3OL9A

Poliovirus polymerase elongation complex with 3'-deoxy-ctp
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymerase
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
total genus 136
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3ol9A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ol9A02
1EETA 1TKTA 2YKNA 3M8QB 3OHBA 2W7OA 2JC1A 1S0NA 4IOBA 3CIZA 5EWGA 2BE2B 4O3SA 1FKOB 2R2TA 2C2DA 3KLEB 1RT3B 3KK1A 3NMAA 1VRUA 4WXOA 4XPCA 2B5JA 4NLUA 1HQUB 4NRUA 2I5JA 3ISNC 4WZMA 4KKOB 4O3NA 1JLCA 4F50A 3H4BA 1RTJB 2FVSA 4B3OA 4K4VA 4WZQA 3FQKA 1YVFA 3PW2A 1S1WA 4Q8FA 3H5YA 4K4YA 2HNZB 1VRUB 1T03A 4F4ZA 4RNNA 2B5JB 3ISND 4MH8A 4MK9A 1QAJA 4GC6A 2J6SA 4JV1A 1JLCB 1K1QA 5K14A 2W9AA 4DL6A 4H4MB 3QGGA 4ID5B 3IG1B 4Q43A 4KAIA 4I2QB 4DL7A 1TKZA 2ASDA 1JLQA 4LSNB 4MIBA 4J9OA 4TQRA 4EBEA 3IGVA 1HMVA 2RF2A 2BRLA 1FKPA 4R5PB 2D3ZA 2YNHA 4QWAA 4ECXA 5F8LA 2WRMA 3LAMA 4ECUA 4R0EA 3OSPA 3QO9B 1REVA 4ICLA 5KFAA 2W9CB 4JV2A 1XR5A 2UUTA 5CYQA 2AWZA 4LSLA 4M94A 5L1LA 1TKZB 2FLPA 1JLQB 3IRXB 3HVTA 5JUMA 4NLDA 1HMVB 1FK9B 2R8JA 5KFDA 3JYTA 3T5HA 2VG5A 3N6NA 3D5MA 2XCPA 3FSIA 4JUZA 3MEEA 1REVB 4ICLB 3FFIB 3DI6A 4RW7B 2WONA 4RNFA 2W7PA 2BQUA 1RYRA 4IR1A 3HVWA 2FJWA 4WFZA 3RB6A 3HVAA 5KG0A 5KFMA 3I0SA 2UVUA 2VG5B 4RU9A 2R2UA 2QV6A 5KT7A 1N56A 4TYBA 4Q44A 1C2PA 1C1BA 3H40A 3DLGB 3V81A 2CKWA 5C24A 2WONB 5KFJA 1JLAB 3M9MB 4DL5A 2ZE2A 5J2PB 4K50A 5C25B 4ECSA 1BQMA 2ALZA 2AX0A 1S6PB 3QLHB 3V6JA 2ILYA 2IM0A 5DGAA 2UVVA 1IKWA 3C6UB 4ED2A 2JEGA 4ED7A 1XR6A 3CVKA 4Y34A 2ASJA 1C1BB 1EP4B 4TY8A 3OSNA 1TVRA 3E01A 5C24B 3T5LA 2BR0A 3DOKA 1S1XB 4Y2AA 2ZKUA 1RT2B 1DTQA 1RT6A 4EYIB 1BQMB 3RAQA 1C0TA 4IH5A 3KHGA 2YNFB 1IKWB 2IC3A 2HNYB 4EBDA 1VRTB 3PW5A 4DEZA 2HWIA 1TVRB 3E01B 4URSA 1ZTTA 1LWCA 5F9NA 1DTQB 1RT6B 4ZP9A 1C1CA 4ZPAA 3CJ0A 4Y3CA 2JEFA 4ECTA 4J9NA 4I7FA 3N6LA 4TLRA 3OLBA 2WOMB 2IC3B 4KFBA 2R2SA 4FBTA 4JV0A 2YKMA 2YNGA 2HMIA 3OL9A 1LWCB 4RNOA 3LP1B 3KLGA 3D28A 3MR5A 4ZP8A 4J9KA 1IKXA 1C1CB 3PHEA 3NBPA 3DRRB 4HKQA 4MK8A 4I7FB 4Q0BB 3JSMB 5DLFA 1RT1B 4O4GB 2RKIA 3OHAA 1KHWA 1JLBB 1TL3A 2XC9A 1RTIA 2VA2A 4NLYA 2UVWA 4EO6A 3H98A 1RT4A 3OLAA 3KLGB 1UWBA 3QYYA 1RT7A 1IKXB 4K4WA 2IJNA 1T94A 3BQ1A 3NBPB 1CSJA 3LP0A 1D1UA 4NRTA 3KJVB 3DM2A 1GX5A 3KLIA 4ECWA 3Q8PB 3NGDA 3V6DA 5D3GA 4MK7A 5I42B 4XPEA 2J6UA 1JLFB 1RT4B 4TYAA 4NCGA 5DQHA 1RT7B 1SV5A 3EPGA 2VG7A 2OPRB 4ECRA 4PUOA 4Q8EA 3QIDA 4K4TA 4IRDA 3PW7A 3KHHA 4ZHRA 3QIPB 3GIJA 3MR3A 4ZVFA 1HNVB 4IRKA 5HROB 1KLMA 4NCGB 5J1EB 5L1KA 3V4IB 2R8HA 3MF5A 2C22A 1TQLA 5F9LA 3DLKA 3ICLA 4OL8A 4IG0A 5C5JA 3KHLA 4RNHA 2FVRA 4RW6A 5T14A 2W8KA 4ZVHA 3MEDB 3DOLA 1QE1A 5I3UA 4J9RA 3I5BA 5DG9A 3SFUA 2E9RX 1RTDB 1NHVA 1EETB 1TKTB 1KLMB 2YKNB 4ZVGA 1RYSA 3TAMA 4FS2A 2AU0A 3DLEA 3T1AA 5KFZA 3KLHA 4ED0A 4IG0B 3KK1B 2V0NA 4FBUA 4IFVA 2I5JB 3QZ7A 2OPPA 3T5KA 2DPIA 3DOLB 5F8JA 1JLEA 5I3UB 4U6PA 4ED1A 3NL0A 2ASLA 1R0AA 4KE5A 4B3OB 2UVRA 3LP2A 5KFBA 4IQXA 1S1WB 2B6AA 3DLEB 4IH6A 4DG1A 4RZRA 3KLHB 4ZP6A 1MU2A 5J2MA 5KT2A 1OS5A 1T03B 4IFVB 3PR5B 4ZVEA 3KK2A 2JEJA 3RB3A 2XGPA 5K14B 1BQNA 2OPSA 1RDRA 1JIHA 4QW8A 3CO9A 5KFGA 4IG3A 3LP2B 3CDUA 1HQEA 1NNDA 1S9EA 3CJ2A 5HLFA 3IS9A 4J9SA 3H5XA 4EO8A 2RF2B 2WCXA 4DG1B 1FKPB 1S49A 1MU2B 1N5YA 4IDKA 2YNHB 3KK2B 3OL7A 3DRPA 1IKVA 4NLPA 4O44A 2R8IA 4NLSA 2R8GA 4WYLA 1W25A 5CYQB 4LSLB 2JEIA 1HQEB 3DMJA 4WFXA 3HVTB 3IS9B 5FDLA 4KV8A 3M8PA 5CYMA 5J2NA 3MTKA 3E51A 4NLOA 2WK4A 3KLFA 3JYTB 1N6QA 4IDKB 4IFYA 3DRPB 2IM2A 4NZ0A 1IKVB 4K4UA 4O44B 3V6HA 1RA7A 3MEEB 5KFIA 3DI6B 5KT4A 1ZTWA 5F8GA 4G3IA 4I2PA 1S0MA 3DMJB 3FDSA 1S9FA 4KV8B 1N6QB 3KLFB 2R2RA 2IAJA 3MECA 5KT3A 3I0SB 4URGA 4IFYB 5DQIA 3PJWA 2IJFA 5KFHA 3BQ2A 3V81B 4WFYA 3T5JA 3BGRA 2ZE2B 4K4SA 5KFCA 2ATLA 4IRCA 3BSCA 1SH2A 4ED3A 3MECB 3KMSA 4MKBA 3C6TA 2XI3A 4PWDA 2GC8A 3HKWA 1DTTA 1S6QA 4TY8B 1S1VA 3RBEA 3DOKB 2IBKA 3I5AA 3BGRB 4IR9A 1LW2A 3Q8RB 2WTFA 4RW8A 1IM4A 4J9QA 4FS1A 1C0TB 4WYWA 2V9WA 2RDJA 3H59A 1SUQA 3I5CA 2OPQA 4J9PA 1RTHA 5KFXA 5KG2A 4DL4A 1DTTB 2ZD1A 1D0EA 4G1QA 3MR6A 3M9OB 4MFBA 3FQLA 3GILA 3DDKA 3SI8A 5KFOA 3UPFA 3LAKA 4YR0A 2D7SA 4KHMA 1SUQB 4QWEA 4TN2A 4EBCA 4ED8A 1S9GA 4KFBB 4RUCA 3G6VA 2YKMB 