4QPXA

Nv polymerase post-incorporation-like complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
502
structure length
495
Chain Sequence
b'SKGTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein
publication title Structure of a backtracked state reveals conformational changes similar to the state following nucleotide incorporation in human norovirus polymerase.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Hydrolase/rna
total genus 167
structure length 495
sequence length 502
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 4qpxA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4qpxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qpxA03
2HNDA 5KG0A 3N6NA 4WXWA 1DLOB 1T05A 4RW7A 3I5CA 3V81B 5KFCA 1RT3B 1RTHB 4XPEA 2XGPA 2W9BA 5HP1B 4I7FB 5F8LA 3KLIA 4MK9A 3NBPB 4NCGA 4URGA 5EDWA 4QWEA 4J9KA 4DL4A 1WNEA 4URSA 2F8EX 2FJWA 1JX4A 1LW2A 1K1QA 4QWCA 4KKOA 4WXOA 2W7PA 1N5YB 3H5XA 4M94A 4IH5A 5J2PA 1IKWA 1CSJA 3KLEA 4WFZA 1JLCA 2I5JB 3ICLA 4TQSA 3KLGB 4KFBA 2RKIB 3T5KA 2C2EA 2FVPA 3FFIB 2B5JA 4K4SA 3KLFB 3KLHB 4LQ3A 2WOMB 4H4MA 1FKOB 4MFBB 4RW6B 2W8LA 4ECQA 2J6TA 4K4TA 4RW8B 3BJYA 4ZP8A 4NLXA 4NLRA 1LWEA 1SV5B 4WE1B 5DLFA 1RAJA 1RTJB 3QIDA 2VA2A 2XCAA 1RT5B 5KFLA 4IQXA 5DQHA 1TV6A 4HKQA 4O3NA 3CIZA 3IS9B 4O4GA 5L1IA 3LP2B 2HMIB 5HBMA 3PW4A 5KFYA 1S0OA 3SFUA 1HYSB 3MECB 3E01A 3M8PB 3KOAA 2WCXA 3V6DB 2YKNB 1BQNB 4ECYA 2YNGB 5J2MA 2I1RA 3DM2B 4Q45A 1JIHA 4MH8A 4NRUA 4ZMMA 1QAIA 1RT7A 3KK3A 2OPSA 2E9ZA 4URQU 2FVSA 5D3GA 3T5LA 2B43A 1S1XB 4G1QB 2GIRA 4Q8FA 2RF2B 4IFVA 3V6HA 1R0AB 3DRPA 3H2LA 3N6LA 5I42A 4KHRA 4ZHRB 2W7OA 3DRRA 5KFEA 2FLLA 5KFWA 1RT6A 2YNIB 3KMSA 4TYAA 3UQSA 3QIPA 1RYSA 4RNNA 5HROA 3IG1A 3LANA 3MEGA 1RA7A 5J2QA 4RW4B 5KFTA 5C42A 5HLFB 2BE2B 5KFAA 4ZP6A 3QGGA 1JKHB 2E9TA 4TYBA 3Q8RB 1T03A 1TL3B 3KLVA 3I0RB 2AGOA 1RA6A 1ZTWA 1EP4B 1UWBA 4IKAA 1N6QB 5DLGA 4RNOA 4R8UB 1LWFB 5C24A 5EWGA 1NHUA 1RTDA 4IOBA 3PVXA 5J1EB 3M8QB 5KFIA 1RT2A 2OPQB 3EPGA 2C2DA 4YR3A 4ZPBA 4PWDB 3CJ3A 4R5PB 2R2TA 4IG0A 5K14A 5KT6A 1S97A 1BQMA 1RT1B 2GIQA 4QW8A 4ECUA 4RUAA 2R8JA 5DQGA 4K4XA 4X2BA 4NLYA 3JSMB 3GV5B 1QAJA 2C22A 4O3RA 3Q8SB 2IM3A 3DMJB 1REVB 4QWAA 1MMLA 1SH3A 4XO0A 3DLGB 4MKBA 3QZ8A 4QPXA 1HQUA 2ZD1B 3LP1A 5KFOA 3PW0A 5KG5A 3BREA 4RUCA 4Y3CA 2R8IA 4Q44A 3DI6A 4Q43A 1J5OB 2HNDB 5F8NA 4YR0A 3RB6A 2WTFA 4MK8A 1YVFA 2R2RA 4YQWA 1IKVB 2R8GA 1JLGA 3MEEA 3HVTA 3HVWA 5KFBA 2ZKUA 3BSCA 5KT7A 3I0SA 3KHHA 3PZPA 3E51A 2OPPB 4NCGB 4DG1A 3QO9A 4ED7A 2IMWP 2IC3A 3OL6A 1S6PB 1LW2B 1XR5A 2OPRA 4ED2A 4KKOB 2V9WA 1IKXA 1S9GB 2YNFB 4KV8A 1FKPB 1S1VB 4O44A 2WONA 1C0UA 4NLQA 4WZQA 5J2PB 5KFHA 4GC6A 5FDLA 1DTQA 1S1WB 4IH7A 3KLEB 2UVWA 2BQUA 2R8KA 2XI2A 1HNIB 3BGRA 5L1KA 5EWEA 1K1SA 4YR2A 2EC0A 1VRTB 5KFXA 2BR0A 4ZPCA 5KFZA 3PR5B 4H4MB 3SI8A 1XR6A 5KFJA 4H54A 2R8HA 3KMQA 2UVUA 1JLQA 4PUOA 1RT4A 5L1JA 5KFVA 3TAMB 2VG6B 2J6UA 2HAIA 1GX6A 2HNZB 2B6AB 3DOLA 3TVKA 4H4OA 2BANB 1C0TB 3MEDA 1RYRA 1HNVA 5HBMB 1S9EB 4KO0A 3CJ4A 1S49A 5J2MB 2UUTA 1S1UA 3H98A 5CYMB 4NLDA 1D1UA 4DL7A 1FK9B 3GYNA 3QYYA 3ISND 2O5DA 2D3UA 2QE5A 2R2SA 1LWCB 3ITHB 2UVRA 4O3OA 4ECXA 1TVRA 2W9CA 2RDJA 3DLKA 1LW0B 5C25B 1DTTA 3DRPB 4JV0A 3GQCA 1TKXA 3DLEA 5DG8A 3C6TB 2YKMA 3LAMA 3DRRB 5C5JA 3HKWA 2R2UA 4ZP7A 1RT6B 1TKZB 3T1AA 3QIPB 4QW9A 4NLPA 3MF5A 3G6XA 1S1TA 4LSLA 4NLGA 3IG1B 3BQ0A 3MEGB 4IFYA 5J2QB 2ASDA 4Q0BA 5DGAA 2CKWA 3KJVB 1HMVB 3MTKA 1C1BB 5KFNA 4LSNA 1QE1A 3G86A 2VA3A 1S48A 4ICLA 4ZVHA 5F8IA 5KG6A 1UWBB 5KT4A 1TQLA 3HVAA 4DL3A 3QLHA 3LP0B 2C2RA 4XPCA 2J6SA 5F9NA 3KK2A 2OH2A 1RTDB 5KT5A 2ZE2B 1T3NA 2FLPA 1RT2B 1KLMB 4QWBA 1HPZA 5F8JA 1ZETA 2IA6A 4RW9A 3CWJA 3QZ7A 4IDKA 1RTIA 3UR0A 4IG3A 3D5MA 5K14B 1BQMB 3FSIA 4FS1A 4M95A 4PQUB 5KFFA 4K4ZA 5F8MA 1JLFB 4ED0A 4I2PA 3NAHA 3V81A 4RU9A 4KB7A 1RT3A 1RTHA 1GX5A 5HP1A 4I7FA 4MIAA 2V4QA 3OSPA 4DL2A 5DG7A 1HQUB 3LP1B 2IBKA 5KFGA 3GIKA 1TL1B 4JV2A 3LAKA 1N5YA 3GV7B 2ALZA 5F9LA 4NLSA 1SUQA 3H40A 1W25A 1XR7A 4FS2A 3G6YA 1JLGB 3MEEB 3KLGA 3KHGA 3NKYA 2RKIA 3HVTB 3RBDA 3FFIA 4IRCA 4KBIA 3KLFA 3KLHA 4RW6A 1JLEA 2WOMA 1FKOA 4J9LA 4ZVEA 5KG3A 2CJQA 2D7SA 3CJ5A 3BQ1A 4NLWA 1SV5A 3H4BA 4ECVA 2WHOA 4WE1A 5T14A 4I2QA 2UUWA 4KV8B 3OLBA 1RTJA 3CO9A 1RT5A 3C6UA 4EEYA 1DTQB 4ZP9A 2HNYA 3V4IA 2IM0A 1C1CB 3BGRB 3IS9A 2FJVA 1MU2A 3KK1A 3NMAA 4ID5B 2JEJA 3RAQA 4TQRA 3CDUA 3MFIA 4IRKA 2YNHB 4NLVA 2VG5A 3M8PA 3V6DA 4B3OB 2YKNA 3SFGA 1BQNA 2YNGA 3DYAA 3PJWA 5J2NB 1OS5A 3IN5A 4F50A 1RT4B 5KT2A 4JV1A 4U6PA 5L9XA 2IM1A 1EETA 4EYIB 1IM4A 3CDWA 1VRUA 1T94A 4IR9A 3BQ2A 4ECSA 1T05B 1S1XA 4RW7B 3D28A 3JYTA 3RAXA 1R0AA 2FVRA 1HQEA 4Y2AA 3NGDA 2W9BB 1JLBA 3KLIB 4ZHRA 4J9OA 1RDRA 2VG7A 4NRTA 3GILA 3OSNA 4F4XA 2AGPA 3FDSA 4EBCA 1IKWB 2BE2A 1JLCB 5F8GA 2D3ZA 1TVRB 2JEFA 4ZPAA 3T5JA 1JKHA 4KFBB 4EBEA 1S0MA 4FBUA 5DGBA 5JXSA 2B5JB 2HWHA 3IRXA 4KHMA 3MR2A 1NNDA 3NL0A 1EP4A 1N6QA 4TY8A 2AWZA 5KFRA 4ED8A 1LWEB 5CYQA 3T5HA 2FLNA 4LSLB 4R8UA 1JLAA 4YMEA 4ED6A 2ILYA 4IFYB 3M9NB 2FVQA 4Q0BB 5KFKA 5J1EA 4EO8A 2E9RX 3KNAA 3M8QA 1TKTA 1TV6B 1JXLA 2OPQA 4TLRA 4DL5A 4O4GB 5KFPA 2GC8A 4PWDA 