4QPXA

Nv polymerase post-incorporation-like complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
502
structure length
495
Chain Sequence
SKGTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a backtracked state reveals conformational changes similar to the state following nucleotide incorporation in human norovirus polymerase.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Hydrolase/rna
molecule keywords Polyprotein
total genus 167
structure length 495
sequence length 502
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 4qpxA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4qpxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qpxA03
3DRRA 4RW4B 4YP3A 3V6KA 5KFNA 4B3OA 4F4WA 4ID5B 4I2PB 4TQSA 2XGQA 3N6LA 2BQUA 1SH2A 4TQRA 3PW2A 2I5JB 2VG7A 2VA3A 2DPJA 4PQUA 3QIPA 1LWFA 4NZ0A 5KG6A 1JLGB 2FVCA 3MR5A 2FLNA 5KFSA 4RNOA 1TP7A 3G6XA 3HHKA 5I3UA 2W8LA 1IKVA 2IJFA 5HROA 5D3GB 4JV1A 4QWBA 3KLGA 4O3NA 4ED8A 2C2EA 2YNGB 5DG7A 3QO9A 2HNZA 1HNIA 4YQWA 4URGA 3GIIA 4NCGA 4O3RA 1HQUB 5DG8A 3OL9A 2RKIA 2IA6A 1C0UB 1BQNB 5KFEA 5KT7A 3FSIA 3DMJA 5J1EA 2ILZA 1JXLA 4ZHRA 5EWFA 1RT2B 3M8PB 2BANB 2XWYA 4TYBA 4R8UB 4EBDA 4ECTA 2AGPA 3OL6A 3RBDA 3BSOA 1HQEA 1HQEB 1T94A 2W7OA 2BQRA 2FVPA 4NLSA 3C6UA 5DLFA 4O4GA 2BANA 4IKAA 1KLMA 3M8PA 4R8UA 4EO8A 4IH5A 5KFQA 3PZPA 4IG3B 4IG3A 1BQNA 4O4GB 2OPPA 4QWDA 1RT3B 4WXOA 5K14B 5EWEA 2V4RA 1JLQB 1HQUA 2HNZB 3G86A 3DLKA 2E9RX 4TY8B 1RT2A 3ICLA 4Q45A 5I42B 4ZHRB 2R8HA 2WK4A 4FS2A 3DLGA 1RTHA 2IM1A 1C0UA 4QW8A 3DM2A 5D3GA 3T5JA 1SV5A 5KFJA 5F9NA 3M9NB 2W9BA 2V9WA 1EETB 4NCGB 4O3OA 2FJWA 1HNIB 5F8HA 3GIKA 4ECUA 4MIAA 2ZKUA 4G1QB 3T19A 3MR6A 2R2UA 4J9MA 1JLGA 1SUQB 2C22A 4ZPDA 3FFIA 1JX4A 4PQUB 2HWIA 4WZQA 4H54A 3QZ8A 4NLWA 5HROB 3KHGA 4MFBA 4IDKA 4ZPBA 4I2PA 2YNFB 1XR5A 4RW4A 1RTJA 1XR7A 4MKBA 2GIRA 3DI6A 1LWFB 4KSEB 5KFUA 4XPCA 4KO0A 4RZRA 3GIMA 3OLAA 2I5JA 1S1TA 1MMLA 5KT4A 4IRDA 2HNYA 3H98A 4RNFA 4J9RA 2WB4A 4KHMA 2BQ3A 3QGGA 4O4RA 2ILYA 5KFBA 3H2LA 3MEGB 2WONB 3M8QB 1TKTB 4KFBA 2VA2A 1MU2B 1TVRA 3MEDB 2VG5A 2IC3A 5L1LA 3TAMB 3TVKA 3NGDA 1NHVA 3LP1A 3UPFA 3FRZA 4RW9A 5L9XA 5HLFB 4NLYA 4TLRA 5CYMA 4RW7A 2D3UA 2WOMB 2O5DA 1S97A 5F9LA 1RTDB 5CYMB 1RT4B 4I2QA 4YR2A 4NLOA 1FK9B 5HLFA 1S0OA 1QAJA 4JV2A 2ALZA 5C25A 1FKOA 2QE5A 3KMSA 3IG1B 3MR2A 1TKTA 4KFBB 3DOKB 3V6HA 5F8GA 3LP2B 3MEGA 2UVUA 4RW8A 1C1BA 4EYIB 2HMIA 1JKHB 3NAIA 1RT6A 1S1WA 2YKNB 5KG0A 1VRUA 3MECA 3C6TB 1TL3B 3NAHA 1IKXB 3DRPA 2W9CA 3I0RB 2RDJA 2FJVA 4KO0B 5KT2A 3PR4A 4HKQA 2ZE2B 4KB7A 4NLGA 2YKMA 4IH7A 3CDUA 2R2SA 3BQ2A 4TN2A 4O44B 4Q0BA 1RA6A 2YNFA 4MIBA 3GIJA 4MFBB 2F8EX 1LW2A 3T5HA 4NRTA 2AX1A 3CO9A 4YR3A 5KFHA 2HNDB 5F8JA 1SUQA 4ZP7A 3DDKA 3CIZA 1C1CB 1JLEA 3GV7B 2JEJA 1EETA 5KG7A 1LW0A 1IKWB 1SV5B 3V81B 2JC0A 1WNEA 3BREA 2J6UA 1RTHB 1HNVB 3CJ3A 1D1UA 1N6QB 2HWHA 4ZMMA 4TY8A 5JUMA 1J5OA 3N6MA 1YVFA 4K4SA 3KOAA 1S0NA 4WE1B 1JLQA 4IG0B 5DQHA 2B5JA 1HMVA 2OPPB 4GC7A 4KKOB 4NRUA 3PJXA 5T14A 4U6PA 4MKAA 2AWZA 5HP1A 3RB3A 1HYSB 5KFMA 5L1IA 3SI8A 2JEIA 3I0SB 3OHAA 1TKXB 2OPSA 3KLHB 4F4YA 3LALA 5KFZA 4RUCA 2AGQA 1S0MA 5F8MA 3MEEB 4QWEA 5DG9A 4IRKA 4ZVFA 4DEZA 3H5SA 2YNIA 3DMJB 5J1EB 2B43A 3PVXA 2RKIB 1N5YA 1T05B 1RAJA 4DL4A 3V4IB 3BSNA 2W9AA 1N56A 4O3PA 4QW9A 4J9LA 4ED2A 2OPRB 5CYQB 3QO9B 4EBEA 1S6PB 3RB0A 3GILA 3BQ1A 1C0TA 2BE2A 1LWCB 3JSMB 2GIQA 3EPIA 2R8JA 1IKVB 3JYTB 3PR5B 5I3UB 3EZUA 4ECYA 2I1RA 2RF2A 4I7FA 3H4BA 3KLEB 3PHEA 4DL2A 1S9GA 1HARA 2VG7B 4EO6A 1S49A 1TV6A 2YNHA 3BGRB 4URSA 4ID5A 1EP4B 1UWBB 1N48A 3E51A 1ZTWA 5J2PA 3KJVA 3DRRB 4F4ZA 5DGBA 4HYKA 4K4YA 4Y34A 3G6VA 3LAKA 5KFKA 1TKZA 3IS9B 3QYYA 1S1UB 4PWDA 2B6AB 3CJ0A 3KHHA 3BSAA 5J2NB 4RNMA 1S48A 4RNHA 5KFDA 3RB4A 3DRSB 5KT6A 5FDLB 1RT1A 3V6JA 4NYZA 4OL8A 4IOBA 2C2RA 5J2MB 4ZP9A 1RDRA 1JLCB 3DOLA 3E01A 1RT7B 2R8IA 3LP0A 5KFYA 3KK1B 4M95A 4RUAA 1BQMA 4F50A 4ECWA 1R0AA 5KFPA 1DTQB 4YMEA 2XCAA 3M9MB 1S4FA 2XI2A 4TXSA 4JUZA 2FLLA 2UUWA 4NLXA 5KG4A 2DPIA 4PUOB 1VRTA 4ICLB 4KAIA 4ZPCA 1FKPB 4R5PB 4J9NA 2IMWP 1T03A 4WXWA 3Q8QB 3H5YA 2OH2A 1RTIB 4O3SA 2AQ4A 1DLOB 3CDWA 3ITHB 3G6YA 5L1JA 5KFVA 2B6AA 3NBPA 4IR9A 5HBMA 3HKWA 5KG2A 3T5LA 2BRKA 3IS9A 3V6DA 4K50A 1JLFA 4LSLB 3Q8PB 2XC9A 1D0EA 1S9EB 4DL3A 4ZVHA 3KK3B 3SFGA 3DLEA 5C24A 4ECXA 3TQ1A 5KG5A 1UWBA 4QPXA 3HVTA 4O3QA 4MK7A 4MK9A 4ED1A 1ZETA 1TV6B 4ECZA 2VG6B 4H4OB 3KK2B 4J9QA 4KV8B 5DQGA 1S1XA 2WONA 3MR3A 4QWAA 2R2RA 1IM4A 4IQXA 4Y2AA 4EBCA 3N6NA 1NHUA 3I5BA 3JYTA 3KNAA 3QLHB 4ZP6A 3QGIA 2FVSA 3Q8SB 5DGAA 1S6PA 2E9ZA 5F8IA 1JLBB 4M94A 1S6QA 5KFRA 2JC1A 4K4VA 5J2QA 3FQKA 3OLBA 4IFYA 1T05A 1N5YB 4Q44A 2WTFA 1S6QB 3GQCA 2JEGA 2YNIB 3PW4A 4XO0A 3IGVA 4XPEA 3VQSA 1JIHA 5KFTA 4QWCA 3PW5A 2CKWA 1S10A 4ECRA 4RW6A 5EWGA 1KHVA 1S1VA 4WYWA 4K4XA 1DTTB 1TKXA 3I0SA 3KLVA 4LSNB 5J2QB 5F8LA 3MFIA 3PW0A 3H5XA 1JLBA 1TL1B 1S1XB 5C42B 5HP1B 4IFVB 1QAIA 5KFOA 4Q8FA 1I6JA 2E9TA 1HMVB 1KHWA 2B5JB 4IG0A 4ZVGA 1XR6A 4R0EA 2IM2A 2BRLA 1QE1A 2AU0A 1HPZA 4KV8A 3OHBA 1HNVA 4NLQA 3I5CA 1JLAA 2R8GA 2VG6A 4H4OA 4LQ9A 3KK2A 3DYAB 3BQ0A 3KLFA 2IM3A 3M9OB 4J9KA 4Y2CA 3KMQA 