4ZPDA 2ZD1B 2YNGB 3PZPA 3QGHA 2WHOA 2HMIB 4MFBB 2UUWA 3MFHA 1RA6A 4MIAA 3MEGA 1C0UA 2XWYA 4YP3A 4DL2A 2FVQA 2IA6A 2C2EA 5KG3A 3CJ5A 2HNDA 1HNIA 5KFTA 2RKIB 1KHVA 3CDEA 1TL3B 1RTIB 5KFLA 3BREA 4RW4A 1LW0A 1UWBB 5C42A 1SH3A 5KFEA 3SFGA 4F4WA 4X2BA 1C0UB 3LALA 3MEGB 3Q8SB 4WE1A 5HBMA 3LP0B 3KHRA 1TKXA 5KG1A 2GIQA 3DM2B 5KFQA 3KLIB 3DYAA 2HNDB 3V6DB 5HP1A 5D3GB 2W8LA 4LQ9A 3MFIA 3PVXA 5DG8A 4Q45A 4H4OA 2BRKA 4KB7A 4RW4B 1J5OA 1LWFA 1TV6A 1SV5B 3GIKA 4PUOB 2VG7B 4XO0A 5HBMB 5J2QA 1TKXB 3MR2A 4NLVA 4ZHRB 3PW0A 5HP1B 3DYAB 2V4QA 2D3UA 3PR4A 4KSEB 3M8QA 3BJYA 2VA3A 1DLOA 3UDLA 2BE2A 4DL3A 1Z4UA 1J5OB 1FKOA 3N6MA 1LWFB 3I0RA 3IGNA 3KLEA 4EEYA 3RB4A 1SH0A 3OL8A 3DLKB 3PJXA 1N48A 4KKOA 5DQGA 5J2QB 1ZETA 4F4XA 1QUVA 5L1JA 1T3NA 4RW6B 5F8HA 3Q8QB 1QE1B 1RTJA 3IN5A 4U7CA 3BSAA 2AQ4A 5F8NA 4K4ZA 1DLOB 3RB0A 3CWJA 1U09A 3T19A 3TAMB 1JKHA 4NLTA 3I0RB 1LWEA 3KK3A 3ITHA 5F8IA 2HNZA 4J9LA 4R8UA 2IMWP 1HPZA 3GV8B 2AGPA 1HYSA 4O3RA 3TQ1A 2QE5A 2OPPB 1NHUA 4HYKA 2BQRA 4H4MA 1N4LA 1R0AB 1JLEB 3IG1A 4ID5A 4I2QA 4K4XA 2FJVA 4O3OA 1S1TA 4O4RA 4LSNA 3G6YA 1JKHB 1JX4A 1WNEA 1GX6A 1LWEB 4R5PA 3ITHB 4QW9A 3KK3B 4ZP7A 2B6AB 1S4FA 1HPZB 3QGIA 4KHRA 3VQSA 4R8UB 1RT5A 5J2MB 1HYSB 3GYNA 5KFPA 3QO9A 2W9CA 3RBDA 1BQNB 2OPSB 4URQU 2C28A 2F8EX 1S1TB 3IRXA 1XR7A 4IG3B 4ECZA 3DRSA 4MKAA 5HLFB 2JLEA 1S9EB 1FK9A 5KG5A 4O3QA 2XCAA 4TXSA 2VG6A 2EC0A 1RT5B 1N5YB 3NAIA 1S97A 3M9NB 2I1RA 3H4DA 1S48A 2HAIA 2O5DA 3FFIA 4RW7A 3GIIA 2AGQA 4O3PA 4LQ3A 3DRSB 4ZPCA 3GV7B 1S1UA 5KT5A 5JXSA 5FDLB 3M8PB 2FVCA 2VG6B 5CYMB 5J2NB 2FJXA 3H2LA 1S10A 5DG7A 3H5SA 3DLGA 5KFYA 3GV5B 2DPJA 4ED6A 3V6KA 1JLAA 2J6TA 5J2PA 5C25A 1RTDA 4J9MA 4ZPBA 2V4RA 4I2PB 4QWBA 5DLGA 3BSNA 1S1UB 3RAXA 2ILZA 4NYZA 1S6PA 3QLHA 3FRZA 3C6UA 2IAJB 1EP4A 3QZ8A 3LANA 5EWFA 1S1XA 3BR9A 2FLLA 1RT2A 1IKYA 4QPXA 1TP7A 3G86A 3KOAA 2YNFA 3OL6A 3EZUA 4IH7A 4NLRA 4WXWA 4YR3A 2HNYA 3C6TB 1VRTA 3CDWA 2HWHA 2IM1A 4PWDB 4QWDA 3NAHA 3UR0A 1S6QB 2IM3A 3CJ3A 1S1VB 3H5UA 1IKYB 2R8KA 1LW2B 2JC0A 4RW8B 3HHKA 4NLXA 1I6JA 2BANA 5KG4A 2CJQA 4F4YA 2WOMA 4YQWA 4EYHB 4NLWA 4ECQA 2OPQB 5DGBA 1RTHB 2XI2A 5L1IA 2FLNA 4ECVA 3LP1A 4G1QB 5KFSA 2XGQA 4PQUA 4ECYA 1JLGA 4YMEA 3DRRA 4H54A 5KFUA 2BANB 4Q0BA 3GQCA 5KG6A 3JSMA 2BQ3A 4NLGA 4M95A 3KNAA 1RT1A 4O4GA 3CJ4A 1JLBA 2WB4A 1S9GB 2RDIA 2D41A 5KFWA 4RNMA 5KFNA 1RAJA 4PQUB 1JLGB 4ZMMA 3KLVA 4RUAA 1T05A 3KJVA 2FVPA 5EUHA 4KO0A 2YNIA 3TVKA 4YR2A 4NLQA 3PW4A 5KFVA 2W9BA 5I42A 1JXLA 1HNIB 1JLFA 1K1SA 1MMLA 1HARA 3GIMA 3G6XA 1S0OA 2OPRA 1LW0B 5KFRA 5C42B 4IKAA 1T05B 2OH2A 4WE1B 1TL1A 4KO0B 2YNIB 3KMQA 4RW9A 3NKYA 3QIPA 3BSOA 2E9ZA 5KT6A 5EWEA 1HNVA 2W9BB 4GC7A 5HROA 2C2RA 2GIRA 4TY9A 5J1EA 5KFFA 4H4OB 3BQ0A 3V4IA 2B43A 4KBIA 1TV6B 5EDWA 1RT3A 5F8MA 2E9TA 4TQSA 1QAIA 1TL1B 3EPIA 1HQUA 2AX1A 4Y2CA 3UQSA 4RW9B 5L9XA 3MEDA 4QWCA 2AGOA 5KG7A 5KFKA
chains in the Genus database with same CATH superfamily
3UI3A 2QGFB 4X65F 4YN3B 1NSQA 1XMOF 1B0PA 1RU2A 3GFXA 1T03A 2WW4A 2N7YA 2J6SA 1YQHA 3QWUA 2BJDA 1OO0B 3VZHA 2LDYA 3AOCA 2ABYA 2E66A 5E3RA 4F67A 5E3AA 3ZZUA 3RG6A 4CQ1A 2P5VA 3ILJA 3HHDA 1QVFR 3FEYB 2MZJA 1YK9A 3FSIA 4JUZA 1R0CB 3F56A 4QIVA 5GADI 2RQ4A 2KL8A 1X4CA 3BN4A 3E8OA 3W7BA 2BX6A 3DU6A 2V9KA 5J2PB 2E29A 1BQMA 1XR6A 3FBEA 1XNQJ 4ATNA 2ZHAA 2ZJRQ 4DV4J 5EX3A 1OQ6A 1ZPWX 3WX4A 4Y6IA 1ZZNA 4B9LA 1UCNA 2GJIA 2MLZA 3RBZA 1RWVB 2VBZA 3SYZA 4TLRA 3TA2A 1LWCB 2QL7B 4C8LA 5A8RA 2APOA 3QAEA 3OHAA 3HULA 2EFGA 1N5QA 2BJEA 4B9NA 1MMDA 4LVOP 1EARA 3EPGA 2QTWA 4K59A 2VC0A 2EFPA 4WFNQ 1JJ4A 2DH9A 3TUZC 3MR3A 1TFYA 2HHHF 5LJ3Y 4RNHA 1U26A 1NPKA 4ZVGA 3EX7B 1U8SA 1RE1B 3ET6B 1ZBTA 1P9YA 2GNKA 3QQCD 4FXVA 3PCOB 2DPIA 1R0AA 3G6ES 1TK5A 1T9WA 1E6VB 1KC8T 4JI2J 3VVTA 4IH6A 2OMOA 4ZP6A 1OS5A 5HMYA 1U1MA 3LP2B 1N5YA 1VISA 4CLKA 1FRIA 2R8GA 5CYQB 1D9AA 2K3KA 4IFYA 2Y8YA 4C98A 2IM2A 3VV2B 4K4UA 4LF7F 4KV8B 1N6QB 2RAQA 2PA8D 5FD1A 2D69A 3FSYA 3CCVS 1S77D 4JOUA 4OI2A 1K9MT 3A3NB 1LW2A 1M1HA 4LF8J 1SVDA 3R5CA 2QFJA 2ZD1A 1B99A 4FXDA 1RHJB 4DL2A 4KHPJ 2WZ1A 1RB0A 1LW0A 3SFGA 2WBMA 4DXLA 4GO7X 2R7TA 3U27A 2G1DA 2DY9A 4X66J 5HQLA 4E8UA 3CD7A 2XBPA 3HHLD 3PR4A 1Z2ZA 1N48A 4A4JA 1CC7A 3CWJA 4NLTA 1VBKA 4BLGA 