4QPXA

Nv polymerase post-incorporation-like complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
502
structure length
495
Chain Sequence
SKGTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein
publication title Structure of a backtracked state reveals conformational changes similar to the state following nucleotide incorporation in human norovirus polymerase.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Hydrolase/rna
total genus 167
structure length 495
sequence length 502
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 4qpxA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4qpxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qpxA03
4O3PA 4NYZA 5C42B 3RAXA 2YNGB 1BQNA 4EYHB 4F4WA 1XR7A 2XI3A 2BANB 3GYNA 3LP1A 2IC3B 5C25B 1HNIA 4IH7A 1S9GA 4RNNA 1N5YA 2R8KA 4WE1A 4YMEA 2OPSA 1RTIA 3MR3A 3UQSA 4K4UA 3FFIA 5KFEA 1T03A 4ECSA 1J5OA 1S1WB 2YNIA 2YKNA 2C2DA 2AU0A 4O4GB 2ZKUA 1KLMA 4J9OA 4KO0B 5I3UA 2BQRA 1TQLA 4ZP9A 3M8PA 1LWFA 5HLFB 4ECVA 2YNHB 3GIKA 3EPGA 3NKYA 1R0AB 1S6QA 4NLXA 3TQ1A 1TVRB 1UWBB 3OLBA 5KFLA 4K4VA 4K4WA 2IJFA 1JLGB 1TL1B 3H98A 2QV6A 2JC0A 4RW6B 5FDLB 5DQIA 1QE1A 4ECWA 2J6SA 3DRPB 4NLQA 4K4XA 1ZTTA 4OL8A 3FRZA 3T5LA 1OS5A 5KFXA 3LAMA 1C1BB 3QIPA 4NLPA 3GIJA 3NMAA 1EP4B 1YVFA 3CO9A 2R2UA 3FQLA 1JIHA 2BANA 3G6YA 1RTDA 2IC3A 2ZD1B 5C25A 3NL0A 1DLOB 3OL6A 2HNYB 1HPZA 3H5SA 4MK8A 3H40A 1QAIA 1SH3A 1LWEB 2IA6A 4MK9A 1SH2A 1S1WA 4HKQA 1N56A 3DMJB 2JEFA 4EYIB 4RNMA 2OPPB 4RZRA 2D41A 4KV8B 5F8LA 3DYAB 1VRUB 3JSMB 1S0OA 4ZPAA 2YNHA 2W7OA 2BQ3A 4NLDA 1N4LA 3DOLA 1TKZB 1MU2B 3I5BA 1R0AA 3JYTB 1RYRA 3CJ5A 3C6TA 1UWBA 3QGGA 4TYBA 2WK4A 4MH8A 1TL1A 4RW6A 3I5CA 1VRTA 4ICLA 4XPEA 4ECZA 5KFCA 4M94A 4G3IA 1ZTWA 3PW7A 3KHLA 3IS9B 5KFZA 3Q8RB 4I2QA 3NGDA 3IG1A 3ITHA 2BRKA 1JLEB 3HKWA 2RF2A 4MIAA 5KFBA 4FS1A 3V6JA 4RUCA 1LWCA 3NBPB 3DDKA 4ECXA 3D28A 5KFKA 3QO9A 4ED3A 1S6PB 3BSAA 2XI2A 2ZD1A 3CJ4A 5KFHA 2JEGA 4KBIA 4EBCA 3HVTB 2V0NA 5KFMA 3BSNA 1S10A 3NAIA 5L1KA 2R2SA 3DLEB 4RW9B 1JLAA 1FKOB 2JC1A 3UDLA 3G6VA 4WXWA 1C0UB 3G6XA 2FVSA 1REVB 2RDIA 3BJYA 4NRUA 4J9SA 1C2PA 2OPPA 4H54A 1IKYB 1HNVB 2AX1A 4H4OA 1JLCA 1DTTA 3DYAA 1VRUA 3LP2A 4G1QB 3KLHA 2HMIB 1HYSB 4K4YA 1TKZA 3M9MB 5DQHA 3IRXB 3MFIA 4Q0BB 1RT1B 5F8JA 3H59A 3TAMA 5F8NA 5J2NA 4R0EA 1LW0B 5KG5A 3G86A 5KG6A 2EC0A 4J9LA 4EBEA 2VG6B 1I6JA 4JV2A 3LP0B 4O44B 1S1TA 4EBDA 3MEEB 3GIMA 2AGQA 1N48A 2J6UA 3MEDB 5CYQA 4JV1A 1RT6B 1RDRA 3NBPA 5D3GB 3H4DA 4LSNA 3BGRB 2WONB 4H4MB 4PWDB 4DL4A 2ZE2B 3HVTA 2C2RA 4Y2CA 3OSNA 2HNZB 3MR2A 4RW9A 3H5UA 1C0UA 1MMLA 1N6QB 1REVA 4LQ3A 3ISNC 4J9RA 1IM4A 4RW4B 1HNVA 2UVUA 4FBTA 5JUMA 1HQUB 5J2PA 4G1QA 3MEGA 3H5XA 5T14A 1LW2B 2IJNA 4KHMA 4KSEB 4ED6A 4WZQA 1RTJA 1S9EA 2D3ZA 1JXLA 2XCPA 3KNAA 4XPCA 4I7FA 2FJVA 3I0SB 4LSLA 4IG0B 3V6DB 1LW0A 1TP7A 3DLGB 4QW9A 5DGAA 5EUHA 2VG6A 3LP0A 3QGIA 4O44A 1S1UB 4Q45A 5I42A 2ILZA 1JLFB 1RA6A 1TL3A 4ZHRB 4IFYB 3CDEA 3PR4A 1RT4A 2I1RA 3FDSA 4ID5B 3EPIA 3M9NB 3HVWA 4PQUB 3SFGA 4ZPCA 2UUWA 4Q43A 4O3SA 3M9OB 1JLBB 5L9XA 5J2MB 3KLEB 3RBEA 5KFTA 3MFHA 2C22A 2R2TA 3V4IA 1S4FA 2AX0A 2W7PA 1T05B 4DL7A 4F4YA 1RTHB 1HMVB 1SV5A 4EEYA 3M8QB 4B3OB 4ECQA 5KFSA 2IM2A 4KE5A 2W8KA 3KOAA 2HNDB 3DM2A 3DOKB 4JUZA 2E9ZA 2FLPA 2VG5B 1FK9A 1BQMB 3I0SA 4TY8A 2IAJA 4DL6A 4K4SA 4ZMMA 5KT3A 4NLRA 3QZ8A 3KHRA 1S1UA 3BSOA 2JEIA 3KLFB 5DG8A 3DOKA 2HWHA 4ZVHA 4Y34A 1RT2B 3HHKA 5C42A 5C5JA 3GV8B 2YNGA 1S48A 4ID5A 4K4TA 4J9KA 1RAJA 3CVKA 4R8UB 4WFXA 1IKXB 2B43A 3C6UB 5EWGA 1JLBA 3RBDA 2AGPA 2XGPA 2ASDA 2AGOA 2XWYA 3N6MA 3OSPA 3DLKB 3KHGA 4NLOA 2WB4A 1D0EA 2WHOA 5DLGA 3PVXA 4PUOB 4MKAA 4O4GA 5KG0A 4QWDA 1NHUA 1EETB 4KO0A 4K4ZA 1RTHA 4WZMA 1HMVA 3V6KA 4RW7B 3M8QA 5HLFA 4B3OA 5EDWA 2FLLA 5JXSA 4RNFA 3KJVB 2FJWA 1TVRA 2VG5A 1BQMA 3KK2B 1JLGA 5FDLA 3EZUA 1S49A 2W9CB 1NHVA 3Q8SB 3DRPA 4KKOB 1CSJA 4HYKA 2B6AB 3GILA 1NNDA 1S0NA 5K14B 1C0TB 1RT2A 1KHWA 3SFUA 2I5JB 1C1BA 3H5YA 1EP4A 3KK1B 2W9AA 2RDJA 1IKVB 4IRKA 4NLWA 2GIRA 5F9NA 4R8UA 3ISND 1IKXA 3BSCA 3C6UA 3E01B 5DG9A 4GC7A 1DLOA 3PZPA 4Q8FA 2R8HA 2HNYA 3DLKA 5KFVA 1LWEA 3KMQA 4FS2A 1TKXB 1U09A 4PUOA 5KFPA 3DMJA 5F8MA 1EETA 4FBUA 2UUTA 4KV8A 3JSMA 5L1IA 3QLHB 3KJVA 4IR9A 1K1SA 1MU2A 2WCXA 3LANA 4TLRA 3JYTA 1D1UA 4R5PB 3IGVA 1S97A 1S1XB 3UPFA 4RNOA 3IS9A 4IDKB 3LALA 4MIBA 4ZP8A 1JLEA 1TV6B 4KB7A 1DTQB 2GC8A 2B5JB 3KK1A 3RB3A 4ZP6A 1IKWB 4YR3A 4O4RA 1IKVA 4TQSA 4ED2A 3FQKA 5F8HA 4EO8A 3PW4A 5C24B 1S6PA 3I5AA 5J1EB 2XGQA 4RW8B 4XO0A 2DPIA 3KLGB 2V4QA 3SI8A 3OL7A 3T19A 3DLEA 5KT4A 1FKOA 2HWIA 5KFFA 2XCAA 1KHVA 2YKMB 2OH2A 4LQ9A 2R8JA 2F8EX 1W25A 4QWBA 2WRMA 1IKYA 4KFBB 1XR5A 4NCGB 4YR0A 3LAKA 1HYSA 2HMIA 3QLHA 3QIDA 3OLAA 5HBMB 5KT7A 4DG1B 2FJXA 1JX4A 2BE2B 2WOMB 3IRXA 4U6PA 2ALZA 2VA2A 1RT1A 4Q0BA 4TYAA 4NLTA 2OPQB 3QYYA 1BQNB 3OHBA 4TY9A 3GV7B 3RAQA 1XR6A 4ZPBA 3LP1B 3MR6A 4QPXA 4X2BA 5KT2A 4M95A 3MEEA 4WE1B 4DL5A 4WXOA 3MEDA 1RTIB 1DTQA 1JLQB 3OHAA 4ZPDA 2B5JA 1IKWA 3QZ7A 1T03B 1RT6A 1J5OB 5D3GA 3OL8A 4URGA 2YKNB 2OPRB 3BGRA 5J1EA 5DGBA 2W9BB 2WONA 1T3NA 4H4MA 5KFGA 5KFAA 4PWDA 2ZE2A 1RT3B 3M8PB 2HNZA 