1C1CA 2HAIA 3DLEB 3ISNC 3ITHA 5DQIA 4NLTA 1REVA 3IN5A 4Q8EA 4ED7A 2UUTA 4EEYA 1NNDA 4LSLA 4K4WA 1JLFB 2ZD1B 3KHRA 4ED0A 5HBMB 2J6TA 3NBPB 1FKPA 3BSCA 1IKYB 3KLIB 4IRCA 1DLOA 4K4TA 2ZE2A 2IAJA 4H4MA 1RTIA 5JXSA 3CJ2A 3FDSA 3H5UA 1DTQA 2UVRA 1BQMB 1K1SA 1T03B 3IGNA 3T5KA 3FQLA 4IH6A 1LWEA 4R5PA 1JKHA 3OL7A 4ZPAA 1CSJA 1RT7A 5KG3A 3UDLA 3ISND 5KFFA 5KFXA 1LWEB 4PUOA 1SH3A 3DOKA 3Q8RB 5J2MA 1RA7A 4YR0A 5C25B 4K4ZA 5EDWA 1R0AB 1RT1B 4NLVA 5FDLA 3KK1A 3GV8B 5F8NA 1FK9A 2IAJB 4H4MB 3LP0B 4KHRA 5J2NA 3GV5B 1IKYA 3KLIA 3RBEA 4RW7B 3KHLA 4RU9A 1W25A 4J9PA 5L1KA 3LAMA 3LP1B 2ZD1A 4RNNA 2IC3B 2XI3A 4NLRA 1MU2A 3GYNA 4WFYA 4Y3CA 3DRSA 2C2DA 5KFLA 1REVB 2D7SA 3T1AA 5J2PB 3KJVB 4PWDB 3EPGA 2IM0A 1EP4A 2D41A 4KE5A 3KLFB 3DYAA 1TKZB 2YNHB 1S1TB 3MTKA 1ZTTA 4FBUA 1JLAB 1S9GB 2ASDA 1HPZB 3DI6B 2ATLA 3D28A 2J6SA 1QE1B 1RTJB 1U09A 2GC8A 3QGHA 3KLEA 4G3IA 2RF2B 4WFXA 2RDIA 4I7FB 4X2BA 4IDKB 3BGRA 1QUVA 5KG1A 1LWCA 3BJYA 1K1QA 4J9OA 4F4XA 3FFIB 4IFVA 5KFGA 5C42A 1TL1A 4G1QA 2W8KA 2OPRA 5CYQA 3H40A 4LSNA 3RAXA 1DTTA 1S1VB 2BR0A 3V4IA 2W9BB 4ED6A 3NKYA 3DM2B 4RW6B 1C2PA 3JSMA 2WCXA 2QV6A 1C0TB 2BE2B 2WHOA 3CWJA 3DLGB 4DL6A 1N4LA 5I42A 4WYLA 3DLKB 3MEEA 3QZ7A 1TQLA 4IFYB 2OPSB 4KBIA 3KLHA 2R2TA 5K14A 2IBKA 1RT3A 4NLDA 4WZMA 4TYAA 3OSPA 2CJQA 4DL5A 2IJNA 4ECSA 4KKOA 1KLMB 3QLHA 3C6UB 3CJ4A 2FLPA 4WE1A 3NMAA 3LANA 3PW7A 1OS5A 2V4QA 2V0NA 1HYSA 4IR1A 5KFAA 4EYHB 4ZVEA 5C5JA 2JEFA 2C28A 1S9FA 1IKWA 4Q43A 2ASLA 3HVTB 4FS1A 1J5OB 1JLEB 3I5AA 5C24B 4K4UA 2FVQA 1Z4UA 2YNGA 2AX0A 3KK3A 1N6QA 3UQSA 2HNDA 3KLGB 3CJ5A 2R8KA 5KT3A 1S9EA 3BR9A 3HVWA 4GC6A 3NL0A 3V81A 3HVAA 3V6DB 5EUHA 1LW0B 4O44A 4Q0BB 2W7PA 2AGOA 5KFWA 3H4DA 1GX6A 3QIPB 4ECVA 3UR0A 4LQ3A 4MK8A 3I0RA 3RAQA 2UVWA 5KT5A 4WFZA 4DL7A 1LW2B 1VRUB 3MECB 4B3OB 2HMIB 4ICLA 1VRTB 4NLUA 4RW8B 5KFIA 3RB6A 4ED3A 2YKMB 1SH0A 2WRMA 1RT5A 2EC0A 3IG1A 5DLGA 1IKXA 1FKOB 3DRPB 2W9CB 4J9SA 3QIDA 1TL3A 3C6TA 3OSNA 3MFHA 4ECQA 1RYSA 1S1WB 1RT6B 2YKNA 2ASJA 3E01B 1C1BB 2OPQB 3IRXB 3LP2A 4DG1B 3DOLB 1JLCA 2D3ZA 4RW9B 4TY9A 1T3NA 4URQU 4ZP8A 3CVKA 3TAMA 2VG5B 2JLEA 4MH8A 2FJXA 2FVRA 4DG1A 3CDEA 4I2QB 1RT4A 4U7CA 4FBTA 2OPQA 3H59A 3IRXA 1RTDA 5KFCA 2WOMA 3MF5A 4NLPA 1S1UA 3M8QA 4JV0A 1RYRA 2UVVA 2HNYB 2XGPA 3PJWA 3MEDA 1TVRB 1GX5A 1RT5B 3D5MA 3OL8A 3SFUA 2XCPA
chains in the Genus database with same CATH superfamily
3W5XA 1IR0A 4B9SA 3T41A 4DN9A 2QSFA 1RWWB 2RDDA 3BN4A 3UWTA 4A46A 5D6GA 5KFNA 3KUGA 3CCSS 3QAEA 4EGLA 1D9AA 2P6SA 3Q0AA 4H4KA 2CNLB 2I5JB 2D9PA 2V34A 3MAQA 1F9EB 3J80Y 1PSDA 4FYXB 4LIWA 4NZ0A 1RHKB 1MWQA 2FVCA 5KFSA 4RNOA 4FXDA 1E6YB 1UEVA 3HHKA 3EICA 3TX8A 2QSWA 2E44A 2MY8A 4RBUA 1RAGB 3NCQA 2XM3A 2Y8WA 2VFSA 2BKOA 1RLDA 3U1MA 4GO7X 2ZJQQ 3D2WA 2MZQA 4ED8A 1HQ2A 2AZ1A 3M6UA 4AXJA 4LREA 2BM1A 3PTWA 2EFVA 2N7CA 3CC4S 4DCJB 3OL9A 1PILA 1C0UB 1BQNB 3FSIA 1N36F 3DMJA 2ILZA 4G1PA 1RT2B 4WPAA 2F3JA 3E8OA 3UR3C 2DNZA 2XWYA 3D7SB 4EBDA 4OYMA 2KRRA 3PY8A 1N32J 3C46A 4C48A 2W7OA 2ACYA 2X3GA 4NLSA 3C6UA 2R7QA 5CA5A 2BA9A 3BYPA 5DLFA 3M8PA 1V9OA 4LFCJ 4IH5A 3WDOA 4DQQA 1UAWA 4FF3A 4JI8F 2HFVA 1F9HA 2ZZTA 3LW5C 1KQFB 2MKCA 1BQNA 2V9KA 4LJMA 4O4GB 4P7VA 3TYTA 3FEXB 2V50A 1JLQB 1HQUA 5U47A 1IQZA 1NHKL 5IT9U 2FZGB 2HNZB 3BKUA 2E9RX 2DGTA 1J2VA 3ICLA 2H1OE 1K47A 3F44A 3MPUB 4TY8B 4YB5A 4ZHRB 3DLGA 4WTOB 1RTHA 1RWVB 4OZ0A 2BJ7A 1J5EJ 1DBDA 5D3GA 3PYFA 3T5JA 1SV5A 5KFJA 2W9BA 1U1QA 3MMBB 3WIVA 4F02A 4OI3A 1HNIB 5F8HA 3GIKA 2Y1RI 3TUJC 1B7YB 2I9SA 2MKYA 5CZVA 3QOQA 2HQCA 3FFIA 2DNNA 3W2VB 2ZVIA 2C22A 1KDNA 4CO4A 2AJ1A 4WZQA 4DR7F 4I67A 2MLYA 4NLWA 3AHPA 4MFBA 3SSQA 2J9DE 2NQPA 3WC0A 1HNZJ 2DKOB 2R3VA 2JXHA 3POTA 2JSXA 2B0GA 2Z2ZA 1LWFB 3MOZA 4XPCA 3OVAA 1KN6A 4B17A 3CCMS 1HWIA 1S1TA 2HNYA 2CYYA 1BLUA 4Y2KA 2WB4A 1VQ6S 3DDIA 1ZZNA 1R8HA 2LLZA 3HPOA 3MTJA 1RAAB 2OSRA 4LF7F 2M2BA 5D4NA 3MEDB 2VG5A 3MR7A 4M5JA 3TAMB 2V2KA 3TVKA 3NGDA 1FD2A 3HSZA 4YDXA 3PFOA 5HLFB 1NJIT 4NLYA 1SL1A 1X4HA 3FVYA 4UW2A 5ETMA 1S97A 1RTDB 1QVFR 5CYMB 2QN6B 4NLOA 3G87A 4P2SA 3P49B 4NL5A 4JV2A 2ALZA 2XLKA 1KWMA 4U7UD 1FKOA 2UXCF 4X4UA 3ISZA 4HVZA 3QJLA 1TKTA 2DCLA 2C3YA 4AE5A 1KVJA 2UVUA 2KI2A 2LKZA 1C1BA 1NBEB 1SIWB 3ZO7A 4DU8A 3NAIA 1RT6A 1F2HA 4EYIB 1L3SA 2XZDB 2ZWOA 3MECA 1G1XA 2VL1A 2JFKA 2ZH2A 2RDJA 4KO0B 1TFYA 4LBPA 5B0CA 2YKMA 4D3HA 4NLGA 1OJ4A 2CPYA 4FNIA 4BC9A 1PGZA 1TZ0A 4GKJJ 1U24A 2K1RB 2YNFA 1O0PA 1EKRA 2CZ9A 2HS0A 1NZ8A 2F8EX 2QFIA 2M9KA 3IBFB 4IYQA 4RJVA 1NJZA 2D3OR 1SKSA 1QTMA 3KG0A 4KGKA 3CO9A 4OI6A 3C16A 4YR3A 3JTNA 3ILLA 4LVOP 1SL2A 1OM2A 1YRTA 2NXEA 2YKAA 2DGQA 2HFUA 1H74A 3MGJA 2Z56B 4CRJA 3GP9A 4ZPVR 4DN0A 5KG7A 2PSZA 5E3AA 4X4SA 1UL3A 4NEZA 3F41A 1WNEA 1VIXA 3BREA 2VUGA 3RJMB 3UFCX 2XO7A 1HNVB 4ELVA 4LFAJ 2PD1A 3P5TL 2FC8A 4ZLJA 1J5OA 3QAUA 4K4SA 3KOAA 2ADBA 2E1CA 4TU9A 5E3QA 4GKJF 3SQOP 4P75A 4P6QA 1HMVA 2OPPB 1U47A 1N5TA 2OGUA 4KKOB 5DZ7A 3VCDA 3G8SA 4X4TA 5BYSA 2HVIA 1UVIA 2C3UA 3T9NA 3CO0P 4MKAA 3GCWP 4LF1A 4A47A 5KFMA 2Z4PA 1NAQA 2KKEA 5L1IA 3I0SB 3HJFA 1YJ7A 4USKA 2OTJS 3BBCA 1FRLA 4FVMA 5CQGA 2Y0SD 5KFZA 2DK2A 3VVTA 1YBTA 5IQ6A 7AT1B 4FF4A 3MEEB 