4QPXA

Nv polymerase post-incorporation-like complex
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
502
structure length
495
Chain Sequence
SKGTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Polyprotein
publication title Structure of a backtracked state reveals conformational changes similar to the state following nucleotide incorporation in human norovirus polymerase.
pubmed doi rcsb
source organism Norwalk virus
total genus 167
structure length 495
sequence length 502
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2014-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 4qpxA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4qpxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qpxA03
4TQRA 4FS1A 2IM2A 3RAXA 3EZUA 3V6DA 1QE1B 5KFLA 2HNYB 4KO0A 4WFYA 4ZPAA 3KLFA 4TXSA 1K1QA 2AWZA 1W25A 2ZE2A 4MIBA 3PR5B 1S1WB 2FVRA 5KFUA 3HVTA 1JX4A 1XR7A 1S10A 4ICLB 2VG6A 5C42A 1C1BA 1HMVB 4QWAA 4F4XA 4NLSA 1RT7B 4NLOA 4KBIA 5KFKA 5L1IA 3PHEA 1C1BB 5C42B 5EWGA 5DQGA 2BE2A 3BQ1A 2YNGA 3NMAA 4H4OB 3BR9A 5I3UA 4KV8B 2BE2B 4ZVEA 4TN2A 4ED8A 1S1TA 3T1AA 4YQWA 2YNGB 3FQKA 1LWFB 3BQ2A 4PQUA 3I5BA 3LALA 4MK9A 3M8QA 1N56A 3CDUA 3DOLA 4WYLA 2CKWA 4QWDA 3Q8QB 3E01A 1RT1A 2IC3B 3M8QB 4KHMA 4G1QA 2RDIA 3DOLB 5C25A 5C24A 3RB3A 4I7FB 5KT7A 2W9AA 3PW7A 3OSPA 1HQEB 5KFVA 3MFIA 1R0AA 4WXOA 1RT1B 1RT4A 5C25B 4NRUA 1JLBA 1TKTA 3CJ0A 5KT2A 1S6QA 5C24B 4TYBA 2AGQA 4QWCA 2IJFA 4DL6A 3KMQA 4ECTA 5J2QB 1JLBB 1TKTB 2OPRA 2UVVA 3LP1A 1RTDA 4XPEA 1S9GA 4J9SA 5J2MA 1S97A 1S1XB 3T5KA 5F9NA 3H5XA 2OPRB 3UPFA 4ZPCA 2YNFA 3KK3B 1N48A 1JLFA 4DL4A 3SFGA 1HQUA 4F50A 1S0OA 1RTDB 5J2MB 4LSLA 3MECB 2YNFB 1T3NA 4B3OB 1TL3A 1JLFB 2DPIA 3KK2A 2BRLA 2VA3A 2ASDA 4K4XA 4K4YA 3PJWA 4O4GA 3IN5A 3H59A 4ED2A 2OPSB 2J6TA 3KK2B 2J6UA 4RW7A 3M9OB 4MKAA 4IG3A 3OHBA 1MMLA 4O3RA 3V6KA 3GQCA 1TVRA 4K4TA 2HMIA 3KHHA 4IG3B 4RNHA 4NYZA 1RA6A 5DLGA 4ECWA 1TVRB 4EEYA 1S0MA 2F8EX 5KG6A 4YMEA 3DRRA 1S9EA 2FVCA 4NLGA 4B3OA 3HHKA 4EYHB 3DRRB 4IQXA 3ITHA 3H2LA 3RB4A 3ICLA 4TYAA 2C2RA 2VG5B 2D41A 3CVKA 1IKXA 2IJNA 2V4RA 3PW4A 3BSAA 3ITHB 3QGIA 4QW9A 4IR1A 3QYYA 4RNNA 3NKYA 2WONB 1HNIA 1IKXB 2R8JA 3BSCA 4LQ3A 4ED6A 3H4DA 1N5YA 3KLHB 3OLAA 5CYMB 4RZRA 4J9PA 3KLEA 2BQUA 3M8PA 5F8HA 1HNIB 2EC0A 1FKPA 2HWIA 3DM2B 3OL6A 1LW2A 2I5JB 3DYAA 4I2QA 3DDKA 4K4VA 2YNHA 4K4ZA 3E51A 1RA7A 4KAIA 5FDLA 4R5PA 3KJVA 1IKWA 3KHLA 4LQ9A 4K50A 3DYAB 1FKPB 3M8PB 4ZP7A 4I2QB 2YKNA 1LW2B 4O4GB 4DL5A 2J6SA 3C6UA 4R5PB 1C1CB 2YNHB 2B6AA 5FDLB 5JUMA 3KJVB 2ASLA 4RW4A 4NLYA 2OPQB 5KG4A 2YKNB 1EP4A 5KFFA 2IAJA 5KFGA 2B6AB 3QGGA 2UVRA 1HYSA 3FDSA 4RW4B 5KFJA 3M9NB 2B5JA 2HWHA 3LP2A 4MFBA 2JEGA 5KT5A 2GIQA 2RKIB 1TKXA 5T14A 3CIZA 2IA6A 4J9KA 1HNVB 3T5LA 2C2EA 2HAIA 3DRSA 4MFBB 4R8UA 4HYKA 5DGBA 5F8GA 1RT6B 2ZD1A 3QIPA 3BJYA 2D3UA 4R8UB 2XGPA 1N6QB 1EETB 1OS5A 1SV5A 2W8KA 2RF2A 3ISNC 3QIPB 4FS2A 2BR0A 5L1LA 4JV1A 3I0SA 2WK4A 2W7PA 4QWEA 4ED1A 1DLOA 2BQ3A 2RF2B 1QE1A 4YR2A 3GILA 2HNYA 3I0SB 4DL3A 2AGOA 1DLOB 4NRTA 2W8LA 1ZTWA 4GC6A 4K4WA 4EBCA 2E9ZA 3DLKB 4U6PA 1S1WA 4XPCA 2XCPA 1S6PA 5J2NA 3IRXA 2IM0A 4KB7A 1SH0A 4ICLA 1HMVA 2XI3A 5J2NB 4ZPBA 1S6PB 4KFBB 1RT7A 3TQ1A 4NLUA 2VG7B 3IRXB 3SFUA 3I5CA 2E9TA 3DRPB 5KG2A 5EUHA 3MR2A 2FLPA 3T5JA 4QW8A 5CYQB 1U09A 5KFQA 4O3NA 3JSMB 4H4OA 5KG0A 4KV8A 3GV5B 1VRUA 4NLWA 4GC7A 4O3OA 1LWFA 2O5DA 1JXLA 2WHOA 3PR4A 1VRUB 3UR0A 5F8MA 4U7CA 4XO0A 1LWEA 4IR9A 2IC3A 5KFHA 3LANA 2C28A 4I7FA 2IM3A 1HQEA 1LWEB 4ED7A 3C6TA 1UWBB 3MEDA 5HBMA 4Q0BB 5KFDA 3PVXA 2I1RA 2GC8A 4Y2CA 4I2PA 3QIDA 3H5SA 4X2BA 1JLEB 3C6TB 3BSNA 3MEDB 4EO6A 5HBMB 5J2QA 3DLGA 4Y2AA 3NL0A 4J9RA 3T5HA 3MFHA 4I2PB 4M95A 4DEZA 1S1XA 1S1VA 3DLGB 4ZVFA 3KK3A 3LP0B 5DGAA 4J9MA 5HLFB 5D3GB 2IMWP 2OH2A 1S1VB 3KOAA 3MECA 1LW0B 2BQRA 1D1UA 2DPJA 4ECYA 4KE5A 4ECRA 3N6NA 4NLPA 3H5UA 4QPXA 5L1KA 2OPSA 2V0NA 1T03B 1D0EA 2ILYA 5F8JA 2WRMA 4FBUA 1S4FA 4ZP8A 4FBTA 4ZVGA 2R8GA 2BRKA 3JYTB 5KFEA 4WYWA 2WOMB 2XC9A 4EYIB 3KLVA 4MKBA 5KFXA 3MEEB 4F4ZA 4IKAA 3SI8A 1J5OB 3FFIB 2FVSA 4PUOA 1RTIA 3MF5A 4Q44A 3PW2A 5EDWA 1DTQA 2OPPA 2WCXA 5K14B 4RNMA 4Y34A 1RTIB 1RT5A 2VG5A 4EO8A 4WZMA 3Q8RB 3EPIA 4PUOB 3VQSA 1DTQB 2OPPB 2R8HA 1C0UA 1RT5B 1T94A 2WONA 4TLRA 1SH3A 3IGVA 4KKOB 3MR5A 5L9XA 4EBEA 4ECZA 2ALZA 1T05A 4YP3A 3KLHA 5CYMA 3V81B 1S48A 5KFNA 1C0UB 4LSNA 3OLBA 3UDLA 1S0NA 3DM2A 1RTHA 4NLQA 5DG9A 1CSJA 1LWCA 2I5JA 2AU0A 1T05B 4JV2A 1REVB 1JLAB 4LSNB 5F8IA 1RTHB 4ED0A 3V6JA 1XR5A 1LWCB 2AGPA 1C1CA 4IFVA 5J2PB 4RUCA 4O3SA 2W9CB 2XCAA 3G6YA 2OPQA 4JUZA 4M94A 4HKQA 4IFVB 2D3ZA 2C2DA 3V4IB 3Q8PB 3PZPA 4ID5A 3TAMA 1JLQB 5F8NA 2RKIA 2XI2A 3PJXA 5KFRA 5KG7A 4WZQA 4J9OA 1HNVA 1S9FA 1FKOB 3MEGB 4ID5B 1S49A 5KG1A 1NHVA 3TAMB 1RT6A 1IKYA 4F4WA 4ZHRB 3LAKA 4NLRA 1N6QA 3T19A 2R2TA 2JEJA 4H4MA 2R2SA 4ECXA 1EETA 3RBEA 1IKYB 1BQMB 3IGNA 3DLEB 5KFPA 1XR6A 2AX1A 4H4MB 4ZMMA 5DLFA 4MK7A 2C22A 5DQHA 5KFCA 4IH6A 2D7SA 3DMJB 4G3IA 3CO9A 4RNFA 4ZP9A 4Y3CA 4IG0A 3KLGA 1NHUA 4NZ0A 3RB0A 2WTFA 2W9BB 3DLKA 1RT2B 4IG0B 1KLMA 3KLGB 4WFZA 2AX0A 5KFAA 3FSIA 2FJVA 3M9MB 1KLMB 3BREA 4KFBA 4DG1B 4NLVA 