4QPXA

Nv polymerase post-incorporation-like complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
502
structure length
495
Chain Sequence
SKGTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a backtracked state reveals conformational changes similar to the state following nucleotide incorporation in human norovirus polymerase.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Hydrolase/rna
molecule keywords Polyprotein
total genus 167
structure length 495
sequence length 502
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 4qpxA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4qpxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qpxA03
4IH6A 5HLFA 4RW8A 1S6PA 4Y2AA 3OL9A 5L1JA 4WXWA 5KG3A 2IJNA 4NYZA 4XPEA 2VG5B 2HNYB 3H59A 5J2NA 3HVWA 3KK3A 2HMIA 1S48A 4DL2A 5KT7A 2JEGA 5KFZA 1RTHB 4IH7A 1TKZB 3DOKA 4GC6A 4H4MA 5KT3A 3CDEA 3OHBA 2IMWP 3MEGB 3HVAA 4O3NA 5F8IA 4O44B 3Q8QB 4KO0B 2RDJA 2R8HA 2UVUA 2UVVA 5CYMA 2V0NA 3BQ1A 5L1IA 4ED0A 1I6JA 3KHRA 4NLPA 5F9LA 2R8IA 1LW0A 3DRRA 1BQMA 3CO9A 4TY8B 4WFZA 4QWCA 4WYWA 3DRSA 3LALA 3BQ0A 3QO9A 1JLCB 4NLXA 4KHRA 3BREA 4F4WA 3FDSA 1FKPB 2YNHB 4NCGA 4O4GB 2ZD1A 3DYAB 5DGBA 1JLGA 3N6MA 5HBMA 2YNFB 5KFMA 3DLGA 1N5YB 4KBIA 4NLVA 4MFBB 3T5HA 4EEYA 3KMQA 1TKZA 5F8MA 4EO8A 1N4LA 3KLVA 4K50A 2ASDA 1RT3A 3IGVA 3UDLA 4ZMMA 2HMIB 5KFLA 3KLEA 3CJ2A 3H5YA 1T05A 4ZP9A 1HMVA 1S4FA 4ICLB 4O3OA 4TLRA 3EZUA 1JLAB 4MH8A 4QW9A 4G3IA 1RT6B 2AX1A 4F4YA 2VG7B 1W25A 5KFTA 2J6TA 1C0TB 4K4SA 1JLQB 3KLGB 4FBTA 1QE1A 3CDUA 4NLRA 1KHVA 3MR6A 4M95A 2VA2A 3PW0A 3JYTB 1R0AB 3KLIA 3JYTA 3GIJA 2W9CB 4K4VA 2YKMB 1LWEB 1IKXA 3BR9A 3CJ4A 4FS1A 1T94A 3PZPA 3BSOA 3ITHB 3IN5A 4IG0A 4MFBA 3QLHB 2C28A 1TVRB 4I2PA 2XCAA 1IKVB 4IG0B 4WZQA 1FKPA 2BRKA 2IJFA 4ZPBA 4ZPCA 5KFCA 3C6UB 3CVKA 2D41A 3H98A 3G6VA 2ZE2B 3MTKA 1T3NA 1TL1A 4RUAA 2R2TA 1JLEB 1JLQA 5KFHA 3KLGA 5F8GA 3DLGB 4IDKA 3BSAA 2ASLA 2D7SA 5KFIA 4RW9B 4HYKA 3N6NA 1JXLA 3OSNA 1RYSA 3HKWA 4YR0A 2JC1A 3QYYA 1RTDA 4RZRA 4ICLA 1HNVB 3GIKA 4ID5A 5K14A 4MK9A 5EWFA 3PW5A 4ZHRB 4TYBA 4ED6A 1S6QB 2OPRA 2YNGB 1HYSB 1JKHA 4DL7A 2HAIA 1TKTB 3Q8SB 3OL8A 1RT1A 2B6AB 1EETA 4X2BA 4NLGA 3OLAA 4EBDA 1S9EA 2IM1A 5I42A 3DYAA 3EPGA 3KK1A 1RAJA 4Y34A 2BQ3A 2IBKA 4TQSA 4TQRA 4PWDA 2WOMA 5KFJA 4NLOA 1TL3A 3IG1B 3MEDA 3DRRB 3IGNA 3V6JA 2ILZA 3IRXB 4R8UA 1S6PB 1DTQA 3FQLA 1C1CB 1RTDB 2DPJA 2W8KA 2ALZA 3JSMB 4Q43A 3HVTA 3RBDA 2WCXA 4EBCA 1CSJA 4H4OB 3IS9B 5DG7A 5DQHA 1HMVB 1TKXA 1VRTB 2B5JB 2W7PA 2ZE2A 4IOBA 2FJXA 4Y3CA 3E01A 4ECRA 3E51A 5EWGA 4NLSA 2UUWA 3M8PA 4JV0A 1SUQA 4R5PB 4ZPDA 1S1WB 5HLFB 3MFHA 2HWHA 3LP0A 3TVKA 3EPIA 3KNAA 1VRUB 2XI3A 2W7OA 1S9EB 4JUZA 5J1EA 5I42B 3GV7B 5KFYA 1T03A 1LWCA 2FJVA 1HQEA 3KJVA 4JV1A 4NRUA 4ZP7A 2YKMA 2W9CA 4F4XA 5J2PA 2J6UA 3QO9B 1XR6A 3TAMB 3PJWA 1BQMB 1KLMA 4KKOB 3DLKA 3UPFA 4NLUA 4TY8A 2JLEA 1IKWA 4LSNB 5KFRA 5KFWA 3IS9A 2WHOA 5HROA 4U7CA 2IM0A 3RAXA 2XGQA 1N6QA 3H5XA 3RAQA 1UWBB 2XI2A 4K4XA 3V6KA 4NLYA 4KSEB 2IM3A 4IG3B 2F8EX 4I2QA 4F50A 3DRPB 2C2EA 2IM2A 3V81A 3KOAA 1DLOA 4ZVEA 2JEIA 4IRDA 4IFYB 5KT2A 2D3UA 3DLEA 4NLTA 4ECQA 2BANB 4O3PA 4J9LA 5K14B 3V6DB 3ICLA 3LP2B 4RW8B 3Q8PB 3DM2B 1S0OA 2BRLA 3NBPA 3GIMA 2HNDB 2XC9A 2FVRA 3BSNA 4RU9A 2OH2A 3ITHA 1LW2A 3DLKB 1HYSA 3H40A 2ATLA 1JIHA 2OPRB 1IKXB 3FFIB 3DRSB 2C22A 3FFIA 1RT5B 3RB0A 2J6SA 3BJYA 1LW0B 5KFQA 1HPZB 1RDRA 1S1TA 3MF5A 2AGQA 1S1XB 5C42B 3UQSA 4ECXA 4LQ9A 1WNEA 2XGPA 2FLNA 1NHUA 4ZP6A 5C25A 4LSNA 3CJ3A 4J9KA 1RT2A 1JLFA 3TAMA 4J9NA 5KG6A 1U09A 3DRPA 2JEJA 4ECWA 1S0NA 5I3UA 3V6HA 4B3OB 1SH2A 2IC3A 3V4IB 1ZETA 4RNMA 3DOLB 4WFXA 5DQGA 2FVSA 5C25B 3NGDA 2E9ZA 4H4OA 1GX6A 3SFUA 3RB4A 4Y2CA 5DGAA 2C2DA 5KT5A 2W9BA 1N48A 3RBEA 5JXSA 1JLAA 4R5PA 4WFYA 4K4YA 4KV8B 3PR4A 4ED7A 3LAMA 4IQXA 1FKOB 4IFVA 2QV6A 3E01B 4ED2A 4RW7B 4PQUA 2OPQB 4LQ3A 1QAIA 3NAHA 4XPCA 5L9XA 3OHAA 1LWCB 5F8HA 1C0TA 3GYNA 1RA7A 5KFDA 1TQLA 4HKQA 2HWIA 2YNFA 1YVFA 3H4DA 3DM2A 3GILA 3BGRB 2AQ4A 3QGHA 3I5AA 4QW8A 2YNHA 3DI6B 4NCGB 4O4GA 4ECZA 5I3UB 1S10A 1DTTB 4Q44A 2R8KA 3H2LA 2BE2A 2BE2B 1IKYA 5KG1A 3HHKA 2R8GA 3LP1A 4G1QB 5JUMA 5KG0A 3KK1B 1XR7A 1MU2B 2CJQA 3PW4A 2E9TA 4YP3A 1N5YA 4URGA 1UWBA 5DG8A 1N6QB 4RNNA 4ZVGA 2ZD1B 5KG5A 3KLHA 1C1CA 4IDKB 1HQUA 2I1RA 5KG2A 2R2SA 1EETB 5EWEA 5KFUA 3NKYA 3QIPB 1C0UA 1HNIB 1RT4B 3GQCA 3T5JA 1HNIA 1RT4A 2WTFA 3UR0A 3KK3B 2HNYA 3M8QB 5J2NB 1S1UB 3GV8B 1RTJB 5KFOA 4PWDB 2RKIA 3MEEB 2FJWA 1K1QA 2UUTA 4J9PA 3NBPB 4DL3A 3GV5B 4IRKA 3BQ2A 5KFFA 4O44A 3LP0B 1TV6B 4RW6A 3DOKB 2V4QA 2HNZB 1TKTA 2ZKUA 3CWJA 1LWFB 3C6UA 4J9QA 2FVCA 2YKNB 4WYLA 5F8LA 5KFNA 4KFBB 3DDKA 3KLIB 3QZ7A 4NRTA 1S1VB 3MECA 1RT2B 4M94A 1IKVA 1IM4A 1REVA 4WE1B 4PUOA 2I5JA 1RYRA 4J9OA 2BR0A 1S1XA 4RUCA 3I0SA 4QWDA 4WE1A 3JSMA 3V4IA 3I5CA 2AX0A 3RB3A 5D3GB 4YR2A 2AGOA 4URQU 4RW7A 5HP1B 5J2MB 4O3SA 4WZMA 2GC8A 2E9RX 5J2QB 1J5OA 5L1KA 2UVRA 1BQNA 1RT7B 1TV6A 4RW6B 3SI8A 3T19A 4ED3A 4IKAA 3H5SA 1S49A 3DOLA 1XR5A 3I0RB 4MIAA 1BQNB 1D0EA 1T05B 2RKIB 3MEEA 1JLBA 3DLEB 3NL0A 5J2MA 4KB7A 1RT3B 3MFIA 1LWFA 1HARA 3QIDA 1S6QA 4MK7A 3MR2A 1C0UB 4NLDA 