3OL9A

Poliovirus polymerase elongation complex with 3'-deoxy-ctp
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
461
structure length
461
Chain Sequence
b'GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymerase
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
total genus 136
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3ol9A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ol9A02
4IH5A 5KG3A 3G6XA 2IAJA 3OL8A 3LAMA 2D3ZA 2R2RA 2R8GA 1IKVB 1TKTA 2IC3A 2OPQA 3VQSA 2IAJB 3NKYA 4RNFA 3PW4A 4NLPA 2OPRA 2IC3B 1S6QA 5KT4A 1HMVB 3MR5A 3T5LA 2BQRA 4Y34A 2FLPA 1S1XA 3SFUA 2OPRB 3DLKB 1S6QB 4NLDA 4RNHA 3DLGA 5DLGA 3MR3A 1C0UA 5KFSA 1S1XB 3T5KA 5KT2A 3RAQA 4WZQA 3DLGB 3V6JA 1C0UB 4F50A 1SH0A 2AGOA 1NHUA 4LQ9A 1S49A 4DL4A 4IG3A 2OH2A 1YVFA 5CYMA 4JV1A 4XPEA 1KLMA 2HWIA 3CDUA 1ZTWA 2AU0A 4F4YA 5CYMB 1KLMB 2WTFA 2QE5A 1C2PA 2VA3A 5J1EA 2D3UA 4DL7A 2ZD1A 1RYRA 2GIQA 3MEGA 5J1EB 2VG6B 3NAIA 2HNYA 2ZD1B 4J9MA 2ASJA 2JEJA 4GC7A 2JLEA 5L1IA 3TVKA 3NGDA 2HNYB 1ZETA 5KFAA 4KHRA 3V6DA 4IQXA 4KE5A 3DOKB 3FQLA 2RF2B 3KHLA 3V6DB 5F9NA 2J6TA 3BQ2A 5L1JA 1SUQA 4ZVFA 3BSAA 1SV5B 2E9ZA 5KT6A 3CJ3A 4ECQA 3FQKA 1K1QA 1SUQB 4TY9A 1C1BA 4IFVA 5K14B 2XI3A 4O3QA 4QWCA 1C1BB 4IFVB 1RT1B 2XCPA 1KHWA 4KSEB 3UR0A 3GIKA 4F4WA 3V81A 1D1UA 1WNEA 4EO6A 3V81B 5KG6A 3M8PA 3H2LA 3V6KA 1JIHA 5T14A 4HKQA 2W9BA 3M8PB 3DRRB 3IG1A 2W9BB 4J9PA 2WK4A 3IG1B 3MFIA 3CIZA 5KT3A 5JXSA 1RT2A 3RBDA 4RW7A 3GV8B 4JV2A 1NNDA 2WHOA 4O4RA 1RT2B 3DRPA 4RW7B 1T3NA 3KLVA 1FK9B 4XPCA 4NRUA 3DRPB 3PZPA 2BRKA 4O44A 3MECA 5KG4A 4RNNA 2AWZA 2EC0A 4EBCA 4O44B 4Q0BA 3MECB 2OPPA 5EDWA 4I7FA 5J2MA 1GX6A 2J6SA 4Q0BB 1JLAA 1QAJA 3BSOA 2OPPB 4I7FB 5J2MB 1JLAB 5C25A 5DLFA 1SH2A 3QGIA 1FKPA 2FJWA 4IKAA 4ZPDA 5KFTA 4ZVGA 5KFGA 3M9NB 1FKOA 1SH3A 2I1RA 3KMQA 1FKOB 2B6AB 4ZP8A 3LP1A 5D3GA 5KG0A 3MEEA 3QLHB 3UDLA 2UUWA 3HVWA 3LP1B 3PR4A 4QWDA 5D3GB 3H40A 2BE2A 1MMLA 3MEEB 4QPXA 4O3NA 5EWFA 3HVAA 5KFHA 1DTQA 4EYIB 3SI8A 2BE2B 3KK1B 3OL9A 4ECTA 2BQ3A 1DTQB 3CJ2A 5F8GA 1S1WA 3D28A 3DI6B 4ZP7A 3KLIB 1R0AB 3EZUA 4WE1B 4TQRA 1S1WB 3CDWA 3JSMA 4EBEA 3I0RA 2FJVA 3JSMB 1XR7A 3I5CA 3MR2A 3MFHA 3I0RB 5J2NA 1S48A 3IGVA 2JC1A 4ZMMA 4J9KA 5J2NB 4B3OA 2F8EX 5KFYA 4IRCA 4ZHRA 3CJ0A 2B5JA 3QGGA 5J2QA 5I3UA 4B3OB 4ZHRB 4MH8A 1RT4A 1T05A 3PW0A 4FS1A 2B5JB 5I3UB 5J2QB 3PJWA 5FDLA 3TAMA 1RT4B 4H4MA 2IM3A 4O3OA 5FDLB 3G6YA 2IM0A 4K50A 3TAMB 4DEZA 2BQUA 4H4MB 4FBTA 1RT5A 5KFRA 1RYSA 2HNDA 2HNZA 1RT5B 3BGRA 1EP4A 4K4SA 2C28A 2HNDB 3H4BA 5L1KA 1QUVA 2HNZB 5J2PB 4DL3A 3BGRB 1EP4B 1JKHA 3GYNA 1BQMA 3QO9A 3PW5A 2ALZA 1TKTB 2OPQB 1VRTA 5JUMA 3EPIA 1JKHB 3DOLA 4QW9A 1S0OA 1BQMB 3QO9B 1VRTB 1S0MA 1BQNA 4K4XA 3DOLB 1IKYA 5F9LA 4NLUA 1S6PA 3CO9A 1BQNB 5F8LA 3CJ4A 1XR6A 1S6PB 3C6UA 5KFXA 2V4RA 3H5UA 5KFQA 3KLGA 5KFFA 2W9AA 5KFZA 4ECSA 4EEYA 4Q8EA 3NAHA 1T94A 4EYHB 3C6UB 1DLOA 3H5SA 3KLGB 3I5AA 4Y2AA 3DLEA 2R2UA 4K4UA 4IG3B 4WXWA 1DLOB 4RU9A 2GC8A 4RW6A 4YMEA 4WFYA 3DLEB 3OHAA 4ECUA 1JLFA 3GIMA 2ASLA 4RW6B 1JLFB 3GIJA 2FVSA 3Q8QB 1LWFA 1XR5A 3CWJA 2C22A 3KOAA 3MEGB 1LWFB 3ICLA 3KNAA 3H4DA 4O4GA 1UWBA 2YNFA 1W25A 1QE1A 1UWBB 2D7SA 2YNFB 3BREA 4O4GB 3RB3A 1N6QA 1RDRA 4J9SA 4ED3A 2DPIA 1N6QB 2OPSA 3CDEA 5KT7A 5I42A 1C1CA 2B43A 2WB4A 2XC9A 2OPSB 3OSNA 2R8HA 4H54A 5KFDA 2YNIA 4TXSA 5I42B 1C1CB 3NMAA 4IRKA 3ISNC 5KFBA 2R2TA 4QWAA 2YNIB 4HYKA 4TN2A 4ED1A 2XCAA 2FVPA 1LW2A 2JEIA 1S9EA 3RAXA 2RDIA 3HHKA 5KFEA 1HQEA 1LW2B 4MIAA 1EETA 1LWCA 1S9EB 2RDJA 1CSJA 4J9LA 4O3SA 1IKXA 1S10A 3CVKA 1HQEB 4LSLA 2JEGA 1EETB 3MEDA 3OHBA 4NLTA 1IKXB 3TQ1A 3LALA 4LSLB 4MFBA 3MEDB 2FVRA 2YNHA 3RB6A 2JEFA 4J9QA 1RAJA 1S97A 4YP3A 4MFBB 2YNHB 1RTHA 5KFCA 3PHEA 4ED7A 1RT6A 1RTHB 4TY8A 4J9RA 4Q45A 1HQUA 4RW8A 5C5JA 1RT6B 1I6JA 4TY8B 3E51A 3I5BA 5C24A 4NLRA 1HQUB 2UUTA 4Y3CA 1HARA 2AX0A 4G1QA 4MIBA 5DG7A 4ZPBA 5C24B 3OL7A 4NCGA 5KFWA 3N6NA 4ZPCA 1S4FA 2O5DA 4IG0A 2W7OA 2XGPA 3GIIA 4FBUA 4MK7A 1RTJA 2DPJA 5C25B 3FFIA 4O3PA 5L1LA 4ECVA 1FKPB 3KHGA 5EUHA 2YKNA 3FFIB 2YNGA 4F4XA 2YKNB 4H4OA 3QGHA 2V4QA 2YNGB 1RT7A 4URSA 1ZTTA 4RUCA 4LSNA 2BANA 4WYWA 3NL0A 4G3IA 1RT7B 1TKXA 5EWGA 5HP1A 2FVCA 4IR9A 4NYZA 2BANB 3BQ1A 3KLEA 4JUZA 1TV6A 1TKXB 4MK8A 4RZRA 3M9MB 5HP1B 1OS5A 5KFKA 1U09A 3KLEB 1TV6B 4ICLA 3EPGA 4WZMA 3H59A 2R8KA 3JYTA 4Q8FA 4RW9A 4ICLB 2R8JA 3DYAA 3UPFA 5KFLA 2WONA 3JYTB 4RW9B 4YR0A 1S1VA 3DYAB 1JXLA 3GV7B 2VG7A 3ITHA 4Q43A 4ZVHA 1S1VB 3I0SA 3M9OB 2VG7B 4KFBA 1JLBA 3FDSA 3I0SB 4ECYA 5F8MA 5F8NA 4KFBB 1JLBB 3LP2A 4K4VA 2UVUA 4LQ3A 1RT3A 5KFOA 3KJVA 3LP2B 2R2SA 1RT3B 4QWBA 3KJVB 3Q8PB 2W7PA 1T05B 1LWEA 4ED8A 4ZVEA 2W9CA 5L9XA 4R5PA 1LWEB 4J9OA 2FLNA 3T19A 4NRTA 2W9CB 4TYAA 1JLGA 4FS2A 1JX4A 4R5PB 5KG1A 1TL3A 5DGAA 4WFXA 1JLGB 5C42A 3NBPA 1HPZA 4J9NA 4O3RA 1IKWA 5C42B 4K4ZA 4ECWA 4ED0A 3NBPB 1HPZB 4MKBA 2FJXA 3LANA 3H5XA 4ZPAA 1S1TA 2WOMA 2ZE2A 5F8HA 1N5YA 2FVQA 1S9FA 2UVWA 1TP7A 5HROA 1RTDA 1S1TB 2WOMB 2ZE2B 1REVA 4KAIA 1N5YB 2D41A 2C2EA 5HROB 1IKYB 4XO0A 1REVB 3FRZA 4RUAA 2V9WA 1HYSA 4PQUA 1LW0A 2AX1A 3Q8RB 3IRXA 4R8UA 3BQ0A 4Q44A 4I2QA 