1XR6A

Crystal structure of rna-dependent rna polymerase 3d from human rhinovirus serotype 1b
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
460
structure length
460
Chain Sequence
GQIKISKHANECGLPTIHTPSKTKLQPSVFYDVFPGSKEPAVLTDNDPRLKVNFKEALFSKYKGNTECSLNQHMEIAIAHYSAQLITLDIDSKPIALEDSVFGIEGLEALDLNTSAGFPYVTMGIKKRDLINNKTKDISRLKEALDKYGVDLPMITFLKDELRKKEKISAGKTRVIEASSINDTILFRTTFGNLFSKFHLNPGVVTGSAVGCDPETFWSKIPVMLDGDCIMAFDYTNYDGSIHPVWFQALKKVLENLSFQSNLIDRLCYSKHLFKSTYYEVAGGVPSGCSGTSIFNTMINNIIIRTLVLDAYKNIDLDKLKIIAYGDDVIFSYKYTLDMEAIANEGKKYGLTITPADKSTEFKKLDYNNVTFLKRGFKQDEKHTFLIHPTFPVEEIYESIRWTKKPSQMQEHVLSLCHLMWHNGRKVYEDFSSKIRSVSAGRALYIPPYDLLKHEWYEKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title The Crystal Structure of the RNA-Dependent RNA Polymerase from Human Rhinovirus: A Dual-Function Target for Common Cold Antiviral Therapy
pubmed doi rcsb
source organism Human rhinovirus 1b
molecule tags Transferase
total genus 136
structure length 460
sequence length 460
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1xr6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1xr6A02
2YKMB 5DQGA 4KKOB 4ZPCA 4EYHB 4RW8A 4IG3B 4ZPBA 5EUHA 5HP1A 5HLFB 4ZP8A 1IKYB 3ICLA 4RU9A 2IBKA 3DMJB 2RKIA 2QV6A 1J5OA 3QIPB 2HMIA 4WYWA 4ZP9A 3DLKB 4WE1A 5KFYA 5J2PA 3M9MB 5HROA 2IAJB 2HWHA 1SUQB 3I0RB 2VG6B 2HNDB 1DTQA 2ZD1A 1TVRB 5KFWA 1REVB 4O4RA 3PW5A 4I2PB 1LW2A 1VRUB 2VG5B 1TV6A 3C6UB 3PR4A 2WRMA 4IQXA 4K4UA 2V4RA 4IH7A 4MK7A 1HNIA 4NLGA 4WXOA 5I3UB 1HPZA 2YNIA 4ECYA 2C22A 2JEJA 4WFYA 2B43A 5F8JA 4H54A 3GQCA 5HP1B 2UVUA 3PVXA 2W9BA 5F8IA 1FKPA 2RKIB 4J9LA 1JLEA 1RYSA 1J5OB 1NHVA 3MEEA 4WE1B 4QW9A 3GV5B 5J2PB 1VRTB 2FLLA 3H5XA 5C42A 5J2NB 1TKXA 4PQUA 3SFGA 1DTQB 3BREA 4J9NA 2J6SA 4TXSA 5KG3A 3MEDB 1LW2B 2O5DA 2EC0A 1TV6B 4G3IA 2BRKA 1NNDA 3ITHB 1HNIB 4XPCA 4K4YA 4ZVEA 3T1AA 2YNIB 3IS9A 3VQSA 3T5LA 3H4DA 3RB6A 1T94A 4Y2AA 3N6LA 2ILYA 2W9BB 1FKPB 2WHOA 4RNHA 4DL3A 1JLEB 2FLPA 4IRDA 3MEEB 3BR9A 3MECB 3JSMA 1RTDA 2AWZA 1QAJA 5C42B 1TKXB 3HVTA 4H4MB 4NLRA 3DI6B 3LP0A 4LSLA 4PQUB 4DL2A 3DLEA 5C24B 5CYMA 5EWEA 4Q8EA 1C1CA 4ZVGA 1JLFB 3QZ7A 1HARA 1QE1A 2FJXA 3G86A 3IS9B 3EPIA 4JV1A 1FKOA 2I5JB 2XCPA 3E51A 2WONB 3PW0A 3Q8SB 1JX4A 3UQSA 3DOKB 5KFJA 4IRCA 1RDRA 4DEZA 2GIQA 2R8JA 1RTDB 4R0EA 3HVTB 1R0AA 4LSLB 3LP0B 3KLIA 4J9SA 3DLEB 1HYSA 5CYMB 5KFAA 3KK2A 4NZ0A 3BSAA 1HNVB 1C1CB 2HWIA 5KFDA 4ED0A 4EEYA 4RW9A 3LAMA 5F8NA 4LQ3A 3OSNA 1QE1B 1TL3B 4YMEA 5DGBA 4RW7A 4Q43A 3PW7A 4DL6A 4NLVA 2E9ZA 1FKOB 3DM2B 5I42A 5KFOA 3H5SA 1T03A 3OHBA 1XR6A 3V6KA 4NLXA 3FDSA 4Q44A 3I5CA 3D28A 4KBIA 3MFIA 5CYQA 2BANA 3PZPA 3FFIB 4WFZA 1R0AB 3G6XA 5KT6A 3KLIB 1HYSB 1S49A 4ZMMA 5KT5A 4M94A 4Y3CA 4QW8A 3KK2B 5T14A 3BSCA 4RW9B 4RW6A 4K4XA 3NL0A 2YNHA 1C0TA 4TYBA 5DQHA 3V6HA 3V4IB 4RW7B 4KSEB 5C25A 4ED6A 1IKWB 1T03B 4KO0A 4ECZA 4XO0A 2IC3B 3QGGA 2DPJA 2BRLA 1MMLA 4TQSA 4O3NA 2ASDA 4M95A 3DLGB 3LALA 1GX6A 3TVKA 3N6MA 1SH2A 3KLVA 3H2LA 5KFMA 3SFUA 4O3SA 2IJFA 2E9TA 2YNGA 4NLQA 4RUAA 4ZP6A 4RW6B 1JLBA 1RT4A 1C0TB 2W8LA 4IG0A 3KMQA 5F9LA 3KHRA 2WB4A 4J9KA 2V9WA 5KFBA 5KFFA 3BSOA 1EP4A 2WCXA 4KO0B 5KFNA 4IG3A 2R8KA 3PR5B 3MR2A 3GIJA 3KHGA 4TLRA 1W25A 2R8GA 1TQLA 2CJQA 2W8KA 5KT2A 3GIKA 4O3PA 4PUOA 4NLPA 5J2QA 2YNGB 4MFBA 4B3OA 4ECRA 2FJVA 4LQ9A 2VG5A 3DRSA 4NLWA 4IG0B 3DDKA 2V0NA 5KG4A 1RYRA 2W9AA 4MKBA 2RDJA 1EP4B 5I3UA 5F8HA 1S0OA 2IM0A 1S6QA 2OPRA 3D5MA 2R8IA 4ECSA 4DL4A 3NKYA 1D0EA 2OH2A 1XR7A 1S6PA 4K4WA 5L1KA 4IR1A 2ASJA 3TQ1A 2C2RA 1VRTA 1JLQA 3NGDA 3DOLA 3KLEA 5J2NA 5KFVA 1S97A 4PUOB 5J2QB 3CDUA 3RBDA 3KLGB 4NLTA 4X2BA 3NAHA 4MFBB 3MFHA 4DL7A 4B3OB 5L1IA 3PW4A 3MEDA 3DRSB 3MTKA 4R8UA 4U7CA 2BQ3A 4OL8A 1QUVA 3ITHA 3UPFA 4URGA 3G6VA 5KFZA 2OPRB 1S6QB 5HBMA 4HYKA 5F8LA 3CIZA 4ZPDA 1SH0A 2D3UA 4IFVA 4RNFA 5KG0A 2VA3A 2B6AA 2UUWA 1S6PB 3MEGA 3JYTB 4J9RA 4FBUA 4NLSA 1K1SA 3MECA 1ZTWA 1JLQB 1RTHA 4J9MA 5DG9A 1NHUA 3DOLB 3KLEB 3MF5A 4EO8A 2IJNA 3KOAA 3IGVA 4H4MA 3DI6A 3OSPA 1RT6A 5C24A 1S1XA 5KFEA 4KHMA 1S10A 4ECQA 3T5JA 2ASLA 3CJ5A 1IKXB 3I5BA 1JLFA 4R8UB 1KHWA 4ZHRB 3KK1A 3BQ1A 2FJWA 1K1QA 1JLAA 3RAQA 3CJ4A 4O3OA 1DTTB 5DG8A 2XCAA 2ALZA 5HBMB 3E01A 3Q8QB 2I5JA 1GX5A 1IKVA 4IFVB 5L9XA 1S1TA 2B6AB 3MEGB 2WONA 1S4FA 3PJXA 4U6PA 4YR0A 3DOKA 1YVFA 3EZUA 1LWEA 2W9CA 1RTHB 5J1EA 5D3GA 4WYLA 3GILA 1IM4A 1C2PA 4F4ZA 1RT6B 4ED1A 4IFYB 1S1XB 3PJWA 4FBTA 1HNVA 1RT2A 5L1JA 3M8QA 4QWBA 3ISNC 2J6UA 4YR2A 3T19A 3KK1B 4NLDA 1JLAB 1TL3A 4ED7A 4ZPAA 5KFUA 4F4XA 3DM2A 2D3ZA 3E01B 4YR3A 1IKVB 3MR3A 1S1TB 5KFHA 4MH8A 2UVWA 3KMSA 4ZP7A 3BSNA 2W9CB 1LWEB 1TKTA 5J1EB 2JLEA 3FFIA 5EWFA 2XGQA 5D3GB 4IH6A 2ZKUA 5FDLA 3GIIA 4PWDA 1RT2B 3M8QB 5DLFA 4LSNA 1TP7A 3V4IA 4XPEA 3T5HA 3DYAA 1IKWA 2JC1A 4EBDA 2IC3A 4MK8A 2AGPA 4YP3A 3LP1A 1TKTB 3DLGA 2C2EA 1LWFA 5FDLB 3EPGA 2IA6A 5KFCA 1S48A 4PWDB 1WNEA 4H4OA 3QYYA 4EBEA 3FQLA 2FVCA 3CO9A 4WFXA 5EDWA 4LSNB 3M9NB 1XR5A 4IKAA 3I0SA 4KAIA 1DLOA 4Q0BB 3OL6A 1CSJA 3DYAB 4WZQA 5KFTA 4IH5A 1RT1A 3QGIA 4I2QA 3OL8A 4ZVHA 5F8GA 2E9RX 4DG1A 3C6TB 2FVQA 1HQUA 3LP1B 4ID5A 3QZ8A 5J2MB 1LWFB 5KFXA 3DRRA 4KFBB 4KHRA 1RT7A 4I7FA 4O3QA 2JEFA 4IOBA 1EETA 4H4OB 