4QPXA

Nv polymerase post-incorporation-like complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
502
structure length
495
Chain Sequence
SKGTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein
publication title Structure of a backtracked state reveals conformational changes similar to the state following nucleotide incorporation in human norovirus polymerase.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Hydrolase/rna
total genus 167
structure length 495
sequence length 502
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 4qpxA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4qpxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qpxA03
1C0TA 2OPQA 3M8PA 4KSEB 1S6PA 1ZTWA 1LW2A 3DMJB 3FRZA 2RDJA 3QGHA 5KFXA 3FQLA 3LAMA 2QE5A 4F4ZA 3MEGB 1IKWB 2XI2A 4B3OB 4NCGA 3BR9A 1SUQA 2WRMA 4QPXA 4J9LA 3M8QA 1U09A 1JLCB 2ASJA 1NHVA 2AGQA 1MMLA 2I5JB 3CWJA 2YNFB 4ECTA 3GIMA 1C1CB 4ICLB 5D3GB 2DPJA 4TLRA 1IKVB 5C25B 3T5LA 4LSLB 5KFUA 2FLPA 2V4QA 2W9BA 2UVVA 4PUOA 4EO6A 2B5JB 2IM3A 5F8JA 3QO9B 2C28A 3IGVA 4QWAA 4XO0A 3IS9B 4TQRA 4KKOB 4KFBB 3T1AA 3GV8B 1T03B 1HMVB 4MH8A 3PR4A 3V6KA 5D3GA 3ITHB 3IRXA 4IFVB 5KFJA 3RB6A 3MF5A 3KLIA 3MEEA 4ECXA 3CDEA 3T5JA 2YKMA 3EZUA 3SFUA 5J2NA 3RAXA 3LP2A 4YR2A 1UWBB 4NLSA 2VG7A 3DRSA 1CSJA 2YNHA 4KHRA 4ED8A 5KG5A 3BQ1A 2CJQA 1HNIB 4NLRA 4O3QA 5J2MB 1TKTA 2HNDA 1KHWA 4QW9A 4RW6A 1D0EA 1SH0A 3G6VA 4KAIA 1R0AA 4U7CA 4JV0A 4K50A 1RT7B 1S1TA 3DYAA 1HQUB 4M94A 4TQSA 3C6UA 2WK4A 2AGPA 2UVRA 1S6QA 4MKAA 4G1QB 3PW4A 5I42A 3KOAA 1LWFA 4OL8A 4I7FB 3GILA 2CKWA 3DRPA 4EBEA 5FDLA 2YKNA 2BRKA 3G6YA 3QIPA 3NBPB 1N6QB 1LWCA 3GV7B 2C2DA 2D3UA 3NGDA 3KK3B 4YR3A 3FSIA 5CYMB 2BQUA 4IRKA 1MU2A 5KFSA 4PQUB 4LSNA 4ZVEA 4RNOA 2FLLA 3BGRA 5J2PB 4IKAA 1JXLA 1IKXA 5KFTA 4WXWA 4IDKB 2ASLA 5HP1A 2R8JA 1SV5B 2OPPB 4ZP6A 1RTJB 1EP4B 5C5JA 5HROA 2ATLA 3KLGB 4ID5B 3HVWA 3H2LA 2BQRA 4H4OA 1BQMA 1SH2A 3MECB 3NMAA 4LQ9A 3KLFB 3DLEB 4DEZA 2W7OA 1JX4A 1N56A 2HAIA 1JLEA 2V9WA 4DG1B 4ZP8A 1S1UA 3MFIA 2J6SA 5C24B 1S10A 1JLGA 2UUWA 4KBIA 4Y34A 3UDLA 4RW8A 1C1BB 2VG6B 3CIZA 4O4GB 4WZMA 5KFDA 2AU0A 3V81A 4IRDA 5EWFA 2IAJB 1DTTA 2BE2B 1BQNB 3LANA 3GIIA 4I2PA 1RTHB 2I1RA 2BRLA 1TL1A 4IG0B 5DQIA 1LWEB 4TXSA 2R2TA 3GQCA 2D7SA 4O3SA 4EO8A 4F50A 4DL4A 2BANA 5F8IA 1TKXA 2WOMB 4WE1B 4GC6A 5J2QB 3PHEA 4KV8B 3I5CA 1RT6A 2JC0A 3V6DB 2F8EX 4ZP7A 2YNIB 1TQLA 3TAMA 4IOBA 4RW7B 4K4UA 3DLGA 3NL0A 2HNZB 1S1XB 2WONA 2HNYB 2VG5B 3UR0A 3JYTB 4WFYA 1RT5B 1TKZA 1W25A 3LALA 4IFYA 1S1WB 2ZE2B 5K14B 2FVPA 1VRUB 1LW0A 2HMIA 3DM2A 1RTDA 5KFLA 1FK9B 1RTIB 1HYSA 2FVQA 5HBMB 4ZHRA 4R8UA 4O44B 4IH6A 4H54A 1C2PA 2OH2A 1TV6A 2D41A 3RB0A 1KLMA 1S9EB 5KFYA 4TY8A 3SI8A 3LP1A 1HNVB 2W9AA 2RF2A 3RAQA 1C0UB 4J9MA 1N5YB 2W9CB 1QE1A 5DQGA 4ECQA 2ALZA 1DTQB 3CJ3A 4DL7A 1TL3A 1C0TB 2OPQB 1LW2B 4R5PB 3DLKA 1IKYA 3EPGA 2IM0A 2OPSB 2OPRA 4K4ZA 1RT2A 3FFIB 5HLFB 3OSPA 3OL9A 4K4XA 4XPEA 5KFVA 2AX1A 3RBDA 1ZETA 3KK2A 4TYBA 4J9PA 1RT3A 1JLFB 3M8QB 3KK1A 1RA6A 4ECZA 3E51A 1RA7A 1VRTA 5KT2A 3KJVA 4H4MB 4NYZA 1DLOA 2C22A 1T05A 3RBEA 5KFCA 1JLAA 4ED3A 3MR5A 4NRUA 1FKOB 1GX6A 3OLBA 4PUOB 3KLHA 4RW4A 3G6XA 2E9ZA 1WNEA 4Q43A 4IRCA 4Y2AA 1NHUA 4NLWA 2IM2A 3PW7A 3BSCA 4RNFA 4ECYA 5CYQB 2FJXA 4NLPA 3MEGA 3IRXB 4B3OA 4RUCA 1S9GB 3CJ5A 3OHBA 4G3IA 1J5OB 4HKQA 3MEDB 3KLIB 3KHHA 3T5KA 3VQSA 2FLNA 3N6LA 2YKMB 5J2NB 5DG7A 2I5JA 2YNFA 2VG7B 5L1JA 1Z4UA 2FVCA 3H5UA 1C1CA 4WZQA 2YNHB 4X2BA 4KO0B 5C25A 5KFMA 5EDWA 5L1IA 3NKYA 1S0NA 1SH3A 2J6TA 3SFGA 2B5JA 3ISNC 3OHAA 4JV2A 3QO9A 2AGOA 3DI6A 3JSMA 2ASDA 4NRTA 2UVWA 4DL5A 3KNAA 5KFKA 3IS9A 4KKOA 3BSNA 3DOLB 3ISND 4KFBA 5L1KA 2RKIA 1EETA 2YNGB 3CJ4A 2XC9A 1S1TB 4EYHB 1S97A 3ITHA 5EWEA 3C6UB 3KLVA 4DL2A 2IM1A 4ZPCA 3HVTA 4J9SA 3IG1B 4NLQA 1LWFB 3BSAA 5C42B 3LAKA 2WCXA 3KMQA 3QLHB 2VA2A 5FDLB 1HNIA 4MK9A 2O5DA 4RZRA 2ILYA 2UUTA 2W8KA 3H59A 4I2QA 4TY9A 3IN5A 2B6AB 3PJXA 1RT7A 4LSNB 5KFZA 4URGA 5DLGA 3MR2A 3QYYA 2JEJA 4NLVA 5EWGA 4TN2A 4EYIB 4R0EA 1HQUA 2XGPA 3GV5B 3G86A 5HROB 2GIRA 4QWCA 1JLBB 5KFQA 4HYKA 1ZTTA 4F4YA 4G1QA 1QUVA 4H4OB 5F9NA 1BQMB 1FKPB 3GIJA 1RT1A 4I7FA 2XCPA 4MFBB 4K4TA 2W8LA 4NLOA 4FBTA 3I0SB 4FS2A 1S1UB 3NBPA 1JLGB 4ECRA 2JEIA 4XPCA 3KK3A 3D28A 4NLYA 4NLDA 4O3NA 2JEFA 3KLEB 4EBDA 3OL7A 3D5MA 4K4SA 3I0RB 4NLXA 1TL1B 4URQU 2DPIA 4IDKA 2E9TA 4QWDA 1RYRA 1RTJA 4PWDB 3MR6A 1TKXB 1S1VB 3LP0B 2JEGA 2IC3A 4J9RA 4DL6A 4K4VA 1QAIA 3MECA 3Q8QB 2GC8A 3KLFA 5JUMA 1RT6B 3V4IA 5J1EB 4DG1A 2V4RA 1XR7A 3DOKA 3DLGB 3CVKA 1GX5A 4Q8FA 5KT3A 2E9RX 2VG6A 1JLQB 4O4GA 5DGAA 4J9QA 4IG3B 1REVB 2BE2A 1RAJA 3KMSA 1BQNA 1HQEB 3PJWA 4IFYB 5KG0A 5KG6A 4O3OA 3TQ1A 4IG0A 4NLTA 2IJFA 2HWHA 1LWEA 3DM2B 2VA3A 4RNHA 3C6TA 4IR9A 4RW9B 5J2QA 4KV8A 2FJWA 4ZP9A 2IJNA 4Q0BB 4ECVA 1HPZA 4IH7A 5I3UB 4EEYA 3NAHA 5KG7A 4F4WA 1TVRA 4J9KA 2ZKUA 5KG2A 5KG4A 2HNZA 4ZMMA 2ZD1B 4KHMA 3DRRB 3M8PB 3GYNA 1S6PB 3FQKA 3CO9A 5KFRA 2R8KA 3DLKB 5K14A 1S1WA 2ZE2A 1RT4A 1JKHA 4Q45A 2HWIA 3Q8PB 4Y2CA 1VRUA 3FDSA 4NCGB 1FK9A 1SUQB 5HBMA 3CDUA 4JUZA 4O44A 1VRTB 3KJVB 1TP7A 3CJ2A 3CDWA 1DLOB 4YR0A 1S9EA 5F9LA 