1HYSB 1N48A 3G6VA 1LW0B 3H5YA 2AGPA 3IRXB 4R8UB 1IKVA 2QV6A 4RNOA 4NLSA 1IM4A 4I2QB 4KBIA 3QYYA 3BJYA 2C2RA 3BR9A 4Y2CA 4M94A 4OL8A 1HMVA 3MTKA 3QZ8A 4I2PA 4IH7A 3DLKA 1MU2A 4I2PB 3QIDA 4EO8A 2HAIA 4URQU 4U7CA 4IFYA 1MU2B 3IN5A 5KG5A 3GQCA 2XGQA 2IMWP 3RB4A 4IFYB 5CYQA 4YQWA 2IA6A 2IJNA 4NLYA 1TVRA 5CYQB 4ECZA 1T03A 4JV0A 1QE1B 1TQLA 1TVRB 2XWYA 1T03B 3KHRA 2FLLA 3PW7A 2E9TA 1RA6A 3DRSA 4URGA 4NLGA 4ECXA 2VG6A 3DRSB 2BRLA 3QZ7A 4ZP6A 3RBEA 4WFZA 4IDKA 4TYBA 1S0NA 3OL6A 1NHVA 4TLRA 5KFVA 4RW4A 2UVVA 4NLXA 3DOKA 4IDKB 5F8JA 2RF2A 5HBMA 2IM2A 3HVTA 4RW4B 1LWCB 3KLHA 3FSIA 4WXOA 4KHMA 3N6LA 5HBMB 3V4IA 3HVTB 5F8IA 3KLHB 3OLBA 3V4IB 1SV5A 4KKOA 5KG2A 5K14A 2VG5A 4KKOB 4MK9A 2ZKUA 1D0EA 1RT1A 2VG5B 3PW2A 2UVRA 4QWEA 2WRMA 3OSPA 3BSNA 3LP0A 4F4ZA 2HMIA 4RW8B 2AQ4A 3MF5A 4PWDA 2XI2A 1N56A 3LP0B 2RKIA 2HMIB 4NZ0A 3ISND 5DG8A 4IOBA 1KHVA 2BR0A 3DRRA 4G1QB 5HLFA 4PWDB 2RKIB 2ASDA 3D5MA 5EWEA 3BSCA 5HLFB 4NCGB 3H98A 4IG0B 4YR3A 3PJXA 4KB7A 4ECRA 2W8LA 2HWHA 2ILYA 4U6PA 1RTIA 1S1UA 1HNIA 1RTJB 5DGBA 2IBKA 1RTIB 1S1UB 1FK9A 2GIRA 3T1AA 1HNIB 1K1SA 3V6HA 2WCXA 5DQGA 4IRDA 4K4YA 1JLEA 4H4OB 3KK2A 3HKWA 1RA7A 4MKAA 2I5JA 1JLEB 4LSNB 1GX5A 3KK2B 1QAIA 3T5JA 2J6UA 5KFIA 2I5JB 3G86A 2CKWA 3LAKA 4EBDA 4KO0A 4M95A 2YKMA 5KFNA 3M8QA 4KO0B 4WYLA 2YKMB 4KV8A 1VRUA 3M8QB 4ED2A 1TKZA 3PVXA 4KV8B 1VRUB 3UQSA 2WONB 1HNVA 4ZP9A 5DQHA 2ATLA 1TKZB 2B6AA 5KFUA 2V0NA 1HNVB 3IGNA 3ITHB 3QLHA 4K4WA 1JLCA 3KMSA 1JLQA 2AGQA 5KFPA 2JC0A 4NLQA 1JLCB 1JLQB 3KK3A 3QIPA 4NLOA 4ID5A 3KK1A 4NLWA 5DQIA 3N6MA 2W8KA 2E9RX 3IS9A 4DL2A 3DI6A 3KK3B 4PUOA 1DTTA 3QIPB 3KLIA 4ID5B 4NLVA 5KT5A 4WE1A 3E01A 4TQSA 3IS9B 5DG9A 2C2DA 1R0AA 4PUOB 1DTTB 5KFJA 3E01B 3DM2A 4ED6A 4DL6A 2CJQA 4IR1A 3CJ5A 5KFMA 4X2BA 3DM2B 1TL3B 3SFGA 3C6TA 2R8IA 3KHHA 3GILA 2IM1A 3C6TB 3KLFA 4DL5A 1IKWB 1Z4UA 3KLFB 4GC6A 2IJFA 1S9GA 3T5HA 4QW8A 3Q8SB 1S9GB 4DG1A 4RNMA 1C0TA 3DDKA 3PR5B 3MR6A 1J5OA 5KG7A 4YR2A 1N4LA 1RTDB 1TL1A 2VA2A 3DMJA 4DG1B 4IH6A 4K4TA 4R0EA 1C0TB 3GV5B 1J5OB 3RB0A 2ILZA 1TL1B 4PQUB 3DMJB 3OLAA 5J2PA
chains in the Genus database with same CATH superfamily
3O6QA 3BO2A 1IKVB 2BE9B 2OPRA 2ZZNA 2FLPA 3T5LA 2MKYA 2MQPA 4LQ9A 3IMQJ 4XPEA 1N5TA 1NSPA 4FPIA 2FQQB 3CMES 2HKEA 2V2QA 2VBXA 2J7KA 2VG6B 4LF7J 1LFPA 4IQXA 1XNQJ 1WF0A 4BS2A 2CVIA 2KFNA 1HWLA 2DGWA 2HS0A 5EN1A 5IT0A 1SV5B 1U1RA 3CCMS 1VQ7S 2W1BA 2XCPA 4YS2A 2LQ5A 1FKAF 2C2NA 3OXGA 3AAWB 4JV2A 1LXJA 1NNDA 4B3MJ 5A8KA 1Q4RA 1WG5A 4LRAA 2DGOA 2IRXA 1K44A 3SQGB 2X3GA 4RUBA 2MTLA 1MWQA 3BDEA 2CPHA 2H51B 3CCWA 5B08A 3G87A 1OYEA 4RX6A 1T3OA 4EYIB 5IT9Y 2GVDA 3H2UB 3DI6B 3K5LA 1R0AB 4OX9J 1VI7A 4DR6J 1ZA1B 3EGNA 4AYBD 2Y8WA 3GWCA 3HM9A 2B5JA 5I3UA 2EKNA 3CULA 3W63A 1F5AA 3PJWA 3GMGA 3KYLA 4H4MB 2DCLA 4QYZK 4WFBQ 2LQ9A 4FXWA 3VR1A 1BQMB 5AXKA 3FZBA 1XNRF 1HKAA 4CLTA 3OFFA 2E1CA 2UP1A 3IWLA 3H5SA 3DLEA 1X4EA 2XTEA 3TA1A 3SSQA 4YMEA 5MLCV 2DH9A 5BJRA 3T3FA 1LWFA 3CWJA 4RO0A 1BY9A 2UUAF 2UV8A 2XB2D 2F3JA 4O4GB 2R7WA 4HTIA 3OSNA 4P7TA 1Z1ZA 3AQOA 2JEIA 3M6WA 2XM3A 3OHBA 4M5MA 1BXNA 1RTHA 2GVZB 1X9SA 4J9RA 3W5YA 4RW8A 1TZ0A 2NCKL 2HHTA 3U02A 3BYPA 3K59A 4EI2A 3N6NA 4X4OA 1UCNA 5T41A 1UVIA 5F3ZA 4X4VA 5L1LA 2YKNA 3FFIB 1NH7A 4F4XA 3M2UA 1D3WA 1Q7LB 1PAUB 2XWXA 5HP1A 2FVCA 3VGVA 5M2UA 1FI4A 1UUJA 5A8WB 5CZXA 2CQ2A 3UE2A 4Q43A 2H3EB 5F8MA 2XULA 3PIOQ 1RACB 1GQEA 4LFAJ 3R5DA 4TYAA 1NBEB 2FHMA 5ETNA 3RTVA 4F36A 1HPZB 2IY5B 3K89A 4V19X 2KDOA 2UVWA 3DU6A 1RWPB 2WOMB 1LK5A 4ZCKA 3SCLE 1RAAB 2B4UA 3HXMA 1XN9A 1U0SA 2B0GA 4KHPF 2F63A 3WBZA 2CPEA 1G1XA 2IVYA 3PO5A 2AIRB 5KG5A 3RB4A 2XSJB 4C8NA 3QFHA 5CYQB 1QE1B 1T03B 1URNA 2HS3A 2Z4PA 5A2QY 5FJ4A 4TYBA 5AXMA 1DJ0A 3MPUB 2JLFA 5AXNA 4N47A 3LO3A 5DM6Q 3KLHA 4W92B 2M5YA 3BGLA 1G7CB 2QA1A 2VG5B 4ZCIA 4QWEA 4DR1F 4NASA 4DFMA 4IOBA 1UEVA 2EG1A 2G4BA 2QFIA 2DNQA 1HW8A 4IG0B 2JRSA 4F0HA 2W8LA 4K5SA 5ETKA 1HHQA 5CXTA 1VYAA 1WC0A 2VQFF 4MAKA 2GHVC 4B9UA 4LSNB 1YZ7A 4DDFA 2ZUGA 2J6UA 1SC4B 3G86A 2LXUA 1VRUA 2MKCA 4AFFA 3PX0A 3DGPA 1SIZA 4JI4F 1ZPWX 1HBMA 3W66A 1CJKB 4K2XA 3M7VA 9ATCB 2DRBA 2OELA 3KK3B 1S77D 2XZ2A 2CG8A 4C3MA 3PRBA 2F4VJ 3GG0A 1SC1B 8RUCA 1OIAA 2IJFA 2K7JA 2AKWB 1CG2A 1S9GB 1TL1A 1Q1KA 3GV5B 4PYAA 3OLAA 1SKRA 2R7OA 4DPWA 3NKYA 3QGPA 1FJ7A 5IV4A 1RI7A 5GADI 1HMVB 2BQRA 1HBOB 1R3NA 1UA1A 1F9EB 2OPRB 3DLKB 4ZVUB 2H4WB 4KRWA 3R2CJ 1IR1A 2OD6A 1RAOA 3HP6A 2D3UA 4Q2MA 1U48A 3P49B 3D66A 2DGUA 4A8SA 1H2VZ 4YDXA 1B0VA 4KJIA 4ATNA 1VQ8S 2BEFA 2LXIA 3EXYA 2P9EA 5IC4B 1YBUA 2KFZA 3H25A 2B51A 1R8HA 3V5RA 5A8KB 2AWZA 3D1OA 1D9DA 3GE9A 4OI2A 1OY8A 1VQYA 2Y3YA 5C25A 2W4PA 1YRXA 4WPAA 4TU8A 4G6VB 2HIYA 2HG4A 5KFHA 1VQ5S 3KNGA 4UQTA 2GVDB 4HR2A 3ISZA 3IBWA 2RHQB 2HRYA 3JQKA 2F8EX 2PEBA 2HHHF 4MYTA 4HH0A 2B5JB 5I3UB 2KXNB 2K1RA 3Q24A 1FERA 3GIRA 2GJ2A 3UCGA 4QW9A 1YX2A 2BJ9A 4OYZA 3JSBA 1S0MA 2VBYA 1OPIA 1IKYA 5GVQA 1N32J 5F8LA 3KG1A 4FYWB 2DNRA 4OQJA 4OV6A 3AHPA 4WXWA 4PRFA 3DLEB 1RK8A 5HI7A 3M6UA 4QIGA 4KHPJ 1PJ6A 2C22A 5HQLA 1LWFB 1Q8BA 2BVZA 2QLWA 5D4PA 2LQJA 2IYIA 3EDQB 3CDEA 1VFJA 5CA5A 2JX2A 2RDIA 1HQEA 