4O4GB 2WK4A 4NRTA 4K4SA 3OL7A 2RF2B 4NCGA 3I5AA 4NLUA 3I0SB 2BQUA 4IDKB 2CKWA 1DLOB 2UUTA 1RA7A 1RT1B 2ZE2B 4I2QB 4MKAA 4EBCA 3H59A 3KK3A 1HMVA 4DG1B 4URQU 4F50A 1HQUB 3CJ0A 2GIRA 4ID5B 3QIDA 4KB7A 5KG5A 1C1BB 3DRRB 3KLFA 1RT7B 1JKHA 4I7FB 2WOMA 2AGQA 3G6YA 3KHHA 1TL1A 1EETB 3RB0A 3KLGA 3UDLA 1T05A 4Y2CA 4NCGB 3SI8A 3IGNA 4QWDA 5JUMA 4KE5A 1U09A 1RTJA 3LANA 1D1UA 4IRKA 3KK3B 1HMVB 1BQMA 4ECVA 4YQWA 1C0UB 5KFIA 2JC0A 2R8HA 2R2RA 4J9QA 5KFRA 3KLFB 1ZETA 4TY9A 1JKHB 1RTIA 2WOMB 1TL1B 1KHVA 1T05B 5KT4A 1RT3A 5KG2A 2GC8A 1IKXA 3BQ2A 4FS1A 5DGAA 2RDIA 4ZHRA 4IR9A 4RZRA 3HHKA 1RTJB 1DTTA 3H5YA 3H98A 1MU2A 3IG1A 1N48A 2JEGA 1JLGA 3LAKA 1Z4UA 1TKZA 1BQMB 2YKNA 3T5KA 2VA2A 1JXLA 4MIAA 2FVRA 2HAIA 3DRPA 2R2UA 3TAMA 1RTIB 5KT7A 1SV5A 4K4TA 3V81A 3PHEA 4IFYA 3M9OB 3KJVA 1RT3B 4TYAA 1N6QA 3H40A 2W7OA 4FS2A 2DPIA 2XGPA 3OLBA 1S9GA 4TQRA 1QAIA 4F4YA 1I6JA 1MU2B 3IG1B 2ATLA 1FK9A 1RA6A 1JLGB 3KLHA 2FVPA 2HNZA 4O44A 4TY8A 1TKZB 5KT3A 1OS5A 4ECTA 4RW8B 2YKNB 2QE5A 5L1LA 2I1RA 3V6DA 3H4BA 1KLMA 4K4VA 4ED3A 3DRPB 2HMIB 3TAMB 1N56A 5HROB 4Q8FA 1BQNA 1SV5B 3NAIA 3CJ2A 2R2TA 3V81B 3KJVB 3MR5A 1N6QB 2YNFA 2ZD1B 3HVWA 1S0MA 1S9GB 4Q45A 5JXSA 4JUZA 1FK9B 3FRZA 3IRXA 4QWCA 3KLHB 2HNZB 4O44B 1HPZB 4TY8B 3GIMA 4WZMA 2BE2A 3H5UA 3N6NA 3V6DB 3QO9A 4F4WA 1KLMB 4GC7A 4J9OA 1LWCA 1RT5A 1BQNB 4HKQA 2XWYA 2AGOA 1N5YA 5KG7A 3CVKA 4URSA 2YNFB 2D7SA 4QWAA 3FSIA 1SH3A 3NBPA 4Q0BA 4ED8A 2AX1A 5C5JA 3HVAA 1RAJA 3IRXB 5KFLA 3ISND 4G1QA 3BGRA 5DQIA 4EO6A 3HKWA 2BE2B 3C6TA 3CDEA 4RW4A 3QO9B 1HQEA 1N4LA 5J2MA 1LWCB 1RT5B 3LP2A 4WXWA 5DG7A 5KFGA 2F8EX 4ED2A 2OPQA 4KFBA 2UVRA 3JSMB 4R5PA 2V4QA 5KG6A 4Y34A 1N5YB 4O4GA 1S1WA 2OPSA 2RF2A 4RUCA 3KNAA 3CWJA 3PW2A 2AU0A 4IDKA 3NBPB 3KHLA 1T3NA 2ZE2A 3RAXA 5KG1A 5KFKA 4G1QB 3OHAA 3BGRB 4TN2A 5F8MA 5EWGA 4RW4B 2R2SA 1HQEB 3BQ0A 2UVVA 3LP2B 1C1BA 3FQKA 2OPQB 4ECXA 4R5PB 1ZTTA 2JEIA 1S1WB 2OPSB 3NMAA 2OPPA 3V6JA 3Q8RB 4KV8A 5K14A 2C2DA 5KFSA 2VG7A 5I42B 3OL9A 2C28A 3GYNA 5KFQA 2IM2A 4MIBA 4JV2A 4QWEA 2BQRA 1C0UA 4MK9A 4GC6A 1LW0A 1S1UA 1S1VA 1UWBA 4RNNA 5CYQB 2B5JA 2BANB 3BJYA 1JLCA 3MR6A 5KFPA 3QLHA 2WTFA 4ECUA 3M8PA 4J9PA 2HNYA 4EYIB 4ECWA 2OPPB 4ICLA 3Q8PB 4NRUA 4KV8B 5K14B 2J6TA 3RBEA 1S9FA 2YNHB 2VG7B 5F9NA 1S9EA 2FVSA 3OLAA 4K4ZA 4NLOA 2XI2A 5C25B 3I0RA 3JYTA 4K50A 4NLYA 2YKMA 2IM3A 3CJ3A 4KKOA 4DL5A 5HLFA 4RNMA 3CDWA 1IKYA 1LW0B 1S1UB 1UWBB 1S1VB 3DMJA 4ZVFA 3QIPA 2B5JB 3GV8B 3RB4A 3DLKA 1JLCB 4JV0A 2IM1A 2IMWP 3QLHB 2W7PA 2BR0A 2IAJA 2D41A 4QPXA 3UR0A 2ILZA 1SUQA 3M8PB 3QGHA 2HNYB 2VG6A 3GV7B 1S0NA 4O3RA 4NYZA 4ICLB 2FLNA 2AQ4A 2HNDA 1TVRA 2AX0A 1REVA 5DLGA 1JLBB 4I2PA 1RT4B 1VRUA 3C6UA 1S9EB 3IN5A 2XC9A 4RNOA 3RB3A 1JIHA 2XI3A
chains in the Genus database with same CATH superfamily
4KKOB 4C8KA 1MROA 3R5DA 4DPXA 4WE1A 2IAJB 1UVKA 5T41A 4QQBA 3ZC4A 2XYHB 4I2PB 2V4RA 1FJGF 3R6GB 1NSAA 4H54A 1YITS 3UCUP 2UVUA 1N33F 5A8KB 2C3YA 1VRTB 2V63A 2BJEA 4DPOA 1DTQB 2OSQA 3SCJE 1TFYA 3C2PA 1OWXA 3UDEA 2EBGA 4QIWD 5C24B 5CYMA 1FEEA 2HKEA 1HARA 4HTIA 2V1SA 3EPIA 1ICEB 1NXIA 3I6PA 2DEJA 1JX4A 4PYAA 4OLOA 4JI4F 1HI8A 3TZZA 4DCPB 4CYUA 2ZM6F 4NCBA 5LJ5Y 5KFDA 5F8NA 2YH0A 4RPFA 2BACA 2RVJA 3DM2B 3FDSA 3CSKA 2K3IA 4UOCA 2PMWA 9RUBA 3NL0A 3V4IB 4NI2B 1NSKL 2XB2D 4P72A 1VQ9S 1T95A 2IC3B 2ASDA 1X60A 2AJ2A 3OR1A 4LFCJ 3FVYA 3DLLQ 1FFWB 1V6HA 4EK2A 4J9KA 1HBUB 5B0EA 3AD9C 2RT3A 3PR5B 2KG0A 4ZPWR 3I32A 2CPFA 4MFBA 5DS7A 1I1GA 4OYOA 2V8HA 3FBFA 2K8GA 2RDJA 2YWWA 1S0OA 3AJDA 1VRTA 4CI0B 2CADA 5F3ZA 1O5JA 1FF2A 3DNCA 3Q86A 3MTKA 2AT1B 4JI5F 2ALYB 3G6VA 4RNFA 2VBYA 3LGHA 2UUWA 4AL6A 2AYBA 1NHUA 3IGVA 1AW0A 4DFPA 2IHR1 5C24A 4NX9A 4ER8A 2W01A 2QL7B 1KHWA 1RE1B 2N7YA 2XCAA 4B3TJ 3E01A 1S1TA 3PJXA 4A8XA 1F5AA 2UUAJ 4RWXA 1UA1A 3UWTA 5GAHU 2LEAA 2RDDA 4FBTA 2JVRA 3T19A 4F4XA 1AUSL 3DM2A 1MNEA 1X5OA 1WF0A 3F73A 1U47A 4YY3J 3V4IA 3SIPB 2QSWA 4OHVA 2OFGX 1PJ7A 2IC3A 1U4BA 1GT8A 3CO0P 2WW8A 1SJ3P 1HBUA 3BF4A 1BWEA 1H2TZ 3QQCD 2JEFA 4HHJA 4CLUA 1H38A 4K4SA 3HP6A 4FF2A 1F2HA 2Q43A 3NY0A 4DR3J 3UDLA 3MCSA 1G6BA 4QWDA 1IJFB 1UKUA 4W98A 3LPYA 5DGAA 2H5JB 3IG1A 1B0VA 4M5JA 1HLWA 1RTIB 1F5BA 4TQRA 3AY0A 4U7UD 3BKUA 1NH7A 3F0NA 3THTA 3H4BA 3TAMB 2HQ3A 4MTPA 2HRTA 3GFHA 4JI1F 1HPZB 3HHLD 4C8OA 4GC7A 3AXMA 1VS3A 2CPYA 2JJ4D 1FRXA 4DUYJ 1KN6A 3H90A 2FJBB 4ED8A 4F67A 4DFMA 3UE2A 3M7VA 3W2WB 1IM6A 2GJ2A 3L4BC 4DV4J 4R5PA 4Y34A 2UUBJ 2MKKA 2CG4A 1JQGA 4N77A 4KT0C 1M5VC 3W9IA 4KTQA 1Y4ZB 4JI3J 3BB5A 2GQQA 4IOAQ 3QJJA 4RNNA 2WVFA 2Y0SD 2ABYA 2QC3A 2VL1A 1ELOA 3NGUA 2O66A 1AB8A 4ZVRB 4OQJA 5D0RA 4RNMA 4X66J 3LW5C 3I0RB 5CZXA 4EYHB 3P49B 1IKYB 4OI1A 1NSPA 1YJTA 5J2PA 3UD5A 3MM9A 4PYDA 3AD7C 3A12A 3PW5A 1LW2A 4B3MF 4KGZB 1HPZA 1YQHA 3KUEA 4BLGA 1RYSA 1NHVA 1U2FA 1OYDA 2ZC4A 1HQ2A 1TV6B 2BRKA 2CJKA 1RKJA 4UF4A 4DL3A 3W2WA 1OY9A 3IBWA 4H4MB 4PQUB 2RU3A 3J7A1 1IWGA 4DSEA 1OIAA 2ACMA 1WHXA 4LRAA 3CCES 4JI2F 1C4CA 3Q8SB 2MB0B 3W7BA 4HVZA 1S4EA 2ACYA 4RO0A 5E2QA 3LAMA 8RUCA 1Q1KA 1YZ7A 4ZOSA 3AA8A 2OMLA 2MQLA 2E7VA 4DQPA 4RW6A 4QIGA 8ATCB 3J81Y 3W60A 1XK8A 4ECZA 3FC9A 4C3MA 2Z8QA 2LDYA 2BRLA 1G1XA 4O3NA 3FBEA 4M95A 1FNMA 2QO3A 2IJFA 2E9TA 1FVQA 1N36J 1GMWA 1UVIA 