4DL4A 4DEZA 3KMSA 5F9NA 4ID5B 2FLLA 4IH5A 2CKWA 5HBMB 3C6TB 4Q0BA 3HVTB 3DMJA 5CYMB 3DMJB 1S1TB 5KFGA 3CJ5A 1HPZA 1QUVA 4Q45A 4YR3A 3I5BA 5HROB 4YQWA 5L1LA 4J9RA 2C2RA 3OLBA 2YNIB 1KLMB 4KFBA 4KKOA 4KAIA 4RNOA 1JX4A 1OS5A 2RF2B 4I7FB 4URSA 1DLOB 5J2PB 3BSCA 1SV5B 2OPPB 4NLQA 4TY9A 4GC7A 5F8NA 4QWBA 1MMLA 3QGIA 2WONA 1JLGB 1VRUA 2O5DA 1MU2A 1Z4UA 1FK9B 2GIQA 3MEGA 3V6DA 2BQUA 5EDWA 2FVQA 1S1WA 1S1UA 1NNDA 5KFKA 3LANA 2QE5A 4IFYA 1RTHA 5FDLB 1SV5A 5KG7A 4QWEA 2BQRA 2DPIA 1LWEA 2IA6A 3NAIA 4I2QB 4O4RA 4ZP8A 2VG5A 5KT4A 4ZHRA 4KHMA 1FKOA 4IFVB 4PQUB 3CIZA 3KJVB 2VG6A 2RDIA 4RNHA 1EP4A 3MR5A 2EC0A 3FSIA 4IR9A 4Q0BB 2VG7A 1N56A 1K1SA 5KFVA 4K4ZA 3OL6A 1IKWB 1EP4B 3OSPA 1D1UA 3LP1B 2FLPA 3MECB 3Q8RB 3VQSA 4B3OA 4OL8A 4MKAA 3KLFA 3KHHA 1IKYB 4IRCA 2OPSA 2W9AA 4FBUA 2OPSB 4FS2A 4IR1A 1DTTA 3OL7A 1SH3A 1VRTA 2R2UA 4ED8A 3D28A 1NHVA 2W8LA 1TVRA 4I2PB 4LSLA 3RB6A 2WONB 1RA6A 2IAJB 2IC3B 3SFGA 5EUHA 3M9OB 4J9SA 4ED1A 1RTJA 1DTQB 1S9GA 4RW4A 2OPPA 4DG1B 3G6XA 1JKHB 2OPQA 5D3GA 3QIPA 4KV8A 2UVWA 5KFBA 1LW2B 3H5UA 5FDLA 4NZ0A 1HNVA 2W9BB 3TQ1A 1HQUB 4H54A 4JV2A 4O3RA 3PR5B 4ECUA 4TXSA 4RW9A 3PW2A 2JEFA 3NMAA 5DLFA 2GIRA 2VG6B 5DLGA 1JLEA 1S1VA 4K4WA 2JC0A 1C1BA 4G1QA 3G86A 4NLWA 1TP7A 1RT5A 2B6AA 1RT1B 1TL3B 3MEDB 3KHGA 3PVXA 4Q8FA 2YNGA 3KHLA 4R0EA 2RF2A 2HNZA 4U6PA 4J9MA 1JLFB 1S9FA 5CYQA 2YNIA 4EBEA 4K4UA 4TYAA 5KFXA 3BGRA 4QWAA 4YMEA 5C42A 3QLHA 5C24B 5CYQB 3C6TA 5DG9A 2BANA 4ECSA 3M8QA 3KK2A 5C5JA 1ZTTA 4RNFA 4EO6A 5F8JA 1TL1B 3MR3A 4I7FA 4ZVHA 5HP1A 2FVPA 2B43A 4EYIB 1QAJA 4IG3A 4MKBA 5DQIA 4ECYA 4Q8EA 3CDWA 1S9GB 4RW4B 2R8JA 3FRZA 2WB4A 2ILYA 4ECVA 3I0SB 4WXOA 4ECTA 3T1AA 2IAJA 3I0RA 5J1EB 2XWYA 3T5LA 1RT6A 5T14A 4KO0A 4O3QA 3LP2A 3CJ0A 3FQKA 1RT7A 4H4MB 1SH0A 2ASJA 4EYHB 1SUQB 3M9MB 5J2QA 3M8PB 1J5OB 2WK4A 4DL6A 3M9NB 4DL5A 3V81B 2AGPA 2YKNA 3N6LA 3ISNC 3LAKA 3G6YA 2V9WA 4MIBA 1JLBB 1HQEB 1R0AA 1S97A 2VA3A 1C1BB 3DI6A 4TN2A 5KFPA 1KHWA 2B5JA 1T03B 1QE1B 2R2RA 1S0MA 3PW7A 3H4BA 4F4ZA 4XO0A 2XCPA 2D3ZA 3ISND 3QZ8A 1REVB 4K4TA 5KT6A 1ZTWA 4PUOB 1RTIA 2AU0A 3IRXA 5KG4A 4R8UB 5KFEA 4KE5A 4MK8A 4ZPAA 3KLEB 1JLCA 4ZVFA 3D5MA 3IG1A 4DG1A 3KLFB 2V4RA 3QGGA 1TKXB 5KFSA 1GX5A 1RTIB 3T5KA 5KFAA 3PHEA 2WRMA 3PJXA 2WOMB 3KK2B 3KLHB 1C2PA 3GIIA 2AWZA 5C24A 4LSLB 1FK9A 2HNDA 2I5JB 4QPXA
chains in the Genus database with same CATH superfamily
4IH6A 3T6BA 1P1TA 7AT1B 1YWXA 4RW8A 3C66A 2W7AA 3SXLA 2V1TA 1LXNA 5L1JA 5KG3A 4K8RA 5J2NA 4F02A 2AJ2A 2JEGA 1RTHB 4FXEA 4IH7A 3D2WA 4GC6A 4BS2A 1UTAA 3CDEA 3GFHA 2IMWP 3MEGB 2E5GA 2RDJA 2HRTA 1I94J 2UVUA 1N88A 4DSLA 3QT7A 4EGLA 3BQ1A 5L1IA 1SJFA 2JBVA 4DUYJ 3W8GA 1ZZFA 3AY0A 2XTJP 4NLPA 2OSQA 4I4BA 5F9LA 1VQMS 5K8MA 5HJXA 2OLWA 3OTEA 1KTQA 2ZM6J 1ROFA 3BF4A 4QWCA 4LFAF 1E6YB 3LALA 4DV2F 2BMBA 3QO9A 4P73A 2R7TA 5E3CA 3KTQA 4LF2A 3U27A 5IZHA 3RRKA 4WTOB 1UVIA 1FKPB 3HVRA 1SKWA 4NCGA 4PG5A 1WC4A 2C3YA 2ZD1A 5FIIA 3DYAB 4DX8H 1X4GA 2IHR1 5HBMA 2YNFB 1S7HA 3MPVA 3UVJA 5ITHA 1B3TA 1WOPA 4KBIA 4ED5A 1CPZA 2DXFA 3T5HA 1FWLA 2Y0BB 4EEYA 1BWEA 4A46A 4LFBF 4QU7A 4P7VA 1N4LA 3KLVA 2IYIA 3MZIA 4X4UA 1N33F 3R7BB 3UDLA 4ZMMA 1Y0HA 3I87A 3MHYA 5J1NA 2DXEA 3NS6A 1L5UA 2XS7A 1HMVA 3TR5A 4HTJA 3GJQB 3HX9A 4MH8A 1PJ5A 4QW9A 4DWIA 1VJWA 4DV5J 4F4YA 1ZM3A 1W25A 1FJGJ 4OYBA 2J6TA 4U8YA 1NK8A 1JLQB 3KLGB 1CLFA 1UL3A 3B4MA 2V8HA 3MR6A 3HP6A 3T1HJ 4TU9A 2VA2A 3MDFA 5A2QU 1VBYA 4K4VA 4ES3A 3CJSA 1T94A 2AHOB 3ITHB 1FDBA 1N34F 4MFBA 4DQPA 2PMWA 4DN9A 4RLEA 2GNKA 2XTCA 4I2PA 5AXNA 2XTEA 3JSBA 5EN1A 3IMQJ 4YB5A 1SXLA 4B9UA 5FJ4A 2NCKL 4NXNJ 4C98A 3K5PA 4KHPF 1AFJA 5HROA 4LF7J 3TZZA 4DR4F 4ZPCA 1S76D 5KFCA 3C6UB 1L3KA 3D0GE 2BKPA 4OZJA 1M1GA 2LECA 2UUBF 1UETA 2ZE2B 5IXUA 1T95A 3H25A 1BQXA 3ELHA 3AA8A 2VF3A 4DQIA 5FLXY 4L72B 2XTDA 1S79A 1P6TA 2GO9A 5E5NA 5KFIA 3UCZP 4HYKA 1WG4A 3F41A 3HKWA 4W92B 2CAJA 2JC1A 1GNKA 1WEZA 4R25A 2MQOA 1HNVB 3ET6B 4DV3J 4MK9A 2HHHJ 1RAGB 1LQ9A 3HZEA 4QIVA 2EFGA 4DR7J 1Q16A 2ZUAA 2B8QA 3MXHP 1JKHA 2QSFA 4MAKA 1MROB 3NG8A 5BR8J 3VVTA 4DS5A 2BKNA 2FZKB 3OQ2A 3RAMA 5IV4A 4K5SA 5D77A 2R7RA 1L3SA 2PA3A 4OMFG 5I42A 2IM1A 4OHXA 4I6AA 1MWQA 5IT4A 3OVSA 2PFDA 3JSYA 2GCFA 2GMLA 2OMOA 2V4JB 4ZPWR 1IJEB 4PXBA 2K7JA 4ILLA 1U25A 1VYAA 1M5OC 2DGQA 3CCRS 4OX9F 1X4BA 3ZTPA 4DSKA 3IGNA 2F40A 1DTQA 2UV8G 3SSSA 5I4MA 2XLJA 3KYLA 2CPIA 1XMQJ 1RTDB 3I9ZA 3JSMB 2DPJA 3DRXA 1QAYA 3R5CA 4MYUA 3A8KA 5DG7A 2A1BA 3OXLA 3UDEA 4RL1A 1GMWA 4CH1A 5IOLA 2ZE2A 4AYBD 2Z56B 3I55S 2B9EA 2DR6A 5AXKA 2FJXA 1XNRF 3E01A 3UD3P 2ROPA 2B4PA 3E51A 2GO8A 5EWGA 2UUWA 3HSZA 3J80Y 3OVBA 2VBXA 2AIRB 3EGWB 2CZ4A 2HVDA 5LSOA 2LDYA 4PPDA 2OTJS 5HI7A 3FMTA 3LP0A 2UUBJ 1DRZA 3GYXB 4AQYJ 5IT9U 2YPYA 2ZZMA 1QY7A 2XI3A 2HFNA 4KRWA 5I42B 1U47A 3M8WA 1EA4A 2OHDA 3SCJE 4OYXA 2A6OA 2RT3A 4M5LA 2HVHA 1LWCA 4KYZA 3BYRA 3TUIC 2PE8A 3VGSA 2D69A 3TZXA 2M8DB 2I8EA 2J6UA 3ZNUA 2WB1D 3QO9B 1B7FA 2QO3A 1BWVA 4A8QA 1RAIB 2BOPA 2G0IA 2DNZA 4DR6F 1U2FA 4AXIA 4LT6A 2Z57B 5KFRA 2CPXA 4RUHA 1FRKA 4U7CA 2MKJA 1VQPS 1BGXT 2AEFA 2CPDA 1HI0P 4CM0A 2V1SA 3RAQA 1UWBB 2KO1A 2XI2A 4K4XA 2XBPA 1B0TA 4MT1A 3W64A 4XIUA 