3MF5A 3KLGA 3T5JA 2ILYA 2IM3A 2IM0A 1S6QB 3MTKA 5L1LA 1N6QA 4NZ0A 4O3RA 4RW4A 5EWEA 3RB4A 4NCGA 5KFIA 4ED7A 4IFVB 1HQUA 2BQUA 1QE1B 4ED8A 5KFQA 4J9NA 3PW0A 4MK7A 2CJQA 2VG7B 2FVRA 3UR0A 1JKHB 1HQEB 1LW2A 2WOMA 2DPJA 4NLVA 1FKPB 4GC6A 3PJXA 2R2RA 2OPQA 3PW5A 1RYSA 4NLGA 1RA7A 3QIPB 3PW2A 3ICLA 4IG0A 3V6DA 1TKTB 3DLGA 1QAJA 2D7SA 2BRLA 4MKBA 2JEJA 2VA3A 1GX6A 1RTDB 4IQXA 2RKIB 2CKWA 4URQU 5CYMB 1JLFA 5KFWA 1RT5B 1HPZB 1JLQA 4IFYA 4ZHRA 3NAHA 5F8IA 3Q8QB 2OPRA 2YNFB 4TN2A 2W9BA 3RB0A 2C28A 1RT7B 1S0MA 4PQUA 3CDWA 1RT3A 1T94A 5F9LA 4F50A 2FVCA 4Q44A 3KLEA 5J2MA 3DOLB 2UVVA 4U7CA 4ED0A 3C6TB 3KHHA 5HROB 2FVQA 3D5MA 4IFVA 4IH5A 1T05A 4O3OA 1VRTB 4ICLB 4O3QA 2D3UA 2VG7A 3CDUA 1JKHA 1HQEA 2UVRA 3BREA 4KHRA 4I2QB 1FKPA 2HNDA 3IG1B 3ITHB 3FSIA 3T5HA 1C1CB 2RF2B 2ASJA 4IOBA 1LWCB 1GX5A 1TKTA 3CJ0A 4TXSA 4WYWA 3PR5B 3GQCA 3QO9B 4J9MA 2AQ4A 2FVPA 2RKIA 4MFBB 1SH0A 3CJ2A 5CYMA 3VQSA 3DRSB 3KLFA 4NLYA 4WFZA 1RT5A 3HVAA 3KLIB 2W8LA 1JLAB 3T1AA 4RNHA 3MECB 5KFRA 1Z4UA 4TQRA 4QWEA 2YNFA 5KFDA 1SUQB 3IGNA 1RT7A 2HAIA 4H4OB 1JLCB 4YP3A 1DTTB 4YR2A 3KLHB 4K50A 3LP2B 4ZVFA 4NRTA 2O5DA 4Y3CA 2ATLA 1S1VB 3DI6B 3BQ0A 3CJ3A 4WFYA 5L1JA 2UVWA 3OL9A 4KAIA 5HROA 4RUAA 3TAMB 5J2NB 4ZP7A 5DQGA 3BR9A 4RW7A 5KT5A 4ECYA 1S1TB 3KK3B 4Y2AA 2E9RX 4ZVGA 4ZVEA 1C1CA 5DLFA 3KK2A 3DRRB 5CYQB 2E9TA 2V9WA 3I0RB 3H2LA 5KG3A 4LSNB 2W9CA 3RB6A 2IMWP 4NLUA 4KKOA 4I2PB 2B6AA 4MFBA 2XC9A 2JLEA 3DRSA 5HP1A 5K14A 1C0TA 3KLIA 3TVKA 4QWCA 5KFJA 1ZETA 4IKAA 2BR0A 2I5JA 3MECA 4ECRA 3E51A 1SUQA 3V6HA 2FLNA 3KMSA 3GV5B 4URSA 5J2PB 3E01A 3BQ1A 1QUVA 4ECTA 3MEGB 5KFYA 3Q8PB 5KG2A 1S1VA 3DI6A 3IN5A 3GIIA 5KG1A 1RTJB 1S9EB 1TKXA 4I7FB 4Q8EA 5KT6A 4LSLB 2J6TA 2R8IA 3V81B 3CIZA 5KG7A 4F4ZA 5KG4A 2C2EA 1S9FA 4IG3B 5KFOA 5I42B 4O3NA 3KK3A 4J9PA 3PJWA 5DG7A 1TL3B 5J2QB 5HP1B 1N5YB 3CWJA 2IBKA 3DRRA 4R5PA 3BQ2A 1RT4B 3I0RA 3MR5A 5KFUA 2QE5A 1S1XA 2V4RA 4I2PA 1K1QA 3KLVA 4IDKA 1HNIB 4DL3A 1S9GB 4F4XA 1TV6A 2OPSB 2ASLA 3QGHA 3FFIB 4IRDA 4DL2A 4J9QA 3V4IB 2YNIB 5C24A 3N6NA 1KLMB 4JV0A 5I3UB 3T5KA 4RW8A 1SV5B 2R8GA 4ED1A 1WNEA 1LWFB 4ECUA 4EO6A 2IM1A 3PHEA 2AWZA 2YKMA 2WTFA 3N6LA 5EWFA 3DM2B 1FK9B 4NLSA 5F8GA 2GIQA 4DEZA 4TY8B 4WYLA 2IAJB 4KFBA 4YQWA 4QWAA 4IR1A 5KFNA 3V81A 4IH6A 3H4BA 4IG3A 4QW8A 5HBMA 4IRCA 4DG1A 2BE2A 5J2QA 4RU9A 1HARA
chains in the Genus database with same CATH superfamily
5AXNA 5ADZA 3BPDA 3CPWR 2CPIA 3VAMA 4M5NA 2HRYA 1M5OC 1RAGB 1HNXF 3ZZYA 1KVKA 3OUYB 3OLBA 4K4VA 3H98A 3DDNA 5H9FJ 4MKVA 4FN5A 1PAEX 1GTEA 4L3NA 4OMFG 4JV5J 1EP4B 1YVFA 3CO9A 1TKDA 3G6YA 5GAHI 2MY7A 2EFGA 2EVZA 3QBCA 4OI4A 3KG1A 4DV7F 2UV8A 1NCLA 4HKQA 3JQJA 2OPPB 3W65A 3T6JA 2F3JA 2YNHA 1A6LA 3M2VB 1TL7A 2HIYA 3I82A 2HHPA 3CW2C 1A0OB 4ZOSA 5D4OA 3MOZA 2HHWA 3EGVA 1S6PB 3BSAA 2XI2A 5L1KA 5KTQA 2RDIA 1SQFA 4WPAA 2SXLA 1W26A 4WFNQ 2J0XA 2RE1A 4NA1A 5J2NA 3JTOA 2KYZA 2EC0A 2B8PA 1RAIB 2KL8A 2W2OP 1B64A 2YWFA 2EWHA 2WONB 4H4MB 4PWDB 1VQMS 2OELA 2NZCA 3FBEA 3R5DA 5JUMA 1VOMA 2QN6B 1LW0A 3DXBA 1Y9OA 2UUBF 2JLFA 3PYDA 2CVIA 1NO8A 2A0FB 2AMCB 3Q8UA 1OY8A 1Z1ZA 2EXUA 3SFGA 4F36A 4Q43A 2CPZA 3NNAA 3CXCR 3CD7A 4UUXA 3UVJB 2R2TA 2AJ2A 3PX6A 1RTHB 2BA3A 4KE5A 4TY8A 4R0JA 4DL6A 3GFHA 1OSDA 2PSZA 2X3DA 1YK9A 1KEKA 1CULB 3BF4A 5C42A 1VBXA 2ZKTA 2NS1B 2QEXS 3S7RA 4NLOA 2WB4A 3VAFA 3PFEA 3UD5A 4O4GA 3P3DA 4YS2A 4WCEQ 4KO0A 4K4ZA 5F3ZA 4FXWA 3LWLA 2FJWA 3NGTA 1JLGA 5T7LA 1UP1A 4ETXA 3MM7A 4NMLA 3H5YA 2ZITA 2W4PA 4Q8FA 4PEOA 2R8HA 1VDHA 4KGVB 1LWEA 3UR3C 3JSMA 3I9ZA 4J9UE 4KHPF 2V8VA 3G8QA 4I68A 1FNXH 2Z2LA 4NCBA 2DK2A 3D7SB 4P75A 1VLYA 3KK1A 4ZP6A 4X65F 3FQKA 4EO8A 2G2ZA 2E1PA 1BGXT 2QIFA 1B0PA 1OYDA 1RAFB 2AZ3A 3MMBA 3HLUA 3GCWP 3MR7A 2M2BA 3M6UA 2EG2A 4CYUA 2QLJB 5AT1B 4ZPBA 3K0JA 1EX8A 2PI5A 2E5LJ 3OHAA 5A2QU 1JNRB 5E3AA 1RT3B 2HNZA 3T5JA 1XQIA 1VCTA 4NCGA 1RHJB 4DX8H 2BQUA 4NLGA 2D3OR 2LKZA 4QYZK 1VQNS 4MKBA 5KFWA 3NCRA 1HL6A 2KI2A 2V8HA 2VICA 2GGPA 1FWKA 2J9CA 1X5OA 1NM2A 4Y2KA 3OR1A 2GMJA 4EU0A 4XK8C 1X0FA 4CLWA 3CUNA 3J7YU 1CVJA 4X4RA 4USHA 3I31A 1TKTA 2YQ0A 4NLYA 5IT0A 3BGFA 2Y1IA 1F9FA 3LOUA 3RBZA 4B9SA 1YJNS 3B82A 1Y4ZB 1S0VA 5HROA 5J2NB 2RB7A 2F8MA 3D6FB 3KK3B 3BO2A 1T95A 5KG3A 1JQGA 4O23A 3L4BC 4DR5J 2XC9A 1FDBA 2CJXB 3HX9A 3M8ZA 1MYKA 4ECRA 4WFAQ 5EGYA 1T0TV 5D4LA 2JSXA 1HNWF 5A8RB 4X64F 1Q7LB 4CQ1A 2DHGA 2W01A 3AJDA 4DPYA 2BEFA 2EFOA 2W2NP 4J9PA 5J2QB 3CWJA 2CQDA 2G0CA 1K1QA 4DL3A 4C4WA 1L3UA 4DPXA 5M2RA 5I3UB 1UPMB 2YKMA 4TY8B 4IR1A 4AL6A 4C0BA 4DG1A 1N5YA 3CCSS 5C42B 1WELA 4L74A 3L7OA 3GYNA 3N5BA 4W90B 1B01A 4WE1A 1N0UA 4O4GB 4J9OA 4KO0B 4ZP9A 2QMWA 2GX8A 4CIOA 2CNOB 4DN0A 2MQLA 3FRYA 1JLGB 5DQIA 1BQXA 3L3CA 2J6SA 1ZTTA 2KT2A 3EX7B 3UE2A 2ZVSA 3A8IA 3HJFA 1WC3A 3H40A 1LWEB 1SI9A 4U8VA 2ZJRQ 4RNMA 2K06A 3JS9A 3JSMB 1RYRA 1VBZA 4D3GA 4R25A 2ZOGA 2RQMA 3PW7A 1F0XA 2LA4A 4P2SA 1IJEB 4I2QA 4GKKJ 3ITHA 5KFBA 2Q1LA 2HLUA 2QA1A 3D28A 2F4FA 5AJ3J 2ZWPA 4TU8A 5E0OA 3MMBB 1REVB 1C2PA 4NXNJ 4C8KA 4H54A 3DYAA 1KBRA 3RRGA 2GHPA 3D6HB 4QZVB 4CYUB 4U8YA 2NXEA 5HVHA 1LKZA 3GJRB 2VC0A 1KN6A 2HNZB 1NH7A 1IM4A 1GK8A 4G1QA 4JYAF 5T14A 3VCDA 4PYAA 3VVTA 