4ED6A 1T05B 1K1QA 3E01A 4WYWA 5JXSA 3T5HA 4KE5A 2W9BB 4U6PA 4KB7A 3KLHB 1C0UA 4RW4B 3M9OB 4ZPDA 4JV1A 3N6NA 5KG1A 3Q8RB 2AQ4A 3HHKA 3DMJA 3H5XA 2R2SA 4R5PA 5KFAA 5L1LA 4ED0A 1S0OA 1I6JA 2UVUA 2OPSA 3FFIA 5L9XA 2R8HA 4F4XA 5HLFA 4YQWA 1IKWA 1QAJA 4ED1A 3KHRA 3MEEB 5KG3A 1JLFA 1RYSA 1JLCA 3LP2B 2JC1A 4H4MA 5KFWA 4DL3A 1S48A 3DRSB 4FBUA 4ICLA 4Q44A 1IKVA 3BSOA 4EBCA 4LSLA 1FKOA 3DDKA 5KT7A 1S4FA 1TKTB 2HNDB 4RW6B 2GIQA 3PZPA 3DI6B 3JSMB 1R0AB 4WFZA 5KFHA 2V0NA 2XCAA 4IR1A 2WB4A 5KFFA 4ECWA 4ECSA 3HVAA 4FS1A 4NLGA 1T03A 3PR5B 1HMVA 2C2RA 2RKIB 1EETB 5CYQA 3DYAB 4RNMA 4QWBA 4IFVA 1S9GA 1J5OA 3ICLA 3MEDA 4TYAA 1S6QB 3HVTB 5KFPA 2IBKA 5I42B 3H4DA 2D3ZA 1UWBA 4K4WA 1IM4A 1KHVA 3CJ0A 3DRPB 2R2RA 4KO0A 2IA6A 3UQSA 2BR0A 1YVFA 2YKNB 5J2MA 3QIPB 3T19A 1LWCB 2EC0A 4QWEA 4Y3CA 1XR5A 3GIKA 4I2QB 1MU2B 3RB3A 1RDRA 3DOLA 3KHLA 3UPFA 4MKBA 3BGRB 4YMEA 1IKXB 2YNGA 3V6HA 5HP1B 1K1SA 4WFXA 5F8MA 4IQXA 5KFIA 4RU9A 3PVXA 1T94A 4ED2A 4ZVFA 1JIHA 3IGNA 3M9MB 2XI3A 3IG1A 5KFBA 4RUAA 2XGQA 1RT1B 3H4BA 3KHGA 3I5BA 5C42A 3EPIA 1JLEB 3QLHA 3QGIA 3OSNA 4ZVHA 4Q8EA 1T3NA 3BQ0A 3HKWA 1N6QA 5KFGA 5T14A 1N4LA 4RW8B 4URSA 4YP3A 5EUHA 3V81B 5DG8A 5CYMA 1DTTB 2J6UA 2B43A 2B6AA 4I2PB 4PQUA 3N6MA 5J2PA 4QW8A 2FVRA 5KT4A 3Q8SB 3H5YA 1SV5A 2OPPA 4NZ0A 2WHOA 4LQ3A 3BQ2A 3PW2A 3QZ7A 1EP4A 4WYLA 1JLBA 2BANB 5F8LA 3KLGA 4ID5A 3H5SA 2IC3B 5KT6A 1FKPA 4MK8A 3QIDA 2ILZA 4MFBA 3DLEA 5KFNA 3V4IB 4MIAA 3I0SA 3BJYA 4ZPAA 4O3PA 3TAMB 3DOKB 5KFOA 2IMWP 2QV6A 5C24A 3RB4A 1C1BA 2WONB 3H40A 1XR6A 5KFEA 4J9OA 5F8GA 2RDIA 5DLFA 3NAIA 2IAJA 1TKZB 4MIBA 3KLEA 2R2UA 1RTHA 2AX0A 3I0RA 1D1UA 4O4RA 1LW0B 5KT5A 4ED7A 1NNDA 1RTDB 2HMIB 4NLUA 3OLAA 1HARA 1HYSB 5F8HA 2JLEA 4ZHRB 4PWDA 3C6TB 4R8UB 2WOMA 1S1VA 3LP0A 4WE1A 4WXOA 1TV6B 2XWYA 3H98A 2FJVA 1KLMB 3PW5A 3TVKA 4TY8B 1HPZB 2FVSA 4J9NA 4ZPBA 3LP1B 3V6DA 1TVRB 2RF2B 2YNIA 3BREA 4IH5A 4RW7A 1S49A 1QE1B 4ZVGA 5J1EA 5DQHA 3V6JA 3OL6A 2C2EA 1S1XA 1JLQA 1TL3B 2HNYA 2AWZA 1OS5A 2VG5A 4IG3A 3JYTA 1S9FA 1REVA 1HQEA 1RT5A 1IKYB 4MK7A 1RT4B 1JKHB 2OPRB 1RT2B 1N48A 4GC7A 3MR3A 1RTIA 3M9NB 3KK2B 1RT3B 3OL8A 5DG9A 3KK1B 2R8IA 4ECUA 3MTKA 4RW9A 4M95A 3MFHA 1S0MA 2WTFA 4O3RA 1JLAB 3E01B 3QZ8A 5F8NA 5I3UA 4Q0BA 1HNVA 5DGBA 4RNNA 2W7PA 1N5YA 3PW0A 3QGGA 2W9CA 2R8GA 3I5AA 1DTQA 2ZD1A 4K4YA 2BQ3A 3DRRA
chains in the Genus database with same CATH superfamily
3M32B 1LW2A 4JOUA 3FC9A 4B3OB 2CQ0A 2ZH8A 3A12A 2JVRA 1B0PA 2VFRA 2V4QA 1EJ7L 4Y6IA 2V1SA 4EMDA 4DV5J 4DV2F 2YWEA 3ITHB 2NS1B 1S7IA 2GO9A 4ZJQA 4RU2A 4FNIA 1HIYA 3BQ1A 4DF8A 1U8SA 1KQGB 2D69A 5D0EA 3MM6A 7FD1A 1RT7B 3GJRB 3VR1A 1OPZA 4M94A 1KFDA 4CTAB 2B51A 3HCXA 4AUKA 3GV7B 5IT9Y 3HULA 4IKAA 2HEKA 2R7WA 1X9SA 1PSDA 4OZ2A 4D3GA 3H2LA 4PR6A 3NMAA 3ZXWA 5H9FK 2ROEA 4DG1B 1HBMB 3ZTOA 4Q2LA 2FGOA 2QEXS 2RIJA 1TL7A 4I2PA 2VKRA 1LWEB 2R2TA 3GIRA 1B7YB 3V6DB 3NL0A 1S1XB 2HNYB 1T9WA 2L41A 3JYTB 2ZH5A 2W4DA 1V9OA 1LK7A 1M5HA 2DGSA 1G6BA 4NOHA 2CQ2A 1P27B 2AEJA 2XNQA 3JSRA 4J9MA 4DL7A 1BLUA 3GWCA 2OPRA 3QBCA 3RBDA 1XJWB 3M8QB 2HHHF 2XYPB 1S59A 6FDRA 5HMYA 3S7RA 1SC1B 1JJCB 2AJ2A 2E9ZA 3OTOJ 3PW7A 4V19X 4DR5F 1FFWB 3MEDB 2YX4A 3KLIB 2BW2A 1UP1A 4M5NA 1E6YA 5BYSA 2IRYA 1EB0A 5C25A 4X64J 5BR8J 2UVWA 2MY8A 2H3AA 4RPFA 1Q8KA 2KTQA 4HI1A 2ZEJA 3N0VA 3LGNA 4DUZJ 2K1RA 3ISZA 2NLWA 3PJXA 3MR2A 3N4WA 3LOUA 1NZ8A 1D9FA 3G86A 4K4TA 4FBTA 1S79A 3CCRS 1JLGB 4FF3A 2RT3A 1TTHB 2HQDA 2R7RA 1WACA 5ETVA 4OYXA 2J9EA 1UVJA 3WC0A 9ATCB 3EXCX 4E0DA 3ELHA 3K58A 4J9QA 4IG3B 1IQTA 3PEJA 2RQ4A 4TNOA 2GGPB 2NXNA 3CCVS 4MTPA 4PABA 2KO1A 4QIEA 4ECVA 2CNLB 1VS3A 1TELA 2HFSA 2HURA 3VALA 2MGZA 4BWMA 1ZAWA 3CUNA 2PDAA 4QU7A 3NGKA 4Q45A 4X4NA 3W1YC 5HBMA 4MYTA 4ANEA 2OD6A 5J1PA 2LLZA 2L3MA 3NMRA 3QJJA 1MN7A 2HPUA 2R2SA 5HL7Q 2ZZNA 2EPIA 3HDSA 3JS9A 1FEHA 3LP2B 3GONA 1IKVA 2PGCA 3SDEA 2M8DB 2JVOA 1UVKA 2SXLA 2XCAA 2WB4A 3HVAA 3PR5B 5CYQA 5DS7A 2ZH1A 4QU6A 5J2MA 4WK1A 2VQEJ 2CNKB 4QWEA 3CE8A 3VAMA 1IKXB 5HP1B 3US5A 4EWTA 1JIHA 4CLPA 3KHGA 3T1HJ 1JLEB 3AD8C 3HKWA 2XTDA 1U1MA 4HHJA 4RW8B 3HPOA 4P71A 2R7UA 4X66F 4LQ3A 2CJXB 1JLBA 3IR7B 5LJ3Y 4DR4J 1MNEA 3SSQA 2CPGA 4O3PA 1F3VA 2V50A 3DOKB 2RILA 4CZCA 3W3SA 2BBEA 1FXRA 1DRZA 2OFGX 4QBUA 1FRXA 1CEZA 4O0IA 3FSXA 4ED7A 3L7UA 2KFNA 3OLAA 2WOMA 2Q79A 1YBUA 1Y0HA 2C42A 4CO5A 1XMOF 4QOTA 4C3MA 5E3QA 2LXIA 3JTOA 3H42A 3OL6A 3PO5A 1TL3B 1BDTA 3W63A 4ZKAA 4HV0A 3AH6A 2LKZA 1P9QC 5IV3A 4LREA 5DG9A 4ZCMA 4DN9A 4C98A 3E01B 2XHCA 1IWGA 1U1QA 1EIYB 2LVWA 4FS2A 1DTQA 1IWAA 4K4YA 1T02A 1C0TA 3QGHA 5KFXA 4KY3A 5F3ZA 3LAMA 2Q43A 4DFKA 4USVA 2ADLA 1GMVA 3CWJA 3OPKA 5DDPC 1C1CB 4Y65A 2K9IA 4FYXB 3DLJA 4IO9Q 1T03B 3RBZA 1JXEA 4CH0S 3MF5A 4OI6A 1SKSA 2BKOA 2YQ1A 5KG5A 2CJQA 3HK2A 1TKTA 2HNDA 3QSYB 2XTEA 3HJVA 1I94J 1O6XA 5BYRA 2HHUA 1Y3JA 1K47A 1L5UA 1UFLA 2JX2A 3PYDA 2HFVA 2B8PA 4TKTA 1VCTA 3S8SA 2OAUA 5C5JA 2G13A 4GKJF 5CHCB 2VPZB 2YWWA 3AXMA 3V81A 4ITSA 3DXSX 4IG0B 3J7A1 4TXSA 4N7TA 2Y1JA 2BANA 1RXOB 2DNLA 3TAMA 4WIIA 2IY5B 4W92B 3JAMY 3J81j 2HZVA 3SYZA 4BLGA 1S1WB 2ZH9A 1HYSA 3QT5A 1EKRA 2B9WA 4CLYA 5GMEA 2F8MA 2KJVA 1N5YB 1IBLJ 4ECQA 3X1LB 3T1HF 