5J1PA 5E3PA 3NNHA 4MFBA 2NR0A 3DHWC 4J9QA 3P96A 4NEYA 1RTHB 2VF3A 3PX6A 5C5JA 1I6JA 3I9ZA 2HHUA 3GP9A 3AQPA 4IUFA 3AD8C 4PQAA 3KHGA 1T9TA 2KM8C 1JXVA 2YKNB 4ZJOA 1JJHA 5RUBA 3JB9k 3M2UB 2BANA 3NL0A 4X4SA 3GCWP 4N41A 4M8LA 3BQ1A 3KLEA 4JBCA 5HP1B 3EPGA 4FVCA 5LXRA 1GH8A 2VOPA 1S1VA 4JI4J 3UN2A 1UEKA 4DS4A 4OHWA 3RZAA 2XMUA 1TL3A 2LP4A 1Y7PA 4ECWA 5C2CA 4DR4F 2FVQA 2EC2A 2MHEA 2Y1LB 2P6SA 2VPYB 3MPDA 2D41A 4XO0A 3W9IA 4USTA 1XQIA 4PQUA 3T1HF 2QV6A 2ZFHA 2HQIA 2XMAA 1YQHA 1WOOA 3GJSB 1MU2A 1CLFA 1F3FA 2KB2A 1RWNB 3CD6S 4I69A 5D0GA 2E9TA 1BQXA 4DV7J 4F0MA 4NLGA 1ZYQA 3AOBA 4IOCQ 3MGJA 2Z2LA 1SL0A 3AJDA 3DOKA 3QATA 3N6LA 3KLHB 3EJMA 4AXJA 1I3OB 3DDNA 4NE9C 2QX0A 1Y5NB 3J7A1 2ZBIA 4R25A 3T6BA 3BSCA 4YR3A 2HIQA 1VBZA 4U6PA 1GXTA 2LDIA 1RAGB 1Q5VA 2M2BA 1RKJA 2RDDA 4ZA1A 2Y1RI 4YB5A 3HPOA 1IWGA 3CCLS 1IWAA 4FF3A 2OEJA 1VRUB 2HW3A 5DQHA 2B6AA 3BBBA 1N88A 4OLOA 2FGCA 3CJQA 4O23A 1HBMB 3QIPA 4N76A 3BN4A 5D4NA 1DTTA 2AEMA 1H2UX 4WK3A 2CJQA 4OHVA 1PYOB 2R3VA 1NK5A 3J81Y 3DDIA 2RRBA 2M0GB 1UEUA 3N28A 1K0TA 4RPFA 5CAAA 5CH7B 1TL1B 2BW2A 1O5JA 3LPEA 4CNZA 1X4BA 2D3ZA 2MKSA 3HI9A 3RG6A 5DLGA 1HLWA 5MAOA 2E66A 2KT2A 4CM2A 2B4VA 2AYGA 2GS8A 1S0VA 2ZC4A 2K7KA 1RYRA 3PDNA 3MM6A 5F9NA 2ZH7A 3HSZA 2XBPA 1SUQA 2ZNYA 1U1PA 3MI7X 3VV2B 5D0EA 1QVFR 2YWWA 4DR3F 2P8IA 3DRRB 3IG1A 4GRSA 2JHEA 1QVGR 4J9PA 3MFIA 2MY7A 1KVKA 2V8VA 3WC2A 1ZBTA 4O0NA 4F25A 4DF8A 4XPCA 4DQRA 1VIOA 4PEOA 5EHHA 4AD6A 4PR6A 2OPPA 1O51A 4WF9Q 4QR2A 2B7BB 2CA9A 3B8HA 2X3DA 4ZVGA 5KFGA 2OEMA 2EEYA 3LP1A 4ZP8A 2KL8A 3H40A 3VZHA 1FXLA 1R8BA 4ZLJA 2H5EA 4CYUA 3QPIA 3KJFB 1DQ8A 3I5CA 3IGVA 1BE4A 4P9SA 3BS9A 3KFWX 4ZHRA 3FNNA 3QGGA 1FO1A 1T05A 4LRFA 1XWLA 3UD5A 2IM0A 2K1RB 2D3O1 2H1YA 3WQPA 4DR2F 3GYNA 3QO9A 5JUMA 3M4XA 2K3KA 2AJ4A 3TA0A 3LWLA 4DR4J 2JVOA 5JVHQ 1QSLA 1XR6A 2AJQA 4EEYA 5KAKA 2ZDOA 2MDAA 3T1HJ 4E0DA 3BH7B 3B78A 4NA2A 4DSFA 2CJAA 1YJWS 1N36J 1FD8A 2JFKA 4U67Q 5KOWA 5KT7A 2BYCA 2R8HA 1UPMB 5KFDA 3FBCA 4IRKA 1ZS6A 3M2RB 2XCAA 4OYAA 3R2DJ 2YKQA 4O3SA 1IKXA 1HQEB 4V1Ak 4CH0S 1KTVA 4MFBB 3F73A 2RE1A 2FZKB 2PMZD 4OYOA 1M1KT 5D4OA 4U7UD 2DXEA 1EAYC 4QR0A 4NCAA 2HQDA 2VFTA 4L75A 2SXLA 2B8PA 1RT7A 2R7RA 1GK8A 2LCWA 4Y6IA 2BANB 1K47A 3KLEB 3G8SA 1F3VA 3M8YA 4BC7A 3W7BA 1FNOA 1S1VB 2DO0A 3GZ7A 4F4KA 1ELOA 4OYBA 5KFOA 1YKWA 1SKUB 3CE8A 1ZAXA 4CP5A 5L9XA 1FCAA 1JX4A 3WC0A 5IM0A 3MD3A 4MKBA 3KWMA 1HI8A 3CW2C 3JS9A 5IXUA 5HROA 1AFIA 1EQ0A 3GFHA 4HI1A 1PAEX 5B0EA 3GYGA 3G6VA 4C8YA 4LBIA 1F5BA 4Y2CA 4ZITA 4LF6F 2NXNA 4IH7A 1BD6A 3ZZYA 4GVLA 4EO8A 4FYXB 3J7YI 1MU2B 3NEKA 4CLPA 2F4FA 2V50A 4EGLA 3THTA 2HHWA 3WHIA 4NOHA 4OZNA 3VGUA 3QZ7A 1S76D 3OVBA 3UD3P 5ETLA 5F8JA 2LECA 1N34F 4CO5A 2DBBA 4Z37A 1YRUA 2VFSA 2MSSA 3MM9A 1KHVA 3R7BB 5HLFA 3AD9C 3D5MA 3G6ES 1LWXA 3ILJA 1JXEA 2ZHAA 1FWKA 1L3KA 1U47A 2J5AA 2BJ7A 1HNWJ 3LAKA 2L41A 2Y1JA 3JTPA 2AZ1A 5GMEA 1GMUA 3QLHA 1KC8T 1JLCA 2JC0A 5A8RB 1YG0A 3CDBA 4K2JA 1YBTA 1GMWD 3DKDA 4AL7A 3QIPB 1SQGA 3CCSS 2CQHA 1DTTB 3GG1A 4ZLLA 5KFMA 4PXBA 2J9DE 1HI0P 2Q43A 3CMAS 4W98A 4GC6A 4DG1A 5LOQA 1J5OA 1N4LA 3RB0A 4F4AA 3IM9A 2Y0SD 4IH5A 2XTCA 2IAJA 1N54B 2DY9A 3M8RA 1RCXB 4DR2J 1C4AA 4NYOA 3RAQA 2W25A 1S49A 2U1AA 5HMWA 4PKDB 4OI6A 1C2PA 5J1EA 3O3LA 4F8RA 3MEGA 2J0WA 5L1IA 3EXCX 2VFRA 4F2RA 3MM6B 2HRUA 1VJQA 5HSPA 3EGZA 1SUQB 1C1BA 4RKUC 1Q95G 1IJEB 2H5IB 1U6FA 4D3GA 5JJBA 3OJUA 1JIHA 4HKQA 4B3SF 3QRQA 4ER8A 3IG1B 4DV5F 5FLXU 5JXSA 3R5GA 2EFOA 1VLOA 4HDGA 3PG9A 1BWEA 3MECA 2GZOA 2EC0A 4DPYA 2OPPB 2F1FA 2X1FA 1ITPA 2EBEA 2YTCA 2ASYA 5LMNJ 2GMHA 3SYZA 2M8HA 2UXDF 3UDLA 3LP1B 3PR4A 3BKUA 1WTFA 1DTQA 3CJ2A 5F8GA 2ADCA 3A4TA 4TQRA 2DEIA 4CYUB 4EBEA 4C48A 4TKTA 1X4HA 3CIMA 2ZC3A 4ZHRB 4FS1A 4C0OC 3K2YA 3CCZA 4QPTA 4FBTA 4ANDA 2V34A 2E7VA 2HNZA 1NJIT 3IC1A 3VALA 5J2PB 2WBRA 1YTYA 3QO9B 1VHFA 4B3RF 4M5IA 1ZH5A 3FCVA 2UUCF 3NS6A 3MPYA 1QSSA 4FZVA 4WFYA 1RHQB 1JLFA 2EW9A 2W2NP 3M6VA 1F1BB 2X7IA 4QQBA 2F8HA 4B08A 1RJJA 2P2CB 2M88A 3BREA 4HTJA 3MOJB 1H72C 3PEJA 4YEAA 2KO1A 4DV4F 5B0BA 5D0HA 1NH8A 1CQNA 5D77A 2DH7A 1S10A 1IKXB 1N34J 4ID8A 4A8XA 4DPUA 1E6VB 5C24A 2D3OR 2C2MB 4LF5F 4ZPCA 4K0KJ 2DKOB 5ETTA 1RT7B 3CD7A 4X64F 2VUGA 3MM7A 4ICLA 1WTBA 4ZN3A 2XSFA 3IR7B 2R8KA 4XDCA 3MPWA 1UFWA 1TL4A 3ITHA 1WORA 2PSZA 3DGVA 5I3QA 2ZHOA 4Y00A 3LP2A 2V8GA 4DUZF 2YY3A 4IQMA 3RBZA 3T19A 3CD5A 4DHVA 1I94F 1RAEB 1HFEL 5IM0B 3MAQA 4ED0A 1PCAA 1J27A 2FJXA 4HT5A 2B9WA 1KWMA 5HROB 3Q8RB 3BJYA 1Y5LB 2DRDA 2G0JA 2CXEA 2MZ1A 2DNPA 4IFYA 1RBAA 3BBCA 3EZOA 3PTWA 3T9NA 2DXFA 1YRTA 4URGA 3TUIC 4ZP6A 5IOLA 1RXOB 2RJZA 4TLRA 5KFVA 4B3TJ 5ETPA 3ZZRA 4E8UA 2NZCA 1UAWA 3P5BP 2XS7A 3N0VA 2WRMA 3MM9B 3ETOA 1DARA 4G1QB 1SL2A 1NSQA 1DQ9A 1Q79A 5HLFB 4GMKA 4I6YA 4B3SJ 2MLZA 2ILYA 1BHNA 3TJ8A 1HNIA 3ADAC 3MAAA 2HGLA 2A10A 1IR0A 4DV5J 2WCXA 2LEBA 4N8NA 5F0WA 2LU1A 2CKWA 1NJYA 1NLKL 2YKMA 1RABB 1P9YA 3EYZA 4DLGA 3C15A 2FY1A 2IHR1 4ED2A 3PVXA 5G0RA 3SSRA 2HFNA 4F3QA 3F44A 3I4PA 1JLCB 2W2QP 4S0MA 4DL2A 5LSOA 1YHQS 4K8RA 3CUNA 3RGIA 4IR1A 4DZ6A 3CJ5A 3R9LA 3AJ1A 4U95A 4ES1A 3ZNUA 3GILA 1IKWB 2HYIB 4RNMA 