4FF2A 4KSEB 1TL7A 2IYGA 2PMZD 2IM3A 2RH3A 1FRIA 1HHQA 2BX6A 4I2QA 2CQGA 4PPZA 2IM2A 1NRKA 2DNMA 2YKAA 1XNQF 1DLOA 1BDVA 5D6GA 4F25A 2XS5A 4K0KJ 4IFYB 5KT2A 2JEIA 1IJFB 3MPUB 4X4NA 4KPCA 3V6DB 1RBLA 2J8AA 4RW8B 3NNCA 1DHMA 2EXUA 2W4DA 3NBPA 1YJ9S 2DNPA 2JZ5A 1HA1A 1RSCA 2DGOA 4GO5X 4N47A 4ED4A 5E2QA 3L7UA 1NK6A 1Q8KA 1UEKA 2NSBA 3DLKB 3G2XA 1Q16B 4DV0F 1E6YA 3TJAA 1VC6A 3PHTA 2KFYA 4QIFA 3DDNA 4C2MA 2J6SA 1LEOA 3GCWP 1UVKA 3MAQA 4X4SA 2VFVA 5CZVA 1HR0J 4B9LA 1S1XB 5C42B 3OR1B 1RI7A 4NZ7A 1NLAA 2QN6B 5A6PA 2XGPA 2FLNA 1FRJA 1JXVA 4EZ6A 4F0HA 3CJ3A 4NMXA 2DJWA 4YY3J 2RQMA 2BUNA 2GJFA 2H4WB 4P2SA 4LR9A 4ELTA 4J9NA 3KKFA 4J7CA 1X7VA 1RWOB 2CIMA 2BJ8A 3ADAC 5ETLA 4DQSA 2CPGA 2GZOA 4L3NA 4MJKA 5DZ6A 2E1CA 4Z2XA 4LRFA 4N5SA 3UNYA 2DNGA 3NP5A 3LH2S 1S4EA 3DOLB 3RB4A 1GX6A 3SFUA 4YB6A 1I51B 5SUHA 3JQJA 3AOAA 3MPDA 2NREA 1JJCB 3RBEA 2UUAF 3FBCA 4IYQA 3MAHA 4KV8B 1NH7A 1YLXA 3LUYA 3BBFA 4PQUA 1NK5A 1B28A 2XEXA 1VI7A 1WF0A 4OYPA 4LQ3A 4DR2F 3H87C 1MWZA 4LVNP 4XPCA 3MMCA 4ZVPB 4USWA 5T7LB 3THTA 5B0FA 2FHMA 1BXNA 2CJAA 3GYNA 4F67A 4C6AA 1O5JA 1NJXA 1RA7A 1WTFA 3ZZUA 1TQLA 3KUHA 1L3UA 1X9SA 3UN5A 3FSXA 2HG4A 1X5TA 1ARQA 3FVYA 4U7UK 2VQFJ 2AJ1A 1PYTA 3HFKA 4MIWA 3DI6B 2QL7B 5IC6B 3D66A 4M5MA 1DTTB 4DF8A 2AF6A 2KN4A 2KJWA 3B82A 2BE2B 1IKYA 1HL6A 2DNNA 1A6LA 5KG1A 2BJ1A 2DNYA 2EG2A 3DXSX 2HW3A 5JUMA 3G8TA 1FE0A 4OZ3A 1EQMA 1QSSA 1F2GA 2MZRA 1MU2B 4FF1A 1UWBA 2GQCA 5DG8A 4ZCLA 2D3OR 2UP1A 3A8IA 4M5HA 4J90A 1C1CA 4OZ1A 2ROEA 3JAMU 4DQRA 3NRBA 4B9MA 1EARA 3BZQA 4CH0S 4N41A 2NZ4A 2PT0A 3UR0A 1NMEB 1MMNA 1PCAA 1BY9A 2WBRA 4Y65A 2HNYA 3M8QB 3KK3B 2B0GA 3PX0A 5KFOA 1KDNA 1ZPWX 4ZLJA 3ENVA 5GADI 2FJWA 1K1QA 3ISZA 5B0AA 3MI7X 4CWBA 4JV5J 3NBPB 3US5A 5D0GA 2DVIA 4K59A 1MNEA 2WSCC 4ZVUB 3GV5B 3RBXA 3GJRB 3BQ2A 1Y5NB 2QYCA 1WEXA 5C2CA 1TV6B 5G0RA 4KH0B 2H9ZA 1LK7A 2XMKA 3T9NA 1MROA 3CWJA 1YITS 2OAUA 3KLIB 4M5KA 1KN6A 1Q95G 1S1VB 3UDVA 1QTMA 2KKEA 1FD8A 2DRAA 1OQ6A 4K7QA 2PFFB 2DBBA 2YH1A 5GAHU 3PCOB 1BD6A 4TKTA 2XLKA 1OYDA 4FYVB 4ZJLA 1U8SA 5CZXA 4IOAQ 3I0SA 2FGOA 2MQ8A 2GAGC 4LRDA 4WE1A 2HHPA 2AX0A 4RO0A 5CAAA 2CQDA 1VQNS 4B3MJ 1F60B 3I4HX 4ERDA 4WZMA 3AAWB 2Z8QA 2E9RX 2R42A 3EICA 3MM6B 4RBUA 5J2QB 3QWPA 3A8JA 3L95X 3DXBA 3SI8A 2PI5A 4OV6A 5F0WA 5HVGA 2LKZA 2M52A 4O23A 3RYLA 4A8OA 1HNWF 1T11A 1T05B 4HH1A 3MEEA 3UD4P 2DNHA 3KUEA 3ZFVA 4DR1F 4PEOA 1PBAA 1R8HA 1G2EA 3Q0AA 1RT3B 4FPRA 2KZZA 1HARA 2F9DA 1ZPVA 3MR2A 1C0UB 4NLDA 3Q2SC 4KPYA 4OFZA 1FVQA 1D9AA 2VV5A 2F65A 3C6TB 3M30B 3DMJA 2C3UA 3M32B 2JRSA 4F36A 2DO4A 1S1TB 2HFVA 3B6BA 2JVRA 1QUVA 4OI3A 3WZ0A 3I5BA 1UJ6A 2X51A 3HHLC 2YNIB 3QAEA 1X60A 4HHJA 1KLMB 4RNOA 2RQCA 4JI7F 2KM8C 3HHLD 2GVDA 2M2BA 3A12A 5K8OA 1DLOB 2E5LF 3RRGA 4JI2J 3G9CA 5LMUF 1V3SA 3AD8C 3D0HE 3G82A 5F8NA 4QWBA 1MMLA 2DHXA 1KONA 2HZAA 1VC0A 1RHJB 3NEKA 3FGVA 1JLGB 2RVJA 4NYOA 5IQQA 3TVZA 4CO1A 3HPOA 1SKRA 3PIOQ 1RAEB 1T9UA 2CQ4A 4EI2A 1NZAA 3UO0A 2EKNA 5EDWA 2FVQA 1S1WA 1FDDA 3OXFA 4X66J 3DOMB 4GC7A 4C3KA 2BQRA 1SV5A 2QG9B 1N48A 2EBGA 3EE3A 4FNHA 5HANA 3HSJA 4O4RA 1WTBA 2IDEA 4ZHRA 5KT4A 1EIYB 2CNKB 1FKOA 4IFVB 2JVOA 1R6YA 2FJDB 3BPSP 2K3IA 2RDIA 1PG5B 2DIVA 2Q6CA 2Y0SD 2J0WA 3GSIA 1KC8T 2YKOA 2AJQA 2F5GA 4Q0BB 2VG7A 1GXUA 1MLAA 4CM2A 4FYDA 3PKMA 2RBFA 3MUMP 3OL6A 1JK9B 3SZ2A 1WG5A 3MECB 4DN0A 3VQSA 2E5HA 3KLFA 4FXDA 3N5BA 3L4BC 4I56A 3BBCA 1MN7A 2GW8A 1U9PA 4FS2A 4A8MP 1NK4A 2PSZA 4KHPJ 2ATCB 1SH3A 3D0IE 4DPOA 2N3LA 3EVOA 2UXDF 1ITPA 1SJ1A 1VCTA 2R2UA 1LNQA 4JI4J 2W8LA 2QTWA 2CQ2A 1TVRA 2AW0A 3ZNJ1 2PGCA 1RAOA 5ADZA 2J0QD 3ETOA 2FY8A 1TKDA 2A0FB 3CCTA 3R97A 3SFGA 4ED1A 1T03B 1RKJA 1RTJA 2M5YA 1DTQB 3CPWR 2MZJA 2ABYA 3CT9A 1HNXF 5D3GA 5GMEA 1VQ9S 3QBCA 2DH8A 5ETSA 2UVWA 4U7UD 1UEVA 5FDLA 3RTVA 4NXNF 2W9BB 3G5OA 1XWLA 3TUJC 2Q43A 4JV2A 2XM3A 4ECUA 1XMOF 2KI2A 3JTPA 2JEFA 3FNNA 4WBFA 5LM7E 2VOPA 3FBEA 5DLGA 1U49A 5C7PA 2V34A 2F4FA 3UN2A 4EFAC 1H2VZ 1O0PA 1YRXA 3PYEA 2QGFB 5AE3A 4A8YA 4RKUC 2UUCF 4U9RA 1PBUA 4EUVA 1WEYA 2PN6A 2XMTA 2YNGA 2CVEA 4O0NA 2RF2A 3PACA 2K7KA 3NCRA 3AJDA 3NS7B 4U6PA 3L7PA 4B3RF 2DGWA 6FDRA 4PG8A 3F73A 2VDHA 3V4MA 1RK8A 1UAWA 1RAAB 3QLHA 3W9JA 3J7ZT 4P71A 2VONA 2MSTA 2BANA 1CJUB 2BNWA 3MMBA 5KOWA 5C5JA 3CCQS 4RNFA 5F8JA 2CQ1A 1U24A 2FHJA 3PG9A 2NUUG 3ZZ0A 3IBCB 1QAJA 3EVMA 2EBEA 4MKBA 2HGMA 3CC2S 4ECYA 4Q8EA 3OFFA 1S9GB 2OD4A 2W4CA 2HIYA 3I0SB 4NEZA 4ELUA 4WF9Q 3PTWA 3T1AA 3UCGA 1TELA 3NGRA 2AJ0A 3CCSS 1NBEB 1RT6A 3FBFA 2ZEJA 3LP2A 1HWUA 4RWXA 4N8NA 4DV4J 2ASJA 3MD1A 5JVGQ 3ILIA 2JFDA 3HFVA 2NPFA 4DX5A 4ZN3A 1KR4A 3MMAA 3VAHA 2WK4A 1FTRA 1CJTA 2DGXA 2FUG9 2MY8A 2NZCA 2OP5A 3ISNC 4M8LA 2YH0A 4XK8C 4MIBA 3R7SB 3G6YA 2VJVA 1S97A 1OHNA 1C1BB 1SI9A 2OSRA 3HHEA 2HHQA 4HT7A 2LFVA 4DU8A 1OWXA 4ZITA 4QR2A 1BAZA 2XYGB 1REVB 1VJQA 3CGIA 3CUNA 1Q1KA 1RTIA 4ZDNA 3PKYA 4F3OA 2L48A 4R8UB 2A18A 5KFEA 3WX8A 4LIWA 4MK8A 2HVIA 5DRKA 4ZK7M 5IM0A 4DLGA 3QSIA 3D5MA 1NSKL 5K20B 4LFCJ 2V4RA 1X0PA 2B9XA 3PHEA 2FIUA 2WOMB 2WW8A 3KK2B 2QJ3A 1LV5A 4HDGA 4ZIWA 3AQOA 1T7PA 2YKPA 3DC2A 4QPXA 2RUGA 4I1TA 3DLJA 5GAHI 5HLFA 3C16A 4DZDA 4Y2AA 1SKUB 3OL9A 3BB5A 4RUBA 4WXWA 