1LFWA 3EPGA 3MD1A 2G2ZA 1KR4A 3CIMA 4NYZA 1HR0F 1DLOA 2BNWA 1WOOA 5A0YA 2VFUA 3Q0AA 4NLWA 5CQGA 3OW2R 4NLPA 2WSFC 4L72B 4RUCA 4G3IA 3J7ZT 4UF4A 2E29A 3ETOA 4QR1A 1JK9B 1VMBA 3UCUP 2FLNA 3ENVA 2JLFA 5L1JA 1YHQS 5D3GA 4X2BA 5L1IA 4YN3B 2J6TA 1S0NA 2WW4A 5GAHU 3PYGA 2B5JA 3ISNC 1M90T 1AFJA 3T3FA 1JJ4A 3ONQA 4HT7A 2GVDB 3H2UB 2DH9A 1ZBTA 3VAKA 2RKIA 3CD5A 1S1TB 1X5OA 2Z30B 1FX4A 2PEHA 4J90A 1HD0A 1W2IA 1WJ9A 3KXDA 2MKHA 4TU8A 5HN0A 1Q8LA 2H51B 4F4YA 2LU2A 2MQPA 4PAAA 2M5YA 4LRFA 3OFGA 4NLDA 3A4TA 3D5MA 2IDLA 5D0HA 2GS8A 4JI3J 4Q2MA 4J9RA 3MECA 2VZ9A 2R7TA 3HHLD 2V4RA 2FLOA 3C19A 4Q8FA 3BZQA 2VD3A 2Z2LA 3FVYA 3PJWA 2XO7A 1RKIA 2DR6A 2AJ1A 2FTRA 1NO8A 8AT1B 3UW1A 3ZZZA 3HHNB 1FERA 5J2QA 4FDFA 2DGXA 2IJNA 4U96A 4OZJA 2HHPA 2OEJA 4ZMMA 3DNCA 4JI2J 1RT4A 5JVHQ 5DZ6A 4C3KA 4NXMF 3D9BA 1UEUA 1M5VC 5D15A 2YWHA 3MM5B 1T05B 3DDIA 4MT1A 3VWSA 3BYRA 4YUDA 4R5PA 2DIVA 5KFAA 5L1LA 3KHRA 1JLCA 3O44A 2JXIA 4F7VA 4FBUA 2DR8A 1NCLA 3KG1A 5H9EK 1R0AB 5HANA 4YY3F 1HMVA 2JRSA 2OEKA 3FEYB 3RAMA 3I6PA 2D3ZA 2XLKA 2VDIA 1KHVA 2R2RA 4KO0A 3UQSA 2ZOGA 2EC0A 4XAKA 1NDPA 2ZHOA 4DFMA 3IG1A 5KFBA 3J81Y 4C4WA 3RJMB 2G1HA 4U95A 5HQ8A 3KG4A 1PGZA 4HH1A 2V2KA 5A6WA 2WHOA 1EX8A 2BJ9A 5HAOA 3H5SA 1UPMB 1F0XA 2F4FA 4X4OA 4X4VA 2Y1LB 4USHA 1GEHA 1FWPA 2DHGA 1U1RA 2ZM6J 1DBDA 2HQCA 3KLEA 1R6YA 1WSRA 4P2SA 1D1UA 4NLUA 5F8HA 2JLEA 3EWGA 2AEFA 4WXOA 3NO7A 2HGLA 3MMCA 2FQQB 3W8PA 2BOPA 1JKHB 2NYIA 4GC7A 2CQHA 1PILA 1FHTA 4DBQA 5AXNA 3UD4P 3P8BB 3UDCA 2BQ3A 3FRZA 3JQKA 3VTIA 5GADU 2L48A 3MEGB 3BR9A 2AZ3A 4J9LA 1OQ3A 2AGQA 1VHFA 1HBUB 1XN9A 4JI3F 2E5HA 2DTJA 2OD4A 4UOHA 3THPA 3THTA 1XTZA 4Y00A 3IRXA 1KQSR 4DSJA 2HG4A 4KHRA 2H4WB 3R5JB 4DSLA 2WZ1A 1R7IA 3RRGA 2ROGA 2UVRA 3SCKE 5I42A 4P73A 2BYCA 2YKNA 2BRKA 3HKZD 4D8JA 3POTB 2AN7A 4ED5A 4CM0A 3BGRA 1JXLA 1ELOA 4HDHA 4I0WA 2LQ5A 2XWXA 4ES3A 1YJ7A 1B99A 3TZWA 3P4UB 3IBWA 2YKOA 2E44A 1DTTA 2JJ4D 2V8DA 1RWMB 1G4CA 4GVBA 2V8GA 2YPZA 4CLSA 1H74A 4RL1A 4GC6A 4KV8B 1IBKJ 3OFEA 4F0HA 2VG5B 1PYSB 1SI9A 8ATCB 4C3LA 1FK9B 6AT1B 2UXDJ 4R8UA 4CLUA 4N77A 3SI8A 5HMZA 1HNVB 2W9AA 4ZPTR 3MCNA 1SBRA 1KVKA 4F0KA 1T9UA 2MZTA 1FO1A 3FEZA 5H9FJ 2VONA 4K4ZA 4XPEA 3GYGA 1OPIA 4DQPA 2EBGA 3GPAA 2CAJA 4OFZA 2MLXA 1A0OB 2DXDA 3OHBA 4HKQA 1R31A 3T5KA 1N0VC 2YNFA 2CDRB 1LNQA 2XY6A 2YH1A 3IS9A 2I6WA 3H0PA 3TX0A 2X7IA 2HIQA 4J9SA 3OR1A 2VPYB 2Z2ZA 2B4OA 1U0SA 2B6AB 3G87A 3U1MA 4U9RA 3M2UA 2N82B 4HHHA 3MWBA 4CLLA 2BJ1A 3OL7A 4NLXA 5HVGA 4M5JA 1TKXB 1QDUB 1YRTA 4B3SJ 1XMBA 3I96A 4B02A 1FJEB 1U02A 5J1EB 1JLQB 4O4GA 1BQNA 1RWNB 4IFYB 3PJ9A 3GZ7A 3VQTA 2C2OB 3HM9A 1K0TA 2DBBA 1EQMA 2Q6BA 3B8HA 4EEYA 1KONA 5KG2A 3C66A 2ZD1B 3HFKA 1KOHA 1XNRJ 4Y2CA 4DI6A 1SUQB 4JUZA 2DNOA 3VAGA 1VISA 2HRUA 1N33F 4OHWA 4PQAA 2W9BB 1IR2A 2CPYA 1TK0A 1RAAB 1IBMJ 4ED0A 2R8HA 1H7XA 4WCEQ 1VBXA 1RWWB 4CO0A 2W2MP 1B0VA 2ZHBA 4ICLA 2C3MA 2IRUA 2GIQA 2HFOA 1YK9A 1IBKF 4WFZA 4E8UA 1U24A 4FS1A 4Z37A 1Y9OA 4DV1J 3CJ0A 2UP1A 2LEAA 3EE3A 2GJFA 1S99A 1T7PA 3UN2A 4F8RA 2B0GA 2GMHA 2IMOA 4FP9A 4WJBA 5T7LB 3IGNA 3QFHA 1TMMA 2QX0A 2DGTA 4Q8EA 2FC9A 2MEWA 3CD0A 4YB1P 4RBTA 4PQUA 2HFZA 3N6MA 3FRYA 2YWKA 2YX7A 1Y4ZB 3PW2A 5F8LA 2VBYA 3GLJA 1Y11A 3V4IB 2DT9A 2K3KA 3H40A 5DLFA 1VQLS 2OIHA 1RTHA 2RE1A 5CAAA 4DR3J 1UZDA 3ZZRA 3KUEA 5JJBA 1HW8A 1RACB 3CXCR 3MCMA 1RT3B 1XBWA 1HWLA 4Q0BA 1MYLA 5ETPA 2PMZD 4QPTA 2DIUA 5M2UA 4X4QA 3R6GB 5LMNF 2DNZA 5D78A 2KM8C 4RBUA 2XI2A 2MQQA 1LKZA 4FN5A 1N52B 1BWVA 1H2UX 2MZRA 3D2WA 4ECTA 2DPJA 1FDNA 2M0GB 3TUPA 4B3SF 2V67A 4KFBB 3T1AA 3VEBA 4K5RA 4JI0F 2HHWA 4IFVB 4CH1A 3JTNA 5IFMA 5FIIA 2X3GA 1GK8A 2XZWA 4MKYA 3G6VA 2LP4A 5THWA 4PXCA 3MPUB 4EI2A 2QLBB 2F4VF 3ZZUA 1XMQJ 2CKWA 3TW0A 1D09B 2CPFA 3G6YA 3NBPB 3T6BA 3TEGA 2LFVA 3I32A 1YBAA 2E5LF 4RNOA 2IHR1 2R8JA 3F56A 3AOBA 1VFJA 2BQRA 2ZUAA 3QMQA 1JX4A 2DR5A 3C14B 2AD9A 3MFIA 3WIVA 2IAJB 4KGMA 2M3DA 2KI2A 1YRUA 1HNWJ 5E7OB 3AQPA 5IOLA 1D9AA 5LXYA 3CCWA 4DV1F 4RWWA 4NI2B 1WC4A 5B09A 1FNMA 4CQ1A 2VPWB 1QAYA 1RT5B 5K14B 1GT8A 2HMIA 2QA1A 1VOMA 5CD4H 5A2QU 1HNXF 4H54A 1YZ7A 1MNTA 4OZ3A 3HP6A 1ZA2B 1RISA 1XNQF 1LW2B 2J8AA 3ZTQA 4DR7J 2QFIA 2AX1A 2RU3A 3VZIA 1RA6A 1RHKB 1RBOB 1MG7A 4RLEA 1Q5YA 2BX6A 3M32A 4IRCA 4ZLLA 1D8YA 4B3OA 1T0TV 4ED4A 3N6LA 2MXYA 2QMWA 2LQJA 1J5EF 3NCPA 3IBCB 2B56A 4NRTA 4KGXB 2VODA 2ZZMA 2J7UA 2MQOA 3ITHA 3EZOA 3Q83A 4DL2A 4YHHJ 2BM1A 3MAAB 1GMWD 2AT1B 1K0VA 4RZRA 2DEJA 4JI7J 3IN5A 5KFZA 1RT7A 3QT6A 2JEJA 1DQ8A 2GHWA 1WG1A 1OSCA 4LF2A 4CTAA 2M7SA 1OY9A 2DNGA 2RRNA 2DCUB 4DLEA 4JI8J 3IWXA 4DZDA 4B9VA 2K5JA 3FKBA 3D28A 1TL7B 3EYZA 4URQU 1VQ6S 3J80U 2DGWA 5D4NA 4USUA 2CJKA 2K2PA 1LV5A 4DG1A 1HBMA 1XR7A 2NSCA 1HQEB 3GCXP 1BWEA 1LWEA 2B8QA 5K5MA 2EFGA 3ZZYA 1C4AA 3CF5Q 4KHMA 2HK3A 1F5AA 3FQKA 4CO3A 4NCGB 1XC9A 5AE3A 1UFWA 3GTYX 4AL7A 2AQ4A 5B0EA 1R89A 2C3OA 1RBLA 2MLZA 4QR0A 2Z0GA 1ACMB 2ZBIA 1S4FA 2EEYA 5KFHA 1KNZA 2WVCA 3DYAB 1KEKA 3MEDA 2DVIA 4DUYJ 2EWHA 3K0JA 3UWTA 2MHEA 2K1RB 2ADBA 4NX9A 1U0HB 3UI3A 3KDNA 5B7WA 2CA9A 1OYDA 3C16B 1VQ8S 2EFPA 1TZ0A 3RB3A 3KHLA 4OI1A 1Q79A 5KOWA 5E2QA 4RUAA 4ZN3A 4ZIVA 1NKCA 4LFAF 4ZVHA 4IOAQ 