2XC9A 4MKAA 2IAJA 4ZPDA 4RNFA 3E01B 3TQ1A 1S9FA 3FRZA 3DDKA 3QLHB 2ATLA 3JSMA 3CJ2A 2IJNA 3HHKA 1C2PA 3KK2B 4ECWA 1U09A 4J9MA 3NAIA 5EWFA 1RT7B 3KK3B 1REVA 2OPSB 3DOKA 4NZ0A 2C28A 1I6JA 3M9MB 2W9AA 5D3GB 4F4WA 2JC0A 1HPZB 3PHEA 3H59A 2QV6A 4IDKB 1RTIB 4IFVB 4IG3B 5I42B 3M9OB 2DPIA 1QUVA 3PW2A 4FBTA 5KFSA 2ASLA 5DG9A 1IKVA 4I2PB 5HROB 3EPIA 4EO6A 2IJFA 4NYZA 2OPPA 5C42B 3MR3A 3PW5A 4J9QA 3BSOA 1S6PA 3CDEA 4KSEB 4J9RA 1T03B 1S9GA 2YNFA 1FKPA 4EYHB 3KHRA 1S1VA 1SUQB 1NHVA 5KT3A 4F4ZA 4Q8EA 1S1WA 2W8KA 1HNIA 2HWIA 5JUMA 1VRTA 4K4VA 2WB4A 5C24B 2BQ3A 4KAIA 4ECRA 1JLEB 5KFQA 3MR6A 3GIIA 3V6KA 5I3UA 3H4DA 1N4LA 1S6QA 4GC7A 3PR4A 2JLEA 4TN2A 3DRSA 2JEIA 4I2QB 4ZVFA 1S4FA 3PJXA 3TAMA 2VG6A 1TP7A 1N48A 1SH0A 4K50A 1IKYA 3C6UB 4IG0B 2HNZA 3LALA 4Y34A 2B6AA 3GIJA 3G6VA 3OLAA 4ED1A 2HNYB 3V4IB 4O4RA 4ECZA 4TY9A 2BANA 1MU2B 1C0TA 1DLOA 3KK1B 2JEGA 4O3SA 3RB4A 1S9EA 2VG5B 3QGHA 2V0NA 2XWYA 4Y2CA 3DYAB 3NBPA 4RNHA 5CYMA 3I5BA 1FK9A 1D0EA 4WFYA 3DI6B 1EETB 4HYKA 3KHLA 1VRUB 4K4YA 1LWCA 3ITHA 3QGIA 2BRKA 2I5JA 5F8HA 3JYTB 1LW0A 5C25A 4NLOA 1HQEB 3I0SB 3C6TA 1JLBB 4MFBA 4U7CA 4ZVGA 2XGQA 1Z4UA 4DG1B 3QO9B 2AGQA 4RW8A 2VG7B 4K4UA 2IC3B 3RBEA 1TKZA 2WRMA 4KE5A 3ISNC 2OPRB 4OL8A 1IKXB 4DEZA 3Q8QB 1S0NA 4O44B 2WONB 1C0UB 3KJVA 1HMVA 2FJXA 2AX0A 4MIBA 5FDLB 4EBDA 1C1BA 3LP2A 3H5SA 2HMIA 1N56A 3IRXB 1HYSA 3MECA 4O3PA 4TY8B 4IH6A 3LP0A 3DM2A 4WFXA 1JLQB 5CYQB 5KG1A 5DQIA 3V6JA 4IR1A 4PUOB 1JLAB 3IGVA 4LQ9A 3OHBA 4QWDA 3MFHA 2ZE2A 3DOLB 1TKTB 1KLMA 4H4OB 4NLTA 5KFDA 4ED3A 3EZUA 3MEDB 4G1QA 1HNVB 2RF2A 4KO0B 2IAJB 4TXSA 1KHWA 2FVCA 4YP3A 4PQUA 1SH2A 3BSAA 2AQ4A 2DPJA 4NLUA 1S1UB 4RNMA 2YNIA 1JLFA 2IM2A 2BRLA 2V4RA 4G3IA 3DOKB 2UVVA 2WK4A 4DL6A 4RW4A 3OHAA 3UPFA 5HLFA 3CVKA 3VQSA 3OL9A 2RDIA 3FQLA 4K4WA 1TL1A 2W9CB 3DLKB 5L1LA 1DTTB 1TL3A 4J9NA 1TKXB 3OL8A 2ILZA 4R0EA 3DLEB 3I0RA 4MK7A 2YKMB 3RB3A 5EUHA 1ZTTA 3CJ0A 5KG4A 2XCPA 3N6MA 4RZRA 1S1TB 1LWFA 4WYLA 3T19A 2XI3A 5KFUA 3Q8PB 3UDLA 2AU0A 5KFMA 4WYWA 5KG7A 3OL7A 2ASJA 3H5YA 4O3QA 2JC1A 3I5AA 4LSNB 1QE1B 4ECTA 2D41A 4R5PA 5KG2A 4ICLB 1RT1A 1C1CA 3GV8B 4J9SA 1HARA 2AX1A 4J9PA 4ID5A 3RB0A 2YNHA 3DMJA 5I3UB 3PW7A 1S6QB 3GIMA 3BSNA 3IGNA 1S10A 4B3OA 3H5UA 3DLGA 5J2NA 3DRSB 1KHVA 2ZD1A 4IRDA 3MR5A 3FQKA 4JUZA 4RW9B 4F4YA 2BQRA 1IKYB 4WZMA 1J5OA 3BR9A
chains in the Genus database with same CATH superfamily
3WHIA 4XPEA 2CDQA 1Y00A 2AYMA 3H8YA 5EDWA 2RB7A 1MROA 4DV6F 1N5YB 1IJEB 5D8HB 4WFZA 1RZMA 3FFIB 4MFBB 1K0TA 1LWEA 3TVYA 2RU9A 3C15B 5BXIA 2DH9A 3IR7B 4LT6A 3QAUA 2YKNB 1X4FA 4ECYA 3VAIA 2FGCA 3OTEA 4ED4A 4WFNQ 4HACA 2GIRA 5K8PA 1U45A 2VC0A 2CG8A 1ROFA 2VFRA 1V5VA 4ZP6A 2RD5C 2H48B 3I0RB 3BKFA 1NJXA 2GHVC 3BBFA 5EWGA 1NHUA 4M5IA 1Y9OA 3W7BA 2D1CA 1P6TA 3V2UC 1RU2A 4IG0A 1U1MA 4ZN3A 4NLYA 3GV5B 1F9HA 1AA1B 1HWLA 1H2VZ 2ZD1B 4ETXA 2V8HA 5KFOA 4Y3CA 2K8GA 1YRXA 1IKVB 4BCAA 3C16B 2R3VA 4DV5F 3BPDA 1RBAA 2XLKA 4H4KA 3TUPA 4QR0A 3HSZA 1DTQA 1VLOA 1HWIA 2YWFA 8ATCB 1YSJA 2GJFA 2RQKA 3PKMA 1PJ7A 1CS4B 4DL7A 3PNIA 1WKLA 2YY3A 2E5LJ 2HQGA 3EWGA 3GU0A 1F3VA 3J7YI 3SIPB 4U96A 5C5JA 4WFAQ 2MDAA 2AZ1A 4FN5A 1S1TA 3D0IE 2OHDA 5JJBA 3MAAB 1W7WA 1PSDA 5KFNA 1VC5A 2O01C 3QLHA 4DN9A 1XTZA 3DHXA 3F56A 4L6V3 1A6LA 2C2NA 2H1OE 3H7HB 4LUBA 4FS1A 1GX5A 5LSRA 4K2JA 5DG7A 2IBKA 4X4VA 3GIKA 1Q95G 1BDVA 4NLSA 1XR7A 4AE5A 4IRCA 3LF0A 4AL5A 2RKIA 4A8QA 2J9DA 3HFKA 4ANEA 4CDIA 3RRHA 3SDEB 5B0DA 2KDOA 4D3GA 3QPIA 2W4PA 2IM0A 1FX2A 1MU2A 4DR4J 4B17A 1I51B 5KT2A 3W60A 4NI2A 4JI4J 3BH6B 5ETSA 1T9TA 2EFNA 3P8BB 1N36J 3ZTRA 1PO6A 4JI7F 1NMEB 3TWZA 2QG9B 4V19J 5A8WB 5DDOC 3G71S 3A3OB 4UTGA 4YMEA 5AJ3F 2GMJA 1NKEA 1TKTA 1E6VA 3T1YJ 2CVEA 2XC9A 4ZPDA 2HRYA 2QSWA 4RNFA 1R31A 2KHCA 4DR2J 3M9MB 2R7TA 4W98A 3R9LA 2HQIA 4FBTA 2E1AA 3MM8A 2KT2A 5ETNA 1S6PA 3CDEA 3KJQB 5ETMA 1E6YA 1FE0A 3Q8UA 2AY0A 4OIXA 4ZCKA 3H4DA 2MZQA 4MKVA 4O0NA 2YX4A 1SC3B 1TMJA 2KO1A 5ETQA 1QSYA 1FWKA 4DSJA 1IWGA 2HEKA 2RUSA 4IYQA 3NBPA 3EJMA 4RNHA 1CC7A 1RTZA 3NO7A 4X4NA 4YN3B 2VOOA 2YVSA 3F41A 2A3JA 3DXBA 3FCHA 4B3RF 2OJ3A 2P9CA 4C8LA 2I2YA 2J0QD 3KJVA 1QJHA 2DTJA 4U9RA 4LFBJ 2KYZA 3IRXB 4U8VA 4KIAA 2KOEA 4ZK7M 2UZAA 4NMLA 1UWAA 5B0AA 1SH2A 5KOWA 2R7VA 2I0XA 1N32F 4LR9A 5A8RA 2ZC3A 2WK4A 4Y28C 1VQNS 4RR5A 2DHSA 4ZPWR 3OL8A 3NGRA 2KKEA 1YITS 1HA1A 2PMZD 1CC8A 1NSQA 3I5AA 5KG2A 4LFAF 3VR1A 3M6XA 5F0WA 1WC4A 1X4DA 3L3CA 2YWGA 4B3OA 1S10A 1YJRA 2DGVA 5HAOA 1L3UA 4UQGA 3W3SA 3MCOA 1HNZF 4DQSA 4UQTA 1EKRA 3MM9A 4URSA 3TZXA 4QWCA 4B9VA 1H72C 4OYAA 3HKZD 4IH5A 4JV5F 3LW5C 2CQIA 1Q78A 1V3ZA 3HZEA 7FDRA 4WE1B 3IWXA 2NUUG 1VHFA 1VBXA 2C2ZB 3HP6A 5KFYA 4CLWA 3M8PB 3M32A 1JIHA 2FVSA 3MR7A 1R0AB 3H2LA 3N6LA 2IBOA 1RT6A 4TYAA 2XZ2A 1DFDA 4G1PA 2MQPA 2JXGA 4E98A 3NGKA 1TL3B 3HHEA 2C3PA 2NPFA 3UWTA 4JI8F 2GW8A 4DCPB 2XMJA 2DY1A 3NG8A 2R7RA 1CG2A 1NCLA 4DZ6A 2R8JA 4O3RA 1KDNA 3VTIA 1MWZA 1WDTA 3TA1A 3DMJB 3PEJA 3QZ8A 3LP1A 2U1AA 3D6MB 2F63A 2R7UA 3GYGA 5DDPC 3DI6A 2HNDB 1SJQA 4CI0B 5CA5A 2GJ2A 1S7IA 1YJTA 1X9SA 2PGCA 4Y00A 4OYBA 2CNNB 4NLQA 2ZVIA 2CQDA 1NSPA 2HHVA 1UVJA 1HNIB 1B99A 2YH1A 4X62F 2CQ0A 1QD1A 3BV8A 1MNTA 