4DR5F 1OSCA 2J5AA 4XPEA 1NPRA 4PAAA 3H59A 1N34J 1FT8A 3HVWA 2R9LA 2IFXA 2OI2A 4QOTA 4C11B 2HMIA 2WVEA 3KXDA 4DL2A 4QYZJ 2HK2A 5KFZA 1TKZB 4PXEA 2ACYA 4QR1A 5D15A 4H4MA 1AZSA 2KYXA 5KT3A 3OW2R 3P5TL 5F8IA 3Q24A 3FUYA 3HT3A 2MEWA 4CLLA 3EM1A 2KG1A 4DPWA 1RABB 2J9DE 1HWLA 5CYMA 2V0NA 3SEOA 1HQ2A 1R43A 2KXHA 3EXCX 3NCPA 3K57A 1YKWA 2AP6A 1CULB 1Y5LB 2FTRA 1VR6A 4WFZA 2B56A 4ANCA 3BQ0A 5IM0B 1HHSA 3P45B 4CCHA 4KHRA 3X1LB 5I3PA 2Q3PA 3PV8A 1GQEA 4ZPVR 4O4GB 4Q45A 4I6YA 4ZVQB 1FFWB 3N6MA 3EJMA 3CXCR 2K8GA 2MKSA 3DLGA 5KFMA 5ETRA 1V9OA 4DX7A 1WKLA 4X4VA 3MPYA 4UW2A 3DLBA 1T0TV 4EO8A 4DCPB 5A8RB 2LA4A 4K50A 2ASDA 1RT3A 4ANDA 3AWRA 1YJ7A 4E8UA 2HMIB 1CJTB 1S5ZA 3CJTA 3LQVA 2HFZA 5LJ3Y 3O8WA 2IRUA 2DR9A 4ICLB 2HBZB 4Q2MA 3Q22A 3M6XA 2LA6A 3CMES 1RT6B 2AX1A 2VASA 2VG7B 3OTDA 3K8WA 2OEMA 2G13A 3TARA 2CPZA 1NCLA 2ACMA 2DNOA 3TEHB 2Y1JA 5ETTA 4ZKAA 3PX6A 1YJTA 3PO4A 3CCVS 1QE1A 4NLRA 4M95A 1EKSA 4AQYF 2DHHA 3PRBA 3JYTA 3P5BP 4PXDA 2W9CB 3QRRA 2YKMB 3BR9A 1IKXA 1JNRB 1U02A 4C8NA 3CJ4A 3WQPA 3MWBA 4FS1A 3PZPA 3BSOA 1TAQA 1VRQC 2DGSA 3M4XA 4HEA9 4HLBA 4IG0A 4NX9A 3I56S 2LU1A 4KGXB 1T9TA 2L9NA 1R6VA 3QLHB 5DDPC 1TVRB 2C28A 3M7VA 4C0OC 1FVSA 2AT1B 2XCAA 4DR6J 2UXBF 1NPKA 2KT5A 5K5MA 2KVIA 3VR1A 2BRKA 4ZPBA 5GAEU 4IO9Q 3QOQA 1RP5A 3CVKA 3TO8A 3G6VA 2CWXA 2ZH3A 3MTKA 3IO1A 1NSAA 1SIWB 1WHYA 4P6QA 2Y1IA 1YI2S 4CYUA 1CEZA 2GQQA 4YDDB 2MXYA 1JLEB 4L75A 3RBZA 5F8GA 1CJUA 2E1MC 3ILOA 3MMBB 3GG0A 2QLFB 1YJUA 3IWLA 2GHWA 1RYSA 2PEBA 2CZ9A 3GFYA 4UF4A 1UVLA 4I69A 4ID5A 5K14A 4JI0F 5DETA 4WK1A 4ZHRB 1F1BB 2V63A 3AB4B 1NDCA 3H42A 5HQLA 1EB0A 2OPRA 3M6WA 2YNGB 4B08A 4DL7A 1NJZA 3QJPA 1TKTB 3W3SA 3OL8A 4X2BA 3LW5C 3OLAA 4NLGA 1SPBP 3OTBA 2HBRB 4Z7YA 3CF5Q 4PWDB 4KIAA 2ZJQQ 3CJKA 3EPGA 4Y34A 1OIAA 4FNIA 2IBKA 3EGNA 4ILRA 2QSWA 1RHQB 4Y6IA 1MYLA 1G3OA 1K0TA 5D8HB 3TW0A 4NLOA 1TL3A 4KR0B 1EJ7L 3DRRB 3NS5A 3V6JA 2K2PA 2J0SD 4A4JA 1LWXA 1S6PB 1T9VA 2HS3A 2ZOFA 4LF6J 2RRBA 1U2CA 3CDBA 3TWZA 1FFSB 3QSYB 4X62F 5JVHQ 3K59A 1BE4A 3C14B 1QVFR 3GJSB 4CT8A 1QTNB 1TKXA 2LVWA 2B5JB 2W7PA 1FDNA 3OTOJ 5AXLA 2UXBJ 3VHQA 1NDKA 4Y3CA 2ZZNA 3KJQB 5CH7B 2QX0A 4JBCA 5A8KA 3K5LA 2RILA 2RSQA 4LIRA 1S1WB 3W9IA 5HLFB 5E3RA 2HWHA 1Q5YA 3L9ZA 2GJIA 2RJZA 1UFWA 4FN5A 3TVKA 1S9EB 4PKDB 4JUZA 5J1EA 3GV7B 1NSQA 3IM8A 5KFYA 4DUZF 1T03A 4KQZA 4CNYA 1HQEA 3VAJA 4DCJB 3DLHA 4NRUA 2CDRB 2DNRA 1GMWD 1MWYA 1NU4A 2VQFF 3TAMB 2H65B 2YX4A 1BQMB 4TY8A 3UPFA 3R1LA 3CCZA 1IBLF 2UUAJ 2BJDA 2G9OA 5CD4H 4ZLNA 3PYFA 3CCMS 4NI2B 3L3CA 2CJ9A 3WHIA 1UZHA 2OELA 2QLXA 3THVA 1N6QA 5A8WB 2X3GA 4NWBA 3V6KA 4UOGA 3G82B 3R5JB 1RLDA 4IG3B 1EHWA 4F50A 2DKOB 1M0SA 5CABA 3KOAA 1HBMA 4ME7E 5DO2A 4ZVEA 5U47A 4CLUA 5L9NA 2D3UA 1HW8A 4NLTA 4PQAA 4CLKA 3J80U 4P10A 4ECQA 4O3PA 4CTAB 2X7IA 3LP2B 5ETMA 2E7VA 3ENWA 2APOA 3Q8PB 2BRLA 2AN7A 1PJ6A 3Q8UA 2HNDB 4ZS6A 4X84A 2V2VA 3J81j 1AUDA 2PMHA 1N32F 1S99A 3TUPA 2OH2A 3CC4S 4HV0A 5ETKA 3ITHA 1UFKA 5T7LA 3NCQA 4HACA 3FRYA 4DI6A 3H40A 1HYSA 3P96A 2KT2A 2VFUA 3DRSB 3FFIA 1IWAA 5H9FK 1RT5B 2MPUA 3R5BA 1NK0A 2BKOA 1LW0B 2RRNA 1OG7A 2JX2A 1QVGR 2OEJA 2R7VA 1RDRA 1S1TA 1SIZA 3MF5A 2BYCA 3RW7A 3Q83A 3UQSA 3D7SB 4ECXA 1XQIA 4ZP6A 2DHAA 2XMJA 4JI3J 2B9WA 2Y8YA 1Q4RA 1O8BA 3K17A 3TAMA 3J7AN 3HJFA 4FXVA 2ZBRA 2VBZA 5KG6A 4X64J 3KUGA 3PFEA 1IR0A 2CQCA 2H48B 2GIFA 5F41A 9ATCB 2BNZA 4X65F 2IC3A 2ADBA 1F9FA 1K9MT 4RNMA 3HCXA 4WFXA 1VDHA 2FVSA 2VOOA 2P9CA 4H4OA 2KFZA 4B3MF 4Y2CA 5A2QY 2B51A 1SL0A 5ETVA 5CCMA 4LJMA 4ER8A 3SBMA 3NGUA 2F8HA 3GMGA 5JXSA 1JLAA 2HZCA 3BKTA 4WFYA 2V8GA 4K4YA 3GSDA 3T1YJ 4IQXA 1FKOB 2YPZA 4IFVA 2DH7A 5THWA 4RW7B 2HBYB 3FZBA 4JI4F 4CLFA 1TUWA 2NQPA 1D3WA 3HD1A 3VV2B 2E5JA 5L9XA 4AL6A 2R7SA 4M5NA 3KJFB 4FYWB 3OHAA 4DR1J 1VGYA 4FP9A 3MCNA 1KBRA 2QLBB 1QJHA 2V94A 4OHZA 4ENOA 2QZ8A 1F5AA 1X5OA 4IUFA 1N54B 2HWIA 4B3RJ 5E7OB 2AZ3A 3BGRB 5BYQA 3QGHA 1HNXJ 4QW8A 2YNHA 3I4PA 4NEYA 1WF2A 2QMUB 1BHNA 4OI1A 4Q44A 1RHMB 5LSRA 1UA1A 1NJYA 2XMWA 1RADB 3H2LA 4HHUA 4LF8J 2HFUA 1KVIA 5G4DA 4N77A 2RQ4A 2R8GA 1WWHA 2CPYA 5M2UA 2V9KA 1VQLS 4G1QB 3GG1A 1VISA 1XR7A 1ICEB 2GVZA 4DUYF 1C4AA 1UW4A 2UUCJ 1FX4A 1VQ7S 3PO5A 2CA9A 2ZD1B 2E7XA 3NNEA 3VCDA 1YX2A 4IDKB 2MKIA 4DV7J 2I1RA 3UFCX 4HHHA 3W61A 4UT4A 2R2SA 1YRUA 2MZ1A 3NKYA 2XHWA 3QIPB 1C0UA 3GQCA 1P1LA 3T5JA 1W7WA 1PC5A 1HNZF 2BM0A 4ZLPA 4Q5VA 4G6VB 2IJRA 3ET6A 4CO4A 3D68A 4YOEA 2CFXA 1X4AA 2V67A 3IM9A 5D4LA 3MEEB 3R8YA 1S6UA 3HK2A 3AOCA 4LREA 2UUTA 2CJXB 4J9PA 2ROGA 2B7CB 2C2KB 2HQ3A 4IRKA 4JI2F 4X65J 2XSJA 3LP0B 5DDRC 3U1NA 1WDTA 3DOKB 2HNZB 2ZKUA 1EX8A 1HI1A 2HGNA 4CO5A 5KFNA 5F8LA 1B0PA 3D1HA 2JXGA 3C8YA 2VPWB 1BLUA 3B54A 4ID8A 4JOUA 4KFBB 1RKIA 4PXCA 3QZ7A 2MHNA 1DAXA 5LOQA 4DR3F 2K9IA 5GMKa 1KSPA 3B78A 1REVA 4WE1B 2IVFB 5JMNA 4OYAA 2K3KA 2F8MA 1YHQS 1NJWA 1RYRA 4R0JA 4DPUA 1S1XA 3S6EA 5HL7Q 3JSMA 1TFWA 1YJRA 2V2KA 4RJVA 2HYIB 2KRBA 1RU2A 2NYHA 2ZNYA 3DCAA 3G8QA 5IC4B 3EWGA 2AGOA 4RW7A 1FNOA 3IR7A 1FF2A 2RHQB 2WZ1A 2Z2LA 4OLOA 5EGYA 5HP1B 4O3SA 1FEHA 1ZH5A 2V2QA 2UVRA 5IWAF 1TV6A 1XERA 1SBRA 5G0RB 1TR0A 2RD5C 2VPZB 4X4TA 3BBBA 3GR1A 2MQPA 4A8SA 3W60A 1H3DA 