1YKWA 5DGAA 3VZHA 2RBFA 3FDSA 1UA1A 1RHMB 2GGPB 4OIXA 3CCLS 2VDHA 5L8RC 1IR2A 4OZ5A 3OR1B 3V4IA 1FEHA 1R3NA 4X4UA 2IYGA 5F0UA 2FYXA 2IM2A 4OX9J 5GADU 1FK9A 2HBRB 2GVZB 4K4SA 3BSOA 2ZOMA 1S12A 3UN2A 5GMEA 1RGVA 3R5AA 5EWGA 2POKA 2ASDA 1VIOA 3HULA 1LQ9A 3KTQA 1G4CA 4QWDA 4OHYA 5LM7E 3IM8A 4KGKA 2QA2A 2VG5A 1EKSA 2UU9F 2XNRA 3I4PA 2LXUA 1DY3A 2MKHA 2JXGA 5AXMA 2DGVA 1HBOA 4FBUA 2I8EA 4HEA9 2FUG9 3DC2A 1PAUB 4JI5J 5DZ6A 2H5JB 4F04B 1U02A 1N0VC 2MGZA 1F2HA 4YY3F 2GO9A 1X9WA 4DX7A 4KR0B 3OW2R 3OR2B 2DXEA 1FKOA 2YKMB 3TW0A 2FJXA 4DG1B 1CBKA 2VPYB 2BM1A 3ZZOA 4FF2A 3OHBA 3JTPA 4M95A 4WE1B 1IKWA 2MEWA 2OPRB 1OSCA 5KFGA 4DFPA 2BJ7A 2ZNZA 5BJRA 2MLXA 2H4YB 4LF8J 4DFMA 2KKHA 4WIIA 4ZDNA 4A8YA 2NZ4A 1HNZJ 3PJXA 5I4MA 2LVWA 4A47A 4LF6J 2ADLA 3MXHP 2PIIA 2EKNA 2KHCA 1VQSA 1FRIA 5LMNF 4PABA 3I56S 3HD1A 1XNRJ 1S0MA 3DXSX 1O5JA 5F9LA 4USIA 1UUJA 1WEZA 5HQ8A 4IFVA 1T05A 1QLNA 2HPUA 3RGIA 3W7BA 4I2QB 2ZH6A 3ITHB 4IOBA 2M3DA 4Q2MA 2D9PA 4JI0F 3HSDA 4WP8A 2UP1A 4K50A 4DCPB 3GU0A 4KAIA 3OTBA 4ZP7A 2HFSA 5KT5A 1UL3A 4ECYA 3G4SS 4NEZA 4MIWA 3FZBA 3B54A 1WKKA 1NK7A 2VKZG 4I2PB 4MFBA 1EJ7L 2X1BA 3SSRA 4DFJA 5H1SV 3PFOA 5K14A 4QWCA 1HHTP 4FDFA 1WC0A 3RW6A 4WKYA 2HHTA 4M5KA 2G0IA 1WHXA 1MYLA 3OVSA 3VGTA 3OVBA 3THTA 4X4TA 3VZIA 6FDRA 1HNIB 1BHNA 3D67A 3V4IB 2YNIB 3LQVA 4FKXA 2RU3A 1YDLA 3MHYA 2K7JA 1CLFA 1FK9B 2OI2A 1NU4A 2BXJA 4DSIA 4RU9A 1HA1A 5B7WA 4J7CA 1MROA 1V5IB 2LEAA 3BBFA 4P72A 2KZZA 2QRRA 5C25B 5AE3A 3QGPA 3MMCA 2R8KA 1RTIA 2XYGB 3UN5A 1U1KA 4K59A 1UJ4A 2ERRA 1KQGB 3SYZA 2JC0A 3AH6A 4C11A 2VKRA 1QSSA 2ZD1B 1FXDA 1HPZA 2XZTB 2XSJA 1HBOB 5F8LA 1IWGA 2CQBA 2J7UA 2Z30B 4XPEA 4M94A 1RB0A 2MGZB 2H51B 2O67A 4ES1A 4DUYF 2FDNA 3P4UB 2DKOB 2ZBPA 3HVTB 1VQ7S 4DS4A 1FKOB 2AEFA 4K2XA 2DT9A 4UT4A 1NZ8A 2X7IA 1YJVA 1FNOA 2OSRA 5KG5A 2B9EA 4J9LA 1J5EF 2AP6A 4EBEA 1B7FA 1Y5LB 1IR1A 5CYQA 1F60B 4NEYA 3Q8YA 3TEGA 4A8FA 3RU0A 3QMQA 4HTIA 2XYPB 1U2CA 1HNVA 4FBTA 3DFEA 1HW9A 2UXCJ 4L76A 4IOAQ 4XPCA 4IQMA 2BW2A 4B3MJ 4CLFA 2V34A 2CPEA 3TRGA 1S1UB 2NCKL 3X1LB 1AXQA 2IPOB 3PR4A 1Y3JA 1IBKJ 1SIWA 3R7NB 2HBQB 4O3SA 3FSXA 2R42A 5EX0A 2C22A 3FKBA 4ZPWR 1T05B 2YX4A 1HMVB 3M8QB 2P8IA 4B3OB 4OZLA 3DM2A 2UZAA 1BQMB 3W2VA 4HI1A 1WF2A 3GB0A 2JEIA 4XDCA 1K0VA 3SQGA 4QIEA 3HSZA 2DNRA 4LRVA 4NYPA 1WWHA 2LA6A 2XWYA 3OSPA 1CPZA 2AY0A 1EETB 5DJBA 1HI0P 1KR4A 4JI8J 2DO4A 4I4BA 5K14B 3SFUA 2VPXB 1IBMJ 1R0BG 3UD3P 6FD1A 3C6UA 2HNYA 4LFAF 1HHSA 1XWLA 1K1SA 3JYTA 2YWWA 1VYAA 2XO6A 5D0HA 1K0TA 2HURA 2M7SA 4AL5A 1KC8T 4O4RA 4TQSA 1AW0A 5F8HA 2HQ3A 2XGQA 4DBQA 1FO1A 5D0EA 4TKTA 1OO0B 4LRAA 3DLEA 4C8ZA 1N33F 4QWBA 5GAEI 2HHUA 2MXYA 2J0QD 5ETVA 2WVBA 1RT1A 1I5OB 1T8EA 1MROB 4Z7YA 4TY9A 4LRBA 3SEOA 3M6VA 1RTIB 1NDPA 5CCMA 4DV6F 1RT6A 4P10A 1URNA 2W9BB 3C16A 2O3DA 1DBDA 2FGCA 2IM3A 4NZ0A 1KOOA 1GXTA 5K8MA 2I6WA 2CVEA 1HD0A 3B4DA 5A0YA 4C11B 4YB6A 4FVMA 4DV4J 2CKWA 4HLBA 1JJCB 3W66A 1HPZB 3NAHA 4DPWA 2XSJB 3ET6A 3ISZA 3R9LA 3CDWA 4RUBA 2CNLB 2DXDA 3HPOA 3OFGA 2MQOA 3A3NB 3KHHA 1OPZA 2H5EA 4OHXA 1RCOB 2VG7A 2UVRA 4ZN1A 3I32A 1C1CB 4BLGA 4J9MA 3CMQA 2BJ8A 1QM9A 1SH0A 4OZ0A 1VGYA 4IOCQ 2YPYA 1U1OA 2G9OA 2IDEA 2YNFA 3IGNA 2XY5A 3TZXA 3ZNUA 1PC5A 4NRTA 2KOEA 4U67Q 2WVDA 2PMWA 2YWHA 1ZA1B 4J5OA 5DLFA 5CYQB 3NP5A 2NXUA 4C8MA 3EWGA 1GAOA 3OJSA 2B7CB 1U6BA 3V6HA 3N5FA 2GW8A 3O5TB 1N5VA 3Q22A 4CO2A 3AA8A 4ER8A 1XMQF 4K2JA 5M2PA 3U02A 1N32F 3PKMA 4OZNA 3I0RA 1UZDA 3J80Y 1SIWB 1S1XA 2V4RA 3ILLA 2CQPA 1V3SA 3IWLA 4FVCA 4PZVA 3DM2B 3DHWC 3W2VB 2KG1A 1G7CB 2VH7A 4QYZJ 2BE2A 2IJRA 3SQGB 1UVIA 3AD7C 2CDQA 3U1MA 3MWBA 1U1QA 1HBNA 5DRKA 1NLKL 1S1WB 2C2DA 2ZKUA 2LQBA 2BQRA 4QPTA 3C14A 4HL9A 1YGYA 5KAKA 1U9PA 2Z2MA 4HV0A 5KFXA 1FE4A 3ZNJ1 4FPRA 2FHJA 2QMUB 2WZ1A 3R5CA 1RHKB 2VFTA 2HNYB 2KT3A 3H5SA 4LBPA 2LU2A 4A8KA 1UVLA 3K8VA 1S0OA 4LF9F 3ENQA 2IRXA 3JYTB 1AZSB 5HATA 1WOSA 4LRFA 2V4JB 5SUHA 2ZBCA 4YFUA 3HKWA 4LFCJ 3V6JA 3BO4A 3NBPB 4GO5X 3I4HX 4WU3A 3B8HA 3AXMA 3DLEB 3G6XA 4ZS6A 4RU2A 3UNYA 4H4OA 4PG6A 2MKYA 3AY0A 4DV1F 4GKJJ 1WD6A 2MSTA 2Z57B 1RT1B 4F4KA 4RPFA 2VG6B 4CT8A 5RUBA 1SL2A 4I69A 1RT6B 3PKYA 1ZM4A 3MR2A 2E7XA 4RW9A 1OYEA 3R7SB 3MPVA 1Q5VA 2RJZA 2E66A 2FJVA 4P2FA 2APOA 3KUGA 1IN0A 4MJKA 3L7UA 1V6HA 2K1RA 2F8HA 4ED4A 1WDTA 2ROEA 2OSQA 3M8RA 3ET6B 3EPIA 4ZPVR 3MCNA 2C3OA 1F9EB 2DR6A 3SIPB 3D6TB 3I0SA 4ZMMA 2RU9A 2V67A 3VW4A 4NLRA 1UEUA 3A13A 5KT3A 4QR1A 3KHRA 1VRQC 1V9OA 4Y34A 4GO7X 1KFDA 4AT1B 1WKJA 4KH1B 4FYDA 8RUCA 2FC8A 3N6MA 3T1HJ 3JSBA 4CLUA 2O1PA 2M88A 2XMMA 2DTJA 2W4DA 3J7Z5 2RQCA 1WOPA 2W2PP 3W9JA 1U1RA 2GFFA 1FTCA 2LYVA 3BGLA 2YH1A 2U1AA 1TL4A 4F3MA 3GP9A 4XTTA 2DNKA 2P9CA 3IWNC 2HFOA 2LQ5A 3AWRA 3LANA 3VVUA 4PRFA 4DN9A 5HANA 5IQ6A 2BKOA 1S1XB 3H0PA 3SCIE 5ITHA 4HTJA 3HXMA 3GFYA 3A3PB 2XTEA 2MQ8A 1RABB 4DV0J 2MHEA 2OAUA 4PG4A 2VHGA 2F8EX 1W25A 4YB5A 2WRMA 2DCLA 1QAYA 3OLAA 4D8JA 4M5GA 2BE2B 4CWBA 1CQMA 2B51A 2AEMA 4CDIA 3CT9A 1H7WA 5KT2A 1HBNB 1JK9B 4C8YA 1W2IA 5B0EA 2WBRA 4OI3A 4RL1A 1U26A 4NMXA 1CQNA 2DJWA 3HHNB 3RB4A 1KP6A 2DPJA 2VF3A 2XO7A 5LOQA 4HH1A 2D7SA 4IQXA 2CYYA 1HI1A 4CT9A 1XMOF 1MNEA 2C28A 3RB0A 1RT7B 