3MCSA 4GO5X 1RTDB 3Q89A 3I31A 4DG1B 2GIFA 1J5OB 1WC1A 2ILZA 1M5HA 3OR1A 2J0XA 2OPQA 2CJXB 2IAJB 2HQFA 3GFYA 2OKQA 3MR3A 1HBNA 4YHHJ 1NDKA 3HFKA 4B3RJ 3OTCA 3C19A 3VAFA 2WTFA 3L95X 2XO6A 3F56A 5J1EB 1U8WA 3FVYA 1XERA 4LT6A 1PILA 4DMZA 4UTGA 4KE5A 5BYQA 1U49A 1CJVA 2DR8A 1EB0A 4ECQA 3L7PA 4IFVA 1MW7A 4O3QA 1C1BB 3I96A 1RT1B 3D68A 1I5OB 5KTQA 4PXCA 1MWYA 4CLKA 4ILMA 4DV4J 3WX4A 2VBZA 2QJ3A 3HHLC 2WK4A 2F5GA 3SCIE 2RVJA 2KTQA 4CWBA 4PG4A 3DRPA 1FK9B 3QT6A 3WIUA 1YBAA 4LF9F 5EX3A 4EBCA 2OI2A 3MECB 2NLWA 4A47A 1GX6A 1QAJA 3BSOA 4NZ6A 2HVIA 2VC1A 3ZFVA 1FKPA 4LF5J 4JYAF 1PO6A 2UUWA 1EARA 4X64J 1DTQB 2XYPB 2YWFA 3CDWA 1F0XA 1Y11A 1AUSL 2EPIA 2EK1A 3B4MA 3D6MB 2PO4A 1RT4A 3Q83A 3K8WA 2LMIA 3BGRA 4QBUA 2HNZB 3MEKA 1I94J 4OZJA 2ZH6A 2ALZA 2HURA 3HDSA 2CPDA 4A8OA 2YX7A 5A6WA 1H2TZ 2JZ5A 5KFXA 5KFQA 2DNZA 4K4UA 3TZXA 4B02A 1H7WA 4ECUA 3TZWA 4MIWA 2EXUA 1JLFB 2FVSA 2DISA 3BR8A 2HBQB 3HD2A 3H4DA 3KNAA 5IC6B 2D7SA 2NYHA 2WB4A 1AT1B 4H54A 4A8MP 3CCVS 3I4HX 2UV8G 5KFEA 1WACA 2ATCB 1U6BA 3FSYA 1KONA 2V94A 2FVRA 2CZVC 3RRGA 4DWIA 4JI2J 3FUYA 2R7SA 2AX0A 2HRTA 2B8QA 1H73A 5C24B 5GADU 3NCQA 3GPAA 4O3PA 1T8EA 2YNGA 2YPYA 2W2PP 3NNCA 2B9YA 2M9KA 4G3IA 2OEKA 1RP5A 2J0SD 2LDYA 3MM7B 2ZJRQ 4DSJA 3IXQA 3GR1A 4ICLB 4CLWA 6AT1B 3NS7B 3QNWB 3ZTRA 1KOOA 1S7IA 4QR1A 3LP2B 2HZVA 4ED8A 1RWKB 3POTA 3FCHA 5F41A 1SB6A 2DNOA 3SCKE 2DB1A 4DR5F 1NO8A 1YI2S 2FHOB 3E2EA 2C2EA 4DPXA 1HYSA 4HACB 3GJQB 4YN3B 3QYYA 4P2FA 3UDVA 3QZ8A 4ZPVR 4DU7A 3QIDA 2RS8A 5E2QA 4IFYB 2JVRA 1Q7YT 1FDNA 1CPZA 2FGOA 1VQNS 2BRLA 1VDHA 1NHVA 4A48A 2DTJA 5GAHI 3HVTA 4KHMA 1YWXA 1RCOB 5IT4A 2L9NA 4F3OA 3PM9A 4Y2KA 2DGTA 1G2EA 3OVAA 3LP0A 3RJMB 3WIVA 1B99A 1RAIB 5AJ3F 2ASDA 3O1LA 3R5JB 2ZH1A 3P5TL 4CTAA 4P73A 3DFEA 4WP3A 5JMNA 1WHYA 4Z7CA 4USVA 2AV5A 1HNIB 1IN0A 3MAAB 2CJBA 4K4YA 1B0TA 4H4OB 1AA1B 4LF9J 3TZZA 1W2BR 4XTTA 1MLAA 2YKMB 3C15B 4ZP9A 3W5XA 4PCQA 5G0RB 4CZCA 1FE0A 3PACA 1CS4A 1B70B 3IM8A 4ETZA 1QLNA 5KFJA 4DQPA 1RSCA 3A13A 1UW4A 3F0NA 1KNZA 5THWA 2CPXA 2IDLA 2CADA 3LAMA 2R8GA 3C16A 3OR1B 2N3OA 2HSEB 3GU0A 1GMVA 4BC9A 1HBNB 1YVFA 1UP1A 3CTRA 3LF0A 4F4YA 4DV1F 1F6TA 4DX6A 4PPZA 1TUGB 3NAIA 2ASJA 4M5HA 3T9ZA 4FPRA 2MYFA 1ZM2A 4KH0B 2DIUA 5GMKa 1PIEA 3FQKA 2GGPA 2B4PA 1CJVB 2XHCA 3AA9A 1KVIA 4QWCA 4IFVB 4B9NA 3UR0A 1XMOF 3H2LA 2XG8A 3LWMA 4Q2LA 3DNCA 2Y9HA 1WF2A 2K8GA 4O4RA 3MR7A 3Q86A 4U8YA 3DRPB 3PZPA 4RNNA 1FFGB 4PPDA 4Q0BA 1Y10A 5J2MA 2FHKA 3C2PA 1SJFA 2ZOMA 5KFTA 1ULRA 4F3MA 1UZDA 3HJVA 2I1RA 2DNNA 5D3GA 2CYYA 2IFXA 2L48A 4QWDA 4EK2A 2VQEJ 1FXDA 4WE1B 3W3SA 4DXLA 1XR7A 4A8WA 1Y5IB 4DCOB 4IRCA 1OQ3A 2BJ8A 4MH8A 2KYXA 1RT4B 4NXNF 3S1TA 1X60A 1B0PA 2NZ4A 1RAHB 3BGRB 3RW7A 1PJ7A 2FDNA 1S6PA 1X4AA 4CO0A 4DR5J 1YZ6A 3HLUA 1RLCL 3LGNA 2COLA 1RB0A 2R2UA 2GC8A 1NEEA 3QSIA 4EZ9A 3LOUA 2VONA 1CQMA 4C11A 3OQ2A 3A8EA 3CXCR 2OTJS 4FKXA 4BWJA 1LWCA 2Z8QA 2ZITA 3EUNA 4LSLA 3MEDA 3VCDA 3EWGA 3UWTA 4OZ1A 3R6LB 3MD1A 1PBAA 2UUTA 1HARA 1UKUA 4PWWA 2MZRA 1VRQC 4N7TA 5AJ3J 2ZVSA 4ZCLA 2YNGB 1TKXA 4U8VA 1TV6A 3UW1A 5KFKA 1S12A 1XK8A 5E0OA 2R8JA 1WHVA 2KG0A 5E5NA 1LKZA 3I56S 4I1TA 2LYVA 4L72B 4DZDA 2B3TB 1EQMA 2KG1A 4WK1A 2FLNA 2LQ8A 4DFKA 1RWOB 2MY8A 2VPWB 3POTB 3T41A 5C42A 3CJ8A 1CJTB 3MHYA 4HLBA 1SJQA 3LANA 3H0PA 1MG7A 2QA2A 4I64A 3HHDA 4JP8A 4OJ1A 3BH6B 4R8UA 1HYSB 1IKVA 4OI1A 1VBKA 2K06A 3D0GE 2NUHA 3ENWA 3MPVA 4U7CA 2ZM6F 1MN9A 2XGQA 1YJ9S 4YQWA 4KIAA 2IJNA 2FZCB 2V9KA 1HQ2A 1FEHA 1TKDA 1FWPA 4C8LA 5F0UA 4YDDB 3H42A 2VG6A 2IRYA 4HT7A 1S0NA 2A18A 5IFMA 4NLXA 3I32A 3FSIA 4QIWD 3HVTB 1MNEA 5DZ7A 1SV5A 4JI0F 1EJ7L 3AJ2A 3LP0B 2Z2ZA 2P9GA 3CNQP 4DV6J 3HF5A 3EGVA 1OM2A 1S4EA 2Z58B 2MJUA 4JI8F 4I6WA 1XIQA 3HT3A 5CABA 4F0KA 1AROP 1SJ1A 3ZNJ1 2WONB 2O67A 2VPZB 3IGNA 2V2KA 3DC2A 4NLQA 2JDJA 1CS4B 5DQIA 2CPFA 3DI6A 4JI5J 4NLVA 1R0AA 4RL1A 3TZYA 4ED6A 3IRWP 4BBYA 3BZQA 3EGWB 1KKHA 3EM1A 3D6TB 1JK9B 2FHJD 1UPPA 2H9ZA 1C0TA 4WJBA 2VA2A 4IH6A 1N33F 1R7IA 1S59A 4ED4A 2KRRA 4NXNJ 3G6XA 2KXFA 4NLPA 2QG9B 1PYSB 1S1XA 1X0FA 3DLGA 3PKYA 1EIYB 4F50A 2MQMA 2ZBQA 3HULA 2CQGA 3QBCA 5ADZA 2DK2A 4FYVB 1ZTWA 2AU0A 1RWUA 2ZD1A 3UD4P 2JLEA 5KFAA 2KM8B 1B7FA 5L1JA 2E7WA 5K8PA 2GGPB 4JI3F 2BBEA 3LUYA 3VGTA 2F9DA 2QYCA 2Q79A 2E1MC 4ANCA 1B3TA 2J9CA 3CIZA 2GVZA 3RBDA 4I68A 1D9FA 3R6GB 1T3NA 4QJVA 3V2UC 2EKYA 1JWWA 3FEYB 2ZOFA 4Q0BB 2NUUG 2WW8A 5J2MB 1UVLA 4ZS6A 3V4MA 4ZPDA 4DUYF 3G82A 2J0QD 3SIPB 5D3GB 4ES2A 2A3JA 3HVAA 3KK1B 5DETA 3D28A 2VJUA 1H7XA 1KR4A 2V2VA 3TANA 2G13A 1MWZA 1FRIA 1WC6A 1VBXA 4DI6A 2QMXA 5B0DA 2FJEB 2RB7A 4BHQA 4CT9A 2IM3A 1R0CB 1RT5A 1RYSA 3H4BA 1CC8A 3JXOA 4UOFA 1OPZA 2XYGB 2DVIA 1S79A 4P6QA 4P52A 1S6PB 1DLOA 3SV4A 3Q8QB 3ICLA 1FNMA 2CAJA 3IP0A 3DN9A 3N4WA 3FCWA 1QE1A 4C11B 5I42A 2YNIA 2N3LA 2G0IA 3NMAA 3VWSA 2JH3A 4HYKA 2OFGX 1RU2A 4USIA 4NLTA 1X5OA 4LSLB 3MEDB 2JEFA 2YNHA 3EVWA 4P72A 1FJEB 1VCTA 4LFBF 2A2DA 3PHEA 5DDQC 4JI0J 3AA8A 9RUBA 3CEDA 4PZVA 4IG0A 4L3NA 4Y2MA 5A2QU 4FBUA 5EUHA 4U9RA 2V4QA 4LSNA 4RWXA 1M0SA 1TKXB 1IQZA 2DGVA 4ZVRB 2FJDB 1TV6B 5B0GA 3W5ZA 3TARA 5KFLA 4JI6F 4ZIVA 2VG7A 1R89A 