2WB4A 2D3OR 1XNRJ 7FDRA 2EBEA 2VIHA 3KHGA 5B0GA 2AJ4A 3NP5A 4PG8A 4M5IA 1SBRA 1WG5A 4F3OA 1RCXB 1RK8A 4DV0J 3DRSA 2H4WB 3P5TL 4CLSA 2BJ3A 1UFWA 3D5MA 2M5YA 4UZBA 4OZJA 3EMTA 3A8IA 3CDUA 3GFZA 5GAHI 4DU7A 1UEVA 1YZ6A 3RYLA 4ZPDA 4FPIA 3QT6A 1RABB 4S0MA 1K1SA 2AYEA 2OEMA 1X8DA 3DOLB 4H4MA 1S1XA 1B0PA 1YJNS 1QY7A 1D9DA 3FCWA 5ETSA 1IWAA 4OX7A 3Q8QB 1SB6A 4U6PA 3QSIA 2HFUA 4FXWA 2G9OA 4DV5F 2QMWA 4QWBA 2J6UA 4OZNA 2ZH7A 4NLDA 3Q8UA 2ZBQA 1IKVB 3A13A 2NPFA 4MH8A 2H48B 4OYPA 3RUBL 3R9LA 4LSNA 2CPZA 2CNNB 3P8BB 2GVZA 1I94J 1TKTB 5FDLB 3M2UA 4LIWA 4HT5A 4H4OA 2R7OA 3OL6A 2EFNA 3QGIA 2R3VA 1HQUA 3RBZA 1HNWF 3D1OA 1VC5A 3VAHA 4IOBA 2OD6A 8AT1B 3AX5A 3PEJA 5H9FK 2PE8A 4KB7A 2D3O1 1EETB 4WPAA 2Z2YB 2DHGA 3FK4A 2V4JB 1KBRA 1UL3A 4C48A 4KC5A 5ETNA 2XMMA 4J5OA 1JXLA 4MIAA 1MMNA 1IVZA 3OT9A 4USWA 3T1HJ 4GVLA 2DPIA 5LMNF 2IA0A 4TKTA 1Q79A 4A8MP 1RA6A 1F0XA 2HNZA 1P9YA 2I1RA 4CLZA 3GR0A 3DRPB 3CCTA 3V81B 3RW6A 3TVZA 2FY8A 4JUZA 4NXMF 3GIMA 3IRXA 1ZAVA 4WZMA 1FRKA 2ZZMA 2OIHA 2A2DA 4URSA 2FHMA 1WKJA 4MIWA 3R8YA 4DUZF 3TZXA 4RW4A 2YTCA 1U1KA 1T8EA 3VAKA 5KG6A 1P6TA 1N5YB 2YKQA 3CJKB 2C3OA 2X1AA 2CPJA 1QVFR 4C7QA 1N34J 3KG4A 1D8YA 3FQKA 2OPQB 5G0RB 4JI8F 1SC1B 3HXMA 2X51A 1JJ4A 2V4JA 5KFQA 2J0WA 5HMZA 1HBMB 1LW0A 3TX0A 2M3DA 2KYZA 4DLGA 1AUDA 4DR2F 3C15A 1RWWB 4J9PA 4ECWA 2BM1A 3TX8A 5HQ8A 2YNHB 5F9NA 2RRAA 1S9EA 4C98A 1DY3A 5HLFA 5IQQA 3I82A 1UWBB 3T9ZA 4QU6A 1VQ4S 1PYSB 2RMLA 2XLJA 2HNDA 4MKYA 2XC9A 1JIHA 2ERRA 2YKMB 4ZPCA 4FKYA 1YJ9S 2H51B 4WYWA 1BC6A 1SUQB 1S59A 1UJ6A 3TRGA 4WFYA 1MSWD 2FB0A 2CQ0A 5F8IA 3PYFA 1UW9A 4LSZB 4J9NA 1X5SA 1NNDA 3US5A 3T1AA 1T94A 4RNHA 1JLEB 3BR9A 1VMBA 1KOHA 3DLEA 3S1TA 3U1NA 4WK1A 3QZ7A 3VVTA 1GTEA 1R8PA 5IFMA 3PW0A 4L3NA 4JI6J 5JJBA 3KKFA 4FVMA 3CTRA 2QTWA 1U0HB 2QA4G 1VJWA 2OP5A 3NOGA 4JI7F 2HFVA 5CCMA 1TR0A 1R0BG 4MMOA 2VPZB 3R7BB 3M8RA 4KGKA 5IV3A 4OYWA 4F02A 4WFZA 2MXYA 2B4UA 1N5TA 4YOEA 4RW9B 1CC7A 2F3JA 2YNHA 4A8WA 1YBUA 1IKWB 1S7IA 4ZCIA 4DHVA 3NMRA 5LSLA 1LQ9A 2MKCA 4CLKA 3KHRA 4Y2IA 3B78A 3OJUA 2IJRA 1LV5A 3MUVP 5IZHA 4J37A 3K0JA 3P96A 4DX8H 2ZVIA 3KXDA 1Q7LB 4NLWA 1W2IA 5KG4A 5DRKA 1FTCA 2R8IA 3NWGA 1WHWA 4FF4A 3RGIA 5KFVA 4DR5F 5J2QB 1NK6A 1AFIA 3IR5B 1X31C 3M6UA 5D0HA 4HYKA 2OPRB 3QFHA 2A2CA 5KG0A 2LXIA 3L7UA 4J9MA 2PDAA 3LA0A 4FKXA 1RT6A 2HVZA 2BA9A 2KL8A 4LF2A 3ZO7A 3LWLA 3TEHB 2WB1D 3CJ4A 3VAGA 2LU1A 5L9XA 3IC1A 2B6AB 5AJ3J 2OJ3A 3AWRA 5IM0B 1B99A 4ZPAA 4UUWA 1PGZA 1DQAA 2CQBA 2HIYA 5J1EB 2BVZA 4QJVA 2G1HA 2ZWPA 3QAUA 1SJFA 2J5AA 1SJRA 1IKWA 3VWSA 3LP1A 2KFYA 2QA4S 2FC8A 3CD6S 2M52A 3A8JA 4GKKF 4EBEA 3CO9A 4DV2J 2GJIA 3CULA 1KTVA 4OZ0A 3TUPA 2RQ4A 3L3CA 1WSVA 1RT7A 5AXLA 4NA2A 2KM8B 3G71S 2ZE2B 4DR7J 1SJQA 3CJ0A 2Q79A 1AROP 4N76A 3V4MA 3G6YA 1T05A 1Y5IB 3OVAA 3PNIA 3SI8A 1RADB 2ZC3A 3LANA 5M2UA 4B9NA 5KFIA 2V94A 4TY9A 1JKHB 2WOMB 1TL1B 1O51A 2PSZA 4ZN3A 3R2DJ 2IBOA 3G96A 1WD6A 2B9XA 2DY9A 2GVDB 4FPRA 2AZ3A 3H5YA 3H98A 2CPIA 1VLOA 3DN9A 3NNHA 4N56A 4DR4J 2M4MA 2EPIA 5KT7A 3I9ZA 1N6QA 5HJYA 4ZLJA 3H40A 2DRBA 1H74A 2FVPA 1JLGB 1NM2A 4LF8J 2NYHA 1S9GB 1HR0F 3SCLE 1FJCA 4EGLA 3JQJA 4KY3A 4HKQA 2DNNA 4EUVA 2NXEA 1JNRB 1L3VA 1NPRA 3QGPA 1N4LA 1RT5B 3Q2TC 1VC6A 1Y5LB 1RXOB 2ADCA 4O0NA 3M2VB 2ZE2A 3ZZRA 2KFNA 4PCQA 3DHXA 1VGYA 4RLEA 3U02A 2UVVA 3D2WA 1CJUB 2AD9A 1TK5A 2OPSB 3EVOA 2ZH4A 3QBCA 3PDNA 5I42B 4XDDA 4DFKA 3Q24A 4LRFA 2YPZA 1S1UA 1WG4A 2J8SA 2BYCA 3GCXP 2Q6BA 4OZ5A 1FX2A 1PBUA 2XI2A 3JYTA 2IM3A 1FHTA 1RWVB 2CQDA 2P9CA 4M5DA 3C6UA 2AJFE 4OJGA 3AJ2A 5HP1A 4B3SJ 4LRCA 1KQGB 2KTQA 2HWHA 1CJTB 1RAGB 4CP5A 1TVRB 2JL9A 2YX7A 4NLGA 2VB6A 4AFFA 2BM0A 1J5OB 2RKIB 1W2BR 2EK6A 2GGPB 2VBZA 2PFFB 5C42A 2C2MB 1TKXA 2N3LA 2CAJA 2DNLA 3GMGA 5KG3A 4C0HA 5A2QY 4OX9J 3ITHB 2VF3A 3AH6A 3T5LA 3DGPA 4HR2A 2K2PA 3HMJG 3D7SB 1NH8A 1KQFB 1JLFB 1VC0A 3D6MB 4WK3A 2JDJA 5E5NA 1K47A 4KGMA 4P75A 1N5SA 1ZYQA 4DEZA 2C2ZB 2LLZA 3HVTB 3B4MA 3LP0B 4J9SA 1NK5A 5I42A 2JRSA 1IQTA 2CQ4A 1HYSB 4C97A 2O3DA 5DQHA 1U1PA 4ZPTR 4W90B 1VK3A 2GFFA 5BYSA 1MMLA 4RUBA 2AP6A 2ZFHA 1ZAXA 4CRJA 5KFNA 3BR8A 5J1PA 5KT2A 3C16A 3EVWA 3NRBA 1EP4B 2IM0A 3OQ2A 2C1EB 2KZZA 4DR6F 3MMCB 1BMQB 3NGDA 4F0KA 5HN0A 3UCGA 2PI4A 4UOHA 2A0FB 2IRUA 2UUCJ 3ITHA 4FNIA 1D8ZA 4TNOA 1WI6A 3R97A 1AZSB 4IFVA 1RWPB 1S6PB 3H42A 4X4UA 4KGXB 1R6YA 1JLFA 2OO4A 4ZVQB 5HSPA 1GX5A 3EM1A 1O0PA 1IBLJ 1LWEA 2J7KA 4LBPA 4WYLA 2BW7A 4GKJJ 1A7GE 4CO0A 5A8RB 2FQQB 3VZHA 3ISNC 3KK1B 1XMQF 5KFHA 2UVWA 3LUYA 2JLGA 1RT2B 4HL9A 4K59A 4PR6A 3T1YJ 2AGPA 2DGOA 3EWGA 2KYXA 4NA1A 2V67A 2MQOA 1VBKA 2FVCA 4MYUA 3AA9A 5F8GA 2MMYA 2JHEA 1JJHA 4O4GB 4OI4A 1ZM2A 2MZRA 1EKRA 4KR0B 3ENQA 3GSDA 4HACA 3M8ZA 1NRKA 2DNHA 1U1QA 2CVIA 3CCJS 4CCHA 3IR7B 2Z56B 1D1UA 3OFFA 3KUHA 2CA9A 2H65B 1ZETA 5F0WA 5AE3A 3W9HA 1HFEL 2UU9F 3HHLA 1DZ5A 3GYGA 1VBZA 3JSRA 3NGSA 1KVKA 2JEGA 3MM7B 2NXCA 1SV5A 4FXDA 5IXUA 4P6QA 1RT3B 3T41A 3OXFA 1RWMB 1P9QC 2E1RA 3G4SS 3ZFVA 3J80U 5KT3A 2QA1A 4RW8B 2RNEA 4DCOB 3TZYA 3MR5A 4ZN1A 2YNFA 3SMZA 4F4WA 1GXUA 1LWCA 4DZDA 4ERDA 2X1BA 3G8SA 2P2CB 3KTQA 3AQPA 3M4XA 3KWMA 1RAJA 3HKWA 3CDEA 4LFCF 3AQOA 4ED2A 5A8WA 3JSMB 2Z30B 4O4GA 2HS4A 3UN3A 2ZHOA 1FE0A 4FYXB 2P6TA 