2VG7A 3PW5A 3DRPA 1JKHA 3CJ4A 3I5AA 4RW8B 5KFZA 4TY9A 5CYQA 2FJWA 4NLDA 1TV6B 1JKHB 5KFTA 3JSMA 4PWDB 5HP1A 4IH7A 3NBPA 3MR3A 3GV7B 5DG8A 1RAJA 3KK1B 4ECSA 5I42A 2AQ4A 2JC1A 2ILZA 1GX5A 5C5JA 5HP1B 1RTJB 5KFIA 5KG5A 3I0RA 3NBPB 2HNDB 3H98A 4URQU 5I42B 5EWEA 2FVQA 3HVAA 1Z4UA 4IOBA 2GIRA 2FJXA 3I0RB 4ZPDA 2E9RX 4KO0B 3OSNA 3KLFB 1SH2A 1UWBA 2WB4A 4ECVA 4Q0BA 4RU9A 3BGRA 3D5MA 2FLLA 2ZE2B 1JLEA 1SUQA 2VA2A 4YR0A 1S1UA 3CJ2A 3BGRB 3HVTB 3KLIA 1QAIA 1SUQB 4K4SA 3CJ3A 2HNZA 2VG6B 4RUAA 3EPGA 4YR3A 5F8LA 4NLXA 1S1UB 3LP0A 4ZP6A 3KLIB 2R2UA 5HROA 5KFWA 4O4RA 5HLFA 4DL7A 5D3GA 2HNZB 3HVWA 1LW0A 5HROB 1IKVA 5I3UB 4IDKA 1I6JA 3NAIA 1S1TB 1JIHA 1IKVB 1T03A 2R2RA 3NAHA 1C0TA 4IDKB 5JXSA 3V6HA 1IM4A 3ISND 5KFBA 3CJ5A 2YNIA 3H4BA 1TL1A 1DTTA 3E01B 1C0TB 3JYTA 4G1QB 4DL2A 2WOMA 3LAMA 3GV8B 1R0AB 2YNIB 4KSEB 4URSA 1RYSA 1TL1B 4IRCA 1DTTB 3MEEA 2FVPA 1RT4B 4EBDA 1S6QB 1J5OA 3FFIA 4OL8A 1KHVA 5KG3A 1JLCA 3QZ7A 1GX6A 2QV6A 3D28A 2XGQA 1N4LA 3GIIA 3OL8A 2R8IA 4H54A 1RT3A 3FQLA 3CDWA 3IG1A 3LP1B 5K14A 1QUVA 5L1JA 3QLHA 3BSOA 4J9QA 1JLCB 1JLGA 2B43A 1S9GB 3PW0A 4IRKA 2YKMA 3KHGA 4PQUB 1RT3B 3IG1B 5DG7A 1HQUB 3QLHB 2W7OA 1BQNA 1JLGB 4KKOA 3UQSA 2XWYA 2YKMB 4LSLB 4O44A 3GIMA 3MR6A 3V81A 4JV0A 1TL3B 2QE5A 4Q45A 3DI6A 2ATLA 1FK9A 3N6MA 1BQNB 5F9LA 3QO9A 2ZKUA 4O44B 2UVWA 1REVA 1JLAA 5DQIA 2UUTA 3DI6B 1FK9B 3GIKA 3FRZA 1HPZA 3QO9B 1C2PA 4IFYA 4RW6A 4RW7B 4TQSA 5J2PA 2IBKA 5KT6A 2W9CA 2JLEA 4J9LA 1TKZA 1HPZB 2FLNA 4QWBA 1YVFA 3DOKA 4RNOA 4IFYB 4RW6B 3G6XA 3KHRA 1RYRA 2HMIB 3V4IA 1TKZB 3RB6A 1JLQA 1VRTA 3DOKB 1ZETA 2JC0A 3IS9A 1S9EB 4URGA 1FKOA 3MEGA 4J9NA 4ED3A 1MU2A 1VRTB 4MIAA 4WE1A 4RW9A 3H40A 3G6VA 4ECQA 3IS9B 4MH8A 3RAQA 4Q8EA 4ZHRA 1RDRA 4NLTA 3TVKA 2UVUA 1MU2B 4WE1B 4RW9B 5KT3A 3GIJA 3CWJA 2V4QA 1BQMA 4NCGA 3DLEA 3V6DB 4MK8A 3OHAA 4Q8FA 1K1SA 4TY8A 4ECUA 2IM1A 3RBDA 5KFSA 4NCGB 1N5YB 3H5YA 3KLEB 3DMJA 3MTKA 4TY8B 4WXWA 1ZTTA 4K4UA 5KFOA 3QGHA 1NNDA 4ZVHA 3CDEA 4F4YA 1IKWB 2W9BA 2ASJA 5J1EA 1QAJA 1RT2A 4IH5A 4O3QA 3C6UB 4KHRA 3BQ0A 1TP7A 3NGDA 2JEFA 4WFXA 5EWFA 4R0EA 5J1EB 3Q8SB 4IRDA 1EP4B 4DG1A 2IAJB 3G86A 3N6LA 1TQLA 1HYSB 3KMSA 2B5JB 3QZ8A 3LP2B 4RW8A 3OL7A 3KNAA 3HKWA 1TKXB 2RDJA 2V9WA 1KHWA 1TV6A 2R8KA 2UUWA 4PWDA 3DRSB 1HARA 3GYNA 4O3PA 3OL9A 2BANA 2ZD1B 5KFYA 5KT4A 3KK1A 2JEIA 2CJQA 5KFMA 1RTJA 1WNEA 4Q43A 1SV5B 2HNDA 2BANB
chains in the Genus database with same CATH superfamily
2RNEA 1J5EF 1WEZA 3VHQA 3MURP 1YITS 1SC4B 3W5XA 3HK2A 1WC4A 2B0GA 1LXJA 5D8HB 3PY8A 3E2EA 3F0NA 5GAGU 4DX6A 3PHEA 1U49A 2A2BA 3F56A 1FDAA 3SCJE 2PIIA 4KV8B 4ED8A 2PMHA 2W7AA 3T1AA 4WTOB 4K2JA 2ROGA 1M5HA 4K2XA 1T9XA 2W9AA 2EW9A 2CQHA 3MFIA 2OIHA 5CCMA 3NOCA 1F5AA 2Y8WA 2VF3A 4LSLA 4EWTA 1WC5A 2Y9HA 3EVMA 2JNJA 4USUA 1X0FA 3IN5A 4ED2A 3TEGA 4MKAA 3OUYA 1K73T 4RNHA 5DLGA 1I5OB 4EEYA 3IR7A 4PG7A 3T9NA 4B3RJ 3CVKA 4DI6A 2AEMA 3DOMB 1Q0NA 2WONB 1ZAWA 4U9RA 2HZVA 1N33J 5HJXA 3SSQA 2PI5A 5FDLA 2BQUA 2XTDA 3M8PB 1LW2B 4DU7A 5JUMA 3FDSA 4RW4B 2K1OA 4HHJA 4OX9J 1WTFA 3OXLA 1EETB 1OS5A 4QWEA 3U1NA 1Q8IA 3NMRA 4NRTA 2AZ3A 2W8LA 4M5DB 3FMTA 5CZVA 3MMBB 4QZVB 1SKUB 1NRKA 2NYHA 3CW2C 1LFPA 2WAQD 4B3RF 4DFPA 1VRUA 2MZSA 3EGWB 3UR0A 4XO0A 1JNZB 1CG2A 1HQEA 3TVZA 1P1LA 2EC2A 5IWAJ 3BSNA 5B0DA 2EEYA 3T5HA 1TMJA 2YH1A 1AA1B 3N28A 4CM2A 4DMZA 3N6NA 2NSCA 3H5UA 1BHNA 5BR8F 1D0EA 4B3SJ 5M2PA 2XC9A 2GV1A 5EGYA 1V6HA 4Q44A 1Y10A 3OVSA 2YTCA 2VG5A 1C0UA 1UA1A 5H9FK 4KKOB 4USJC 3W60A 3LGHA 3J7A1 2Q6BA 3OLBA 2AGPA 2E7XA 2ZM6J 3POTB 4JUZA 1NEEA 4DSLA 4QIEA 1T9VA 3AOCA 3TAMA 5D0GA 2V2KA 2Z30B 3NOGA 1PARA 1AT1B 2MZ1A 1FRIA 1HBMB 2IVMA 4PG8A 3T1HJ 3VCDA 3CF5Q 1SJFA 2LDYA 2B4UA 4F8RA 2PD1A 2YVSA 2EVZA 3KK1B 4V19J 2DRBA 2CQ0A 5CAAA 4URQU 3H98A 3AOAA 4E8UA 5AJ3F 2GIRA 2CFXA 1F5CA 1O51A 3PHTA 2XMJA 1QTGA 3BGRA 2ZM6F 3LTOA 1UA0A 3NGKA 1JQGA 4YR3A 5F8LA 4ZP6A 2LECA 2YQ0A 2W01A 5G0RA 5HLFA 3Q23A 3AODA 3E3XA 3ISND 3IR6B 2DK2A 4KR0B 3ISZA 3GV8B 3ADAC 2R9LA 1RT4B 5HO4A 4Y0FA 5E3QA 3T1HF 1X0PA 2R8IA 3FQLA 2E1PA 3KHGA 5DG7A 2A10A 1LFWA 3HJFA 4OIXA 3C2PA 5F9LA 3QO9A 4Z7CA 4DV2F 2UUTA 1C2PA 4RW7B 2HVIA 2FLNA 2YQ3A 4FYVB 4ERDA 3V4IA 3R5BA 3K5LA 4DQPA 4QQBA 4RKUC 3G6VA 1R43A 2C2NA 3FBEA 4WE1B 1N0UA 2V4QA 1W2BR 5EX3A 1U2RA 3CDEA 2C3YA 4JP8A 1IKWB 2W9BA 2ASJA 1Q53A 3B8HA 3WIVA 1G7CB 3CJ8A 1B28A 3C8YA 1AB8A 1UW9A 5L9NA 3BV8A 3B78A 4O3PA 3AJ2A 1FDDA 3V6DA 2KT2A 3F44A 2FQQB 3B82A 2PI4A 3AA9A 2FB0A 4B3MJ 3BO2A 1JX4A 4YEAA 4F4XA 5ETLA 2L9DA 1SJQA 1HI8A 3G8TA 1CJKB 4YQWA 1N56A 2LQ5A 2PEBA 3Q8QB 1RT1A 5C24A 3PW7A 2BVZA 2KHDA 5KFVA 4TYBA 4PABA 4DR6J 3HHEA 3IA0A 2ZH6A 2ZNZA 4B3OA 2CNKB 4ZPCA 3N01A 1S0OA 2GJ2A 2RIJA 2V8PA 3MECB 3QWPA 3ONQA 1TU0B 2CA9A 3MM9A 3OTDA 1UZHA 2P2CB 4Z37A 4FYWB 3R2DJ 2MYFA 1RISA 5DZ7A 2QIFA 1NLAA 1FRLA 3DKDA 1BXNA 4E0DA 4PRFA 3OJUA 2IJNA 4PQAA 2R8JA 2NQPA 1YQHA 4QIFA 1RA7A 3DYAB 5A8KB 1FKPB 2R7WA 4ZN1A 5F41A 2YKNB 2MHNA 2UUCJ 4MYTA 4HI1A 3LP2A 3DFEA 2VC1A 2BKPA 2LFVA 4MFBB 5DGBA 3TO8A 4R8UB 5M2RA 1R8PA 2U1AA 1HI1A 2W7PA 3BS9A 3I0SB 1FXRA 1A7GE 2C2MB 5J2NA 3TUIC 1OPZA 2E1CA 4NLUA 4YS2A 4X65J 2F4VF 1YJ7A 3OTBA 4P2FA 1QUPA 1RSCA 