4AAIA 2AHOB 2P6TA 3EXYA 2AJ1A 4EZ6A 2N4DA 2UUCJ 1U0HB 2OTLS 2VIHA 3P49B 1DFDA 1BWVA 3FEZA 3CJ0A 1Y00A 1U24A 3KLFA 4LREA 3HK2A 1PIEA 1MN7A 3T1AA 3M30A 3MECB 1YJUA 4RNHA 3SSSA 1Z4UA 3IXQA 4H4OB 3ULHA 2R7OA 4ZVFA 1RAHB 1YJWS 1SQEA 1RHRB 1FTRA 4DSKA 5LMUJ 2RMLA 3WC2A 5IQQA 3CCJS 4QOTA 1HI8A 2ZH4A 4X4VA 3BEGB 1YX2A 2VQFJ 2D3O1 2VONA 3Q8VA 2IMWP 1IR0A 4KJIA 3DRSA 3CDAA 3KLIA 5D4PA 4DUZJ 2LMIA 5B08A 3E51A 3ENVA 3POTA 4WU2A 3WIVA 2VASA 2WW4A 2A18A 3LH2S 4C8NA 1R8BA 2LCWA 1NK8A 1RZMA 3RG6A 3PXGa 1P27B 1KLMB 4CM0A 4LFBF 3DLJA 4EO6A 3D68A 5C2GA 4YQWA 4A46A 4F3OA 3RAMA 2PT0A 5DZ7A 2YY3A 4AUKA 2ASYA 2KRBA 3GG0A 3TA1A 2OPSA 3MR3A 4U96A 3T1YJ 2ZDPA 2MJNA 4P71A 4F8RA 2VU5A 1TL1B 2GNKA 5C2CA 2PA3A 3BYRA 2HYIB 2MZQA 1U47A 2NR0A 2IA6A 5CHCB 4JV5F 1U2RA 4FF3A 2ACYA 1OM2A 5J1PA 1VRUB 3SCLE 5CZVA 4K5SA 3I5CA 2QL5B 3NEKA 2G1DA 3EZOA 1PO6A 2XB2D 1HWJA 1WHWA 4BWJA 1GNKA 1RK8A 2FVSA 1WI6A 2AJ0A 1WSVA 1WOOA 1DTTA 4NOHA 3W5ZA 3MFIA 2YKPA 4C6AA 3BO3A 5F8NA 4UY85 3G86A 2XMAA 3LP0B 3GIMA 1ZPVA 2HKEA 4WWSA 2GAHC 4ENOA 3PEJA 3H4DA 3T9ZA 4UZBA 5LJ3Y 4X62J 2XTDA 3ZZRA 2KJWA 1C0UA 3GCXP 3CC2S 3ISNC 4JBCA 3P6YC 5J2PA 3GXQA 1B7YB 3D9BA 4UOGA 1E6VA 3KNAA 4HHHA 2RS8A 1LK7A 3CCMS 1D9AA 1RA6A 2W24A 3OTDA 4LF7J 2X1AA 1GMWD 1F9HA 3JTNA 2ZZNA 1JLBB 3TX8A 1KFSA 4FYVB 2L9NA 4DL7A 8ATCB 3FEXB 1MWZA 1KNZA 3QFWA 4L72B 1MN9A 3FSYA 3KLFB 4DR6J 5DG8A 4UQGA 4PPDA 4CLPA 1RAJA 3CCRS 1IKXB 5A6PA 3TARA 2ADCA 4FZVA 3H7HB 1CJUA 2ZJQQ 1NJXA 2FTRA 3M32B 1CJVA 3AD8C 3ONQA 3DOMB 1AUSL 2BOPA 4NLWA 3POTB 3U7JA 4B9NA 1HBUB 1A7GE 3D6MB 1TFWA 3T9NA 4A8QA 1NRKA 4TLRA 1GEHA 4Q2LA 2OO4A 2YX7A 1OHNA 2HVDA 4D3HA 5J1EB 2CADA 3KLGB 3I87A 4M63A 2P9GA 3Q2TC 1LK5A 1ZA2B 4UZCA 2BJ3A 4JI4J 2B4PA 2B56A 2DH8A 2QFIA 2B5JA 4KGZB 4RBUA 4UUWA 5DGBA 1HLWA 1ZS6A 3ILIA 2C1EB 2E5LF 1REGX 4AD6A 3LF0A 1KONA 1JKHB 2HVHA 1FKPB 3N0VA 1M5KC 1T11A 4NZ6A 4PQAA 4LBIA 1JLFA 3J7YI 4ZHRA 2CPDA 1MMNA 2MQNA 4BDPA 4WK3A 4M5JA 2GHVC 4DR7J 3L9ZA 4NE9C 2CQ2A 3C15A 1QY7A 5JVHQ 2KKEA 2KXFA 4NASA 4WKRA 2NUHA 2EC2A 4X4NA 5KOXA 2J0WA 2VFSA 4YP3A 1DTTB 3MAAA 4EWTA 3CJ3A 3R5BA 1R0CB 4Z2XA 2VB6A 3UW1A 4KH0B 3BBCA 2RRNA 4NLUA 2M5YA 5E3PA 2B4OA 2NPIA 4DV3J 2KFNA 3GV5B 3ELHA 1LFPA 5J2PB 4DR5F 3D3BJ 3MMJA 3DI6A 3IN5A 2CQ0A 2J6TA 2R8IA 1S76D 3MCSA 2NYHA 5K8OA 4OZJA 1RSCA 3BQ2A 3P45B 2HFNA 1RTZA 2ASLA 3CC4S 1HHQA 3P5TL 2FJBB 3HD2A 1C4CA 4CO5A 3HZEA 4ED1A 1UVNA 2V63A 1OPIA 2HRUA 5KFNA 1M5SA 3NCQA 2ZNYA 2K1OA 4EYHB 4X4PA 3A4TA 1B99A 1IBLJ 2GCFA 4ECSA 1CJUB 4DV2J 1VI7A 3QT5A 2L08A 4OI2A 3GFXA 3W3SA 4QYRA 2XWXA 1FKAF 1CJVB 3M7VA 3W64A 4OHVA 1RUSA 4ES3A 4ZK7M 1RKJA 4OL8A 2IVFB 2EW9A 3GIJA 4JI3J 1YRTA 4JI1J 4OYZA 2Z58B 1BD6A 1CJTB 1F6TA 1E6YA 2JEFA 3DU5A 4BC7A 3IR5B 3DOLA 4QIVA 1NPPA 1KQSR 1QTMA 2BE7D 3QGGA 1GMVA 2Z56B 1GT8A 4G3IA 1ZTWA 2XMWA 1RWWB 2R3VA 4UTGA 2CPHA 1H2UX 3TI0A 1O51A 4EBCA 3CNQP 2R2SA 3UDLA 4GKKF 5AXKA 2BMBA 4K4YA 1TKZA 5I3QA 2RRBA 1Q79A 3SMZA 3FMBA 1M5HA 1TK8A 4NXNF 4JV2A 4EBDA 2VOPA 4P9SA 3M1VB 5A6WA 5BYQA 1RWKB 4Y2CA 1IBCB 1FDDA 2VQEJ 5D8HB 4Y2IA 3LJPA 2ZH1A 1S9EA 4CTAA 1TP7A 3SV3A 2I38A 4LIWA 1JLFB 4N56A 4ZHRB 2UUWA 3M9OB 1LXJA 5L9XA 4Q7AA 1LXNA 2W1BA 3C15B 3ZZ0A 3QT8A 2RQ4A 1NXIA 3GZ7A 2HHSA 2HWHA 3HHKA 3RR7A 4OX9F 4ZCMA 2CPYA 5JMNA 3MAAB 2CQIA 2K3KA 3KJFB 3D1QA 4PUOB 3BDPA 3HHLD 4WZMA 2V1TA 2FLLA 2VUGA 1X5TA 2KU7A 3RR8A 2M70A 2EFNA 2JRSA 2LEPA 2CPJA 2BOAA 1SJQA 2R7VA 5KOWA 3KMQA 3AX2A 2QC3A 3CCVS 3QRQA 5LSRA 3IO1A 1YRUA 3HHLC 3PRDA 2PA8D 3LPEA 2N7YA 3KUEA 4A48A 4I67A 1ZBTA 4JI5F 2WBMA 4YEAA 2F9DA 2OH2A 3E2EA 2HWIA 3RBXA 2RT3A 1XK8A 1IKYA 3PEHA 1KRPA 2WOMB 1RHUB 3SCKE 3RAQA 1VC5A 3MEDA 1JLQB 1L5UA 3MGJA 4N41A 1BAZA 2V69A 4QU6A 2HVZA 3PHTA 3UR0A 2EK6A 1AT1B 3G82A 4ZVSB 1I51B 1RA7A 4LF8F 4ZLLA 1QAJA 4Z7CA 1SL0A 2YQ3A 1UWAA 2JXHA 1HNZF 3Q8QB 1E6YB 4J37A 4LF6F 2FVCA 3F0NA 2DNQA 3DOLB 5D6GA 1X9MA 4O3OA 2BA9A 2DR7A 1XNRF 5DS7A 5BR8J 1HQEA 3IBFB 5A8KA 2ASJA 4K7QA 2RKIA 2LFVA 2VBXA 4DSEA 3OTEA 5F0WA 1YJ7A 4ZVTB 4LSZB 3RTVA 2CFXA 1Y5NB 3UNGC 2WAQD 2O5DA 2PC6A 1XJWB 3HHDA 2JVRA 5L1JA 1KD1T 2UVWA 1B0TA 2PEHA 4RUAA 3PACA 4RW7A 4N77A 1RBLA 1B0VA 4DSLA 3NNEA 2E9TA 2J9DE 1SJRA 2WVEA 4OJGA 2FHOB 1SUQA 3F73A 1QUVA 4NL5A 1S1VA 1YTYA 3A12A 3TWZA 1S9EB 4CTAB 4OI0A 4AL7A 2UXDJ 3V81B 2XS2A 3PDNA 4U7UK 5DG7A 5HP1B 4OYBA 3MR5A 1T9XA 1YZ7A 4FYWB 5G0RA 3CB4A 1Y10A 4WTOB 3T5KA 1LWFB 1IRQA 3PHEA 3N6LA 1I1GA 4DEZA 4WYLA 3TANA 2VD3A 3LGNA 2CJAA 1NDKA 4NYZA 1XR7A 2IC3B 4HR2A 3UQSA 2H9ZA 5B0CA 2HQCA 1UPPA 3QRRA 2CJ9A 3SSQA 2VJUA 1NJYA 1UWBB 1WTBA 4OI1A 3C19A 3NWRA 2QV6A 3BZQA 1BMQB 4ECWA 4FKYA 4BS2A 3HHLB 3GLJA 3TNVA 4OYWA 4DU8A 3NL0A 1L3TA 4ZIWA 2D41A 3MMAB 3W2WA 1SKSA 3C6TA 3QJPA 2DNZA 4U95A 3K5MA 1WACA 4FPIA 1EB0A 1RCXB 3NGDA 4RUCA 3D0IE 3CJ4A 4KBIA 1JNZB 3O8WA 3US5A 4LVOP 3LTOA 3G6VA 2RS2A 4CI0B 2OPPA 1IKYB 4ZPTR 1N52B 4F0MA 3H90A 3PG9A 2Z0GA 5D15A 2D9OA 4CH7A 3H59A 4HH0A 2OGUA 1TAUA 1UJ6A 1S1TA 3MEDB 1RDRA 3OPKA 4ED5A 1PBUA 3MCMA 2J76E 3MM8A 2P6SA 2WSCC 3KNGA 5THWA 1VQ5S 2RSQA 2UXCF 3CDEA 3HVWA 4F0HA 1ZZNA 4P2XA 2NSBA 4B3MF 5K20B 3AJ1A 2DGXA 3LGMA 1G6BA 1IBKF 2HQIA 4OYOA 2DHAA 