1FRJA 2XTJP 5DM6Q 2R2SA 1KRPA 3BQ0A 2ZJRQ 1TL7A 4ANDA 4K7QA 5D77A 4ELVA 4NEYA 3CCMS 3OL9A 2KDOA 1U1OA 1OMSA 2B8QA 3AX2A 2CZVC 1S12A 4GC6A 4YHHJ 4JP8A 2FTRA 4NWBA 1R6VA 2F7VA 4LF7F 4K4ZA 2F40A 1HHSA 4ZVFA 4AYBD 2D41A 4JBCA 2XMAA 2XQCA 1OQ3A 1X7VA 5DLGA 1HBOB 4PWUA 4RW8A 2ATCB 3H7HB 4ZP9A 4P9SA 3MGJA 1IR1A 4F4KA 4IQXA 2DHAA 2YNIA 5ETOA 2X7IA 3KDOA 4NE9C 2J7UA 2PIIA 1HWUA 2J8AA 1UJ5A 2CG8A 2P8IA 2XMWA 4O0IA 1VQOS 4K4YA 3H20A 2GA7A 1FKPB 3SSRA 3JSMA 1RTDA 4YB7A 2R7TA 4FNHA 2UXCF 3H2UB 2D9PA 1HA1A 4UTGA 2CUYA 1H2UX 2I5JB 1IN0A 2WONB 3E51A 3DOKB 5IT0A 3OJSA 1FCAA 4E2FB 1K0VA 3RJMB 2RUSA 2DR9A 1FKAF 1NLKL 4XAKA 2AMCB 1C1CB 4M5HA 1F3FA 3LOUA 1TUWA 4DR3F 4NYPA 1DQ8A 2B7CB 3W3SA 4KBIA 2HSEB 3FFIB 1WC3A 5KT6A 1S49A 2IYGA 1R8BA 4KSEB 2KB2A 2HFSA 1SCJB 3M8YA 2HHSA 4IO9Q 2DY1A 4W4MA 1AFJA 2E1PA 2LU2A 2G1DA 4DF4A 2DIUA 3HD2A 2J9DA 1UPMB 3RZAA 4B02A 2HHPA 3EDRB 2LFVA 4TLRA 1MN7A 4X64J 5B7WA 2AKWB 3FJ2A 4RBUA 4NCAA 4TU8A 2OH2A 1JXEA 4K4WA 2D68A 2FD2A 1UTAA 4PUOB 2P9EA 5BXIA 5I3QA 2L9WA 4LF4J 3PW4A 2BQ3A 4TU7A 3N0VA 2K1RB 2W7AA 5HBMA 3R6LB 4FBUA 1Q5VA 3WBZA 4DUYF 3OSPA 2G0CA 3BN7A 4BDPA 3CJ5A 1LWXA 3BQ1A 4YFUA 2I5JA 4CTAB 2R7QA 2WONA 4YR0A 3DOKA 1NJZA 3GILA 1CS4A 2MQ8A 1L3SA 5L1JA 2LQ9A 1JLAB 2F8MA 1SKUB 2WAQD 1TU0B 2YX1A 1URNA 3M32B 3EICA 4ZP7A 3H0PA 2ROPA 3FFIA 3TZWA 5EWFA 3M6XA 1RAHB 3W8GA 5HVGA 1Q81T 2FIUA 3M8QB 5DLFA 3GTYX 4JI3F 1H73A 2OUGA 4EBDA 4MK8A 1G7CB 3QRQA 3ZNUA 1LWFA 4QYZJ 1QUPA 4E8UA 1X5TA 3R1LA 4WFXA 1CQNA 3GU0A 4WZQA 4IH5A 4DL0C 5H9EJ 4ID5A 3QZ8A 2PFDA 3DRRA 2YY3A 4X66F 2RF2B 4NLUA 2HHUA 1DLOB 4OV1A 1GMVA 2KJVA 5BJRA 2ZWOA 2GIRA 5KG5A 2HVIA 3RAMA 3CDAA 4HDGA 2IRXA 2CPEA 5HJXA 1S0VA 1YRUA 4ZA1A 2Y1IA 3BGOP 3G87A 2JC0A 1NZAA 3SEOA 4DUTA 3GONA 2JFDA 4CTAA 4OMFG 3OFHA 2YKNA 2R2UA 2IFXA 2GAHC 3O2IA 1MW7A 3HSGA 2ADBA 2YWFA 4FDFA 4F4AA 2LQ5A 3M32A 4TY8A 2MKHA 5HO4A 1VJQA 3A4TA 3KJVB 4F36A 1RKIA 4Q45A 4PG7A 4WFNQ 3HSJA 3O8WA 1FFSB 3ZTOA 2DR8A 1BQNB 2HBQB 2NPIA 4LR9A 2AX1A 3ISND 1U6FA 1N32J 4G1QA 5D0GA 1HQEA 3LP2A 1PG5B 2Z58B 1FWPA 3HFVA 3FUYA 4F25A 2BW2A 4X62J 2RF2A 3PW2A 2AU0A 1NK0A 3BDEA 1XERA 1XNRF 3VAIA 5LL6d 1UVNA 1UVMA 1CJKA 2FZKB 3EZOA 2OPPA 4L6V3 4RBVA 2J9EA 3NWRA 2HGNA 4AE5A 3BV8A 4MK9A 3F56A 1S1VA 4DWIA 3QLHA 1NSQA 2XO7A 4ITSA 2KFZA 4NASA 2J6TA 2ASYA 3KDNA 1S9FA 3GR1A 3MD3A 3MAHA 5C25B 4NLYA 3CJ3A 1EQMA 3ZZZA 3MOZA 3CDWA 2VG6A 3W5YA 1S0NA 1WDDA 1REVA 4WP9A 3GLJA 1QVGR 3QIPB 1CQMA 3Q8YA 1AT1B 1VRUB 3PO4A 4C11A 4ZITA 1BGXT 2LXUA 4XK8C 1F6TA 3JTOA 3PV8A 5K8MA 4USVA 1TMMA 1KFSA 3KG0A 2ILYA 2BX6A 2PGCA 3K5OA 2FLPA 3EYZA 1HI0P 4X4PA 1FDBA 4ILLA 3G86A 4JV1A 1E6VB 4CLTA 4OYZA 1IBKJ 3PX4A 4LSLB 1BLUA 4ED0A 5EN1A 2EFOA 3D1HA 3EDQB 2E9ZA 4P2FA 2VZ9A 3PRVA 2B9YA 2MKYA 2OD4A 2YKOA 5HQLA 4M94A 3WIUA 4DSFA 2D9OA 5HANA 4PABA 4RW7B 5C25A 1WWHA 1T03B 4KO0A 3CC7S 1RQ0A 3N6MA 5HATA 4AT1B 1VISA 3MPYA 2CJQA 3MXHP 1NHKL 2X3DA 3T1HF 1K9MT 2IVMA 4OZ3A 3AXKA 5DDOC 4YB5A 1R31A 3JXOA 3KLEA 1WTFA 4CH1A 4R8UA 1YX2A 3D67A 2L3MA 3RTVA 2PMZD 1ZTWA 1RTHA 4BWMA 1NKEA 2QN6B 1HD0A 1NAQA 2HHHJ 3Q89A 4M8LA 4NXNF 3TA0A 1C4AA 1KC8T 2QGFB 2XSJA 3AOCA 4EU0A 3BO3A 3G2XA 1D9FA 2N4CA 1TL4A 1M5KC 1RHUB 2KXHA 4DFJA 4A8YA 2ZKUA 3T6JA 2CQIA 1FXRA 3OFGA 4A47A 1TP7A 2EI5A 4GMKA 3VZIA 2E5IA 2GAGC 1PSDA 4AL5A 5HMYA 3UD4P 3EPGA 4L72B 1PJ6A 4KPYA 3IWXA 2HHQA 3DYAB 1RACB 1RISA 2RH3A 4C8NA 4CH7A 4PG5A 4MKVA 4NRTA 3OL7A 1V3SA 4DV3F 4IDKB 2FJAB 2PMHA 4DG1B 3OR2B 3C46A 5AE2A 1RU2A 2QRRA 2X1FA 4NCGB 1CC8A 5CAAA 3IGNA 1RTJA 2HFOA 5F41A 1RWOB 1OM2A 1U6BA 4ZLNA 5B0BA 3UN2A 3KLFB 3FZBA 1J5EJ 3GZ7A 2ZOMA 1N0UA 3R27A 2CJAA 4UZCA 3ELHA 1BQMB 1EZZB 3ONQA 3EXCX 1MWZA 2E1CA 2FJEB 1UEUA 4A8OA 1IJEB 1VQ6S 3OLBA 4Y00A 4JI6F 2KVIA 1OS5A 1LFPA 5GAEU 4TLQA 2HHXA 2FZGB 1XJWB 4NOHA 3OFEA 3MWBA 1RGVA 2BE2A 4RU2A 1UMJA 2DGVA 1EARA 3OXLA 4Z37A 4WTYA 3HVAA 1M1GA 5DQIA 1UWAA 3P4UB 5IOLA 2Z57B 5DG7A 2MQMA 2V4QA 3BBBA 5JVGQ 3EUNA 1QLNA 1B7YB 4IDKA 4DV1J 3NG8A 3OHAA 3EGVA 3OR2A 2UV8G 2ZM6J 3MMBB 1S1WB 1K73T 4ILRA 4ETZA 3TJ8A 2Z2MA 3EZ5A 3C66A 3L95X 2BANB 1JLCA 1U6ZA 2W2QP 2GMLA 2FZCB 2KG1A 2XG8A 3N5BA 2IM1A 2EKYA 4QPXA 1U2CA 2YKAA 5CCLA 3FCHA 1XBWA 2AQ4A 1DHMA 3IM9A 1VFJA 1WELA 5AJ3F 1PILA 1X5PA 4X4OA 2GNKA 5T7LA 3DLKB 4C2MA 2COLA 3EJMA 2MSSA 3ZTRA 2P9GA 2XEXA 4MK7A 1KFDA 5I3UB 5F8JA 3IA0A 1SQGA 2V1TA 5C7PA 3FMWA 1YJWS 1WC5A 1YKWA 1TK8A 3AOBA 2J6SA 1DQ9A 2GHWA 4JI5J 4B17A 3QAEA 5EX0A 3EX7B 4IRDA 1Y11A 4PPZA 4DV2F 2KKHA 5THWA 2MQPA 4OYMA 1QE1A 3IS9B 1U0SA 3JQKA 3IAM9 4NYOA 1RDRA 4LRBA 1S99A 1H2VZ 2BKOA 4I6YA 2M2BA 2QL5B 5A0YA 4AD6A 2VASA 2MZQA 4Q43A 2DISA 4A46A 4ZJLA 1ULRA 3MFIA 2BANA 3PZPA 2XTCA 1R0AB 3KLIB 2VH7A 4L75A 4DR1F 4WIIA 1C0TA 4Y2KA 2CZ9A 2YXLA 1U49A 1XMOF 1VQ7S 4ELTA 4F7VA 3SFUA 3ZZ0A 1Q8KA 4X4RA 3MR2A 3LTOA 2R8GA 2MKJA 4O3PA 1Y7PA 4WJBA 4NMLA 1CULB 4CLFA 2MY7A 1RB0A 2W9AA 4ZVUB 5I3UA 3HLUA 4NZ7A 2XS7A 2VJUA 4ZVSB 4TVAB 4LF8F 3KLGB 1YJVA 5L1IA 4U7CA 3MAAB 1QUVA 3UPFA 3MEGA 3LF0A 4FN5A 4A8QA 3TOQA 4DX5A 1K1QA 3C3LA 2MJNA 3W9JA 1NDPA 2EFQA 4V19X 3EZUA 3RRHA 1WOPA 5KFUA 4DBQA 5HVHA 4YR3A 2J9DE 3MR3A 5K5MA 2RRBA 3PYEA 2IVFB 4IH6A 2DNZA 2BV3A 2HQIA 4DZ6A 4E98A 1FT8A 2B7BB 4KIAA 