3GV8B 2NXNA 4BC7A 1HBNB 4DN9A 2V2ZA 4R8UB 2B9WA 1S1TB 1YI2S 5KG5A 1S9EB 4P52A 2XNRA 1PC4A 2M3DA 2C2NA 2H4WB 1JXVA 4AQYF 5AE3A 1U1NA 2D74B 2HS4A 1S79A 5FDLB 3M8PB 2VG6B 4M8LA 2DPJA 2EG1A 4ED6A 4OYZA 2COLA 4OJGA 1O8BA 2YH0A 4NYZA 1TR0A 4U67Q 3RUBL 1D09B 1EP4A 1UTAA 2XMKA 5GMKa 3QZ8A 1S1XA 1NK7A 4OHZA 4YR3A 1WF2A 1VRTA 2POKA 3E3XA 3MOZA 4NI2B 4NLWA 1RTHB 2PN6A 1TFWA 2C3MA 4M5GA 4RBTA 3HXMA 4U96A 1H7WA 3SV4A 1NK6A 1F5BA 1U6ZA 1XC9A 1FJCA 3CC2S 3Q86A 4KO0A 3TVKA 2DXDA 1FEHA 4L73A 1U1KA 2AZ1A 3SSSA 3GIMA 3PYFA 5FLXY 4IKAA 4DPWA 2R7QA 1V6HA 1RAHB 2OI2A 2CVEA 1HNVA 1RWXB 1XJWB 2MJNA 3LQVA 4KBIA 4B3SF 2AX1A 2PFFB 2RUSA 2VHGA 3D6FB 2CDRB 3BO2A 4CH7A 1JLCA 4F50A 3HD2A 2WAQD 3H5YA 1CS4B 2W9AA 2JLFA 3RGIA 4Q43A 4ES2A 3DHXA 2QIFA 3UDCA 2YKPA 3EVWA 2VUGA 4DV3F 3L3CA 1HR0J 3HFVA 2ASYA 4OYAA 4FN5A 4LVNP 3MHYA 1BQXA 2Q6BA 1RAGB 5L39A 5KFMA 2VC1A 2AD9A 3WC2A 1C1BA 2OEJA 1RBAA 3N0VA 3EE3A 5ITHA 3I4PA 2G2ZA 2QRRA 4USTA 1Q8KA 4A8FA 3CJTA 1WACA 4ZLPA 2UU9F 4PZVA 4WK3A 2GX8A 2XHWA 4DZDA 1M5OC 1U45A 1TK0A 4N8NA 2EBEA 1FJEB 3D28A 2CPEA 2B4OA 1I94J 2V67A 2D68A 1EZZB 2DXEA 2PD1A 4DR1J 2OSRA 4FYVB 2DRAA 1JJCB 1SQGA 3VAIA 3KJVB 3DM2A 5D4PA 3KLIA 4ZVSB 3K5LA 3FMWA 4MK7A 2CZ4A 3QRRA 3ULHA 2H54B 4ZVFA 3C14A 2CJYB 1AUDA 5J1EB 4A8YA 2K1RA 2UP1A 4OL8A 2KTQA 4E0DA 1LWXA 3O2IA 1GK8A 3FEZA 3IR7B 3TAMA 2LQBA 5A76A 3DLEA 3JXOA 3EZ5A 4B3RF 1IBKJ 1FJ7A 3VWSA 3ETOA 4OZ3A 4OX9F 4DV5J 1MU2A 1T03B 4USIA 3KK2A 1B70B 4TLQA 2XWXA 3FVYA 2WVBA 5BR8F 2VPXB 2JEIA 2FY1A 1YJ9S 3CJRA 1MW7A 3WDOA 2BYCA 4L3KA 3I56S 2Z2ZA 3MECA 5C2CA 2J0XA 1ZAVA 1KLNA 1NXIA 2SXLA 1WTBA 1NRKA 4DX6A 1QY7A 2DO0A 3BDEA 3W64A 3HKWA 2KVIA 1SKSA 4ZIVA 2W24A 3M2VB 1IR0A 3IBCB 2V9WA 3K5OA 2RT3A 5KG2A 2ADCA 1BC6A 2WSCC 3MR6A 3B54A 3BH6B 1TUGB 3F73A 4PQAA 4CP5A 3MEGA 2FVQA 3QFHA 5A8RB 3QAUA 5ETVA 2G0IA 2BZ2A 1YJWS 4X2BA 1TUVA 3UDEA 4WE1A 4DS5A 2RHQB 3TP2A 3EICA 2L48A 3AJ1A 3HM9A 1G1XA 3BJYA 2D3UA 3LGNA 3M8QA 1ZM3A 3ZZRA 3RR7A 1LWFB 3KUHA 2XSJA 5J2QB 4O23A 1C4AA 5F8NA 3K8VA 2LP4A 2MZTA 3ITHA 4LBPA 1R0AB 2DNZA 1X4BA 2BOAA 2HIQA 1JQGA 3ZZTA 1UFLA 3S01A 3DOMA 4KHRA 1VYAA 4ZVRB 1VQNS 4J7CA 1K44A 4OI6A 2YY3A 2XS7A 2XCAA 2HHVA 2NUUG 1N5YB 1S7IA 1S97A 2CQ3A 2OIHA 3H5SA 2OFHX 1AT1B 5KFYA 2MGZA 1VQKS 3MMBA 3WIUA 4F36A 1SQFA 4U8YA 2KXNB 1TL7B 3CJSA 5I3QA 2CQGA 2FZGB 5F3ZA 2IFXA 2GZOA 5IQQA 3CDWA 2HKEA 3TEGA 3CJ3A 4HTJA 4B3MF 4GVLA 1LW2B 2ERRA 2BANA 3HSJA 3MD1A 4PQUA 2P6TA 2RHSB 4DQPA 3QGPA 2DGXA 1JLBA 2NXUA 1WF1A 1YX2A 4DV7J 3VAFA 4DX7A 3C16B 1LNQA 3KLVA 3PW4A 2XYGB 4X4NA 2J8SA 1LW0B 2ROPA 3MMAA 1TL1A 1YZ7A 4TQSA 2DNRA 3J80Y 1Q16B 4ANCA 4Y2CA 3HCXA 1ROFA 5KFKA 3O44A 4DFPA 2I5JA 1ICEB 2NUHA 3D68A 3M8WA 5G0RA 4CNZA 4WZQA 1S1WA 2C3OA 1GMUA 1VRUB 5IT0A 3S8SA 4GC6A 4X4SA 1AROP 4DL7A 2ASDA 2CADA 2MKJA 4YDXA 1FNMA 2VFRA 2YNHA 4LF9J 4ICLA 2EFOA 1PJ7A 1HMVB 2V69A 2OEMA 5I4MA 2WONA 2GQQA 4IR1A 1E6YB 1RYRA 2G4BA 1X5PA 4OJ1A 2R2UA 4DPYA 3D0GE 5C24A 1YZ6A 4XK8C 2ASJA 3QWPA 1EP4B 3DHWC 1S1XB 2ZKUA 1VC6A 4EZ6A 1NK5A 2YPYA 4OJ3A 1VRTB 4DEZA 1U47A 1IWAA 3Q2TC 3N6LA 3OQ2A 2DH7A 1RWUA 1IQZA 4RNOA 2D9OA 4PYDA 9ATCB 5IT9U 3Q0AA 5L9NA 2IIHA 1TL3A 5EGYA 1F3VA 3QYYA 2NYHA 3NBPB 3P5TL 3CD5A 1SV5A 4K4TA 2DIUA 4EMDA 1LXJA 4E2FB 1YIJS 4A8WA 1HNVB 1IR2A 2DNKA 3MF5A 5EX0A 1A6LA 3BH7B 1EHWA 3I31A 1N33F 2MMYA 3EVMA 4J37A 1HNZF 2OPPA 4YHHF 3BBFA 2UVRA 2NYIA 4IQXA 4C7QA 3BYPA 1NSAA 4DV1J 5B0BA 3US5A 4B9TA 1AZSA 4CCHA 4NXNJ 2AT1B 2Z56B 1NU4A 5D4NA 2HQGA 2B9YA 4RL1A 1UETA 3JTPA 2YQ1A 3H25A 3MCSA 5KT3A 2LDIA 2IJFA 5KFHA 1CULA 3NP5A 3B78A 1FRMA 1RHRB 3CCMS 2A2DA 3PYEA 2OTJS 1HI0P 4PPZA 3BGRB 4ZS6A 2RDJA 4NA3A 2EK6A 3OXGA 4DR6F 3M1VA 2CVIA 1VQYA 4MYTA 2KG0A 3M9OB 3SI8A 1R0BG 1YWXA 2M5YA 2ZBPA 4CO0A 4MFBB 4X62F 3P5BP 3L4BC 2DGQA 2XMVA 2E1CA 1K8AT 3PIOQ 4F4WA 1NK0A 3GR1A 3LALA 3DM2B 3KLIB 2UUAJ 1F2GA 1F0XA 3DYAB 1F5CA 1GXUA 3OV7A 4B3TF 4Y2IA 3ZTQA 5A8KB 1EJ7L 4LRFA 3IN5A 3BSAA 3TAMB 3GB0A 3AXKA 5F8IA 1AW0A 4UTGA 4ID5A 2EEYA 2RQMA 4DV0J 3G6YA 1GMVA 3VQSA 1RT5A 1U49A 3RBDA 2W9CA 2V1SA 3DRSA 1YJTA 3IA0A 4NZ7A 2O5DA 1NJIT 5E5NA 4LRCA 2H9ZA 3M4XA 3RAXA 3OJSA 4ES3A 2ZBIA 1RT2A 3KTQA 1IKYA 2N3LA 2VV5A 2HWHA 3PXGa 4QIWD 4DPUA 5GVQA 2ZH8A 2M4MA 