3EICA 3ZFVA 1FKAF 3K8VA 1SL2A 4DUYJ 2NCKL 1LWEB 2RSQA 3ET6A 2KVIA 1B4SA 4X2BA 3C6TB 1DQ8A 3ZNUA 2X1AA 3DLGB 4WK1A 5HMXA 2DGSA 2ILYA 4ZP8A 1P9QC 1VIXA 2G0CA 2YKOA 5IT4A 3SI8A 2ZZNA 1RT5A 3D1QA 3RUBL 4CYUB 1P1TA 1M1KT 5DM7Q 3KLHA 1S48A 2XZDB 3R6GB 4U67Q 2GMJA 4DUYF 2D3ZA 1KVJA 1EZZB 3FRYA 5KFRA 1QVGR 4LF8J 1VQKS 3SYZA 4AXJA 3RBXA 5LJ3Y 1SL0A 1IBKF 3T1YJ 4NLRA 3R3TA 1LOUA 4FNHA 2QSFA 2LLZA 2HQDA 1KEKA 4ZJQA 2WVFA 2VL1A 3SXLA 1CQNA 4IG0B 2P9EA 1IJEB 3HFVA 2FHJA 2P6TA 4S0MA 2HLUA 1CC8A 2IYIA 2LXIA 2ROEA 4TU7A 2VKRA 4DV3J 1ICEB 1SC6A 3GTYX 1HBUB 2DNNA 5IT9U 3VF0B 2OMLA 4YHHJ 3D1OA 5D3GA 3P5BP 1CJTA 2XS5A 1CULA 3T1YF 5GAHU 2K6LA 1IKVB 2R2RA 4IDKB 3G6ES 1R8HA 2RT3A 3PNIA 5F3ZA 3Q8UA 5B0BA 4V19X 4H54A 2DNHA 4DR7J 2YKMA 3R7NB 4U8YA 1FJCA 1XTZA 3M1VB 4F3QA 3FJ2A 3GIKA 2IBKA 1UPPA 4CO1A 2YKQA 1H3DA 4C0BA 4CLYA 4KQZA 1MU2A 3M8WA 3MM5B 1AZSA 3MD1A 4LF9J 5CCLA 3B6BA 3QGHA 4ZVHA 5IM0B 4L3KA 3BR8A 3S1TA 5EWFA 2VU5A 5IV4A 3DN9A 4C8MA 4DPOA 4NI2B 1TV6A 3H7HB 1PO6A 2HNDA 2VPWB 3GG1A 1VCTA 1X8DA 2RUGA 4WFYA 2IMOA 2OUGA 1B64A 2Y1LB 2GFFA 4LF6J 2ALYB 2CQIA 2YWGA 4WP3A 1HBNB 3T9ZA 1RABB 4ZDNA 3BPDA 1GMUA 2OO4A 4TN2A 5ETQA 2GO8A 1P94A 2QT7A 5LXYA 1MSWD 3PX4A 4KHMA 3M6XA 3J81U 1KOHA 4ZK7M 1U1PA 4TLQA 1TKTB 2GZOA 3LP1A 3HZEA 2BJ3A 5T41A 4J9SA 2JL9A 1S97A 2MGZA 2MKKA 3I4HX 2CAXA 3DDIA 4ZVTB 5J2MB 5J1NA 4I6AA 4KPCA 3JSBA 1OY9A 5ETOA 2OPSB 4C7QA 2GS8A 1U48A 1X4HA 4IG3A 1MMLA 1W7WA 3RTVA 2N3LA 3RR7A 4ECWA 3W64A 5KG6A 2VQFJ 4DFMA 4LF6F 2B4OA 3FVYA 1MWYA 4D3HA 3OT9A 2B4VA 4O23A 4HLBA 3OQ2A 3H4DA 4RZRA 2OEJA 4I69A 4RR5A 4LQ9A 3EM1A 1C1CB 4MKYA 2A18A 4WFBQ 4H4KA 4NLYA 1B01A 2LXUA 2XMTA 4HYKA 1OJ4A 2CIMA 1ZPVA 4OZ1A 5D78A 4JV1A 2A3JA 2MKCA 4B9TA 2AGOA 2E9ZA 3AD9C 4M5JA 1KKHA 2RHQB 2HAFA 5HQLA 3EE3A 5EUHA 4JI2J 1GXLA 4KV8A 1YLXA 4USHA 3UN2A 2DEIA 3TEHB 3HHLC 2JLFA 3WX8A 3MEDA 2HBQB 2EFQA 4NA1A 1IQTA 4I2PA 2M5YA 3SSSA 4KTQA 5LMUF 4Y2AA 2D3O1 4OYXA 4KPYA 1YJWS 4ZVFA 1T02A 1T95A 1FRHA 2MMYA 5FJ4A 1X9MA 3MZIA 3D0HE 4ZIVA 4QPXA 2H1OE 4A47A 4DFKA 4DPUA 4ZITA 4D8JA 3ZZUA 3LQVA 4IKAA 1EHWA 8AT1B 1KQGB 2GVZA 3SIPB 1CJUB 1Q8BA 3WHIA 3DOMA 3KUGA 2WONA 4JI2F 5B0EA 2DHSA 1UVMA 4B3TF 1RTHB 4QIGA 4LJMA 3J80U 3CO0P 4HKQA 4IFVB 1V3ZA 2C2DA 3N9UC 5ETTA 1OPIA 2DXDA 1EETA 3RBEA 1KP6A 2CQDA 3HT3A 3KUHA 4WP9A 2K2PA 1FF2A 1KTVA 3LWLA 3GCXP 4M5DA 2YWEA 3GR0A 3BGLA 1RWXB 4JI7J 3KLGB 1LXNA 2H48B 4N56A 3M9MB 5B08A 2FC9A 2HBRB 4LRVA 4Z2XA 1SJRA 4IH7A 5B7WA 5AE3A 2ILZA 2RQKA 4DX5A 3TWZA 3HVAA 1HNXJ 3ILOA 2GW8A 5I3QA 3OSNA 5H1SV 2GQQA 2VQEJ 1KVIA 4Y2IA 1PCAA 2YWKA 2KRRA 3UO0A 2QLBB 2SXLA 1PGZA 3RRKA 4BHQA 1IR1A 2HQCA 4MJKA 1WI8A 3UR3C 3A1YG 1OY8A 2I0XA 2MQ8A 2OFHX 4MTPA 4YB7A 4UZCA 4I6YA 4JI7F 1JLCA 4M5HA 1ULRA 2Y1JA 2Q6CA 1X7VA 4HT7A 3AX2A 3CD5A 1YJVA 4G6VB 1WDDA 4KKOA 2XWYA 2E1MC 4ZVPB 3AT1B 3G71S 4DV5F 1H72C 1VGYA 2J9DA 1HNXF 1FDBA 2E7WA 4OI6A 2ROPA 1FEEA 1RWKB 2W4PA 4BDPA 5ETKA 4NX9A 4NZ7A 2WVCA 2ZUGA 4NLTA 1VYAA 3CWJA 1EQ0A 4Q8FA 4ZJOA 1XNQF 4A8MP 2UZAA 1D9AA 3W5YA 4ETZA 1XNRJ 5J1EA 2VKZG 1HBMA 1IR0A 2RRAA 3G86A 4N77A 3N6LA 3H42A 2MQLA 4X64F 2FJEB 3HKWA 2RDJA 5L8RC 2ZZTA 4UUXA 1HARA 1JXVA 2LU2A 3KK1A 1HIYA 3OXGA 3CEDA 2UXCJ 1UAWA 3G9CA 1K47A 4ZVOB 3CNQP 1RU2A 5AXNA 3Q8VA 3UW1A 1T3OA 1U1NA 4L73A 2BM1A 4OYOA 2DNYA 2BABA 3M6WA 5EHHA 1B3TA 1FO1A 9RUBA 4CCHA 2HZCA 1RAOA 1TL4A 2C2ZB 2DGUA 2OFGX 1UTAA 2DXEA 2QMUB 3NG8A 3DOLB 1RT4A 5C25B 4NRUA 4BS2A 1AFJA 4QWCA 2OPRA 3EZ5A 3KK3B 3CDAA 4FPIA 3MM6B 2W4DA 2DPIA 1MN7A 2V94A 3M6VA 4K4YA 4CQ1A 1RAFB 4RW7A 1X31C 1TVRA 4K4TA 2BYCA 2AY0A 4EU0A 4OYAA 1U0HB 2GVDB 2AV5A 2F8EX 4DSIA 1FJGF 2W4CA 3VZIA 2Z2YB 2BSQE 1ZZFA 2PMWA 4J9PA 4JI3J 2KKEA 2X7IA 2DRAA 3DM2B 3DDKA 3E51A 2ZDOA 2MPUA 1IKWA 1X9SA 2ASLA 2AHOB 3FZBA 4L74A 3TQEA 2QL5B 1N5TA 2WW4A 3EDRB 3BJYA 2XGPA 4TU9A 2LVWA 2CPYA 4X62J 2Z2LA 3MI7X 4UF4A 3E8OA 1ZTWA 3THVA 1KFSA 3DLKB 3J7YU 3GSIA 3DU6A 4ZPBA 4KFBB 1FA0A 4QW8A 3C15B 1CJKA 4DN9A 2WSEC 2B9XA 3GV5B 3TOQA 4EFAC 1VHIA 4JI3F 1NJWA 3LANA 2QYCA 2VBXA 4ZS6A 4A8WA 2GC8A 3GSDA 1N5VA 2BOAA 2IMWP 4USKA 2VFVA 3MECA 1D1UA 1X4EA 3CXCR 4BLGA 4LF7J 1EARA 4X62F 1CS4B 3HJVA 4Q5VA 4ZVGA 2BRKA 2P9GA 1J5OB 3FFIB 5F3TA 1NXIA 2K5JA 1AUSL 3FBFA 1RTIB 5HQ8A 4QOTA 4BCAA 3DGPA 1MW7A 4OV6A 5A8KA 1F60B 3UI3A 5JMNA 4I67A 5J2PB 3G6YA 4DV1F 2QZ8A 2CVEA 3Q8PB 2XLKA 5F8NA 2XI2A 4BC7A 1G4CA 2DIVA 2OMOA 1WUUA 3SEOA 2FC8A 1IKYB 1PAUB 4H4MB 2HEKA 5DLFA 2D7SA 1KS2A 3ZTRA 3BREA 1PC5A 2IRYA 2CQGA 4B08A 1H38A 4ECSA 4JI8F 2AQ4A 3MWBA 5I42A 2X3DA 2D69A 4F0HA 1GX5A 4XK8C 3NBPB 1KSPA 2V67A 4C8OA 4KO0B 1SH2A 3D5MA 4C3LA 1SUQA 2XLIA 2E5LF 3HVTB 2MJNA 4RUAA 1KLNA 5KFWA 4DS5A 2HNZB 3A3PB 2KG0A 4CO2A 3RJMB 2PC6A 5H9EJ 3IBFB 3RRHA 1YJUA 2V1SA 2KH9A 2XS2A 5DDQC 2YX4A 4USIA 2R7SA 2Q79A 4KSEB 1TL1B 3W1YC 1NK4A 1NBEB 1HNWJ 2M70A 1GX6A 3GIIA 2UU9F 1BMQB 3BSOA 2B9EA 3A8IA 2HHXA 1RTZA 3MM7B 2HHWA 2JXGA 4O44A 4JV0A 3VAHA 4Y2KA 2AYMA 4U7UK 3EYZA 3DOKB 1HBOB 5KTQA 3TANA 4F3OA 3LWMA 5E5NA 3S6EA 3UN3A 2FPHX 1KQSR 4TY8A 2HHQA 4LF4F 3MTKA 3UNGC 2P5VA 4OFZA 2E5HA 2OAUA 4F4YA 2J0QD 1F9HA 4AL6A 4IRDA 1EP4B 1T9YA 3BKUA 4IO1A 1L3KA 1I94J 