2MZJA 2J9DA 8AT1B 3FGVA 4QJVA 4TU7A 3T3FA 1UFLA 5IFMA 2IYIA 1RT2B 4R8UB 1DHMA 1XIQA 2AGPA 2W2QP 5U47A 3KHGA 2F1FA 3NWGA 4FNHA 4A8MP 1RTHA 4EMDA 1X31C 4RW7B 4LF5J 3PTWA 4DDFA 1R6YA 4HI2A 5ETQA 2XYHB 2OEJA 2LDYA 5CA5A 4G6VB 2Q6BA 4H4KA 1FVQA 2ZOFA 3R8YA 1IKVB 3PZPA 4JI8F 2JBVA 4M5LA 1NUEA 1IBMF 5F8MA 1TZ0A 3LUYA 3QLHB 2WCXA 4H4KC 1FX4A 5G0RB 4AQYJ 4WBFA 3QRPA 5HK4A 4XO0A 2AIRB 5DETA 1PJ5A 3LAKA 1H98A 2MKJA 2M8DB 2VA2A 4Q0BA 1VQYA 3NNHA 2LP4A 3D0GE 7FDRA 1FHTA 2DEJA 2CAXA 2AKWB 2GIFA 2BNZA 1N8RT 3W62A 2CA9A 4J91A 3AB2B 1Q16A 4KGXB 4C3LA 2BABA 1JXVA 2HIQA 4F2SA 3TVZA 4EUVA 2ATCB 3U1NA 2MHNA 1BC6A 4RW4A 1ULRA 1FJGJ 3PW0A 2FVRA 1ACMB 2O01C 2ZHOA 3VAHA 3UD4P 1FRKA 1RT5B 3X3UA 2DIVA 1TFYA 1NSKL 1RT3A 1RWPB 4DV4F 2XS5A 5J2MA 3W2WB 2ZHAA 1IVZA 3C6TB 3Q86A 3CDUA 2YQ1A 3U1LA 1QUPA 3A3OB 1FDNA 3VHQA 3TUZC 1GFWB 3G8SA 2NPFA 1O6XA 3J7ZT 1VQKS 2MPUA 3TOQA 4YR2A 3OFFA 4DX6A 4C8LA 3B4MA 5EHHA 1RWNB 1S1TB 4ZVEA 3CJKB 1QD1A 5CD4A 3S8SA 4Q5VA 4PXDA 5IV3A 1FJEB 4JI6J 2QSFA 3MM8B 2ZBQA 3BQ1A 4F4AA 5KFYA 2G4BA 3NS6A 3S01A 5B0GA 3GYGA 4ANEA 4IG3B 3KK3A 3NGKA 3R6LB 4ZLNA 4C0OC 2IIHA 1S9GB 2HEKA 3QGHA 3FFIB 3AOAA 4ETZA 2L9DA 2COLA 3AOBA 3R27A 4G1PA 4RW8A 5A8RA 4ECUA 3PYFA 1DQ8A 2WTFA 4DUTA 2DO0A 2MY8A 2XMVA 1IM6A 3H4BA 5J2QA 2CQHA 3RAXA 2JHEA 3F44A 3D1OA 2FHMA 4RNNA 2QX0A 4KY3A 1R8CA 1NJIT 3NGSA 1JJ2R 5I3UA 6AT1B 2HBZB 3M8PA 3GIKA 3M8WA 5B0DA 2Y1LB 1X4GA 1FJCA 1TUVA 3QIPA 1AROP 4J9VA 3EXCX 5CAAA 2DRBA 4O0NA 4E2FB 2BDPA 2PMZD 5D78A 2A2BA 2LXIA 2GV1A 4FXVA 3DLHA 4F7VA 1W7WA 3NRBA 4NXMJ 1X9SA 3K89A 4NI2A 5DDOC 4E8UA 4OJHA 2VOOA 1X60A 5DDQC 4ID8A 4USVA 3ZO7A 4J9SA 4LFCF 2VPWB 1KTQA 4Q0BB 1S6OA 3GIRA 4CLTA 2XY6A 1WHYA 4HHJA 2MKCA 1G2EA 1BY9A 4DXLA 2BE9B 4GKJF 1HR0J 1Q16B 4E0DA 3VTIA 2EI5A 2C2RA 4ILMA 4P74A 1REVA 4J9RA 4RW4B 4NCAA 1QVGR 4ED6A 4MKYA 4LSLA 4QW9A 1JXEA 4Q45A 3KDOA 1FRXA 3HHEA 5L38A 4ZPCA 2KM8C 5J2MB 4RBVA 2QFJA 1VHFA 4YDDB 4B9UA 3SQOP 3C2PA 1ZAXA 1VJWA 4I6AA 2DISA 2YPZA 3V5RA 2N3OA 3NGUA 4ZCIA 3VALA 2P9EA 4ELTA 5MAOA 3CVKA 1B28A 1IJFB 4ITSA 1VQLS 1Q8IA 5JJBA 4V1Ak 4KPYA 1AB8A 3UCUP 2RRAA 3T1HF 2GVZA 5FDLA 5LXRA 2DHHA 2AN7A 3ZXWA 2NSCA 4WF9Q 4EK2A 1KHWA 2HVEA 1OY6A 3CO0P 4TLQA 3UDEA 2FD2A 4FS2A 3K8WA 4KV8A 1S59A 1NK0A 2Y1RI 3LW5C 1YITS 4W92B 2XG8A 1DTQB 3DGPB 2V8DA 4HHUA 4HT7A 2VODA 4OQJA 4RW8B 1N56A 2NXCA 4UY8T 2RQKA 2J8SA 1ZPWX 3CCQS 1LOUA 1NJWA 1HYSA 4AYBD 2Z4PA 1GH8A 4NLTA 4DV0F 2GAGC 4RJVA 3MR6A 3BBBA 2OLWA 2MSSA 1LNQA 2BM0A 2CXEA 3GR1A 4ZPDA 2Y8WA 3IM9A 2L3MA 3BGRA 1N5QA 3OR2A 3A1YG 3M8PB 4PKDB 5HSPA 3DGVA 2E1MC 2CIMA 4RKUC 3WX4A 1FDAA 1QTNB 4J9NA 2CJQA 3JSYA 3PYEA 3KG4A 1S57A 3QIPB 3OTOJ 4IG0A 2MZTA 3PY8A 1ARQA 2OEKA 2C2KB 2OPRA 4OJ3A 3DRYA 3H20A 4F50A 2FZKB 1XMBA 1N34J 2FVQA 2NQPA 4NI2B 3S6EA 4EZ9A 1T3OA 1WC6A 1FA0A 2E7WA 1FXRA 4WFZA 2W8LA 4LR7A 2F4VJ 2UUCF 3VGSA 1NHKL 1FI4A 1PJ7A 2AF6A 2ATLA 1UKUA 3BQ0A 2CQ3A 2HLTA 4OLPA 1Q5YA 2ZJPQ 3W9HA 4B3RJ 3A8KA 1IQTA 2HS4A 2NUUG 2H5IB 5LMUF 4CZCA 1Q86T 1TUWA 2DY9A 2HZCA 1ROFA 3KMSA 2LU1A 2KXHA 3E01A 2KM8B 4ECTA 3Q8PB 2VV5A 4DUZF 3M8YA 4LSLB 2C2EA 4M8LA 3PJWA 5DM7Q 2K2PA 2QE5A 4I2PA 1EKRA 2IA0A 1FEEA 1SC6A 1TELA 5GAEU 5C24A 2CZVC 1X4DA 3BS9A 4YOEA 2KO1A 4L75A 4OZ3A 4FP9A 2AT1B 1HARA 4C0HA 3UDCA 1T9WA 3ENWA 3FBCA 3HM9A 1NDLA 4F4WA 2BANB 5ETPA 3BKFA 2YBVA 1HNIA 2RD5C 4OYXA 2YNIA 4PG5A 1DJ0A 1KQFB 1NKEA 3MPUB 2FJDB 2FIUA 3T1YF 1F5AA 5FDLB 4K4XA 4KGMA 1K47A 2N3LA 1TR0A 4ME7E 5C25A 1P1TA 2VPZB 1SH3A 1H73A 4EYIB 1ITPA 5A2QY 5I3PA 4KV8B 3RW7A 1N4LA 3I5BA 2P2CB 3PO5A 3IFEA 2G2YA 5KFCA 1U45A 2DXFA 2CQ4A 4IUFA 2RF2A 3M2UA 1NK6A 2ZD1A 4ED7A 4KC5A 1CC8A 2FZGB 3PV8A 3CF5Q 3KLHA 1HYSB 1RP5A 4R0EA 3OT9A 4BWMA 3MEKA 1YSJA 4ZA1A 3BGRB 1RBOB 3HVTA 2RHSB 4LQ3A 1VLOA 1FCAA 1YZ6A 2DNGA 3QSYB 1FVSA 3K59A 1PSDA 4X62F 4KSEB 1RAEB 2MMYA 2QO3A 4CCHA 4IG0B 1NSAA 1VK3A 2K8GA 4DF4A 3VAKA 3RRHA 2B9WA 3R1HA 1RT4A 2I1RA 5B0BA 4ID5B 3M9NB 1QAXA 1X7VA 2IDLA 2YXLA 5K8PA 2RUGA 5KFTA 3MFHA 4CP5A 4DQQA 3QATA 3K2YA 1JJHA 3FMTA 4LF7F 1N88A 3GTYX 4CO4A 4JI2J 5KFSA 4EGLA 2RH3A 3KOAA 2AW0A 1DZ5A 4DZDA 2D69A 1S1UA 2A3JA 1UVKA 2YNGA 2HFUA 1N36J 2B43A 2JX2A 3CJRA 4DR6F 2XBPA 4DPTA 5KG0A 1NJZA 1BUXA 1HMVA 1K44A 3M8QA 4B3OA 5JXSA 1D9DA 1WUUA 1BQMA 2NYIA 4RUHA 1TTHB 1VS3A 1VR6A 1KTVA 1PYSB 3TJ8A 1UFKA 3W61A 3E01B 5DG9A 4P7TA 1EETA 3BH6B 2DHSA 4IR9A 1MU2A 3H87C 2B9YA 1S97A 3WQPA 1VFJA 2B8QA 4YR3A 2G2OA 2RDDA 5C24B 2PD1A 3U27A 4OZ2A 1RI7A 3VEBA 2QSWA 3OL7A 3O2IA 1UA0A 2EEYA 1XR5A 2IMOA 1R7IA 2DR8A 3QSIA 2BW7A 2ALZA 2CNKB 4TYAA 2LQ9A 2OPQB 2IY5B 3E8OA 2ADBA 1WEXA 4JI4F 3OXLA 2ZE2A 5E3QA 2ZH2A 4O3RA 3Q0AA 2AYBA 1HQUA 4MK7A 3SXLA 2PDAA 2BNWA 3ICLA 1NPRA 2JEJA 1GX6A 5CYMB 1Q4RA 3VGUA 2W9BA 2VBYA 4QBUA 4AXJA 4PQUA 2XQCA 3VAJA 1RJJA 5ETSA 1FE0A 2E5GA 5BYSA 4OV6A 4GVBB 3T5HA 1W2BR 2RF2B 3M2UB 4DR7F 4MAKA 3PR5B 2DGTA 2K7KA 3KUHA 2KHDA 3KLHB 2JVOA 5LL6d 1XNQJ 2DBBA 3OQ2A 3R6GB 1JMTA 3BR9A 5AXLA 2FZCB 2MQMA 1C1CA 3DRRB 4KQZA 2R7XA 3W9IA 1M5PC 1BE4A 4M5IA 4LF1A 1EA4A 3P96A 1WTFA 2E1RA 1D8ZA 4B9LA 2LECA 4DV3F 1J2VA 4K0KJ 2YH0A 1RWXB 2IVMA 2EG1A 2KFYA 1RT4B 5KFUA 3EJMA 4IDKA 2IRYA 