5A8RA 1F5BA 3GIRA 1WC5A 1TKDA 3GFXA 3H5SA 2L9WA 4DSKA 1JQGA 3JQMA 4L73A 1Q95G 2ROEA 4PWUA 4JI0F 3TUZC 3PVXA 2R42A 2MLXA 5E7OB 1P9QC 1R8PA 4DL4A 3V4IB 4PQAA 1WG4A 3AOBA 4QZVB 2FJEB 4O3PA 4QW9A 4J9LA 4B3SJ 3EWGA 2RIJA 4EBEA 3R7NB 1LOUA 3RB0A 3F0NA 5J2NA 1LWCB 1V5VA 5HANA 3JSMB 2WVEA 2R8JA 2HVEA 4R25A 3JYTB 2VPZB 5FLXY 2AMCB 3EZUA 5I3UB 2I1RA 3PKYA 4IO9Q 1I94J 1XK8A 3PM9A 3KLEB 2IHR1 4CNZA 2ERRA 1JXEA 1UVJA 3R3TA 2V8GA 1W26A 1QTGA 3JQKA 3OT9A 2L41A 3D4JA 3MUMP 1S49A 1TV6A 4ZDNA 4LRBA 3SV3A 1YJNS 4LR9A 4USJC 3CCQS 1NLAA 2HW3A 1YJRA 2IIHA 1N48A 1H7XA 4M5DA 4KHPJ 3DRRB 4MAKA 2XTCA 2MKSA 2QA2A 1UTAA 4F4ZA 5F9NA 1WJ9A 4HYKA 2LDIA 2UZAA 4MMOA 2ZH3A 3G6VA 3R5BA 5KFKA 2BABA 3IS9B 1TUWA 1PJ5A 3FKBA 1S1UB 3QFWA 3QYYA 4JOUA 4P74A 1ARQA 4USMA 4PWDA 3NXZA 2MJUA 1HLWA 5J2NB 1XEZA 2KFNA 3CD7A 2AYGA 3RB4A 2HPUA 4WJBA 5GMEA 1G7CB 1D9DA 4OL8A 2K2PA 2EK1A 4QYRA 4WTYA 2MTLA 3I6PA 5F3ZA 3MR6A 1D3WA 2OLWA 2YKPA 3U02A 2XWXA 3GJQB 1BAZA 1FFWB 2CAXA 2K7KA 3R7SB 5KFYA 2D74B 4RUAA 2RRAA 4M95A 4W4MA 2YH0A 2XCAA 3CC2S 2HRUA 1U1MA 1FNXH 2NUHA 3MCMA 1QSYA 4OHYA 1RQ0A 4JI8J 1KQSR 4NLXA 4LVNP 2FLLA 3HK2A 4DI6A 4PUOB 4ICLB 4ZPCA 3U7JA 4R5PB 4LFAF 1AXQA 2VC0A 1VJQA 2V8DA 1SJRA 2MXYA 4QIWD 1VQ8S 2MLZA 2M70A 4PG7A 4M5LA 1D9FA 4Y0FA 2OH2A 1VK8A 1BUXA 1KQKA 1WKKA 2PN6A 5HVGA 3MM8A 5KFVA 2B6AA 3AOCA 4IR9A 2K8GA 5HBMA 1U2RA 2KT3A 3BN7A 3UN5A 5KG2A 1S12A 2BRKA 2E1PA 4PEOA 1JLFA 1ICEB 3TJ8A 3T5LA 1B64A 5IS2A 3S1TA 3N4WA 5LT5A 1S9EB 1XMQF 2DRDA 2F40A 2JRSA 3ET6B 2QGFB 1D0EA 1M0SA 2HQGA 3KJFB 2PEBA 4N77A 4WFBQ 5KG5A 1UWBA 2P9CA 4DV7J 4ECZA 2OMOA 3W60A 1HBUA 2I38A 3KK2B 4DSJA 3GFHA 4PYAA 1N0VC 3MR3A 1TMJA 3A1YG 3UDVA 1VQYA 1DQ8A 4QWAA 1F60B 2E5JA 4IQXA 2PMZD 2J8SA 3TP2A 1CBKA 1MROA 4C11B 1HNWJ 2BM0A 3QLHB 5ADZA 4P2MA 1CJKA 3ZTPA 3Q8SB 1H0HB 5DGAA 1AZSA 4CI0B 1U8SA 3WX4A 3G4SS 5F8IA 1Y0HA 1X9WA 4M94A 2H5IB 1U1OA 5J2QA 2CZ4A 3FQKA 1CS4A 2LQBA 4F67A 4Q44A 2WTFA 2K7JA 2MQMA 2ZKTA 5IWAF 2JEGA 4LF7J 1URNA 3PW4A 2GVDB 3IGVA 5HN0A 4XPEA 1JIHA 1T02A 2LVWA 2EFPA 1BHNA 2GHPA 2CDQA 2IPOB 2N4CA 2W7AA 5BYRA 2PI4A 3CB4A 2CXEA 2ZBPA 3GXQA 3D6MB 1R6YA 4LSNB 2QG9B 5F8LA 1G6BA 1SXLA 3H5XA 2CQPA 1TL1B 1S1XB 2BEFA 2LCWA 3NWRA 4IFVB 1AZSB 3HF5A 4P52A 3H7HB 4DL2A 2OELA 4DSFA 3M2VB 2ZH6A 2E9TA 3OFFA 4AL5A 1MROB 2GJIA 2BUNA 2CQ4A 1M5SA 3A3OB 1Q53A 3MM6B 2V5HG 5E33A 3FJ2A 5G4DA 3TQEA 4A48A 5LSLA 2YKQA 1UVMA 4DWIA 1RWOB 3LJPA 3OHBA 4LF5F 1P6TA 1HI0P 3VAKA 2R8GA 4H4OA 2XG8A 1Y5IB 3BQ0A 1PIEA 3KLFA 1ARRA 1YJTA 4J9KA 4Y2CA 1C1CA 3GE9A 2HZCA 3ISNC 4N8OA 1Y3JA 4X84A 3H40A 4HTJA 5AT1B 4V19J 2C3PA 2UUTA 3VR1A 3J7YI 3J81Y 3GYXB 3EZ5A 3HKZD 1WF0A 3VGTA 3MMJA 4LRFA 3BKFA 2DBBA 4Q45A 5HBMB 3D3BJ 1F0XA 3HHDA 1FKPA 3GPAA 3NBPB 4L75A 3Q83A 2DGUA 2QIFA 2DH7A 3EYZA 1RP5A 2CUYA 2E1RA 5LMNJ 3G5OA 2LU1A 3IFEA 4ZIWA 4IRCA 3FT7A 3FDSA 3ENQA 2VODA 1DFDA 1BQMB 1CJTB 3HULA 1JJ4A 1HFEL 1X4DA 1FFGB 4R5PA 1TL5A 5AXNA 1RT7A 3T1YF 5KFFA 3TAQA 3K58A 3AJ2A 3Q8RB 3PACA 4DR1J 4PRFA 1KOHA 3WHIA 4K4ZA 4DZ6A 2JBVA 5C25B 1HNZF 5F8NA 1FK9A 1RJJA 3LP0B 4ZPTR 4CO1A 4QYZJ 2GQQA 1CG2A 2K06A 1SC3B 2DR6A 4HACA 2XZ2A 3TOQA 3OV7A 3RR7A 4P71A 1F1BB 5L1KA 4LFBF 1I51B 2MMYA 3LP1B 3NP5A 2ZD1A 1YRXA 4HLBA 1Z2ZA 2XI3A 4RBTA 4DR3J 2Q6CA 5LSRA 1MU2A 3U1LA 4E98A 4Y3CA 2DNGA 3DRSA 4NYPA 5KFLA 2E66A 4FPRA 3W7BA 2ZBQA 2JH3A 4OX9F 1EKSA 1NKEA 5AJ3J 1FXLA 1N5SA 3SBMA 4AQYF 1FDDA 5G0RB 3J81j 1NDLA 3J7YU 3CJQA 3DYAA 3TJ9A 1WOPA 2YNHB 3ULHA 5BR8J 4Z7YA 3VAHA 2N3OA 1S9GB 5E41A 4F4AA 3O44A 2ASDA 3DI6B 2J6SA 2WVFA 2CJYB 2GC8A 2U1AA 4G3IA 3M2RA 2RF2B 2HHQA 2EK6A 4EK2A 4RL1A 4BCAA 2BYCA 4XTTA 4NZ7A 3KWMA 5KFGA 1H2TZ 5C42A 2G0JA 3VF0B 2W8KA 2HHHJ 1FEEA 2CQCA 4J7CA 1DTTA 5D4LA 4PWWA 2H4WB 4ES3A 3C15A 4RW6B 2W25A 2XMKA 1XBWA 3JSMA 4DCOB 2QV6A 4NA1A 4DL6A 1OY8A 3CWJA 2XLJA 5T7LB 2A1BA 2YQ0A 4CLLA 1GXTA 1TQLA 1WC1A 5BJRA 1U0SA 2A3JA 2OPSB 3EXCX 4L74A 4BWMA 5E2QA 1MN7A 4WZMA 1RCXB 1ZZFA 2L9DA 2QZ8A 3M8ZA 5IM0B 4DV3F 4NI2B 2YWFA 3DRYA 1KLMB 5E0OA 1DJ0A 5ETQA 1U8WA 1O51A 2J0WA 2Q1LA 3CJ4A 3D68A 3EVMA 1LK5A 1SC4B 1TL7B 3TNVA 2VHGA 4MKVA 3PW7A 1NDCA 2VICA 3HX9A 1HD1A 2HS4A 5FJ4A 3DXBA 2GQ2A 5A8KA 3W62A 4LBIA 3HFZB 1S9FA 2ZHAA 2DT9A 4C6AA 4YB7A 2AD9A 1UA1A 2WW4A 2B8PA 1A7GE 1J5OB 3I5AA 1T9UA 5IWAJ 3K0JA 4OLPA 2Y1LB 1SKRA 1BD6A 1FWPA 3UQSA 3HJVA 2QL9B 1RWMB 2XSJB 2DH9A 4M5MA 3D66A 1G2EA 1JJ2R 5D0RA 4JI6F 1B4SA 4NPOA 2DRBA 5GAGU 4ECVA 2BJEA 4LQ3A 2G0CA 3I0RA 3VZHA 4A8QA 2PO4A 3MZIA 3L09A 8ATCB 4IUFA 4KTQA 2ZZNA 3PO5A 1U0HB 5CZXA 1I3OB 2BOAA 2RB7A 4DHVA 4CNYA 1VRTB 2HK2A 4RW8B 1TK5A 3RB6A 2VBZA 4YEAA 4DR6J 3KG1A 4DSEA 1H38A 2HVDA 4F3QA 1S77D 1IKXA 3DRPB 2W9CB 4DR5J 3QIDA 1NO8A 1H6KX 4ZVQB 1ACMB 2KDOA 2V1TA 1CJUA 3BO2A 3F56A 1RT6B 2DHSA 2ZH5A 2ASJA 1SIWA 2B3TB 3E01B 1HR0F 3R1HA 1RKJA 2X1GA 2M5YA 4DV4F 3TZWA 2D3ZA 2KH9A 2CPFA 4URQU 4ZP8A 3M32A 2OFGX 3CJKB 2DB1A 5A0YB 2VH7A 3TEGA 4WF9Q 1NZAA 5IV4A 3OVBA 2UUAJ 2APOA 3DN9A 4U7CA 5DDOC 2OPQA 1RTDA 3R7BB 3TUPA 2XMUA 3IR7A 1WORA 1YJWS 1Q7YT 4NLPA 4RKUC 5T41A 4PQUB 1OWXA 1AROP 4J9UE 2XGPA 3MEDA 2KG1A 3N0VA 4DV2J 2B9WA 2NSCA 2JJ4D 3OL8A 1YX2A 4CM0A 3T5HA 1SKWA 