4JI1J 3MCNA 1CJVB 1B0TA 1T02A 5EX3A 1LOUA 4XTTA 1S48A 4J9UE 3A8EA 4F2RA 4Q0BB 1SVDA 2VDHA 5KFTA 3DGVA 4I2QA 1FDDA 3M1VA 5J2MB 4QYRA 4M5NA 1RAEB 1R8CA 1QTMA 1Z1ZA 3O44A 2VQEJ 1NPKA 3A8KA 1CULA 1FNXH 2YBVA 1RT1B 4B3SF 1HMVA 4F50A 3QIDA 2HRUA 3DHWC 5MLCV 1C1BB 5CHCB 4I7FB 3P3DA 4ETXA 2B51A 2W2NP 3POTA 3KLGA 3RB0A 3UD3P 3MMAB 4HEA9 3MCMA 5GAEI 1T9WA 2DNPA 2RQCA 4OHZA 4N47A 3RR8A 4OX9F 2HIQA 2RDIA 2B4OA 1MU2A 3VGUA 3LAKA 2F1FA 1U26A 2PA3A 2QLWA 1SIZA 2HAIA 1HD1A 4PPDA 4FYWB 3R5AA 3PHEA 3M9OB 4TYAA 2W7OA 4FS2A 4QR2A 3FGVA 3KLHA 4O44A 1TKZB 4ECTA 1RHKB 1T3OA 4A4JA 1W7WA 4RUHA 1KLMA 1N56A 5ETPA 4BHQA 4Q8FA 4WU2A 3CJ2A 2R2TA 3PYGA 2AEFA 1FTRA 1KWMA 5LMUJ 1S0MA 4QZVB 5JXSA 1VQNS 3J81j 3UVJB 4BS2A 3GIRA 3FBCA 1T9YA 2AGOA 3CVKA 5DDPC 3TYTA 4K5SA 3NBPA 4Q0BA 4U8YA 1HBNA 2HLUA 3L7OA 1DAXA 3MUMP 5J2MA 3ZTPA 3LWMA 2POKA 2V68A 3SQGB 4JI2J 1C1BA 2MYFA 4YDDB 1X4GA 2VG7A 1YRTA 2DK2A 4CDIA 3JQMA 2WSCC 4JI0J 2PD1A 2LYVA 2R9LA 3MR6A 4EZ6A 4Q7AA 4ICLA 2UUCF 1B4SA 2CQPA 2R7UA 4KKOA 1AXQA 1HWKA 3E2EA 1KDNA 5D15A 2P5VA 2B5JB 4B08A 3D9BA 1SIWB 2BR0A 2IAJA 1OPIA 3A3OB 2CPDA 2DEIA 1JLBB 4I2PA 2HFNA 4OHWA 4PXDA 3ADAC 1LKZA 2W24A 1IBLF 2IBKA 5A8KA 3E3XA 4GKJF 2UZAA 3SSSA 4CT8A 1DTQA 5E3CA 2WRMA 5LOQA 5SZTA 3GV5B 3MEDB 3T1YF 1HNIB 3VQSA 4Y2AA 3QRPA 2B0GA 1WC0A 1F9FA 2Z2ZA 1PJ5A 2JSXA 2WVBA 1H3DA 4CNZA 1WTBA 2GIQA 4QCLA 1OQ6A 3BBFA 3K17A 5CZVA 1HNVB 1Q82T 2XWXA 2LKZA 3AX3A 2P6SA 3PW7A 4DL6A 1FKOB 4NI2A 1BXNA 4QU7A 5KT5A 3KK2B 3AD8C 3VTIA 1VR6A 2ZHAA 4XO0A 4TQSA 4ED5A 2G4BA 5L8RC 3W5ZA 1E6YB 1JLBA 3CUNA 2W8LA 1HL6A 2VU5A 5KFBA 2Y1LB 3I87A 4ZCMA 2AV5A 5ETMA 2FUG9 2R8KA 4M5LA 1HNWJ 1R27B 1D9AA 4IG0B 3H8YA 2V0NA 1RYRA 5U47A 1REGX 2APOA 1D0EA 2F4VF 3NKYA 3RRGA 3K7RA 2KT5A 1S97A 1NB2A 1RZMA 3NAHA 4B3OB 3MEDA 1OYEA 2VA3A 5F8LA 4B9TA 1M1HA 4IO1A 1HIYA 1JLQB 5DG9A 1SL2A 1RI7A 4DV7J 2VICA 1CEZA 2R42A 2BJ7A 2Y1JA 1RHMB 1SJ1A 1BWVA 2YVSA 2BJ1A 1X4AA 4F4ZA 4ZPVR 3MM5B 1AYEA 1HNVA 1FVSA 2AF6A 4C0BA 4B3RF 5LMNJ 5KOWA 1X4FA 4P73A 4DDFA 4LREA 1YLXA 2XGQA 2AEMA 5B08A 1HWJA 2VHGA 2ZKTA 3D4JA 3DKDA 5MAOA 5ITHA 2DO0A 3MI7X 3DCAA 4DF8A 3BN4A 4NXMJ 4C6AA 3BH7B 2ZZTA 4JB8B 2AYGA 4GVBB 1E6YA 1PC5A 4PWDB 2XYPB 1ZZFA 3TJAA 4KAIA 2HS0A 3F41A 3B54A 5KFXA 4WWSA 2HGLA 1RJJA 1N5QA 3BGUA 5E41A 3FSYA 2OFHX 1TK0A 3MURP 1ZAWA 2CXEA 3NS6A 4FYDA 2F9JA 3ENVA 2AJ1A 1ROFA 2GX8A 3WC2A 2MGZB 4ZVOB 4UOFA 1RTIA 3UR3C 2CJXB 1XNQF 2Y8WA 1I3OB 4DQQA 3BYRA 1EJ7L 3DOMB 1GMWD 1BQXA 3TAMA 3VQTA 3ZZPA 4KYZA 2XGPA 3FMBA 1SL0A 3MM6B 1KP6A 1RHQB 1UVJA 2NUHA 4ED3A 3R5JB 3HVWA 1R7IA 2IDLA 3N01A 1Q0NA 1FK9B 1YK9A 4PG6A 3C14B 3SCKE 1YBAA 5AXMA 3CMAS 2R7XA 4QWAA 1HI1A 5C5JA 3DU5A 1PYTA 2WW4A 3K8WA 5I4MA 2I6WA 3GE9A 3BGRB 4TN2A 3OTCA 4Q2MA 3ILJA 4V19J 1YBTA 4D3HA 5KFSA 2KM8C 4JI7J 3QWUA 2DITA 1RAFB 1VI7A 3ENWA 4LF4F 4KV8B 5K14B 1ZBTA 4JYAF 2DBBA 4NLOA 3I0RA 4J91A 4DL5A 1HNXJ 1YTYA 4BC9A 1IKYA 2W2PP 1IXKA 4H4KA 4KRWA 3M8PB 1Y3KA 4O3RA 4CO4A 3IN5A 5HVFA 4RU9A 2MZSA 2QV6A 2XLKA 1WF2A 2VG5B 1TV6A 4DSJA 3FBBA 3SDEB 4J9LA 1EIYB 2E1AA 4QR1A 4PQUA 4DR5J 3BREA 3VR1A 2C3MA 1FD8A 2EC0A 1L3UA 3MCOA 2R7RA 3MAQA 1S72S 3N6LA 2W9BB 3MEEB 1WKLA 2AWZA 4LBIA 3OUYB 2LCWA 4LMZA 2CWKA 3UW1A 2VBXA 2DB1A 2XTEA 4LQ3A 4G1IA 5DGBA 4ZKAA 1WEXA 4UUXA 4B9UA 3CCVS 2NXJA 5EGYA 1QM9A 3JB9k 1PCAA 2KJWA 4Y3CA 1X0PA 3V6HA 3EGWB 3QGGA 4DX7A 4I0WA 1HKAA 3BZQA 4I67A 2ZNYA 5KFMA 4O3SA 3K5MA 3M2RB 4GKKJ 4P7TA 1UW4A 1TAUA 2HRYA 3BYPA 4OX8A 4U67Q 1TQLA 1YJRA 2YKPA 2YNGB 3HHEA 3PHTA 2DRDA 2VG5A 1WC4A 1KOOA 5AT1B 3L09A 3TUZC 2CQGA 2Z4PA 1IR2A 4QIFA 3DOLA 3FEYB 4USJC 3R7SB 2K3KA 1S6QB 3IFEA 1SH0A 3WDOA 3J7Z5 2J0XA 2ZHBA 4CO1A 4Q2LA 4LF5F 3T5JA 5GAGU 4UY85 4IUFA 1DTTB 4YN3B 1NPPA 1IKVA 2N7CA 4K2XA 3CD5A 4PRFA 3CPWR 4HTJA 2DJWA 2EFGA 4X62F 3HHDA 4GRSA 3BGLA 5IWAF 4OJ3A 2W9CB 1TKTA 5D3GB 4ATNA 5GMKa 5FDLA 5CABA 1TUVA 4PWWA 2E5LF 3CXCR 3MZIA 2CJBA 2F8HA 1HR0J 2HVHA 1KQKA 2MLZA 3UDCA 2MZTA 2VODA 3VALA 4PZVA 1TMJA 2C3PA 1G3OA 3FQLA 2A18A 2V9KA 3N9UC 2H54B 5HK4A 1WG1A 3K89A 3K5NA 2B9WA 5CYJA 1EETA 2VPWB 5ETRA 5H1SV 1PKUA 3I0SB 1YIJS 1RWNB 2UXBJ 1GNKA 4K0KF 2AZ1A 4CH0S 3LGNA 1TL5A 3KK3B 2H4YB 5LXYA 2NLWA 3M30B 5AXKA 4P2SA 3ET6B 1QAXA 2GC8A 3B6BA 4BCAA 3BQ2A 4XIUA 3DDIA 1DTTA 1WOOA 3SV3A 5FLXU 3D54A 1SQEA 3DRPA 2NSBA 3MM8B 3V81A 4FVCA 3QT8A 2HZVA 3MD1A 2VFRA 3G6ES 5B0FA 3HHLC 4JV5J 5E3RA 2LECA 1BHNA 1DBDA 3D66A 4N41A 4OLPA 1F1BB 4I69A 1VQ5S 1RCOB 2ROEA 4QWCA 3GJQB 1V3RA 3W64A 3K5PA 2ZBRA 3V6DB 1KLNA 2DH7A 2HVEA 2QZ8A 4ES1A 1N5YA 2RILA 3N79A 1T9XA 2V2QA 5KTQA 3CJKA 3EGNA 1X4EA 2QLFB 3QO9B 1VHIA 4LVOP 2F8EX 2OPQA 5G0RA 1WEZA 2H5EA 2LQJA 4X4NA 4QOTA 2LXFA 2CWXA 2MJUA 5LM7E 1HBMA 3D3CJ 4B9LA 4ZCLA 3U1LA 2A1BA 3V6JA 2BJ8A 2C2DA 1VYAA 4MIBA 3QFWA 1UWBA 2J9CA 3L9ZA 3WX8A 3BDPA 4NRUA 1S6OA 4KGVB 2XMJA 1VQYA 2YKMA 4P74A 3J7AN 1Y0HA 3MM8A 3UR0A 1SUQA 2HNYB 4ZIVA 2F63A 4AXJA 3PRDA 3QT5A 2KRBA 1SKWA 2MLXA 3B82A 3DMJB 3AT1B 2O1PA 3OD2A 3FRYA 1BD6A 4O4RA 3PR4A 2GO9A 2CFXA 1MROB 2B43A 2QMUB 1RLCL 3OTDA 1JLEA 4WE1B 4Y65A 4WP8A 2XNQA 1GFWB 3SFGA 1UFKA 1RAIB 4LFBF 2ZOFA 2DVIA 1YJUA 3TANA 4Y2MA 4HH0A 3QSYB 3VGSA 4HI2A 4LF6F 1U0HA 4LJMA 1RWXB 1U24A 1WUUA 1JJ2R 3Q22A 