4IDKB 1RYSA 2YKAA 3L95X 5J2NB 4KTQA 3OV7A 2VPWB 5HP1A 4U7CA 1GTEA 4JI6F 1MNEA 5IT9Y 3LAKA 4RZRA 2OO4A 3PKMA 2F9DA 3I0SB 5K8OA 1Q81T 2EK1A 1OSDA 1FK9B 1HR0F 4H4MA 4G1PA 4DL5A 4OLOA 2VFSA 3SCLE 2FVRA 5F8JA 3GIMA 3MHYA 5H1SV 4NYOA 1S6QA 2OPSB 4OX9F 3RB4A 4U6PA 2ADBA 4YDXA 2HYIB 2YNIB 1WEYA 3CTRA 3UDLA 4Y3CA 3FFIB 1T95A 3W2WA 1NJYA 1R3NA 3QPIA 4YB1P 2B6AB 3GIKA 4QCLA 4ZHRB 2DGQA 4EO8A 1SUQB 1S1TA 2XY6A 2XNQA 2F4VF 5IM0B 4Q0BA 5GAEU 2ROEA 4X4OA 2EVZA 2B4OA 1TP7A 2KXFA 4C8YA 4CO1A 2O5DA 3U27A 1RT7A 2W7PA 2EFVA 2XSJB 4RW9B 1M5HA 2OP5A 3DRPB 1DFDA 1EP4A 2QSFA 3MEDA 4JV0A 1M90T 4NA1A 3RAMA 1YTYA 3TAPA 5A8RB 1IJEB 2FHJD 5KG3A 3T6BA 3HPOA 3Q2SC 3RAQA 3O44A 2VQFF 1T03B 2EG2A 5BYQA 5K8MA 5KAKA 4PWUA 2O1PA 3KHLA 1FDAA 4KO0A 4TNOA 4K4TA 4QR2A 4OMFG 5B09A 2KRBA 4OHWA 3PACA