3E2EA 1X60A 4KGXB 4DV0F 4DV5J 2DY1A 2KG0A 3UCUP 4DDFA 3V6KA 4B3OA 2J7UA 4F4WA 4ID5B 3VAJA 4I2PB 1L3UA 2MB0B 4TVAB 2H65B 3QPIA 4J37A 4TQRA 2VG7A 2CQ1A 4PR6A 3GMGA 2B9XA 3UE2A 1X4EA 4UT4A 3IAS9 4G1IA 5KOXA 2J9CA 4C3KA 4DFJA 2R7SA 1DARA 4RLEA 2YXLA 4KC5A 1M90T 4OV1A 1UW9A 2CFXA 2O67A 4RPFA 4U7UK 1CJVA 7FD1A 2PI5A 2Y3YA 2QRRA 1UUJA 2GHWA 3NOGA 5EX3A 4O3NA 2H51B 4DMZA 2A6OA 2C2EA 3CEDA 1HBNA 2B9EA 4BHQA 1QD1A 3QO9A 2Y9HA 2BJDA 5H9FJ 3FBEA 1HNIA 1M5HA 3GG0A 3HHLD 1IJFB 4NCGA 2L48A 4URGA 4YQWA 3GIIA 4O3RA 3CULA 2DYAA 4C7QA 2J0QD 2MQNA 2RKIA 2V67A 1RWPB 4P9SA 3AX2A 5IC4B 4C8NA 2P2CB 1OSCA 2HKEA 2GO8A 3NEKA 4ZHRA 1JXLA 2PFFB 1RCOB 2BANB 4MJWA 4P2FA 2CJ9A 2AGPA 2QJ3A 2V2QA 3BSOA 1HQEB 3MURP 2FVPA 2VJVA 2BQRA 4F25A 3QRRA 3FSXA 2DNYA 3V5RA 2CQDA 2R7OA 4IKAA 1KLMA 3VAFA 3PZPA 4EO8A 1R7IA 2JXGA 3QSIA 4DX7A 1PC4A 1RISA 2YKOA 3CNQP 5CD4A 2YH1A 1PAEX 2IBOA 1U49A 1N34F 4LUBA 1X31C 4QWDA 4WXOA 3H42A 5EWEA 2V4RA 3DHWC 3NNCA 1IR1A 2HURA 2ZBCA 5HO4A 1VCTA 2OEMA 4JP8A 1X0FA 4LRAA 4V1Ak 2RJZA 1RT2A 2NCKL 3OTDA 1VHIA 2CQHA 3PV8A 4DV1J 4NXMJ 2IM1A 2H3AA 2B4OA 5A8WB 1C0UA 1WC3A 4QW8A 3I82A 2I6WA 2V69A 3TVYA 1NEEA 2Y1JA 2KU7A 2V2VA 3FNNA 4L76A 1EETB 4M63A 4NCGB 1LK7A 1IBCB 2LA4A 4O3OA 1LQ9A 4ECUA 2WBRA 2FY8A 3IBCB 4G1QB 1FX2A 1R8CA 2CPXA 1JLGA 1KOOA 2C2MB 1SUQB 2QLWA 3KDOA 3MPDA 3Q86A 4M5GA 3ZTQA 1HHSA 2H3EB 3GSIA 4PPDA 5D15A 2HWIA 2FUG9 1Z1ZA 4CLFA 4B3MF 3KHGA 1TELA 5GMDA 3Q2TC 4ZPBA 3BBBA 4GKKF 1R27B 2UU9F 1VQLS 1EHWA 2M8HA 3U1NA 3RZAA 5KFUA 3W61A 3ZZYA 4LRVA 4ME7E 1T9TA 4N7TA 5M2UA 5DS7A 3GIMA 3OLAA 4ITSA 4WKYA 1VLYA 3G71S 2Y8YA 2A2DA 2KELA 3M2UB 4CTAB 3C14A 4OX7A 4RNFA 5GADI 2VASA 4TU7A 2BQ3A 4O4RA 5KFBA 1NK0A 3H2LA 1Q78A 3M8QB 2V68A 4EWTA 2G4BA 3OD2A 4UY8T 1S7HA 4KFBA 2VOOA 2VA2A 1MU2B 1REGX 3R27A 3H20A 5L1LA 2OI2A 3LP1A 1NK6A 3UPFA 1UCNA 4CQ1A 3CE8A 1QSSA 2HZAA 1XJWB 4F2RA 3KKFA 4K2XA 2WOMB 1MN9A 3QRQA 2VOPA 3MHYA 1RT4B 3P3DA 1FK9B 1FXRA 4W90B 1S0OA 3TVZA 2OO4A 4N56A 1E6VB 1P1LA 3BGUA 1NUEA 3HSGA 3KMSA 3IG1B 3G96A 3BM7A 4KFBB 3DOKB 3MEGA 2PE8A 2FHJD 3D6FB 5LJ3Y 1YQHA 3L7UA 3QT7A 2YKNB 4LF5J 2AP6A 1UW4A 4DV6F 4LR7A 1OY9A 1Q5VA 4F8RA 1PO6A 1XNRJ 2MYFA 3C6TB 3NAHA 1IKXB 3DRPA 4FVCA 2W9CA 2FJVA 4DV7F 3PR4A 2HRYA 3NNHA 3J7A1 4HKQA 4IH7A 1AB8A 2UV8A 3EDQB 1HBOA 1AT1B 2DO0A 2LDYA 2XMMA 4MIBA 6FD1A 3AFGA 1ZM2A 4NRTA 2JFDA 5CH7B 4DU7A 2ACMA 3RW7A 1ULRA 1TMMA 1M1HA 1Y5LB 2KHCA 5D4OA 2EEYA 3R9LA 1SUQA 2O01C 4CLYA 2MKKA 2Q66A 2CZVC 1B7FA 2ZITA 2POKA 4DQRA 2JEJA 1EETA 3ZZUA 4CLSA 1IKWB 2FGCA 1X9SA 2CA9A 2XSFA 1WC4A 2RUSA 3QATA 4OZ1A 4WU2A 4UZCA 1FA0A 1NSPA 2ATCB 2E7XA 1WWHA 1N6QB 2MKIA 1D1UA 1Y4ZB 4LF4F 4RR5A 1ZA1B 1VDHA 2J7KA 2KL8A 2V1SA 2ZNZA 3OTBA 5L39A 2J76E 1S0NA 4WE1B 3PJ9A 2UP1A 4GC7A 1DQAA 2B5JA 3QNWB 3BH6B 4NA3A 2VIHA 3M2VA 4NRUA 1FERA 5A8KB 2BV3A 4CYUB 3PJXA 4U6PA 1NM2A 3OJUA 4KGMA 1JJCB 1JB0C 1RBOB 2ZFHA 5KAKA 1TAQA 4M5KA 3OHAA 1FWLA 2JEIA 1FJEB 3KLHB 4N76A 4F4YA 4E2FB 5F8MA 4JI1F 2HQDA 3NMRA 3CJRA 4IRKA 4K59A 1GXLA 1FDBA 1T9XA 2HFOA 4FYYB 2H48B 5J1EB 4OHWA 1WHWA 4ZLPA 3NRBA 1WOOA 4PG5A 5M2RA 4OYAA 5H9EK 1QTNB 3OXLA 1X4CA 1R0BG 3AB4B 5B0DA 1BE4A 2LXIA 2OPRB 4NYOA 5CYQB 4WIQA 3CMQA 4FYWB 3IWLA 3HHEA 3GILA 2BE2A 3H90A 3ZFVA 3BQ1A 2AEFA 4QBUA 1U2FA 3R5AA 1FTCA 4Y2IA 5B08A 5MLCV 1UWAA 1X8DA 2UUCF 3PR5B 3UD5A 2GQCA 4Y6IA 1VQPS 2F5GA 3I87A 3H4BA 3RRGA 2COLA 2HGMA 2ZC4A 4RUBA 4IOAQ 3PHEA 2H5EA 3AOAA 2VDIA 2EBEA 2HRTA 4KR0B 3W65A 4DS5A 2ASYA 2VJUA 1HARA 2VG7B 2FGOA 4HHHA 1UZHA 1UJ4A 1HL6A 2VV5A 1GNKA 3ZZPA 1EP4B 3VVUA 1VMBA 3EM1A 2HWTA 1HD0A 3I55S 3KJVA 5J2PA 2HFNA 2XY5A 1ZTWA 2KO1A 1TUVA 1U1LA 3ZTRA 1BC6A 5DGBA 2BVZA 1Y3KA 3LAKA 3OQ2A 4F0MA 3W66A 4YUDA 5LSOA 2QYGA 4AL6A 2G0IA 2YWEA 2DR7A 3NGRA 3CPWR 4C8ZA 4B3RJ 2C1EB 1FNMA 5J1NA 2ADLA 4B3RF 3DRSB 2PMHA 4PAAA 5FDLB 5KT6A 5JVHQ 3B54A 4NYZA 2AJ0A 1ZAWA 3MMCB 4EUVA 5J2MB 1KLNA 5HI7A 1KRPA 3CD6S 1IBKF 4Q2MA 3ZTOA 2M7SA 2LXUA 1GMWD 3EVOA 5K20B 2ZH4A 2MQOA 3LP0A 3CCUS 3EVWA 5K8PA 1NK5A 4DSIA 2QT7A 3W9HA 4NEYA 4F50A 1UJ6A 4KHPF 3W8PA 4ES2A 3NO7A 4YMEA 3M9MB 1RAHB 1S4FA 3HD1A 4ZLLA 1M5OC 3FCHA 4TXSA 1LKZA 5GAGI 3MEKA 4W98A 4XDDA 1NU4A 1VRTA 2FJAB 4KAIA 2IDEA 4U67Q 1WF1A 5ETNA 4L6V3 2IMWP 1T03A 3R8YA 3Q8QB 1WUUA 2EWHA 4XDCA 3H5YA 5K9FA 5IV3A 1N32F 3TZYA 1RTIB 1T95A 4NZ6A 2AQ4A 3VAIA 4Y28C 4DX5A 4I1TA 3LO3A 3NBPA 4FNHA 2O1PA 3I4PA 4C8YA 3K57A 1RK8A 3IS9A 3VHQA 1CEZA 4K50A 2WW8A 1XC9A 3I32A 3L4BC 1WHXA 3P96A 2AYMA 1HR0J 2Q43A 3FRYA 1LNQA 2BJ1A 1CULA 3MAHA 1LFPA 1RAIB 2B8QA 3FBFA 5C24A 4ECXA 3TQ1A 4WP9A 2E7VA 4O3QA 5A6WA 4MK9A 4PPZA 4B9UA 1QLNA 1RAFB 3NS5A 4H4OB 4J9QA 2HVHA 1Q8LA 3HD2A 5M2PA 3G6ES 4U8VA 1SI9A 4KV8B 3QT5A 3MM6A 1YSJA 3GJSB 5GAHU 1U7LA 1I5OB 1KTVA 2KYZA 3I5BA 2GHVC 2DNLA 2IYGA 1Q81T 1NKBA 4JV1A 1WF2A 4WP3A 3UNYA 3H8YA 4DV0J 3AA9A 4DV5F 2GPEA 2E9ZA 8AT1B 3VW4A 1SJ4P 4JI4J 1S6QA 3MCSA 3K8VA 4NE9C 2JC1A 3T19A 5LJ5Y 3K59A 3SYZA 4K4VA 4B9TA 2BKNA 1OHNA 3QMQA 1XERA 3US5A 1PG5B 3CJSA 1RZMA 2CQ0A 2K5JA 2HIYA 3R6LB 1YJ9S 5T7LA 2GVDA 1X4GA 3KG4A 3M8RA 2HHPA 4DUYJ 1FO1A 4JI7J 1KHVA 3F73A 1OMSA 4OYZA 1UVLA 4WYWA 5J2QB 2DNPA 3FEZA 