3IBFB 4CO2A 1WI8A 1WUUA 1RYRA 4YHHF 2DCUB 1YJWS 3L95X 1S1UA 2FJBB 5CYMB 4WF9Q 2ZBCA 3ZZOA 3UVJB 1WSVA 2BJ1A 4O3OA 1C4CA 3OXGA 3HMJG 3DLKA 5K9FA 1FDAA 3DRRB 1UVNA 4ZP7A 3T1AA 4CLSA 1XMOJ 1S79A 1NKBA 2ZOGA 4A8WA 3WDOA 3FGVA 3VZHA 5DS7A 2ZUAA 2FLPA 3QWUA 2WVEA 4U7UK 4BS2A 4RW9A 5A76A 2DIUA 1UZDA 4M95A 5H9FK 3M2VA 4QYZK 2FZGB 1LWXA 3K5MA 5HN0A 5HP1A 1ZAWA 4Z7YA 2D9OA 1CJVB 2GGPA 2VQEJ 1YG0A 3VGUA 2JHEA 2WBRA 3TUZC 1TUWA 4M5DA 1SV5A 4LBPA 4ECVA 4KV8B 3OLBA 1QVGR 5HATA 2FJVA 3UR3C 3NMAA 4L72B 3RAQA 1BQNA 1RWOB 3QATA 5HMXA 4DU7A 2UXBJ 5L9XA 2MSTA 2V68A 2Q6CA 1DQ8A 3J80U 4P75A 4NRTA 1MROB 3PYFA 2HHHJ 4EBEA 2J76E 1W2BR 2CUYA 2G1HA 4NA2A 1LWEB 4CLPA 2M70A 4FXVA 1I5OB 2XSFA 4LBHA 1QTNB 4PWDA 1GMVA 2I6WA 1IVZA 2IJNA 3KK2B 2RHQB 4ECWA 4LF8F 3RYLA 3DOKA 4DV2J 5B0EA 3AH6A 2NCKL 1BHNA 1M1HA 5ETTA 2C3YA 1IM6A 3TJAA 4A48A 3D1OA 3QRPA 1NBEB 1NHKL 3CJSA 4X66F 3N4WA 3IWNC 2WB4A 1S77D 3V6KA 4DUZJ 4I2QB 4ME7E 1PYOB 3B78A 4IG0B 4ZVSB 2E29A 4DPOA 2NYHA 1S12A 2MXYA 4O0IA 2VG5B 3TA0A 3DYAB 3CUNA 1S76D 3EGNA 5F8HA 1H2TZ 4LFBF 4NLOA 1GMWD 1AFJA 3SQGA 4RW8A 2WVDA 4C3LA 3ZXWA 4PR6A 2HMIA 3Q22A 1HYSA 3T1HJ 3MUVP 4P7VA 2CJYB 4B9NA 2VPYB 4I1TA 4A8MP 1Z2LA 3BSAA 2VH7A 2KM8B 4DZDA 3FUYA 1T7PA 2LLZA 3UPFA 2VDHA 3W9HA 4DV0F 2M8HA 4L73A 4JI2J 2ILZA 4R0EA 4MK7A 1S1TB 1KC8T 3A4TA 4O3QA 2B3TB 2XNQA 4ECTA 1W2IA 1WELA 3GPAA 1KD1T 2HS3A 5GMEA 2WVCA 5HMWA 3Q2TC 4ES1A 3PW7A 3D66A 3IGNA 2VFUA 3G5OA 3MGJA 4R0JA 1N88A 4RW7A 5KFCA 3HT0A 2ZH1A 4MJKA 5I4MA 3J7ZT 4OMFG 4TQSA 1FERA 4F04B 4KFBA 2RKIB 4YY3J 4OYIA 3R6GB 2BVZA 4ED5A 2CVIA 3TZYA 2XCAA 1LOUA 3CD0A 1N33F 4YB5A 2B4VA 2E5GA 2PEHA 5G0RA 2VD3A 3D4JA 1LV5A 3TX0A 3M2RA 1DURA 2D74B 3J7AN 2QA4G 1DQ9A 2FB0A 4TU8A 4DXLA 3L9ZA 1NPKA 1Q8IA 4FP9A 2CQCA 2CPZA 2B9EA 2DNZA 1O6XA 2RDDA 1T03A 3TJ9A 2BXJA 1CLFA 4JYAJ 5GADI 1S6OA 4IOBA 1DZ5A 3A8IA 1CJUA 4X65J 5FIIA 1S97A 1IUJA 4I69A 5ETLA 1N5TA 3DLGB 2QMWA 3AD8C 1NM2A 1J5OB 5HL7Q 2R2RA 3MM8B 4DSLA 2VFSA 4F4AA 2IMWP 1S6PB 4PG5A 1OJ4A 1E6YB 4GC6A 2Y8YA 2MZSA 2XZDB 1HBUB 3BGRA 4A8FA 2H4YB 3ENQA 1M1KT 4PUOA 3CGIA 4X4UA 2UP1A 2Z58B 4OYPA 3VCDA 3JTOA 2DO4A 2MJUA 2XMKA 1YDLA 1MSWD 3QT8A 4LRAA 2XYGB 3GYNA 2O5DA 2QYCA 1UVLA 4N8OA 1TVRA 4J37A 2R2UA 1CQMA 5C2CA 3NCQA 3KJVB 1WC1A 1KOOA 1ZPWX 2FC9A 5F8IA 3HVAA 1PARA 2HAFA 2UV8G 4NOHA 1D9DA 2VUGA 2BE7D 1HPZA 2VQEF 3UR0A 1LFPA 5DRKA 3MM7B 3EGWB 3D0GE 5GAGU 2DNLA 4CLTA 4JV2A 2V8GA 4EZ6A 4DN0A 3BR8A 1WKJA 3H40A 2EK6A 1TZ0A 3KLFA 4OJ3A 4K5SA 3PX4A 1RTJA 1LK5A 2FHJA 2HFVA 5E3AA 4B3OB 1FEEA 2QL5B 2WAQD 3JYTA 1X8DA 3I31A 1FJGF 4AYBD 3ZTQA 1X4BA 5HMYA 2LU2A 2JLFA 3GR0A 3ZTSA 2CDRB 2LDYA 5D78A 1H6KX 4HHJA 3ISZA 3JSBA 3AHPA 4DR3F 4KC5A 3PDNA 1APSA 2OIHA 2FJEB 2HRUA 4LRBA 2Y0SD 1T9WA 5IZHA 1SPBP 1Q7YT 1FRKA 3B4DA 4KGVB 1FCAA 4CO3A 4FKYA 4DUZF 1RAOA 2CAXA 2AZ3A 3GSIA 3M30A 2DHXA 1TFYA 2HWIA 1ZPVA 2X3GA 1JLEB 2VZ9A 1Z2ZA 4AQYJ 1IKYA 2B6AA 2Z2YB 3V4IB 4F36A 3AT1B 3DI6B 1EETB 4NX9A 2W4CA 1JLBB 1FRIA 2DGUA 2PIIA 4HH1A 1FJ7A 4NYOA 1TFWA 3LP2A 2RJZA 1N56A 1NUEA 4CCHA 2M0GB 1S72S 4TU9A 3IGVA 3RBXA 4XDDA 1IBMJ 2QRRA 3FNNA 2DPJA 1S1UB 3M4XA 4DL6A 1UW9A 2B9XA 4KGMA 3DLKB 2LU1A 1WOSA 2RAQA 4WBFA 1SKSA 3N6MA 1XWLA 2AU0A 1OY8A 4I68A 5BJRA 5KG7A 2C2MB 2JC1A 3KUEA 1BXNA 2MMYA 1RT1A 3K0JA 1OMSA 4J9PA 2YNHA 5I3UB 1RHJB 3QAEA 3EX7B 1KHVA 3MR5A 2AP6A 4JUZA 4RW9B 1Q5VA 2R7XA 4HI2A 3FRYA 4C7QA 4YY3F 1SBRA 1RQ0A 5HP1B 4MK9A 3W61A 2QZ8A 4ZDNA 4HDGA 4M5DB 2MKSA 1SV5B 2PO4A 1EB0A 4Z37A 1R3NA 1S0OA 3E01A 1BQNB 2I1RA 4AL7A 4Y2KA 1UA0A 5BYQA 1XNQJ 4AUKA 1FRLA 4OLPA 4GO5X 4IFVA 4CWBA 2RQCA 3GG0A 3VVUA 3HJVA 4RJVA 3TVZA 2G13A 5KFTA 2MQNA 4UUXA 3HD1A 4X65F 5A2QY 3BBCA 1MG7A 1WWHA 4I6AA 1LWFB 2Q6BA 4DF8A 2BNZA 4OI3A 1UFWA 1B28A 2C2DA 2ZBRA 4FKXA 4R5PB 4PWDB 9ATCB 5HQLA 4E8UA 1MLAA 2FD2A 3EICA 1RP5A 4YDDB 5LSLA 4C11A 4P9SA 1Q8LA 3W9JA 4OX9F 3RB6A 2WTFA 4ILLA 1PIEA 4QYRA 1JLGA 3MEEA 3MPVA 2DHGA 3VF0B 2ZKUA 1UL3A 1YJ9S 3PKYA 1LW2B 1J2VA 4OYMA 2UVWA 2QX0A 1IBKF 1EJ7L 4PCQA 3NS7B 5B08A 3S1TA 2WBMA 2E7WA 2DRBA 2HBZB 5CHCB 2Q1LA 3KJNB 4M5MA 2CPGA 1CBKA 1GH8A 2QE5A 1TR0A 4ZVQB 1R8AA 3HHLC 5DG8A 3LAMA 1CJTB 3SCKE 2EFPA 4JI0J 4ZVTB 3JQMA 3AD7C 1DQAA 1VQ5S 4ZJLA 2IDLA 3FJ2A 3D3BJ 1EA4A 3QZ7A 3D5MA 4FXEA 1H0HB 2M9KA 3C19A 2K3IA 3EZOA 2V63A 1HQUB 2B0GA 4PG7A 4PXEA 3DXSX 3UCZP 4DS4A 2ALZA 3U27A 4FS2A 2UXCJ 3CJ5A 1NH8A 2XTDA 2DNYA 1DHMA 4E2FB 1FTRA 1HBMA 1XMQJ 2QSFA 1NK0A 3PJWA 1NDCA 4HL9A 3BQ2A 4MMOA 1S1XA 2HIQA 3R7BB 4RW7B 1HQEA 4ZPVR 4KY3A 1WC3A 5T41A 2IY5B 2Q66A 5CZXA 3W5ZA 5F8GA 4EI2A 4KFBB 2CPJA 3UN5A 4DR1J 3FC9A 1V3SA 4TY8A 1RAGB 4PXDA 3H90A 2KXFA 2EBEA 1NO8A 3RU0A 4P6QA 4LR7A 3M2RB 1BDTA 2BSQE 3AX2A 3CCJS 4NZ0A 2HKEA 2UXDF 4LVNP 4CNYA 3M8WA 3PW2A 3D1QA 4AQYF 2E1CA 4KSEB 1T03B 2B8QA 3GJSB 5RUBA 1IRQA 1M5SA 4FXWA 1CJUB 2Y3YA 2VFVA 2VG6A 2W7AA 3C6UB 2BANA 4I67A 4EK2A 1D0EA 4IOAQ 4K4YA 5AE2A 4A8YA 1NB7A 2BABA 2MSSA 2XWXA 4MIBA 1IBMF 5ADZA 2I9SA 1ACMB 4DSIA 4PUOB 2EI5A 2BW7A 2HVDA 2Y1RI 4C97A 1D9FA 2YQ3A 2K2PA 2BJ8A 5E2QA 1RHQB 2YNIA 1UA1A 1NJZA 3PRDA 3CVKA 2RDIA 2N4CA 1OYEA 1B0PA 3BKTA 1ZTTA 4BLGA 4RZRA 4WYLA 1AXQA 2P8IA 