3VW4A 1RHMB 2B43A 2L9WA 3ZTPA 1CS4A 3BQ2A 5H9EJ 4ID5A 4MK8A 5KFNA 3CCJS 1NPRA 1T11A 2RDIA 4DCOB 1TKZB 2R2UA 1RUSA 3W5XA 4KYZA 1X9MA 3AX5A 1KLMB 2GHPA 4ZPBA 3LP1B 3VGVA 4DV4F 2YNIA 2A2BA 4YHHF 2MGZB 3BBCA 3TX8A 4IG3A 3EUNA 1YDLA 2WVEA 3OQ2A 3Q8YA 1RT2B 3W5YA 2E7XA 4OHXA 3OT9A 2GGPA 4DV0F 4JI7F 1F1BB 2DGVA 3QOQA 4LF7J 1R0BG 3MXHP 2OELA 3DHWC 2RDJA 4K2XA 3MUMP 3IO1A 1B28A 2I5JB 3R5GA 1IKVB 4LRDA 4ZLJA 3SDEB 2OFHX 4YDXA 3QO9B 2JHEA 5CZVA 3AY0A 4OHVA 3LP2A 3D6MB 5BJRA 4ED8A 1X4AA 5J2MB 4LF4F 4AFFA 4L6V3 4MJWA 5IT0A 3IR6B 1X5PA 4TQSA 1IVZA 4M5IA 3TJ8A 1LWFA 1F3FA 1X9WA 1VQKS 1ZAVA 3UO0A 2XHWA 1U45A 4P10A 1NSQA 1GXLA 1IKXA 1UL3A 5KFTA 2ASLA 5HP1A 2FY1A 3PIPQ 1TFWA 1QD1A 5HROA 5KTQA 3S1TA 2MPUA 4YB5A 4BDPA 1JLEA 2FJDB 4OHYA 2DKOB 4RW8A 2AU0A 4WZMA 3W60A 1JMTA 1TL1A 3VVTA 1WC0A 4DL4A 2WOMB 3IRWP 1X31C 1U6ZA 1RT6A 3I31A 3TARA 3NCRA 1V3SA 4DUYF 1NKBA 4ZN1A 5A8KA 1KVIA 1MW7A 1KTQA 3L7OA 4W98A 2Y1IA 3E2EA 1UVNA 1LQ9A 3RAQA 2DHXA 1DTQB 3NXZA 1HBNA 1TL3A 1C0TB 3EVWA 2V5HG 1WEXA 2L9NA 1VBYA 4TYBA 4J9PA 4ECZA 2ZITA 4H4MB 5KFCA 2DR9A 2XS2A 5A8RB 4Y2AA 4P2XA 5GMKa 4OI3A 3TAQA 1J5OB 5M2PA 4C6AA 3CDBA 3D1OA 4NMXA 1C1CA 2CXEA 3AJ2A 1WDTA 4C8YA 3BSAA 2MZQA 1B01A 4MK9A 2O5DA 5IXUA 2E1MC 4OX9J 2W8KA 3H59A 1M1HA 2Y8WA 1S12A 1CQMA 2CPIA 2RSQA 2GIRA 4LF7F 3K5OA 1ZTTA 1XEZA 1UVIA 1UUJA 3GIJA 2XCPA 3SXLA 3I0SB 3RR7A 2Z56B 1IXKA 3PTWA 2CFXA 2ZBPA 3AJDA 1S1VB 3LP0B 2R7SA 1QAIA 3V5RA 2U2FA 3MCOA 5DGAA 1WHWA 3FEXB 3R6LB 4X4SA 4IG0A 4NLTA 1TK8A 4PG6A 5CABA 3SQOP 3HHDA 2FJWA 3BO2A 4UW2A 5I3UB 4F4WA 2HVHA 4AD6A 3FZ2A 1S1WA 3DLBA 1KS2A 4ANDA 4CM2A 3CJ2A 1DLOB 3BH7B 5A0YB 4B9TA 3N5BA 3F41A 3CC4S 1H73A 4ZPDA 2E1AA 4C97A 4B3RJ 4F4XA 3VV2B 3ZNUA 4LJMA 5KFWA 2MZ1A 1FI4A 2QIFA 2HSEB 4CYUA 3PZPA 2C2RA 1S5ZA 2RKIB 3J7YI 3H25A 3R9LA 2VPXB 4USKA 3K5NA 3H4DA 2W01A 1YVFA 3I55S 2X1AA 4N8NA 2HHQA 2GVDA 1MU2B 1FT8A 3D54A 1VRQC 4PG7A 5LL6d 1B70B 2XMUA 4LF9J 3HFZB 5K8NA 2H48B 3Q23A 3GJQB 3AAWB 2XG8A 3R7SB 2FVRA 2D3OR 4QIWD 1NLAA 1FJGF 3T41A 2DNRA 3DLEA 1VC0A 2XEXA 4X65J 5C24A 2F3JA 4DV3F 4FF2A 2MHNA 4L76A 4FXDA 2XSFA 2F40A 3IP0A 4HTIA 1N32F 4O4RA 4WIQA 4LF5F 1NNDA 3BH6B 2HFNA 3QGPA 4WE1A 3H98A 5BYQA 3PW5A 2FVSA 3RZAA 2JXHA 3K8WA 1RT4B 2O67A 2VKZG 1U47A 3L7PA 3QZ8A 2DH7A 2YKPA 2NXEA 4USIA 2D1CA 4JBCA 3FQLA 4QPXA 1JLCB 2ASJA 3TUJC 2FLPA 2DHAA 2UVVA 1QLNA 4PUOA 3T1YJ 4PRFA 1HMVB 3BGUA 1VK8A 1AUDA 3CDEA 2CZ4A 2APOA 1R3NA 4OV1A 4JP8A 1TUGB 1R0AA 4JV0A 4JI6F 1WHYA 4JI1F 3KOAA 2A18A 2KKEA 1CULB 4OZLA 2U1AA 4YR3A 3JSBA 1VK3A 2HYIB 2AKWB 1YJTA 4FXVA 4H4OA 1BQMA 3KWMA 4LQ9A 2M4MA 4WFAQ 5EGYA 3WX4A 3AX2A 4JI4F 2VG6B 2BE2B 5LSLA 3UD3P 2MQNA 4X62F 2G4BA 1UCNA 4O3SA 3N79A 3E8OA 2QA4S 4ZVOB 1KQFB 2QMUB 1TQLA 3SV3A 4IOBA 3MMCB 2FVPA 4WFYA 2K3IA 4FKXA 3NWRA 1OY6A 2M88A 1X4FA 3CCES 4A47A 5DM7Q 2MZSA 2CQ3A 4HH0A 4BBYA 3RB0A 1SC4B 2CPDA 2HBQB 4CNYA 1PIEA 2GQ2A 2B3TB 2Z8QA 2UV8A 5ETSA 4R0JA 2NXJA 4JI5J 2MKIA 2GZOA 2Q1LA 4A48A 4KQZA 4ED3A 1RHRB 3MR5A 4NRUA 3Q2SC 2GAGC 1M5PC 4F02A 1WNEA 4AE5A 1OWXA 2FJXA 3MEGA 3IRXB 3KHHA 1DQ9A 4F25A 1VBKA 5AXKA 5B08A 1N34J 1HBUA 3CJ8A 1V3ZA 1F9HA 3LGMA 4HVZA 2ASDA 1PKUA 1Z1ZA 5KFKA 2J0WA 1FCAA 4EYHB 1QSSA 4CLFA 4A8WA 1IR0A 2QO3A 5SUHA 3RR8A 3C3LA 3SCIE 3WDOA 4AQYF 5K20B 5IZHA 4NLVA 2DRBA 5KFQA 2MZJA 3Q86A 3BBFA 2KZMA 4MFBB 1NJIT 1CJKB 2AMCB 2EFVA 4K4SA 5LXRA 4NA3A 5D0RA 1WC1A 4CLWA 4QWDA 3MR6A 2EKNA 2CJAA 3PEHA 4Y0FA 5CH7B 4DSIA 2CNNB 3HD2A 1GTHA 3TQ1A 4IR9A 4KV8A 2V94A 1NJYA 4IH7A 1F5CA 3MMAA 3S01A 2ACMA 3DRRB 1SJRA 3CO9A 4K59A 2HVEA 3Q8PB 1IRQA 2HVDA 1FK9A 4K0KJ 1R6VA 3FBBA 1T3OA 1TP7A 3OVSA 5F0UA 1Q0NA 4GRSA 4ZPWR 1OQ6A 3DMJA 2YX1A 1IKWA 5DDQC 3IM8A 1RYSA 3EGWB 1RWVB 4EBCA 4XK8C 1RB0A 2G2OA 5KFPA 2B9EA 1F2HA 1X4EA 2LA6A 1TFYA 1DQAA 2AEMA 4QJVA 3J7AN 4YB6A 2F1FA 5G4DA 3SZ2A 3JQMA 5KFIA 4RU9A 1NUEA 3M2UB 4ZPVR 5IC4B 2W2OP 1N6QA 2GQQA 2DY9A 3P45B 4OYMA 3O1LA 2B6AA 4DR1J 2W24A 3PRDA 4LRBA 2OPPA 2UU9F 4L73A 5LSRA 2HS0A 3D6HB 3FBFA 3BJYA 2J8SA 4J9OA 5CCMA 4CLZA 2AX0A 3N9UC 4P9SA 1HBOA 2W2PP 4TY8B 2NPFA 5J1EA 1JLQA 3AA8A 4F3QA 3D6TB 4F0MA 5HVFA 1SC6A 5IM0B 1UW4A 4I6AA 2UUAJ 2BOAA 5CCLA 3OXLA 4WF9Q 2ZD1A 2Z2YB 4J9UE 3CMQA 1QTMA 2ATCB 1HW9A 3R7BB 1SUQA 1S57A 2VL1A 4U7UD 3AT1B 3TJ9A 3G9CA 3F0NA 4ICLB 4TLRA 4UUXA 2W9BA 2KVIA 3T9ZA 4QWAA 1RJJA 1KVJA 4TQRA 4KKOB 2R42A 1YQHA 2HRTA 3V6KA 1CVJA 1U25A 3SQGB 1RWPB 3KUGA 5U47A 4NLSA 4WP9A 3GU0A 1HNIB 2VC0A 4P75A 1RHQB 1ZPWX 2P6SA 3CO0P 1WC6A 2CQ1A 2AV5A 3C15B 1WG4A 3A13A 3GILA 3DHXA 2CWXA 4K0KF 2CIMA 5FDLA 4DSFA 2V69A 1TUVA 1Y5IB 4IRKA 4PQUB 2PC6A 1SL2A 4WXWA 4IDKB 2RUGA 4ZP6A 2O3DA 5T7LA 4TU7A 3TRGA 2W7OA 1QSYA 1YJRA 3A8IA 2BNZA 3KKFA 2EFQA 1RTHB 2BRLA 2F5GA 2YY3A 3HD1A 3J80Y 1FFGB 1N36J 1FXDA 2F8EX 1FRKA 1NPPA 2A6MA 2QL5B 3TQEA 2CQBA 1VRUB 1MWQA 3D0HE 4OZNA 1X4GA 3R3TA 2M70A 2DY1A 4DS5A 3I9ZA 2FD2A 5IQ6A 1RAIB 2I9SA 3CJ3A 2GAHC 2IM0A 4JV5F 4WKRA 1RT3A 2ZC4A 1VRTA 1B7FA 2W4PA 1IJFB 3OLBA 4PZVA 3G6XA 1LXNA 1N5QA 2RNEA 4RUHA 1O51A 3HHLB 2ACYA 2E5JA 1AUSL 4F36A 4KFBA 4B9NA 4B08A 2OI2A 4BCAA 2ZJQQ 3B54A 2J9CA 2NUHA 3CDAA 4DV7F 4DOZA 1SKUB 4R0EA 2K1OA 1U6BA 