4U96A 3A3NB 1VR6A 1E6YA 4FVMA 3IR6B 3NS5A 4RWWA 3KJVA 1BUXA 1DQAA 1ZA2B 5HVHA 3BO3A 3TWZA 4O3RA 1QTNB 5C42B 2CPIA 2V4JA 1KSPA 4C8MA 2Y8YA 4J9UE 4Z2XA 1RUSA 4L74A 4LR9A 1WOPA 4R8UB 2CPJA 5DS7A 4RR5A 1N33J 2W24A 1HMVA 1HBOA 4I2PA 2QC3A 3DLKA 3W8GA 4DS5A 2IMWP 3B6BA 1NRKA 1TVRA 3RW6A 5H9FJ 2FLLA 3PW7A 1RA6A 1LXNA 3NNAA 4X4PA 5HANA 1MSWD 4KC5A 1IBMF 1T9VA 1RLDA 2UVVA 3HKZD 3AXKA 2YH0A 4USHA 1N0VC 2YPZA 5G4DA 2CFXA 3MF5A 2XI2A 2GJFA 2Z0GA 2BR0A 5CQGA 4NCGB 2CNOB 4RUHA 3OTEA 3Q8UA 4N77A 4OYXA 4C8ZA 2EFQA 2RIJA 3OT9A 1QAIA 2FD2A 2RS2A 2G2ZA 2NXJA 4DOZA 1R8PA 1WHWA 2E5GA 4RJVA 3R5CA 5A76A 5KFPA 1P8GA 2ALYB 2W8KA 4NLWA 4I0WA 2E9RX 3L7OA 4TQSA 4QIEA 2KFYA 4ILRA 4DL6A 2XY7A 1KQKA 1T9XA 4PWUA 4X62F 4M5DB 4LBPA 1SXLA 4CIOA 2NSBA 1ZPVA 3RBXA 1C0TB 4E98A 2CIMA 2FB0A 1NB2A 4RNFA 3MMAA 3SFUA 2ABYA 1S1XB 1L3SA 5KT2A 3DLGB 3V6JA 2OAUA 1RBLA 1CJUA 1SH0A 2YBVA 1NHUA 1RKIA 4ENOA 5CYMA 3CDUA 1X5PA 2FJBB 2QE5A 4YUDA 2ZD1B 4J9MA 3TA2A 4F2SA 3V6DA 2L9DA 3GJRB 4GKKF 2XMJA 2IA0A 3IWNC 4UQGA 4DBQA 4ELUA 2GV1A 2R9LA 4LFCJ 4ZOSA 2BDPA 1D1UA 1JNZB 4HVZA 2PE8A 2UUBF 2ZNZA 1WI6A 2HVEA 1JNRB 2KHDA 1VLYA 5KG4A 3GSDA 4PG6A 1XMQF 2GMLA 1U1OA 3J7ZT 1FJGF 5DLFA 1YLXA 3JQJA 4UUWA 3ZTQA 4C8KA 2HBYB 3AY0A 3G82B 3PIPQ 2RAQA 4UW2A 3QJPA 3IBCB 3W62A 3KLIB 1GXUA 6FDRA 4DX5A 3MFHA 3KXDA 2VC0A 5EX0A 2DY1A 2A6OA 4CDIA 1UFKA 4FKYA 2FC8A 1RT5B 3DLLQ 1UVJA 1QUVA 1TKTB 1VRTA 1BQNA 4NLUA 5U47A 3TYTA 2E1RA 2C3UA 1NK8A 4ECSA 1T94A 1V5IB 3I5AA 2M70A 4DQQA 1DLOB 2YVSA 1N8RT 3L4BC 4R0JA 2RD5C 3D1HA 2U2FA 3GIJA 4ERDA 2AD9A 2YNFA 3MCMA 3SCJE 2BOAA 2BACA 4ILLA 5I42B 1TMMA 3ISNC 4QWAA 2YNIB 5HAOA 1X4FA 5DJBA 3C66A 2RDJA 3HHKA 5ETOA 3TQ1A 1RHKB 2J7UA 1IBMJ 2I2YA 4DCJB 1F5CA 1S97A 3LA0A 2YNHB 5KFCA 1VBYA 1QM9A 1NPPA 5E33A 3E51A 4NLRA 4Y3CA 2BW7A 4K7QA 1FWLA 2XGPA 4ZJQA 2L9WA 3VVUA 2GHPA 4ETXA 2OUGA 5EWGA 4NX9A 2PC6A 1M5SA 4UZBA 5HMXA 3TUJC 3EZ5A 3PYFA 4KGMA 4Q7AA 4C0HA 4PG8A 3JYTA 3M30A 4BWMA 1MMDA 2A1BA 2VG7B 3PJ9A 4CLLA 1T11A 2G0CA 4ZVQB 2XZWA 1RWVB 1E6YB 4LQ3A 4N56A 2CG4A 3KJVB 2VICA 2LQBA 4J9OA 1M5PC 3X3UA 4W4MA 4WFXA 2ERRA 2YQ1A 4WKRA 4ZPAA 2V4JB 3R27A 3SDEA 3TOQA 1REVA 4KAIA 3EX7B 1H3DA 3BQ0A 2K3IA 4X65F 3HHLA 3PO4A 4NA1A 4I2PB 2B56A 1XNRJ 3J81U 5CCMA 1TVRB 1LQ9A 4DUTA 3GFZA 2ZZMA 1HWKA 1NM2A 2CWKA 3X1LB 3PNIA 4HH1A 2UUAJ 4GKKJ 5KG2A 1FDAA 3FMBA 1KQSR 2HMIA 3HCXA 4NZ0A 5DG8A 4HHUA 4JV5F 2BOPA 3DRRA 2FHJA 1VQPS 2WVBA 3H98A 4KB7A 1HWIA 4AQYF 1RTJB 2YKAA 4FYYB 4CLYA 3MMJA 5C7PA 1IVZA 3K5MA 1D9AA 4MKAA 2D9PA 5KFIA 3FBEA 4KO0A 4M95A 5KFNA 1XMQJ 4NMXA 1FJGJ 2V8DA 3KMSA 4C7QA 3D6HB 4QIVA 1Y4ZB 1ZAVA 4JB8B 5KT5A 4OFZA 5IWAF 2Z56B 1U6ZA 1KN6A 3TAPA 3VGSA 3BF4A 2MZQA 1PKUA 3T5HA 4JI7F 4EMDA 3DDKA 2CRLA 3DMJA 5GAEU 3CC2S 1H6KX 1Y3JA 2W2OP 1GAOA 1S7HA 4DN9A 3J81j 3K57A 2ROEA 1N0UA 4Y34A 3MMAB 2L3MA 3SXLA 2KXHA 1FHTA 4DL4A 2OH2A 1CJUB 2BKNA 4IOAQ 5CYMB 4ZN1A 5LXYA 4ZVOB 2HNYA 5CCLA 3KHLA 1BLUA 1R8AA 3V6DB 2JWNA 2RNEA 5HL7Q 1YK9A 3BQ2A 2HVDA 4ZVFA 4OJGA 1KLNA 3BB5A 2RQCA 2NPFA 3M2RA 2Y0BB 2V8HA 3V6KA 1WSVA 1PGZA 4CO2A 4PABA 3FKBA 4X84A 4HI2A 4USUA 5DZ6A 2IRUA 2KHCA 4I67A 2C2OB 4DR1J 4M1KA 1TELA 4DSLA 1WF1A 4LRDA 3JSRA 1URRA 3DOMA 4ALZA 5B0CA 1IBCB 5KG0A 1RHMB 2C2KB 4QPXA 2ADBA 2VQFJ 1S72S 3OL9A 1IBLF 2C3YA 3EICA 4X4TA 3EZUA 1JJCB 5GAHU 2FJVA 3GR0A 3H2VE 2JC1A 1WJ9A 2MQNA 4B3OA 2XY6A 3IBFB 3MMCA 2DHSA 4C3KA 4G1IA 4HL9A 1R43A 4DEZA 1R8CA 4KT0C 1W2IA 1DY3A 1VRTB 3HFVA 4LF2A 5F9LA 1BQNB 2XNQA 3ENQA 4MKVA 2V4RA 1LEOA 4ZVSB 2QRRA 2MQ8A 1HA1A 4IG3B 1NAQA 4RW6A 3FEXB 2O01C 3SEOA 2AW0A 3ZZOA 2YNFB 3BGFA 3OXLA 4UY8T 2B43A 2LFVA 3H7HB 2R2TA 3VVTA 4TN2A 5DG7A 3N5BA 3CVKA 4DPTA 4DJBA 4DX8H 3M32A 2R4FA 1FRMA 3U1NA 2QSWA 5K8OA 3CCES 4FF1A 1C4CA 4JV5J 3NGSA 4XDDA 2D1CA 4OIXA 4AQYJ 3QGHA 3W2WB 2YWKA 2VODA 1H38A 2DHAA 4CLFA 3P45B 4Q8FA 2FIUA 3JYTB 3M30B 1A7GE 3CJKA 5A8RA 3CGIA 3VHQA 5FIIA 4AXIA 1LWEA 4NYPA 4ZVEA 1X5TA 1NK9A 1AFJA 4OJHA 3NBPA 2C3MA 4IO9Q 1FF2A 3C14B 4MJKA 1S1TA 2ZE2A 3SDEB 3M2VA 2RQMA 3EVMA 2EVZA 1SPBP 2HHHJ 1REVB 4X66F 4LUBA 1EKRA 4CI0B 3BKTA 4NLSA 2YWHA 3TJAA 4DSKA 3QRPA 4KH1B 3HHLB 2QFJA 4B9SA 4KYZA 1RZMA 2JL9A 3DRSA 3RBEA 3OR2A 1ZAWA 4NCBA 1ACMB 4LF1A 2OMLA 2W01A 4MK9A 2ZKUA 5DO2A 4LVNP 3LTOA 2DXDA 5LJ5Y 4F4ZA 2W7AA 2HMIB 4Y28C 1D09B 3N01A 3CB4A 2H4YB 2HWHA 4KY3A 4IRDA 3KK2A 3UFCX 3HZEA 1RA7A 2I5JA 3NRBA 1KD1T 4OX9F 4KO0B 2NREA 1XMBA 1M5VC 2QLJB 3DU5A 3GFXA 1MROB 1F2HA 4PUOA 3KDNA 3NCRA 1A6LA 4ZCMA 4OHYA 3DM2A 1IBLJ 3W61A 2R8IA 3PX4A 2W4DA 2IM1A 4DL5A 4PG5A 3M8WA 2BXJA 4CO1A 1TUVA 1FE4A 2FC9A 2OSQA 2VB6A 2EG2A 2DNLA 3MR6A 4IYQA 4WU3A 4FP9A 4K4TA 1VS3A 3UI3A 2RUSA 3DMJB 5J2PA 3ONQA 2CDQA 1FFSB 2XZDB 3PW4A 5KT4A 1OJ4A 2RRAA 3PYEA 3KG0A 2APOA 4NZ7A 2XMMA 2G2YA 1VK8A 4YFUA 2GA7A 4W90B 3O5TB 2CJ9A 4DL7A 2MKKA 3O44A 1TU0B 3TVKA 1FFWB 2HNYB 2GFFA 3FQLA 2RF2B 1H0HB 3MM5A 2LLZA 1YDLA 1LV5A 2X1AA 2ZZTA 2J8AA 4TY9A 2F8MA 5K14B 4WTYA 2A6MA 3B4DA 3BPDA 3M8PA 1HD1A 1TTHB 3MM8A 2QIFA 1F60B 3QAEA 2GQCA 3TUZC 1Q53A 1RGVA 4NXMF 1V6HA 2WHOA 1E6VA 4CCHA 2C1EB 5EDWA 2XYHB 1WC4A 2HHQA 1VHIA 2V67A 1D8YA 4QCLA 