3IBWA 2UV8G 4QR2A 1ZYQA 2M88A 5ETTA 3PW0A 2VFVA 1NH8A 2K1OA 1UVKA 2LQ8A 1UETA 3AJ1A 3P8BB 3DCAA 5KFOA 1NKCA 1NB7A 3J7AN 1DQ9A 1WEYA 3B82A 3D54A 4PXBA 1HMVB 2B5JB 1F6TA 2CJXB 4ZVGA 4HI1A 3BPSP 2QA4G 3CDAA 3LGHA 3M2RB 4OFZA 4DL0C 2IM2A 2CDRB 3PX6A 1FDAA 4B3MJ 1XNRF 1CULB 3IXQA 1HPZA 4ZA1A 2RU9A 5HMXA 4NLQA 3I5CA 3G8QA 5HATA 3KK2A 1FJGJ 3CCTA 2HHTA 3R2CJ 5G0RA 2IM3A 2ZOMA 4ANCA 3LF0A 2DY9A 1SC6A 5I3QA 5DQIA 3OXGA 1YZ7A 2KKHA 5HQLA 2FQQB 4Q8EA 1SB6A 4YHHJ 2VF3A 3C16B 2OD4A 1RTZA 2NREA 3R5CA 1MYLA 2BW7A 2M0GB 2A6MA 1NNDA 2PFDA 4K4WA 1JLFB 5EGYA 2ZM6J 3NGSA 4ED0A 2RBFA 1PKUA 2QMXA 1VC5A 4KH1B 5HMYA 1GXUA 1DLOA 4K4TA 3D1QA 2NUUG 2IAJA 4H4MA 4YFUA 3CJ2A 4ZJQA 1TR0A 1DTQA 2NPIA 3DU5A 3D6TB 5FD1A 3TEHB 5HSPA 1K1SA 4HTIA 5GMKa 1S0VA 2NXJA 3MWBA 4A4JA 3JAMY 3OL7A 4ZPAA 1CSJA 1SJQA 2F7VA 1VQ5S 3ISND 4PUOA 3SV4A 4NXMF 1SH3A 2JXIA 1JK9B 1H73A 3DOKA 2EG1A 4GVLA 4RWWA 3RYLA 3UCZP 1WSRA 1RSCA 2Q79A 2DR5A 1WC0A 4BS2A 1AFIA 1R0AB 1GT8A 1RT1B 4NLVA 1FESA 1I1GA 3HI9A 3NS7B 2IAJB 3LUYA 4H4MB 4KY3A 5FDLA 3KK1A 3GV8B 2DGOA 4X62F 3VEAA 1T7PA 1ZAXA 1TFWA 1F3VA 1W25A 3BYRA 4J9PA 1YWXA 3OW2R 3SZ2A 1X0PA 1S79A 1N5QA 4ZIVA 3FMTA 2DNKA 4WFYA 4PCQA 3QQCD 2OSQA 1EIYB 2NYIA 3LPEA 2AJQA 3KJVB 1YRUA 2KXFA 4K2JA 4DV1F 1X93A 1RADB 2W24A 3BBFA 4DPOA 2MY7A 1OQ6A 3M8WA 3KLFB 3NS6A 2NYHA 1TKZB 4ELTA 1S1TB 3WZ0A 1P1TA 2W2PP 4L3KA 6FDRA 3SCJE 1X5OA 3HT3A 1U6FA 1HPZB 2VDHA 2CQ2A 3A8JA 3D28A 4PKDB 5LMUF 2ATLA 3QGHA 2HIQA 4USTA 4X64F 1F3FA 2RDIA 3BGRA 2O3DA 1QUVA 2VB6A 1BQXA 1KFSA 1VC0A 2H5JB 2R7WA 1K1QA 3SSRA 3W2VA 3IP0A 2YWWA 1MW7A 1PBUA 1TL1A 3GYGA 1B0VA 1UEUA 2OPRA 2QL5B 1P27B 4G1QA 5CYQA 2WSCC 4HHJA 5HAOA 3TX0A 2HSEB 2RE1A 3VGUA 4LRCA 4B08A 2W9BB 2JWNA 4KH0B 3PX0A 3O8WA 5AJ3F 3GZ7A 1VBKA 4Y2MA 3AA8A 1UFLA 2RQ4A 1PBAA 1ROFA 3DLGB 5DDPC 1UMJA 4WYLA 4ANDA 8RUCA 3SQGA 2UUBJ 3BGOP 2W2OP 3QZ7A 2BNZA 1CS4B 1VHFA 4KBIA 3V4MA 2HBZB 1TAUA 1M1GA 2CJQA 2MZJA 4DR4F 2KZMA 4ZKAA 2XB2D 1VR6A 3AD8C 3QLHA 5LOQA 1UFWA 2HHVA 1O5JA 3EE3A 4WE1A 5THWA 3AJDA 1P8GA 4B9LA 3QT6A 1OS5A 2FJDB 2WZ1A 2W2MP 3CGIA 2AV5A 3I9ZA 4LF6F 5MAOA 5KFAA 3K5PA 2X51A 4U95A 2LA6A 4EYHB 2F4VJ 4ZVEA 4J5OA 2BJ3A 2RMLA 2JEFA 2AT1B 2C28A 1IKWA 4C3LA 2F9DA 2YTCA 2FHJA 4N47A 4EFAC 2RH3A 3ETOA 4QPTA 2CJBA 5C24B 2Q2KA 5HJXA 2AIRB 2HFZA 2MKJA 5DM7Q 2HNDA 3CJ5A 2DH8A 1S9EA 3BR9A 5KT3A 2GO9A 3GG1A 2ZJRQ 4GC6A 4JI3F 2VQFF 4NX9A 1F2GA 3V81A 2BDPA 5EUHA 3R6GB 4C9DA 5DRKA 2DGWA 3BKTA 2YBVA 1E6YA 1RU2A 4O44A 1NK9A 4Q0BB 2R7TA 4HH0A 3JSYA 4OJHA 5KFWA 1HNWF 1T8EA 4F26A 2J7WA 1GX6A 2B7BB 2VFRA 3EUNA 3UR0A 3TRGA 3W8GA 3K7RA 4LRDA 2E1AA 4CO3A 1O6XA 5L8RC 4CZCA 5IT4A 5KT5A 4DL7A 4F4KA 1VRUB 2ZDPA 2XULA 4U96A 1NJWA 3AD9C 2EW9A 2RQMA 3MOJB 4B3OB 2HMIB 1IXKA 4ICLA 1EQ0A 1XN9A 1NDKA 3SMZA 2JVOA 2YKMB 1SH0A 4P7TA 3QFHA 2ZEJA 3IR6B 4AAIA 1E6VA 3VEBA 1KFDA 2DD8S 2W4DA 2XZWA 4I6YA 3OJSA 4ECQA 2GS8A 1RYSA 3IR7B 3PKMA 2E5IA 3CSKA 5F0UA 1CPZA 1C1BB 2D3O1 2OPQB 5IT9Y 2M4MA 2ABYA 2V8VA 3LP2A 3PDNA 4RW9B 4ID8A 4TY9A 5ITHA 3IA0A 3KNGA 1T9VA 3QWPA 2HG4A 1T3OA 1WEZA 2CPIA 3M32B 5IC6B 2FJXA 4EZ6A 2OEKA 4DG1A 2QLXA 1WKLA 4FBTA 1NPKA 1OYDA 5L46A 5KFCA 4L72B 5F3TA 1BY9A 1CJUB 2EFNA 3A4TA 1IR2A 1S1UA 1V3SA 2KOEA 3M2UA 4ZVRB 2ZBRA 3K8WA 4JV0A 4CTAA 2ZH1A 1ZA2B 2VQEJ 3A3PB 4A8YA 4ER8A 4KJIA 1GX5A 1RT5B 1MG7A 4OHXA 4MJKA 4IQMA 3SFUA 2WONA 2C2KB 4FKYA 2XCPA 3DRRA 4D3GA 4YDDB 4LF2A 4RW4B 4YP3A 1Q8BA 1RBLA 3HVRA 5LMUJ 2HQ3A 4CM2A 2UVRA 1IWAA 3N6LA 2BQUA 2A10A 3PW2A 4OZ2A 2F8HA 1A9NB 5IXUA 4F0HA 1SJ1A 2DPJA 2VA3A 2GZOA 2CADA 1LWFA 3MR5A 1VQ4S 3AX5A 2V8PA 4DPUA 1D09B 4OI1A 3BO4A 1ZPWX 2X1FA 4DR4J 5I3UA 2P5VA 1Q8IA 3UVJB 1YITS 4DSLA 2XSJA 2DNQA 2KXNB 3CDBA 2BX6A 5A8WA 4X4OA 4X4VA 2YNGB 4DJBA 2OD6A 3MM9A 5DG7A 4ZVPB 3B78A 4RWXA 4KRWA 3HHLA 3MMBA 3THPA 3MPYA 1NPRA 4XIUA 1FRJA 3CTRA 3AX3A 3T1HF 3EZOA 2E5LF 5J1EA 4EU0A 3K5LA 1WHVA 5EWFA 4LIRA 2YQ1A 4MIWA 4R8UB 4ECTA 5F41A 2D68A 4CCHA 4HDGA 1HQEA 1ZM9A 4UZBA 1B0PA 2AEMA 1RKIA 4O4GA 4R8UA 2W2QP 5KFQA 3G2XA 3E3XA 4NI2A 4FF2A 4CYUA 4IG3A 5IM0A 4OI4A 2DHHA 3IWXA 5LMNF 5GAEI 2OPPA 5K14B 3H2VE 1IJEB 2H1YA 5CCMA 1A0OB 3HHLB 1U6ZA 1IBMF 2QLBB 3OFGA 1K0TA 1G4CA 4B3TF 3C2PA 1IBKJ 3IR5B 4YHHF 1X7VA 4UUXA 1Q8KA 4ZJOA 1WG5A 1CJVB 3PRBA 1JJHA 3JB9k 3C15B 1FEHA 1D8ZA 2O66A 4DBQA 3B8HA 2YPYA 2M8DB 4DLEA 2MJNA 3ZNUA 3G8TA 2ZKUA 2ADCA 4J9MA 1FJGF 2R2UA 2YWHA 1EB0A 4ZPDA 1JX4A 1KVIA 1WDTA 3BEGB 4H54A 2XS2A 2BNWA 3HZGA 2V6AA 3QZ8A 1WTBA 1VOMA 1U1PA 2AZ3A 4I2PA 4QIEA 1HBOB 1UZDA 3M30B 2J5AA 2M3DA 4RW4A 2MPUA 1RAOA 4MKBA 2KTQA 2GIRA 2KB2A 3DI6A 3LA0A 2BE7D 4KSEB 4PYDA 5JJBA 1TL4A 4RZRA 2BW2A 2I5JA 2IJRA 4JI2F 1Y7PA 1KVKA 1MMLA 3UN2A 3W63A 7FDRA 2ZH7A 3JXOA 4N8NA 2ZHBA 4J9RA 4LF4J 1P94A 2J0SD 5I3PA 3DRXA 3QGGA 5DZ6A 4DXLA 2UXDJ 1O8BA 4DFKA 1K73T 3MEGB 3U27A 1DZ5A 2QA4S 1TKTB 1TVRA 2X1BA 3OBIA 5A0YA 5CCLA 2MZTA 3CJKA 1BMQB 3OTOF 3HM9A 1NHVA 1YIJS 1EX8A 3FRZA 4RW9A 4WIIA 4TLRA 1W7WA 5CYMA 3NWGA 3NY0A 2D3UA 4HACB 1HNXF 2O5DA 4HT7A 4I2QA 5HLFA 2DR9A 2DXFA 3GJRB 1QAJA 5C2GA 5E3RA 4X4QA 5C25A 3T3FA 5SUHA 1FNOA 4FXVA 2ZDOA 3MR2A 2FPHX 1AYEA 5F8GA 3CCWA 3K89A 3N01A 1WELA 