2ERRA 2ZBPA 3VZHA 3DOLA 1FRXA 1PC4A 5RUBA 3B4DA 4AD6A 2CNNB 2J76E 4WKRA 4X4RA 2IRXA 1JLBA 4OYMA 4DS4A 4BHQA 1ARRA 2POKA 2BZ2A 3H2UB 5SZTA 2Z2ZA 3IP0A 4FKXA 4DV7F 1G6BA 1LK5A 4MK7A 4FVCA 1SJQA 2IPOB 4DL4A 1K47A 1EAYC 4DEZA 5F9NA 2FLLA 3FBBA 2C42A 2PIIA 4Y0FA 1VHIA 2BSQE 4ZIVA 4LF5F 3CD6S 1PYOB 4KY3A 4OX6A 4PG4A 2D68A 1PAEX 2MZTA 2C2RA 1XEZA 4YS2A 3IBWA 1CJKB 4DSJA 2VKZG 5L1LA 2HHSA 3VVUA 2D3O1 4KFBA 4V1Ak 1H74A 2DR5A 4TLQA 5F3TA 4A8WA 1IR2A 3PIPQ 3VAFA 3BSCA 2P6TA 4CT9A 3LPEA 1Y9OA 1CQMA 2G2ZA 4TY9A 1U1QA 1REGX 4LFBJ 1TL7B 2QFIA 4BWMA 3IXQA 3W1YC 2ZC3A 3QWUA 3TRGA 4DQQA 2WONA 2ZM6F 2N3OA 2C2ZB 2O5DA 1H98A 1Z4UA 2GIQA 2QMXA 1WELA 2DITA 3MEGA 2N82B 2GX8A 3V6DA 2BQUA 1IBMJ 1FNXH 1NNDA 4J9LA 3LANA 2QE5A 5FDLB 4D3HA 4GKJJ 5I3QA 1J5EJ 1Z2ZA 4CQ1A 4I2QB 2IA6A 1JB0C 1KWMA 4UQGA 4DFMA 4WFAQ 4E2FB 2FJAB 4B3TJ 1PGZA 4PQUB 3A3PB 3CIZA 2VG6A 4RNHA 2KL8A 4CI0B 1K73T 1R27B 2N4DA 3AODA 3H8YA 3D6HB 4IR9A 3U7JA 1N56A 3K5NA 2BW7A 4WP3A 1KQKA 5KFVA 4K4ZA 3W5ZA 1EP4B 3HHLB 5K8PA 1FERA 2VKRA 3CMQA 4OI4A 1WACA 5AT1B 3VTIA 3W9HA 2RAQA 4MKAA 2L41A 2FLPA 3MOJB 3ONQA 3KHHA 2FD2A 1S6OA 2OPSA 5D0RA 1W2IA 2OPSB 2QT7A 2W9AA 3T3FA 1DTTA 1FJGF 1HD0A 2EEYA 1ZAWA 2ZZTA 2YXLA 3MM7A 2HBQB 3N79A 1HBNA 4HR2A 1KQSR 1NHVA 1SKSA 4I2PB 3NOCA 1VQKS 3RR7A 3OTCA 1RA6A 2WAQD 5D78A 1FCAA 3M9OB 2KRRA 4J9SA 2DEJA 1NJIT 2MGZB 3DHWC 4RW4A 1ZM9A 1PIEA 1X4FA 2IVYA 2OPPA 1MW7A 4DG1B 4QR0A 3D1OA 4F0KA 2JOQA 4CIOA 1VQ5S 4LRAA 4KV8A 1AA1B 1NEEA 4K2JA 3DOMA 1QSYA 4NZ0A 2Q6BA 2BA9A 4DR7F 1MSWD 1VMBA 1OMSA 1ZYQA 3PW2A 4I67A 2HLTA 3DLLQ 2M70A 5DLFA 2GIRA 3GWCA 3D3CJ 4K2XA 2ZH9A 4FF4A 1JLEA 3VWSA 1VQ6S 1FJ7A 2JC0A 4CDIA 1UJ5A 1JMTA 1RT5A 2B6AA 1RT1B 1TL3B 1R8AA 4RBVA 3VEBA 1FXDA 1NUEA 2XLIA 4MKYA 4R0EA 1AB8A 2AJFE 2I9SA 3CNQP 5DM6Q 2KHDA 3JQMA 2LLZA 1S9FA 2J9CA 2YNIA 5KFXA 1IN0A 3BGRA 1L3VA 4QWAA 2B8PA 3IWXA 4DV2J 2ZH1A 1RAFB 8AT1B 2QEXS 2VIHA 2KYZA 4P2FA 5C42A 2JHEA 1G4CA 4Z37A 3W62A 5C24B 3AFGA 3C6TA 5DG9A 2ZBCA 3PRDA 4OYZA 3FCVA 2XMMA 4PRFA 1TL1B 4LUBA 3J81U 2XSFA 1R31A 4DFKA 2P9GA 4EYIB 2KELA 3TP2A 2F3JA 1YSJA 1Q86T 5DQIA 1DARA 1SC1B 1FTCA 4PR6A 5A8WA 2WB4A 3OTOF 3HKZD 2HKEA 3WDOA 2K5JA 1F5BA 1U1KA 1K0VA 5J1EB 2KXNB 4F4KA 4W98A 4YEAA 1KVKA 2C2MB 4USHA 3TANA 3R5AA 3M05A 1VBXA 2FHJD 5MLCV 1Z2LA 4EYHB 1F2HA 1ULRA 3M9MB 5K8NA 4DV5F 2KH9A 4LF1A 2GHVC 3M9NB 4DL5A 2HURA 2AGPA 2YKNA 3LAKA 3GU0A 4OL8A 1D8ZA 2RU3A 1AFIA 2AZ1A 5KFPA 2CQ0A 1KOHA 4GKKF 2B5JA 2KXFA 3TAPA 1UJ4A 1YQHA 5B08A 2VC0A 5HMXA 2R7WA 1F3VA 2ZJPQ 3VQTA 3BO2A 1U1MA 2LCWA 4B9NA 2NSCA 3T6JA 4Y00A 4L73A 4WWSA 3NGSA 4ZVRB 1SJRA 3JQKA 2IDLA 4C97A 3NO7A 3ISND 4K5RA 2ZH8A 3ZZPA 1R89A 5LXYA 2I0XA 1SVDA 2ZWOA 3W7BA 5KT6A 2XZDB 4KE5A 1WSRA 5IT9Y 3KLEB 4W90B 2MY7A 4DG1A 4N8OA 1P94A 3KLFB 3T5KA 3Q2TC 1G1XA 2VFSA 2DRBA 3HLUA 1QUPA 2D74B 3PJXA 5B0EA 2YX1A 2D1CA 5L46A 3KLHB 5AE2A 2L9DA 2H5IB 4LRVA 2HNDA 4TU8A 2I5JB 2IRYA 1U4BA 4DL0C 3BDEA 1S6PA 3FEZA 3SMZA 1SJ4P 1TK0A 2ZHOA 1VLOA 1Y5IB 3H7HB 1IBLJ 4NYZA 5LL6d 4MYTA 2VG5B 1S59A 4WTYA 2XY7A 2ZBIA 2W25A 3HD2A 3MM8B 4DFJA 5D0EA 2HHHF 3HVAA 1T9YA 2V2ZA 3Q8QB 4KO0B 5B0GA 2R8HA 4UOFA 1X9MA 4N76A 4JI8J 3TJ9A 3NLCA 1VOMA 2XYPB 3MAAB 2DR8A 4C8OA 3KHRA 1LW0A 1HD1A 4UY8T 3G4SS 1YZ7A 3DRRA 1BQMA 2XMUA 4TY8B 2ZH4A 4CH7A 1N5TA 2ZH7A 2PD1A 1X9WA 1JLCB 2CWKA 4ZVOB 4NLXA 2JSXA 5D4OA 1CULA 2JXHA 6FD1A 2BBEA 3NGTA 3ZZYA 2ZNZA 3FDSA 1AXQA 3JXOA 4JI5F 2YNHB 2UU9F 2OO4A 2VFTA 2UXCJ 3QNWB 3ZTRA 1N5YB 4MKVA 2J8SA 3SCKE 1XMQF 2D9PA 2G1DA 2LEPA 1TKZA 3MM9A 3S7RA 2ADCA 3BN4A 3IGVA 5GAGU 2WVDA 1V6HA 1U1PA 1RZMA 2H1OE 1J2VA 2FGCA 4QJVA 4J37A 5KFLA 2O67A 3CJRA 1T05A 2LU2A 4ZP9A 4BLGA 3HXMA 2ZVSA 4RX6A 2F9JA 4MMOA 4JI3F 4C9DA 4AAIA 3EZUA 1JLAB 3U1MA 4RR5A 3D6TB 4G3IA 2VDIA 1AYEA 3AX5A 5KFTA 3K7RA 5MAOA 3MUVP 1C0TB 5HK4A 1B01A 4OLPA 2Z2YB 3NMRA 2G1HA 2XHCA 3VZIA 4FBTA 2ZBQA 5CD4A 3TI0A 4OYIA 4ITSA 2MQNA 2XO6A 3MCSA 3P3DA 3C15B 4HH0A 4ZA1A 1FJCA 1LWEB 2I6WA 4KGVB 3NGKA 2HPUA 3TQEA 3K58A 2KVQE 1R3NA 2JFKA 1Z1ZA 1Y4ZB 3FJ2A 3T1YF 4LF8F 3CO0P 1FHTA 2BACA 2AKWB 3OR1A 4QIGA 4C8YA 1PILA 4IG0B 4WZQA 3AJ2A 4LRCA 2LYVA 3UWTA 3PYGA 1QD1A 1LFPA 3PX4A 1K44A 2X1AA 1V5VA 3I96A 3H98A 3R5GA 5B0BA 3O3LA 3BO4A 1T3NA 4RUAA 3AH6A 5A0YB 2R2TA 4FF3A 3C14A 5KFHA 4Q2LA 2VHGA 4IDKA 4F3MA 3BSAA 2ASLA 2D7SA 3OPKA 4RW9B 1JXLA 3N6NA 5E0OA 3OSNA 4XTTA 1DBDA 1U48A 4RZRA 4ICLA 3KG1A 4P2XA 1WOOA 4CTAA 5L38A 3PW5A 3P4UB 2M3DA 2QLJB 3LTOA 2E5IA 2HFSA 3RU0A 4ED6A 4V19J 1S6QB 4LMZA 2PI4A 1APSA 3X3UA 4UOHA 5BYSA 1N52B 5IT0A 1I3OB 3M2UB 1T8EA 2ASYA 1PARA 1FO1A 2VFRA 4ELVA 1XMBA 2XSJB 5HVFA 1GAOA 1N5VA 5DM7Q 4DUTA 3MGJA 1NB2A 3W5YA 3DYAA 3MM5A 2RMLA 4USKA 3CB4A 1PKUA 4LVOP 1SCJB 1RAJA 4E98A 5KTQA 3VAMA 4TQSA 4TQRA 2DYAA 2XYHB 2EVZA 2WOMA 5KFJA 1FDAA 2W2PP 3D4JA 2QL9B 1F0XA 2DD8S 1NXIA 2CQ3A 3IG1B 3K5OA 3VGUA 4WFBQ 1WC3A 2MLZA 3SYZA 2ZUGA 4CZCA 2ILZA 1XNRJ 3GIRA 4R8UA 4NOHA 3HHNB 3FQLA 4ETZA 1OPZA 1Q78A 3W2WB 4YUDA 1VHFA 5B0DA 2ALZA 3EGZA 1B7YB 2K6LA 2R4FA 4Q43A 1U6FA 3HVTA 3PEHA 1KFSA 2HHUA 1F6TA 2AJ4A 2DHSA 2NXJA 2WCXA 4JB8B 3RUBL 4XAKA 3QFHA 2YWKA 5E41A 5CXTA 4RWWA 1UMJA 4IOBA 3M2RB 