4GKJF 4L73A 3KTQA 1SC3B 2QT7A 1X5SA 3BBFA 4M5NA 3DOMB 2W2MP 1L3TA 2E5IA 4O3NA 3K8VA 2CNNB 2HQ3A 4LFAF 3SI8A 2V1SA 3LQVA 3I0RA 1S48A 2DNMA 2YXLA 4B3OB 3GB0A 3MMCB 2ROGA 3TEGA 1YJUA 1ZOTA 4WP9A 2DGQA 1EP4A 2C28A 3GSIA 3B54A 2UZAA 4K4XA 4OHXA 4OI3A 1WC3A 1Q8KA 5E41A 1TFWA 2GQ2A 2I0XA 4X66J 4Y2AA 2BKPA 2MPUA 2HZCA 2ASLA 3QAUA 4RW6B 2AJ2A 2BX6A 1S99A 2GCFA 1N6QA 2XTJP 1Y00A 3A8IA 2GNKA 2OPSA 3CPWR 2RHSB 2DT9A 2NYIA 1U1QA 4J9LA 3C46A 3GLJA 2UXCF 3RB6A 1RAJA 5D78A 2CZ4A 3M32B 1WKKA 3W9JA 1OSCA 4OYWA 4G1QA 4BDPA 3A3OB 1S4FA 2O5DA 2UU9F 5D6GA 1VQMS 5IS2A 4DR3J 2OJ3A 2V1TA 2XZTB 3BV8A 4RUCA 2HPUA 3DRYA 4NYZA 1FRKA 1OS5A 1VMBA 1U09A 4J9VA 2I38A 4RW9A 2I6WA 4B9TA 4KGXB 1JXLA 1Y3KA 2F4VF 3GV7B 1U1MA 3M9OB 4L76A 3G9CA 5M2PA 3CJKB 1UZHA 5H9EJ 3A8JA 1Y0HA 4EUVA 1LWEB 5FD1A 4ZPTR 4NMLA 2ZH8A 1IKWA 3NBPB 1RTDA 1S1TB 2ZE2B 4MT1A 3M2VB 2WB1D 2CQ0A 1T0TV 2AX1A 4I2QA 5H9FK 4RLEA 1EZZB 4NEZA 2NXUA 3IR5B 3P6YC 4URQU 2WVDA 4A4JA 1CVJA 1IR2A 2Y1IA 2AMCB 3TR5A 5LSLA 2HLTA 2XO7A 2R7UA 3NLCA 3DRSB 3FGVA 3AWRA 4WFZA 3OR2B 4DFJA 1A9NB 5SZTA 5HBMA 2H48B 4WXOA 1NK7A 1X4GA 1UA0A 2VPXB 3J7AN 4Q5VA 1RT1A 4YB7A 4P2SA 1QTMA 2HQCA 3R97A 2VFVA 3UN3A 1V3SA 1A0OB 2EWHA 2XLJA 3G8QA 2IBKA 3QT7A 1FK9A 3EVOA 4B9VA 4NXMJ 5CD4H 1NDPA 3THVA 3L9ZA 3KK2B 2I5JB 3HK2A 1QAYA 2FPHX 4YB1P 2DNKA 2BUNA 4WP8A 3PXGa 4OYPA 1HNVA 2WBMA 1WEYA 2JJ4D 4GKJJ 1TAQA 3TVYA 3R1HA 3ZZ0A 4PUOB 2YQ3A 4UUXA 3HZGA 2LVWA 3I87A 5IZHA 3DM2B 1MN7A 3R1LA 3C6TA 2DJWA 1SQFA 3KLFA 1N32F 2FZGB 2ZH2A 2BJ3A 4QU7A 1X8DA 3K0JA 3US5A 3A3PB 1NKCA 1IXKA 3OL8A 2P9CA 1Q0NA 2IC3A 3NGTA 2RU3A 1VGYA 1VQKS 2MKHA 4LRCA 3T5KA 1UJ6A 4A8FA 3ZZZA 2HWIA 3DLHA 1NK4A 3VAGA 2N4CA 2LA4A 2VA3A 4NWBA 3DLBA 4LF6J 1NZ8A 3W9HA 5HO4A 5HMYA 2J6TA 3MM5B 3IO1A 5KT6A 1Q16B 3FBBA 5K5MA 3AT1B 3V81A 4P7VA 5AT1B 2MLXA 1FX2A 3M8PB 3MM8B 5KT3A 2UXCJ 3GV8B 4NRUA 4O44A 3BPSP 3QSYB 2VASA 3Q8VA 3THPA 2HFSA 1L3UA 1BGXT 4QIFA 2QA4S 3FBFA 2UU9J 4UOHA 4WU2A 1Z2LA 2EI5A 1SJRA 3RRKA 4M5GA 2BE2A 3KKFA 2RRNA 2BQ3A 2MHNA 4P10A 1RWXB 3I0RB 1DAXA 3QFWA 1KQFB 1YGYA 5J2QA 4ZDNA 5FDLA 3MMBA 1JJ2R 3PFEA 4P2MA 4K4SA 2WSCC 1EP4B 5D0RA 4NL5A 5I4MA 3UNYA 1S0OA 4DCPB 4HACA 1WKJA 5KFFA 3NAHA 4EYHB 4FN5A 4DV7F 4DQSA 1F9FA 4RU9A 5K20B 3GIMA 3R7SB 3D4JA 3CC7S 1N5VA 3KOAA 3IFEA 4WIIA 4ZLPA 3ETMA 3WZ0A 1HD0A 3RUBL 3I9V9 1N6QB 1WELA 2XC9A 2OPSB 2CQ1A 1HI1A 3PRVA 5LM7E 4ED1A 4ZLNA 1OWXA 1L5UA 1HWUA 3LALA 2ZDPA 1RE1B 4CLUA 1NDCA 2YKPA 1JMTA 3I5BA 4AT1B 4Y0FA 4LIWA 2HBZB 3WX8A 2QA4G 3OL7A 1UVNA 2CZ9A 2VL1A 2I8EA 4MK7A 1UTAA 2NS1B 3OBIA 3R5BA 4H4OA 4ANEA 1WI8A 2DR6A 3M9MB 3D7SB 2IMOA 5ETSA 4RW9B 1O0PA 4OZLA 4C98A 2B9EA 3ZTSA 1JLBA 4RBVA 4ECYA 2E5LF 1PJ5A 1VQ9S 5LJ3Y 2P5VA 4K4VA 2Q1LA 3NWRA 2QGFB 2UXDJ 1SL1A 1M5OC 1F2GA 2DGXA 4PXDA 2VZ9A 1RWMB 4NRTA 3W60A 3PCOB 4D3HA 2R7VA 4K4ZA 1RISA 1TP7A 2KRBA 1N5QA 3FC9A 2ZBRA 1Q81T 4NA3A 4C3LA 1IM4A 4I2QB 4BCAA 4LRBA 2ZWOA 2KZZA 2M7SA 4YB6A 1AB8A 4PG7A 3LGHA 1N5SA 2IA6A 1G6BA 4NLYA 3DXBA 1CULA 2XWYA 3A1YG 2UUCJ 1B64A 1WWHA 4BLGA 3U27A 2HHVA 1VQOS 4IDKA 3AH6A 3E3XA 4FYDA 3ET6A 2AP6A 1VQSA 3OPKA 5HBMB 1WC5A 1QD1A 2QTWA 3IWXA 1TUWA 1HNXF 2RSQA 3CJSA 3PW2A 4RW8B 1N56A 2RKIA 2KN4A 3L7UA 2WSEC 3TP2A 2PA8D 5L46A 2QYGA 2VKZG 2P6TA 2AJ1A 2D74B 1UJ5A 3TI0A 2E5JA 2NPIA 4QOTA 4WKYA 1FTCA 4WYLA 1U0HA 5A0YA 3UQSA 1Q8IA 1HNVB 3NGUA 1JLQA 2Z2YB 1B7YB 5HJXA 4KGKA 3IS9A 2OO4A 4CT8A 2C2DA 2V68A 4WE1A 1AYEA 2ZUAA 2B7CB 1IBKF 3OTDA 2QL5B 3N79A 3U1LA 4X2BA 4P71A 2QLXA 2CQPA 4Z7YA 3C6TB 1Z4UA 2FLOA 3KLFB 3ZXWA 2DR9A 4YR2A 1SJ3P 4U7UK 4DUZJ 1TK8A 2NXEA 1F9HA 1KBRA 2XQCA 3AFGA 2IC3B 3PYGA 4NLDA 1N36F 5KFSA 4FXVA 3MCOA 1SIWB 1K73T 2QLBB 5H1SV 1N52B 2IBOA 2RH3A 3QT8A 4TNOA 1WHXA 4WIQA 4CO4A 1G4CA 3GYXB 3TO8A 4GC7A 4KHRA 1T02A 2O1PA 3L3CA 3NOGA 4OZ3A 4WFNQ 1S57A 4F4WA 2CJYB 4EO6A 3V81B 2ZJQQ 3HX9A 4FF2A 1X9MA 1KQGB 5BYRA 4RW7A 2OGUA 4ZK7M 1FXRA 4LR7A 2DHHA 4O44B 4L3KA 1NDLA 3G71S 1X9WA 1SH2A 3QGIA 2PI5A 2AZ3A 3DGPB 2XLIA 1S5ZA 3MEEA 3T6JA 3W64A 3W1YC 2HHXA 4USMA 1MMLA 1EX8A 2BE2B 1V3ZA 4ZP7A 3BKFA 1DBDA 2X1GA 3JSMA 3KUEA 1U1LA 1D8ZA 1TFYA 2BE7D 2DNGA 2O66A 2E5LJ 2M3DA 5J2QB 4JI1F 5FDLB 3G6YA 1KOHA 2BQUA 2HNDA 1U1KA 3MMBB 1CJTA 5L1KA 2EFGA 3DOLA 3D3BJ 5ITHA 2OFHX 1RHJB 3RR8A 1NU4A 2RU9A 1JJ4A 2KU7A 2H65B 2OMOA 1UWBA 1RDRA 4UOCA 7FD1A 2DCUB 3KJQB 2MSTA 3FZ2A 1C1CA 4WFAQ 1UVKA 2VIHA 4EZ6A 1WDDA 3NGKA 2RMLA 3U1MA 2JEGA 1P6TA 4CLSA 4YP3A 5E3AA 1XTZA 1HNWF 3M1VA 1HNXJ 4B17A 2XMKA 4MIBA 4CQ1A 3LH2S 5C25B 5B0FA 2GW8A 4P2XA 4ELVA 4CM0A 1ZZNA 4AUKA 2C42A 3OV7A 2HS4A 1HR0F 4DLEA 2WONA 2GHWA 2FY8A 2PD1A 1HL6A 3R7NB 3P3DA 5F8NA 2V69A 2XHWA 1JLBB 5GAGI 4JYAJ 2GMJA 3I55S 1TL5A 2CPZA 3BYRA 1DURA 2DRAA 1JLGA 4WCEQ 2QMWA 1IBKJ 1XJWB 2C2ZB 5M2RA 4UT4A 2AYBA 3CCUS 2ZH5A 3EDRB 4K59A 1IKYB 3VAHA 4E2FB 3IRXA 1LFWA 4Q44A 3H5YA 2C2RA 3CJRA 4ELTA 3ZTOA 1FJCA 2RILA 3MTKA 1HWJA 4HDHA 4LIRA 2HAIA 1XEZA 3JTOA 3AOCA 1Y9OA 4ECZA 1TQLA 1HNZF 1M1GA 1CULB 3TW0A 5K8MA 5BR8F 3OUYA 4IDKB 3ET6B 2WVCA 4USWA 5F8IA 3NMRA 3KG4A 3Q2TC 5BYSA 3DLJA 2DH8A 1HW9A 1VQ4S 3BSNA 1OYDA 1YIJS 5AXLA 2RKIB 5LMNF 