4USHA 1U1OA 4ZJOA 3SMZA 1HWUA 3DOMA 3IR5B 4OZ1A 2MQLA 2K5JA 1PC5A 1CJKA 2OSQA 3FQKA 2J5AA 1VYAA 2J0XA 2HFZA 4DCOB 2CA9A 5B0FA 2WSCC 4JI3J 3T5KA 4O23A 4K4SA 3KLFB 5HVFA 1U2FA 4H4MA 5J1PA 1UAWA 4C3MA 1RTJB 3QIDA 2IHR1 2QC3A 5B0GA 1TU0B 4KGKA 1TV6A 2DYAA 1H7XA 2DNNA 4O4GA 1PYTA 1XNQF 3PW4A 1LKZA 3QRQA 1SI9A 4B3TF 2ZHAA 1O5JA 3PV8A 3T5LA 2RF2B 4UW2A 1X9WA 5I42A 1HNXF 2YXLA 1NEEA 5KFEA 3CE8A 1KQFB 5HLFB 4BHQA 3RBZA 3QGGA 1FJCA 3VW4A 3T6JA 3AD9C 1VK8A 2DB1A 1SC4B 5KFIA 1WF2A 3CJ3A 1WG1A 5D4NA 4ANCA 1QAJA 1OQ6A 1R0CB 3IWLA 3OR2B 3Q8SB 3QQCD 4YB7A 4QWAA 4PXCA 4MKBA 1HNWJ 1R6YA 1GFWB 3PM9A 2E1MC 8RUCA 2AMCB 3GR1A 1GXLA 3HVWA 2OFGX 4ED2A 3PIPQ 4QZVB 4O44A 3I55S 3M30B 2O67A 4IH7A 1K1SA 3EVMA 1WG5A 1XK8A 2XMUA 3KWMA 2R8HA 4LRFA 1FTCA 2HAIA 3A13A 2B6AB 1G4CA 4EU0A 4F3OA 5AXKA 1Q16A 2GQQA 2UUAJ 2HQ3A 4C4WA 2QL9B 1LEOA 2UVRA 1FKAF 3R97A 3MMCA 4JV0A 3GQCA 3MUMP 5H9EJ 3G6XA 1N34J 2WVFA 1QE1A 2V4JA 2J7WA 4P71A 3P49B 4DBQA 1WACA 4JI6J 3MD3A 1T9UA 5FLXU 4BBYA 3POTA 3KUGA 5F8JA 3SZ2A 4DL0C 1BQMB 1UJ6A 4QQBA 3IM9A 4EGLA 1RT3A 3G82A 4DL2A 4DSEA 1JJCB 3G6YA 3KLGA 3HVTB 3S01A 1AFIA 4J9LA 3PO4A 3R5AA 5HK4A 1L3KA 3TUIC 2W2MP 1OO0B 3IS9A 4A46A 5LJ3Y 1URRA 1KQSR 3CDUA 3HLUA 2YNHB 1VQSA 1PCAA 1IM4A 1XJWB 2F65A 1NPRA 2Y1LB 3GCWP 4WFBQ 2VG7A 4A8OA 3GILA 3EM1A 2RRAA 2FTRA 1KQKA 1EHWA 3T3FA 2F3JA 2ACYA 4OX8A 3U1NA 2FLNA 1D8ZA 4EO8A 4WIIA 4TLRA 4DL5A 2QLBB 2HHSA 3OR1A 3E01B 3DDKA 1IR1A 1F5AA 1AZSA 3B54A 4F2RA 4Q2MA 1I6JA 1GTHA 1VS3A 2QV6A 4IFVB 3N9UC 1B3TA 2CQPA 2XMMA 2DBBA 1Z1ZA 4WU2A 3CCRS 3OTOJ 2N3LA 2YNFA 3DDNA 5KT3A 4F4ZA 1YQHA 2GMLA 4OZ0A 1FXRA 3R7SB 3AJDA 3IBWA 1BWVA 1U1KA 2EPIA 4QIGA 4P73A 1N48A 4K50A 2HNZA 3FVYA 4A8SA 4DJBA 1DLOA 2M8DB 4C11B 3J80Y 3DLLQ 3QGIA 1OHNA 1TAQA 2MY7A 1FRMA 4LBIA 4ZVGA 1TKZA 3IR6B 2C42A 1U1PA 3DM2A 3OW2R 3SCLE 3MFHA 2K1OA 3OUYA 3D6TB 2I38A 3BDPA 1KLMA 3PYGA 3PYEA 3RZAA 3LOUA 2NSBA 4DV4J 1FEHA 4LF5J 3VQSA 3EXCX 3FQLA 1TL1A 4B3MJ 5L1LA 4PXBA 3JQJA 4ETZA 2HLTA 2XULA 2Z30B 3AX5A 2XI3A 1LQ9A 5CABA 3BO4A 1FRXA 2GFFA 3AA8A 1QSLA 3UW1A 3BSNA 1X7VA 4XAKA 2HRTA 1ZYQA 3AJ1A 1NJYA 4JI3F 1TK8A 5A6WA 1U24A 4IOCQ 3N79A 3GXQA 3CULA 4B08A 4FPIA 2W7PA 5K20B 2B51A 3V4MA 3TQEA 3E2EA 3BJYA 1VQ7S 4CIOA 1R0BG 2H5IB 2BV3A 4KH1B 2NXJA 2YKPA 4PPDA 1L3VA 1HBMB 5HBMA 3MECB 2WCXA 1UETA 2HVIA 4HEA9 2ZH9A 3MUTP 2OPSA 2B43A 1RHKB 1S1XB 3R8YA 2DHAA 5T7LA 2XHWA 7AT1B 4RNNA 3IG1A 2E9TA 4ZLPA 3R1LA 4FYWB 3CCVS 2OSRA 1QTGA 1Y11A 3NS5A 1RTDA 2XTEA 1RT2A 1HNWF 3MOJB 1YJVA 5CAAA 2IRYA 2YWHA 2W2PP 5E3QA 2C22A 2HFSA 2QGFB 2QTWA 1RU1A 1YJ7A 1MMLA 3KDOA 3C2PA 3BREA 4Q44A 5F8NA 2LA4A 1XERA 2B7CB 3QOQA 3I0SA 3E51A 3NNHA 1R8CA 1YRTA 3PRBA 3NNAA 4ZVPB 1RAFB 4LSZB 4H54A 4NWBA 2VG6B 3M8ZA 3CDBA 1GX6A 2SXLA 2Z2LA 3DOLA 4H4OA 4MTPA 2BANB 2VDIA 4N56A 1KQGB 1VR6A 4P52A 3BB5A 4DFKA 2AJFE 3CSKA 1PG5B 2DGOA 2N82B 1X5SA 4LF9J 5J2QB 5IT9U 2QLJB 2HHUA 2G2YA 1IBLJ 5HO4A 2FYXA 1UWBB 1TQLA 5CD4A 4AL6A 2OH2A 1RKIA 2VKRA 1S5ZA 1H98A 3FSIA 3NWGA 4A8KA 4K5RA 3FKBA 4PRFA 1L3SA 3JAMU 4FF1A 1Y5LB 4KBIA 4RW6A 2WOMA 4FF3A 5KG3A 3IXQA 4EEYA 3ZNJ1 1KN6A 1RK8A 4OV6A 3DOMB 4ZCLA 2XZWA 4IRKA 2H9ZA 1RT4B 1CJKB 1OY9A 1X4EA 4EYIB 1VRUA 4IR9A 1TL7B 3RAXA 2K6LA 3RR7A 4ZLLA 1KFDA 3OSNA 1NJIT 2QYGA 1MMDA 1RBLA 2BE2A 4ITSA 1DAXA 4C0BA 3HDSA 2KG1A 5JXSA 4P2FA 5E41A 1IN0A 1EP4A 2AWZA 4J7CA 3M8QA 1TV6B 3SEOA 4O4GB 3AAWB 1VQ6S 5BR8J 4YUDA 1C2PA 5GAEU 3RG6A 1REVA 5LMNJ 4F4WA 2CQ3A 2HHPA 5I42B 1TL4A 2BA9A 3DLHA 4F25A 4J9QA 4F3QA 1S1WA 1NK5A 4ZKAA 5KFQA 1SQEA 3WX4A 3ET6A 1ZA2B 1VQ4S 2VBXA 4DV6J 1TP7A 3P6YC 1H2UX 2HNYB 2D68A 2BX6A 1TMMA 4FYDA 1G3OA 3VAKA 4XIUA 2QIFA 5D4PA 1WC0A 5E7OB 5C25A 3MDFA 3QT7A 4TLQA 3ENWA 3OTBA 1VHIA 2B56A 4DEZA 5D77A 4O44B 3K5LA 4WJBA 1H38A 3HVRA 1Y0HA 3QMQA 4ILRA 5CYQB 4DV4F 4HHHA 2ZNYA 4OZLA 1KSPA 2G2ZA 4LF5F 1UVKA 1PGZA 1Q16B 2IAJB 2FVCA 4J91A 3DRXA 2UVVA 1TELA 3OTDA 5A6PA 4L3NA 1RACB 3MMCB 1WKKA 2Z57B 1UMJA 1QE1B 2POKA 2OMOA 3GV8B 5CXTA 1HARA 3W5YA 2NQPA 4DV5J 2AEMA 1S6QB 3DRSB 5LSOA 2BQRA 2G4BA 3PXGa 2MPUA 1RT3B 3DHWC 4KRWA 3DGPA 4QWEA 4NASA 4TKTA 2MZJA 4KTQA 2RT3A 2CPXA 5J2PA 1IKWA 1CSJA 2JLGA 5LT5A 3KLGB 2C2EA 2B5JA 3IBCB 2H54B 4PQAA 4OX6A 1XEZA 4HKQA 1R7IA 3IS9B 1S57A 3M8RA 4M5NA 1HHSA 5J2MA 4Q45A 3IO1A 2LA6A 3NGTA 3DU5A 4DFPA 3QRRA 2HGLA 1T9YA 1N5SA 4ES2A 1RCOB 4G1QB 3DRPA 5K8NA 4DPWA 2WSFC 3HD2A 4PYAA 2GVDA 4OJHA 5C42A 1ZM3A 4OZ3A 1W26A 2DVIA 1SC6A 2MKJA 1Q86T 2C1EB 1FD2A 2ADBA 2AHOB 4ZPBA 2R2TA 3OR1B 2C3OA 3AODA 3M6UA 5K14A 4QW8A 5IM0A 4ECUA 1HHQA 1AZSB 3HM9A 2HIYA 4KR0B 4OHVA 3SSSA 2FQQB 1FWPA 3A8KA 2R8GA 4EFAC 2JXIA 5GAGI 3PZPA 4NCGB 4DG1A 4ED7A 1HKAA 2YNFB 2WONA 5THWA 3KLEB 3BEGB 2V8VA 3HSJA 2BR0A 4USUA 3FBCA 3HI9A 5L39A 2EK1A 5IC4B 2HNZB 1KS2A 3FMTA 6AT1B 3JSRA 1D8YA 3MMJA 4LF4J 4KGXB 1WC6A 5AJ3J 4LF9F 2HQDA 3A1YG 3J7Z5 1T9XA 1IBLF 6FD1A 3B4MA 3R2DJ 1RWVB 4LREA 2YKMA 3THPA 2CAJA 1TKZB 4IFYA 2ASDA 3MTKA 4LJMA 4LSNA 3G86A 2HS0A 4UZCA 5L46A 4XPCA 1GQEA 1RHRB 1N0VC 1B7YB 1KLMB 3VWSA 4IDKA 4QIVA 2F8HA 1RTHA 4Y6IA 4I7FA 2E66A 4V1Ak 3TANA 3DNCA 1TL1B 4NE9C 2KJVA 2ZC4A 1FJEB 3KHGA 1CQNA 3TA2A 1ZS6A 2JBVA 