3SQOP 1VK3A 1NKCA 9RUBA 1H7WA 1WD6A 3EDQB 4ECRA 3UNGC 4I68A 1U1NA 1L3TA 5A8RA 5GAGI 4NLSA 1DURA 3T41A 2CNOB 1RBOB 4ZPDA 3Q23A 3OR2B 5BXIA 1I5OB 3O5TB 3EPIA 3ILLA 2ZDOA 4F4AA 3KNAA 2DK2A 4UZBA 4YHHF 2KHCA 2A6MA 3IFEA 1Y00A 4CLTA 2FJVA 2QA1A 3KJVA 4DF4A 2PC6A 3D6MB 4JI1J 4ZP7A 4JV1A 4KTQA 2CG8A 4F4XA 5J2PA 1QAXA 5JJBA 3MMAB 3PRVA 4ZCIA 4C3LA 3PJWA 3CCUS 2FJBB 3DDIA 3KWMA 1KLMA 2W2NP 3RR8A 2MSSA 4LSNB 4PG6A 4C7QA 3IS9A 2WHOA 3AD7C 1O6XA 2IM0A 2MLXA 2E5LJ 3P49B 2EG1A 2ZH6A 5LMUJ 4Y2IA 2FQQB 1EZZB 2NXNA 2XZ2A 3ZXWA 4P74A 2HZVA 2MQQA 1DQ9A 3L7OA 4KGZB 4LSLB 2BOAA 1AZSB 4NLYA 1U0SA 2DT9A 2RUSA 3AB2B 3DHXA 2JH3A 2C2EA 3WC2A 3DRPB 4PWWA 2YWEA 4CNZA 2Z2MA 3WBZA 3MM8A 5HQMA 4F2SA 1B64A 1S12A 5HSPA 4IRDA 3TX0A 4CO0A 1NZ8A 1B0VA 5K14B 1J5EF 3PNIA 3ICLA 2IY5B 3G96A 3DM2B 2SXLA 1S0OA 3O44A 2R7OA 1GMVA 3GIMA 2FVRA 3BSNA 4RU9A 1HHTP 4UTGA 4QPTA 4LR8A 1LW2A 2DY9A 1KOOA 3OUYA 2AYEA 4WK3A 1PAUB 3D3BJ 2ATLA 4DU7A 2FC9A 2BA3A 1RE1B 1F9EB 3OVAA 4DZ6A 4DPYA 1DQ8A 2RQKA 4UOCA 2VBWA 5KFQA 3OD2A 2XMAA 1HPZB 4PZVA 1IBMF 5M2RA 2K1RB 3ZC4A 1NB7A 2VB6A 4LQ9A 2ZVIA 1S72S 1D09B 1UP1A 1NHUA 2MHEA 4U96A 5C25A 1CS4B 3VAIA 1B70B 2KKHA 1H2TZ 3MMJA 1JLFA 1CBKA 5AJ3J 1WJ9A 1YBTA 3DRPA 1FWPA 3M6UA 2JEJA 4ECWA 1S0NA 5I3UA 1NDLA 1U7LA 4JI1F 3S8SA 1SH2A 4C3MA 4M1KA 2CNLB 1ZETA 5DQGA 1ZAVA 5C25B 2V8DA 2E9ZA 2C3MA 2HFOA 2LEAA 5DGAA 1UVMA 5KT5A 2W9BA 3D54A 2LDIA 2GMHA 2HIQA 4R5PA 2A2DA 2M4MA 1R8PA 2B3TB 2CRLA 3E01B 4PWUA 4QCLA 2LXIA 1SQEA 5BJRA 3NAHA 3EUNA 1QAIA 1HNWJ 4ILMA 1FRLA 3DGPB 2HHWA 2HRYA 3KDOA 5F8HA 1C0TA 2RHSB 2MLYA 3MAAA 2N7YA 5KFDA 1NK7A 3MM5B 2G2YA 2YNFA 1YVFA 3UVJB 1IM6A 3H4DA 3GILA 1Q5VA 4GVLA 3SCLE 3I5AA 1FI4A 4O4GA 2AMCB 2CPJA 4OHYA 1S10A 1IWGA 1YGYA 2R8KA 1NKEA 4LF5J 2BE2A 1WF1A 4B3SF 3PYDA 3GTYX 2QFJA 2C3PA 1U1OA 4KGKA 3AXMA 3G87A 1RHKB 4BDPA 1N5YA 2CJQA 4C4WA 2E9TA 4YP3A 4URGA 3TZWA 4X4OA 2HAFA 5KG5A 1CC8A 2K06A 2HQDA 3AQPA 1FXLA 4DMZA 2Y9HA 2HK3A 5KG2A 1EETB 3CIMA 3TA2A 5B0CA 1NAQA 4ZJOA 2Q2KA 3M8SA 1YIJS 5LXRA 3PY8A 4DV4F 4M5JA 3GCXP 3NXZA 2OUGA 4PABA 4B17A 1S1UB 1M5HA 1WUUA 3A3NB 4OX7A 1HBUB 2RKIA 5AJ3F 2MGZA 2LXUA 3BGLA 2VQEJ 4GKJF 3QATA 4OX9J 4DL3A 2MYFA 5E3AA 2CQIA 3FC9A 4O44A 1RCOB 5KFFA 2QA4S 4B3TF 1WDDA 3G6ES 3CTRA 2HVEA 2V4QA 3ULHA 2DISA 1LXJA 1KEKA 1XN9A 4B9VA 3MUTP 3QRPA 1R0CB 1A9NB 3GFXA 3C6UA 4CO2A 3C19A 3VGVA 2XNQA 1YK9A 4DV6F 2CJBA 1IR1A 2IA0A 4NRTA 1X4HA 2AD9A 1RT2B 2W01A 1YJWS 5GVQA 2WVCA 1IM4A 1HWKA 1FKAF 2I5JA 5H9EK 5HMWA 1HWIA 3WIUA 4BBYA 2JDJA 4OV1A 2BR0A 5IQ6A 4RUCA 1P9YA 4QWDA 3HM9A 1HKAA 2FHOB 2LQ8A 2BV3A 5IV3A 3V4IA 4GKKJ 5DDQC 3I5CA 1M5KC 3RB3A 1AT1B 1ZM2A 5K9FA 4B02A 3J7YU 1UVJA 1LKZA 4URQU 3KFWX 3OV7A 1ZAXA 2MKKA 3CJQA 5L1KA 4LF4J 1BQNA 3MURP 1Y10A 2F7VA 1RT7B 1PJ7A 3M6VA 4RW6B 3T19A 3UDCA 2Z4PA 3S01A 3GYGA 3GV8B 1S49A 1SQFA 1TMJA 3HSGA 1D8YA 3C46A 4MIAA 1D0EA 3R5DA 3BN7A 4QBUA 4Y2MA 1BC6A 1WORA 1IBKF 4OZ2A 1OQ3A 3FCWA 3UR3C 2BABA 1KVJA 3N0VA 1N0VC 4ES2A 1RWNB 1A0OB 1F9HA 4EMDA 1MYKA 4WIQA 3KMSA 4KGMA 1RWKB 2DNKA 3Q89A 1CJKA 4IH5A 1V3ZA 3U1LA 1ZM4A 5HBMB 2MJNA 3MCMA 3TOQA 1Q81T 4Q0BA 3HVTB 3NWGA 4UQTA 3DMJB 3M32A 5CYMB 7FD1A 3LJPA 2Y1RI 3CJ5A 3D9BA 2H3AA 3K8VA 3MEKA 2YWWA 2G0JA 2U2FA 1WHVA 3QT8A 5HROB 2HEKA 2UU9J 3A1YG 1Q53A 1JX4A 4PYDA 2CPEA 2P5VA 1OS5A 2RF2B 3OFGA 3PEJA 4I7FB 4URSA 4ZPTR 3V2UC 3K0JA 1SV5B 3QPIA 4ZOSA 4AE5A 4NLQA 2GGPB 3H0PA 4U67Q 5L39A 2XB2D 1M5PC 4CP5A 2V68A 4QQBA 3R1HA 1X93A 3SV4A 1ZOTA 2OGUA 3DKDA 3PDNA 2IBOA 3MM7B 2ZHAA 4C8KA 2BE9B 2BJ9A 3R2CJ 4IFYA 1RTHA 4LBPA 4NE9C 1B4SA 4USUA 5KG7A 4QWEA 3R7NB 1LWEA 5LT5A 4JV5F 4ZP8A 2E1RA 2GJ2A 1MNTA 5D4NA 2DIUA 1BUXA 2V5HG 2QL5B 1U0HA 3VAGA 3SCIE 1EP4A 5ETQA 3MR5A 1URRA 2WW4A 2P8IA 3EXYA 3JSRA 3FSIA 2LXFA 3QJJA 5A76A 2BE7D 3M8RA 1D1UA 1IKWB 3LP1B 4J5OA 3MMCB 4B3OA 2M9KA 2C1EB 3HDSA 2L08A 1IKYB 2LMIA 2QMWA 1NK9A 3FEXB 2AYBA 4P72A 3ZTSA 2W1BA 3DFEA 1YTYA 4IR1A 5IFMA 3OL7A 2H5EA 1U45A 2PEHA 1VRTA 2W4PA 2OTLS 2MQLA 1X4DA 3HULA 2DGTA 5H9EJ 1GXTA 1R8CA 3TA0A 1RU1A 1SB6A 2IC3B 1JQGA 2AYMA 4N56A 1NH8A 1SL2A 1CVJA 2HWTA 3SSRA 1LFWA 1OY6A 2LP4A 3HMJG 1RGVA 1JKHB 1Q8LA 4I64A 4OHVA 2J9EA 3QIPA 3FSYA 3GP9A 2HS0A 1SQGA 1FX2A 1HNVA 1FEEA 4H54A 4WP8A 4O3RA 5HQ8A 1RLCL 1I1GA 1H0HB 3PR5B 4TXSA 1IUJA 3T9ZA 4EWTA 4UUWA 3AT1B 3AX3A 5KAKA 2VG6B 1OPIA 3W2VB 3BV8A 3T5LA 2MKHA 3TAQA 4G1QA 2H5JB 3C2PA 4NLWA 5GADU 4Q8FA 4JI8F 2YTCA 2XNRA 2CUYA 1UW9A 4HACB 3R2DJ 2DRDA 3MOZA 3KHLA 2GVDB 1JJ4A 4D3GA 3IRWP 2JXIA 2HNZA 3I32A 1GK8A 4DR3J 3TNVA 5CYQA 1MN9A 2P6SA 2QYGA 3HT0A 4EBEA 2KJVA 3H2VE 2ALYB 3EZ5A 8ATCB 4YMEA 3KJNB 4MJWA 4OZ5A 2FJEB 2FZCB 3BO3A 1VS3A 2YQ3A 1ZTTA 5A0YA 3MR3A 4I7FA 4ZVHA 1MG7A 2B43A 1JJHA 2LQBA 4IG3A 3BM7A 1U1RA 3LF0A 2NR0A 1S7IA 2JL9A 3CDWA 4C8MA 2QA4G 4RW4B 1JXEA 1GTHA 1RCXB 1VIXA 3FRZA 4ECVA 2OIHA 4ECTA 4OI6A 4JI6F 3VEAA 2A3JA 2FLOA 4NI2A 1VFJA 3L09A 4O3QA 3TEGA 1E6VA 1GTEA 3FQKA 3MR7A 1SH0A 1M5VC 4F04B 1SC4B 5J2QA 3H20A 2MKCA 4LF6F 3EX7B 4DL6A 4JI5J 3V81B 2V9WA 3M2VA 2L9WA 3EYZA 3M2VB 2KM8B 1JLBB 1HQEB 1R0AA 1IBKJ 2VA3A 4WFNQ 3BGOP 4TN2A 2F4VJ 2Q66A 1KHWA 3KG0A 3IAM9 4WP9A 5T41A 3GXQA 1NPPA 