3J7Z5 5D8HB 2E29A 1S1UA 5L9NA 2HVZA 3Q8YA 2PMWA 2NXCA 1AW0A 3QWUA 3BM7A 3MCNA 5L38A 1K8AT 1RHUB 3R3TA 2R7TA 3CDAA 2CQ4A 1L3VA 1XBWA 1NSKL 1U0HB 5A0YB 2V0NA 1ROFA 3SSSA 4DFPA 1JLQB 4ID5A 4NLOA 3LGMA 3KK1A 3N6MA 2AJFE 3E01A 3IS9B 1DZ5A 2QMUB 1HIYA 4GVBA 2XMTA 1TL3B 3GTYX 3QJLA 1VQ6S 1FNXH 2LU2A 1KDNA 3AX5A 1M1HA 2N4DA 2J8SA 3PR5B 3G8TA 4UOGA 2A2CA 1NUEA 4PQUB 4JI1J 1W7WA 1UW9A 2G1DA 2YWEA 3AX2A 2PI4A 4F26A 2PDAA 1R0BG 1WEXA 5E7OB 4JV1A 3D67A 4LF8F 4M5JA 2M4MA 2IVMA 3K5PA 3W8PA 2V2ZA 3NGDA 3FSXA 1ZETA 3CSKA 3DOKB 4A46A 6FD1A 5HJYA 1K1QA 2OHDA 2Z57B 3UR3C 1UETA 3GIKA 4KSEB 5KG6A 4CH1A 5T14A 2W9BA 2MXYA 4K0KF 3OFGA 7AT1B 4RW7B 2VD3A 4DPOA 2GAHC 5B09A 1NXIA 4RBTA 2RUGA 4HEA9 4OZ5A 2FJWA 4ES3A 4HHJA 3TQEA 1NB7A 1KFSA 2B6AB 3TUPA 1REGX 4KQZA 3MEEB 1SQEA 4LVOP 2BABA 4OYMA 1YJTA 1S1WA 3VAJA 1T7PA 3S01A 1W26A 1HR0J 3JSMB 1CBKA 2CQDA 4ZMMA 2IDEA 4DX7A 3N9UC 4H4KC 2IYGA 3OXFA 2YKOA 3PW0A 3D2WA 4EFAC 2LXFA 2ZH3A 3EE3A 1WEZA 2HNDB 1NK0A 2L08A 4DSEA 3DOLB 2Z30B 3CJ4A 4AL5A 3KLGA 1KEKA 1RADB 2D9OA 3G4SS 4B3TF 4ZVTB 5HN0A 4KGVB 4OYIA 4Y65A 2E1AA 4HHHA 1W25A 1UWBB 4ED3A 2LA6A 2RT3A 1U8SA 2EFVA 1C1CB 1HNZJ 2MJNA 5BXIA 1NKEA 4DV1J 5BR8J 4J37A 1VJWA 2QL7B 3MTJA 2XY5A 2KH9A 3M1VB 2JNJA 2K2PA 4NCGA 2XS2A 3QRRA 2QSFA 2CQCA 3MDFA 1XMOJ 2V63A 3F41A 4G1PA 4KPCA 4ZVPB 3D54A 3HHLD 4UF4A 4PXEA 2E44A 1QAXA 2DGSA 5H9EK 3H59A 3TNVA 2RQ4A 3DYAA 1X0PA 2B4OA 2MZJA 3UVJA 1HBUA 2Q6CA 3FDSA 2FTRA 1RT3A 3RR7A 3G96A 2R2SA 3Q8PB 1T05B 3A12A 2W9CA 2DEJA 4R5PA 1T9UA 3JAMU 3Q0AA 3R8YA 5DGAA 1JLGB 2MKIA 4LF4F 3BN7A 2JSXA 4M5DA 4YHHF 1DFDA 5F8HA 4Y2IA 1S9FA 1KVJA 2Q3PA 3SZ2A 2VOOA 3IRXB 2OP5A 3BR9A 3P4UB 2FUG9 5IQ6A 2IIHA 3IN5A 1K0VA 3T1YF 1FVSA 2N7YA 5DDOC 1RHRB 4JV0A 1FRLA 2YQ0A 4LSZB 5GMDA 5KOXA 4LF8J 3PKMA 1OY6A 1Q78A 3OTBA 4DV0F 1WD6A 4RW4A 3OUYB 3PV8A 2BV3A 4DF4A 2EBGA 1SJ4P 2GAGC 4KKOA 4F02A 2HHSA 2CNKB 1NKBA 3LPYA 4KTQA 3MUVP 5HVFA 3KDOA 2PGCA 1S1UB 3T1AA 2CQBA 5DQGA 5LMUF 3CO0P 1JLEA 3HKWA 1U26A 2JOQA 1GNKA 3BDPA 3C3LA 4DL0C 4EBDA 2I9SA 4X4UA 3M8QA 1KFDA 4JOUA 4AE5A 3J7YU 3UN5A 3C8YA 2ACYA 2XLKA 3PHTA 1O6XA 4ID5B 3KLIA 5J1NA 4PYDA 2BZ2A 3E01B 2LEPA 2OSRA 1Z2ZA 1RQ0A 4GVBB 1LNQA 2DHXA 1X7VA 5CYJA 4QYRA 1T9YA 4OZ0A 1FA0A 4ZJLA 3Q8SB 3P8BB 4R0EA 2HAFA 2PMHA 7FDRA 8AT1B 1UVMA 1TKTA 4FDFA 3CF5Q 2MB0B 1S6QA 3AXMA 4YY3F 2CVEA 4WZQA 5D4LA 4C2MA 5B0AA 2OTLS 2HK2A 2AGOA 3J80U 2EFNA 2YX4A 4UY85 3BO4A 1AXQA 2IPOB 2JEJA 2DHGA 2ZM6J 4JI2F 2MQLA 2CPYA 3VF0B 5AE2A 2VBWA 2DNHA 4DQIA 4P75A 3VZIA 1YSJA 3A8KA 1YJNS 1IM6A 4FXDA 4DU8A 2W9BB 3UDEA 2Z2MA 4WTOB 2PT0A 2BRKA 3QT5A 2QO3A 3CCQS 2YH1A 1FD2A 1TL7A 2J6SA 4YOEA 1JLAA 4RBUA 2BM1A 3HVRA 2WVFA 4M5KA 2MGZA 3Q22A 2MZTA 3KMQA 2EK6A 1Q86T 3ENVA 5T7LA 3QLHB 3NP5A 3HVWA 2NQPA 2HBRB 1SC6A 5EWFA 2KI2A 2KVQE 2FYXA 2J76E 4JI8J 4B9MA 5IQQA 3NCPA 3TAQA 1S1WB 2AEJA 4EU0A 3I6PA 4J5OA 1GFWB 1NPKA 3DCAA 5J2NA 3PY8A 5KFYA 2RQKA 1GEHA 4I6AA 4O3OA 2DNYA 5KFRA 4DL3A 1JKHA 5DRKA 3PW5A 4LF4J 2EFPA 2ZVIA 4ZIWA 3C6UA 2W9AA 3KLGB 4QYZJ 2E5HA 2QN6B 1LK7A 1RWWB 1NZAA 3GJTB 3JTNA 1TK0A 2R42A 1NMEB 5FLXY 3OW2R 3DHXA 3MEGB 3ENAA 3RB3A 4J7CA 2DPIA 3T1YJ 3SMZA 3CD0A 1VC6A 3H8YA 2M52A 4TXSA 1V9OA 2AT1B 5KFBA 2FVPA 1LW2A 1BMQB 1S9EA 4RU2A 1EETA 2C3PA 4DV0J 2G1HA 4OX6A 3NGRA 5CHCB 2F65A 3CJTA 3M05A 2WSFC 3D6FB 1RT6A 4MTPA 1EKSA 2XMWA 4CNYA 1T9WA 5L39A 4JI3J 3BGUA 4J90A 2WZ1A 4OX8A 1RTJA 2DPJA 3CMQA 4XAKA 2DO4A 3OTOF 2ZBCA 3FRYA 4URSA 4MKYA 3G2XA 1RU1A 4WYWA 3VTIA 3JAMY 4EWTA 1NHKL 2E7XA 4ED5A 4ITSA 3PEHA 1P9QC 5LMUJ 4WZMA 5HATA 1RTZA 4UZCA 3O2IA 3DYAB 5DDPC 1GXLA 4L6V3 3I0SA 1OMSA 4FNIA 4KFBA 3UVJB 4G65A 1FT8A 1HBUB 4DUYJ 2BM0A 5C2GA 1J5EF 1RT3B 4QWBA 1QSYA 3HO1A 1I51B 2W9CB 2FJAB 4FS2A 4R5PB 1DRZA 4J9NA 3H5XA 4X4NA 1N5YA 2R7XA 1VISA 1VIXA 2V9WA 3M8SA 1N48A 2XEXA 4NPOA 2VDHA 4KBIA 3RYLA 3U7JA 4OL8A 2MMYA 5HQ8A 1FRHA 5HVGA 4OI4A 3GQCA 3IAM9 2CDRB 4YY3J 2OIHA 3QMQA 2BKOA 3DRXA 2CQ3A 4C8OA 2DITA 2N82B 1FTRA 2H54B 2C3OA 1CEZA 1MMNA 8ATCB 4RW4B 1UWAA 4KKOB 1IJFB 4C97A 2GX8A 1BC6A 2UVRA 1OO0B 2Q66A 2VV5A 5GAEI 4C6AA 2O3DA 2HFOA 3OJSA 1X31C 4OX7A 2AYEA 5DGBA 2BJ1A 1G3OA 4LFBJ 3AD7C 1JLEB 2VQEF 1GX5A 1OQ6A 3ILOA 3T5JA 3TVZA 5AE3A 2GO9A 3HSGA 3M8QB 2WAQD 1TKZA 3RAMA 5KFUA 2AEFA 3ITHB 3AX3A 4P74A 5DG9A 3BEGB 2ZJPQ 2VH7A 4JI6J 1X4DA 3I82A 3J80Y 4KPYA 2HFUA 4XK8C 1U1NA 2QL9B 3ILIA 5KG7A 2KJWA 1U02A 3L09A 2NSCA 3B82A 5KG3A 4X4RA 3VQSA 2VKRA 4CLZA 4DSIA 3MR5A 1S6QB 1C0UA 1XC9A 2V8PA 4IG3A 1KLMA 3H90A 1U2CA 2ZH4A 2M8DB 4FF4A 1NJWA 1VQLS 3HFZB 2VDIA 1PBUA 2GIQA 4A8YA 1YJVA 3OVSA 3OFEA 1X4CA 2DR7A 2KVIA 3KUHA 4OV1A 1GMWA 1NJXA 4C0BA 4TU7A 3BSAA 2E9ZA 4DV3F 2ACMA 3O8WA 3GCXP 2VFUA 1PG5B 5D15A 4I56A 3S7RA 1RT2A 1KTQA 4FNHA 1NCLA 2KT3A 4GO7X 1IUJA 1OSDA 1TMJA 1CC7A 4I7FA 3TJ9A 1YJRA 1TL7B 1U24A 1JLAB 1H98A 4WWSA 1R27B 1S6UA 1M5KC 4IKAA 4ZPWR 3CCRS 3M8ZA 2MGZB 1FKOA 2HGMA 2HEKA 3QWPA 3W2WA 4F04B 3OTOJ 4LR8A 5HMZA 1ZM4A 5T7LB 3ZZUA 1U4BA 3Q23A 2H5JB 4ECTA 3CC4S 1FDDA 2R7QA 3NG8A 3S6EA 3MR2A 1FVQA 1WG1A 2D69A 5J2NB 3CJ0A 2AF6A 2J7WA 2MZSA 3TAMA 5ETRA 4TVAB 5HK4A 1J5EJ 2X1BA 