3BQ1A 2AYGA 4CNZA 3CO9A 3EZ5A 2JNJA 4DV7J 5IV3A 4I4BA 1G1XA 2ZUGA 3V6DA 2RRBA 5B0CA 2YNGA 2JX2A 4DHVA 1N54B 4X4PA 1T94A 4USJC 3WBZA 2BOPA 3DN9A 2GQ2A 4QIWD 4QCLA 1JJHA 5BR8F 3NL0A 3GJRB 4R8UA 1KWMA 9RUBA 5J1EA 4QU6A 2ZH6A 2MLXA 2BKNA 4M5LA 3FRZA 2HK2A 3MMBA 3CCQS 3CJ2A 1U09A 2OPSB 2VV5A 2W9AA 2PN6A 3O5TB 1K8AT 4LFAJ 1RTIB 5T7LB 1VC6A 3VGTA 1U6ZA 2LKZA 3MCSA 1VQOS 2XHCA 2ASLA 2XNRA 3UNYA 4EO6A 1FVQA 3HHLA 4M5GA 3GFYA 3BSOA 2DH7A 1TK5A 1SKRA 7FD1A 5IWAJ 1HNZJ 3Q24A 2AJQA 4RLEA 1PJ6A 2M3DA 4UZBA 4FYXB 2DY9A 3IFEA 4ZVFA 2WSEC 4JV5J 2DRDA 4O3SA 1YRUA 2KXNB 5EX3A 4F0KA 2HZVA 1P94A 2KB2A 3BN4A 1NK9A 4ELVA 4MT1A 2I5JA 4J90A 1LW0A 3I0SB 3MD1A 3UCUP 3CCSS 4K4UA 2BJ7A 1KP6A 1VQ9S 3NNEA 4ELTA 5AT1B 4K2XA 4FZVA 3HHDA 3V6JA 4IR1A 2KHDA 3CT9A 5ITHA 3DOLB 4H4OB 1FD8A 3HFVA 2J9DE 4FDFA 2L9WA 2N3OA 4YP3A 4JI8J 3AB4B 1H74A 5DM6Q 4G3IA 3BGUA 1BD6A 4RW4A 2DNQA 4OI2A 1OPZA 5KAKA 4C0OC 1C4AA 2BKPA 3LPYA 2DNGA 4OFZA 2LEBA 3QT5A 2EG2A 3K89A 1UJ4A 4YFUA 5KFMA 1XIQA 1JJ4A 4CLZA 2E7XA 4JOUA 1VBKA 1X0PA 2UU9F 4RKUC 3BR9A 2JJ4D 1T05A 4X62J 3I5CA 2E5HA 2KZMA 2P9GA 2XSJB 3MPWA 1MYKA 2XMTA 2IFXA 4P10A 4U95A 3C14B 4ZIVA 3PG9A 4YHHJ 1P1LA 4RW6B 2WOMB 3EXYA 4ECQA 5H9FJ 2ZKTA 5IS2A 1XNRF 2X1BA 5KFLA 3CIZA 4XDCA 1SQFA 2K7KA 1TAUA 4OYXA 2OAUA 3EVWA 4M63A 1JXVA 2YQ1A 3GP9A 2R7SA 2FLLA 3VGSA 3QIPA 3W2WA 3MEGA 2BE2B 5KFAA 3VV2B 2DH8A 3CCTA 3ADAC 2X3DA 1EP4B 1X5PA 3I82A 2BA3A 3M8QB 2DIVA 3PFOA 4Q5VA 3BN7A 2QJ3A 2MKCA 4RUAA 4DUYJ 4K4XA 1REVB 1M5VC 4N77A 2CJAA 2XY5A 2R42A 4Y65A 4YQWA 4PKDB 3QNWB 4CYUA 2GO8A 4LFCF 4KKOB 2QT7A 2JFKA 5FDLA 1S1WB 5EX0A 4I6YA 5EWEA 2VB6A 1KVJA 2NXCA 3BGOP 4LF4F 3ET6B 3Q23A 1JLQA 4RPFA 2HHXA 2AJ0A 2CNLB 2DNHA 2MZ1A 4KO0A 5I3PA 2RQ4A 3UN2A 3D54A 4K59A 3QYYA 2CZ4A 2W9CA 5C25B 2LCWA 3J81U 3R5GA 4KHPJ 4LF8J 2F1FA 4Q0BA 1U02A 1EARA 1Q79A 2J0SD 4CO0A 2R9LA 3H87C 2E7VA 4X66J 1X4AA 4IG3A 1SB6A 2JH3A 2X51A 1TKDA 2MQOA 2APOA 4I64A 3V81A 1XBWA 4PG4A 2HGMA 4IUFA 4FPRA 3OJUA 3VAMA 3A8JA 1SUQA 4DV7F 4PG6A 4ZVUB 1FKOA 2DO0A 2WHOA 2UUWA 2CZ9A 1Q82T 2CPEA 5LMUF 1UVMA 3THTA 2M2BA 4P2SA 1YK9A 2K29A 2FHMA 2EVZA 4K0KJ 3DGPB 4ZHRA 2JL9A 1RDRA 1JWWA 2AGPA 4DSKA 3FDSA 1IKWB 3TO8A 4USWA 4FYVB 3M1VA 2QLWA 2B5JB 2XZTB 3EE3A 2EFGA 2M52A 1HD0A 3OQ2A 1XC9A 4LSLB 1JLAA 1SC1B 5FLXY 2KRRA 2OPQA 2FZCB 4DCJB 2J7KA 4DV0J 3TQ1A 3R1HA 1S9FA 2RUGA 3HHKA 1EAYC 4KGZB 5EGYA 3RRKA 2JC0A 2PSZA 5IWAF 5F41A 4I2PB 4F0HA 2IJFA 1VGYA 5C42B 2ZBPA 1NLKL 1U0HA 2AD9A 3I4HX 2VBZA 2QMXA 1HI8A 1S4FA 2RSQA 2V2QA 2CYYA 1QUPA 4MJWA 2X1FA 3G2XA 2VONA 3GIJA 2LYVA 5IM0B 1SJ4P 3OLAA 1RISA 4TY9A 2OELA 3KK1B 1TUGB 4ELUA 4NXNJ 4Y2CA 2ZHOA 3A8EA 2ROPA 4AD6A 2KZZA 1N33J 1KKHA 1T95A 3TX8A 4MFBA 1B4SA 4DG1B 1EZZB 3ISNC 5E5NA 5IT4A 4L75A 2XS5A 2WONB 2F7VA 2YH0A 2VICA 1X9MA 2DGSA 3AB2B 3MI7X 3W2VA 2XLJA 1Q4RA 4WFXA 4F2SA 3LH2S 4CLYA 1NZAA 1RWWB 4NLTA 2K3KA 3BO3A 4NCAA 1MNEA 2RHSB 2KFNA 5HI7A 1UKUA 4C8OA 2XMWA 2AJ2A 4NMXA 1RWKB 3I0RA 2YKMB 5KG4A 2P6TA 2RH3A 3Q8PB 3H5YA 4LSNB 1VBYA 4U7UD 3TOQA 1N5QA 4J9UE 3BF4A 3ZZUA 2HHQA 2GVZA 2ZD1A 2BQ3A 2EWHA 4WXWA 1RTHB 2LQJA 1ZBTA 4I7FB 3OFHA 3CJ8A 6FDRA 2EXUA 4DPYA 2FVPA 4N76A 2EW9A 4NLRA 5DLFA 2LQ8A 1VLYA 4YB1P 3DGVA 5H9EK 4NPOA 3T6BA 4GVBA 3V6DB 2YNGB 4Y2MA 2KN4A 5D15A 4DQRA 4V19X 4QBUA 2V34A 4XTTA 1YZ6A 5KFWA 5G4DA 1RYSA 1R43A 3CXCR 5HROA 1BMQB 3MAAA 5IOLA 3AQOA 5F0UA 1U26A 2AGOA 3NNCA 4DUYF 4ILMA 4R8UB 3E8OA 5J1EB 2DD8S 1NZ8A 3MMBB 4X2BA 4AXIA 4CLFA 2EBGA 2VL1A 4EUVA 2IM3A 3MAHA 2R8IA 4LRVA 2MJNA 1BE4A 4NZ7A 3UI3A 3RRGA 2Y1JA 5KT7A 3HHLB 3SDEA 1JMTA 3L4BC 1U2CA 2MB0B 3X1LB 1RE1B 3TAQA 5KFZA 3D2WA 1FJGJ 1VQLS 1T11A 1CULA 3M6WA 5KFVA 4ZN1A 2DCLA 4DV3J 4JI1J 4ER8A 1RWPB 5JVHQ 1HFEL 3H98A 4DR3J 4KHPF 2D3UA 1BGXT 4WTOB 4HACB 3GB0A 1LW0B 5A8WA 4ZVRB 3MF5A 2PD1A 4RUHA 4OZJA 1YWXA 3ZZZA 2VA3A 4ICLA 1UFLA 4ZVHA 5KT4A 2MKIA 1KVKA 3CIMA 1FVSA 2XYHB 5E3PA 2VPXB 2B9WA 1U47A 4U8YA 3GFXA 3IAM9 3I9V9 3SV4A 2XLIA 2NXUA 3KJFB 4WKYA 2E1PA 3RBDA 3KLHA 5MAOA 1LK7A 1F9FA 2HFNA 4UF4A 2F4VJ 2QLXA 1DTQB 4OZ5A 2JEJA 4K0KF 2BJDA 3KDNA 3GG1A 3GLJA 5H1SV 2ZJQQ 1T05B 3NGDA 4J9OA 1NKCA 3ONQA 5IT9Y 2OP5A 1FI4A 4X4RA 1X60A 3IRXA 2DNPA 2PFFB 2HK3A 4YEAA 4TVAB 1F6TA 3M7VA 1UVIA 1WF1A 1BC6A 3UDEA 4D8JA 5KFPA 2GC8A 2DKOB 3QLHB 3NOGA 2AF6A 2C28A 1MN7A 4D3HA 2G0IA 3H59A 1T8EA 2HURA 3M9OB 3JAMY 3CNQP 3FCVA 4LF6J 4OHYA 2KFZA 2LXFA 3UD5A 2HVHA 1VDHA 3W2WB 4CH0S 2OPPA 4DMZA 1UTAA 3W62A 4DX7A 1FKPA 3JXOA 3MM5A 4KYZA 1HBNA 5JUMA 1Q8BA 4OZ2A 4ECRA 3O8WA 5A0YA 4NXNF 3W5XA 3GIIA 3M8YA 4UY85 1U49A 1SH0A 3G6VA 4DQQA 1MU2B 3AWRA 2JEGA 1NDLA 3PY8A 1UJ5A 3UN3A 4NI2B 4WTYA 3ITHA 2FY8A 4CYUB 1MMNA 2UUBJ 3ETMA 4LIWA 5FDLB 3MCMA 2P2CB 2HVZA 2Y1IA 1I94J 1JLQB 1WHVA 1TKTB 2CWKA 4NEZA 2V8DA 3RJMB 1E6VB 2HS4A 5KFDA 2CIMA 3GFHA 4KO0B 4RU2A 1QAYA 1KHWA 2AQ4A 3FEZA 4DR6F 2DEIA 2V4RA 3OL9A 2W9CB 2WW4A 2YPZA 1TL3A 2F9DA 3NGSA 3ZO7A 1QM9A 4OX9J 2H3EB 1DY3A 1AW0A 4IO9Q 2XS7A 3GSDA 2L08A 4DU8A 1T02A 3DMJA 2QFJA 2BOAA 1DARA 1XR5A 3GCXP 2V9WA 2HNDA 5CYJA 5FJ4A 1B0TA 1IBKJ 3TNVA 3V81B 1KLNA 2XGPA 3KLIA 3NBPB 4C6AA 4J9KA 2FJWA 3P96A 4G65A 4HLBA 2BE9B 2B4UA 4M94A 