3TYTA 2R2RA 4RPFA 1S0MA 1URNA 4CLZA 2UXCF 2BJ3A 2QA2A 3GE9A 3H4BA 4OYWA 2O01C 3DU6A 2D3ZA 3O1LA 3QZ8A 1DZ5A 1D9FA 4PUOB 4K4TA 1ZTWA 1V5IB 2P2CB 2KZMA 1WI6A 2XG8A 2PA8D 1CQNA 2DHGA 4ZVTB 2RS8A 4ZVFA 4WCEQ 2CQPA 2J7KA 1TKXB 1AUSL 1R8BA 5KFAA 3FKBA 1GMUA 3MM9B 4CRJA 1N8RT 2VL1A 2LQ9A 2G2OA 2EFVA 2AWZA 4HVZA 4AUKA 3CCES 1U6BA 1D9DA 2FHKA 1N0UA 3CD7A 3MD3A 1KKHA 3HJVA 3TJ8A 4AT1B 3IBFB 2QLWA 3FCHA 1KTVA 2IJNA 3NWRA 2HNYB 3SQGB 1G7CB 1FNMA 1S48A 3GFZA 3V5RA 3KK3A 3POTA 5KT7A 1SL1A 2CG4A 2A10A 4WPAA 2CPFA 3DOKA 3PM9A 3J7Z5 1TZ0A 3LGNA 3HHLA 4USMA 3OHBA 2VD3A 4O3NA 4O44B 1NSPA 2AV5A 2I2YA 3A8EA 3JAMY 1SJ3P 2UVVA 1BDTA 5E33A 1I6JA 2CADA 4ED0A 2ZHBA 1T9WA 2R8IA 2HQCA 3CO9A 3QMQA 4WYWA 3DRSA 1WI8A 2JLGA 2Y8WA 1VQOS 2EPIA 2LQ5A 4X66F 4QYRA 3CC7S 3BREA 4ANEA 4F4WA 4WU2A 2KOEA 3ZTOA 4W4MA 2ZITA 4CLYA 4Z7CA 2PO4A 5DGBA 4JYAJ 1JLGA 4OJ3A 5E3QA 2KDOA 4JI7J 1UWAA 2GVZB 3M8YA 2EFNA 4ECSA 4OZ0A 4NLVA 4MFBB 3KMQA 2BEFA 4JP8A 3CD0A 5F8MA 1U1LA 1XC9A 4F7VA 1TUGB 4O0IA 1NHKL 1N36J 2WVBA 4WU3A 3SQGA 4DBQA 1F3FA 2C2NA 2AEMA 3PJ9A 4CLSA 5BYRA 3KLEA 3CJ2A 3H5YA 1ZA1B 3AJ1A 3CJ8A 4USJC 2OD6A 4GO7X 3TVYA 1S4FA 5FLXU 2ZH2A 2VJUA 4O3OA 4JYAF 2I38A 4TLRA 2J7UA 2ADLA 2CDQA 4EZ9A 3M30A 3NNHA 1XK8A 4ZN1A 2DCLA 4K4SA 1M1HA 3R6GB 4LBIA 2J9DA 1VBZA 1UPPA 2CJKA 1X0FA 3CDUA 2BXJA 1KHVA 4UZCA 4YHHJ 2HLUA 5DS7A 3JYTB 3PW0A 3KLIA 1R0AB 3GIJA 4LF9F 2YVSA 2A2BA 1Y7PA 3BS9A 1KRPA 2EFOA 2X3DA 3IN5A 5HMZA 1NDPA 1RWPB 4G65A 3WIVA 2V4JA 3I31A 2H3EB 2OMLA 3UCUP 3W65A 3UE2A 2WSFC 4WJBA 2W2MP 1IKVB 2DR7A 2Y3YA 4H4KC 1I94F 1FKPA 5HVHA 3ZZOA 2IJFA 5D0HA 2UXDJ 5CYJA 5LJ5Y 4A47A 1TMMA 2D41A 5AE1A 2KB2A 1TL1A 3SIPB 1JLQA 3KLGA 4DSFA 1OO0B 3DLGB 5D4PA 4OIXA 5FD1A 1RWXB 1M1KT 5IS2A 3QQCD 4FKYA 1RAHB 4YR0A 3NY0A 3QYYA 1RTDA 4OI2A 1VLYA 3BR8A 4FVMA 3GIKA 5EWFA 5DZ7A 2PDAA 2EK6A 1SIWA 3FMWA 4OQJA 4TYBA 4C0HA 4ES1A 1HYSB 2HAIA 3Q8SB 2LQJA 1EETA 1RT1A 2B6AB 3HI9A 5GAEI 4NCAA 1P8GA 1QM9A 2RB7A 5HMYA 3KG4A 3E2EA 3W2VA 2CVIA 1PSDA 4EBDA 4PYAA 1HWJA 4ZCKA 1S9EA 3G8SA 4B9TA 4LF7F 4ZJQA 4KJIA 1PYSB 2ZWPA 1NO8A 3KK1A 2BQ3A 2BJEA 2FC8A 2ZC4A 3GZ7A 3N28A 4PWDA 4OJ1A 4L6V3 2HRUA 2MB0B 1UEUA 2VPYB 4KH1B 4RU2A 3GJTB 3MEDA 3U02A 1S0VA 3EVWA 3HSDA 4DSIA 5H9FJ 3AA9A 2R7XA 4J9UE 2C2OB 3IRXB 4AFFA 4NXMF 4YN3B 2CAXA 1C1CB 1RWWB 2DGVA 2ZKTA 2GPEA 5AXMA 3CE8A 3QAUA 4IO1A 1B99A 3ZO7A 2W8KA 1IBCB 1X5PA 2DXDA 4HDHA 3RBDA 1ELOA 4FPIA 4NA3A 1CSJA 4EBCA 4H4OB 3IS9B 4NZ6A 2WBMA 4NA1A 1C4CA 4LSZB 5DQHA 4YFUA 1HMVB 2GAHC 1VRTB 1TU0B 4F2RA 5M2PA 3ZTQA 3POTB 3J7YI 2ZJRQ 1DFDA 2VUGA 5DJBA 4KC5A 3CD5A 3M8PA 4JV0A 3RJMB 1SUQA 3ILJA 4MTPA 5CA5A 3E3XA 4R5PB 2YX7A 5HJYA 3MFHA 2RDDA 3ETMA 3N4WA 4DXLA 3T1HF 2R7UA 4LFCF 1MMDA 1VRUB 4DR4J 4GMKA 1UPMB 2W7OA 4Y2KA 3OR2A 3FZ2A 3DU5A 4QIWD 1KFDA 1U0HB 1SC6A 2DCUB 2YQ0A 4LF4F 2YKMA 2W9CA 4DJBA 5J1PA 2FPHX 1WG1A 1XR6A 2B7BB 1X4EA 5EHHA 5DDOC 1CJVA 4C8LA 4DV3F 4KKOB 3DLKA 4NLUA 5KFWA 2JLEA 1IKWA 1CS4A 2C22A 3K89A 3O6QA 1GFWB 1Q79A 1RBAA 2E1AA 1RISA 1GT8A 1UFLA 2L3MA 3D1QA 3OJUA 1AW0A 4OZNA 5BR8F 3BKUA 2XGQA 3RAXA 1UVNA 1Q0NA 3H5XA 2OFGX 3IAS9 4A48A 3I82A 1GH8A 3W2WA 1VIOA 4DCOB 5F0UA 5KOXA 1XTZA 3SSQA 3ENAA 2GGPA 2F8EX 2J0XA 2RNEA 5E3PA 1UZDA 3V81A 2IMOA 3GR0A 1XIQA 2YBVA 3EGVA 2WVFA 3DLEA 2OEKA 2BANB 3OFHA 4DX6A 4DR5J 4LFAJ 2FDNA 2XZTB 1Q7LB 2X1GA 4JI0J 2HHTA 5LMNF 1U8WA 1UKUA 3LO3A 2XC9A 1FRHA 4B3SJ 2E66A 2G4BA 5EX0A 2VQEF 2HQIA 4DHVA 2RS2A 1R0BG 2ZDPA 4G1PA 3DGPA 4J9VA 1WC6A 3R27A 4ALZA 1Y11A 1JIHA 2OPRB 1IKXB 3FFIB 4ZVSB 1JJ2R 3IWNC 4C8ZA 5H1SV 2CQBA 4DLEA 3RB0A 2G0CA 3BJYA 3VF0B 2FYXA 4GRSA 2B4UA 2J7WA 5CHCB 2COLA 3BPDA 4OZLA 4U95A 2AGQA 1N33J 3RW6A 1Q8IA 4YB7A 1FJEB 3JTNA 3TA1A 1WNEA 2VODA 2O66A 2YKQA 4CO3A 4LSNA 4I6WA 1V3RA 4CLPA 4ZCMA 1HW9A 1RT2A 1T02A 2CXEA 4P52A 4J9KA 4FZVA 3CCJS 4XDDA 4F3QA 1N5SA 1U09A 2HQFA 2Q1LA 2RIJA 4C11A 1HI8A 1RWVB 3DNCA 2XY5A 4RBTA 4E0DA 2MZSA 3I9V9 3V6HA 2W2OP 2XY6A 2BW2A 4B3OB 2GS8A 1QDUB 2FB0A 3BEGB 3V4IB 2XZWA 4F8RA 3SV3A 2MMYA 1WSVA 3AHPA 3NGDA 4NYPA 4TNOA 3K2YA 3CCLS 3VAKA 4P75A 2MKYA 1Q7YT 4FXWA 1RHRB 4DV1F 2EK1A 1RHUB 2C2DA 1FXRA 5A6WA 4DV6J 3A13A 2ZOGA 4LR7A 2QRRA 3LAMA 5ETNA 3PR4A 2EC2A 2QV6A 4ED7A 4ED2A 1OY8A 2GHPA 3AOBA 2OPQB 4NPOA 1UA0A 3WC0A 1TK8A 4M5DB 1IQZA 3HO1A 1LWCB 2DGUA 2EWHA 3BH6B 3W5XA 1RWMB 2NXEA 4Q7AA 1X5SA 3IC1A 4HI2A 3CJKB 4HKQA 3M8ZA 3K5MA 2XS2A 2MJUA 1CG2A 1H6KX 1WHWA 2YY3A 3DM2A 2AQ4A 1RACB 4NCGB 4ECZA 2UZAA 3F44A 5I3UB 1VK8A 3MTJA 4EK2A 2X1FA 3HFZB 3KDNA 4L76A 3IA0A 3P8BB 4TVAB 2YWFA 1P9QC 3HHKA 4FDFA 2JLFA 3LP1A 1LOUA 4LRBA 4UUXA 2VICA 5KG0A 1W2BR 2EW9A 3KK1B 1K8AT 1A7GE 3PW4A 2H51B 2WSEC 3A4TA 3PVXA 4AL5A 2AY0A 2KG0A 3CULA 1N6QB 4RNNA 4ZVGA 2ZFHA 1RJJA 3MPWA 2XWXA 2NXCA 6AT1B 3VALA 1VC5A 4K0KF 3KLHA 1RQ0A 1HQUA 2DO0A 3Q86A 3M2UA 1HR0F 3IR5B 3CCWA 4NASA 1WKKA 1U6ZA 5KFUA 5EWEA 1HNIB 1RT4B 2CJYB 2B4VA 1HNIA 1RT4A 4D8JA 2X1BA 2WTFA 1VQ8S 1OM2A 1QSLA 4YY3F 2H1YA 1ZZNA 1H38A 1N32J 5J2NB 1P27B 1YJNS 1ZS6A 1RTJB 2B9YA 3S1TA 5EX3A 2HQGA 3QFWA 2BDPA 2E1PA 4X4PA 1VQ4S 2BJ7A 3H90A 2F4VF 3LGHA 1WKJA 2HHXA 3LWMA 4F26A 2M88A 4RW6A 4XDCA 1W26A 1R7IA 