3NOCA 3MOZA 3C14A 1H74A 2OPQB 1JKHB 5ETMA 3W2VA 2F40A 3HHNB 2DIVA 3HT0A 4X62J 3N5FA 4K5RA 3H5UA 1UFLA 5KFZA 3K7RA 3C6UB 1TAUA 3K5OA 1YJ7A 2JFDA 2HWTA 3TRGA 1SKWA 2CUYA 2HZAA 3MUMP 3D0IE 4DV6F 1BWVA 3JSYA 1LW2B 1S9EB 4CH7A 1CSJA 2IJRA 1EETB 2MQOA 3IA0A 3Q2SC 1FRJA 5I3PA 4TY8A 3UNGC 1HQUA 5SUHA 1RT6B 4KGZB 5E3RA 1PC4A 3RRHA 3AB4B 5KFWA 2F7VA 1RAFB 1FKPB 2CJKA 1TR0A 1B4SA 2UUBJ 5K9FA 3ZZPA 2VHGA 2VJVA 4JI5F 4IR9A 4JUZA 2YX1A 4RZRA 3PRDA 3QJJA 3UPFA 3ZO7A 3VAIA 4ZVHA 1SI9A 1S6OA 2IVFB 1MROA 3I0SB 2PA3A 3FJ2A 4KFBB 1UL3A 2UVUA 4XIUA 3TX0A 2CQIA 2N7CA 1U2RA 1AZSA 1QJHA 5CZVA 1N5YB 2X51A 3FRZA 4RUAA 2XMVA 4NI2A 4I4BA 1LW0A 2HHPA 3NY0A 3FEZA 3OHAA 2OLWA 4RNOA 3CCJS 3WDOA 3OD2A 3VQTA 1EHWA 1U25A 3TX8A 2A0FB 3OL6A 4LMZA 2RF2A 2IM2A 3V4IA 2PFDA 5LT5A 4V19J 1WSRA 5K14A 1KS2A 1D0EA 2ZOGA 5LL6d 4DV3J 1R31A 3E8OA 2AQ4A 4PWDA 3D1QA 5EWEA 3M6XA 3PJXA 4ECRA 2LEAA 4DN0A 1RTIA 3ZC4A 2CNLB 2V6AA 4A8QA 1Q82T 2KT5A 3DXSX 2QLFB 4KV8A 1O8BA 1QY7A 2ZWPA 2MLYA 2ATLA 1TKZB 2AHOB 4K4WA 3PYDA 2WVEA 5LSRA 3ZZTA 3HJFA 4USKA 5JVGQ 3UCZP 1PSDA 1R6YA 3HSDA 3SFGA 4TU9A 5AE1A 3S8SA 4MYUA 4QW8A 4B9LA 2UXBF 3NXZA 3W65A 1WUUA 4MIAA 1GTHA 5ETVA 2R2RA 4MMOA 2KKHA 3UCUP 3IAS9 2VU5A 4ZKAA 2MEWA 2F9JA 2LKZA 4RNHA 1FESA 1UJ4A 1C0UB 3UO0A 1OY9A 4OJ3A 1PC5A 1SKSA 4DR7F 2BMBA 1KLMB 1GT8A 1APSA 3PFOA 1V3RA 4X65J 4LBHA 4C9DA 4CRJA 1T95A 3ELHA 4TLQA 2MKJA 5A6PA 3OFHA 2ZKTA 1M90T 1WOSA 4DV2F 5GAGU 1GTEA 2DD8S 3CJ3A 2E1PA 2XI3A 3ILLA 5ETQA 3D0HE 5E3QA 1KHWA 1WNEA 1P1TA 3AB2B 2AJ0A 1WKLA 1SVDA 1U45A 4CTAB 3MUTP 1RT2B 2HGNA 2ZHBA 3KLVA 2GJIA 4PAAA 2J9DA 3GONA 3SQGA 1FX4A 4I7FB 4OLPA 1QDUB 2MQQA 2ROPA 3M9NB 3HMJG 1SH3A 2G2OA 1FKOB 2DR5A 1Q5YA 1WDTA 4F7VA 4J9KA 2GQQA 4M63A 1RBOB 4X4QA 1FRXA 2XS5A 3MURP 3SBMA 2HLUA 2B9XA 4H4MA 2OD4A 3AODA 4K50A 3TAMB 2D68A 2WW4A 5IWAJ 2V5HG 3VAKA 5IT9U 1BQMA 2HVHA 3EPIA 3C16B 4N8OA 1NSAA 3W2VB 2KZMA 3CO9A 1WG4A 3BGOP 4JI7J 4Q8EA 1P1LA 3UDCA 4LF7F 5E3CA 3MZIA 4LREA 1XNQF 1XR5A 2XTDA 4O4GA 3SV3A 3K58A 3MWBA 4J9SA 4WBFA 4OI0A 2KJVA 3RAXA 1ZZFA 3NWGA 2ZBPA 4F67A 1NK6A 1LOUA 5EGYA 2QEXS 4B3MF 1QUPA 2QZ8A 2BJEA 4ED7A 3K17A 1SCJB 4Q45A 4TY8B 1HQUB 2Q6BA 4ZPBA 3R5AA 2W7OA 3HHEA 3GIIA 4OZ2A 1KRPA 2CWXA 3FFIA 4ECVA 2HFZA 4AL6A 4M5LA 2POKA 1ZTTA 4CO3A 4IO1A 5A8WA 1TK5A 4MK8A 3FMWA 5IV3A 4DR6F 1ICEB 3MAHA 1U7LA 4YR0A 1P27B 4C4WA 3KJNB 2PN6A 3ZTPA 1NJZA 3HD1A 1HHTP 1IQTA 3CCTA 2W7PA 5B7WA 2HK3A 4USJC 4OMFG 4LJMA 1VC0A 4KR0B 5F3TA 5KG1A 1HPZA 1AZSB 1ZM3A 1KP6A 1Q8LA 1FDBA 2WOMA 1R6VA 2PIIA 2GO8A 3LW5C 1VC5A 3VAMA 4NI2B 3JQMA 1LW0B 2AGPA 3D3CJ 4M94A 2UXBJ 2HQGA 4OHZA 3EMTA 5HQMA 2XSJA 3CT9A 5CYQA 1T03A 5DM7Q 4LFCF 3KHRA 1ZM9A 4QU6A 3KUGA 4ECXA 4DR7J 2ZH9A 5DDRC 1LWCB 3QQCD 5CD4A 1FEEA 3OLBA 3V4IB 3HSJA 2VG5A 2BA9A 4DV2J 4QZVB 3OSPA 3ISND 4PWDB 1I1GA 2JLGA 2BJDA 4N5SA 1NPRA 2J9EA 2AYMA 4H4KA 1RTIB 2GIRA 1K1SA 1U2FA 3V6HA 2DYAA 2PFFB 1UMJA 3D9BA 2W4CA 5L8RC 1PYTA 4O0IA 1JQGA 3RU0A 1DHMA 2ZEJA 2XNRA 4KV8B 5K8NA 1VK3A 3H20A 2G9OA 3MXHP 4A8KA 3ULHA 2YWGA 1CJKA 4J91A 2AGQA 1SBRA 3K5NA 3KK3A 1V5VA 1K9MT 1YITS 2KYZA 1JB0C 3SQOP 1HHSA 3AOAA 3KHHA 1VOMA 2PEHA 3FK4A 3TEHB 1S9GA 1AUDA 2HFVA 1J2VA
chains in the Genus database with same CATH topology
1Y3JA 2G1DA 2YWEA 1GAOA 1S7HA 3O6QA 3OR1A 4DN9A 3K57A 1IKVB 2J0XA 2OPQA 2ROEA 2PI4A 2IAJB 4F26A 1N0UA 2OPRA 2ZZNA 2FLPA 3GFYA 3T5LA 4Y34A 2PDAA 3MMAB 2L3MA 2OKQA 3MR3A 1HBNA 1WEXA 2MQPA 3HFKA 5E7OB 3SXLA 2KXHA 1FHTA 4DL4A 4LQ9A 3OTCA 2OH2A 4JV1A 4XPEA 1N5TA 4LF8F 3VAFA 4IOAQ 5CYMB 2WTFA 2M4MA 3CMES 3L95X 2IVMA 3K5PA 5LXYA 2VBXA 3F56A 5J1EB 2J7KA 2VG6B 2HNYA 3FVYA 1XERA 5CCLA 4LT6A 1PILA 3FSXA 4DMZA 3NGDA 1ZETA 1LFPA 4IQXA 4KE5A 3CSKA 3DOKB 1WF0A 3KHLA 4A46A 1BLUA 1R8AA 3V6DB 4BS2A 2CVIA 2JWNA 2RNEA 6FD1A 5HL7Q 3BQ2A 2KFNA 1HWLA 2DGWA 5BYQA 2HS0A 5EN1A 1U49A 4ZVFA 2DR8A 4OJGA 1SV5B 5IT0A 4ECQA 3BB5A 2RQCA 3CCMS 1U1RA 1K1QA 1KLNA 2NPFA 3M2RA 3L7PA 4IFVA 3UR3C 1MW7A 4O3QA 1VQ7S 1UETA 1C1BB 3I96A 1RT1B 2XCPA 4KSEB 3GIKA 2V8HA 2LQ5A 5KTQA 4PXCA 1MWYA 5KG6A 4CH1A 3V6KA 5T14A 4ILMA 2W9BA 1FKAF 3WX4A 2MXYA 3OXGA 2VBZA 1PGZA 3HHLC 4CO2A 4K0KF 2WK4A 3SCIE 3AAWB 2RVJA 4X84A 2KTQA 4HI2A 3OFGA 4JV2A 1LXJA 1NNDA 4PG4A 3DRPA 2IRUA 4RW7B 2VD3A 1FK9B 4DPOA 2KHCA 5A8KA 1Q4RA 4I67A 1WG5A 1YBAA 5B09A 4LF9F 2DGOA 5EX3A 4EBCA 3MECB 2NLWA 2IRXA 4RBTA 2RUGA 4A47A 1GX6A 3SQGB 4M1KA 1QAJA 3BSOA 2X3GA 4DSLA 1WF1A 4NZ6A 4HEA9 2HVIA 2VC1A 3ZFVA 1FKPA 3JSRA 4OZ5A 4ES3A 2FJWA 3BDEA 4HHJA 2CPHA 3CCWA 5B08A 1URRA 1NB7A 3DOMA 1KFSA 4JYAF 4ALZA 5B0CA 2B6AB 1PO6A 5KG0A 2UUWA 4KQZA 3MEEB 4QPXA 1SQEA 4RX6A 1T3OA 2ADBA 4EYIB 1S72S 5IT9Y 4LVOP 3OL9A 2BABA 3H2UB 1DTQB 1IBLF 2C3YA 1YJTA 1S1WA 3DI6B 3VAJA 3K5LA 1T7PA 4X4TA 3S01A 1R0AB 3EZUA 2YWFA 3CDWA 1VI7A 5GAHU 2FJVA 1F0XA 3JSMB 3GR0A 3H2VE 3EGNA 4AYBD 2CQDA 2JC1A 2EPIA 2EK1A 3GWCA 4ZMMA 2MQNA 4B3OA 3B4MA 3HM9A 3N9UC 2XY6A 2B5JA 5I3UA 3CULA 4H4KC 3MMCA 2PO4A 1F5AA 2IYGA 2YKOA 1RT4A 3OXFA 3PW0A 2DHSA 3PJWA 4C3KA 4G1IA 3D2WA 3GMGA 4HL9A 1R43A 3KYLA 4EFAC 2LXFA 4DEZA 3K8WA 4H4MB 2ZH3A 2LMIA 1R8CA 3BGRA 2DCLA 1WEZA