4F67A 4LQ3A 1X4GA 1FKOB 4QJVA 4WP9A 2NZ4A 2H4WB 4ALZA 5DQHA 1R6VA 2XQCA 3SCJE 3C3LA 3CC4S 3TYTA 1RAIB 1RAAB 2JZ5A 2H1YA 3MXHP 4P2XA 3EMTA 2XBPA 2AYBA 2ZM6F 4DPUA 1OIAA 4OI1A 4ZHRB 3DRRA 1A9NB 2IRXA 3UQSA 2W25A 5A8RB 2PI5A 2IIHA 2NS1B 4B3SF 3M1VB 2LP4A 4HTIA 3CCMS 5D4LA 3GE9A 2OPQB 4YR3A 3DLJA 1O8BA 4DX6A 1Q53A 4WP8A 3AFGA 1NDKA 1U48A 4XO0A 3VALA 1RCXB 5HQ8A 3MM9B 2V67A 1P27B 2QA1A 2KT5A 3Q0AA 2CADA 4KV8A 2AEFA 5KFHA 1SJ1A 4OYZA 4DV3F 4JI1F 5KFXA 4ZPCA 2V69A 2HVEA 2UV8A 4KH0B 3H25A 3GFZA 3CMAS 3QJLA 4DWIA 4BC9A 2V50A 4RL1A 4EZ9A 2V2ZA 3O2IA 3M32B 2VBYA 4LRDA 2R2SA 1TKXA 1RT6B 4NLPA 2UXDJ 4GKKF 2FHJD 3W2VB 3GZ7A 3PCOB 1RAHB 5F9NA 2IDEA 3KK2A 1DBDA 3DKDA 5D4OA 3D67A 1JK9B 1VOMA 3T9ZA 5F8MA 1FNXH 3BYPA 5GAEI 4CLUA 1KNZA 3LP1B 1F60B 4NEYA 3GV7B 2F4VF 4HR2A 5SUHA 3CJTA 4USIA 1OM2A 4I2QA 1RABB 1M1GA 4CTAA 3OXFA 2GVZB 2VG5A 4ES3A 3DYAA 3NWRA 4DR5J 4JV1A 4PABA 1EKSA 1HW9A 4JI5F 2E5IA 2XEXA 5B7WA 4USTA 2BYCA 1LFWA 3RR8A 4BWMA 4NA1A 4EBCA 4NYPA 4UOFA 3AQPA 1JKHA 3MR2A 2EEYA 1M5KC 3UO0A 3IRWP 5ETRA 3ULHA 3CJKA 2FVQA 4CQ1A 2MYFA 1YI2S 3FZ2A 1JXLA 3TI0A 3F44A 1YJNS 4GVBB 3JSMA 4LF6F 1FHTA 3NAIA 3ZZTA 2JVRA 4HHUA 2FHKA 2DJWA 5E3RA 1QUVA 3M2VB 5DG9A 5HROB 1PILA 3PW5A 4Z2XA 2GGPB 2RRNA 3KHRA 3HXMA 3UDCA 3TRGA 3R5JB 2YKOA 4YS2A 2DHHA 4M5KA 1RGVA 3KYLA 3NGUA 2JEIA 3TAMA 1B01A 1U6FA 5B09A 3R5CA 1RHMB 2X7IA 4O4RA 4FNIA 2Z8QA 2XO6A 2UUBF 3I5BA 2B4OA 1ARQA 2QL7B 4YDXA 1Z4UA 1I94F 2WRMA 4B3TJ 4C98A 3Q8QB 1HHTP 1VQYA 2CPHA 1VQKS 1HNXJ 2DGXA 1CULB 3LP0A 5KG1A 2NSCA 3Q89A 4LQ9A 2HZCA 2W4DA 4UOHA 3VAFA 3W63A 2DGTA 2CFXA 3PEHA 3K59A 3JSYA 2E5JA 1UEKA 3DOKB 4AAIA 1DJ0A 4MKYA 4K4WA 2NLWA 3N01A 1CEZA 2D3O1 3G9CA 2AJ1A 4WYWA 2ASJA 4QR1A 3B82A 1V5IB 4ICLB 2L41A 2AX1A 5DDRC 3H2UB 3DLGA 2X1GA 2XG8A 1J5OA 3LA0A 2AJ4A 4HDHA 4LF7F 3P4UB 4B9MA 2GO9A 2X1AA 1WNEA 3U1MA 3TEHB 2R4FA 1KBRA 1HBUA 1I3OB 4CRJA 1K9MT 3HT3A 3KLHB 2Z2MA 3SQGB 4RW8B 4JBCA 3LUYA 3ZZYA 2HMIB 3W8PA 1HYSB 2KU7A 3MEKA 4F0MA 1OPIA 1NK6A 3NMRA 2V8PA 2HZAA 5D3GA 2FHOB 4LMZA 1J27A 3G8TA 1TL5A 3EGVA 1B64A 2W7OA 1RAEB 5F3TA 3G6ES 1WEXA 3TARA 2DR8A 3Q8RB 1UPMB 2IJRA 2I8EA 2QEXS 4IKAA 1ZZNA 5DDQC 2D69A 1U8WA 2V94A 1VJQA 2HG4A 3MM7A 5D0RA 1U1LA 5IC6B 2DRAA 4QPXA 3CC7S 4Q43A 3PYDA 4F3MA 3K5NA 2OPPB 2OLWA 3QJJA 3OL6A 4ZS6A 1FKPB 1P9YA 4YB6A 3MM5B 4WZQA 5DJBA 5CD4H 1HBNB 1G7CB 3UE2A 5A0YB 2V1SA 1QY7A 1IXKA 2YWEA 5L9NA 3QFWA 4GKJJ 5HJXA 5G0RB 1HNVA 1F0XA 2XYPB 1RUSA 2UUTA 3LGMA 1D1UA 4M8LA 3K8WA 2DISA 2LFVA 3ITHB 1X93A 1HBOA 3K8VA 2J7UA 3HX9A 2VFTA 2CQHA 5SZTA 1SKWA 4DL3A 2J6SA 2ABYA 1YBAA 1L3TA 4CT9A 3BYRA 5IT0A 2CPFA 2FGOA 1WJ9A 5KFFA 3MURP 3HJFA 2Z56B 2BW2A 4W90B 4GVLA 4KB7A 3EDQB 2YKQA 3LAKA 4C0HA 5M2UA 2VHGA 5A8KA 1JLEA 4F02A 4ZVEA 3OXLA 4DR5F 3RW7A 3H4BA 1AT1B 3KG0A 1ZM4A 1RT5A 4CH1A 4ZP9A 3V4IA 3CMES 3BGRB 3L7PA 1U6BA 1YGYA 3MFIA 2YQ0A 4MIWA 2BM0A 3D6HB 5LL6d 2DR6A 3GMGA 1XQIA 2DEJA 1EETA 2YX7A 2FVRA 3J81Y 1JLBA 3KLIB 5D0EA 3KTQA 3VAHA 3KG1A 1BUXA 2E1RA 2D3ZA 1KOHA 1TVRB 2JVOA 5DZ7A 3FSXA 3PIOQ 3T5HA 4N5SA 2JOQA 3KNAA 1WEYA 3WC2A 1OY6A 2ZH3A 2E5LF 1GXTA 3KXDA 2HBQB 1M5OC 4KJIA 3D6FB 2ATLA 4WCEQ 5GMDA 4FVCA 1SIZA 1HPZB 3BZQA 3AA9A 1H73A 1P9QC 2K7JA 1X31C 2V1TA 1IJFB 5AE1A 1R27B 2ZH7A 2Q79A 4X4TA 3MR3A 4B9TA 3UCGA 1S9GA 4EYHB 3HK2A 1Q1KA 3OFGA 2GHWA 1SJRA 2YX1A 2QO3A 5I3UA 3PR4A 3P45B 2DXEA 3PJXA 4CZCA 1U0SA 3P3DA 3DC2A 4ECZA 2AN7A 2BBEA 1C0TA 1KONA 2HGNA 2MKKA 2ZOMA 3PO5A 1P1TA 1QDUB 2ZNZA 2PA3A 2DXDA 2Z4PA 3HHNB 4HTJA 5AXLA 1OSDA 3JYTB 2MHEA 4DR4F 1UCNA 4KE5A 4M5HA 4JI4F 2FJXA 1RLDA 1C1BA 3L7UA 1N36F 2NZCA 4O3PA 2AV5A 5D0GA 2M88A 1N52B 3OVSA 3OHBA 3EGZA 4YOEA 2B9YA 2AT1B 4DFMA 4NLUA 1JLFA 1ARRA 2BACA 5HSPA 3D3CJ 2AIRB 3T1YF 3U7JA 1TKXB 2XCPA 1J5EJ 2YPYA 1LWFA 5KFUA 1GMWA 2ZBIA 3Q83A 4DR2F 4PWUA 2MZRA 4R5PA 3FSYA 2W2OP 4ID5A 1FDDA 4QR2A 5J2NA 4IRDA 2W24A 3G96A 3IAS9 1IKYB 2W1BA 3N6NA 4F8RA 4R25A 3CCES 2VQFJ 3CMQA 2PDAA 2BEFA 1HW8A 4DQIA 1MWYA 4ID8A 1LW2A 1K1QA 4NA3A 2LMIA 1KVIA 1JLCA 2ZH4A 1AROP 1KFSA 1YKWA 3ZNUA 1ZM2A 4M1KA 3JB9k 4ZP8A 4NLXA 5E0OA 2ZZMA 5L1IA 3LP2B 1YZ7A 2JRSA 5CZVA 4CTAB 1CVJA 4ZLNA 3KOAA 4RBUA 4MH8A 1QVFR 1A0OB 3VEBA 1RT7A 1K47A 4DX8H 3LWMA 4LR8A 4RBVA 1WOOA 1LNQA 3ZZRA 1CJTA 3KMSA 2LVWA 2G1DA 1GMUA 1JKHB 2A6MA 4TYBA 2AEJA 3MM6A 1RA6A 4RNOA 1BY9A 3PACA 3CJKB 2KFYA 3EPGA 2PI4A 2KKHA 5KT6A 4Y0FA 1RT1B 4WU3A 3TP2A 3JSMB 2RS2A 1VIOA 1HQUA 4RUCA 2ZHBA 1YVFA 3R27A 4CM0A 1WEZA 5KFBA 3KHHA 3QO9A 3T41A 2D9PA 1TUVA 2MKYA 2R8KA 2XI2A 1WF0A 4GKJF 2EC0A 3VEAA 3PR5B 3SI8A 1HWJA 5KFJA 2D3OR 1M5PC 5L1JA 1HQ2A 3TAMB 1KTQA 3TVKA 4A8XA 3IM8A 3MPYA 3MWBA 5CQGA 5IFMA 4NLDA 3ISND 1WDDA 3LO3A 5CH7B 4DUTA 1DTTA 2FC8A 2VODA 2GMHA 2LEAA 2B4PA 4FF2A 3M05A 3LP0B 1T3NA 3GTYX 4CO1A 4X84A 3AJ2A 2A18A 2H5JB 3WC0A 2QLFB 2UUCJ 3AOAA 3CF5Q 4N47A 1Q7LB 2P6SA 3BGLA 3OFEA 3S6EA 2YKAA 3SCIE 2RS8A 1JLGB 3MEEB 2NREA 1IWAA 1ELOA 3ZC4A 3G87A 2H65B 3AY0A 4FYYB 4OX7A 4DPTA 3C6UA 3M2UA 4B9LA 3WX8A 2RNEA 1FFGB 1G6BA 3N0VA 1JNRB 2G0JA 3ILIA 2CWXA 3RGIA 2OEKA 2HHWA 2ZVSA 3QBCA 3W66A 3MCNA 2JEFA 2IMOA 4P7TA 4KHMA 2ZITA 3G8SA 1R8PA 3IC1A 4DS5A 1BQXA 