1SL1A 2UUWA 2OGUA 5IFMA 4LR8A 3MMCA 4ZPAA 4XAKA 4RX6A 3B54A 3HF5A 3T6JA 2VBYA 2AJFE 3T41A 4RWWA 4NLOA 4KBIA 3OV7A 4B9SA 2V4JA 2G2OA 3VVTA 2BE2B 1N5SA 1NH8A 1OIAA 4USWA 4AQYF 1NMEB 3ILIA 1DJ0A 1U9PA 3CJ0A 1EX8A 4DR4J 2R7TA 4ECTA 1NZAA 1K8AT 1HQ2A 3Q89A 2YNFA 3EXYA 2G0IA 4N47A 3OHBA 4O3RA 2RS8A 3QJLA 4NYZA 1GMVA 1X93A 1N34J 2F7VA 3MM5A 5E3CA 3MUTP 4EYHB 1BQXA 3ITHA 2GCFA 1T9WA 2AJQA 2MZRA 2F8HA 3RAMA 3OLAA 5CYMB 3ULHA 2EC0A 1VOMA 2HQFA 5IM0A 4R5PA 3KJVA 3QQCD 4DL5A 2QG9B 1VQSA 5KG4A 2CQBA 2QMWA 3TAQA 2B6AB 3J7ZT 4FVCA 4ED5A 4NI2A 4I56A 4CRJA 4DS4A 2XSJB 2BR0A 2W8KA 4DPWA 2C3UA 4CI0B 4Y00A 4C8NA 3CJSA 3HP6A 4P7VA 3W63A 3CD6S 3DC2A 1MN9A 2POKA 4KB7A 4PXBA 1U1KA 2QA1A 5A0YB 1S6PB 3PO4A 2W2NP 1N34F 3O5TB 3CJKB 1N5QA 5EN1A 1OYEA 4K5SA 2GHWA 3SBMA 4WIQA 4ZLJA 5KFHA 3AX3A 2C28A 1E6YB 3FMWA 3BEGB 5T7LA 4OI2A 3EX7B 4DEZA 4UY85 4B9MA 5DGAA 3LGNA 4ECRA 1FWLA 5HMZA 3W9IA 2MZQA 2OPSA 3SQOP 5MLCV 1F2HA 2A2CA 3TZYA 5HSPA 2YQ1A 4C48A 4N8OA 3J7YI 2QL9B 2Y3YA 1DTQA 2YWFA 3PV8A 2EFNA 3Q8RB 2A6OA 1M5VC 4TLRA 2IHR1 4B9UA 1TMMA 4NLQA 2XO7A 3GG0A 3EXCX 3TZWA 3VAJA 3WIUA 1LWCB 1C1CA 3SQGB 5DETA 1ACMB 3IP0A 3PZPA 4U7UD 2OEKA 1L3VA 3LAKA 4NEYA 3M2RB 5AXLA 3IR5B 5HANA 3KG4A 3GCWP 1KLMA 4DJBA 2UUAF 3ENVA 4FXVA 4NLVA 3PW5A 4TY9A 5B0CA 4C2MA 2CDQA 5HP1A 2DISA 4PYAA 1HR0J 2MZJA 4WPAA 2Q43A 3O3LA 5H9FJ 4OZLA 4ZPDA 2EXUA 2JJ4D 3P5TL 4LIRA 2FY8A 1TR0A 1VQ5S 2VG6B 3KLIB 3DLHA 4ANEA 1RHJB 1YRXA 4M5GA 4OJ3A 2ZBRA 3HHLA 2ZJPQ 2FD2A 3H20A 2AW0A 3CCUS 5JXSA 1FX2A 4G1QB 2FHJD 2YNIB 2EWHA 2CPEA 1KHVA 3TZXA 3QZ7A 3BGUA 2QV6A 4XDDA 2NLWA 3FGVA 1O8BA 3VGUA 2B43A 1CBKA 3G87A 4RUBA 3QLHB 2W7OA 2QA4G 3CCRS 1BQNB 1HR0F 1UFLA 3NNAA 3DI6B 1HPZA 2DR5A 3GJRB 4DLEA 2H65B 2R4FA 1RE1B 4NZ6A 3KHRA 2HMIB 1TKZB 1WF2A 5FLXU 2ZBIA 1F1BB 4J9NA 4ED3A 2K06A 3TRGA 2ZHAA 5LSLA 2UVUA 2AJ2A 3TJ9A 2RH3A 4F04B 3MMAA 2MDAA 4X84A 1RAIB 2C42A 1ZA1B 4HACB 1IXKA 2PGCA 1RKIA 2IAJB 2DCLA 3EWGA 1NHKL 4DR1J 3KNAA 1KHWA 4WU2A 1FE0A 4YFUA 4Q43A 1U45A 1P8GA 1NDLA 1VC6A 4DPYA 3VAFA 1RWUA 2FVRA 3JAMU 1NB2A 1B0VA 2R7OA 3W2WB 3QAEA 5EWGA 2CWKA 4DF8A 2ZITA 3IXQA 4RUHA 4H4OB 2BBEA 3VTIA 2E7VA 2GA7A 1LWFB 1BAZA 4DXLA 1J2VA 3M05A 4CNZA 8ATCB 3KDOA 3R27A 4FYYB 4FF4A 2DVIA 4RL1A 4LSZB 4JYAJ 1UETA 1RTDA 4NA3A 4K0KF 1S1XB 2DNOA 3BH7B 1JLFA 3CPWR 1D8YA 3W3SA 1Q8LA 3W9JA 3PRBA 4LFBJ 2ASDA 2NXUA 2MLZA 2LYVA 2QGFB 3BN4A 5LMNJ 1URRA 2R7XA 2HHHJ 3GQCA 3HI9A 2QLXA 3TA1A 2DHHA 4L6V3 3DRRA 3Q8YA 2G13A 4F7VA 3ICLA 3IC1A 4CT8A 2H4YB 1HNIA 1IKXB 4LBIA 4DHVA 4I2QA 1N32J 4K4VA 4KAIA 4K4ZA 3RAQA 4K50A 2J6SA 4ES3A 1VQ6S 2F5GA 2YNHB 2W1BA 4PXCA 3C16B 1HW9A 3DHXA 3V4MA 2JHEA 1D09B 1RT6B 3QOQA 5HJYA 2P9CA 4IUFA 1FFGB 3LA0A 4LFBF 2XMKA 4K4WA 5LMNF 4B9LA 1FNOA 1XBWA 3PEJA 3P6YC 2VG7B 1X4GA 1LKZA 3VEBA 3MM8A 2Q1LA 1FE4A 2CYYA 1R89A 1U6ZA 3PM9A 1N8RT 2KN4A 1Q95G 2W2OP 4HVZA 3PVXA 3NL0A 3KK3A 3NWGA 1TUVA 1JJ4A 1JJCB 1SIWB 4ELTA 2DH8A 2IRUA 1PJ7A 1M5SA 1REGX 4DSEA 2GVDA 4MKBA 3OFFA 1IWGA 3MPWA 3LO3A 4OJ1A 3AB4B 3NGTA 2EI5A 4PG6A 3Q24A 1SH3A 5L9XA 2BJ9A 2B8QA 2LQ8A 3DM2A 4JV2A 5A2QU 4LSNB 3MGJA 2V2ZA 4RUCA 4BC9A 2BW2A 1MNTA 2NXCA 2V9KA 2GNKA 4ZHRB 4KHPF 4HEA9 1HD0A 2DNLA 4ZA1A 4MK7A 2C22A 1BDVA 4DDFA 3CO9A 4WCEQ 2V8HA 2AYGA 1NHUA 3RB0A 3DLKA 4LF5J 1JXEA 4NEZA 3FSIA 1AW0A 2ZOFA 4OZJA 4KFBA 4OYPA 3AX5A 3OR2A 1TL7A 3C15A 4CZCA 2AJ0A 4OZ5A 3AQOA 3OD2A 1X5TA 2UXDF 4UY8T 4K5RA 2FJXA 2OP5A 4OYZA 2WB4A 5ADZA 2CPZA 2UXBJ 2HRUA 4XDCA 1FNXH 5HROA 3JB9k 3VW4A 3MCMA 3VR1A 1I6JA 3KNGA 1RWWB 3NAHA 3H4BA 3E01B 3NY0A 1YIJS 2RU3A 1YTYA 1DTTB 4LF5F 1J5OA 3FFIA 3FMBA 2V8VA 2FZKB 2XGQA 3BH6B 3A8KA 2B9WA 1MWZA 4F36A 1DAXA 5CHCB 1L3UA 2VD3A 2BE7D 3MR6A 3KTQA 4Q45A 1D9DA 2P8IA 2ZKUA 1Z1ZA 3P96A 2BJDA 4ILMA 4U96A 3MUVP 2LQJA 2E5GA 5J2PA 3OBIA 4WFAQ 1WG1A 1RYRA 1KBRA 4A8SA 2F63A 4RW9A 1Y3KA 4N5SA 2QSWA 2EFOA 1K1SA 4YN3B 1DQ9A 1PYSB 1P9YA 3A12A 3UVJA 3M30A 5U47A 1HWUA 2FZGB 2HW3A 1G2EA 5HQMA 4A8XA 2ZFHA 2FJBB 4YY3J 5DG8A 4FS1A 5D6GA 3GIRA 4KO0A 4ES2A 1YZ6A 3R1LA 4L3NA 4CO0A 4OI1A 3HVTA 2D9PA 3M6UA 2I2YA 4NLSA 1IRQA 3KG1A 4LF1A 1VI7A 4A8YA 2GQ2A 2Z4PA 1SI9A 4A8QA 1U02A 4ZVRB 2PFFB 2JWNA 1NK0A 2H1YA 5LJ5Y 4TU8A 4OHVA 2XYPB 1PBUA 1TK0A 4XPEA 4Z7YA 1RCXB 2JVOA 5F9NA 4USTA 4GKKF 1JMTA 3DXSX 2K8GA 3FCVA 1F2GA 3THPA 3V5RA 1FRXA 2HQ3A 3KK2B 2J6UA 3LPYA 1RBAA 4DZDA 3JSYA 1HBOA 5K8MA 1PKUA 3R5GA 3IRWP 3UD5A 4J7CA 1WOPA 1WC6A 1ZAVA 3HHKA 4IQXA 5DRKA 2C2RA 4WFNQ 1V3RA 3NKYA 1OSCA 2D74B 4GKJJ 5F8HA 3AY0A 3KHLA 1QAXA 4O4GB 2B7BB 4DV4J 1YX2A 5LSOA 1EP4A 1YBTA 2PE8A 3V2UC 1NDPA 5C2GA 1SKRA 2O01C 3MOJB 3T5LA 2RQ4A 2EPIA 3QIPA 2ABYA 1GFWB 3C14B 2G9OA 2CRLA 3PG9A 2CNLB 1V9OA 2AKWB 4DL3A 5CD4H 2EG2A 2L3MA 3LUYA 2M88A 1SJ4P 2XCPA 3K5OA 2FGCA 4JI5J 2BM0A 3TQ1A 2XMUA 3R8YA 1U09A 3JSMB 4ALZA 2CZVC 1VFJA 2DBBA 4QIVA 4IOCQ 4ZJLA 5F8MA 2KO1A 5THWA 2K1RB 4LF2A 4DOZA 3WBZA 4M95A 1DRZA 2N7CA 4P7TA 3H8YA 3LP0B 2V6AA 4DQQA 2ACMA 2FIUA 2ZH2A 2HSEB 2APOA 1TFYA 3D9BA 2PEHA 4ANDA 4JI4J 3N0VA 4UUWA 2HS0A 3TUJC 2PT0A 3BYRA 3MF5A 4B9NA 3PW2A 3PYGA 3D6MB 1HHQA 5I4MA 4WZMA 1QDUB 4CO5A 1T94A 2MQOA 1VQLS 3L9ZA 5D0EA 5CYMA 3MCSA 2VFSA 3ZTQA 