3B4MA 1ZA1B 3AY0A 4OQJA 3HKZD 4QR2A 5KAKA 2H65B 3IAM9 4Y00A 5E33A 5M2RA 2KT3A 1T05A 4ZCKA 2C2KB 2BABA 2HEKA 4Y65A 2OAUA 4WE1B 2L9NA 3QIPA 2W9BB 3SCIE 1WORA 4KY3A 2KJWA 3FC9A 2F8HA 5F8MA 2BW2A 4KGXB 3MEDA 3K5PA 3M8QB 2R2TA 4DSJA 1FDNA 1CBKA 2XSJB 4CZCA 1X4AA 2MDAA 4K4VA 1RACB 3FQKA 1YVFA 2OEKA 1RLDA 3MMJA 1UA1A 1PO6A 3HP6A 1Q7LB 2AYMA 2VKZG 4GKKF 2VQFF 3BV8A 4ECUA 3GJSB 4KYZA 4JV2A 5L1LA 2R8JA 1HFEL 4KC5A 4LFBJ 1ZPVA 1XN9A 2KFZA 4PG4A 2XMJA 2CKWA 3M9MB 2MGZB 4ECSA 2CA9A 3IR6B 1TL5A 2JEGA 2UZAA 2YWWA 1TVRA 2Z2MA 4Y2AA 4OX7A 2O67A 2Y1LB 1NPRA 4IH5A 1GEHA 2IVFB 1ULRA 1IBLF 3R97A 3E01B 5B0EA 1FEEA 2HQFA 5F9NA 1RT6B 4K0KJ 4FBTA 4JV0A 2PE8A 2YNGA 3NGSA 2Y0BB 2WBRA 1XWLA 4J9KA 3CCQS 1YRXA 3W3SA 1MLAA 2GHVC 3PHEA 1JLBB 1F9EB 1FWKA 2ZM6J 3D9BA 2DK2A 2ZNZA 1JJHA 4C2MA 3Q8PB 5GAHU 2GMHA 1VS3A 2ZNYA 2VZ9A 3MMAB 3T1YF 1VQ7S 3D54A 2K7JA 1LV5A 1N36J 2HHSA 4DUTA 4UF4A 3CCJS 1TQLA 1U1PA 2HRUA 4OZ1A 2R7UA 1UVIA 2Q43A 4DR5F 4ZVTB 2IPOB 2EC2A 3KJFB 2MTLA 2E5LJ 3CJKB 2A0FB 2I5JB 1RHUB 1EQ0A 3U1LA 4NA2A 5G0RB 1XK8A 1NZAA 1S1WB 1LXNA 1CQMA 3UN3A 2D3OR 4I68A 3PO5A 3NOGA 1TMJA 4IDKA 2HURA 2YNHB 3OL7A 3RAMA 4DUYJ 4ILRA 4CT8A 4YB5A 4NX9A 2HHXA 1R31A 2PT0A 2QA4G 3FDSA 1FXDA 2J5AA 2I8EA 1WEZA 2YWGA 3EMTA 2W4CA 2DNYA 4MKYA 4D3GA 3K59A 4QU6A 3OTBA 1RSCA 2B7BB 2QYGA 4JI0F 2DGTA 3I5AA 4JI6J 3H59A 3GYGA 5KFXA 2HRTA 4LF4J 2R3VA 4QR1A 3DDKA 2I38A 4DU8A 1F2HA 1SUQB 4R0JA 4ZVUB 1RADB 2XMWA 4RU2A 3V4MA 4WFBQ 3WHIA 3ZZYA 3P6YC 3A8KA 1TL3B 2ZBRA 2NXEA 1SH3A 1Y3JA 5KFEA 3KHRA 1TKXA 2LXFA 8AT1B 4KB7A 1J5OA 1SV5B 2VASA 1RWMB 1YJVA 2DNPA 5HP1B 2BE2A 3N5BA 3GFZA 3B4DA 4DV6J 5EN1A 1XERA 3GG1A 1HPZA 3SCJE 4F3MA 2BJ3A 2OPPB 2ATCB 1N32J 3MI7X 3LWMA 5CCMA 4ZP7A 1WOSA 2HWTA 3OTOF 4ZCIA 1KNZA 2C28A 2HK2A 3PYGA 2H4YB 3KWMA 2CQCA 1J27A 3FFIA 2HAIA 3GIIA 2OKQA 4P71A 2XSFA 5KT5A 4M1KA 1TU0B 3SBMA 3O6QA 1UFKA 3SQGA 5DLGA 5FLXU 5ETQA 3JSBA 3ENQA 3PKMA 4IH7A 3HFKA 2IM3A 5JVHQ 2WOMA 2EI5A 1RCOB 2XM3A 1MMNA 2O1PA 1X9SA 3DRRA 1TTHB 2Q1LA 4JI3F 2GCFA 4Q2MA 2RE1A 3I6PA 2IHR1 1TAQA 4AYBD 4RUAA 2XY6A 1UUJA 1WHXA 1JXLA 1PIEA 4AXJA 2KO1A 3X3UA 4TKTA 1Y00A 3G82A 3KMQA 5KT6A 2FC9A 2R4FA 3DLLQ 3CNQP 5DDQC 2CPXA 1YJRA 5EDWA 1RT3A 2LYVA 2J9EA 1VHFA 2VDIA 5J1PA 4P6QA 4CNYA 1V3SA 2ZJQQ 1NKCA 4B3OA 1X4EA 2ZVSA 4ENOA 3PJ9A 2W2QP 2X1FA 1K1QA 3MAAA 4ID5B 3NS5A 4ALZA 1JLQA 1HWKA 1KRPA 2RF2A 3ENWA 4Y2MA 4OYOA 5F8LA 2OUGA 3OSPA 2W9CB 4NOHA 5CD4H 3MM5B 2D1CA 2RRNA 1WD6A 3DI6A 4K8RA 3RB6A 2LXIA 2HFVA 2DH8A 1A9NB 5AT1B 2KRBA 4RU9A 3WX8A 1J5EF 2Q6CA 5LSRA 2V2VA 4WKRA 4NEYA 3CJ8A 2HBQB 4LMZA 3C46A 1RT2B 4A8SA 3LWLA 2K7KA 2NZCA 4OX8A 1IKWB 2IC3A 2MQOA 3PNIA 2RJZA 5DM6Q 4Y3CA 3K0JA 1RBOB 1YG0A 1L3SA 3BO4A 1IKXA 2F4VJ 4OZ0A 3NCRA 2MQLA 4A8XA 3R2DJ 2FGCA 3ILIA 1UWBA 3QNWB 1WDDA 1SCJB 1GXLA 2DNHA 3H20A 3HHEA 4TYAA 4NCGA 5LSLA 3QIDA 2YBVA 3QIPB 3THTA 3ISZA 3M8RA 2C22A 4IG0A 1MWZA 1N0UA 1KDNA 5C5JA 3RRKA 3MEDB 1G2EA 5DG9A 2W25A 2XYHB 2HHUA 2J0SD 3KLHA 1EAYC 4OJHA 2V0NA 4ZVPB 3DOLB 4U6PA 4ED1A 5C2GA 3CB4A 3OPKA 2B9XA 2B6AA 3G2XA 4DLEA 5KT2A 3HZGA 2JEJA 3FMBA 1JIHA 2HFOA 5KFGA 3TWZA 4J9SA 4DFKA 5AJ3J 2J0WA 2HBRB 3D3CJ 3ZO7A 3P45B 5D0EA 1SJ1A 4C0BA 5B08A 3CE8A 4HI2A 5HMWA 3WZ0A 1O5JA 3JQKA 1PJ6A 4JI5J 2CDQA 2Q66A 3FKBA 2VJUA 4PPDA 1K47A 4MKBA 4S0MA 1KONA 1WC1A 1JMTA 1RU1A 1CLFA 4JI4J 1Y5IB 1WG5A 1TELA 4K5SA 2CPIA 5DRKA 2QLWA 3FQLA 2Y9HA 5KFOA 3UPFA 5H9EK 4HTIA 2XY5A 1RAOA 3BYRA 4UOCA 4ZPDA 2YNGB 4YP3A 2RU9A 4B17A 4LR8A 3OVAA 3NGUA 4JYAF 1WEYA 1ZOTA 3NRBA 1C0UB 4DR4J 5KG1A 2H1YA 1MN7A 4C8YA 4Q45A 4H4OA 4O0IA 5HMZA 2RVJA 3GJQB 2V4QA 1YLXA 5CCLA 3NCPA 2CQIA 3Q8YA 4DUZF 3E2EA 4P7VA 2QMXA 4RWWA 3I0RB 3TUPA 5D4OA 2BJ7A 1WI6A 3UCUP 4KJIA 4LSNA 3ENVA 3JQJA 3MMCB 2MLXA 4OZNA 3HSGA 3T1HF 4O3QA 3DGPB 2GS8A 5CAAA 3P8BB 5ETPA 3M9NB 2CQDA 2AZ3A 2FVCA 2VBYA 3AQOA 2B8PA 5LMUF 3K5NA 4CLWA 4ZPBA 1FDBA 4DV2J 1FXRA 1ZS6A 2XMMA 1PCAA 4C97A 3J80U 3M8YA 3BBBA 4P10A 3MXHP 1YBTA 3DU5A 3ZNJ1 3HHKA 2KZMA 1LK7A 2JH3A 1SL1A 3GFYA 4MIWA 3J7ZT 2UXDJ 2XGQA 3TX0A 3LTOA 1RT1A 2EG2A 5KTQA 4ZK7M 4FNIA 5KFWA 1RAJA 4KTQA 1TL4A 1RCXB 2HLUA 5E3PA 2MKCA 2FVPA 1WDTA 1IBMF 1H3DA 2PGCA 2JDJA 2ZWPA 5DETA 2NCKL 4KPCA 2XYPB 4N41A 1OSDA 2XHCA 