3FT7A 3M9NB 2E9RX 2N7CA 2K1RA 1UZHA 4RO0A 4MKAA 1XN9A 3FBBA 5EHHA 1XMOF 1FA0A 2OTJS 5D3GB 3CPWR 2LQ9A 2MQ8A 3D1HA 1YIJS 3BGFA 1VC0A 3VAJA 1X4HA 1X0FA 1S1VA 1NB2A 2AKWB 2W8KA 5LOQA 1SL1A 2OKQA 2L9DA 4Y34A 4OJ1A 1M0SA 3C46A 4TU7A 3WIVA 2BJ3A 3R2CJ 1FK9A 2ZWOA 1O51A 4HYKA 2CQ2A 4DOZA 1LWCA 3BH7B 2Y0BB 4DLGA 1HQEB 3CC2S 2AGQA 4OL8A 4JB8B 1P8GA 5D6GA 2GAGC 2UXBF 4HVZA 2ZFHA 2AX0A 2J0WA 5GAHU 2ASYA 3ENVA 3JTPA 4TY8B 3P5TL 1SQGA 2CNKB 2PT0A 4B02A 4DDFA 2HHHF 2ZE2A 4C2MA 2XY6A 2ZDOA 4ED3A 3K5PA 1HNVB 2RF2A 3MOZA 4BDPA 2B8PA 4HI1A 4RNMA 1J5EF 2BRLA 2VF3A 3OHAA 5HLFA 3AXMA 3UNGC 2GHPA 1HBOB 2ZOFA 3VQTA 2Y9HA 1U7LA 4DV2F 1UPPA 3UDLA 3FZBA 2G0CA 1PBUA 1V6HA 2VQFF 1T0TV 3OR2A 3H5UA 2GV1A 2NXNA 3I4PA 3O44A 2XY7A 2C2OB 3QGPA 4OI6A 4M5JA 3MPUB 2W9BA 2MQQA 5F8LA 3QSIA 1L5UA 2FJAB 3TAPA 1JJ2R 4OI0A 5A8KB 1EX8A 1Y5IB 3SXLA 2VA2A 1RT5B 1NSAA 2VKZG 4O3NA 2KYXA 3SYZA 4WK3A 2BZ2A 4PYDA 2WW8A 5KOXA 3WQPA 1SL0A 2RVJA 4PWWA 2OEMA 3EVOA 4KPYA 1WHXA 4URQU 1X4CA 2IPOB 2YNIB 3T1HF 3LANA 3UFCX 2BJEA 2PE8A 1FNOA 1SVDA 1Q5YA 5DLGA 2QFIA 2AW0A 2LEPA 4JI2F 1BQMA 1YBUA 5ETPA 2KG0A 5KG5A 2HPUA 4YR0A 4MK8A 3HVTA 1KR4A 3BSCA 2DNMA 1F9EB 1IR0A 1RWMB 2DGQA 4GO7X 1S9GB 2GCFA 5C7PA 1RWNB 2EKNA 5L1KA 1IR2A 4YR2A 2DR7A 3FK4A 4H4MB 2J8SA 2UVUA 1FESA 4NZ6A 3P5BP 1C0TB 1RLCL 2ZDPA 4OHXA 3CJRA 2VPZB 2OGUA 2PMHA 2Z2ZA 1D09B 2EFOA 2ADLA 5M2PA 1H3DA 1IBCB 3CCLS 3ILJA 2CQGA 3DLEA 2M5YA 1HD1A 3CJQA 4QW9A 1QTMA 1RKJA 4NLGA 5FD1A 5DGAA 1C1BB 4OQJA 1Q0NA 4KT0C 1FNMA 3MTJA 4I0WA 5CCMA 4PAAA 2C2RA 5KT5A 2UUCF 2N7YA 2IA6A 1REGX 1BLUA 4JYAF 4A47A 1JLFB 3M6VA 1YTYA 3KG4A 3OSPA 2DK2A 3MAQA 4WPAA 3GYXB 2EKYA 5F9LA 4DX5A 3HSGA 1R89A 3H20A 2CJQA 5I3QA 5JVGQ 1WTFA 3N5BA 2ERRA 4ID5B 1F2GA 4NLVA 3FEXB 3SFGA 3MPDA 5J2NB 2MHNA 1OS5A 4QOTA 3N5FA 1TK0A 3CDAA 1EQMA 1O0PA 3IP0A 2IM1A 2HW3A 1Y5NB 2XMAA 3J7YU 2ZJPQ 4Y2AA 3BS9A 3TZZA 3B8HA 3NRBA 1IQTA 2CJKA 1JLCB 4ZPAA 4FBUA 4ERDA 1MN9A 3R5BA 2HWHA 2A2DA 1Q8KA 3OFFA 3FCWA 3B6BA 5KFKA 2IYIA 1R8HA 4WK1A 1KEKA 5K8OA 1OG7A 1Y7PA 2V4JB 1D9AA 5EN1A 3VAGA 1RT7B 1TTHB 3POTB 1HI0P 1WHYA 2HFOA 4WIQA 2CJBA 1AB8A 2ZH8A 1Q81T 3H2VE 3G82B 2XTCA 4ZOSA 2UU9J 1T9VA 1KRPA 4C8ZA 3MM6B 2M4MA 4Q8EA 5LXYA 2HWTA 3FEYB 3MR6A 1FWLA 2DXFA 3N28A 4GC7A 4TN2A 1S59A 1CPZA 1WHWA 2CJXB 1ZOTA 2U2FA 1JNZB 3FBFA 1XNRJ 2OO4A 3DDIA 2FY1A 2CPYA 3KHLA 2A2CA 1M90T 4CH7A 2OTLS 3C6TA 4U7CA 1FFWB 3QO9B 2VG7B 4KQZA 3ILOA 3TJ8A 2CRLA 4PEOA 1V9OA 4TNOA 3MECA 3HULA 4NCBA 2CG4A 2QA2A 2LXIA 3EZUA 3CW2C 2H3AA 4PQUA 4UUWA 3CD7A 3U02A 2IM2A 2V5HG 1VQPS 2ZWPA 1ZAVA 2W2QP 4DSFA 1DTTB 3NCPA 2F9JA 1NPPA 4C9DA 2A10A 4H4KC 5DM7Q 3AOBA 4AXJA 3OL7A 1WC5A 4CM2A 3T9NA 1HL6A 1S4EA 5DO2A 3D7SB 1C1CA 4J9SA 1FRHA 3LTOA 2LXUA 2K06A 4GMKA 4HT5A 3I9ZA 4LFCJ 5KG0A 1G2EA 5HVHA 1DLOB 2KM8C 3QSYB 1NK8A 4DL4A 2CXEA 2F8EX 1JX4A 1XMBA 4DI6A 2IRUA 1VI7A 2W8LA 4OYOA 1MW7A 4OI4A 3LWLA 3M2UB 1FFSB 1RB0A 2OEJA 1GT8A 1NK4A 2F8MA 2ATCB 3DM2B 3O3LA 3PFEA 1YLXA 3OUYB 1NAQA 4Q8FA 1H7WA 4K8RA 3K57A 1Y3JA 2OMLA 5IXUA 2ACMA 5J2QA 1Y3KA 2RE1A 1LXNA 1UWBA 2HYIB 2XS2A 1U1NA 1NXIA 3JTNA 1VCTA 4ATNA 2K1RB 1F5CA 1FX4A 1QAXA 4G1IA 3SV3A 2G2OA 4I6WA 1VRQC 2KXHA 2Q43A 1WTBA 5LMUJ 1MWQA 3R7NB 4MAKA 2CNOB 1S1VB 1C0UA 2Q2KA 2BQUA 1KTVA 2GIFA 1RT4A 2HHTA 2Z0GA 5L8RC 4QU7A 1TL7A 2RBFA 1JB0C 3MEDA 5HBMB 1RXOB 3CJ4A 1RHUB 1S49A 1S6UA 3LGNA 1FK9B 3CEDA 1UEUA 1LWCB 3Q86A 3HO1A 2RDJA 1PC4A 2VIHA 4LRCA 2MY8A 1SXLA 1HR0J 3IG1B 3BQ0A 2CKWA 1ICEB 1AUSL 2EG1A 5KG6A 1U1RA 2BKOA 1RTDB 2MKHA 2ZE2B 2PC6A 1RT2B 1GEHA 4Q7AA 4Y2IA 3NOCA 5CCLA 1ZETA 2QMUB 3CWJA 1RI7A 3ILLA 3NAHA 4RU9A 2RQMA 4F26A 3RUBL 1RADB 2HSEB 3G4SS 1JQGA 2XTJP 1WOPA 5T14A 2CQ4A 2HNYA 5LXRA 5IQ6A 4TQRA 3MHYA 2H51B 4OLOA 4DLEA 2MLYA 4F50A 5K8MA 2PA8D 5D0HA 4U6PA 2O3DA 2LECA 5B0BA 3CDWA 1RJJA 2DITA 1VJWA 3D28A 3ZZPA 2W9BB 4KPCA 3HHLD 1QSSA 1PJ5A 2FPHX 1VMBA 3Q8VA 2O1PA 1S0MA 4USKA 2MGZA 1NNDA 2NUHA 1N6QA 4ED8A 5CYQA 4OJGA 4WKRA 2HQFA 3W9IA 1SIWA 1F3FA 4ZVOB 2IAJA 4J9MA 4JI0F 3PJ9A 4EWTA 3I87A 3K7RA 3FMWA 2W01A 2MZTA 4QIEA 4NL5A 1NU4A 3EPIA 4WP3A 2VJVA 1AUDA 4HT7A 4J9RA 4NXMJ 3KKFA 2NPIA 3TW0A 1GTEA 2HQCA 1DRZA 3NLCA 1VRTA 4K4VA 2DNOA 2ROGA 5KTQA 1S6QA 4QYZJ 3BDEA 1U2RA 2JLEA 2IVFB 3DRSA 2KH9A 3CCWA 4UY8T 2FLOA 2GQCA 3D0HE 3LALA 4RUBA 4ED1A 4C3KA 4B9UA 1UW4A 5HVGA 5MLCV 1F2HA 1S9EA 2UXCF 2XWYA 1T3OA 1OQ3A 2VJUA 1VRUB 1ZA1B 2ZZTA 1XMQF 2RILA 1B7FA 3CD5A 1SJ3P 2YWWA 3GJTB 1UFKA 4CO4A 4WWSA 1HMVA 4LF1A 4A4JA 4QWDA 1X5TA 4I56A 5LJ5Y 4G1QA 2VU5A 1B70B 4DR1F 1S99A 2NYIA 2B7BB 2OD4A 3R3TA 2GJIA 1VQ8S 3R5DA 4FNHA 3O1LA 3DCAA 3QT6A 2WB1D 3DLEB 1K44A 3RB3A 2R7WA 2V2KA 3SSRA 2ZEJA 3E3XA 5E33A 2CZVC 1FE4A 3MMAA 3ELHA 3GONA 1BWEA 3RB0A 3MZIA 3HFZB 5BYRA 5F3ZA 4ZCIA 5K5MA 2HBYB 4C8MA 2BDPA 2HFUA 4WZMA 4Q2LA 3ZTPA 2KJWA 1NSKL 4C48A 4URGA 4NCGA 1AYEA 2J9CA 3H5XA 3KLEA 2F4FA 2K9IA 3ENAA 3OT9A 1PAEX 1K0VA 2J6TA 4RWWA 3H42A 1RAJA 5C2GA 2EC2A 4IQXA 4P2MA 2DNKA 2GX8A 1ZM9A 2VC1A 1QAIA 5U47A 3KK3A 3W8GA 3QFHA 3V5RA 3V6HA 4KHRA 1FF2A 1SJFA 1M5HA 2ADCA 3I96A 3TEGA 4ZJQA 3KLVA 5C24A 1UP1A 3U1LA 3OBIA 3BBBA 3VVTA 5DQGA 1ZAXA 1FRJA 4F4KA 4F7VA 3PW0A 