2WVDA 4R25A 2ZVIA 3V6JA 4RLEA 5IQ6A 2XCAA 4W90B 3QRQA 3TR5A 4PYDA 4WZQA 1X4FA 4GO5X 3AFGA 2J9DE 2R2SA 2XSJA 2Q3PA 3DLEB 2XHCA 5K8OA 4Y3CA 2D3OR 3TVYA 1VC5A 1RT2B 2WBMA 3N79A 4HH1A 4DF4A 3CJ4A 6FD1A 2OJ3A 2FJWA 3HLUA 3QPIA 1T11A 2JC1A 3AAWB 3GP9A 5AXKA 2K7KA 3UE2A 2DNMA 2G1HA 2XEXA 3AXMA 2XHWA 1WG4A 4YR0A 1S1UA 3Q83A 3PEHA 2QX0A 3GYGA 2XB2D 2GO9A 4FF3A 1FD8A 1JIHA 2DGWA 3HXMA 3JAMY 5KFBA 1FRJA 3OXFA 4IRCA 4WJBA 1XMOJ 1SKWA 2KRBA 3VZHA 2M4MA 1MYLA 2MEWA 3G82A 3IG1A 3I55S 2C2OB 2XULA 3PW0A 1JLGA 4YDDB 1SQFA 2HIQA 3HSDA 1GAOA 4NASA 1SBRA 2LEAA 3NWRA 3N6MA 1NSAA 5DQIA 4C4WA 1FK9B 2G2ZA 2EFGA 4IFYA 1WC3A 3SQGA 1CVJA 4PG5A 1KNZA 2EK1A 4I0WA 3HZGA 1VRTB 3H40A 3IMQJ 3IS9B 3GJTB 2FYXA 3G4SS 2CNNB 3VALA 2Z2MA 3RYLA 3M2RA 4NCGA 4DUZF 1UUJA 4F4KA 1BE4A 1NNDA 2QLFB 2DH7A 4ZPVR 2KFNA 1OYDA 2GX8A 3BQ0A 1XMOF 1HYSB 2V9WA 1IM6A 2HBZB 2J7WA 2KL8A 1L5UA 2IBOA 5M2UA 2ZD1B 5BR8J 1HWKA 5JVHQ 2AYEA 2VJUA 4GMKA 2BJEA 1X4CA 4TXSA 3FCHA 1F9EB 1RWPB 1WJ9A 2FZCB 3HD2A 3CT9A 4ICLB 2VG6A 5C42A 5A8RB 1U2FA 1NSKL 1UJ6A 1NJZA 2YNGA 3NMAA 3BR9A 3I5BA 3MTJA 4G1QA 3U7JA 2VDIA 3CCJS 3KG0A 1NZ8A 3UCUP 3GLJA 4FNIA 1SQEA 2YKPA 4IR9A 3JQMA 1IBLF 2UUBJ 3QATA 2FY1A 2QLJB 2J6TA 1WI6A 5HMWA 2KZMA 2HMIA 1BWEA 1RA6A 1CQMA 5GADU 2KU7A 3IR7B 4C6AA 1T9TA 4N8NA 4IR1A 1I3OB 4RNNA 5AJ3J 2BA3A 1P6TA 4JI0F 4EO6A 2A0FB 4DR2F 3PTWA 5FDLB 4DBQA 2BKNA 1MYKA 2NPIA 2IAJA 5A76A 4QU6A 5ETVA 5KT5A 2GIQA 2JDJA 2C2EA 2W25A 1MLAA 2RF2A 2UUBF 2WK4A 1DLOA 1PAEX 3VAIA 4GC6A 2RJZA 2CG8A 4C8ZA 2J7UA 3SCLE 2IM0A 4B9VA 1S59A 2I6WA 2E9TA 2MKYA 2MTLA 3W2WA 5KFQA 5K8NA 4H4OA 3TAPA 4DV2J 2LP4A 4DR3F 1LWFA 5A8WB 1VRUB 1QLNA 1VQYA 2KT5A 4I1TA 1JK9B 2W24A 1R0CB 3P3DA 1RGVA 2NZ4A 4ED7A 1UWBB 1XERA 1VQPS 3AA8A 3M32A 2I1RA 2CUYA 1GTHA 4ZLNA 1S1XA 1S1VA 1W2IA 2RHSB 4IOAQ 2OH2A 3VVUA 3OR1A 1VLOA 5ETRA 3IAS9 4LT6A 2BACA 1BDTA 4FBTA 1RK8A 2OKQA 1DZ5A 3JQKA 4F4ZA 3FEXB 4PUOA 2HPUA 2W2PP 4ZLPA 1O6XA 5F0WA 3THTA 3TYTA 3VQSA 1VQMS 1ZOTA 1T05A 1C0UB 1FI4A 1CSJA 2A1BA 2GJIA 3VGVA 1RWOB 1JLAB 3QBCA 4LFAF 3K0JA 3C16A 1LNQA 2R7RA 3PJXA 3U1MA 2Y1IA 2UV8G 3TAMB 3OFHA 3CULA 1RT6A 4ECXA 3DRXA 2ZH8A 2C3PA 4PWWA 1BQMB 3DHWC 1AUDA 2LXFA 1QVFR 1NK5A 1Z2ZA 3CE8A 5CA5A 3LGMA 1K0VA 1B0TA 2VG7A 4QJVA 4DZ6A 2VBWA 5SUHA 3TX0A 1TK8A 2R7QA 2BJ8A 2Z58B 2EG1A 4OI0A 1QJHA 2KOEA 4X4OA 2VA2A 2NXNA 3BGRB 3MAQA 1YJRA 2MQNA 3K59A 3HVWA 5G0RB 4C11A 4GO7X 4M1KA 1WG5A 3CJ5A 1EAYC 4OX8A 1YWXA 2KFYA 1VS3A 3QT7A 4NXNF 4M5NA 1CPZA 5CD4A 4EBCA 1RT3A 1UZDA 4ES1A 5L1JA 4J9QA 4IRKA 4QCLA 4IYQA 2N82B 2IDEA 4CLLA 1WOSA 1ZA2B 2C3MA 3QNWB 3OVAA 4ZPTR 4CLSA 3QT5A 4ED4A 4F2RA 3QO9B 2LKZA 2ZEJA 1EA4A 1BGXT 4KJIA 4DN0A 3NXZA 2DR6A 3HHLD 3MPVA 2F4VJ 5GAGI 2KVQE 3P8BB 2F3JA 1RLDA 4ZKAA 4ZHRA 2CQ1A 1V5VA 3QFWA 4AFFA 2CPGA 2Z2ZA 2AT1B 4Q2LA 1IBMF 2NUUG 4HDHA 1MMDA 1DBDA 3WC0A 4ZN3A 4DV6F 5FD1A 4R0EA 1RP5A 4P9SA 3OL7A 2RU9A 3C66A 3NGUA 2BANA 3O1LA 1WDTA 2IM2A 1R27B 1QE1B 2MY8A 1WSVA 3W66A 2MJUA 1K1QA 2XSFA 1FERA 1WF0A 2NPFA 4TVAB 3K57A 1S10A 1C1BA 1RI7A 3M2UA 1UPMB 2VOOA 2NR0A 2JFDA 4XIUA 4LRCA 1I1GA 4CLPA 3BQ2A 2MZTA 2VPZB 4WP8A 3M8QA 3CDUA 3E01A 4Q2MA 1JB0C 3O2IA 5HMYA 4NOHA 1RT1B 2CNOB 1JLBA 1NK9A 5C24B 1IBKJ 4LFCF 4YOEA 4JV5J 4F50A 3BN7A 3WX4A 4B3OB 2DB1A 3ZO7A 2LQBA 4K4XA 1VDHA 4J90A 2VFUA 3HSZA 4CLFA 4JBCA 3UFCX 4KGXB 3MM9B 4OHXA 1R0BG 2DR8A 3I4PA 1RACB 2D41A 2DGOA 3UDEA 2V4RA 4TNOA 2FHKA 3PW4A 2MQPA 2GPEA 3RR8A 1IR2A 4ECYA 2LA4A 3BM7A 2XM3A 1D8ZA 2BV3A 3DLJA 2MXYA 1FESA 3MHYA 4AD6A 4DQIA 3G5OA 3DCAA 1DY3A 3QSYB 3MCOA 1YHQS 2MQQA 4JV5F 2E5JA 2MKHA 4O0IA 3QRRA 3TNVA 4CIOA 2W2QP 1YBAA 3C3LA 4RBVA 3IRXA 1U6FA 5J2NB 1LV5A 3DRPB 2ZBQA 2DEJA 2VODA 1RWVB 3OTOJ 3CGIA 1KC8T 1XN9A 4O3OA 2VB6A 3PO5A 3JS9A 1JXLA 1NB7A 2IIHA 2XMMA 1S99A 2ASYA 4MJWA 4L72B 3MAAB 1IJFB 5HBMA 4Q0BB 2M0GB 1U7LA 3ET6B 2X1GA 2AEFA 2BA9A 2DGVA 1FJ7A 1AYEA 2KB2A 2HHTA 4LRBA 2VHGA 3I31A 2N4CA 2H9ZA 2R8GA 2DNPA 3NS6A 2HFNA 2QTWA 1Y0HA 2OD6A 2OPPA 1RT5B 3OTOF 2HK3A 3W2VA 3VQTA 4NWBA 3V81B 2CJ9A 3GFYA 3BYPA 5F8IA 3PJ9A 4DCJB 4OYMA 1NK8A 4M94A 4DFJA 3QT8A 2HGNA 4ID5A 4FKYA 2QMXA 5KG7A 3CCLS 1S7HA 3MEGB 2DHGA 4GRSA 3C14A 1NJYA 3D0IE 2NUHA 2M8DB 1RAEB 4IQMA 2KFZA 3DMJB 4RNFA 3TARA 2CVIA 5B0GA 1KFDA 1N88A 3H87C 1WC1A 2HFSA 2FJVA 1PYTA 1Y3JA 1JKHA 1NU4A 3KWMA 1VISA 4EGLA 4NLDA 3JSMA 2OEMA 4MAKA 1Z2LA 5C5JA 5KG5A 3G2XA 3I0RA 2HVZA 1KOOA 3KLFB 1V3SA 1XWLA 2RAQA 1G3OA 4HT5A 1DARA 3LP0A 3ENAA 1RCOB 3I9ZA 2LQ9A 4USMA 2F1FA 2WSCC 3ZZRA 4U95A 3RBZA 2LEPA 1GH8A 5GVQA 1KQFB 1C0TA 1R3NA 2MHEA 2GIFA 4OX7A 4X4SA 1R6VA 4LVOP 1QD1A 2HZAA 2FVPA 1YG0A 3N5FA 4ILRA 2W2MP 4OL8A 5KG3A 2ZH1A 5LOQA 4J9VA 1D3WA 5IC6B 2YKMB 2QE5A 4RU2A 2UVWA 2X3GA 4JB8B 1VQ7S 4RW6A 4M5IA 3RW7A 4EZ9A 2ZDPA 4OZ2A 1FTRA 4CO4A 3CUNA 2AIRB 3H2VE 3NRBA 3FC9A 1S9EB 3PKYA 5E3RA 3B4DA 3ETOA 3UDCA 4J37A 1MU2B 5KT3A 3J81j 1SB6A 3DLEA 4CTAA 1AZSB 3KLEB 2DKOB 3IWLA 5LMUJ 1RT2A 2RQMA 1TP7A 2ZH5A 5IQQA 4PZVA 1TKXB 1XEZA 4DUTA 4J9UE 4UQGA 2K3KA 3GE9A 1S5ZA 3D7SB 2E44A 2V34A 1N52B 1KQKA 3PR5B 4LMZA 1S1WB 4PG4A 2IPOB 4LBPA 2BOPA 1SVDA 1YGYA 2AF6A 4DV7F 3QAUA 3BQ1A 4YUDA 2MKJA 2H3AA 4ZVEA 3D4JA 