4P2MA 5EWEA 4UUXA 2X1BA 4TY9A 3V4IA 1B7YB 4QWCA 2W01A 3LPYA 1NM2A 2ZH2A 1TKTA 3ZTSA 3CIZA 2BE2B 5BYRA 2DRBA 3UCZP 1HQUB 4O3NA 5BYQA 3J7YI 4MH8A 5GAGI 3O1LA 4DL6A 2W1BA 1QDUB 5ETOA 1WHYA 2V50A 4ZJQA 1REVA 4M94A 4UZBA 2VIHA 3UNYA 3N6NA 4H4KA 3FFIB 2H5IB 2FJWA 2VBXA 2Y1IA 3EXYA 4ZIWA 4KGZB 1HWIA 2PMWA 1FTCA 4NXMF 3HSZA 4NASA 3SQGB 2B4UA 2IM0A 3M05A 3V6JA 2GO9A 3MM9B 1XBWA 3DOKA 1ZZFA 4GMKA 4X4PA 3PW5A 1AA1B 4UUWA 4ZPAA 2DD8S 4J90A 1P8GA 2WOMB 3A4TA 1FD2A 2H3EB 4X64J 5AXKA 5ETLA 2VOPA 3DRRB 2UVWA 2AIRB 2PFDA 4DR3J 1T94A 5GAEU 3LP0A 2DEIA 1M1GA 3RRHA 1F5AA 2F65A 2J6UA 2QL9B 3Q22A 4WF9Q 2JHEA 1Q8BA 4B9VA 2EKNA 4CM2A 1FWLA 1VCTA 3SEOA 1FERA 2VPWB 4RW6A 5IC4B 1ZH5A 3P49B 4C48A 4FS2A 2XTDA 5KFZA 3LGMA 1VOMA 2F9DA 3G8TA 3T5KA 4B3OB 3HX9A 2GQ2A 4UZCA 1P1TA 2V8PA 1KFDA 2IRUA 2RF2B 1FHTA 3MWBA 1XMQF 2HIYA 1CPZA 2V4JB 1PYTA 1HQEB 3I82A 5J2NA 3ILLA 1HI8A 1KD1T 3DI6B 3GP9A 1R8BA 2ZC4A 4USWA 2R2RA 3LA0A 2XTJP 4V19J 5BJRA 1UP1A 5LMNF 1SJQA 2ZFHA 1SIZA 2CFXA 2XZWA 2W2NP 3D1QA 4HHHA 1HD0A 1TUWA 3RBEA 2IBKA 2E7VA 2QN6B 2CQPA 2OPQA 1X4FA 3GZ7A 2LU2A 1RHMB 3A8EA 1TK8A 4WFAQ 3AA9A 4C11B 2HGNA 1SKUB 1IWGA 5B0GA 5CQGA 2WHOA 4RJVA 2KU7A 2G1HA 2XWYA 1YBUA 4HVZA 2HNDA 5KFTA 2EXUA 5B0FA 1UWBB 1IQTA 3RW7A 3HHLC 4WIIA 4M5JA 4IUFA 4DR7F 2ZZTA 4KKOA 3MR7A 3TAPA 3BGFA 1DLOB 2U1AA 1VJQA 3SZ2A 1LWEA 2HNZA 1RKIA 3AB4B 1RWPB 3VTIA 2P9EA 2CZ9A 5DZ7A 4R5PA 2B6AB 1HYSB 3EZOA 3T41A 1SL2A 1FXLA 1DAXA 2HRYA 2LMIA 4B08A 1S48A 2MKHA 4B9MA 5A6PA 4O3PA 1SJ3P 3I4HX 1RWNB 1S10A 3IWLA 2HGMA 2PI4A 4QWBA 1R6YA 3DCAA 1VDHA 3VQTA 1M5KC 2L41A 3KOAA 2OLWA 2KYZA 4OMFG 4QWDA 3G71S 2JC0A 4PR6A 3BO3A 2P8IA 2ZOMA 1BUXA 3LF0A 3DDNA 3TYTA 5ETMA 3JSMA 2VL1A 5H9EJ 1RAFB 2J7UA 2UV8G 1M5HA 4OZ5A 5HAOA 3HVRA 1WC4A 1QUPA 2XLJA 4QU7A 1S0OA 4GO5X 3TJ9A 5K8MA 2YNIB 3DLBA 2DO4A 4H4OB 2UXCJ 1QAIA 4MTPA 1VQPS 2AGOA 2N7CA 4X4RA 2W7OA 3W5XA 3NGDA 4NLUA 1VK8A 1KQGB 3H4BA 2FVSA 4QPTA 3ILOA 2ZDPA 2HS3A 3FGVA 3MCMA 3MCOA 4I1TA 4KAIA 1TKZA 4LSNB 1AB8A 2RQCA 4I64A 3M2UA 3R7SB 3W9JA 3PACA 4DF4A 1FA0A 2N82B 4OHYA 1F1BB 2DHXA 1C2PA 3MTJA 3SSQA 1BE4A 1OY9A 5K5MA 1VRQC 4FDFA 2AX0A 2DNQA 5RUBA 2FYXA 4MT1A 1FVSA 4PG8A 4EBDA 3D67A 3S7RA 3LO3A 1ZTTA 1DRZA 2Z4PA 3G9CA 2I0XA 2KZZA 1YDLA 2ROGA 2ZH1A 2YTCA 4HKQA 4I7FB 3OR1A 1RT1B 5L46A 1U6FA 2FGOA 3H98A 3GR0A 4EI2A 4K4WA 2HFUA 2XTEA 3K7RA 2KXHA 4YY3J 4WJBA 1Z2LA 1RT7B 4ZLJA 3SQOP 4IRKA 1AFJA 1VK3A 3NGRA 4FP9A 3V4IB 2R8HA 2BJ9A 3CDAA 1TKTB 1KLMB 2DY1A 1T9XA 2AMCB 4ED0A 2Z0GA 3OTCA 5I3UB 3RYLA 4YOEA 1A7GE 2OPSA 4QW8A 4HH0A 4LFCF 7FDRA 4WTYA 5HLFA 3IS9A 4EO8A 1BWVA 4E98A 2O01C 1P27B 3MD3A 4NA1A 2GW8A 1KVJA 4Z2XA 1FT8A 3DMJA 1L5UA 2V8VA 3KLFA 4EZ9A 3BR8A 2K3IA 3GMGA 1IKVB 1ZTWA 5F8GA 3IRWP 2DGWA 3KDOA 3AX3A 5MAOA 1N5TA 1HKAA 1OY6A 5KFCA 3R2CJ 3BSCA 1SJRA 4DPOA 3C6TA 2V5HG 3DOKB 2QLBB 2WTFA 1I51B 2IYGA 2DR6A 1CC8A 2ZH4A 2ZBCA 2NZ4A 3EM1A 1VC5A 4KGMA 1M5PC 2Y3YA 4P74A 4QWEA 1S9GA 3TNVA 3PFEA 1V5VA 3THPA 4NZ6A 5AXLA 4ES1A 2HSEB 1QLNA 3LP0B 2X1AA 8ATCB 2XLIA 2ZVIA 4JV5F 4LQ9A 1F9HA 5DG8A 1H72C 3OJUA 3GIKA 5HBMB 2MSTA 1ELOA 2DITA 3RB4A 1KEKA 1PKUA 4RW6B 5DDRC 3HDSA 4M5HA 3PKYA 3VCDA 1D8YA 4ILMA 3AODA 5HSPA 1JKHB 1WJ9A 1ZM9A 1HW8A 3KK3B 1Y10A 1U1LA 3KFWX 3QO9A 3J7Z5 1B7FA 2I1RA 2DR5A 1PBAA 2BV3A 1S1UA 2UUBJ 2M9KA 5J2NB 3QJPA 4NWBA 1XNRJ 2EFNA 5T7LB 3D6HB 1Q78A 3AT1B 3GSDA 3FRZA 3C6UA 3RU0A 1SL0A 4ZVQB 3KG4A 2HHWA 1YRTA 4ELVA 2D9PA 2RUGA 4X65J 4C3MA 4EYHB 3JSYA 1XMOJ 3K89A 2OPQB 3TA0A 1YJNS 4YMEA 4H54A 3TVYA 4DQSA 4ZN3A 1Q0NA 1U25A 3MUVP 2VD3A 2Y1RI 4OYXA 2B4PA 1XEZA 4C8ZA 5LM7E 2DISA 3J81j 5D8HB 1QSSA 2DNGA 3TZYA 4HACA 4ILLA 4GC7A 2HHTA 2C2RA 3VZIA 1B4SA 2B43A 4OLPA 4CLPA 5KG7A 3VAKA 2IVYA 3NOCA 1I3OB 2B5JA 4KKOB 1UEUA 2IJRA 3WBZA 4OYIA 3IWNC 2UUCF 1NSKL 2HNZB 3AOBA 2V34A 3BB5A 1KVIA 5DO2A 3VGTA 4R5PB 4V19X 4GVBB 2C2MB 1CG2A 3R5JB 4DR4F 3JSRA 2VG5A 2XCPA 2CUYA 3Q2SC 3OTDA 2VQEF 1SXLA 1HNXF 4F0MA 2W7PA 2KDOA 3RBXA 2MZRA 2MZ1A 1DQAA 3OR2A 3PX0A 2MY8A 2N4DA 3V81A 2Z8QA 1LOUA 2NLWA 1N34F 1YRUA 5GMDA 1JXEA 3PHTA 2HHHJ 3B6BA 2M7SA 1DTQA 2UXBF 1HW9A 1N52B 3RAQA 1KOOA 2A18A 2GFFA 1D8ZA 3QATA 2R9LA 2JEFA 1M90T 1O0PA 2LVWA 3OL9A 3W1YC 1C1CB 2EWHA 2HS0A 4ETZA 