3ILOA 2N7CA 5HVGA 2CPGA 1X5SA 4CH1A 1QTGA 2FPHX 2KVIA 3N4WA 1V3RA 2I0XA 1EQMA 4C97A 2YNGB 4OJ1A 5T41A 1T03A 1J5OA 2YKNA 1F3FA 3DNCA 3NKYA 5C7PA 1R0AB 1S6QA 1SC3B 3TQ1A 2C3YA 1IBLF 4RW6B 4K4WA 2IJFA 4DV2F 3PM9A 3HP6A 3E3XA 1Q53A 3TYTA 3NMAA 3FQLA 2Q43A 2AEJA 4NX9A 3FEYB 4ATNA 2MZSA 3GJTB 4DR3J 2KRRA 2OJ3A 1S1WA 3OJUA 2KT5A 3JB9k 4JI3F 4KRWA 4JI1F 1MU2B 4TYBA 2WK4A 2BACA 1DQAA 4DSJA 3AX5A 2DNPA 3Q8RB 3LGHA 2FHKA 4HT5A 2GQQA 1VQOS 3EM1A 1O0PA 4GVLA 3BJYA 1FX2A 1F2GA 1H2TZ 1H3DA 1NH8A 4PCQA 1AZSA 3TAMA 1H74A 4LF2A 5K8NA 4O44B 2V4JA 3N9UC 2AGQA 1AUDA 1HQ2A 3NBPA 3G2XA 2ZE2B 4ZVUB 3H5UA 1MMLA 2PO4A 2PEBA 2UVUA 1HQUB 4P6QA 3SZ2A 3H5XA 4WZQA 5BXIA 2VG6A 5L46A 2VQEF 5I42A 5H9EK 4YB1P 1OIAA 3GPAA 3NGRA 2GVDB 3MPWA 3G8TA 2OFHX 1R89A 4PQUB 4WJBA 4C48A 1FT8A 1HW8A 4JP8A 4C98A 2DITA 1SV5A 2K29A 1VHIA 4FYXB 3MOJB 3R5JB 1RISA 4XAKA 2XZDB 1M90T 1LEOA 3GV8B 3G96A 4WFXA 5K9FA 3D2WA 3AA9A 4DOZA 1U2FA 2ZBIA 1AYEA 4I1TA 3DLKB 3TQEA 3PVXA 2B9XA 1NHUA 3OV7A 2ZH9A 2M4MA 3A8EA 1VQPS 4MT1A 3KJVB 3GSDA 3QPIA 3ZTOA 3EZUA 4HYKA 5ETOA 5ETLA 2W9AA 3IA0A 5FLXY 5KFVA 2N82B 1T9TA 2VFRA 3AB4B 4LR8A 3GFZA 2UUTA 5IOLA 4YDXA 3CULA 2MTLA 4O0IA 3JXOA 4QQBA 2GJIA 4HVZA 4IDKB 4OI6A 1UMJA 2B4VA 1R6VA 3PYGA 2I9SA 2K3IA 2VBZA 2DPIA 5KT4A 5KFFA 1Q1KA 2KZMA 5EX3A 2BJ9A 4IO1A 4X2BA 3MEEA 1T03B 1J5OB 2YKNB 1S6QB 1N6QA 4DF8A 2KYXA 2V2VA 4GC6A 1KWMA 1WC4A 2KELA 4URQU 4C3MA 1I94J 3C46A 2HW3A 1MSWD 4ELUA 4J90A 3CCWA 2H54B 3CTRA 1K9MT 4I6YA 2OMLA 3G5OA 1FERA 4A4JA 4UF4A 2D3UA 1U1MA 1H0HB 4WYWA 1RWMB 2CPXA 3OXGA 3CJ2A 5LJ5Y 1FF2A 5BR8F 3KJQB 2A6OA 1FRLA 1RT7A 2HAIA 3FC9A 4Y3CA 2DIUA 2OD4A 4CO0A 3TAMB 5DQGA 1K8AT 4W4MA 4Y2AA 1U0HA 2EBEA 3NS7B 3GJQB 3GR0A 4KKOA 2DH9A 3CD0A 3MECA 5J1NA 1YBTA 2IBOA 3P8BB 4N8NA 3GIIA 1TKXA 1S7IA 4F3QA 4B02A 3CGIA 3C66A 5I42B 2XZ2A 4O3NA 3OD2A 5AE2A 2UXDF 2EFVA 1TV6A 3FBFA 4DR4J 2H1YA 2LQ8A 4NWBA 1SV5B 2R8GA 2HFVA 5EWFA 1UZHA 4NLSA 1VQ9S 4DV5J 4LUBA 3MPYA 3OBIA 2DHXA 2AJ4A 3H2VE 3QOQA 3EICA 1KLMA 3L09A 5ETRA 2YNHB 4DX5A 2XMTA 1UAWA 2DGUA 4PWWA 2OEMA 1TL7B 4RZRA 2L41A 3I6PA 1D3WA 5E5NA 3RZAA 1FD8A 3HF5A 3T5LA 2E5HA 2R2UA 2PE8A 1JIHA 4CO1A 2MB0B 3O44A 2GZOA 3K58A 3KG0A 2OTJS 3CCTA 4ZN3A 1Q8KA 2BQ3A 4NLDA 3ZTQA 1TL1A 5GAGI 3KHLA 1PKUA 1FD2A 3ZZUA 3R2CJ 3KDNA 3QWPA 1NLAA 4MIAA 4TVAB 4PYDA 2OIHA 3QO9A 5KFMA 1H38A 1AFIA 1YJRA 2ROGA 2PGCA 3BN4A 1VRUA 2WSEC 2YVSA 2GJFA 1UETA 2VC1A 1LV5A 2ZM6J 1LW0B 3MEEB 3TA0A 1RKIA 3OSNA 2NREA 3CJTA 3EMTA 4M5MA 1N6QB 1WDDA 4BHQA 5IWAJ 4M1KA 5HMZA 1RTJA 2NXJA 2ZBRA 3G71S 2FJEB 3LP0A 2B0GA 1X5PA 2HQGA 5B0AA 2A6MA 1Y3KA 3FBBA 2YTCA 2HFZA 2AX0A 2EFQA 3O3LA 2E9ZA 2Y1JA 2IAJA 3MDFA 5T7LB 4OX6A 1FFGB 1HBMA 2FLOA 4ZVHA 3MM7B 2MZ1A 4RBTA 1JLBA 2AYGA 2QA4S 1D0EA 2XLKA 5DLGA 2ZH5A 5D4NA 1DAXA 1PG5B 2ZUGA 4RNFA 4UOHA 1H2VZ 2QG9B 3BKUA 1NHVA 4KKOB 1CSJA 4LF5F 5LT5A 2F65A 3KK1B 1U8WA 2RDJA 2CNNB 2LQJA 3F41A 1IKXA 1DLOA 1NZAA 2KH9A 1TKXB 3EGZA 3K5PA 3DN9A 4USJC 3M32A 1D1UA 3DKDA 2CJKA 5SZTA 4YHHJ 1BLUA 4NPOA 3DOMA 5K5MA 4P7VA 3UI3A 3BB5A 1TV6B 3BV8A 3I5AA 2CG8A 1HBUA 3GONA 3HT0A 3ZZTA 1N5SA 4AQYF 4C2MA 4NCGB 1QSLA 2R7UA 2V6AA 1JX4A 4U6PA 5B0FA 1U7LA 4ZVQB 5E3RA 3OFEA 4WXOA 4LMZA 1RQ0A 5J1EA 1U1NA 2KXNB 1VMBA 1ZOTA 2HBYB 3KLGA 3MF5A 3IBCB 2ILYA 1SJ1A 2IM0A 1PYTA 2DGQA 2FY8A 3D66A 3KKFA 3D1HA 1U6FA 2OP5A 4A8SA 3PW2A 1TKTB 5JVGQ 1D8YA 2KN4A 1FJGF 3HFVA 3D3CJ 3KYLA 5D77A 3NNCA 2AD9A 1TMMA 4ES2A 3ENAA 4ZVOB 4OHWA 4Y6IA 2AJFE 5HROB 4IH5A 4ZLJA 1JKHA 1FKPA 4WIQA 5E2QA 4TXSA 3QO9B 2FVPA 1OY9A 4DPOA 5F41A 1M1KT 3HVAA 3MD1A 1BWEA 5KFRA 4KYZA 4TQRA 4ANDA 2HHHJ 2H3EB 1RU1A 4WFYA 2Y0SD 4DQPA 1KKHA 2RUSA 2C42A 4ZVGA 1H7XA 2RNEA 1R27B 3H2LA 1Y11A 3RB6A 2DGSA 4LIRA 1WKLA 2EPIA 2ZC4A 2QLXA 4BCAA 3OVAA 1UJ5A 4OX8A 3TUPA 1RTJB 1UEVA 4Q8EA 4JI6F 3IBWA 5KG7A 4PPZA 1S9FA 1ICEB 1MNTA 1FWPA 3NS5A 1N5YB 4FF1A 5CZXA 4OYIA 4Z37A 3AXKA 2CG4A 2R4FA 2E1CA 2ACMA 4B08A 3M05A 4OHZA 2MKIA 2MQQA 1S72S 2IM1A 2AWZA 3MAQA 1APSA 2IAJB 1FESA 1X4CA 1P9YA 1F3VA 4IRCA 1HBMB 2YKOA 3LA0A 3ZTRA 1BQNA 2J7WA 5E33A 2ZHBA 1RE1B 5KFEA 2VZ9A 1R8HA 2AU0A 1OJ4A 1EQ0A 1M5VC 1GMWA 4ECVA 2AYMA 2X1FA 4P52A 4M5DA 1P94A 1U48A 2UUAJ 1X93A 3FRZA 2E44A 2A10A 1FNMA 1S99A 4NLPA 4OV1A 4L73A 4B3TJ 2Z2YB 1DLOB 2E5IA 3OL6A 4QR0A 1SXLA 4MK9A 3MM5A 5E7OB 3FK4A 1WF0A 3DYAB 2HS3A 1NSPA 3MPDA 4PAAA 1SKWA 2QA4G 1WORA 4PG8A 1Y7PA 4QIGA 1YJTA 3UDVA 4ECZA 2JJ4D 1GMUA 3DCAA 3IG1A 3TUIC 1LWCA 1U49A 2EFPA 1R31A 2H4WB 2JEGA 3NLCA 4NXMF 1RWUA 1CJTA 4DQRA 1B3TA 1Q81T 4ANCA 3SBMA 4G1QB 3MZIA 3TZZA 3BGOP 5F8JA 4CO3A 1HIYA 5KG6A 3VQTA 1UVJA 4JV1A 1N48A 1NB2A 1P6TA 2MYFA 2Y8YA 2DYAA 5BYRA 4LSNA 2ZC3A 2HGLA 5AE1A 2F40A 5FIIA 2J0SD 2GMLA 1H72C 1S6UA 1HR0F 2QMXA 1KQKA 3HFZB 3AJ2A 4WFBQ 1QSYA 2XCPA 1RLDA 1X4HA 2HHVA 1KSPA 2LEBA 3QGIA 2X3GA 4DR2J 2HHXA 2B4UA 3M1VA 4G65A 5FLXU 3H8YA 2HRTA 3QAEA 4LF4J 1TL5A 2QL7B 3TZYA 4U9RA 2QGFB 1NSQA 4CLLA 4M5HA 3AHPA 1RWVB 2JLGA 2W4CA 2IFXA 4B3SJ 2XLJA 2W8KA 2MLZA 2FQQB 2VG5B 5FD1A 1PGZA 1V3ZA 5IZHA 3DOKA 3RBDA 2WSFC 3J80U 5D0GA 4DFKA 4LJMA 4C9DA 3DRPA 4I6WA 5IT9Y 2H1OE 1SL1A 1D9FA 2BSQE 1EAYC 4ZCKA 3I55S 4PUOA 