4B3TJ 2BUNA 2OHDA 4C8YA 2EFVA 4M5KA 4AL7A 2CKWA 2IC3B 4OQJA 2CZ4A 4I7FB 1NLKL 4WXOA 4OYIA 2UVVA 2HG4A 1N48A 5G4DA 4RJVA 2PA8D 3IO1A 1SQGA 2MGZB 2B3TB 4EMDA 2BRLA 2VA3A 2XWXA 3PJWA 4Q7AA 3K2YA 2K3IA 2DITA 3S8SA 1UJ4A 1S76D 4FF1A 4IG3B 4FYXB 4GVBB 3ZC4A 1TAUA 3X3UA 3U1LA 1NPPA 4TYAA 2PN6A 3IWXA 2VASA 3M8PA 3PX6A 1LW2A 3BGFA 4OJHA 4RW4A 2OPQB 3K89A 2ACYA 1HYSA 2ZWPA 5KFJA 2YKAA 4Y2MA 1WSRA 4J9KA 4G65A 2ZD1A 1ZM9A 2D3UA 1YRTA 1ARRA 2RBFA 4X4PA 4WBFA 2FJAB 3C46A 2ZC3A 3MMBA 1XMQF 2MQMA 3QT6A 1QSYA 4ICLA 2ZOMA 1KVKA 5HVFA 5A8RA 3SFUA 3D0GE 3T5JA 5CYQB 4G1PA 4DV5J 5KG0A 3B4MA 4NLWA 4CP5A 3AH6A 4PKDB 2WHOA 2DO4A 3PR4A 4U7CA 4X66J 3KKFA 5DDPC 1N36F 5KFDA 2CDRB 1JLEB 3MEDB 3GXQA 5AE2A 3GB0A 4I2PB 4N7TA 4OLPA 2KHCA 2Z8QA 2YY3A 3KUEA 1XNQJ 1LW0B 2BQRA 4HTJA 3O8WA 1WKJA 1C4AA 5L1KA 4Y28C 3WZ0A 4LIWA 6FDRA 4X64J 2XS7A 2LDIA 3QRPA 4LR9A 1OWXA 2WCXA 1H7XA 4EO8A 2GVZB 4RBTA 2PMZD 1U0SA 4LUBA 1UVJA 1F9FA 1UL3A 4KGMA 4NPOA 3POTA 1BWVA 1SCJB 4X66F 4CLKA 3K58A 4NCBA 2H3EB 3S7RA 2KXFA 2DTJA 4C0HA 5GAHI 3BBBA 2XQCA 4NZ0A 1U8SA 2WTFA 2AX0A 4OHYA 3ZNJ1 1JNRB 2A2DA 3I5AA 2CPDA 4PWDB 3HM9A 5J1PA 3GV7B 1RAJA 1BC6A 5A8WA 3FEZA 2HWTA 2DR9A 3R97A 1N33F 1UWBA 1FJGJ 8RUCA 2ZH9A 2CJBA 2PSZA 4Y6IA 1I51B 4DL7A 1YDLA 3K8WA 3IBWA 5E33A 1GK8A 4OX9F 1U2CA 5L38A 2M8HA 2XLJA 2XMAA 1RYSA 4EBDA 3PYDA 2MKIA 3SSRA 1JLCB 4RBUA 1HQUB 5MAOA 1TL3B 1CEZA 4KC5A 2G2YA 1JLAA 1JWWA 3TX8A 3FRZA 2B8PA 2HHVA 3GZ7A 3HHDA 5IWAF 3ZZPA 4WE1A 4MH8A 1FCAA 3TVKA 3HKZD 1BQMA 2RQCA 2NXEA 1GMWA 1FT8A 3L95X 5KFSA 3MMJA 1N5YB 1SJ3P 1TELA 1KRPA 3O44A 3PXGa 1VK3A 3HSJA 3C6UB 4B3SF 5J1EB 2D68A 2KYZA 2WB1D 1WKLA 3Q0AA 1TQLA 1GT8A 3WQPA 3QZ8A 2RD5C 1WHYA 2XG8A 3GYNA 1KR4A 3L7PA 1WF1A 2CJQA 1FEHA 3BGOP 2E29A 1B7YB 2JOQA 3A8EA 3J7AN 5ETMA 3BDPA 1RAAB 1RT7B 2IJRA 5BYSA 1S57A 1YI2S 3EVWA 3FZ2A 3FBBA 3LALA 1M1HA 2CQ4A 1X9WA 4DV1J 1Q86T 3M8SA 2B9YA 3KMQA 5J2QB 2DGQA 1QSLA 1M1GA 5LM7E 4CM0A 1G6BA 2HQIA 2OPRB 3ZXWA 5KAKA 1VK8A 4FXDA 2CQ3A 3M8ZA 5IT9Y 3CD7A 1D9FA 3Q86A 3CC2S 3D2WA 3QGPA 5CQGA 3V6KA 4W92B 1TVRB 1S0MA 4YMEA 2IA0A 4JI8J 1PILA 3G96A 1NPRA 3H2UB 5CZXA 1UFKA 3D1HA 3QYYA 2F65A 3FSYA 2WSFC 3DYAA 1Y4ZB 1FKPA 2M7SA 3ENWA 1QM9A 2I5JB 3CCQS 1MNEA 3L4BC 1ZM3A 1LK7A 2E5LJ 1WD6A 2YKNA 2OLWA 3GFHA 3JSRA 1E6VB 2KDOA 4F4AA 1XQIA 1UMJA 4MFBA 4A8OA 3CIZA 4R8UA 2J8SA 4K7QA 1N6QB 1PJ6A 3TW0A 2KKHA 3I0SA 2QRRA 1QE1A 1AFIA 2VH7A 2AMCB 3F41A 1B7FA 2KJWA 3WC2A 2UU9J 3NNHA 2V8DA 2XI3A 2ZHOA 3P4UB 2FLPA 1U47A 3PYFA 3VAKA 1O5JA 1GEHA 1U1RA 3IFEA 2KXNB 2IVFB 1LWEA 3ZZYA 3DDNA 4CLZA 1L3SA 2G1DA 4PPDA 2EK6A 5SZTA 3C6TA 7AT1B 3DLGA 4OYWA 3MFHA 3UCGA 4QPTA 1B0PA 4LF4J 1RHRB 2L48A 1Y9OA 1T03B 4C3KA 1IWAA 5E41A 5KFEA 2WOMB 3DLLQ 4LBHA 2AEJA 4B3MF 4WIIA 4ZLLA 2HKEA 4HR2A 4QYZK 4CYUA 5K14B 4CT9A 3FUYA 3J81Y 3R5DA 2V69A 5D4PA 3UDLA 3DGPB 2AU0A 3W5ZA 2HURA 1Q16B 1R6YA 1K9MT 2OSQA 1KWMA 4DR6F 1S49A 2OTJS 1NHVA 5IT0A 2JEJA 2CPJA 4AQYJ 4ZMMA 4OHWA 5KFCA 4IG0A 2ZZMA 1XC9A 2RS2A 3Q2TC 5KFAA 2N7YA 3DRPA 2YWHA 3ZZZA 2IY5B 4OI3A 3MR3A 2RMLA 4BWMA 4AYBD 2J76E 1VBZA 2MB0B 5I42B 3TJ8A 1HBUA 2VZ9A 5D4OA 4DWIA 3W9HA 3MAAA 3EVOA 2ERRA 2RUSA 4Q0BA 1EKRA 4RU9A 2FLLA 5A6PA 4P2MA 1BLUA 1UW4A 3HFKA 4PR6A 1SUQB 2XZWA 2UUCF 3BB5A 4KGKA 3PDNA 2DHXA 1IKVA 3KJQB 5K8PA 4IDKA 2CQ2A 2XTCA 5IV3A 1YJNS 2BJ1A 1QTMA 3NCPA 1X4BA 4HDGA 3CC7S 2J5AA 2CADA 1R0AB 4URSA 3DU5A 3LPEA 3Q22A 4JOUA 2ZOGA 1M5PC 1S77D 2HS3A 1JJHA 1S9GB 2F9DA 3X1LB 3OPKA 5HK4A 3W8PA 4PQUB 3M1VA 4AAIA 4X65F 3GIMA 3V81A 2HVDA 2EBEA 3MR7A 4A8FA 4O44B 4V1Ak 5DJBA 3MAHA 4KH0B 2HFUA 3RW6A 3CCVS 3BKTA 1OMSA 4UOCA 4F26A 1YVFA 3G6XA 2XY6A 5D15A 3NO7A 1ZETA 3MEGA 2AN7A 4MIAA 4ECQA 2J9EA 3QWUA 1U26A 4CH7A 4X4TA 3GIJA 1Q1KA 3A3NB 4QYRA 3DMJA 4TY8B 1URNA 5RUBA 1PYOB 2V8GA 2B5JB 1RKJA 2R8KA 2L9WA 2CXEA 5EX0A 3FCWA 1UVKA 3F73A 3J80Y 4OX6A 3R7SB 1ZH5A 3EZUA 5KFLA 3MMCB 3KLFA 4MMOA 1WTBA 2PFDA 4C97A 4A8KA 4A48A 4MIBA 5HL7Q 1PJ5A 1HBNA 1ROFA 3EZOA 1HMVB 1HWIA 1SXLA 2ATCB 2GAGC 4LF8F 1EB0A 2VBZA 3VEAA 2V4JB 4ZCIA 3UCZP 2Q2KA 3D6HB 5JVGQ 4YB6A 4N76A 3D6FB 2XTEA 3K5NA 4RPFA 5CXTA 1TKTA 1TTHB 5BYQA 4DL6A 5CABA 3U02A 1SIZA 2QO3A 2QN6B 3I96A 5J2MA 5B09A 3T5KA 4DL4A 3BO3A 4CWBA 2YNFB 4DQRA 4R0JA 1WEYA 4NMXA 2UUAJ 2BX6A 4DR5J 4WKYA 4OI4A 4DV3F 3UD4P 1S9EA 3DNCA 4P73A 4F0KA 3H2LA 1GTEA 4YHHF 3BSAA 3ITHB 1FJEB 3PFEA 4LQ3A 2ADLA 1GQEA 3KLEA 3BKFA 3FEYB 4M8LA 4R5PB 3KJVB 3CCZA 3QMQA 3PRVA 2HWHA 5B0FA 5DDOC 1TKXA 5T14A 2IA6A 1Q4RA 1HNVB 3BDEA 4DU8A 1UEVA 3LW5C 2CJXB 3ISNC 4DR7F 5L1LA 5E2QA 1LK5A 1X5OA 4YR2A 3GILA 3OTEA 4DV0J 1U1LA 2ZJRQ 1LQ9A 4U6PA 2VIHA 1S1WA 4DR5F 3NEKA 2PO4A 3EMTA 5KG2A 3M2VB 3RZAA 4PXDA 2DO0A 4O3NA 2LA6A 5HAOA 2OELA 2O5DA 2CAJA 4W4MA 5DS7A 5CYJA 1A6LA 2OD4A 4LF9F 2IC3A 1B70B 2VUGA 4I7FA 7FDRA 2RB7A 3H5SA 1TFWA 2BE9B 1FXDA 5T7LB 4MKVA 3DLBA 4MIWA 2ZJQQ 1ZAXA 1FWKA 3CJRA 4J9MA 2DRDA 3FK4A 4RWXA 1HW8A 3VAGA 4ER8A 2V0NA 2JFKA 1MROB 3CCES 4FBUA 1N0VC 1UEUA 4QR2A 4DV0F 4K8RA 4NA2A 3CD0A 3NGRA 4GVBA 3MEEB 6AT1B 1CJUA 2VDHA 3AB2B 2VJVA 2RVJA 4Y34A 4OMFG 1OQ6A 1DTQB 1W26A 3IGVA 1RTHA 3SCKE 2VFTA 2F8MA 3PIPQ 1NKEA 3VAMA 4P52A 3JTNA 