4OX8A 1TKTA 1EKRA 5A8KB 4QZVB 3LPYA 1LWFB 1QLNA 3UI3A 4DV1J 4X62J 1M5SA 2FVCA 2YKNB 4WYLA 4J9QA 3G71S 3DDKA 1J27A 1OYEA 2VH7A 4L74A 3R9LA 2FZGB 1NM2A 2H54B 3FEYB 3MECA 3R3TA 4M94A 1IKVA 2F63A 2GFFA 4PUOA 1WOSA 2KU7A 4S0MA 3EZOA 4FYXB 4J9OA 4GVBB 2DH9A 2K1RA 4B9SA 5ETPA 4QYZK 2JNJA 3GONA 1X8DA 4UY85 3P6YC 3JS9A 2GV1A 1GXLA 2DB1A 2EI5A 2Z30B 5D3GB 1FWKA 3MCOA 3QT6A 4YR2A 1DY3A 2Z0GA 4N7TA 2NYIA 3PFOA 4DUZJ 5J2MB 4NCBA 1TFYA 2GC8A 2VC1A 2RRAA 1J5OA 3HHDA 1KLNA 2VU5A 3OT9A 4C0BA 4IOCQ 4GVBA 3UN3A 1S77D 4WKYA 1E6VB 4ED3A 4IKAA 1KP6A 1VBKA 2NLWA 3H5SA 4BC7A 4F0MA 3AXKA 1XR5A 3I0RB 5L8RC 3QJLA 1BQNB 2MZQA 3B8HA 4FYYB 3OJSA 4HT5A 1HBUA 2RKIB 1Q8BA 1ZA2B 3JTOA 3DLEB 3NL0A 4J91A 4ZLLA 5J2MA 4TU7A 4KB7A 2IVMA 3MFIA 5C2GA 1LWFA 2HSEB 3QIDA 3EMTA 4PG7A 1FESA 1S6QA 1YG0A 4PCQA 4C48A 2HHVA 3RGIA 4I0WA 3O2IA 2E29A 4ID5B 3VGTA 3F56A 2CKWA 3LOUA 4ATNA 3QGPA 3KNGA 3RG6A 1TK5A 4A8FA 3J7A1 1U26A 3EDRB 1O51A 5KFGA 1HPZA 2EFPA 4OYOA 4YR3A 3RRHA 4J9RA 4YQWA 3OLBA 2V6AA 2YWHA 4KKOA 4KAIA 3F0NA 4NMLA 5HN0A 1S57A 5HO4A 1HBMB 2LEBA 5J2PB 2DY1A 2OPPB 1YJVA 3LA0A 2N7CA 2HGLA 2K29A 2NPIA 4AL7A 3QRQA 4HTIA 2OKQA 5LSLA 2IIHA 1GEHA 4DV0J 2UV8A 4A8KA 3C16B 1N36F 2CPHA 1WC1A 2JJ4D 3QGIA 3SDEA 2GA7A 3SDEB 1VRUA 2EFQA 3HZGA 1MU2A 2VPXB 1FK9B 1TL5A 3OXGA 2C3OA 3BGUA 3OFEA 1XNQJ 3JB9k 1YZ6A 1S1UA 2ZOMA 5KFKA 1X4CA 1EQ0A 2XQCA 2F1FA 2DPIA 3FT7A 2V50A 3NAIA 5HAOA 2VG5A 1JWWA 3VW4A 2RU9A 3GLJA 4IQMA 4KHMA 3TUZC 3KJVB 4HI1A 2GMJA 2U1AA 1DJ0A 3N9UC 2EC0A 3UW1A 1FE4A 4LF9J 1H2UX 3QT5A 2M7SA 1FD2A 1K1SA 1TUVA 1NLKL 3DGVA 4NA2A 2VZ9A 1HLWA 3OSPA 1UUJA 2M0GB 3ENQA 4P7TA 3R6LB 3BGFA 1DQAA 2HVZA 4M5DA 1N5QA 3Q8RB 1CJVB 2V69A 3D6FB 3N01A 3W63A 4IRCA 3CEDA 4USIA 4Y28C 3UD5A 2YQ1A 2RE1A 1FA0A 4FBUA 4JI6J 4NL5A 1UCNA 8RUCA 1X31C 3DN9A 4QIEA 1JNZB 4YDXA 4M63A 4ED8A 4DR2J 3D28A 1HFEL 3AD9C 1TTHB 4LSLA 3RB6A 1WC5A 1HBOA 2BM1A 2WONB 3ZZTA 4X64F 3AX2A 2IAJB 3CMAS 1KNZA 3NNAA 5EUHA 1RB0A 4M5IA 2KFNA 2R7QA 1S9GA 1TL4A 3CW2C 3HF5A 2A2CA 1QTGA 3G6XA 1YBUA 2O3DA 1BMQB 2OPQA 1VQSA 4OHWA 1KD1T 3M2RA 4USVA 2M8HA 5ETOA 3C3LA 3GB0A 5HATA 4HL9A 1RXOB 4H4KA 1Y3KA 1LW2B 3H5UA 5KFBA 3OUYB 2FY1A 4OI0A 3TQ1A 1HQUB 2H4YB 2XMVA 1FRMA 5CCLA 4RW9A 2MQMA 1OJ4A 3BYPA 2CYYA 2EKYA 3NMAA 2MDAA 3CDAA 3LGMA 3Q8VA 4KT0C 4DFPA 2VBYA 1FFGB 4K4WA 1S1VA 1C1BA 4USTA 3FK4A 2DNLA 1SC3B 3G86A 1TP7A 1CC7A 3NOGA 3Q8YA 2JWNA 2D9OA 3MEDB 4DPTA 3TZYA 3KHGA 1ACMB 1WC0A 3M1VA 2BVZA 3M1VB 1OSDA 1XBWA 2QIFA 3BDPA 3THPA 4J9MA 1JLFB 2YWGA 4M5GA 3LWLA 3IR6B 4K4UA 4TYAA 2Y1LB 1YRTA 1KS2A 4LBHA 5B7WA 3ZZZA 1YBAA 1YDLA 1F5CA 4NXMJ 2OJ3A 5CYQB 1XJWB 2NS1B 5GMDA 2R3VA 4YB1P 3M8QA 1ZBTA 3MM6A 2DEIA 4P2MA 2AEJA 4DOZA 2XULA 4CYUB 4EO6A 3KK2A 2FVPA 2NUHA 1RUSA 3GPAA 2CZVC 3IR7B 4U8VA 7FDRA 5HP1A 3BH7B 3DRYA 2W2QP 4DPXA 2GQ2A 1T3OA 3A3OB 4L3KA 2DTJA 2R8JA 2AYGA 2ILYA 3J81Y 4WXOA 2IAJA 2K1OA 1HIYA 3I0RA 3WX4A 4BC9A 1H7XA 2XWYA 3D67A 4P9SA 2KT3A 4BWJA 4KO0A 1T9XA 2W24A 4OJHA 3TX8A 5T14A 4G1IA 3CJ0A 1HNZJ 1RT7A 4H4MB 5CQGA 1OY9A 1RTZA 1SUQB 1J5OB 3M8PB 1IXKA 4DDFA 2KTQA 3N6LA 1KQFB 4ETXA 3FMBA 4EU0A 1Y3JA 4AXJA 3DI6A 1KQGB 2DNQA 1WHXA 1H72C 1QE1B 4CLWA 2NXUA 2CQHA 3ZZRA 1IRQA 2V8VA 2O1PA 4X4QA 3PW7A 2Z58B 3PXGa 4BCAA 2XO7A 5F3ZA 1HBNB 1PO6A 1H73A 4XO0A 4F4ZA 2XCPA 2ZH5A 4V19X 4DSEA 2E7WA 1U2RA 2V8PA 5IWAJ 1VQYA 4A8XA 5B09A 4OJGA 2AU0A 3IRXA 3RZAA 5KG4A 2Q79A 3W66A 3C15A 1XMOJ 4ZPAA 2P9EA 3N5FA 1JLCA 3E8OA 1NKBA 1IVZA 2OFHX 1TAUA 3IG1A 2MTLA 3BKFA 3QGGA 1RWUA 2N4CA 1GX5A 1RTIB 5KFSA 2QC3A 1M90T 2B4OA 2WRMA 1IQTA 2HS4A 4WIIA 1Q82T 4QU6A 3I6PA 5LMNJ 1C2PA 1AROP 1HBOB 3CSKA 3OBIA 1FK9A 5C24A 3W8PA 3GIIA 2E44A
chains in the Genus database with same CATH topology
4IH6A 3T6BA 1P1TA 1YWXA 4RW8A 3C66A 2W7AA 3SXLA 5L1JA 1LXNA 5KG3A 5J2NA 4F02A 2JEGA 1RTHB 4IH7A 3D2WA 4GC6A 4BS2A 3GFHA 3CDEA 2IMWP 3MEGB 2E5GA 2RDJA 2UVUA 1N88A 4DSLA 4EGLA 3BQ1A 5L1IA 1SJFA 2JBVA 1ZZFA 3AY0A 4I4BA 4NLPA 2OSQA 5F9LA 1VQMS 5K8MA 2OLWA 3OTEA 1KTQA 1ROFA 3BF4A 4QWCA 4LFAF 1E6YB 3LALA 4DV2F 3QO9A 2R7TA 5E3CA 3KTQA 3U27A 3RRKA 1UVIA 1FKPB 3HVRA 1SKWA 4NCGA 4PG5A 2C3YA 2ZD1A 5FIIA 3DYAB 4DX8H 1X4GA 2IHR1 5HBMA 2YNFB 1S7HA 3MPVA 5ITHA 4KBIA 4ED5A 1CPZA 3T5HA 4EEYA 1BWEA 4A46A 4LFBF 4QU7A 4P7VA 1N4LA 3KLVA 2IYIA 3MZIA 4X4UA 1N33F 3UDLA 4ZMMA 1Y0HA 3I87A 3MHYA 5J1NA 3NS6A 1L5UA 2XS7A 1HMVA 3TR5A 4HTJA 3HX9A 4MH8A 4QW9A 4DWIA 1VJWA 4F4YA 1ZM3A 1W25A 2J6TA 1NK8A 1JLQB 3KLGB 1CLFA 1UL3A 3B4MA 2V8HA 3MR6A 3HP6A 4TU9A 2VA2A 3MDFA 1VBYA 4K4VA 4ES3A 1T94A 3ITHB 1FDBA 1N34F 4MFBA 4DQPA 4DN9A 4RLEA 2GNKA 2XTCA 4I2PA 5AXNA 2XTEA 3JSBA 5EN1A 4YB5A 1SXLA 4B9UA 5FJ4A 4C98A 3K5PA 4KHPF 1AFJA 4ZPCA 1S76D 5KFCA 3C6UB 1L3KA 3D0GE 4OZJA 2LECA 2UUBF 1UETA 2ZE2B 5IXUA 1T95A 3H25A 1BQXA 3AA8A 4DQIA 5FLXY 4L72B 2XTDA 1S79A 1P6TA 2GO9A 5E5NA 5KFIA 3UCZP 4HYKA 1WG4A 3F41A 3HKWA 4W92B 2JC1A 1GNKA 1WEZA 4R25A 2MQOA 1HNVB 4MK9A 1LQ9A 3HZEA 4QIVA 2EFGA 1Q16A 3MXHP 1JKHA 2QSFA 4MAKA 1MROB 3NG8A 4DS5A 3OQ2A 3RAMA 4K5SA 5D77A 2R7RA 1L3SA 2PA3A 4OMFG 5I42A 2IM1A 4OHXA 4I6AA 5IT4A 3OVSA 3JSYA 2GCFA 2GMLA 2OMOA 2V4JB 4ZPWR 1IJEB 4PXBA