2GA7A 2VQFF 2ZKTA 4QWCA 4CLTA 2QGFB 3D7SB 2GNKA 1RAOA 1P9YA 2V2QA 3BF4A 3NBPA 4XPCA 1U26A 2QZ8A 1KOOA 5K8PA 3I0RB 3W2WA 2KM8B 2N3LA 2WSEC 2FHJD 3MR7A 2MYFA 3C14A 1EQ0A 2F9JA 1KD1T 1DY3A 3TVZA 1REVB 3FGVA 4LR9A 3MTJA 4DN0A 4CT9A 3A8KA 4DX8H 4NI2A 2PMWA 2ZDPA 3GJSB 5K14A 3EICA 4LF6F 4OV6A 7AT1B 1X8DA 5JXSA 1Q16B 2VHGA 3AA9A 3HHKA 3CEDA 3QAEA 1S0OA 1QAJA 1VLOA 4C8NA 4CI0B 3DRSB 3PYEA 2O66A 2C1EB 2XY5A 1T9TA 2W25A 1RK8A 4IR1A 1BXNA 4XDCA 4RNMA 4QWBA 2VIHA 4U7UK 3H2VE 2OTJS 4QIFA 1VIOA 1IM4A 5FD1A 3N01A 1L3KA 2BACA 3UPFA 1X4HA 2DGQA 3V6HA 1M5SA 1M5KC 1NH8A 1AZSB 2XGQA 3MAAA 3CCLS 2RRBA 2KU7A 1CJUA 5T14A 5EUHA 3K57A 5KT4A 2XMMA 4UOFA 2UXCJ 3ENQA 1SCJB 2CQ4A 4F2SA 1NSKL 5JMNA 1VQYA 4M5GA 4ME7E 2FPHX 1HI0P 1HA1A 4NWBA 4U67Q 3TNVA 4WFBQ 2ZOMA 2RF2B 4LUBA 3KJQB 1HQEA 4OYIA 4FXWA 1RTIA 3PY8A 4LBHA 4M95A 5F8NA 3CB4A 3I4PA 5AT1B 3QGGA 4DJBA 5SZTA 2LA4A 4UTGA 4BHQA 4ZDNA 1BY9A 5AJ3J 3CJTA 4KPCA 4NCGA 3BO4A 2HQIA 1SQGA 5IT4A 5KFUA 4EO6A 2YVSA 3ZTRA 4ZCIA 1SL1A 5CZXA 2ZH6A 2QLJB 3OTEA 4C7QA 4ECXA 4DFPA 2YKMA 5J2NA 2VG7A 2UXBJ 2H4YB 1KHWA 2R7VA 1SH0A 2XB2D 1H2TZ 1X0FA 4IO1A 4NL5A 4LF8F 3DYAA 2AGPA 4MKAA 4ZCKA 1X5SA 1L3SA 1U0HA 3KK3B 3C16A 4USMA 4QCLA 2XMTA 5GVQA 3NGSA 1CS4B 4ID5B 1KC8T 4DEZA 4G6VB 3M8SA 1NK0A 2HHVA 4M5KA 2YQ0A 2RHQB 3OXGA 3H7HB 4DV5F 3GQCA 4RJVA 4EO8A 3CT9A 3HZEA 5F8IA 2DNPA 3KJFB 1CC7A 1YITS 2UUBJ 2YNIB 1MN9A 2AYEA 1SXLA 2DYAA 1BQXA 1TKZA 2DO4A 5C2CA 2EXUA 5LMUJ 2OH2A 3TP2A 1KLMA 1S9EB 2W1BA 3LP1A 2H65B 5HI7A 4DQSA 2PI4A 1RU2A 2EFOA 1A9NB 1U7LA 3FFIB 1RT2A 4C8MA 3ZFVA 1OO0B 3L95X 3B4MA 5IC6B 1SIWB 3KLHA 2UXCF 2ZH2A 1ZAXA 3I56S 1FDAA 1NHUA 4A8YA 2IPOB 2I5JA 3TJAA 3W9JA 3QO9A 3KNAA 3M8RA 4ZPCA 4PG5A 1LWFB 2MKSA 2VA2A 2PFDA 1K9MT 5A8WB 4OMFG 3JXOA 4Y2KA 2BABA 5HROB 1Q78A 6FD1A 2XS5A 1QUVA 4CDIA 3RUBL 1YTYA 3PYFA 5AJ3F 4EZ9A 4QYZK 3OFHA 4ZVPB 4FYYB 1TL1B 1VLYA 3OTOF 2JEGA 4LRVA 2G1DA 2PE8A 2DNHA 1RT6B 1U1KA 1Z2LA 2FDNA 5A8KB 4DL0C 2FHOB 1HWUA 4X64F 4O3OA 2CAXA 2YQ3A 5BR8F 3TOQA 5LM7E 2LQBA 2ZJPQ 4KGVB 2LQ9A 2J7WA 2CVIA 1HBNB 1KN6A 2F65A 3M8PB 4DUZF 1HWJA 4DR6J 3ET6B 4Z2XA 2B4VA 4DF4A 3CDUA 3OTDA 4EUVA 5F9LA 3LPEA 1FD8A 4U6PA 1SJ3P 2WBMA 1GXUA 4KJIA 2RBFA 5K8OA 5E5NA 4DCJB 1FNXH 3CD7A 1NSAA 4YQWA 4KHPJ 3D1QA 2BW7A 1S6OA 5T41A 4H4MA 4DPXA 3R5DA 1NZAA 5A8RA 2CG8A 1R43A 5KFFA 1B4SA 4PXEA 2BVZA 4RX6A 1J5OA 3FMWA 1VC5A 3BKTA 1UWBA 3HVRA 4K4WA 3DRPB 2OP5A 2GJ2A 3LF0A 3Q2TC 2D9OA 2FIUA 2HRYA 4PWWA 4OLOA 1FNOA 4WFXA 1VR6A 2KXHA 3ADAC 3M8ZA 3I5BA 3TO8A 5KFGA 2BV3A 4C2MA 5DG8A 3CCZA 5J2PA 2LMIA 1O5JA 4NZ0A 1WF0A 2LXFA 2ZWOA 3NWGA 1NJXA 3I0SA 1SC3B 5KFOA 1FJ7A 2NYHA 3MPVA 4UQTA 3CJRA 3PHTA 4OQJA 5KT5A 3DC2A 3GFXA 1S1VA 3LP0A 3TVKA 1GMUA 4C8ZA 8RUCA 5FJ4A 3EDQB 5F41A 1WEZA 3BKUA 1N5TA 2UZAA 2AYBA 1PC4A 1VQPS 4B3MJ 2VQEF 2JH3A 4O23A 3KK2B 1V5IB 3CMES 2Y8YA 2R8IA 4LMZA 3BM7A 4L74A 1ARRA 5I3UA 2W7PA 2VFSA 4EFAC 4J7CA 3MD3A 3TAPA 2P6TA 5LT5A 3F73A 1ZA1B 1NEEA 1Q8IA 2OGUA 1HI1A 4XDDA 2LYVA 4CYUB 2F7VA 4DR4F 4XO0A 2YPYA 2B4UA 3GV8B 2XS7A 2E7VA 1DARA 1W7WA 5E3AA 4K5SA 3WX8A 1VQ4S 4DX7A 3CCTA 3G71S 2GV1A 2OHDA 3RW6A 2VJVA 2XZ2A 2CRLA 4I7FB 1Y3KA 2JFKA 1U9PA 2EBEA 2C2DA 3NGDA 2RU9A 2KHDA 1MU2A 3PNIA 3CJKA 1B64A 2FLLA 3UVJA 1ZM2A 1FRIA 3ILLA 2DRAA 4DU7A 1UA1A 3T6JA 3DLEB 1ULRA 4F04B 2J6SA 5C24B 2UUWA 2G0JA 3LANA 1RCXB 4H4KC 4WE1B 2JLGA 2E7WA 4ZP7A 2C3PA 4K4UA 3DLGA 3MM9B 1AB8A 4RBVA 2HNZB 1RKJA 3LTOA 1P8GA 3DM2A 3EMTA 1NDKA 4C8KA 3VVUA 2E5GA 1I94F 4CH7A 1SQFA 2XM3A 4I68A 4ID8A 2JOQA 2OPSB 3VEAA 1RAHB 3M6WA 2FB0A 1JLFB 4EGLA 3E51A 3HJFA 2XY7A 1LEOA 1FKOB 3M4XA 4PUOB 2IM2A 1WF2A 4OI0A 3BSCA 4RNFA 3R5CA 3CJ5A 1CPZA 3KG0A 4I6YA 1RBAA 2ZH4A 4HT5A 3H5UA 1SH3A 3SFGA 2PN6A 1JJ2R 4GVLA 2KOEA 3A1YG 4DL5A 2G9OA 1OM2A 5DZ7A 3G96A 5GAEI 4PWUA 5KOXA 2HZAA 1S97A 2XMVA 3KLVA 4Y2MA 3W9HA 4MAKA 1MROB 5IWAJ 2QC3A 3MAQA 4OX7A 1IBLF 5IV4A 3TR5A 1WWHA 3V4MA 1AROP 3OR2B 5F9NA 4H4OB 1BQMB 1CULA 2W8LA 1TK5A 3WZ0A 4DDFA 2HQFA 4EBDA 2FJBB 4NE9C 4UY85 2HHXA 3Q8QB 1WC3A 3VGSA 2XLIA 1F5BA 3CVKA 1UJ4A 3VZHA 2VG6A 2BE2A 1RAJA 1QY7A 1BE4A 2XYHB 3UN5A 1JQGA 3BPSP 1T9YA 3NAHA 4LFBJ 4KT0C 1HNZJ 1KTVA 4QYRA 2HGNA 5CD4A 1X0PA 1UJ5A 2I2YA 4ED6A 3SSSA 4R25A 4KE5A 4CP5A 3VAFA 4F3OA 2BXJA 2RHSB 3NNCA 3MUVP 4Z7CA 3MEEB 5KG3A 1DAXA 2OMLA 3MPWA 3K8VA 3RRHA 4A8SA 2PEBA 1RI7A 4NCAA 4RO0A 4CWBA 3GXQA 1X4CA 1G1XA 3BR8A 1WEYA 1YI2S 3T19A 5ETOA 1PO6A 3QAUA 4Y3CA 3B6BA 5ETTA 3M8WA 1XK8A 2Z2MA 4JI2F 4MMOA 3BS9A 4PEOA 4ZVQB 3W65A 4LRAA 2Q66A 3PXGa 1UMJA 4YP3A 7FDRA 2P9GA 3AODA 1AA1B 4ZLNA 3Q8UA 2FJEB 3FK4A 1SV5A 3KLGA 1FEEA 4DV2J 2W4CA 4MFBA 1V5VA 3FJ2A 4C8LA 1CG2A 2MKYA 1CJKA 3PACA 2K8GA 2DHHA 1C1BA 2WONB 3F44A 2ROPA 1WUUA 1LW0B 2KZZA 1M1GA 2QRRA 1PAUB 3AOCA 4ZHRB 3GJTB 3V2UC 1HLWA 1OG7A 1XIQA 2DXEA 4QR2A 2EG1A 4ELVA 3I9V9 1S49A 1QE1B 3NCQA 3MMAB 3BGLA 2QL7B 1S77D 1Q7LB 5IWAF 4MK7A 1C4CA 1NDCA 2PD1A 3M9NB 3HI9A 4ECUA 1RZMA 3K5MA 2WTFA 2KXNB 1I1GA 4J91A 3PW0A 2BJDA 3ENWA 3MPYA 3DRRA 3HT0A 2DITA 5M2RA 3DMJB 1VGYA 4KTQA 1IKWB 2XMWA 1U09A 4NYPA 1HHTP 4DQRA 3DOMA 3GIMA 2R7XA 3GG1A 3CJSA 2B7CB 3CCMS 3BKFA 3K89A 2ZM6F 5KFJA 1QTNB 