4IFVA 2OPQA 2AYBA 3R2CJ 1UWAA 3FT7A 3PFOA 4J9OA 4C0OC 2D1CA 1R31A 3HDSA 2QJ3A 4P6QA 3M8YA 3AJDA 2GAHC 2LCWA 4QR1A 5L39A 2AX1A 2ZBPA 2XTJP 3K5PA 2MKSA 4ZP9A 3KLGA 5C2CA 4K0KJ 1KLMB 4DG1B 2CQCA 5KFZA 5CYQA 2CQPA 2VQFF 2YWWA 1PSDA 2L08A 1Q79A 5HP1B 3OVBA 4ELUA 2CPIA 2QYGA 3BBFA 1JLEA 1CJVB 1S0VA 2IVYA 5ITHA 2HIYA 1WHVA 1S7IA 4O4RA 2L9NA 4HI2A 1LW0A 5AXMA 2BKOA 3A8JA 3HHLB 2IFXA 3KDNA 2DD8S 4YB1P 2EBGA 3PACA 5IC4B 3OJSA 4WWSA 1F6TA 1S6QB 5D77A 4AL5A 2JSXA 1Q5YA 3OL8A 1QUVA 3MCNA 3W7BA 1APSA 1VC0A 2MSSA 1YSJA 4D3GA 2I8EA 4ZCLA 1HPZB 3HMJG 3TA0A 2DIUA 4CDIA 1Y7PA 2XZ2A 1NK6A 2B51A 2N3OA 1YRUA 1YZ7A 1IN0A 4LVNP 1CLFA 1RB0A 3OHAA 3GU0A 5HVGA 2O67A 5AE1A 1WELA 1ITPA 3NCQA 1HNZJ 2OI2A 4AE5A 4HH0A 5ETSA 2V1TA 3MMAB 4OZ0A 4O3QA 5CH7B 2JBVA 3Q8SB 3HFZB 3KMSA 3T6BA 2JZ5A 2DNRA 4JI6J 4PWDA 3DRSB 1SC3B 3GMGA 3P45B 5KT4A 5KFMA 1H73A 4P2XA 2XO6A 1SV5B 3LOUA 3BO4A 4TQRA 1VRQC 1YKWA 4UQTA 3RAXA 1TUGB 4I64A 2XBPA 2ZKTA 4BWJA 1VQNS 2RRBA 4QWAA 4AUKA 3NS7B 5JJBA 2KI2A 1Q78A 3SCIE 3UNYA 3DOLA 3HPOA 1HHTP 1HNZF 5C25A 1RQ0A 3OSPA 4N41A 2FJDB 2PDAA 4DQSA 3GJSB 1WACA 1PIEA 4JI6F 3MM6A 4FXWA 1RADB 1RTDB 1FNMA 3NLCA 1NJXA 1HQUA 4KHPJ 2ADCA 1TL3A 1JLFB 4K59A 1KN6A 2HFVA 3M9OB 1MMNA 5I3PA 4KIAA 1U0HA 2DHAA 2HGMA 4DLGA 1FVSA 2JRSA 1RUSA 1X60A 2GHPA 2VQEF 3DRRB 3RB4A 2UXDJ 2BEFA 1WORA 5K9FA 1FRMA 2GMHA 1N5YA 1HNIB 2HWIA 2WBRA 4PEOA 1DURA 3KXDA 2KELA 1Y5LB 4I2QB 3C6UA 2K9IA 2DGTA 5KFGA 1U8WA 2JEGA 2RKIB 3KJNB 1FXLA 5F8GA 4NMLA 3ZTSA 2J8AA 1OG7A 1FRKA 2F4FA 4X4RA 3RU0A 3H90A 4ED1A 2QA4S 3EUNA 4ZCKA 4ZIWA 3J7Z5 1RXOB 1FX4A 3D66A 4DX7A 1SH0A 1WEXA 2X51A 2XYHB 3ZTPA 2E66A 1S4EA 2NZCA 1RT7A 1RWNB 3CIMA 2XMVA 4FN5A 2VONA 4IO9Q 2YH0A 3MM8B 2HFOA 1N54B 1T9UA 5GMEA 4PAAA 2HRTA 1K0TA 1OM2A 3MXHP 4YDXA 5D0HA 3QIDA 1XNRF 1B99A 1OSDA 5J2QA 3GPAA 4Y65A 2F40A 2DNQA 3U27A 5KOWA 1M5OC 3C19A 4KE5A 3R6LB 2H5IB 1CS4A 2C3OA 2UXCF 3L09A 3P49B 2VPXB 4ZVSB 4I6WA 4EYIB 3M4XA 3D67A 2XNRA 2QLWA 1RTIA 4ITSA 3SDEB 2XZTB 4OZ3A 2R8HA 4KY3A 3HT0A 1H0HB 1ZYQA 2I5JA 2GMLA 2AZ1A 2LMIA 4ED0A 1F3FA 1XR5A 2W9CB 3AD7C 3LJPA 1E6VA 2KXHA 3VGSA 3MOZA 4PWUA 2NS1B 1S9FA 2NSBA 1IKYA 1F0XA 4DPTA 1N6QA 4H4MA 3RRGA 3CB4A 3HO1A 2Y0BB 3IGNA 3N5BA 1XR6A 2RDDA 5E3PA 1U1OA 4DX8H 2KTQA 3Q2SC 3R9LA 1XMBA 3SV4A 1UVNA 3PIOQ 4GKKJ 2I38A 3OR2B 4ZCMA 1TL7B 3NBPA 4KH1B 4DCPB 1WHXA 2YX1A 1RTJB 3MDFA 1EKSA 2YBVA 1Z4UA 4IOBA 2YPZA 3EGZA 1H2UX 4UOHA 2ZE2B 4MT1A 1A9NB 5DDRC 4KGVB 1QAIA 2HNZA 2QFIA 1XK8A 5HROB 5I3UB 1S1TB 1S72S 1T03A 5HN0A 2YPYA 4NYOA 5D4LA 3RGIA 4UZBA 1TL1A 4EI2A 2WOMA 3LAMA 1N4LA 2RILA 3MM7A 1OHNA 5K14A 3ZZOA 2HHPA 2ZVSA 1NKCA 1A0OB 4M5LA 1K44A 3UQSA 2QEXS 2VPYB 1RHMB 2QFJA 3HSGA 2ATLA 3L3CA 5E3AA 1UCNA 1ARQA 3CCSS 1HL6A 1ZPWX 5HVHA 3IWNC 2ZUAA 3DOKA 3R5AA 1Q16A 2OTLS 3MEKA 1FD2A 2AJ1A 2BXJA 1RDRA 4RW9B 2DJWA 1RAGB 3LH2S 3HX9A 2IM1A 1H74A 4AT1B 2YX7A 4LF7F 2GGPB 5DO2A 2DR7A 2HVHA 4NE9C 3UVJB 2M52A 3M30B 1VMBA 5ETPA 1BY9A 2BNZA 5KFYA 3TUPA 2JEIA 3L7OA 1WKKA 1QTNB 3GYXB 2ADBA 2HNYB 2BZ2A 4UT4A 2AWZA 1RWMB 2DNGA 2ZWOA 1KONA 3VV2B 2KJVA 1XR7A 2J0WA 1GMWD 4CH1A 5KFKA 5L1IA 2CPXA 1OY6A 2BE2A 1Q7LB 1Q81T 5B0AA 4MK9A 3MPYA 3EGNA 4WYLA 3NGSA 3AXKA 1FVQA 3RB3A 4ZVUB 1R0AA 4X4QA 3A4TA 2B4PA 4I68A 2VFRA 4M63A 1S9GA 1X4AA 4FP9A 3H5XA 4PQUA 3HCXA 4J5OA 2F9JA 2V63A 4B17A 4M5MA 3G8SA 3H59A 2V50A 3WDOA 1U1MA 3R5CA 1R8AA 3H0PA 3KHHA 1HD1A 2MY7A 4I4BA 3CMQA 1UFWA 3QSIA 2V5HG 4NLGA 5AT1B 4A4JA 2ZC4A 3QGIA 1AROP 4ED6A 4HTIA 3IBCB 3OL6A 2Z56B 4LRFA 2C1EB 2B6AA 3R5JB 1FDNA 2FGOA 2UVRA 2B5JA 1HWLA 3PX0A 3VGTA 1HNWF 4OLOA 4GVLA 3QIPB 1SJ1A 5FLXY 3CDBA 2KM8C 5A0YA 2VOPA 4XPCA 1S6PA 2R42A 3CJKA 3IM9A 1HMVA 3I5CA 3MR2A 5DZ6A 3ELHA 1NPKA 3OFGA 4OYBA 4GC7A 4NYPA 3I82A 1F3VA 4E2FB 2KM8B 1U24A 1GXTA 1E6YA 5K5MA 2X1FA 1DHMA 1DFDA 1VLYA 1IVZA 3S01A 3PKMA 4FDFA 2FUG9 1T0TV 3ILLA 4P72A 4DUZJ 4WTYA 2V2VA 1I94F 1UVIA 2DPJA 2JX2A 2EKYA 3SV3A 4NLPA 2WRMA 2VV5A 5GAEU 4E98A 2RE1A 3I9V9 3JYTB 5KFXA 1S6OA 5A6WA 1QSSA 4X4UA 2O66A 2FVSA 3OFEA 4RNMA 3KYLA 3MUMP 3N4WA 2D9OA 3MR5A 4HHHA 1XJWB 5C7PA 2ALZA 4X4NA 1U4BA 2HYIB 5KFNA 4KGZB 1LWCA 3UN5A 1REVB 1Y00A 3BBCA 4F67A 2BDPA 4O3SA 1KD1T 2KG1A 2Y1RI 3M8RA 3H25A 3AOBA 1JLQB 1HNVA 4EUVA 1FKOB 4ENOA 4DR4F 5BXIA 4NL5A 2UV8A 2JLGA 2R2TA 4P74A 4NCAA 5KFPA 1ZM4A 2LU1A 3QJJA 3NNCA 4EZ6A 4IH6A 4LREA 4ATNA 5ETNA 3GFZA 1WC0A 1IBLJ 3M2VA 4RW8B 2AJ4A 2DXFA 3CSKA 2Y8YA 3A13A 2HBYB 1U6BA 4UW2A 3G8QA 4DSJA 2E9RX 4F0MA 4P75A 1DQAA 2V2QA 1M90T 3KLIA 4K4SA 3CJ3A 1S1UB 4NLXA 2DT9A 1MWQA 3AD8C 3ZTOA 4JI0J 4DR2J 1O0PA 1MROA 1RLCL 3V6HA 2YNIA 1S79A 4DL2A 3MEEA 4AXIA 3CDWA 2EFPA 3JXOA 3QLHA 1H7WA 3G82B 3IG1B 1BQNA 1JLGB 3R1HA 4LSLB 4G1IA 3DI6A 5E0OA 4PPZA 4TQSA 2JLEA 1TKZA 3OUYB 3SZ2A 4IFYB 1ZS6A 1SPBP 2JXHA 2FTRA 1UJ5A 3CJTA 3BZQA 4Q8EA 4DR3J 4HV0A 1VQ9S 3NCRA 1KTQA 2HRYA 3A3OB 3CMAS 3UD3P 4NCGB 2GQCA 4HACA 3JTPA 1VJQA 5KFOA 4ZOSA 1OQ3A 3TP2A 2J9CA 2BW7A 4DG1A 4QIWD 5A2QY 1GXUA 3CCMS 4DL0C 4UTGA 1Y5IB 4CLWA 1EQMA 1UP1A 2QL7B 4ETXA 2IRXA 1YK9A 1J27A 4UOFA 3T3FA 1CJVA 5KFUA 3EDQB 2V68A 1RZMA 1NK7A 2H4WB 4FKXA 5C42B 1TUWA 2L41A 2E5IA 4WU3A 3NP5A 4LFAJ 2YNGB 