3LQVA 3NS6A 5E3CA 2WZ1A 4CLLA 2KVIA 3OJSA 3K2YA 4RBTA 2LDIA 2JXHA 1RWUA 2IC3A 2OPRA 4CLKA 1IKXA 3A12A 2DNRA 5JMNA 5HANA 5J2PB 3A3NB 4CP5A 4OZNA 5IV4A 1B0VA 2J6UA 4Z7CA 2MTLA 4ZIWA 2XMVA 1NH7A 1F5BA 4DV1J 2OD6A 5J2MB 1HR0F 2KL8A 3NXZA 1U4BA 2GA7A 3VHQA 4ECXA 2EFVA 2RU3A 2FZKB 5IQQA 3DRPB 2RMLA 3C6TB 5GADU 2GVDB 3W1YC 3S8SA 2QN6B 2H5EA 5HQMA 2ZH5A 1A7GE 3CB4A 2P9EA 1IQZA 2ZZNA 1ZZFA 1WI6A 1FO1A 4QWBA 1WSRA 3HZGA 1RTIA 4X4QA 5K14B 2ROEA 4PQUB 4QIFA 4ED0A 3AOCA 4FVMA 4MIAA 3BPSP 2V4QA 1N5YA 2IYGA 3AXKA 1MYLA 3Q2SC 4W4MA 1N8RT 2WVBA 3FFIA 3D68A 3Q8YA 1OWXA 3HCXA 3C15A 3DRYA 4N7TA 4X4SA 3IR7A 1C1CB 3TZWA 4N41A 2C3MA 4RWXA 5AE3A 2YKNA 2DR5A 4E0DA 4CO5A 4K7QA 1FDNA 3PHTA 5J1NA 1RBOB 1YJUA 3SBMA 3QJPA 2QA4S 2L9NA 3CO0P 5ETOA 1GK8A 3THVA 4U67Q 4HV0A 3T5JA 2IVYA 3DLBA 4JP8A 2UUAF 4DR6J 4ED6A 4IFYB 4X64J 4FF4A 2IA0A 4OHZA 3GIRA 1F1BB 4GRSA 4ZPTR 2A1BA 3PHEA 1N34F 5GVQA 4NXMF 4IDKB 2OFHX 5KFSA 4XK8C 1GNKA 1IKVA 2E44A 3C16A 4JI6F 1PAUB 1FXLA 4NYZA 2XO7A 2A2BA 3UD4P 1NLAA 4DR7J 3K5OA 2VPWB 5M2RA 1NHVA 3LPEA 2BMBA 4KAIA 5DZ6A 3H0PA 3I56S 3O6QA 1SCJB 2BM1A 2NR0A 2CPIA 3RB4A 1ZH5A 3QGHA 3FBEA 2XSJA 4C8YA 1CS4A 1VISA 2J9EA 5AXMA 3C14A 2BRKA 4DQPA 3RBEA 5HJYA 2FIUA 2AYEA 2FJDB 1VIXA 1C0UB 2ZM6J 3M8SA 2DGWA 3NP5A 1BAZA 4IH6A 5DQIA 3HF5A 3CCZA 4L76A 4B3SJ 3MEDB 1UUJA 1U9PA 2ZJRQ 3W64A 1EIYB 2KRBA 4CT8A 1SKUB 3BKUA 2JFDA 2GAHC 5EUHA 3CJ0A 4BWJA 3R6LB 2BUNA 3T19A 1OYDA 3W65A 3OD2A 2CQ1A 2GS8A 5BYSA 2D41A 4AT1B 2JSXA 3CD6S 3GIMA 1VFJA 1SL2A 2M7SA 2KTQA 4F4YA 3OTOF 4DPXA 4L74A 4PZVA 2V6AA 3NEKA 1R8BA 4KKOA 4WXOA 2I5JB 3ICLA 1ITPA 2ZBQA 3J81j 4K4TA 2XB2D 3SQOP 3NCRA 1Y10A 3GJQB 1GXUA 3KUHA 3I32A 4J5OA 3ETOA 3SFUA 3US5A 1YX2A 4NRUA 4ZMMA 2E9ZA 1PBAA 2COLA 4QPTA 4GKKJ 3JQKA 5DETA 2VASA 5ETKA 1RA7A 5GMKa 4RW4B 2MGZB 1ZTWA 1N6QB 3C8YA 1VBZA 2VBWA 3K58A 3DU6A 3G8QA 2PMWA 3PVXA 1SIWB 4B3MF 3LJPA 3D9BA 2GIQA 2KI2A 4PG8A 1SH3A 1U1QA 1NDPA 4MYUA 2JWNA 3TUJC 5ETVA 2ALYB 2FUG9 2YWKA 4EMDA 2FDNA 3CCUS 1N5VA 4OV1A 3J7A1 4JI5J 1ULRA 1S0VA 3SSQA 1VRTB 3KFWX 2L3MA 4IQMA 1XR6A 4DV1F 3KMQA 2O66A 2IVMA 1UEVA 5LM7E 1S9EB 1VQMS 2V9KA 3OTCA 3PRVA 2W2NP 3WIUA 3NY0A 2F40A 1HLWA 5HMZA 3EUNA 2C2KB 2MLZA 2KELA 3OPKA 2OUGA 3HKWA 3QIPB 4LSLA 2R7QA 1U8SA 3F73A 3MEGB 4LF2A 2Y8WA 1HMVB 3PX6A 4S0MA 1YHQS 1PYSB 1YBTA 4FXDA 2YTCA 1S48A 3C66A 2XM3A 2CJ9A 2MEWA 3A3PB 1D3WA 2GNKA 3AX3A 4K4ZA 4I2PA 2KT3A 2J8AA 3PTWA 2V2VA 3CTRA 5KFGA 1HWKA 3OV7A 1W25A 3K17A 1WD6A 3L7OA 3NKYA 2N4DA 4DFJA 1LXJA 3BM7A 3RTVA 2D7SA 4PPZA 4NLWA 2GZOA 4WE1A 3MMAB 4P74A 2GPEA 2P5VA 1X5OA 3KK1A 1URNA 3M8PA 3IN5A 8AT1B 1V3RA 3VGVA 4ECSA 3UD3P 2EFQA 1EQ0A 1Y4ZB 1R0AA 1WORA 3ZTOA 2F5GA 3VZIA 3DFEA 4F4XA 1WG4A 4X64F 4UOCA 5DGBA 2C3UA 4G6VB 3PX0A 3RAMA 1VK3A 5KFRA 2A6OA 2R7OA 2HBRB 4W92B 2ILYA 4JI7J 4Q0BB 3X3UA 4ZITA 4BC7A 4IO1A 5GAHI 5L38A 2L48A 4AFFA 3EDRB 4UT4A 5EWFA 3KK3B 1NJWA 1FXDA 4DR7F 2OI2A 4IG3B 2DT9A 2DPIA 2CPDA 1N0UA 2A0FB 4OHWA 4J9VA 2BJ9A 1K73T 2MQMA 3UDVA 1FT8A 1SUQB 3EYZA 4X4OA 1HNIA 3OVAA 4LF7J 5C24B 2DR9A 2VOPA 4ZLJA 1N4LA 5AXNA 1FDBA 3KNGA 1GAOA 3HPOA 4N8NA 4ZA1A 3JS9A 2Q3PA 4LVOP 2V0NA 2RIJA 5CYMA 2PEBA 2PFDA 1OSCA 3I6PA 4WFYA 3UVJA 3GWCA 1S7HA 2XGQA 4B9SA 2JDJA 1HI1A 1QLNA 2IC3B 2OPRB 2LQBA 4HH0A 1NK7A 1IKXB 1S0NA 1HIYA 1NRKA 4UOGA 4EBDA 2HLUA 1RWXB 3H5SA 3FMBA 3ZFVA 1JXEA 3LGHA 4DF4A 4B3RJ 1JLAB 3IMQJ 4USVA 4C8NA 2NXEA 2ZH2A 4ANDA 2G9OA 3L09A 1RSCA 3TR5A 1I1GA 4TXSA 3F0NA 2CQBA 3HSDA 3WZ0A 3OVBA 2KVQE 1CJVA 4LIRA 1PKUA 3ZZ0A 2BNWA 4OYWA 4J9NA 3RW6A 3S7RA 3BO2A 4MYTA 4ENOA 1N32J 4C8KA 4USMA 2LQ5A 4L3KA 5LMNF 4RX6A 1U0HB 5A2QU 4ZCMA 1U25A 4P72A 2YBVA 3QWPA 3IA0A
chains in the Genus database with same CATH topology
2EWHA 4WXWA 3QGPA 4OI6A 2J0XA 2HFZA 4XPEA 1RTHB 2CDQA 2MQQA 2LQJA 1ZBTA 1Y00A 5F8LA 4I7FB 2W9BA 2AYMA 3H8YA 5EDWA 1L5UA 3OFHA 2RB7A 5B0FA 1MROA 6FDRA 4DV6F 1N5YB 1IJEB 5D8HB 2FJAB 2WSCC 3TAPA 4WFZA 1JJ2R 4OI0A 3T5KA 2FVPA 4O23A 3FFIB 4N76A 4K4SA 2EW9A 5A8KB 3KLFB 1U2FA 4H4MA 4MFBB 5J1PA 1UAWA 1K0TA 4C3MA 4NLRA 1LWEA 5DLFA 3TVYA 1RTJB 3QIDA 1Y5IB 2IHR1 2RU9A 5B0GA 1RT5B 3SXLA 2VA2A 2VKZG 4KGKA 1VLYA 1TV6A 2DH9A 1H7XA 3IR7B 4O3NA 4YB1P 2DNNA 4O4GA 2KYXA 1XNQF 3SYZA 4WK3A 4NPOA 3PW4A 4LT6A 3T6BA 2BZ2A 1LKZA 2WW8A 3QAUA 3V6DB 5KOXA 2YKNB 1X4FA 2RVJA 2YNGB 4ECYA 1SL0A 4Y2MA 3VAIA 2FGCA 3OTEA 4KPYA 1SI9A 2KN4A 4B3TF 1WHXA 2ZHAA 4DQRA 4V19X 1O5JA 4URQU 1X4CA 4WFNQ 4QBUA 3PV8A 3T5LA 2GIRA 2RF2B 4UW2A 1X9WA 5K8PA 5I42A 1U45A 1HNXF 2VC0A 1NEEA 5KFEA 5KFWA 2YNIB 3T1HF 5G4DA 1RYSA 1R43A 3CXCR 5HROA 3LANA 1ROFA 2VFRA 3CE8A 1KQFB 5HLFB 3UFCX 4BHQA 4ZP6A 2BJEA 2PE8A 3QGGA 1FNOA 2RD5C 3AQOA 5F0UA 1FJCA 1U26A 3I0RB 2AGOA 1NJXA 3NNCA 5DLGA 4DUYF 2GHVC 4ILMA 3T6JA 4R8UB 5EWGA 1VK8A 3E8OA 1NHUA 2DB1A 5J1EB 1Y9OA 3W7BA 5KFIA 1WF2A 2DD8S 2D1CA 1P6TA 2AW0A 3V2UC 3CJ3A 2LEPA 1WG1A 5D4NA 4IG0A 4JI2F 1BQMA 1U1MA 3MMBB 4X2BA 4NLYA 2KG0A 3GV5B 4AXIA 1OQ6A 1QAJA 2EBGA 3IWLA 3OR2B 2VL1A 4EUVA 2IM3A 4YB7A 3Q8SB 4QWAA 1HWLA 4PXCA 1H2VZ 4MKBA 3MAHA 1R6YA 2ZD1B 4ETXA 2V8HA 5KFOA 5KG5A 3PM9A 2E1MC 2R8IA 4Y3CA 4LRVA 2HPUA 2MJNA 4YR0A 2K8GA 4NZ7A