3HP6A 3J7Z5 2J9DA 2GNKA 2HMIA 4HR2A 1S1WA 5KG0A 3R5DA 3GSDA 3C14B 1VRUA 1CJTA 3B4MA 4QIGA 3X3UA 2XMWA 4B9NA 1DRZA 3I0RB 2DTJA 2JLGA 1N0UA 2ZE2B 4B9VA 4ZK7M 3BF4A 5HMWA 3CDUA 4P73A 4UQGA 2R2SA 3BQ2A 1B99A 2JL9A 1Q79A 4O44B 4Q0BA 5JVGQ 4M5HA 3VV2B 4DUZJ 2LQJA 3X1LB 2M52A 1CQNA 4MFBB 1LW2A 1Q7LB 3IM8A 5KTQA 5KFHA 1MNEA 5F8JA 1V6HA 2GMJA 2HNDB 4A8WA 3DDKA 3CIZA 1U1RA 3NNAA 1C1CB 3QJPA 3GV7B 4C3MA 3FUYA 4M5IA 3FZ2A 1SV5B 2GW8A 1BWVA 1T0TV 2W4CA 3H87C 3BGLA 3CJ3A 2OTLS 1R6VA 2HBRB 4PXEA 3JAMU 4ZMMA 2KJVA 3FBBA 3MD3A 4WWSA 5ETKA 4FF1A 1YVFA 3EGWB 3O6QA 4HI2A 3UO0A 1R31A 3MAAB 3QWUA 3TWZA 1IVZA 2CJAA 3WQPA 1VRQC 4IG0B 4DUZF 4IOCQ 1Q86T 2JNJA 4I4BA 1KTQA 4OX6A 1AUSL 4CT9A 1HYSB 2MDAA 1LV5A 4C8OA 3T6JA 1TKXB 2VPYB 2GIFA 2MKHA 3LALA 2AGQA 1HKAA 4RUCA 1S0MA 3PXGa 5DDRC 1U6BA 3KYLA 4QWEA 1FRIA 4ZVFA 4DEZA 5LM7E 2YNIA 1NK4A 1KEKA 4OZ5A 2RKIB 4DCPB 5HJYA 2JZ5A 2DISA 2RILA 3DNCA 4C0BA 3BSNA 1FFSB 2EI5A 3CT9A 4OMFG 2W9AA 1W2BR 3R2DJ 2L3MA 2RAQA 4ED2A 3QO9B 1HBNB 5B7WA 1VGYA 3R5GA 1PAUB 5EX0A 1HNXJ 1C0TA 2VC1A 1CJKB 3R5JB 1N8RT 1HBMB 3EPIA 1S5ZA 2CJKA 3G9CA 4FYVB 2CPJA 4C11A 3VGVA 4WCEQ 5HMZA 2XTJP 4ECYA 2RF2A 4PABA 2RVJA 1RHQB 1XWLA 2C3OA 4DFPA 4ERDA 3I4HX 4GVBA 2GV1A 2KT5A 2K3KA 4CO5A 1S9GA 3L7OA 4OIXA 1FVQA 4M8LA 1K0VA 1WOSA 2FLOA 4CLZA 4EO6A 2DRAA 4K0KJ 3DFEA 1L3VA 3D0GE 4ID5A 2AW0A 4PZVA 4WFAQ 1UWBB 1SJ3P 1KP6A 5B0FA 4F36A 1IUJA 2UU9J 3SSSA 2XO6A 3ILJA 4J9VA 2W4PA 3WC2A 1X5SA 3N9UC 2X7IA 1NPPA 4Y65A 2QFJA 3HFVA 3M8YA 2YX4A 3GR0A 1GMUA 2CRLA 2DGVA 4QIFA 2WSFC 2B6AB 3CJ0A 1Y00A 2EFOA 3BPDA 3A8EA 3BSAA 3MM8B 3MPWA 5BYQA 3KHHA 3EJMA 4RNMA 1S48A 2HQIA 4HDHA 4Q7AA 2ZVSA 2ZOFA 3QBCA 4RNHA 5ETVA 1RT1A 3WBZA 4DX6A 3VAMA 1L3TA 4RBVA 2V4JA 4ZP9A 1RDRA 3DOLA 3CMAS 2E1MC 2K29A 3MMAB 2VPWB 3K17A 3E01A 3IWNC 4CLTA 5E3CA 1OPIA 2N82B 2ZH8A 2EPIA 1K9MT 2ALYB 1BQMA 3BGFA 3UN3A 2YWGA 1GTEA 4ECWA 5KFPA 1DTQB 3CMES 2F1FA 2Y1IA 1FJ7A 4A8XA 4JUZA 1TK0A 2UUWA 4WBFA 2DPIA 1PYOB 2EFGA 4ZJLA 2HVZA 3MM5A 3ADAC 1FKPB 2QL7B 5B09A 2Z57B 4USVA 4C97A 2VQEF 1DAXA 4WXWA 2DEIA 3ENAA 4USHA 5LXRA 3DLJA 1RWKB 1N5VA 4O3SA 4ATNA 3PYEA 5L1JA 2F65A 1FCAA 1Y10A 2RRBA 4HV0A 3EGNA 4LMZA 2ZWPA 4LSLB 2EVZA 3EGZA 1QVGR 3OTEA 1S99A 3DU6A 4C98A 4DL3A 4JB8B 2G2YA 1C4AA 3DLEA 3LPYA 4MYTA 2OEJA 4HH1A 4M5DB 2K3IA 2NS1B 2OAUA 4YB6A 3OFEA 2F4FA 3HVTA 4JYAJ 4ZLNA 3HZEA 2R7UA 3UDCA 4NASA 4Z2XA 1TV6B 1ZETA 1KNZA 2VG6B 1DY3A 1F5AA 1HWKA 1S1XA 1SJFA 1H3DA 2BXJA 4ZVTB 4QCLA 1IM4A 1TL7A 4NA2A 3N6NA 1NHUA 3JYTA 3RG6A 1UFKA 1X4FA 4J91A 4JI6J 4MYUA 5ETRA 3MUVP 2LYVA 2IDLA 2MHNA 2CWXA 4Z7CA 1S6PA 2R7VA 1JLBB 4CO2A 1T9YA 2GAGC 2KYXA 4WP8A 5KFRA 1MYKA 1WC6A 1NJXA 2XS5A 1RLCL 1SQGA 5BXIA 3LGNA 3RGIA 1Q0NA 1DURA 5J1PA 1S7IA 3TA2A 1N5YB 4P10A 1S6QB 1LFWA 1S72S 4CLWA 5CAAA 4QWCA 1RABB 3PW5A 1S6UA 2OUGA 5F0WA 2CKWA 4CT8A 1S10A 1VJWA 2I8EA 4RW6A 1TU0B 5EWGA 3AH6A 1SC1B 4K4XA 1DTTB 1LXNA 3I0SA 3KLVA 2FZCB 4LF6J 4K5RA 2RS8A 4JBCA 1MMNA 4OYXA 4QQBA 3ZNJ1 5C42B 3MFIA 3CJTA 5K8MA 1FRHA 3LWMA 5HP1B 4Q8FA 2MGZA 4CP5A 2OJ3A 3ZTSA 2C2ZB 3PEJA 4LF8F 3W1YC 3RUBL 3GFYA 1SQEA 4UUWA 1U48A 1N33F 1WHYA 1QE1A 2J9EA 2KVIA 2ZNYA 1QUPA 3FMBA 3PYDA 3ILIA 5D0EA 1A6LA 1HNVA 4TU8A 4ILLA 3D0IE 3OTCA 4I56A 3DYAB 4TNOA 3Q2SC 2UUBF 1JXVA 1AFJA 3JSBA 3M9OB 2HAIA 2NXNA 3DLEB 3AXKA 4C4WA 1FTRA 1REVA 1IBLJ 3I56S 4ED7A 1KONA 2MSTA 3M9NB 2MQQA 4X66F 2VQFJ 2FY1A 4LSLA 4EZ9A 2ZD1B 1UP1A 3D1HA 1ZOTA 3KXDA 1XMOJ 2HK3A 1R3NA 2GVZB 2K1RA 1PJ6A 2J6TA 1ZPVA 1X9MA 2P8IA 3A8IA 1IKYB 3BSCA 3KLIB 4W92B 1RI7A 1VIOA 2XYHB 2A2CA 2HHWA 1GH8A 1NXIA 4BDPA 2DHAA 2ZZMA 3O5TB 2FHKA 4USIA 4OJ1A 3T5KA 2QC3A 3LTOA 4M1KA 3FQLA 4IH6A 1JKHA 4JI2J 2W2NP 4PG6A 2BE9B 5KG3A 1XNQF 5L38A 5KFXA 4KPYA 4PXDA 1QSLA 2XQCA 4V19X 3MMCA 1VLOA 4F7VA 1RA7A 1SPBP 2X1AA 5J2MA 1U45A 1N36J 4PXCA 5EDWA 3ZXWA 1FRKA 3RU0A 4KHRA 1FJCA 1K44A 1EQMA 2CNNB 2JHEA 2Z2MA 3MMAA 3FGVA 2A2BA 2LP4A 3MDFA 1N52B 5AXKA 3LAMA 1H2VZ 4F3MA 4Q5VA 4C8LA 1VQOS 1WDDA 1JNZB 1T9WA 2ROGA 2HBQB 4ZN3A 4A8MP 4OHVA 4DPWA 3M8SA 5J2PB 4HT5A 2IM0A 1EP4A 1NLKL 3MM7A 4ZVOB 1NJYA 4DR1F 4A8FA 2UXBF 3VGSA 4YOEA 2WVCA 3MTKA 3Q89A 2FIUA 3VZIA 4CLKA 3T1YJ 3SCKE 1JLAB 4ALZA 2CPZA 1QJHA 5HQMA 3C19A 2B4VA 4DPTA 1RTJB 3IM9A 5CYJA 4CH7A 3OR1A 4X2BA 1RGVA 4DV2F 1CC7A 2QO3A 4AD6A 4MT1A 1OG7A 4X64J 2NR0A 1RWXB 1LWCA 3FSYA 5KG1A 3BJYA 4F4XA 3FFIB 3KUHA 2DNMA 3MI7X 1Q16B 4IFVA 3IRWP 1XMOF 4ZOSA 1VBZA 2Z2YB 2N7YA 4LSNA 3P45B 5DJBA 2XNQA 3RAXA 1F5CA 1S1VB 2XHCA 4OYOA 3BZQA 5DO2A 3PIPQ 3CCVS 3L9ZA 2E5LJ 2UXBJ 4XK8C 5IQQA 1HBMA 2WCXA 5A2QY 5GADU 2HHXA 1C0TB 2LQ5A 1N4LA 4OV6A 5I42A 3OFHA 2DHGA 1WI8A 4CLUA 3MEEA 5A8RB 3Q23A 4BWJA 2RSQA 3CJ8A 1SL0A 1L3KA 4IFYB 3KLHA 2FTRA 4WK3A 5B0GA 2AN7A 1VQNS 4X4NA 3OXFA 2HHSA 4DL5A 2KFZA 2IJNA 3UD3P 1IM6A 4ECSA 2KFYA 2RT3A 1KBRA 1R89A 2CNOB 2XBPA 3AXMA 3ILOA 4OI2A 3C6UB 4DPXA 2EXUA 3TO8A 2FLPA 1FT8A 2GCFA 3NMAA 2KN4A 3JTOA 4USWA 2P6TA 3DGVA 3N5BA 5DM6Q 2VBWA 4UF4A 3P5BP 4FXEA 2V4QA 1M5PC 3JSRA 2DR8A 2BZ2A 3CW2C 3GCXP 1VQKS 4E0DA 1UPMB 1AW0A 4O0NA 4I68A 1SKUB 1Q4RA 1NSQA 2HS3A 3FEYB 1FRMA 4KQZA 1Y9OA 2E29A 3J7ZT 3K5OA 2PIIA 3G82A 2QX0A 