3JSMB 1RTIA 2AP6A 4NLYA 2JX2A 3OLAA 3KLGB 2BKOA 3BQ1A 3WC0A 4NRTA 3TEHB 3ZTOA 1FJGF 2MZSA 9RUBA 1RT4B 2NR0A 3UD4P 4B9SA 3ELHA 4LF7J 1X4DA 5M2UA 1HBMB 4HEA9 5HL7Q 5F9LA 1N5SA 4KPYA 3PTWA 4ZN1A 5E3QA 1VQSA 4JI8F 4C8KA 3DNCA 4X4UA 4IFVB 2BJ1A 2XGPA 3W5YA 1Q4RA 4DG1B 1KKHA 1U8WA 1M0SA 4N77A 2EFVA 2LEPA 2W4PA 1X0FA 2XULA 2GGPB 3H2UB 4BWMA 2OJ3A 2OTLS 2CNLB 3DRPB 4O44B 2BEFA 1RA7A 2N3OA 2QEXS 5K8PA 2E5GA 3HK2A 3KJQB 4URGA 3BQ2A 3H42A 1FFGB 4IRCA 1OYDA 4ED3A 2MB0B 1ZM4A 3R9LA 4ANDA 1DTTA 1S1VA 4IR9A 4XDDA 3K5MA 4J9QA 2CNOB 1XQIA 1PYSB 2FJBB 1VJWA 4G1QA 3ZXWA 4YR0A 3W2VB 2D7SA 4X4TA 3DXSX 1U2RA 3R6GB 2W2MP 3JS9A 3P3DA 4AQYJ 1EIYB 2V63A 4I69A 3MFIA 5CZXA 4RW4B 1TV6A 4USVA 3PW0A 4PXBA 3A13A 1FKOA 3KLEA 3R1LA 1SH0A 5DQGA 2E5HA 1VMBA 2AQ4A 2E1MC 1SC1B 2ZEJA 2FJDB 3D3BJ 2FB0A 1SJFA 1NHUA 2BQRA 4H4MA 1L3TA 1FNOA 3U1MA 3QGIA 4FYXB 1U48A 4JI7F 2HVDA 2JJ4D 2KYXA 5KFPA 3DLJA 4URQU 2OPSB 2F8EX 3B82A 4ERDA 4MKAA 5HLFB 4CLFA 4TXSA 4OX6A 1R89A 6AT1B 1VQ9S 2RU3A 3J81Y 4RW7A 2NXJA 1L3UA 2OD6A 3HPOA 4LF5F 1D9DA 1XMBA 1GMWA 1T11A 4C4WA 1CJKA 2V4RA 5D77A 2DB1A 2MSSA 4B3SJ 5IM0B 2HZVA 3PX6A 2C3UA 4QIEA 4GKJF 4ETXA 3C6TB 3FBBA 1HNWJ 5D0RA 4RBUA 2LFVA 1PGZA 2VF3A 3IAS9 2XZDB 2YQ3A 3G87A 3AX5A 2CQ2A 1JLGA 5CYJA 1MNEA 4LIRA 3CDBA 3PY8A 3GQCA 4C8MA 4OYWA 4X84A 1S9GB 1KVKA 3LPEA 1HWJA 1S72S 1DURA 3I9ZA 3W9HA 3CULA 4DV3J 1CJVA 3H90A 4JI1J 5A0YA 1ACMB 3QT5A 3LGHA 1U0SA 2AYEA 4BDPA 2B56A 2DR7A 2K06A 4J91A 4RW9B 5SZTA 3OHBA 3P4UB 4WZMA 1VLYA 3R5GA 2UU9J 2YKOA 3G8QA 2HHQA 1IVZA 1XIQA 4WBFA 1B0VA 4QWAA 2VFSA 2FHJD 2WRMA 4DZ6A 2EKYA 1Y7PA 3QO9B 1XR5A 2UUTA 2ZDOA 2CNNB 5JUMA 5F41A 4M5LA 3HMJG 2BE9B 3MEEA 4RNFA 1FRHA 4Y2KA 3GSIA 2Y1JA 2QV6A 2RIJA 4DR2F 3PM9A 4DSFA 3GONA 1GAOA 4ZVOB 2XG8A 3BN7A 2ZE2A 1KTVA 1T9VA 3C6UB 2FLPA 3CTRA 4A8OA 2P9GA 2AJ2A 1BQMB 4LR9A 1C0TA 3KHGA 2DRDA 4IO1A 1DJ0A 2IBOA 1LWCA 3MDFA 2F4FA 4B3RJ 3FBCA 3CJ0A 2PIIA 3R1HA 2R2SA 4UW2A 4QCLA 4P7TA 2YKMA 4OX9J 4ZP8A 1PG5B 5DLFA 3BKTA 1KHWA 4Z37A 3SV3A 2QG9B 2E1PA 5BR8J 2CXEA 4ITSA 1U6BA 3NG8A 1D1UA 2GVZA 1NUEA 4LF6F 1V9OA 1QD1A 3QT8A 5LSOA 1YHQS 1ZAXA 4IRDA 4ZHRA 2KT2A 2YX1A 2RH3A 2MZQA 3ET6A 2BJ8A 3ZZPA 4PEOA 4M63A 2AU0A 4I6AA 4FBUA 2CQBA 3IP0A 2BXJA 1DZ5A 3LP2A 4DPTA 1HHTP 4UY85 2AJQA 5F0WA 4PWUA 1S59A 1RAAB 4ZVEA 1VQ4S 3H5XA 1IJEB 1S49A 3AHPA 1FDAA 3W61A 5HATA 4KV8A 5CD4A 1N6QA 4B02A 2B9EA 1NEEA 2BM0A 5KFIA 5B7WA 1T0TV 1ZAWA 3HHLA 4FNHA 3A8IA 3OR2B 4IFYB 2IMOA 2H5EA 2M2BA 3I55S 4WFYA 3V81B 4QR0A 1FF2A 2AYGA 2QC3A 2GC8A 1WSVA 5GAHI 2PDAA 2KHDA 3FUYA 4RUHA 1R6VA 4CT9A 1UVKA 2CIMA 1H73A 1D0EA 2ZUGA 4D3HA 1FRKA 2HG4A 4BBYA 3G6VA 2ZD1B 3U02A 1X5SA 4R25A 2ALYB 4FF3A 3KG1A 4F26A 3SCLE 3CJ5A 4F04B 4DL0C 1NPPA 1RTIB 3DKDA 5F3TA 2GIQA 2JSXA 3TUIC 4ELTA 2DKOB 2FJAB 4PXEA 2HVZA 1GTEA 2XTCA 3T9NA 2IDEA 1EKSA 1QVGR 4G6VB 1HBNA 1WEXA 3T19A 5L38A 4R8UA 4B3MJ 2A6OA 4HYKA 2VFUA 4F0KA 1S1TA 1Y9OA 2ZBQA 3F44A 4L3NA 4LRDA 3PRBA 4AXIA 2VG6A 4OZJA 5CHCB 4ZLNA 5HQ8A 3D6MB 3UD5A 2ZH9A 4LFAF 1VBXA 4ELUA 4CTAA 1DY3A 2WSEC 2F40A 1N5VA 3IWXA 2FJXA 1U2CA 3VR1A 1BMQB 3DLGA 3GV5B 1UVJA 2J6TA 3QLHA 1REGX 2F8MA 3FK4A 1JWWA 1VBZA 3EZUA 4CDIA 4NI2A 3C19A 4CH0S 4WXWA 4MMOA 2HNYA 3BDPA 3UVJA 1Q81T 1S1VB 2G2YA 4QYZJ 4I67A 2FLNA 4F4AA 2DTJA 5DGBA 3KUGA 2NQPA 2L9WA 3FCWA 4C0HA 1PAEX 4G1QB 2CWKA 4C8OA 4CLTA 2C3YA 4FVCA 4USMA 3CJ4A 1NZ8A 4EK2A 2CG8A 5LXYA 2P9CA 4IOCQ 3K57A 5KFVA 1JLFA 4H4KC 2IY5B 4WP9A 4DQIA 2IDLA 4LRBA 4X4OA 4KO0B 4UQGA 2QLJB 5LL6d 3AAWB 5L8RC 1S6UA 4KQZA 1TV6B 4RWXA 3L09A 4KH1B 5L9XA 3CCZA 2PEHA 1FKOB 3KLEB 2E5JA 2R7WA 2HVEA 3CF5Q 4Q8FA 1DHMA 3ISND 1Z1ZA 1JLCB 4H4MB 3L7UA 4Q7AA 3IGVA 1FD8A 1H0HB 1H38A 2YH1A 3R6LB 2AJ0A 4LBIA 2B3TB 4BCAA 3OUYA 1RISA 3HD1A 5D0GA 1QSYA 2BKNA 4KGVB 3BGUA 4WU2A 1FI4A 4RW7B 3QRQA 5CA5A 2UVUA 4Q44A 3H40A 1DARA 3TZXA 5KFJA 5CH7B 3FRYA 2DT9A 2JL9A 1U4BA 4NMLA 3R5AA 1C1BB 3OSNA 3T6BA 2ZH7A 4DU7A 2BACA 4WIQA 1N33J 2UV8A 1HNZJ 2CYYA 4YHHJ 3MM7A 4J9NA 3TJAA 5DDPC 1FFSB 3VHQA 3HF5A 3D7SB 2VA2A 3OFHA 2OGUA 2IJNA 1Q53A 1DBDA 4CYUA 4AL6A 2FZKB 3V6DA 4QIFA 2HZAA 5DQHA 1RHQB 4LJMA 4K2JA 3PW7A 2EK1A 2YPZA 1UJ5A 4FF2A 2M88A 1VIXA 5DDOC 4AD6A 5L1KA 2CQ0A 1XNQF 2ZWOA 4AUKA 2DNNA 4LSZB 