3OVAA 5DDOC 3RU0A 3EZUA 4USTA 3W2VA 1CSJA 2GO8A 3GYXB 4FPRA 3JSYA 1WG5A 1P1LA 3R1HA 1TAUA 4ZA1A 4K7QA 1HKAA 3Q22A 1W26A 2QTWA 4DCPB 1N6QB 1Q1KA 3EM1A 2X1GA 2HHHJ 2K7JA 3R27A 1VQ9S 2OPPB 4U8VA 1RTJB 1KWMA 3ILJA 3QJLA 2Y3YA 1N56A 2RH3A 3R7NB 5DETA 4DR5J 4KBIA 2G0IA 5KFDA 1LWXA 2HLUA 4N8OA 3NOCA 4NZ7A 1NKEA 1HBOB 2HIYA 2PIIA 3PRBA 3NNAA 1NH7A 5F0WA 1W25A 2ZE2B 3D68A 2KFZA 3TZYA 2HQGA 2FVQA 3W8GA 1NK6A 3ENAA 3P6YC 1TL4A 4YB7A 1SIZA 1U2FA 4TY8A 3AB2B 3LO3A 3PRVA 2RMLA 4QIGA 4K4XA 2DH8A 5I3PA 5IM0A 3TEHB 1JXVA 1EARA 2V9KA 4CNZA 3R2CJ 4HL9A 1S9GB 3Q8VA 4XIUA 3VQSA 5GAGI 3QFWA 4OYWA 3MI7X 2JSXA 5IS2A 3NS5A 2YWGA 2NZ4A 2KHCA 1LXJA 3FSYA 4KKOA 3ISND 3SQGA 2L08A 3FBEA 3SSRA 4NLQA 3TZZA 3LAKA 1OYEA 2KT2A 5FDLB 1HNIA 2UXDF 3D0GE 1FWLA 4B9MA 3CC7S 3MPDA 5DLGA 3TYTA 1RAFB 3QYYA 2PFFB 3C15A 2HZCA 1Q82T 1ZPVA 3DFEA 3J7YU 3ILOA 2O01C 1RT1A 2YXLA 3CW2C 3JTPA 1FRJA 2W7AA 1JJHA 1SL0A 2VBWA 5HVHA 4LF1A 4IDKA 2KVQE 1PJ6A 3HHLC 2IC3A 2BE9B 3SCJE 4ZJOA 3VGUA 2A2CA 1YJNS 2BKNA 3EX7B 4CIOA 1FD2A 3IR5B 4X4UA 3GR1A 4ZP9A 1HQ2A 4I56A 3O6QA 5CA5A 4AL5A 5ETMA 4ZIWA 2MB0B 4QYZJ 1VRUA 2VFVA 2KFYA 2E1PA 4FF4A 2BDPA 1VRTB 4YR0A 2F8HA 3SEOA 4PYDA 2E5IA 4X66J 3D4JA 3H90A 3N6NA 5KG1A 4UQGA 5ETQA 2D3O1 4IUFA 1QSLA 2Z4PA 3BSOA 4LSLA 3W62A 4RW6B 2V4JA 1PC5A 1S7HA 1S76D 3PM9A 4DSKA 2CJYB 2WB1D 2AJ4A 1XMOJ 1Q7YT 1S6QB 1ZOTA 3HHLA 4ZITA 1Y00A 3GIKA 2POKA 3P3DA 4C9DA 5F8MA 1XNRF 4Q5VA 4OJGA 2R3VA 1X60A 4DWIA 1L3VA 3I4HX 2XSJB 2BA9A 2ZNYA 3W2WB 4TLQA 2DNMA 1EP4A 4PXDA 1IBMF 1ZS6A 2ZH3A 4UUWA 3BEGB 2MKJA 5I3QA 3K17A 4FVMA 3I0RA 1DURA 3OUYA 3U1LA 3UNGC 1RTDB 3TVYA 2A1BA 1H2VZ 4J9NA 2JZ5A 3BREA 4RW7A 2RJZA 3VGTA 4M5MA 1URNA 1REVA 1Q8BA 1Y7PA 3FCHA 2DB1A 3NNHA 3UFCX 5DM6Q 1W2BR 3ZZPA 3DU6A 1H0HB 4HR2A 4GKJJ 3PX0A 1IN0A 3HF5A 1OY8A 2VU5A 2NREA 5B0FA 1LFPA 1Q16A 5F8JA 3TA0A 2IVFB 4B17A 4MH8A 4G1PA 3RB6A 2CQDA 1R8PA 3RTVA 1G3OA 4B9SA 1B0TA 3DRSA 2JFDA 1N5SA 1G7CB 4LSZB 3D66A 4DR3F 4KAIA 2ABYA 3M05A 1ROFA 1KBRA 1WI8A 1D9DA 3PW4A 2X1BA 4EBEA 4HLBA 1FF2A 3BYPA 1CJUB 3DDNA 3GB0A 3FSIA 2AZ1A 2V68A 3M2RA 1HR0J 4OX8A 2CQPA 4KRWA 2ATLA 4Y2IA 3HVWA 4C0BA 1AZSA 3KLFB 1BGXT 1AT1B 2V9WA 1S1UA 1REGX 4QIVA 2DEIA 1YJ9S 5DQIA 1WTBA 4LVNP 4F50A 3HHEA 4FYDA 2E1RA 3X3UA 1TUWA 1VIXA 1NM2A 5J1NA 4C11A 4S0MA 3DXBA 4AAIA 2LDIA 1RTIB 2WBRA 3A3NB 1GNKA 3PKMA 2J0QD 2N7CA 2GPEA 2RF2A 3DU5A 1XMQF 2DXFA 2AIRB 2HBYB 1R8AA 3DLKA 2EKYA 3DRYA 1ZZFA 4PG8A 4DFJA 4NPOA 1GX6A 4RW4A 1U1PA 3A8JA 2PMHA 2VBZA 4ECYA 2YKMB 5J2NB 1F9EB 1X4BA 2VG7B 2AJFE 4KPYA 1HNWF 3LW5C 1S4EA 1FJCA 3QNWB 2PA8D 4BWJA 5EWEA 1PBAA 1PYOB 4DS4A 2LDYA 2UV8G 2YKAA 2IYIA 5C42B 4FZVA 2BJEA 2JXGA 3QLHB 2D68A 2P9EA 4NXMJ 2KXFA 2VBXA 2C2NA 3MM7A 3SCLE 2ZOFA 5EWGA 3OJUA 1PBUA 4DR7F 4NLOA 3BDEA 3BPDA 3AQOA 3KK3A 4NLYA 1NBEB 4GO5X 4I6WA 2FC8A 1QVFR 2P9CA 3MURP 4YY3J 3RYLA 3QT7A 1FVSA 3ZC4A 2V2ZA 1O0PA 3KMSA 1PAEX 4OI2A 3FMTA 2OSQA 4RW9B 1UTAA 4MYUA 1BUXA 2RRAA 2ZKUA 2KL8A 1S6PB 3NEKA 1Q95G 2HWIA 1BMQB 1CLFA 4ER8A 1NK7A 1S9EA 1U48A 4WYWA 3RW7A 1GQEA 3KLHB 3CTRA 4JV1A 4JI8F 3FFIA 5L9XA 5ETLA 1RABB 1YSJA 2KN4A 3K2YA 2Y1RI 2RQMA 2J7KA 1SIWA 4F2RA 4ECSA 2V34A 4NLGA 3ZZ0A 2PA3A 1NAQA 5B0DA 4NXNJ 3PX4A 3QATA 3AXKA 3ILIA 1UAWA 2VV5A 4FPIA 3NGUA 1LWCB 1EAYC 4NA1A 3EXYA 3LWMA 2N4DA 4YMEA 4IQXA 3PVXA 1P6TA 1VYAA 4OIXA 1MWYA 1T3NA 1YZ6A 4OYAA 5I4MA 3GSIA 2H9ZA 3C2PA 3PKYA 2XBPA 5A8WA 3H5YA 2V8PA 1UETA 4UOCA 1Q53A 1WELA 2RB7A 5E3RA 1D8ZA 5ADZA 2DNQA 4MIAA 3MGJA 2XULA 2QG9B 4CO1A 2EK1A 2DRDA 2XWYA 3AOAA 5GMDA 4KGKA 3DGPB 2JEIA 4IH5A 3G8TA 4F67A 1IKYB 4ZVSB 2AF6A 2DCLA 3KK1B 1AFIA 1K73T 1JLAB 3BO3A 4P7TA 3EVMA 5L46A 1RU1A 3M8PA 1U2RA 3ET6A 4WP8A 3ZTSA 1UVLA 1CJTB 1FX2A 4LFCJ 1NHVA 1MMLA 2JWNA 1YBTA 2ZC3A 2IM3A 4N76A 2BJ3A 3M6UA 3MM8B 2YH0A 1T9VA 3KUHA 3B4DA 3QT8A 1VQOS 4YR2A 1UWBB 2BJ7A 2YNHA 5HK4A 2Z57B 2RD5C 1D0EA 4HHUA 3NNEA 3MHYA 2L9DA 3VAIA 2K6LA 3C6UA 2KT3A 1I51B 2ZNZA 3DRPA 2RVJA 3TUZC 3GP9A 2NQPA 2LQ8A 2D3UA 4K2JA 5KFSA 4LSNA 3ZZOA 5J2PB 3NGRA 3NG8A 3HSJA 3G8QA 2CPEA 1RWXB 2N7YA 4MKVA 3UDLA 1WTFA 2MKKA 5EWFA 1YJUA 1IBCB 1SPBP 1BDVA 2D7SA 4NYOA 2XTCA 1RCOB 4ELUA 5CXTA 2A3JA 2AHOB 4OLPA 4LVOP 3D6FB 1FE4A 4NXNF 5D4OA 2CQGA 4RWXA 3UR0A 1UZHA 1YX2A 2QMXA 1ZZNA 2D41A 1PYTA 4DMZA 5AXLA 1C0UB 1OMSA 2GCFA 4A46A 3UCGA 1KLNA 4ZS6A 3PO4A 4P74A 5HLFB 2FGCA 3KK2A 3M1VB 1G2EA 5B0CA 4C0OC 5HJYA 3KJVA 1BD6A 2FHKA 3RBEA 3W5ZA 1SJFA 1AW0A 3FCVA 1IQZA 2BJ8A 2WSCC 3U27A 2AJ0A 5KFMA 1H6KX 3OHAA 3FZBA 4A8XA 5L38A 3DI6A 3O2IA 3BSNA 3DOLB 4YOEA 2XC9A 4NCBA 2YTCA 2XLJA 1EA4A 3HVTA 1QUPA 1NK9A 3WQPA 4LBIA 3GCWP 1SQEA 4I2QA 4TY9A 3CJKB 3UVJB 1N33J 3G2XA 2V8HA 2ZH7A 1FKPB 4I7FA 3FCWA 2ZZTA 3H8YA 4ECRA 5E33A 4LFCF 4FYWB 1FA0A 2IBOA 4RR5A 4DPOA 4O3NA 3MOJB 1OIAA 1IUJA 2E9TA 3R97A 4PWDB 1PARA 3JB9k 1SJ1A 2PSZA 1X93A 3DLGB 1GX5A 5KT3A 4I1TA 2VOOA 2NZCA 1FDBA 3TWZA 3MEKA 4OJ3A 2IJFA 2HWHA 3DM2B 2GJIA 3AB4B 4ENOA 1Y5NB 2ZJRQ 1VHIA 5A76A 1HPZA 1GAOA 1I5OB 3AJ1A 4UZCA 3TA2A 3MM9A 2HNZA 2AYGA 2VUGA 2D9PA 1S0VA 2DISA 5JVGQ 4HACB 4W4MA 2HBRB 3UDVA 2QT7A 1GMWA 4CLKA 4OX9F 3IFEA 1OSDA 5B0AA 3R5BA 5ETKA 4F26A 4KB7A 