4I6WA 4AUKA 5KFDA 2FC9A 3TI0A 4K4UA 2G1DA 1GTHA 1Z4UA 1H98A 2AX0A 3SDEA 4C2MA 3KK3A 3GFZA 3KLGB 3ET6A 2YX7A 4FZVA 4IO1A 3ZZOA 2BMBA 2V2ZA 3NGUA 3PFEA 2EC2A 4U8YA 4DR2J 2XY7A 2UUAF 1LW0B 2GFFA 3PNIA 2W7PA 2F4VF 2AGOA 2DNHA 3HLUA 5D77A 4DOZA 2Y0BB 3L3CA 3H4DA 2GAHC 2WVBA 4ZCKA 4MK8A 2UVWA 3O3LA 1KD1T 4YB1P 3TA1A 4AFFA 2PDAA 4H4KC 1V3ZA 2PMWA 4O23A 4NMLA 4NLUA 4ZN1A 4DR6F 1V3RA 4QOTA 2IVMA 2WRMA 2EC0A 3IG1A 5DLGA 4LF8J 1FKOB 4J9SA 1TL3A 3BS9A 4KPCA 3C66A 3L7PA 2CVIA 1WSVA 3SXLA 9RUBA 2XYGB 1HA1A 3HXMA 3SCIE 3AWRA 2AF6A 2R7RA 5CD4H 1IWGA 1JLCA 2YY3A 3KDNA 3CVKA 2QTWA 3TAMA 2VG5B 2BBEA 2JLEA 4DPYA 2FVRA 1BDTA 2JX2A 3W9JA 3P6YC 3CDEA 1FE4A 1X5PA 3IRXA 1APSA 3M7VA 3NGKA 3TARA 1RYRA 5JMNA 1QM9A 2J8AA 3RTVA 5SZTA 1V5IB 3AAWB 3PJWA 3IAM9 2H54B 4YS2A 2VKZG 1PARA 2XMVA 3D5MA 4FPIA 4DQSA 1YJUA 1U1KA 3LH2S 3POTB 4RX6A 3DKDA 1XTZA 4FP9A 3HDSA 1HW8A 2KT2A 2IYIA 4A8OA 3CD0A 3KUEA 3FCWA 4TQSA 2XGQA 3Q24A 1YJVA 2RRNA 3DC2A 1SH2A 3SIPB 2DITA 1TK8A 4PQUA 3QIPA 4RU2A 4QU6A 3ENVA 5KG6A 4FN5A 1JLGB 2FLNA 3W2WB 1TP7A 1S6OA 1YI2S 5ETOA 3G6XA 3RW6A 3HCXA 1U02A 4JYAF 4OYIA 2W8LA 1IKVA 2IJFA 2IY5B 5HROA 5D3GB 3NCPA 5C2CA 4QWBA 5D8HB 1GFWB 1B01A 4K5SA 3KLGA 2NXUA 2LECA 2E5GA 1XIQA 4J90A 1K8AT 1B3TA 3M4XA 1RBAA 2HNZA 4X62J 5H9EJ 1XMBA 3G82B 4UY85 3S8SA 1HQUB 3GONA 5DG8A 2KZZA 4OQJA 2YVSA 4DR7J 1S59A 2IA6A 3C3LA 2HGNA 3HSJA 5KFEA 5KT7A 1GQEA 1EJ7L 2X3DA 3EMTA 1VI7A 1UEKA 2WSEC 3ZZTA 1YGYA 4DZDA 1MMDA 3M8PB 4TYBA 2FB0A 1ZM3A 2QYCA 3TA0A 3OL6A 3RBDA 3BDPA 2PC6A 1OPZA 1T94A 1M1KT 4S0MA 3LWLA 2BANA 4F3OA 1FD8A 1X5TA 2XEXA 2GJ2A 3AODA 5L9NA 3KTQA 3ZZ0A 4IG3B 4CLPA 1KQGB 1AA1B 1J27A 2RQCA 2FD2A 4ENOA 1SVDA 2A0FB 2UUCJ 1RT3B 4QJVA 4ZCIA 4RUHA 3H25A 3H2UB 5BR8F 2KM8C 1QAYA 2XMTA 3DLKA 3VAGA 1U1NA 2G9OA 5I42B 3W5ZA 2R8HA 2WK4A 4G65A 4FS2A 1U26A 1IBLF 3QJJA 3DM2A 4LSZB 3PO4A 2V9WA 2FJWA 1GEHA 4E8UA 1PCAA 2NZCA 2ZH9A 1PJ7A 1R0CB 3MM9B 2B56A 2C2OB 4NCBA 3N28A 1SQFA 3L95X 3O2IA 1S4EA 1RHRB 3Q22A 4TKTA 1OO0B 1N33J 5HROB 4DS4A 2G2ZA 4IDKA 2YNFB 3OR1B 1XR5A 1NSAA 4UOCA 2MSSA 3R97A 5C7PA 2VKRA 1RTJA 5IZHA 1XR7A 3CF5Q 4LR8A 1RXOB 1YDLA 2F63A 2W1BA 5D4PA 2VFTA 4KO0A 4OYPA 1XNQJ 4NMXA 1FX4A 5KT4A 4IRDA 5AE3A 3H98A 1RHMB 3MM7B 2F9JA 1OIAA 3D6HB 4I69A 4JI7F 3D1OA 4KHMA 2XTEA 2N4DA 2ILYA 2ROPA 2HZVA 2AJFE 3IMQJ 3QGPA 4KIAA 2WONB 4OYWA 2F8MA 3BH7B 1WD6A 2DNOA 4KGVB 4K7QA 2IC3A 3RRHA 2XS7A 2DJWA 2AHOB 5A76A 5EHHA 4NXNJ 1VBYA 2ZM6F 3FCVA 3BV8A 4R0JA 5L9XA 2P9EA 2I0XA 5HQ8A 4DQPA 4RW7A 4X66J 3HHNB 2HHUA 5F9LA 2Q6BA 4EI2A 4YR2A 3JS9A 4OLOA 1HW9A 4QU7A 1VS3A 2HLUA 3PIOQ 4ZS6A 4JI0J 2QE5A 1RE1B 3KJQB 1SIZA 4RO0A 3V6HA 3LP2B 4RW8A 2DNRA 1U9PA 2OHDA 2MHEA 1JKHB 2AEJA 3HT0A 3TW0A 4AT1B 4X65J 4DLGA 2DGSA 1IQTA 1U0HA 1KS2A 4MTPA 2QEXS 1TL3B 1TTHB 3AY0A 3CIMA 1Y5NB 5KT2A 4ZCLA 2AYEA 4KB7A 2IFXA 1EZZB 3EDRB 1R8AA 2XTDA 2WBMA 1FRXA 3H0PA 4TN2A 4XAKA 3CUNA 1VQ9S 1RA6A 3PYGA 2YQ3A 3P4UB 2CG4A 4C8KA 3Q8VA 2AX1A 3NOCA 2OIHA 1FI4A 2SXLA 2QMWA 1JWWA 2CPHA 4ZP7A 4AL7A 5FLXU 4NXNF 1JLEA 3OVSA 2V63A 1LW0A 2XYPB 2LQ9A 2VONA 1KKHA 3V81B 2JC0A 4OZ3A 1VBXA 4WK1A 2P9GA 3IO1A 1RTHB 2J6UA 2RS2A 2HWHA 2Z58B 4TY8A 5JUMA 5K8OA 2AY0A 3AD7C 3N6MA 1NSKL 2KRBA 3M6WA 2CQIA 1JLQA 4USUA 3ETMA 5DQHA 4GO5X 1VQSA 2DIVA 3V2UC 4GKKJ 2NSBA 1HHQA 5T14A 1RHUB 2AWZA 5HP1A 9ATCB 3RB3A 5IFMA 2ZOGA 3SI8A 3CC7S 4PWDB 4UTGA 3K2YA 2CIMA 2GMLA 2LEBA 4C8MA 2OPSA 4FYDA 3UNGC 2D9OA 4OHZA 1MSWD 5DG9A 1ITPA 3GB0A 3JQJA 4BLGA 3EX7B 1T11A 3DMJB 5LL6d 2B43A 3VWSA 2ZC3A 5A2QU 1J5EF 3WIUA 3RAMA 1N5YA 3EXYA 4YN3B 1T05B 1RAJA 5H9FK 1N56A 3BB5A 1ELOA 2CPDA 2HLTA 3C8YA 5DDQC 1WEXA 4CO0A 3SQGB 1NK7A 1S6PB 1YZ6A 3PRVA 2XMAA 5ETLA 3ZC4A 1GMVA 2GIQA 3UCGA 4DX8H 3DOMB 4L3NA 3K5MA 1IKVB 4B02A 5EN1A 1W2IA 3AT1B 4YY3J 1PYTA 4I7FA 4K0KF 3W2WA 1ZH5A 1Q16A 1YBUA 3S01A 3BR8A 2LXFA 3ONQA 3RBZA 3TZXA 1R8BA 2DXEA 2YNHA 4BC7A 3BGRB 1I94F 2YX1A 4URSA 5RUBA 3W64A 1MNTA 3M1VB 3VQTA 3E51A 2OFHX 1WG1A 3MXHP 2IRXA 3QT8A 5CHCB 3A13A 4MKYA 2CAJA 4K4YA 4Y34A 2CQBA 4C0OC 2ZUAA 3FK4A 4DFMA 4QR0A 1TKZA 3TR5A 1CVJA 4DUTA 1OSDA 2L9NA 4X65F 5E5NA 2JVRA 3THTA 1FF2A 2KJWA 2OP5A 3BDEA 1EAYC 5E3PA 5ETPA 5K5MA 3NG8A 4F04B 3CXCR 4DF4A 2Z0GA 1JNRB 4AXIA 3PX4A 1LXJA 1NB2A 3V6JA 5D0HA 3UD4P 1SBRA 4JI1J 3PRDA 4IOBA 5HVFA 2C2RA 2DO4A 1JLCB 1GAOA 2PGCA 1WKJA 3IC1A 4B3TJ 1RT7B 1UVNA 1KC8T 2R8IA 2OMLA 2C42A 1IBMJ 3KK1B 2E7WA 3CCRS 1AUDA 2G1HA 3MD1A 1RHJB 2ZJPQ 1R0AA 3HFKA 2QA1A 1NK8A 2XI2A 1N34J 1YKWA 2CNKB 2CQ3A 5KG4A 5B0BA 2L08A 4ETXA 3I31A 1VK3A 1TUGB 1YTYA 4J9NA 5FIIA 3RR8A 3KJNB 4PG8A 4I0WA 2BOPA 2V4JB 2WVDA 1IN0A 2HYIB 3K5NA 5AXLA 4ANEA 3DHXA 5GAHI 1DLOB 3CDWA 3ITHB 5CABA 1FE0A 3FBCA 3G6YA 3T1HJ 2RU3A 4KT0C 1WACA 3HKWA 4UQTA 3CCES 2I2YA 1RWUA 4G6VB 3V6DA 1N54B 4B3SF 2MZSA 2ZUGA 3Q8PB 2FHOB 2YWKA 2XC9A 1HWLA 1VQ7S 3N79A 5AE2A 4ZVHA 3CCZA 4NWBA 4LBHA 3SDEB 3SFGA 3HSDA 3TJAA 2RHSB 3SCLE 3KK3B 4A8KA 1M5VC 4DR5F 3M1VA 3NGTA 4O0IA 2LMIA 4QPXA 3OUYA 4ILMA 3T6BA 4MK7A 3HMJG 5K8NA 4ED1A 5GAEU 1BGXT 2C3MA 1YHQS 4X4PA 2IRYA 3TZZA 2QLFB 4UOGA 5DQGA 4DF8A 2R2RA 3FC9A 3LGMA 4I64A 1CLFA 1GK8A 3D67A 4P2XA 4Y2AA 1EA4A 