2QL9B 3LQVA 2B4PA 2NZ4A 5SUHA 5CYMB 5KFAA 4X4SA 1VQKS 2QLXA 4RW9A 4HI1A 4L3KA 3H25A 1TL3B 2XS5A 1YJ7A 2QG9B 2LQBA 1XMQJ 4Y28C 4ZCKA 2NQPA 2KT2A 4CYUB 2FJDB 1ZM9A 5GADU 2E1MC 3BGFA 4A48A 4P52A 2JWNA 4HLBA 3HKZD 2L9NA 1WOSA 3NEKA 1J5EF 3W8PA 1GX6A 3FNNA 2BJDA 1QSLA 1HNZJ 4P10A 2EVZA 1X9MA 3AB2B 2BEFA 3K5LA 1FDNA 3OR1B 2BE7D 2W8KA 1KQSR 5J2QA 1NK7A 2CQCA 1Z2LA 1TELA 4OYIA 2FJVA 4LQ9A 4KHPJ 5GAGI 3DDKA 1X9SA 5L9NA 2OPRA 4DL4A 3TAPA 1H0HB 3UCZP 4UQGA 2ROGA 4MFBB 2MZ1A 1N0VC 3FSXA 4ZVPB 3U1MA 3I31A 5H9FJ 2B6AA 4J9RA 1F2GA 2RQMA 2BBEA 1RSCA 5JVHQ 4LF9J 2UU9J 3I5BA 5IM0A 2FJWA 1V9OA 1BUXA 1U1RA 3P5BP 5M2RA 1RBAA 2RHSB 5J1EA 2EK1A 4DV1F 3ZTQA 1TL3A 4ED7A 3E01B 1S1TB 4ES2A 3KMSA 1S5ZA 3AOAA 1OY6A 2QLBB 1GK8A 2Y0BB 5FD1A 1U1NA 4EWTA 2DR5A 3N4WA 4IQMA 4DXLA 4F3QA 1M90T 5HAOA 3PXGa 2QYCA 5EDWA 2CQHA 3OVBA 4PXBA 4OYAA 2V2ZA 1Q16B 5C2GA 2DH9A 3C6TB 1R89A 3DFEA 2J7WA 3J80Y 5K8NA 4CM0A 5E33A 3ZZUA 2M8DB 1M1KT 3I5AA 3SQOP 2BQUA 3C8YA 3DDNA 4UQTA 4MKAA 3W66A 4I68A 4ALZA 3KUGA 4X4VA 1Q95G 1JKHA 2WOMA 1X4BA 1TL1A 1VOMA 1FJEB 1S6UA 3M6VA 2GVDA 1U09A 1U48A 3DRYA 2CQ2A 4HHUA 3PFOA 5B0CA 4OJ1A 2OMOA 3TUIC 4LF7J 1JLGA 2CYYA 1V5VA 2CNLB 1VCTA 2YWKA 3GCWP 3UI3A 3PIPQ 2IY5B 1X4CA 5BYRA 4DPUA 1S9GA 5LSRA 3IG1B 5ETKA 3OTEA 2VQFJ 5L1LA 1D3WA 5HROB 1F60B 1XEZA 3NAIA 4CO2A 1KKHA 2JZ5A 2YQ3A 4ZJQA 3SCIE 3JSBA 3BKFA 3FRZA 1PAUB 1UZHA 7FD1A 2V69A 2L08A 2CQ1A 1RT5A 1KR4A 4DS4A 2RHQB 3CC2S 3W1YC 3M2VA 2NUUG 3C6TA 3G8TA 3CCRS 2SXLA 4ZIWA 3HVRA 3TEGA 1ZPVA 1CJUA 2OPSA 4RUCA 1NMEB 2UXCJ 2FHJD 1YG0A 5EWGA 4ECXA 4R5PB 2EFVA 3GWCA 1H7WA 3CJTA 1NBEB 4GO5X 2H5IB 2DRAA 4ENOA 4OHXA 1YSJA 3T6BA 1DRZA 2V8VA 2CDQA 3ILOA 2KZMA 4X4QA 4LIRA 3VV2B 5BR8F 1LXJA 4EYIB 2Q1LA 3QATA 4F2SA 3OLAA 3A1YG 1Q7YT 4DMZA 3QJPA 4JV0A 2DGXA 5D4LA 1CJTA 2V50A 2MPUA 1TVRA 5M2PA 3M8WA 2R7VA 3RB3A 3UFCX 5DQGA 2AW0A 4C3LA 1J5OA 2RKIA 2GGPA 5KFYA 5HROA 3M9MB 2FC9A 1HW8A 1YRXA 4WXOA 4DV6J 2VBWA 5A6WA 3GQCA 2XY6A 3PVXA 4G1PA 1PC4A 4ANCA 5J2PB 2WSEC 1ZH5A 3MM9B 4M1KA 1LW2B 4OZ1A 3HCXA 4XPCA 4ZVEA 4I1TA 2K06A 3ULHA 2WHOA 2ZNZA 2ZOGA 3HVTA 4FF3A 5GADI 3LP0A 4HDHA 4OFZA 5IT9Y 1T7PA 1UFLA 2NXNA 3WHIA 1WSRA 1RBOB 2XCPA 4USMA 3Q8VA 1LK5A 1O6XA 5KFJA 3HJVA 2G13A 2GMJA 2KN4A 3TQEA 2HQGA 2HWTA 1HYSA 2VQEF 1LK7A 3RBXA 3HZGA 2KXFA 3H5SA 5I3PA 4CM2A 1KEKA 2MTLA 2HEKA 2NSCA 2EKNA 1KNZA 2VFTA 3ILIA 2RJZA 3J7YU 4RW6B 3Q0AA 2CZ4A 1EP4A 1H72C 1O8BA 3UNYA 3QPIA 1RHJB 3K59A 1QJHA 3GIJA 1KVJA 3MMCA 3IRWP 2O01C 1WEYA 3JSYA 3GJTB 2GW8A 1AZSA 3GSIA 3TA1A 1S6PA 4W92B 2HK3A 2MEWA 2DXEA 2OEKA 4DN9A 2FHOB 5LMUF 4HH1A 2XBPA 2VPYB 3UN5A 3DRSB 2HYIB 5KFZA 3DLJA 4YDXA 3KOAA 5A8RA 7AT1B 4ECQA 1IKXB 4DLEA 4ZHRB 3KK1A 2DGTA 2YPYA 2VDIA 3OXGA 3JS9A 1GMUA 4C3KA 1IM4A 2RQKA 1S1XB 4FYYB 1RT2A 1WHYA 2ZITA 1TUGB 1RAAB 3GIIA 2VOOA 3D68A 1Y3JA 4X65J 3U27A 4JI0F 1B3TA 1Q4RA 1EQ0A 1Q78A 3S01A 4FYVB 2IA6A 5KFCA 1FRMA 2NREA 2OSRA 1IUJA 5FJ4A 4LSNB 4IKAA 2G0IA 1RTZA 2EG1A 3I55S 2GVZB 2FVQA 1PAEX 4U9RA 3M2UB 4KFBB 2OI2A 4H4OB 4LFAJ 1WC1A 4FXVA 1S7HA 2CKWA 3TUJC 2GIFA 1TKDA 3IWNC 1HQUB 2VC1A 3GJSB 2XSFA 3D6HB 4Z7YA 2ZH5A 3IXQA 4DQRA 4CWBA 2F65A 2KO1A 5JUMA 1U25A 1FXDA 2QX0A 1C0UB 4EZ9A 2R2RA 3MM7A 2GCFA 5KT4A 1RT3A 1IKXA 3HI9A 3LO3A 1FJ7A 4ZHRA 1X9WA 2FPHX 4B3TF 3TARA 1Z4UA 1SC6A 2UUAF 2M8HA 3N28A 4JOUA 2XNRA 6AT1B 2W2OP 4A8SA 2QLJB 2W4PA 1RHRB 4F4YA 3A3PB 4DSIA 1F3VA 2OKQA 2WVDA 3MPWA 2DNKA 4YY3F 3HM9A 2HNZB 2RAQA 5J1NA 4TU9A 1CBKA 2QEXS 2BOPA 4RR5A 4C9DA 1JB0C 3IRXB 2ZVSA 4KFBA 1SPBP 1BE4A 2MY8A 1VQLS 1RWKB 4RW4B 2G2ZA 2PA8D 3AJ1A 2HS3A 2JEIA 1VK8A 2XYGB 4AQYJ 4CIOA 5LJ3Y 4HHHA 4I6WA 4USUA 2C28A 1M5PC 1URRA 1JWWA 1C0UA 3CE8A 2KU7A 2MHEA 3BO4A 4L74A 2VD3A 1HBOA 3RU0A 2A6MA 4MAKA 4R25A 2C42A 1LW0B 5IT9U 4DV7F 5DZ6A 3C15B 4OHYA 3FEXB 1S9EB 2ZJPQ 2ZH1A 1WACA 2K7JA 2XI3A 2LQ8A 4K5RA 2HGMA 4IG3B 5HLFB 1XWLA 3IP0A 2HNDB 4PKDB 3MMJA 5KFWA 2CPHA 2CRLA 4K4UA 4IH7A 2GO8A 4ECYA 2UXDJ 4KQZA 1XC9A 1FKPA 4Q8EA 5E3AA 2BMBA 4QW9A 2V8DA 2WVCA 1NDCA 5ADZA 2ZEJA 4TXSA 5L39A 2O5DA 2DNMA 2OLWA 1S57A 2HHTA 1S79A 3KYLA 4DV4F 3MECB 2QYGA 3CB4A 4NLRA 1Q8LA 2UUBF 1C1CA 3W63A 1YWXA 4OJHA 3AFGA 2GMHA 1SC4B 4DN0A 5CD4H 4NXNJ 3UQSA 3CCWA 2NZCA 4XDCA 2VV5A 1H6KX 3DLEB 5D6GA 1MWQA 4CT9A 1RAOA 3J7YI 1WHVA 5DZ7A 2CIMA 1JJCB 1H98A 2DGUA 3BM7A 1FWLA 3V6KA 3I4PA 3R3TA 3I5CA 3D28A 2XHWA 4ZMMA 1BY9A 2I38A 3VF0B 4ED6A 3KJNB 4A8FA 2DPJA 3AB4B 3M6WA 3N5FA 3DLGB 4USIA 4ZJOA 4U7UK 3PYDA 4Z2XA 3R1HA 3DXSX 4ZP6A 2GHPA 2XTDA 3KMQA 3ZZTA 3LGMA 5KFFA 2DNOA 4IG3A 5E7OB 2JLFA 4ID8A 1WC6A 2Z2LA 1W25A 1U02A 4GO7X 2F5GA 4PUOA 3TAQA 3SBMA 3THPA 1WI8A 1OSCA 4DV3J 4MKBA 2K1RA 3IMQJ 2HBYB 1NUEA 3SZ2A 2ASJA 3I4HX 4DL7A 3D1QA 1NEEA 5KAKA 2IIHA 3CIZA 2BUNA 1U8SA 4R0JA 1EB0A 3M8SA 2LP4A 3MECA 4LR8A 4EO8A 3IAS9 3J81U 1ZA2B 5KFEA 1JLAA 2MZJA 2NCKL 3TW0A 3JAMY 3CMES 2DTJA 5D4OA 1PO6A 3NCPA 1RT6B 4BWJA 3PJWA 2BE9B 3M8QA 1RP5A 2RD5C 3K57A 2FYXA 5DDQC 3OBIA 3BSNA 4HT7A 3PJ9A 1CPZA 3ENAA 2A3JA 2EW9A 1UCNA 2E29A 2XMVA 3Q23A 4YP3A 2KI2A 3DLGA 2J0SD 4CLLA 2DXDA 1WNEA 3CCUS 1N36F 3M9NB 1IBMJ 3VAMA 1DLOA 2HQDA 2HURA 1HNXF 3ZZOA 3WX4A 1UVLA 1EX8A 3LP1B 4L73A 4P2XA 1SQFA 2DO4A 4Y0FA 2R7SA 4DV0F 3DC2A 