2V6AA 1UWAA 3G82A 3M9OB 3KFWX 1MYKA 4E98A 2HK2A 4U8YA 1I6JA 2OPSA 3QRPA 1KFSA 4A4JA 1JLFA 2CDQA 4KGZB 2GVZB 2QFJA 1UKUA 3CC2S 1E6VA 4Q44A 4DR2J 2DJWA 4HEA9 1FKOA 3DDKA 2IFXA 2I8EA 3BB5A 4DUTA 4ECWA 4DQIA 2KKHA 4OJHA 2IBKA 2GW8A 2ZUGA 2IA6A 2AP6A 2M2BA 3LUYA 1YGYA 3QIPB 1WI6A 9RUBA 1B3TA 1EKSA 1AXQA 1NPKA 4DLGA 4DSEA 1MROA 5D4LA 5LMNJ 2ZBCA 3QGIA 2G2YA 2KYXA 2NR0A 5CYMA 2PI5A 1RWOB 3OR2A 4B3RF 3UN3A 5G0RA 1DJ0A 2IMWP 4B3TJ 4JI0J 3RB4A 4I69A 5F8GA 2MY7A 5DJBA 2IVMA 2M52A 1U1LA 3QJPA 3AFGA 1TV6B 2ADCA 2W2NP 2QA4G 2F4VJ 1U8WA 1J27A 2FUG9 1Z2ZA 3OL8A 3MMBB 3MFHA 4O3RA 2E5LJ 1H72C 2W9CA 2R8GA 4LF9F 2OPQA 2X1FA 2DO0A 1IR1A 3R1LA 4ZOSA 4G1IA 3G6ES 3D3CJ 2ZVIA 3T5LA 3LA0A 2C28A 2KYZA 3CJQA 3JQJA 4PPDA 2DNKA 2PT0A 2MSSA 2DGOA 5EN1A 4X65F 2VICA 3MEEA 1X7VA 3RAXA 3SFUA 3I82A 1AYEA 2EC2A 3FNNA 4U7CA 3R2DJ 2B9YA 1HNXJ 3LQVA 1HQUB 4G1QB 4OL8A 3GG0A 3G8SA 2ZWPA 1XNQJ 2JL9A 1APSA 3PDNA 2CG4A 3MAHA 1KKHA 1SV5B 5LJ5Y 1ZM4A 3KLGB 4WKYA 1WKLA 1QM9A 1C1BB 3CMAS 1FFSB 3GIIA 2MTLA 4DR2F 2I0XA 3T1YF 1VQNS 1NMEB 2D74B 1J5EJ 2RQCA 2JNJA 1WKJA 3AD7C 4FVCA 5L9NA 1GFWB 5DO2A 3FT7A 2WONA 1U1NA 2M9KA 2GMJA 1LW0A 4L75A 1V6HA 3HMJG 3IBFB 4ZHRA 4UY8T 1RAGB 4O44B 1UEVA 3W9IA 5DRKA 1JB0C 1QE1A 2MJNA 4WWSA 4NMLA 5B0BA 2CUYA 3DLHA 3OSPA 1F6TA 5HSPA 1CJVB 2N4CA 3CPWR 5KT2A 3CCSS 3DOMB 5HATA 1KRPA 5ETRA 3D1HA 4UT4A 2BA3A 3M2VB 4OYZA 1WOSA 4B3TF 3WHIA 3U1NA 2IVYA 2OTLS 5HMWA 3W2VB 3MOZA 3JSMA 1EETA 2YNGB 3KJNB 4WTOB 1HWIA 3M30B 3R5AA 2XQCA 1BHNA 3DGVA 5MLCV 4URGA 3Q89A 4JB8B 4EYIB 1L3TA 2AYMA 2NPIA 4JI5F 3EVOA 1JWWA 4N47A 5HO4A 3VHQA 1NXIA 3QSIA 1ZYQA 4UOGA 4I67A 2KG0A 5FLXU 4DHVA 2VB6A 3BN7A 4Z7YA 1RTJA 1Q5VA 4M5DB 4OHZA 5JUMA 4X4RA 3HX9A 2OSRA 1RE1B 1N34F 1HHSA 4CRJA 1WHVA 1KSPA 4AL6A 3C6TA 1FXLA 2H1OE 4F4KA 1ZM3A 1RGVA 5KG7A 1TVRA 4J9KA 2RS2A 1FVQA 3GYNA 2EVZA 2MQ8A 2ZE2A 4DXLA 1F60B 2VF3A 4LFAJ 2HKEA 3LGHA 5GAHI 4CO4A 4C48A 5BXIA 3OTCA 4XTTA 3Q8RB 4X4PA 2UVUA 3GMGA 3OTBA 2HWTA 1HD1A 2ASYA 2QYGA 4M63A 2JC1A 2WVFA 1M1KT 1NDLA 2LEPA 1U6FA 2IDEA 2CQCA 3MM6B 4C8OA 1V3RA 2FYXA 1YWXA 1S9GA 2EG2A 3ICLA 4DV4J 1I3OB 2X51A 4O0NA 1PJ7A 2WVBA 2H5JB 3LPYA 3EGVA 4D3HA 1IM6A 4PKDB 4DV0J 4FYVB 3TANA 1SKRA 3CSKA 4Q7AA 3D3BJ 4BC9A 4FF1A 3TZXA 1IJEB 1RT1B 2H5EA 2HLTA 4P6QA 3EPIA 2KJWA 3BQ0A 2FZGB 4I2PB 4P52A 3P49B 4ATNA 3C8YA 1EZZB 2IC3B 3L3CA 4WU2A 2AW0A 4ZPAA 2EW9A 1VJQA 2V1TA 5KFEA 1VBZA 4WU3A 4RKUC 1N5VA 4ILRA 2KH9A 3LWLA 4LF4J 2YBVA 5D6GA 4UZBA 4USJC 3H87C 2LXUA 3V6DA 4ZVGA 3V6JA 1S1XA 3BGFA 2HNYA 2AWZA 2BZ2A 1S9FA 3JYTA 1CBKA 2OPRB 3MTKA 1M5OC 3ZZTA 5HJXA 1CC8A 2HQ3A 2E66A 3N28A 4LR7A 5EDWA 2CZ9A 1ZTWA 2C2MB 4KSEB 3GE9A 2QE5A 3FUYA 3UCZP 3M8QA 1E6YB 4DR1F 2HVIA 1Q81T 2RUSA 5AXMA 4X84A 5C25B 4LSLB 2V4JB 3M6XA 2KELA 3OJSA 3IGVA 4YFUA 3W66A 1UEKA 3PR4A 1WKKA 3NY0A 3KLIA 4FXEA 1GTEA 3T5JA 2DNYA 4IQMA 4KR0B 1H38A 2PO4A 1M0SA 4QW9A 3NS6A 4RW6A 1LOUA 1R8HA 4PYAA 3KTQA 1ZH5A 2IA0A 2K06A 2Z58B 3UNYA 2MQMA 2F63A 1S6QA 5C7PA 3KYLA 4DU8A 4DX5A 5AE2A 3VAHA 2BQUA 2UUAF 4ZVEA 2NUUG 1EP4B 1ARQA 5GAEU 1U2CA 1F2GA 1XWLA 1SH2A 4ZP8A 1TR0A 1S10A 3HSDA 1JLGA 4Y34A 2YWFA 2XSJA 2R4FA 1FE0A 1ICEB 3OUYB 3AWRA 3PHEA 3L9ZA 4NASA 1NHKL 2ZBQA 3GFZA 1P94A 1WF1A 4RW7B 3H20A 1YJWS 1HWKA 5GADI 3NS7B 2R7OA 2OJ3A 1HHQA 1TAQA 1RTDA 5EX3A 5HBMB 4IH6A 2FZKB 4LRCA 1TKDA 2H3EB 1PCAA 1ZETA 2HHTA 1RA7A 3BV8A 4MIWA 1QAXA 4J9VA 2BM0A 4NEYA 1A7GE 2VOPA 5CYQB 1P1TA 4YEAA 1WHXA 4FKYA 4ZK7M 2XTJP 2AY0A 3SV4A 2DR7A 2MKCA 2J0SD 2A0FB 1N36F 5F3TA 5L1KA 3TUIC 4OZ0A 4WBFA 2RAQA 3B78A 4WFNQ 2WCXA 5IT9U 1MLAA 4JYAJ 2ZBRA 1T95A 3D0IE 4BC7A 2IIHA 3HT3A 3M2RB 1FESA 4TN2A 3CD6S 4ZVRB 3RG6A 3W61A 1JLBB 1Y5LB 5B0GA 1KDNA 2MDAA 2CJ9A 1S1UB 1NB7A 4PPZA 1FRLA 1J2VA 1XERA 3HO1A 1RWUA 1VQMS 4M1KA 1D3WA 1FWKA 3WIUA 3IR7A 2A2DA 2QLXA 2DGUA 4K4VA 2GC8A 3KLFA 2FZCB 1KP6A 1GXTA 3DOKA 3WC2A 4NA2A 4C11B 4GO7X 3RRKA 2Y9HA 4AXJA 2CNOB 3I87A 3MMJA 5L39A 1T8EA 4OZ1A 4J37A 2R8KA 1RWKB 3DLKB 3FDSA 3J7Z5 1ZM9A 2QYCA 3NOGA 3E01A 4ILLA 4RW4B 2H5IB 1FJGJ 3H5XA 4ETXA 2G0CA 4DV3J 3OBIA 2MJUA 4RUBA 3O8WA 3PIOQ 1TKTB 2HNDB 3BGOP 4P2MA 1N32J 4LF5J 4LIRA 1T03A 1K44A 1RAEB 1RQ0A 4TYAA 4DZ6A 2IRXA 1WDDA 1NK4A 3CGIA 1PG5B 1GH8A 3IAM9 1YIJS 3L4BC 1XR5A 4MKBA 3MM7B 2CPXA 5LSOA 2XO6A 4ZVFA 3ZNJ1 5C42A 3UE2A 3QLHA 4P7VA 2BMBA 2GX8A 3T9NA 4HDGA 3V81B 1YLXA 2GHVC 3M6VA 2ALYB 3Q8SB 4WK3A 2BANB 4WP3A 1ITPA 5KT6A 1NJWA 3TAMB 4NZ6A 2CWKA 1DHMA 4QQBA 4A8QA 4OJ1A 1MMNA 1HYSB 1FRMA 1SJ4P 3A8EA 3NGTA 2LCWA 2UUCJ 1RSCA 2WVDA 4DPWA 4JI6J 3CCQS 4JI1J 2CYYA 3P5TL 4OI4A 3TA1A 1F9FA 1WC5A 1N48A 4EZ6A 4JYAF 2V63A 1QTGA 3FMBA 3NP5A 1R0CB 1VJWA 4RW9A 1NK8A 5ITHA 4Y28C 3ZO7A 1N5YA 3FBCA 4ETZA 4P72A 4KC5A 3PV8A 1S6PA 3MUTP 1VQ5S 1WD6A 4JI4J 2VC1A 5D3GB 4X62J 2B5JB 4A8OA 5ETNA 2V8VA 3EGNA 4DX6A 3D67A 2F9DA 4NLRA 4O3QA 1QVGR 2J9DA 3MDFA 3CNQP 4GMKA 2J76E 3AHPA 4W90B 5DDRC 1S1TA 2KDOA 2WK4A 2CZVC 1SKWA 3IM9A 1RADB 5D0GA 2NXCA 4YDDB 1YRXA 5GAGU 4ZJLA 4DPTA 1LWCA 3N5FA 4N5SA 1BAZA 4L3NA 3MECB 1HFEL 4IOCQ 4DPYA 5K8MA 3SMZA 4IRDA 3OVBA 2I1RA 4I4BA 4B9UA 1Q86T 4G65A 3A3OB 2RS8A 2CPZA 5J2QB 2VJUA 4A8KA 2QL9B 2VASA 5D8HB 