4A8WA 1YI2S 4KT0C 2FGOA 3PIPQ 2F63A 3G87A 1IQZA 4AE5A 2H48B 1EZZB 3IGVA 3AAWB 3CD6S 3CIMA 3IS9A 3LALA 1NDCA 1JLEA 1IKWB 2RHQB 4ED2A 3PW4A 2HG4A 1U4BA 1VBKA 2V50A 2V4QA 2XCAA 4CLZA 4DL0C 2HMIA 4LR9A 3MCOA 5KT7A 4FXDA 3IC1A 1SC4B 3QYYA 1BQNB 5H9EJ 2CDRB 4DL5A 1VQ4S 3CCZA 4KPCA 5D3GA 3OL8A 5L39A 2HWTA 3UCZP 3TVYA 2AZ1A 4IFVB 4M5DB 5M2UA 3BGUA 5KFQA 1DARA 2JL9A 3IAS9 2WOMA 3QFHA 3HT3A 2M9KA 2R2RA 2KG0A 1WG1A 1RACB 3DLGA 5DM6Q 2E5JA 4DR1J 1JLQA 2V94A 4N8OA 4MTPA 3MM5B 3QAUA 5CABA 3OTOF 4K5RA 1T94A 1WG5A 4U7CA 4ED0A 2UXBJ 1UVMA 3WBZA 3FT7A 4PR6A 3CDBA 1S7HA 3BREA 3IG1B 1SKUB 1LWCB 1GX5A 1U1LA 1N34F 2AQ4A 4MFBB 1NBEB 3AOCA 1X8DA 1NMEB 3BH7B 3TZWA 4DJBA 2DB1A 1URRA 3OL9A 2F4VF 2MQPA 4JI7J 2ZZTA 2CQGA 3GSIA 2V9WA 3OFHA 4LSNB 4ELVA 1C0TA 5KFJA 3K5OA 4TNOA 4B3RF 3IP0A 3Q24A 4QR2A 3WX8A 5G4DA 3DLLQ 4RWXA 2DNOA 5AJ3F 2DR9A 4X66J 1M1GA 1QDUB 3RUBL 3K5NA 2FC9A 4FYYB 2CZ4A 1U6ZA 1S77D 3CE8A 3WIUA 3F56A 4R5PA 3IMQJ 4OYPA 3V2UC 3MMCB 2OKQA 4DL2A 4ERDA 3JQKA 2XHWA 1K73T 3M6WA 3L95X 3EVOA 4KFBA 1QJHA 1TAQA 3AFGA 3V81A 1YRXA 3IR7A 1R8AA 5HP1A 5HN0A 3DOKB 2KB2A 5GADI 1I3OB 4HDGA 1HNXJ 2XI3A 2QJ3A 4IH7A 4K4UA 3GMGA 4ZIVA 2ZZMA 1TQLA 1LWFA 4BC9A 3PIOQ 3EPGA 4NLXA 2GA7A 2R7TA 3DRPB 4DV7J 1XBWA 3LAMA 4DLEA 4LRCA 3TEHB 4B9VA 2IC3A 2OD6A 1F1BB 2XS7A 4ALZA 4MK8A 1QAIA 3HFKA 2Q66A 2W7OA 2P5VA 4ZJOA 1UWBA 4DI6A 3BPSP 2GPEA 5GAHU 3R7BB 3IS9B 5KFZA 3HHLA 2CPFA 1JLEB 2K6LA 3DDKA 2Z2ZA 2HSEB 1ARRA 4EFAC 2V0NA 4USUA 2ZH8A 2Z8QA 4WP9A 1HNVB 3ETOA 3P5BP 2HMIB 3MMAA 1P8GA 1SVDA 1YIJS 5DQHA 1XEZA 4P2MA 4YN3B 2R7WA 3AX3A 4DSFA 5D3GB 2YWKA 2KJVA 3C8YA 2UUBJ 3MEGA 4USKA 1Z2ZA 4KHMA 2E29A 1T9VA 1CJKA 3QJJA 3DLGB 5EUHA 1TL3A 2QTWA 2V2ZA 2V5HG 2R7SA 2BX6A 1YG0A 4ZITA 2ZEJA 4CRJA 2DNMA 2QLBB 2VBWA 5LSLA 1TU0B 1AA1B 2W7PA 4F4YA 4NYOA 4XIUA 2QL9B 2FHJD 1VIXA 3K5LA 2BYCA 1CEZA 3VEAA 3LO3A 4JI2F 1X4EA 2MZRA 4WTYA 1OQ6A 3HKZD 2RIJA 1R43A 3C6UB 4F26A 1RHQB 2AGOA 2R7QA 1MLAA 4X4SA 4IO9Q 1N36F 2XSFA 1S49A 3A8JA 4DQSA 1C0TB 1RT2A 3CMES 1T9UA 1C1BA 1RADB 3QNWB 5GVQA 2GIRA 4R8UA 4KHPJ 2ABYA 2H65B 3JSRA 3WDOA 4F25A 3AODA 2HK2A 2MJUA 5CXTA 4X65J 4R5PB 3UFCX 2FB0A 3T41A 3UPFA 4G1IA 2G1HA 3R97A 4C3KA 3ADAC 3WZ0A 4DPUA 1IKVA 2WW8A 1NAQA 1LWXA 3C16B 3T19A 1KHVA 3PCOB 4PXEA 3ZZZA 4KFBB 2XHCA 3QLHA 3QIDA 3IR7B 3FCHA 7AT1B 1IXKA 2XMKA 5A0YB 3PX4A 3FVYA 1XR6A 2PN6A 3HZGA 4N47A 3D4JA 5E3CA 4URGA 1SKRA 1NK4A 5KFAA 3DU6A 2LDIA 2M8HA 2RILA 1G1XA 1C4AA 4F02A 1KS2A 2X51A 4ED8A 2JFDA 2VG7B 4PWUA 1VQ8S 1R8PA 1RYSA 4CLKA 2PMHA 2LXFA 3AQOA 1JJ4A 4A8XA 2I2YA 2YNFB 3CC7S 2UV8G 1TMJA 2GO8A 3KXDA 1BDTA 4F67A 2GS8A 4UW2A 5GMKa 3CMAS 3MM6A 4TU9A 1ZM9A 3Q23A 1RT5A 2YWEA 1N5TA 3EZ5A 4N7TA 4RWWA 2DGOA 1T9YA 1XN9A 1T7PA 4V19J 4HACA 2DRAA 1Q95G 1XNQF 3I0RB 1HNWJ 4X64J 2B6AA 1BDVA 1O8BA 2BR0A 3CCUS 3CD5A 4DMZA 3BDEA 1S5ZA 3MEGB 2RAQA 5A8WA 3IAM9 1CJKB 2J9EA 2W2MP 4LVNP 4F4ZA 4WK1A 3CJKA 1TL3B 1UTAA 3FCWA 3ZTPA 4K0KF 4ZKAA 2GMHA 1Y5IB 2HGNA 1RAAB 3W63A 4IRDA 3EUNA 1MW7A 1CG2A 4CM2A 3CEDA 4Y0FA 1Q8BA 3C14B 4QWAA 4IG3A 2YWGA 2J5AA 5CD4H 2OMOA 1EIYB 3NXZA 3MAHA 1S9GA 2MKSA 4YMEA 3FFIA 4CLYA 4NA2A 4JOUA 5HMWA 2CJYB 2EBGA 4NLQA 2YX1A 3BN7A 2JXIA 4RR5A 1C1BB 3ILJA 5MLCV 1RXOB 3VF0B 3WHIA 2C3UA 5DDRC 2Q2KA 3EDQB 1KDNA 3H2UB 4ZPAA 1NKBA 3GJSB 4DR3F 5GMDA 5B09A 1VRTA 4X84A 4DQIA 1VK8A 1WSRA 2AV5A 4U7UD 2XMJA 5KFKA 4ED3A 5KFHA 5ETMA 1S10A 4RW9B 1JLAA 2CRLA 2JC1A 5HMXA 4PG7A 3CJSA 3ZC4A 2ZVIA 1NK5A 1JLCA 2DD8S 3LP2A 2A2CA 2IRUA 2XTJP 1RBAA 2DVIA 2K1RB 4FF4A 4F0KA 2HK3A 1GXLA 4JYAJ 1NEEA 4DU7A 3TAPA 2DCUB 2W7AA 3R2DJ 2FJAB 3TR5A 1DQ9A 2IJNA 2HQDA 4NZ7A 1JXLA 2CZ9A 1YHQS 4I7FA 4F2RA 3I0SB 2BJEA 5IT9U 2IVYA 2R9LA 4OLOA 2ILZA 2U2FA 5CH7B 1UFWA 2K9IA 1MG7A 2Y9HA 3RBEA 1X0PA 2OUGA 2QLWA 4QIFA 2V2QA 2BUNA 4ECQA 3MM6B 4DZ6A 1Q8LA 5ETTA 1N54B 4BBYA 2DNNA 1S48A 1YLXA 4K4TA 4J9KA 2XULA 1WC5A 3EDRB 3NOGA 3RRKA 1AFJA 3FMWA 2UU9J 3V6KA 5HLFA 5EDWA 4HACB 5HAOA 1TVRA 1TK0A 4QCLA 4ILLA 2BJDA 2B6AB 1NNDA 3EGWB 3JQMA 1S0NA 4DCJB 3EYZA 3GG1A 2V8GA 9RUBA 5F9NA 3ISND 4P73A 3BSCA 2HS0A 2BKNA 4UOCA 1YBAA 2CWKA 5A8WB 1WHVA 1B70B 4E98A 5KFPA 1ZM3A 3MURP 4B17A 3PJ9A 2EK1A 4YY3J 2V9KA 4RNOA 4MIBA 4KB7A 3DLBA 4ZVRB 1JWWA 4C7QA 1KVJA 4OYMA 3SI8A 3NCPA 2JNJA 4MYTA 3J81Y 1FRMA 4L6V3 3IRXA 1ELOA 2HHQA 3MI7X 4USMA 1JB0C 3GV7B 7FD1A 3O1LA 2CUYA 2J8AA 3THVA 3B78A 1DTQA 3DGPA 3LPYA 3IR6B 1T02A 3QZ7A 1T3NA 5LXYA 3HI9A 5L1LA 2AJQA 1LW2A 4NLVA 5LMNJ 3M4XA 2B7BB 1PILA 2VA3A 1WEYA 1NK9A 4IFYA 1P1LA 3Q89A 2V2KA 3M30B 2DNYA 4TN2A 3AQPA 3KLEA 2UVVA 1I94F 2XY7A 1VRTB 4JI0J 2DGWA 5H9FK 4KHRA 3EGNA 2QYCA 2CQCA 5IC4B 3VQSA 3DRSB 2G0JA 3KLIB 1JLAB 5IM0A 1JLCB 2C3PA 3LP2B 1IUJA 1UEKA 4EI2A 3I96A 3J7AN 1HKAA 3FZ2A 3TA2A 2E9RX 3LWMA 1EARA 2GQ2A 1Q82T 2W9CA 2H3AA 3C3LA 1PCAA 3NO7A 4CH0S 4URSA 1ZZFA 5KG2A 3B6BA 3M6XA 4I7FB 3VAGA 1PC4A 3NG8A 3CIZA 3EE3A 2GHWA 5KG4A 2QYGA 1XC9A 3KLVA 2OPSB 2X1GA 4J9QA 4JV0A 3J81j 4DR4F 4IH6A 2BBEA 4QW8A 2QT7A 3VWSA 1HWLA 1HWIA 3FNNA 4DV5F 3HDSA 2V1SA 1F5CA 5HLFB 1TVRB 3N79A 1QE1A 1WI8A 2K5JA 3TUJC 2BANA 1OWXA 1H6KX 3JAMY 3Q83A 5DDPC 1XERA 4YUDA 2KVQE 3GE9A 4DUYJ 3BR8A 