2XMJA 3BO3A 4EBCA 3DOMA 3UI3A 4QYZK 3KNAA 1NDPA 4ZP6A 3QGIA 2FVSA 2EFQA 1RU1A 1U4BA 4OZNA 5A6PA 4B9MA 4ED4A 4WKRA 1WTFA 1WI6A 4U9RA 4X4RA 1UA0A 3AB2B 4K8RA 4JI3J 3OLBA 2MZRA 4IFYA 1T05A 2D69A 1Q5YA 1Q1KA 2Z2LA 3GQCA 4F0KA 1DHMA 3SEOA 3WX8A 1YBAA 1VISA 3OR2A 2KHDA 2YNIB 3J80U 4XO0A 1NRKA 3VQSA 5KFTA 1U25A 3A3NB 2UXDF 2C2NA 2H9ZA 4ECRA 3DGPA 4NOHA 2RHQB 3HO1A 2LEAA 2CPGA 5D0GA 4ETZA 2N3LA 3CCJS 1S1VA 3R1LA 1BDVA 1TKXA 2DHXA 4HL9A 4DV4J 1FKAF 4QR1A 4LF9J 3QRPA 2LU2A 3VALA 1JLBA 3DXSX 3NCRA 4ZITA 5IOLA 1QAIA 2DGXA 3ZZRA 1I6JA 2RD5C 2IA0A 2RUGA 1HBUB 3MPVA 4EMDA 2BKPA 2D1CA 1KHWA 5IT0A 4IG0A 3TANA 4JI5J 3GTYX 1XR6A 4PG4A 4R0EA 2MQPA 4DQIA 1NH7A 1H2UX 3O1LA 4P72A 2JOQA 1NMEB 5HVHA 2QMUB 2BRLA 4LT6A 2AU0A 4DV6J 2BACA 4KV8A 5B0EA 3PEHA 1JLAA 4CWBA 1X4BA 2VG6A 4LQ9A 2PA3A 2VPXB 3M6XA 3Q8UA 4NCAA 2AJ4A 1FHTA 2ZBIA 2GGPA 1JMTA 3B6BA 2UXCJ 3KMQA 2OKQA 3ITHA 1VC6A 2LFVA 3IN5A 4NLTA 4AYBD 2FJBB 2IVFB 1H72C 2B51A 2V8HA 3OPKA 4EEYA 5CXTA 4OJ3A 4GMKA 4WU3A 3GIJA 3KHRA 3GR1A 3D3CJ 3GU0A 3S7RA 2DXDA 1S76D 3OTOJ 2KXHA 2XY6A 4BBYA 2DVIA 4Z37A 4QIVA 1S57A 2ZE2A 1HWUA 1R43A 1RTIA 5JXSA 5HL7Q 4LFCF 5GVQA 1CQMA 3PCOB 3H5UA 1T03B 3IGNA 3EGVA 1LWEA 1CC8A 3UDLA 2XLIA 4OYBA 2QLJB 2EKYA 1LWEB 4OX8A 2GX8A 3W5YA 4CIOA 3CCLS 2EBGA 4A8SA 2HQFA 2RNEA 2AYBA 4OI0A 3MCNA 4YR0A 1B28A 3DDNA 4AQYJ 3THVA 1X4AA 2G13A 2W01A 3W3SA 4ILRA 2BJ8A 1SCJB 2NXCA 2R4FA 4DV3J 2Z8QA 1HI1A 1NCLA 2CVEA 4OZLA 1IKYA 1HWJA 3KLIA 3GV5B 4DR3F 4RW7B 4ZVUB 2GMHA 2VFUA 3KHLA 3RBEA 3TUIC 4RU9A 2GVZA 5ETSA 1M5KC 4CDIA 3HHLC 4RNNA 2MZ1A 2IC3B 4GRSA 1RUSA 4NLRA 2HHHF 2IRUA 3GYNA 2C2DA 2MQLA 1Q82T 2GJFA 1REVB 4OZJA 2D7SA 3T1AA 2IVYA 1LWXA 1Y11A 3EPGA 1HI8A 2D41A 3ZZZA 4ES1A 1UJ5A 2GGPB 1C4CA 3D9BA 4KE5A 2B9YA 5B0AA 1HHTP 2VZ9A 3Q8YA 3GWCA 3JTPA 1HIYA 1ZTTA 4FBUA 2NZ4A 2A18A 1QE1B 2AJ2A 1U09A 2MEWA 2JLFA 2YPZA 3KLEA 3ELHA 4WFXA 3M30A 2B4PA 4I7FB 3A8KA 4IDKB 1BWEA 4UOFA 4J9OA 2DCUB 1URRA 2MGZB 2BJ9A 3AQOA 1LEOA 3RBXA 4GVBB 2R7XA 3TAPA 3T9ZA 2K6LA 1ZS6A 2J0XA 4FDFA 2K9IA 3AQPA 2DIUA 4OJGA 3MUTP 2JDJA 2BR0A 3V4IA 4ED6A 3UDEA 3NKYA 2FZKB 3DGPB 3DM2B 1C2PA 2RQKA 4OX9J 2WHOA 2BE2B 2PEHA 4MIAA 4N41A 3OR2B 3DLKB 5KOWA 1KSPA 2LEPA 2WB1D 1PYSB 4C0HA 4ZVSB 2WAQD 1FVSA 3KFWX 2NPFA 2R2TA 2G2OA 3N5FA 4Q2LA 1RT3A 2PA8D 4NLDA 5K14A 1H7WA 5H1SV 2IBKA 1YG0A 4TYAA 5LXYA 3FMWA 3OSPA 1GMWA 3LOUA 1EARA 3I9V9 5DETA 1YLXA 4KKOA 2XHWA 1YK9A 1U2CA 3PHTA 1FXDA 3LQVA 2CWKA 1VYAA 3LANA 3QSYB 5AXMA 2CQGA 5AE1A 2VD3A 2V0NA 1HYSA 2U2FA 4IR1A 4FKXA 1QDUB 4I6AA 1RAEB 4KGZB 2HEKA 4UOHA 2EKNA 5C5JA 5HK4A 3MCOA 4YY3F 2HFSA 4WFNQ 4DUYF 4Q43A 3MAAA 3OUYB 3HVTB 2ASLA 2BA3A 3PG9A 1MWYA 4ZCMA 1RACB 1JLEB 4DR2F 4FS1A 1FWKA 1G3OA 2VU5A 5D78A 1MLAA 3RRKA 2YNGA 1D8YA 1N6QA 2FVQA 2KM8B 2R8KA 1OQ3A 4JV5F 3HVWA 1MWZA 2CPEA 3I96A 3NL0A 4CH1A 3HVAA 3V6DB 4KYZA 3UVJA 1XQIA 2CG8A 2KVQE 2FDNA 4JI4F 1FDNA 2XNRA 3DLBA 3NLCA 1VFJA 2GA7A 2MQ8A 1RB0A 1IRQA 3QIPB 1Z2LA 4Y00A 3M6VA 2E5HA 3RAQA 3A12A 4WFZA 1UPPA 2IMOA 1LW2B 3GLJA 2ZHOA 3MECB 4TLQA 3UW1A 4HEA9 1ZM4A 3NNEA 2VBXA 2R9LA 2HAFA 2AKWB 2VBYA 3MM5B 1B70B 2FHMA 5KFIA 1OYEA 6AT1B 4ED3A 3FZBA 1PC5A 3S6EA 1L5UA 1RT5A 2H4YB 1KR4A 4JI5F 2B4UA 2FYXA 4ZPWR 3J81U 3C6TA 4F2SA 2BSQE 3OSNA 4HHUA 3MFHA 1S1WB 1ZBTA 2YKNA 1N88A 4ELUA 1RWNB 1XMQJ 2Q3PA 4LFBJ 1QAXA 2HGLA 3IRXB 3M05A 4N5SA 4LF9F 4DG1B 3DOLB 3D0HE 1T3NA 4D8JA 3W9IA 4ED5A 3ENWA 3DLLQ 2V94A 4MH8A 1OY6A 1UKUA 2NLWA 4FXWA 4I2QB 1RT4A 2B7CB 3H59A 2XZTB 3GJTB 2EG2A 2HBYB 2WOMA 1BXNA 2PT0A 1ZAVA 2Z30B 3MF5A 5I4MA 3M8QA 2UVVA 1QY7A 4JV5J 2HNYB 1F9FA 4M5NA 1TVRB 3B4DA 1P9YA 2DEJA 3VTIA 4CH0S 1B0TA 3G86A 1VQMS 3DLHA 3CD5A
chains in the Genus database with same CATH topology
1IR0A 4B9SA 4DN9A 2QSFA 3BN4A 4A46A 3UWTA 5D6GA 5KFNA 3CCSS 3QAEA 4EGLA 1D9AA 2P6SA 3Q0AA 4H4KA 2I5JB 2D9PA 3MAQA 3J80Y 1PSDA 4LIWA 4NZ0A 2FVCA 5KFSA 4RNOA 4FXDA 1E6YB 1UEVA 3HHKA 3TX8A 2QSWA 2E44A 2MY8A 4RBUA 3NCQA 2VFSA 3U1MA 2ZJQQ 4GO7X 3D2WA 2MZQA 4ED8A 3M6UA 4AXJA 2BM1A 2EFVA 2N7CA 3CC4S 3OL9A 1PILA 1C0UB 1BQNB 3FSIA 1N36F 3DMJA 2ILZA 4G1PA 1RT2B 2F3JA 3E8OA 3UR3C 2DNZA 2XWYA 3PY8A 4EBDA 2KRRA 3C46A 2W7OA 2ACYA 2X3GA 4NLSA 3C6UA 2R7QA 5CA5A 2BA9A 5DLFA 3M8PA 1V9OA 4IH5A 3WDOA 4DQQA 1UAWA 4FF3A 4JI8F 3LW5C 1KQFB 3TYTA 2MKCA 1BQNA 2V9KA 4LJMA 4O4GB 4P7VA 3FEXB 1JLQB 1HQUA 5U47A 1IQZA 2HNZB 2E9RX 2DGTA 1J2VA 3ICLA 4TY8B 3F44A 4Q45A 4ZHRB 4YB5A 3DLGA 1RTHA 4OZ0A 1DBDA 5D3GA 3T5JA 1SV5A 5KFJA 2W9BA 1U1QA 3MMBB 4F02A 4OI3A 1HNIB 5F8HA 3GIKA 2Y1RI 3TUJC 2I9SA 5CZVA 2C22A 3W2VB 3FFIA 2DNNA 4DR7F 4CO4A 4I67A 2AJ1A 4WZQA 4NLWA 3AHPA 4MFBA 3SSQA 2J9DE 2NQPA 3WC0A 3POTA 2JSXA 2B0GA 3MOZA 1LWFB 4XPCA 3OVAA 1KN6A 4B17A 3CCMS 1HWIA 1S1TA 2HNYA 2CYYA 1BLUA 4Y2KA 2WB4A 1VQ6S 1ZZNA 1R8HA 2LLZA 3HPOA 3MTJA 2OSRA 4LF7F 2M2BA 5D4NA 3MEDB 2VG5A 3TAMB 2V2KA 3TVKA 3NGDA 1FD2A 4YDXA 3PFOA 5HLFB 1NJIT 4NLYA 1SL1A 1X4HA 3FVYA 4UW2A 1S97A 1RTDB 1QVFR 5CYMB 4NLOA 3P49B 4P2SA 4NL5A 4JV2A 2ALZA 2XLKA 1FKOA 2UXCF 4X4UA 3ISZA 4HVZA 3QJLA 1TKTA 2DCLA 2C3YA 4AE5A 1KVJA 2UVUA 2KI2A 2LKZA 1C1BA 1SIWB 4EYIB 3NAIA 1RT6A 1L3SA 3MECA 1G1XA 2VL1A