3FQKA 1HI0P 3DGVA 3I32A 4KRWA 4QWDA 1FFWB 2RDIA 1ZZNA 1HQEB 2AGQA 2HHSA 1S6QA 4ID8A 4WK3A 2C2KB 1Y5NB 2CJKA 1H98A 1IUJA 3JTOA 3KJFB 4UOGA 2HFZA 1T3NA 5IZHA 1NKBA 2HGLA 4C3MA 4WKRA 2YXLA 3BPSP 1YJTA 2XMWA 4L75A 5E7OB 2FHMA 1HFEL 2K7JA 1VQOS 2VG5B 1IKXA 2HQGA 4ZPWR 3TI0A 4EK2A 2DGXA 1HWJA 2H5EA 2YNHA 4ZP7A 3GJQB 2QA2A 3D6TB 3DRYA 3BF4A 3DRSA 2ZH7A 4ELVA 4F3MA 3PCOB 2JEFA 1SV5A 1Q5VA 4FS2A 1UKUA 2E1AA 2RF2B 1DLOB 1VHFA 4NXNJ 1TZ0A 1ELOA 1EIYB 1YJ9S 1TAQA 4NXMJ 3ZZ0A 1PBAA 5LL6d 3IM8A 2IM3A 1ZM2A 4DCOB 4RO0A 5IXUA 2HLTA 2GHVC 1NDKA 3M32B 4J9RA 2RRNA 2NYIA 4BBYA 4C8KA 5HLFB 1IBMJ 1S1VB 4DR1F 2WVEA 1SIWA 1EJ7L 5LSRA 1R7IA 3OR1B 2DY9A 1PG5B 4DV6J 1S6UA 5F8JA 2DYAA 1S4FA 3CCTA 5HI7A 1V5IB 3W65A 1WHWA 3KLVA 3TZZA 3OTCA 1P27B 4P71A 1BD6A 2R7UA 3KFWX 5EDWA 1RBLA 4PUOB 3EPIA 5BJRA 1X5SA 4FVMA 4NXMF 1KDNA 4EBEA 4LSNA 2J0SD 1S0NA 2LEBA 2CPFA 1T05B 4L76A 1FHTA 3PYEA 5D0RA 4DPXA 3GR1A 1Q8KA 1NM2A 2XY5A 3GWCA 3M7VA 3V4IB 3CMES 2RKIA 3FSXA 5KG1A 4JYAF 4F4WA 1H2TZ 3T19A 1X4DA 4QU7A 2XNQA 1RJJA 3AHPA 2W9BB 5GAEI 2H5JB 4LFCJ 4WFZA 1T7PA 1VJWA 2HHHF 1VBKA 7FD1A 4DSKA 2NXJA 4ZVQB 1PC4A 4QYZJ 1BUXA 1HHSA 3TJAA 3V6DB 5KFIA 2FVQA 1S12A 4O0NA 3EJMA 1RHUB 5FIIA 3CCWA 4ECVA 2G0JA 2VC0A 1N32F 2MLXA 2O1PA 2M2BA 3CJ2A 1NH7A 3AJ1A 1R8CA 2R2UA 3O6QA 2R7VA 3CC4S 3NAIA 4C11B 1IM4A 1DTTA 3NNEA 1NUEA 1NSQA 2AP6A 3D28A 3AWRA 4LRDA 3SDEA 1RT3B 2FDNA 3D54A 3GFXA 3ENQA 4WF9Q 1WOOA 3UDVA 2Z0GA 4HL9A 1Y11A 2W9CA 4RNOA 2Z57B 3JQJA 3RB6A 1ZBTA 4F02A 1IBCB 4W98A 3NS5A 3QFHA 4PXEA 2MSTA 2DCUB 1ZTTA 2H51B 2I9SA 2ZNYA 1HKAA 3ETMA 2BNWA 4IH5A 4KHRA 4WFXA 1SKSA 4KYZA 3FBCA 3LP2B 2DH9A 2JVRA 2ZBCA 9ATCB 2U2FA 1RAHB 2BMBA 1RBOB 3OL9A 2CJYB 1RTJA 1WNEA 2BANB 1QAYA 1HLWA 3MPDA 1UVLA 1NJIT 5D4NA 2B56A 1W25A 2GJFA 2ZE2A 1RHQB 4JI1J 2K29A 5F0UA 2R3VA 5GADI 4XTTA 2AD9A 5LT5A 1C1BB 2ZHBA 3UWTA 5DQGA 2E1RA 3M2UB 5I3UA 4YB5A 1Q7YT 1NSPA 1S1TA 3D68A 2DNZA 3HD1A 2CPHA 2Q66A 3M8QB 5KT7A 3ZZTA 4FPRA 5KT2A 1G1XA 2IJFA 4CLTA 2VICA 1JLBB 3K7RA 4P2SA 1JJ2R 4F2SA 5DM6Q 2XY7A 2CG4A 2COLA 3UPFA 3SFGA 1FTCA 3HULA 2FLOA 2HK2A 3KK2A 1WWHA 1Q82T 2ZH3A 1U25A 1NAQA 1RHKB 2FHOB 3CTRA 4A46A 2JH3A 4P10A 3US5A 2FVCA 1FFSB 2PA3A 4JI1F 2UXBF 1VQ4S 4QW9A 4C8LA 3HVRA 4FYDA 3BSCA 2P6SA 3KLHB 5IS2A 4O4GA 4C98A 2GGPA 1C4CA 1NO8A 3FKBA 5KOXA 1H2VZ 4MYUA 5KFFA 3QGGA 3M9NB 2O3DA 1NCLA 1FWPA 2HAIA 5IOLA 3D3BJ 2KZZA 2UP1A 2IDLA 4J91A 2BQ3A 2HS4A 2HNYA 1X5PA 3R7BB 3ILJA 3K17A 1R8BA 3W62A 1T8EA 2Y0SD 3IRXB 2X1BA 1H6KX 1L3TA 3VWSA 2K1RA 4QBUA 2MLYA 2CWXA 3LF0A 3HHNB 4CO3A 4Y2CA 2WVBA 5HBMB 3K5MA 2M9KA 3I56S 5D3GB 4OJGA 3KOAA 4OZNA 1CJTB 1CULB 4YY3F 1M0SA 2QC3A 4LRAA 2CZ9A 4CNYA 4WYWA 4OV1A 1XIQA 2EKNA 2ZH4A 3W8GA 4F25A 4USVA 2NREA 1UEKA 4ANCA 4DSFA 2OPPB 1GNKA 4ECZA 5K20B 4YP3A 5DG9A 3W2VB 2XYGB 1VQ8S 2IYGA 3SMZA 2DNKA 4DV7J 2G4BA 2J0XA 4ID5B 3TUZC 5H9EK 4CH0S 5DQHA 4G3IA 4FF2A 1HA1A 4PCQA 4TKTA 2BJ7A 1TKDA 3MPUB 4ILLA 4LR7A 3W61A 2HVEA 1SC1B 1IQZA 2M3DA 1LEOA 1TV6B 1JKHB 3MD3A 5KFTA 2HNDB 5EWEA 1MG7A 3I0RB 1TL5A 3AQPA 4GKJF 2JXIA 1VR6A 1QY7A 5HATA 4DV4F 4OHZA 1F5BA 3EPGA 4FXEA 5L46A 3QJPA 2B7CB 5BYRA 3OW2R 4HHUA 2KYXA 5LXRA 2J7KA 3FNNA 1CC7A 1C0TB 3JYTA 4ME7E 3CJQA 1TK5A 3EGVA 1AXQA 2KT3A 3LP1B 2HHUA 4JI5F 1YBUA 4X4VA 4U8VA 3TA2A 3D3CJ 2WW8A 1J5EJ 1FK9A 1OO0B 3I6PA 1VIOA 3IAM9 5GMKa 1REVA 2H54B 1XMQJ 5KT6A 4J9LA 2N4DA 4C9DA 4QWBA 4RW6B 4CLUA 1VBYA 3PRDA 4B02A 1JLQA 1VRTA 1U1QA 2JC0A 3IS9A 1VBXA 4URGA 1FKOA 2DY1A 4H4KC 1M5KC 3RG6A 4MK8A 1N36J 3I87A 4ECUA 3RBDA 2WZ1A 2OSRA 4FZVA 3H5YA 4WXWA 4KT0C 1NDCA 4K4UA 4CTAB 3L7UA 2A6MA 1QAJA 5GMDA 3NGDA 4JI4F 1LWXA 4RW8A 4QR0A 1RU1A 2CJAA 3DXBA 3GONA
chains in the Genus database with same CATH topology
3LOUA 3BO4A 4TQRA 3MMCA 2RNEA 2IM2A 1J5EF 3RAXA 4UQTA 1R27B 1QE1B 2MY8A 1WEZA 4ZPAA 3MURP 4I64A 2MJUA 1K1QA 1YITS 4XAKA 2XSFA 2XBPA 4RX6A 1FERA 1WF0A 3HK2A 2NPFA 2ZKTA 4BWJA 2B0GA 1LXJA 5D8HB 3HF5A 3PY8A 1VQNS 3K57A 3T6JA 2VBYA 3E2EA 2RRBA 5GAGU 1S10A 4QWAA 1C1BA 2AJFE 1RI7A 4AUKA 4RWWA 4NLOA 4KBIA 3OV7A 4B9SA 3M2UA 3PHEA 1U49A 2NR0A 2VOOA 2JFDA 2V4JA 2A2BA 3F56A 4XIUA 5JJBA 2KI2A 1FDAA 3SCJE 2PIIA 1I1GA 4KV8B 2BE2B 4ED8A 2PMHA 2W7AA 3T1AA 1Q78A 3BQ2A 2MZTA 2VPZB 1N5SA 1NH8A 3CDUA 3DOLA 3M8QA 1OIAA 2ROGA 3SCIE 1M5HA 3HPOA 1HHTP 4K2XA 3E01A 1HNZF 4AQYF 4Q2MA 5C25A 1JB0C 1RQ0A 3O2IA 2W9AA 1DJ0A 3OSPA 2EW9A 2CQHA 3MFIA 5HMYA 4NOHA 1RT1B 2OIHA 1JLBA 3CJ0A 4N41A 1NK9A 5C24B 2FJDB 2PDAA 5CCMA 2R7TA 4ECTA 1NZAA 1F5AA 4DQSA 1K8AT 4LFCF 1WACA 4JI6F 3MM6A 2YNFA 4FXWA 3EXYA 1FNMA 3NLCA 1NJXA 1RTDB 1HQUA 4F50A 4YOEA 3BN7A 4LSLA 3WX4A 4EWTA 2ADCA 4B3OB 1TL3A 2DB1A 1JLFB 4K59A 2LQBA 4K4XA 1KN6A 4N47A 1X0FA 3IN5A 4ED2A 2VFUA 3M9OB 1MMNA 4JBCA 4MKAA 5I3PA 3OHBA 4O3RA 4KIAA 3UFCX 3OUYA 2RS8A 2DHAA 3MM9B 1K73T 2HGMA 4OHXA 3QJLA 4RNHA 4NYZA 5DLGA 4DLGA 1FVSA 2JRSA 4EEYA 3IR7A 2F7VA 4PG7A 2GHPA 2VQEF 3T9NA 3MM5A 5E3CA 3MUTP 4EYHB 3DRRB 1BQXA 3ITHA 3RB4A 2DR8A 2GCFA 3I4PA 2D41A 2DGOA 3CVKA 2V4RA 4TNOA 2FHKA 3PW4A 2AJQA 2MZRA 2MQPA 2WONB 1ZAWA 2F8HA 4U9RA 5K9FA 1FRMA 3RAMA 2GMHA 1N5YA 3OLAA 5CYMB 3ULHA 3RR8A 1HNIB 2HWIA 2EC0A 3SSQA<