2BVZA 4YB7A 3T6BA 3QJLA 4K8RA 3HCXA 2BRKA 2DH7A 4FS1A 3TAQA 4ECXA 2JH3A 1M1HA 2ZH7A 4LT6A 1C0UB 2BJ1A 2AX1A 1J5EJ 3EVMA 2MKKA 3IRXB 2A2DA 1E6VB 3CSKA 4CNZA 4AXIA 2R7RA 2ZM6F 4RO0A 4DL4A 1U8SA 2N4CA 2XZWA 3UO0A 3W60A 2FY1A 2J7KA 2JOQA 3TJ9A 5CYJA 3KWMA 1LW2B 3W8PA 3J7A1 1KVIA 1L3KA 3PX0A 2OFGX 1X4AA 1OG7A 5IWAF 4IFYB 3TX0A 2CJBA 5HVFA 1SJ4P 3KLEB 2PFFB 4I0WA 1SIZA 3THPA 2VFVA 5CCLA 2BKPA 1DRZA 4JUZA 2FLPA 3IRWP 1ZM2A 1ZH5A 3N28A 4ID5A 5IM0B 2BZ2A 2XM3A 1MWYA 4ZVPB 1FFSB 1LFWA 2Y0BB 2XNQA 3NOCA 1UCNA 3MM9A 2W9CB 4LFAJ 1UW9A 5IXUA 5CQGA 4W98A 4IRKA 1OQ3A 4GC7A 5L9NA 1VQ6S 4X4QA 1FXLA 5HMYA 3DMJA 1YWXA 4ZCLA 4NA3A 4KTQA 2D68A 3L7PA 1SB6A 9ATCB 4B9TA 1HWUA 3N01A 1U1PA 2KTQA 1N33J 1FJ7A 2B5JB 2VQFF 4YHHF 1J27A 2R8JA 3D0HE 3DHXA 1BXNA 4YR0A 1HWKA 3MUMP 4DV6J 3PRVA 2MDAA 3ZTSA 1WC1A 2D74B 1IWAA 1HFEL 1WF1A 3SDEA 5KFIA 1QE1B 3K57A 3NMRA 1NKCA 3PW5A 2OPQA 3QWUA 1FRJA 3V6DA 3VV2B 3MUTP 5F8IA 4IYQA 4S0MA 1L3SA 3D5MA 2Q3PA 4O3QA 2HNDA 2O66A 4DS5A 3GQCA 5CYMA 2XEXA 5IS2A 3UN3A 1RU2A 3S1TA 1VC6A 3G6ES 3M2RA 5KFDA 2CQ1A 3KJNB 2A1BA 3DI6B 3AT1B 1SBRA 1P9QC 2W25A 3RJMB 3G9CA 4GVBA 2HHHF 3KK2A 3ZFVA 2D1CA 4N5SA 1GTHA 4MJWA 2I5JA 1XMQJ 3H25A 3TO8A 2FLNA 1N32J 4MMOA 4DCOB 1DURA 3HJVA 4DWIA 3SV4A 2CWXA 3O6QA 5KFOA 2GJ2A 3DRRA 4N76A 4XDDA 4V19X 2JWNA 2NLWA 3BKTA 4JB8B 3CJQA 5HI7A 4RX6A 2Q6CA 3N6NA 3PO4A 4OX7A 3EVWA 1QVFR 1PYOB 4LBHA 1S4EA 3K17A 1ZAVA 1MWQA 5HBMA 1CC7A 4O3PA 3AD9C 4FXEA 3LP1A 3Q2SC 4ZLPA 1SQGA 4C8OA 2HQFA 2HGMA 4I64A 4DHVA 3KFWX 4HDHA 2GQCA 2JFKA 5KFLA 4CLSA 2B3TB 3MM9B 5HQLA 1OS5A 2QLFB 2L9WA 1RTDA 4LF9J 2UUAF 2F5GA 1SH2A 3DMJB 5IT4A 4Y00A 4B3TF 4ILRA 5HQMA 2C2MB 1TKZB 1R0AA 3CJ5A 4MH8A 4RW6A 4ICLA 2PFDA 3OXFA 2ZFHA 1YJ9S 3NY0A 3OTCA 2DNLA 2E7VA 3V4MA 1V5VA 4DV1J 1SPBP 1UW4A 3BSNA 3NAIA 2ZUAA 4WXWA 3TJAA 5IC6B 2DR5A 4NRUA 1KLNA 4GRSA 5E41A 2L48A 3M9MB 2C2OB 4QIWD 5ETNA 1Z2LA 3FCVA 5A76A 1I6JA 2Y3YA 2J6UA 2AYEA 4ZJQA 3DRXA 2V68A 4Y2MA 2DNHA 3VGVA 3RYLA 3DDIA 2V8PA 2QZ8A 3SDEB 2KDOA 2D3ZA 3UWTA 3HSGA 1CS4A 3V6DB 1SCJB 2C3MA 1KOHA 4O44A 1Q7YT 1OMSA 3HVRA 4RLEA 1RWOB 2G13A 3W1YC 4DR2F 1S4FA 1G3OA 4AFFA 1YQHA 4EEYA 3MUVP 3QT6A 1SJ3P 3FUYA 2HNDB 4LF4F 1RLCL 3UCGA 2CAJA 3QZ8A 2ZDOA 2KFZA 5HJYA 2IHR1 2NXNA 5C5JA 4B3SF 2GVDA 1VBYA 3D54A 3M2RB 4UQTA 2PI4A 4QU7A 2YKAA 3PRBA 3I9V9 2XGPA 1VISA 2XTCA 4USWA 3M8SA 2WHOA 4MKAA 3J81U 5HJXA 1U0SA 3QT7A 3OUYA 3KK2B 2JZ5A 2Q79A 3BM7A 1VC0A 1D09B 2F9JA 3Q8SB 3GILA 2DRDA 2LLZA 3VR1A 2I5JB 1EP4A 1F5BA 2YKQA 5HO4A 4UOFA 3H42A 3WC0A 1B4SA 4X4OA 3DLKA 5GAGU 1U09A 1FRHA 5L1IA 5D0RA 2ZH3A 4B9MA 2F7VA 3KJVA 1Y0HA 3M2VA 4OFZA 1WG4A 4MYUA 3CCES 3R5GA 4PXCA 3IWXA 4ZP8A 1NB7A 2GC8A 4I56A 3RB3A 1YBUA 1S6PA 4LRDA 3CJ8A 3TP2A 1SJFA 4LQ9A 1S79A 3K7RA 1FFWB 5HBMB 1X4BA 3G82B 1VJQA 1GXUA 3LP1B 4QPXA 5LSOA 1L3VA 2BV3A 1GQEA 2XLIA 2WONA 2ZWOA 4H4MA 4PWDA 2M52A 3W5YA 4WP3A 3MTKA 2WB1D 5EWEA 4A8OA 2ALYB 5F3TA 1HQEB 3HO1A 1XMOJ 2RVJA 2DY1A 4PXBA 5A8KB 4OZ1A 2EKYA 2BRLA 3ETMA 1RTDB 2RKIB 1Q78A 2VDIA 2HZVA 2HAFA 2WVCA 4ZJLA 1TUGB 3MTJA 4USTA 1TK5A 4Q44A 5EN1A 3UVJA 4DR1F 3SCJE 4FNIA 2MLYA 4ICLB 5ETKA 5DO2A 1A9NB 4GMKA 2M0GB 3FSIA 3MD3A 3QQCD 4DLGA 2UXBF 1M0SA 1PARA 5FJ4A 1CULA 4QWEA 1SUQB 1NPKA 1X4FA 4L3KA 1S1VB 4CNYA 1EHWA 2HZAA 4KIAA 1XTZA 2JDJA 3PNIA 4Y65A 2VL1A 1PBAA 3HSJA 2JLEA 1FWLA 1WJ9A 2XMUA 3GWCA 3R1LA 3TVKA 1ZETA 4IKAA 4JI7F 1ZYQA 1U25A 3ZZPA 4Y28C 3FJ2A 1PJ6A 5KG1A 2DEIA 3HMJG 5KT6A 1CS4B 2ROPA 2VJVA 3R3TA 2OHDA 2IBKA 2C2NA 3VAIA 4X66F 4LFBJ 1HD1A 3W5XA 3JAMU 3W8GA 4F4XA 2E1AA 2HVIA 1Q0NA 5HL7Q 2VFUA 2WVFA 5IV4A 1MMDA 1WNEA 4OYAA 2GIQA 5F8GA 1RAOA 3GYXB 1ZAWA 1SC1B 2C2ZB 3BYPA
chains in the Genus database with same CATH topology
2PT0A 4C0HA 5AXNA 3UDCA 3ENWA 5ADZA 5GADI 3HM9A 4HDGA 2YY3A 2XI3A 4F4WA 2BANB 2CPIA 3CPWR 4AUKA 2ASYA 2KRBA 3GG0A 1HNIA 4IH7A 2RD5C 3VAMA 3TA1A 2OPSA 3MR3A 4K4UA 3GMGA 2HRYA 2YNIA 2ZZMA 2ZDPA 1M5OC 4PG5A 2MJNA 1TQLA 1HNXF 1DJ0A 1LWFA 4BC9A 1KQFB 1NKEA 3ZZYA 3PIOQ 3EPGA 4F8RA 4NLXA 2GA7A 3OUYB 2R7TA 3OLBA 4K4VA 1TL1B 2FJDB 2FIUA 2GNKA 3DDNA 3H98A 1F5AA 5FDLB 5H9FJ 3T1YF 4FN5A 2PA3A 3DRPB 4K4XA 1GTEA 4L3NA 4KGMA 4OMFG 1XBWA 3LAMA 2N3LA 1EP4B 1YVFA 3CO9A 4DLEA 1TR0A 1TKDA 2HYIB 3G6YA 2MZQA 5GAHI 2IC3A 2OD6A 5C25A 1U47A 2MY7A 1P1TA 4B9VA 2XS7A 4ALZA 2EFGA 2EVZA 4OI4A 3KG1A 4MK8A 2VPZB 2UV8A 1SH3A 4DV7F 1QAIA 3HFKA 2IA6A 2NR0A 5CHCB 4HKQA 4JV5F 1U2RA 4FF3A 2ACYA 5J1PA 4EYIB 2Q66A 2OPPB 5A2QY 5I3PA 4KV8B 1VRUB 3T6JA 2F3JA 2YNHA 3RW7A 3SCLE 5CZVA 2W7OA 1N4LA 1A6LA 3I5BA 2P5VA 3M2VB 3PO5A 1UWBA 3IFEA 4K5SA 3I82A 5GAHU 3I5CA 2HHPA 5KFCA 1U45A 2G1DA 2CQ4A 3IS9B 5KFZA 1PO6A 3HHLA 2CPFA 4ZOSA 5D4OA 1JLEB 3MOZA 2RF2A 4IUFA 2XB2D 3M2UA 1HWJA 1NK6A 3DDKA 2HHWA 1S6PB 3BSAA 2XI2A 2ZD1A 1WHWA 4BWJA 4EFAC 2V0NA 1GNKA 5L1KA 4ED7A 1RK8A 2ZH8A 2FVSA 5KTQA 2Z8QA 1WI6A 2AJ0A 2RDIA 4KC5A 1CC8A 1HNVB 3ETOA 3PV8A 3CF5Q 1DTTA 3KLHA 2HMIB 1HYSB 2SXLA 3MMAA 4NOHA 1P8GA 1YIJS 5DQHA 3MFIA 2YKPA 4WFNQ 2J0XA 1XEZA 3BO3A 2RE1A 5F8NA 4NA1A 5J2NA 1RP5A 4R0EA 3JTOA 2KYZA 4UY85 3G86A 2EC0A 4BWMA 3MEKA 3LP0B 2R7WA 1YSJA 3GIMA 1B64A 1ZPVA 4DSFA 5D3GB