2DK2A 3S6EA 1UA0A 2C2ZB 4AT1B 2UXBF 5KFLA 3HXMA 1C2PA 4AQYJ 2BSQE 3DGPA 2IYGA 1UW9A 2LU1A 4EK2A 1NSPA 2VFTA 2B7BB 4R5PB 1IKYA 3MZIA 2BKPA 2XMKA 3KK1A 1UFKA 3MM5A 2C22A 1T05A 1VQSA 1JLAA 4DPUA 2HBZB 5AE1A 3HFVA 4AYBD 2ZVSA 1LK5A 5E0OA 1MSWD 3VAJA 1NRKA 2OUGA 1CJTA 5DG7A 2WAQD 1Z4UA 2FVCA 2YNHB 4WZQA 4KO0B 3NKYA 4JV2A 3MM8A 2J0XA 2UUCF 4LR8A 2UUBF 1N0UA 3C6UB 2IM1A 1VI7A 3AX3A 1NU4A 3IG1B 4MJKA 1CQNA 1WOPA 4HI2A 1TU0B 3KMQA 4OX6A 5LMUF 2OKQA 3IAS9 2BEFA 3UR3C 3M7VA 3HZGA 4LSNB 2ERRA 2XGPA 3GV5B 4HTJA 2GIFA 1YJVA 2GFFA 1EHWA 3EZ5A 3ULHA 3KLEB 4X4TA 2ZFHA 4ES2A 2HAFA 4OYPA 2O1PA 1RLCL 4KH0B 3W64A 1R8CA 4DL6A 3E3XA 2N3OA 3JAMU 4FNHA 3HLUA 4V1Ak 1U4BA 3BN4A 5HQMA 2DNNA 2M8HA 4B9LA 4KH1B 4OYBA 1PJ5A 3HSZA 2B9XA 1VQ7S 4OZ5A 2CPHA 2CQIA 4ERDA 1JKHA 2JBVA 4OYOA 3KJVB 3UDEA 1UJ6A 3P96A 5MAOA 1C0UA 5HMXA 2UU9J 4GKKJ 3PFEA 1JNRB 4KIAA 5HLFA 2CPJA 1SB6A 3M1VA 2XNRA 4DL3A 3TI0A 2EFNA 3DLLQ 3DI6B 4EU0A 2FHJA 4PG4A 3OD2A 2R7QA 3HVTB 5I42B 5LOQA 2BR0A 2YKNB 3IC1A 2BE7D 2Y0SD 2CJBA 4I2QB 1RDRA 3DOLA 3BGRB 2HFUA 1YG0A 1K1SA 4F3MA 1T94A 4ED2A 1RHUB 4DR6F 3K5LA 3DN9A 1YKWA 3VCDA 1X5TA 1NLKL 2MSTA 3OSNA 2C3UA 2HS3A 2A10A 3POTA 1N4LA 4URSA 1DTTB 3GFYA 5E41A 5L8RC 4GVBB 4WYLA 1MMDA 4TVAB 2VDHA 4TU9A 1FKPA 2HVZA 4J5OA 3QIDA 4ZVTB 3PX6A 4KHPF 5EHHA 1NB2A 1XR6A 4NEZA 5H1SV 4V19J 4PWDA 2LEBA 4R8UB 2FJVA 1HPZB 4ILMA 2C2EA 1OS5A 2VG5A 2X3DA 3MCSA 1H98A 2EI5A 2KG1A 2W2QP 2YKQA 5E3CA 3OV7A 3C46A 1S0MA 3CCUS 1RHJB 1HNVA 3DKDA 2AJQA 3G82B 2A6OA 2OO4A 4ZLPA 3I5AA 1N54B 3VF0B 3IWLA 4HACA 4F4ZA 2COLA 2WRMA 5D77A 3RBXA 3K7RA 2YNFB 1E6VB 2QJ3A 4PXBA 3IS9B 1NJZA 2XMAA 3NLCA 4F4AA 4AXIA 2GVZA 2KT5A 3OR1B 3PFOA 1URRA 1SVDA 4LT6A 5HQLA 4K50A 4K8RA 4BS2A 2XMJA 2FHMA 3G5OA 3J81U 4H4KA 2GQCA 4USWA 4DQQA 4B3MF 1NK5A 3QIPA 4JV5J 2NXUA 5CYMB 2V2VA 3U7JA 4GKKF 3L09A 2QLFB 5KAKA 5G0RB 2HAIA 3K5PA 3GSDA 2QSWA 4DV6J 3CIZA 4O4GB 2P2CB 3OFFA 2XZTB 1BQNB 1FTRA 2C3YA 2NSBA 1UPPA 5FLXY 1TKXA 3PCOB 2MLYA 2R9LA 3LJPA 1FKAF 3I5CA 1K8AT 2EK6A 2JC0A 3R8YA 5IQQA 3IWNC 3ETMA 1N8RT 3LALA 4M5HA 4IFYA 4QZVB 3QWPA 2J5AA 4M5LA 3OXFA 4DV7J 4WTYA 4C0HA 1TV6A 2P5VA 5KFYA 5A2QY 1L3UA 2W9CB 5DQGA 2ALZA 2VQFJ 2OPQB 2QN6B 2B4PA 3OL9A 5KFVA 1R8BA 3DCAA 3MMBA 1WSVA 1RP5A 4N56A 1VC6A 4Q43A 3LH2S 2RDDA 1RTZA 3O5TB 3QWUA 2OLWA 4M8LA 3EJMA 1H7WA 4HYKA 2CADA 1U1OA 4ELTA 2E1CA 2AGOA 3QRQA 1JNZB 3IMQJ 4LBPA 3CJ4A 4CT8A 1QJHA 3U02A 2OEMA 4LF6J 5C2GA 2ILYA 1H3DA 2UUTA 4LIWA 1R27B 3WBZA 1OHNA 3G4SS 3UD5A 1HQUA 2MMYA 3P5BP 4ANCA 2KRRA 4G1QA 1DFDA 3AD9C 3PG9A 4I64A 2CVEA 2JEFA 4E2FB 3GR0A 5CYJA 2GMLA 2DPIA 2DD8S 1RYRA 3RGIA 2K7KA 5E3PA 3V4IA 3EDRB 2HS4A 1T9XA 3A3PB 3HSGA 2E9RX 1XQIA 5EX0A 2NCKL 5KG6A 5KG0A 1O8BA 2VA3A 2FY8A 4IYQA 4A8FA 2QSFA 4RNHA 1MWZA 2HHSA 2XZDB 2QA2A 4Q0BB 2OMOA 2KRBA 4L3KA 2DHSA 2JDJA 5KG4A 3QRRA 5D4PA 3IXQA 5KFRA 3Q24A 3NRBA 2QLWA 3EGZA 1BC6A 2Q6CA 1FDDA 1HI8A 4ES1A 4O44A 2K29A 2I38A 3CDWA 4A8MP 1K1QA 1TMJA 3T5HA 2KB2A 4ALZA 1DZ5A 5K9FA 2ZHAA 1FTCA 2Y0BB 4DV6F 4ED1A 1CJVA 1KQKA 2HGMA 2P8IA 2IJRA 1RLDA 3BDPA 1S48A 2XYGB 3O3LA 5KT7A 1SJQA 3M2VA 4CCHA 3JSMB 2H1YA 2V0NA 1EETB 3W7BA 4IFVA 4ZCLA 4PCQA 3QQCD 3BBBA 3IA0A 2WW8A 2MQLA 3KNGA 2J9DE 3SBMA 4P2FA 2Q3PA 4ZVUB 3CULA 1S72S 1UVMA 4LFBF 2YNGA 1HNZF 3SIPB 3M9MB 2XI3A 3H4BA 3M30A 3GFHA 2C2KB 2HW3A 4N41A 1WORA 3B82A 2J6UA 4QW8A 1S6UA 2RQKA 3QZ7A 2ILZA 2VH7A 5RUBA 3DRXA 2QV6A 1Q4RA 3NAIA 2IAJA 4MIBA 1OJ4A 2HMIB 2BUNA 1U49A 1HARA 3C6TB 1FRHA 4M5DA 3THVA 1TL5A 4WPAA 1N88A 2FJAB 1TVRB 4LF8J 5DQHA 3K59A 3M8YA 1RT5A 1HL6A 3QPIA 4YS2A 3MR3A 2ZDOA 4CO2A 2H54B 1Y10A 1VDHA 5DGBA 4RNNA 1A6LA 1X4DA 2Q2KA 5A6PA 3KDOA 2LECA
chains in the Genus database with same CATH topology
3M32B 4LF9F 2OPQA 3MXHP 1LW2A 2X1FA 3DHWC 4JOUA 2RDJA 4K2XA 2DO0A 3MD3A 3MUMP 3TAPA 4B3OB 2CQ0A 2ZH8A 3R1LA 2P6TA 5LT5A 4ZOSA 4G1IA 2JVRA 3F73A 1B0PA 1NEEA 3IO1A 2I5JB 3G6ES 1Q8IA 2VFRA 1HI1A 4XDDA 1IKVB 3T5LA 2LYVA 2V4QA 4Y6IA 3SDEB 2OFHX 4YDXA 3QO9B 2F7VA 2C28A 2KYZA 2JHEA 4PPDA 4DR4F 4DV2F 4XO0A 2YWEA 5CZVA 2DNKA 2PT0A 2B4UA 3GV8B 2MSSA 2DGOA 2XS7A 5EN1A 4X65F 3ITHB 3AY0A 4OHVA 1DARA 5E3AA 2NS1B 3MEEA 1X7VA 4K5SA 2GO9A 1VQ4S 3RAXA 3SFUA 4RU2A 3LP2A 3I82A 4FNIA 3CCTA 5BJRA 4ED8A 3BQ1A 4DF8A 1U8SA 1X4AA 5J2MB 3G71S 4LF4F 1KQGB 4AFFA 2GV1A 3FNNA 4U7CA 4L6V3 3MM6A 7FD1A 4MJWA 2B9YA 5IT0A 1RT7B 3VR1A 3RW6A 3LQVA 3IR6B 1X5PA 1OPZA 1HQUB 4M94A 4TQSA 1KFDA 4CTAB 4G1QB 2B51A 2XZ2A 1LWFA 2CRLA 4OL8A 3GG0A 4I7FB 3G8SA 1Y3KA 1X9WA 2JL9A 4AUKA 1VQKS 2JFKA 1APSA 3PDNA 1ZAVA 2EBEA 3GV7B 2C2DA 2CG4A 3MAHA 3NGDA 2RU9A 2XHWA 2KHDA 5IT9Y 1MU2A 3PNIA 3CJKA 1U45A 2FLLA 1B64A 4IKAA 1GXLA 1IKXA 1UL3A 1ZM2A 1FRIA 5KFTA 2R7WA 5HP1A 2ASLA 1SV5B 1X9SA 5LJ5Y 2FY1A 1PSDA 3PIPQ 1TFWA 2DRAA 5HROA 1ZM4A 3KLGB 4D3GA 1UA1A 4WKYA 3H2LA 5KTQA 3T6JA 4PR6A 3NMAA 3S1TA 2MPUA 3DLEB 4YB5A 4BDPA 1JLEA 1ULRA 1QM9A 2FJDB 2ROEA 4DG1B 4OHYA 1HBMB 2J6SA 5C24B 2UUWA 4Q2LA 4RW8A 1C1BB 2AU0A 4WZMA 3CMAS 3GIIA 2FGOA 3LANA 4DR2F 2RIJA 4I2PA 2QEXS 2VKRA 2I0XA 1JMTA 1TL1A 3T1YF 1LWEB 2R2TA 1VQNS 2D74B 4H4KC 4DL4A 2WOMB 4WE1B 2RQCA 3IRWP 2JLGA 5L9NA 4FVCA 1U6ZA