4DV4F 2V1TA 1X31C 4J9RA 2E9RX 4XIUA 3C14B 2LQ8A 2K1RB 3T1AA 2B51A 2QA2A 2G9OA 1R43A 2VFVA 4DR6J 3D1OA 3DLEB 4I6WA 2MPUA 2V2KA 5LOQA 2QT7A 3MURP 1BQNA 1LEOA 2PC6A 1JB0C 2HFSA 2E7WA 4F25A 2WCXA 1MU2B 2LECA 3KK2B 4X62J 4DCPB 1NJXA 4P9SA 4WWSA 3QSYB 5CYMA 2U2FA 1VLOA 4CH1A 3MEEB 5HVHA 3NWGA 2IAJA 4CWBA 2XNQA 2Z30B 2ZE2B 3M2VA 4DPXA 3MECB 1W26A 5LT5A 5K20B 4B3TJ 4YFUA 1AYEA 4FS1A 1C0TB 2XZTB 3I5CA 4JI2F 5D0HA 1SKWA 1H2TZ 3IBFB 1WC5A 2HFZA 3AOAA 2FDNA 4KHMA 1C4CA 1GH8A 4TN2A 4ED8A 1YGYA 4RUCA 2YKMB 2CJ9A 1NJZA 4YEAA 1SBRA 3Q24A 5KFLA 3MEGB 2QFIA 3OXFA 3CO0P 1K0VA 2GVZB 2KHCA 2FJEB 2BRKA 1BY9A 4WTOB 1LWFA 4OI4A 2R7SA 4CLUA 5J2QA 4ZHRB 4KSEB 3HZEA 1YJ7A 2VA3A 4DL3A 3AWRA 3PJXA 1B64A 5F8HA 1RTJA 5ETTA 4LF8F 4PG5A 1U09A 2HLTA 1BLUA 4O3RA 1R3NA 1WC6A 3IG1A 1UJ4A 4O3OA 1HHSA 4USKA 3CMAS 3ITHB 2FHMA 4YS2A 4UOGA 1RAIB 3GYNA 3W62A 4AT1B 2X1GA 4KHPF 2R7VA 3IRXA 1XR7A 1FCAA 3DOMB 2HBYB 4QJVA 3P96A 2QA1A 3A3PB 3NAIA 4ZDNA 4ID8A 2DNLA 2BW7A 4X66F 5ADZA 1TL7A 4PRFA 3EGWB 1JK9B 1UW4A 5C25A 4Y0FA 3HHLB 2RNEA 4ED5A 4EUVA 2A6MA 2NS1B 3OD2A 3V2UC 3UW1A 5B0DA 2FLLA 4PXCA 5I3PA 3G86A 3OL6A 3MMBB 4NLRA 2BUNA 2IM1A 1UPPA 2HK3A 1OYEA 2CJQA 4I6YA 4FYYB 4YQWA 1X5OA 1FNXH 3C16A 4C9DA 4JP8A 2BANB 2AJFE 3GWCA 2ACMA 4BC9A 4GKKJ 2D41A 4A48A 1HI1A 1R8CA 4PQUB 1Q95G 2VQFJ 2P6SA 4PYAA 1NDLA 4YR2A 3WIVA 1MMLA 1S99A 3PG9A 2Q3PA 1CJTA 2GO8A 3K17A 3NKYA 4IQMA 5HROA 2BKPA 4NMXA 1TL1B 1RTDA 2CJAA 5IOLA 5EWGA 3SDEA 1VRUA 1IXKA 4WKYA 2XZ2A 2NSCA 2ZHOA 1RJJA 1IBLJ 2VODA 2H48B 1S57A 5K14A 2QLXA 4MKVA 3HT3A 3M8SA 4HDGA 4MIBA 4J9OA 2IRYA 2QMWA 4EBEA 1HMVA 1GTHA 2BRLA 4ECXA 4P73A 4R0EA 4CIOA 2MJUA 1E6YA 2AW0A 2G0JA 4G1IA 4NLDA 1UPMB 1I5OB 1FRJA 3JAMY 4ICLB 1WOPA 4CTAB 3TUJC 2VJVA 4L74A 2IYIA 5KT7A 3DLGB 2G13A 2WONB 1HWLA 1HQ2A 2JVRA 3T1YJ 2KH9A 4HHJA 3QLHB 4N56A 3JTNA 5C24B 1OPIA 4M5IA 4L72B 3MM6A 4DR5J 2HNYB 3UVJB 3RTVA 3M2RA 3W2WA 3HJVA 3GCXP 2O3DA 3ZFVA 2RRAA 4KH0B 2HMIA 1TZ0A 1MWQA 3UN5A 3NBPA 1HR0F 2BDPA 2CJBA 4DFJA 2M70A 3FSXA 2HPUA 1VIOA 2IVMA 1CSJA 2XB2D 4DSIA 2RRBA 3N9UC 5D3GA 2HYIB 2KM8C 5HJYA 1JLFB 2DJWA 4GRSA 1WKJA 1GT8A 4FZVA 3Q89A 3HO1A 2CPYA 3KHLA 1HNWF 2HHPA 2FVRA 2W8KA 4ZVHA 5BXIA 3I5BA 3I96A 4A46A 1D9FA 4JI0J 2ZKTA 2AEFA 1G7CB 1JLEA 1Q1KA 4KE5A 4F2SA 3L7PA 3AJDA 5M2PA 1I94F 4NL5A 4YB6A 3CDUA 4OV6A 4JI1F 2KXFA 1X5TA 4DR1F 1VI7A 4NLSA 3OUYB 4Q5VA 3K8WA 1M5SA 2GHPA 1AZSB 4DS4A 2WK4A 3MOJB 4C8NA 4DN0A 4NZ0A 5KT4A 4I2PA 1S0MA 3D0HE 3BGRA 3ZTPA 4UOHA 5GAEI 2ATLA 4F8RA 1RLCL 3KMSA 3QJLA 4EWTA 1CULB 1EX8A 4LIWA 5K8NA 3NNAA 4RW8A 5IFMA 2ZH6A 1IBKF 2C1EB 1HWUA 4DV5F 4UT4A 3PO4A 4MFBA 2ACYA 1NK9A 3D1HA 3MM7B 3M7VA 2DGVA 3MAHA 5MLCV 4RO0A 3M1VB 2RILA 3OTOJ 4BWJA 1NKEA 3PRVA 4I4BA 3ZZOA 3IR5B 3FZ2A 3JTOA 3W8GA 5C42A 2LA4A 1T02A 4OI0A 1KP6A 4CYUB 2HVHA 1O6XA 3EWGA 3DYAA 3V6DB 3J81U 2W8LA 1N88A 5G4DA 1OM2A 4DLGA 3AD9C 1TMMA 5A8KA 3DFEA 3Q8VA 4CO3A 3CGIA 3JB9k 3DC2A 1WSRA 3ZTRA 1NH7A 1NCLA 4K4ZA 3RB0A 4OYMA 4MJKA 3F0NA 1VGYA 1S76D 2IMWP 4ZA1A 4HDHA 3CSKA 3IBWA 2KN4A 1FVQA 3SMZA 3M32A 4RLEA 4USUA 4OYBA 4K2XA 1SJ4P 4QW9A 5IZHA 4PABA 3J7A1 2L3MA 1BQNB 2PMHA 1SIWB 4JI3J 2JLEA 1S6OA 1BWEA 2GAHC 1RT5B 3GG0A 2C2OB 5HVFA 1FKAF 1HBOA 3DRSB 3GV7B 2J7KA 4AL7A 5HQMA 5CYMB 1W2BR 2FY8A 5ETNA 2DHAA 3T3FA 3D2WA 4RX6A 3BSNA 1S6PA 5C7PA 2ZZMA 2IAJB 4X4QA 2GJ2A 1EKRA 3T6JA 3PV8A 2LQ9A 1FRXA 1VFJA 2LEBA 3EGVA 3OTEA 3EXCX 1IKYB 2R8KA 1I6JA 4F4YA 1KFSA 1OIAA 1PAUB 2QJ3A 4L76A 3VALA 2FHOB 2XMTA 5GADU 4JB8B 4O4GA 3X1LB 1YITS 2FC8A 4PAAA 2DCUB 5KFNA 1KWMA 1RXOB 1QTMA 4MAKA 2W9BA 1LKZA 1T05B 1NMEB 2LCWA 1X7VA 1J5EJ 4OHWA 2M52A 5JMNA 2HVIA 4YB7A 1EETA 1S0NA 3R3TA 4O3SA 3GPAA 4U8VA 4NRUA 3OVBA 4DDFA 1RTJB 3QRPA 3PW2A 1U0HA 3TA1A 4MK9A 2CPDA 2VICA 3QGGA 3IG1B 2XS5A 1KR4A 4TQRA 4QQBA 4DV7F 5IT4A 2E7XA 3IMQJ 2KB2A 4YUDA 3SIPB 3EYZA 4LSLA 3PRDA 1S5ZA 3IRXB 3MPDA 4MYUA 5KFDA 1IM6A 3JYTA 2BQUA 3SCKE 4WFZA 4NYOA 2V68A 4W98A 4F3OA 1N56A 4TYBA 3CMES 4HHUA 4U9RA 1PSDA 5C25B 2CNKB 2ILYA 3VGSA 3AQPA 3E01A 3T5LA 1RT6A 1FX2A 3A3OB 2JNJA 3ZZZA 4DCOB 5AE2A 2EPIA 1TVRB 4URSA 2DR8A 2FHKA 2Y0SD 3RZAA 1YBAA 5HVGA 3Q8UA 2MHEA 5B0CA 3OLBA 5IS2A 4KFBA 3CCUS 4NPOA 1AFIA 4DWIA 4LF9F 4IYQA 1Y3KA 3T9ZA 