4CLWA 2DYAA 1J27A 2DIVA 4URQU 1T11A 1F9EB 4OYBA 3IBCB 1RT7B 3B8HA 4CO3A 4Y2CA 5C2CA 2UP1A 4KE5A 1UP1A 4MYTA 4DSLA 2QFIA 3D0GE 2FGOA 2YQ0A 4ECVA 3IR6B 3KJQB 2I9SA 2W4CA 3OW2R 1T05B 2BZ2A 5A6PA 1R0CB 4CNYA 2L41A 2Y8YA 5A76A 3T5KA 4CZCA 2FVRA 1B7FA 3SXLA 4I4BA 3OV7A 3KJVA 4YB6A 2DT9A 1I6JA 3UDVA 4F26A 2CNOB 1BQNA 3TNVA 4PQAA 1N6QB 1N52B 2ZD1B 3DU6A 3HZEA 2QA2A 3TP2A 1APSA 1I94F 4J9OA 4ED4A 2XY5A 2W1BA 2AIRB 4B9VA 1N88A 2X1GA 1ZOTA 3U7JA 1XTZA 1NK8A 1VHFA 1FX4A 5CA5A 1ACMB 3HULA 3O3LA 2MQQA 5E3PA 3NXZA 3IWLA 4OZLA 4OZ2A 1KSPA 1EKSA 2DNYA 3BH6B 1T3NA 4NZ6A 2C3UA 1ZM4A 4ZLPA 1ZTTA 3Q8RB 4A8KA 1XN9A 4DQIA 1FNOA 4QWEA 3DXBA 4M63A 5RUBA 2XMKA 3Q8PB 2BDPA 4DR1J 2DR7A 1XMOJ 3RB4A 1S1UB 2AJQA 3QIPA 2ILZA 1VRUA 4V1Ak 4RNOA 3JYTB 3CCZA 4NA3A 3HT3A 4ZPBA 3QJLA 3BO2A 4M5DB 2LA4A 2KRRA 1VQMS 3R7NB 2ZD1A 4F04B 1KD1T 3C6UB 3OTOJ 4RL1A 5HP1B 1CLFA 3TI0A 3NS7B 4EFAC 2VKZG 5D8HB 3H5XA 3GFXA 3K2YA 3ZNJ1 3NCQA 1M5SA 3FKBA 2LMIA 1FA0A 4K8RA 2Y9HA 3RB6A 1E6VA 2KT3A 3CGIA 2MKSA 5C42B 2JOQA 1TKXB 3VAJA 4LSLA 5EWEA 4DJBA 3OTBA 2PN6A 3DGPB 1N34F 2H9ZA 4IRCA 2GJFA 3CT9A 5IC6B 1HHQA 4NZ0A 3BSAA 2HWIA 2G2OA 2HZAA 4RW7A 3J7ZT 2UXBF 3MTJA 1T03A 3OHBA 4ZDNA 5CXTA 4UY8T 2ZZNA 2DNRA 4N7TA 2PEHA 1DURA 4FP9A 3JAMU 4RUAA 1YGYA 5F9LA 1X0FA 2V9WA 5K8PA 1P1TA 2V6AA 1T9UA 1RBLA 2CJYB 3BS9A 3GIKA 4CO5A 4JV5F 1NJXA 3PRBA 1ZM3A 4IYQA 1NU4A 2I8EA 2C2RA 4Z7CA 4NLTA 4X2BA 3C16B 1YHQS 4URGA 5E3QA 2QFJA 1VBXA 2HQCA 4USKA 5CD4A 2XZ2A 4NLSA 4C0OC 1RU1A 2HLTA 4KHMA 4IFVB 3NGRA 4PEOA 1DJ0A 2XM3A 4ED1A 1NK4A 1F5CA 4YR2A 2HW3A 2DKOB 2E44A 1FJGJ 2B4VA 2IYIA 3MEKA 2DHHA 1LWEB 2OTLS 3TJ9A 1PYOB 1N33J 2R7WA 4DPYA 3H2VE 3S8SA 4QIEA 3CDBA 3DYAA 1MMDA 1JMTA 4F0HA 1Y9OA 3ZXWA 3NOCA 2V8PA 4AXIA 4C8ZA 4WBFA 2YH1A 1XR5A 1V5IB 2XZTB 4ZVHA 2E9RX 4DG1A 3LPEA 4J90A 1NK9A 2HG4A 3PX0A 4KHRA 4JI4J 4NCGA 2YWEA 2UUTA 1RA7A 4LVNP 4EBCA 3H59A 5EHHA 2ZH8A 2F9DA 3PM9A 3KLFA 4AL7A 3KHHA 1VQSA 2RUGA 4HACB 1VRQC 1SKRA 4LRDA 3PKMA 1BQMA 1NO8A 2CPXA 3D6TB 1MLAA 2V5HG 3BBCA 5KG2A 4IR9A 3GYXB 4LUBA 3Q83A 2ZBPA 2VA2A 2DGSA 1VBYA 2HBZB 2A10A 3HHLB 5B0DA 2CNKB 2VJVA 1H7XA 2ATLA 1P8GA 3R5GA 3VGVA 4DPWA 3NCRA 1NB7A 3HX9A 2HMIB 2FHJA 4QYZK 1SV5B 4WIQA 2E5JA 3HO1A 4LR7A 4DQSA 3P6YC 2W25A 5H9EK 4D3GA 3O1LA 5IQ6A 2RB7A 2B56A 2K7KA 2YNFB 1NCLA 3FSIA 2GV1A 2O67A 4QR0A 2WSFC 2JFKA 2NS1B 3KFWX 2FHKA 1LWCB 1HNZF 2J76E 2UVRA 5KFGA 3MMBA 3MUTP 3ETMA 1S1WA 1QSYA 4DR7F 2GQCA 1SKSA 5KFKA 2OTJS 3TVYA 3FCVA 2NR0A 2V8GA 3V5RA 2RU9A 3ZZYA 5A8WB 2EEYA 4KHPF 2HBRB 4BC7A 2RRNA 4JV2A 2BQRA 1TL7B 4C8LA 2WTFA 4J7CA 1RUSA 1JK9B 2IPOB 3RBEA 1F9HA 2WBRA 2M7SA 1U7LA 4DR4F 1ITPA 4LF9F 2RE1A 1UPPA 5BYQA 2I2YA 3DLKA 2W7PA 5KOXA 5B0AA 3ICLA 2W4DA 2HMIA 1R3NA 1Q53A 4H4KC 3GJRB 1M5HA 4LF1A 5F0UA 2JEJA 2HPUA 2DXFA 2F4VJ 3MPVA 5HI7A 4G65A 2BOAA 2W2MP 3PFEA 2IDEA 1L5UA 2AEJA 2YNIB 3IS9A 4PAAA 1P27B 2YWHA 1QAJA 3DI6B 2V2KA 2U2FA 1JNZB 3BKTA 2R8JA 1RTDB 2XZDB 1R0AA 2VC0A 3KLIA 3X1LB 5DJBA 3OSNA 2XY7A 5L46A 4B3RJ 4NLVA 4ZLLA 3OVSA 5HMXA 1B64A 3NLCA 4BBYA 3G6XA 3PCOB 4QW8A 5T14A 3BSCA 2GS8A 4K4XA 2MLYA 1Q86T 2BKPA 2GZOA 2KHCA 3EXYA 5A2QU 4Q5VA 3BPSP 3ILLA 4B9MA 2WCXA 5D78A 3W65A 3NNCA 1LFWA 3HSDA 1ZPWX 2WVEA 1B70B 4ECRA 3VGTA 3MAAA 1ZZNA 2VQFF 1SXLA 2VOPA 3B4DA 1XR7A 2CQ3A 5L1KA 3TQ1A 3HFZB 3RBDA 3MFHA 5ETLA 4OL8A 4OV6A 1A9NB 4EI2A 3CJRA 5CH7B 4C8MA 2D3UA 3A3NB 3UNGC 4ZVTB 3MF5A 2IJNA 3DI6A 4UW2A 1X4HA 2H3EB 1DFDA 5ETQA 5DG8A 2MDAA 3I56S 2ALZA 5HBMB 1XNQJ 3NNAA 1S4FA 3V2UC 4IFYB 5AXNA 4KH1B 1QTNB 2PT0A 2D3ZA 4B3MJ 4USTA 1CJVA 1CS4B 1UUJA 3T5HA 4KPCA 4DPTA 3CD7A 3DRXA 2C2NA 2KXNB 1RT1A 3OL8A 2QIFA 3FEZA 4L76A 4PXCA 1LWFB 4ZS6A 3CD0A 4I7FA 2ZH6A 4N5SA 3HD1A 2WK4A 5ETTA 5DETA 3MMAA 4WFAQ 4PXEA 1UEKA 3CJSA 4ID5B 4NMXA 3DRRB 3S6EA 1N54B 2F4FA 4U96A 4DV6F 2FLOA 1OJ4A 3P45B 5HL7Q 1VQ8S 5LSOA 4FS1A 1G2EA 4RWWA 4JYAJ 2KH9A 1TKZA 3CC4S 4U95A 2DD8S 4ZK7M 4IFYA 2LDIA 4N8OA 2ZDOA 1T0TV 2YKNB 4C4WA 3UVJA 2QE5A 3PY8A 3TA2A 1UA0A 4K4VA 1QAYA 1NJIT 3BPDA 1FD2A 1M0SA 2IMOA 1VDHA 1Y10A 2L9DA 4TY8B 4F0MA 3N6NA 2YX4A 2OAUA 2JH3A 4J9VA 1U2RA 2DCLA 1NJYA 2M0GB 2XWYA 1FXLA 4I64A 3T9NA 2G0JA 2HZCA 3O6QA 3FZ2A 5KFLA 4G6VB 4EO6A 3SQGA 2EG2A 1R8HA 4WXWA 3D0HE 2E7XA 2E66A 4DV5J 5K9FA 3RAXA 5KG1A 4G1QB 3MDFA 1U1MA 1HQEB 3LP2B 3IBFB 4I56A 3VCDA 2ZH9A 5F3TA 4DOZA 3GFYA 4F8RA 3GYNA 2OGUA 3KG1A 3CCSS 1CJKB 4U8VA 2RSQA 2B5JA 4KH0B 5CYQB 3BJYA 3PX6A 4ECUA 4WCEQ 2FDNA 2OPPB 2DHSA 3K58A 2DNQA 6FD1A 1FERA 1VIOA 1FRIA 1S1VB 4MJKA 3AAWB 1UZDA 3QLHB 3R2CJ 5K8OA 2HVDA 2PO4A 3RR7A 2AX0A 4UT4A 1UETA 4WF9Q 3HT0A 5B09A 1R43A 4PG4A 2VG6B 1REVB 5DDRC 2CDRB 3LH2S 3HHNB 1HNIA 2C22A 3CF5Q 2ZH2A 4X4TA 1CVJA 3CIMA 3CW2C 4F3MA 4X65F 4G3IA 4C11B 3H4DA 2HAFA 4FF1A 1TZ0A 3WZ0A 3L7PA 4DX6A 3HPOA 4DL2A 4ZVGA 4LF5J 1Y5NB 2FJXA 1FKOA 2N3OA 4M5GA 3QMQA 2YQ1A 1A0OB 2ZBCA 4NL5A 4LFAF 4R0EA 1TTHB 5JMNA 4KJIA 3W2VB 1WF1A 3KK2A 3WC0A 2B9EA 3CNQP 4YHHF 3HJFA 4Q44A 1NDLA 2OELA 2DHXA 5IWAJ 5CYQA 4USHA 3G8QA 3KJFB 9ATCB 1VIXA 2E5LJ 4DUZJ 1RLDA 2EFPA 1SH2A 2Q66A 5GVQA 4IG0A 1MG7A 4KO0B 3O5TB 4NLPA 3Q2SC 2BKNA 4JI8J 4B3OA 3IM8A 1AA1B 1T9TA 1NZ8A 5ETVA 5F8HA 5L38A 3ISZA 4ECSA 2QMXA 1JLQA 2DCUB 4CLYA 4K0KJ 4DR2J 4YB1P 1GAOA 4E0DA 4QBUA 2VKRA 2XO6A 3KLEB 1NKCA 3MM5A 1S10A 2ASLA 4R8UB 3RAQA 2HFZA 2C2OB 1YVFA 2U1AA 2N82B 1RTHB 5G4DA 3HFKA 4OI3A 1KVIA 5HMWA 3W2VA 2AHOB 2VPXB 1IBCB 1K8AT 2A6OA 2YWGA 3SSQA 4DCJB 2EXUA 2LVWA 2JLEA 4GVBA 2XSJB 2RS2A 4AQYF 1OSDA 2CJ9A 4PWDA 2AYMA 2JC1A 2J0QD 3HSZA 5FLXY 1FEHA 2N4DA 3WQPA 3QYYA 1FESA 3KNGA 3VHQA 1CSJA 4OI0A 1FFGB 1P1LA 2FY1A 1LNQA 4X64F 3RW7A 4O3QA 2ZH3A 1T9VA 4OI6A 1LXNA 1FRHA 5IT4A 3G9CA 1NKBA 4OYXA 2BXJA 2MGZA 2MSTA 2AGQA 4OIXA 2E5GA 3X3UA 3CCQS 2V34A 1YDLA 1UAWA 1OY8A 2UXDF 1HHTP 3PKYA 4IRKA 3DOMA 5IC4B 3WIVA 1WJ9A 3HHKA 1RTJB 3MM6A 1X4DA 1N48A 3CJ8A 4O23A 3GB0A 5K20B 2HK2A 5IV4A 1QAIA 1FK9A 3C14A 5D4NA 3AHPA 3ETOA 2M88A 1A6LA 2VFSA 3R5BA 1WORA 4WKRA 4ELUA 3H5UA 3HF5A 1K44A 2AJ0A 4I6AA 2X3GA 1VQPS 5DM7Q 3W62A 2D7SA 1Q5YA 3R5CA 4LFBJ 1HWLA 3ZTSA 4M5MA 3BGRA 2MKIA 2BE2B 3W5XA 5E0OA 4LF6J 2DR6A 4OX6A 4CQ1A 2PI5A 3KNAA 4ILMA 3JTPA 1CG2A 3JTNA 3F44A 3DLBA 2ZDPA 1GXTA 4YS2A 3NMAA 2XULA 4KV8A 5K14A 3GG0A 1KONA 4C8YA 2IM2A 2VONA 1QDUB 1I5OB 2XZWA 2UV8A 1U45A 5KFPA 3M8PA 1FI4A 4WFBQ 2XMUA 1FRLA 2QSFA 1Y00A 1M5OC 1FDAA 2KVQE 2EWHA 4X84A 1NJWA 4RKUC 1S76D 1YI2S 1JLCB 5CQGA 4IR1A 3QGHA 3GV7B 2ZJQQ 3NGKA 1S77D 4NYZA 2V2VA 2CVEA 2Z0GA 2BJ9A 3D0IE 1RT4B 2R4FA 3RG6A 1LEOA 5EUHA 4ZP8A 3SDEA 2E7WA 6FDRA 3GP9A 2MQNA 2VFUA 2L48A 4QPTA 3D6FB 2DGQA 1G4CA 2D74B 2GHVC 1NDKA 3W61A 4CLPA 1HW9A 1FO1A 4M5KA 1XMBA 5T7LB 2W9BA 1XIQA 3MEEA 2FLLA 1SJ4P 5J2NB 2NXUA 4AUKA 3OUYA 1N32F 1EHWA 1IBMF 3VAFA 4YUDA 4YEAA 2PEBA 2RIJA 3G82B 3EGZA 3THVA 1IQZA 2QJ3A 4P7VA 2JVOA 4EEYA 1TFWA 1RWUA 1QE1B 2BABA 2ZBIA 4YMEA 5KFOA 1FWKA 1XR6A 4NLXA 2OHDA 3VVUA 1W26A 4B9SA 5D4PA 2PC6A 4RJVA 5GMDA 3M2RA 3AODA 3CJQA 4UOGA 5A0YB 1OPZA 3C19A 3TO8A 4TYBA 2B8PA 2JNJA 3SYZA 3SV4A 2XMTA 3LALA 3PTWA 3TVKA 1N5VA 3KLVA 2G2YA 3H2LA 2YNGA 1SL1A 4NLQA 1RT4A 1C0TB 4DSKA 3BSOA 2QT7A 2FGCA 1MWYA 1PIEA 1K0TA 3HDSA 2NYIA 4RX6A 3OPKA 1UJ4A 4ANEA 1S6QA 5LT5A 3MOJB 5DO2A 4LT6A 2HHVA 2HHWA 3DLHA 5J2NA 3CCLS 2ZUAA 1R8AA 2KHDA 3MPDA 2ZUGA 1EAYC 2DH8A 4NEZA 2WBMA 5HQMA 4LBHA 1DARA 1KTQA 1GTHA 3QWPA 2MHNA 3TR5A 4FZVA 1FE4A 2XHCA 4O3OA 3QNWB 2B3TB 3MEGB 3QRRA 3G82A 1IBKF 2W9CA 5D3GA 2Y3YA 2DGWA 1C2PA 3NS5A 2M70A 1Q8BA 1JXVA 3GG1A 2D1CA 1L3TA 2Q3PA 1L3KA 2IVYA 2OEJA 3QT7A 4XPEA 1Q8IA 2HQFA 4WTOB 4WP3A 2JX2A 2C2EA 3I0SA 3CMQA 2EC2A 4P71A 3K8VA 1QSSA 4WKYA 3HK2A 3I9V9 1QD1A 4RBTA 2Y1RI 2D69A 3EE3A 3PEHA 1GQEA 1SI9A 1U1LA 2DNGA 4I2QB 3KK3A 3IO1A 1U8WA 2WZ1A 3CEDA 3M1VB 3M30A 3D3BJ 1WDTA 3ET6A 3MHYA 3OTOF 1ZS6A 1D09B 2H1YA 1HMVB 1WKKA 3M05A 2C2KB 4YQWA 1MN9A 1HWIA 2R8HA 2E5HA 4J9QA 5KFRA 2LA6A 2HHHF 3POTB 5BR8J 1KHVA 2LEBA 1OO0B 3RRKA 2I0XA 1KS2A 4N8NA 4RZRA 4OI2A 1PBAA 4QIVA 2RS8A 1GXLA 2LEPA 5GMEA 4K4TA 4DS5A 2Q6CA 1GH8A 1MU2B 3V6DA 4DR6J 4NPOA 2VUGA 1IR0A 4P2MA 5IS2A 3TWZA 3KLHB 4O44B 3PACA 2VFVA 3QO9A 3PG9A 1KLMB 4MT1A 2XS2A 5FIIA 3MR7A 1Z2ZA 5KG7A 4WU3A 1SH3A 1I51B 3MPUB 2GQ2A 3S7RA 1XQIA 1J2VA 3CWJA 1SC3B 3NBPB 3I96A 3EVMA 3KHLA 1HBNB 4K2JA 5F8MA 3NGTA 2M9KA 1VLYA 2IRYA 3GPAA 4IOCQ 4EMDA 5LXRA 3BEGB 4Y6IA 3E8OA 1N8RT 1ZA1B 1GEHA 3T3FA 2HNYA 2XLIA 2VG7B 2FVSA 3PO5A 3UO0A 4K50A 1V3ZA 4ES3A 3DMJA 3GV8B 2IMWP 5AE1A 1TAQA 3PIOQ 4ICLB 4DU8A 2FLNA 4DI6A 5D0EA
chains in the Genus database with same CATH topology
3CCZA 4KKOB 4C8KA 1MROA 4RW8A 4NA3A 3HT3A 4ZPBA 3R5DA 4RU9A 2MZSA 2QV6A 3QJLA 3BO2A 4ZP9A 4WE1A 2XLKA 2IAJB 1WF2A 4M5DB 1UVKA 2LA4A 5T41A 2KRRA 3MGJA 1VQMS 4QQBA 2ZD1A 3ZC4A 1KD1T 4I2PB 2VG5B 3C6UB 4F4KA 1TV6A 2V4RA 1FJGF 4IQXA 4DSJA 2DHAA 2YNIA 4H54A 5HP1B 3UCUP 1YITS 3SDEB 2UVUA 1N33F 4J9LA 1CLFA 2J7UA 5A8KB 3TI0A 2PIIA 4EFAC 2C3YA 1VRTB 1HWUA 2E1AA 2VKZG 2J8AA 5D8HB 1UJ5A 3H5XA 2BJEA 3GFXA 3K2YA 4DPOA 4QR1A 4PQUA 3NCQA 2XMWA 1DTQB 1M5SA 3BREA 4O0IA 3VR1A 2C3MA 1VQOS 1FD8A 2EC0A 2LMIA 1FA0A 1L3UA 4K4YA 2R7RA 2OSQA 3MAQA 3RB6A 1E6VA 1S72S 3H20A 3N6LA 3SCJE 2GA7A 1FKPB 2W9BB 3C2PA 1TFYA 1OWXA 3MEEB 2KT3A 3SSRA 3CGIA 3JSMA 1RTDA 2AWZA 2EBGA 2MKSA 5C42B 2JOQA 1TKXB 4QIWD 4YB7A 4LSLA 3VAJA 2R7TA 5C24B 5CYMA 5EWEA 4DJBA 4FNHA 1FEEA 2UXCF 3OUYB 3H2UB 2D9PA 1HARA 2LCWA 3OTBA 1HA1A 4LMZA 2PN6A 4HTIA 3EPIA 1H2UX 2I5JB 1N34F 3I6PA 2H9ZA 1IN0A 2WONB 3E51A 1JX4A 4OLOA 3DOKB 5IT0A 3OJSA 1HI8A 4IRCA 1FCAA 4JI4F 1K0VA 3CT9A 2ZM6F 2DR9A 1FKAF 3UW1A 4NCBA 4XAKA 5LJ5Y 4NZ0A 3BSAA 2HWIA 1C1CB 2VBXA 5KFDA 2DB1A 2XTEA 4LQ3A 5F8NA 2YH0A 2BACA 4G1IA 5DGBA 2RVJA 4RW7A 4ZKAA 1WEXA 4UUXA 3J7ZT 4B9UA 3LOUA 3CCVS 3DM2B 2UXBF 3MTJA 1T03A 4DR3F 4NYPA 1DQ8A 2B7CB 3OHBA 3W3SA 4ZDNA 3FDSA 5EGYA 1QM9A 4KBIA 3JB9k 5CXTA 3FFIB 4UY8T 3CSKA 5KT6A 2K3IA 1S49A 2IYGA 2KJWA 4UOCA 4Y3CA 1X0PA 1R8BA 3NL0A 3V4IB 2ZZNA 3V6HA 4KSEB 2KB2A 2DNRA 3EGWB 2XB2D 1VQ9S 2PEHA 1T95A 2IC3B 3QGGA 1DURA 2ASDA 4FP9A 4I0WA 4I67A 3BZQA 4IO9Q 2HHSA 3OR1A 2ZNYA 3FVYA 1AFJA 5KFMA 3DLLQ 2LU2A 4O3SA 3K5MA 3M2RB 1V6HA 2G1DA 4P7TA 4RUAA 4DF4A 1YGYA 2DIUA 5F9LA 1X0FA 4J9KA 1HBUB 2V9WA 1UW4A 5K8PA 5B0EA 1P1TA 1TAUA 2HRYA 2RT3A 2J9DA 3PR5B 4OX8A 3RZAA 2KG0A 4U67Q 4ZPWR 4B02A 2HHPA 3I32A 4TLRA 3BS9A 1TQLA 3GIKA 2CPFA 1YJRA 2YKPA 5B7WA 4CO5A 2YNGB 3HHEA 3FJ2A 4MFBA 1I1GA 4RBUA 5DS7A 2VG5A 4JV5F 1NJXA 4NCAA