2RKIA 5D4LA 4EO6A 3CCLS 1T9TA 4LR7A 1GX5A 4PCQA 3EUNA 2MQMA 2RD5C 4ED4A 2KKHA 3MAQA 2WVEA 1CJTB 4PWWA 4FXWA 3GIJA 5HROB 3CJKA 4WP3A 3BPDA 1NHKL 1QE1A 1H74A 3W63A 1NHVA 2HBZB 1RTDB 2DNOA 1P9QC 1Y5LB 3SDEB 2RQKA 1SKRA 4U7UK 1VQLS 3NS6A 4RZRA 5K8OA 5K14B 1NNDA 1PC5A 2Y8WA 1UA0A 1QTNB 1FESA 4M5NA 4EFAC 1QM9A 4NLOA 4JYAJ 4IDKB 3EDQB 1URRA 4OI1A 1T8EA 3T5JA 5B0AA 2RMLA 2AEMA 5JVGQ 2QL5B 2PI5A 3VAHA 1Y0HA 2GVDA 4DUZJ 3MM6B 4WU3A 4WYWA 2OHDA 1SUQA 4CO1A 1X4GA 2BMBA 3M2RB 3W2WB 3CD6S 4DV1F 4EBCA 4TU8A 4F3QA 2DNMA 3QGHA 2HMIB 3FBFA 2Q79A 4NXNF 1V5IB 5KG3A 3T1HJ 1AXQA 4FKYA 4QYRA 1KHVA 1S12A 1P1LA 2KI2A 3GU0A 4P75A 2GQCA 5HP1A 5D3GB 2MLYA 4USJC 4G65A 2FZCB 2ZOFA 2DGSA 5JJBA 5LMUJ 1TKXB 3BKUA 3BPSP 3CUNA 1J5OB 1SC3B 3IGNA 3OL8A 3RJMB 1UFWA 2RB7A 1X0PA 2KVQE 4U7CA 1UWAA 2MXYA 1B3TA 2OP5A 5LXRA 1SB6A 4J5OA 1JLEB 4I2QA 3NWRA 2VOOA 1WNEA 2HQDA 3MGJA 2Z2LA 1S4FA 1HPZB 2GAGC 5U47A 2DHGA 4KRWA 1UMJA 3OFFA 4O0NA 4DBQA 3ZNUA 4KR0B 1FK9A 2CQ4A 1Y5NB 2E5IA 1R27B 1U1RA 2CPHA 5B09A 2BA9A 1IBMJ 2CQ1A 4ZJOA 2UUAF 3CC4S 2VONA 2W7AA 3EDRB 4JBCA 4J9MA 4I2PB 2N4CA 3LANA 1Q86T 5SUHA 2JLGA 3TI0A 2J9DE 1RAEB 3BZQA 2JFDA 4RW8B 5KG4A 4DV0F 4ECQA 1WELA 2J9CA 1NLKL 2KRRA 3OVSA 5HO4A 1JJ2R 1Y11A 4CO4A 4ZMMA 2QSWA 3FZBA 4NLQA 5I42A 5C42B 4CM0A 4CLSA 4F02A 1RP5A 2M0GB 3BSOA 1Q5VA 3VAGA 5IC6B 2DHSA 4NXMJ 3G82B 3UQSA 2ADBA 1NSPA 1U24A 1BXNA 2YKNA 4OHXA 2JC1A 1RT3B 3NMAA 3R7BB 4N47A 1KTQA 3H0PA 4DQQA 4NYPA 4ER8A 3M32B 4TVAB 3MM5A 3LAMA 2V8HA 3MAAB 1JLQB 3HVTA 3KUEA 5J1NA 1LFWA 1RWWB 2E1RA 3NLCA 3EJMA 5A2QY 1HBOB 3N28A 1IUJA 4LT6A 1Q8LA 2ALZA 3C8YA 1S6PB 1IKWA 1Y4ZB 4EU0A 4ED7A 5FIIA 3TO8A 2MQNA 2MKYA 4EYIB 1OMSA 3TOQA 5F0UA 4KIAA 1T95A 3EGNA 3CD0A 4ECTA 1H98A 1VQ5S 2HAFA 2IC3B 3MZIA 2NREA 3AB2B 4OLOA 2FTRA 4LUBA 2DYAA 4O4GB 3GE9A 3O3LA 2RS2A 1IKXB 1XMQJ 4LFBF 2QO3A 2R42A 2DXFA 4XPEA 5KOWA 4ECRA 4PUOA 5AXMA 4Y28C 1WC3A 4KT0C 2F5GA 4NCGB 2GA7A 2P2CB 3TZZA 3BKFA 3DOLA 5LMNJ 1EETB 4IG0B 2QLFB 1PILA 4K0KF 4QZVB 2LU1A 1CEZA 2EFQA 3KLHB 1U0HB 5J2MA 3NNCA 3NMRA 1RDRA 1HA1A 3CO9A 4Z7YA 1KS2A 1FE4A 1HLWA 2ZM6F 3MUTP 2XS2A 2R8IA 1R8PA 1W25A 4CO5A 4LSLB 2KG1A 4OI3A 1CQNA 2ZC3A 2AEJA 3JYTB 4V1Ak 5H9FK 2CPJA 4G3IA 1N36F 4ZPVR 2CRLA 5DQIA 1LQ9A 5GMEA 2B0GA 3BGOP 2X7IA 3CMQA 4PG7A 5EHHA 3F41A 4DR7J 2XI3A 4PWDA 2E5LF 1CVJA 3MUMP 3FEXB 3MM8A 3IM8A 4J9PA 1Q5YA 3KDNA 3M30A 2XLKA 1NDPA 4KFBB 3JQMA 3QJJA 4AL5A 2F7VA 1C0UA 3U7JA 4DUYF 4IOAQ 2RKIB 2XO6A 2WW8A 1MG7A 3Q8SB 2FQQB 2EW9A 4LF1A 5HJXA 3PVXA 1NH8A 3UD3P 3TARA 1Z4UA 4RR5A 2DCLA 2YKAA 3I0RA 4EEYA 2I2YA 3KXDA 5L1JA 3OW2R 1QE1B 4JI6F 1EQMA 3L9ZA 4LF4F 5D15A 4J9LA 5CABA 3R5BA 3ZC4A 1APSA 1H6KX 3MMCA 3TQ1A 3VGVA 3DGPA 2Z57B 3M6VA 5K9FA 1F3FA 2JFKA 3ONQA 1NAQA 4LBHA 2EC0A 1KSPA 1RQ0A 3H4DA 3QSIA 3WQPA 4LQ3A 1U2FA 1VR6A 3IM9A 3NY0A 3HT0A 4HR2A 2WVDA 1U02A 1T7PA 1NB2A 4NCBA 4NE9C 2M8DB 5IWAJ 1QJHA 4DV6F 1VHIA 2XEXA 7AT1B 2KT5A 2E1AA 3D6TB 3UWTA 3H5UA 3S1TA 2GVDB 1N32F 1OQ3A 5L1IA 2F9JA 3G4SS 5KFSA 1OPZA 4TU9A 3PX4A 4Q0BA 2BQ3A 4M95A 4NLGA 3KNAA 2PMZD 4RNMA 3N01A 1YTYA 5HI7A 5EUHA 1N54B 5HANA 2XQCA 1K1SA 1RI7A 3C66A 3G6XA 2OPRA 2LLZA 3JAMU 1F9FA 3CPWR 1HQUA 2YX4A 2K2PA 3VF0B 1WHWA 4ZJLA 1S4EA 4IO9Q 3TVZA 2C2DA 1X4HA 5BYSA 2PO4A 3KK1A 4XPCA 1U1OA 5D78A 1SPBP 2VFTA 4OZLA 5HN0A 2OELA 3G8SA 4QOTA 4K4YA 4F4ZA 1QAJA 2MKKA 2K8GA 4I2QB 4N7TA 1WC0A 2FIUA 1FKPA 2D3ZA 1H2VZ 1KOHA 3BF4A 2QZ8A 2XMUA 1G3OA 5KFAA 1RTZA 1FK9B 3D5MA 4C3LA 1REVB 2NPFA 3HVWA 3HVAA 3I0SA 2AV5A 1LK5A 3MM9A 3M8ZA 2C3PA 4DL5A 2CZVC 4ED2A 2R7RA 4DX5A 1X9WA 3OBIA 5IQ6A 1FX4A 3PIPQ 4UOFA 2HQ3A 5ETSA 1B0TA 4W90B 2L9DA 1UW9A 2R7OA 2HQCA 1MROA 4AE5A 2VH7A 4LFCJ 4A8MP 1VQ8S 4CO2A 5A8WA 3L7OA 1PBUA 2YWKA 3UO0A 2X3GA 4ECWA 1V3RA 5I42B 2VG7A 2CJKA 4Q8EA 3SXLA 2YKQA 3KHHA 2LKZA 2NSBA 1WG1A 3J7AN 1QAXA 3DLKA 2F63A 3NGTA 1NBEB 4YB1P 2YKNB 4I56A 2I9SA 4PXDA 3FJ2A 1EB0A 5CZVA 5F8JA 3FCHA 2ASLA 1WG4A 3AFGA 5KOXA 2C42A 5KFBA 2F1FA 1OWXA 3PR5B 2F4VF 4FPIA 2V4JA 1HQEA 5DM7Q 3Q23A 3A8JA 2VBWA 3AD7C 4NLPA 1FWPA 4CLZA 4WYLA 1F6TA 2DHHA 1VQMS 4FVMA 3HVTB 3OFEA 1FDDA 2J7WA 1MWYA 3D4JA 1ZM2A 5E7OB 3N5FA 4JV5J 3IO1A 5IV3A 3NCQA 2CJXB 4K4SA 1SH2A 3NEKA 3CCTA 1URNA 1BHNA 4W92B 4C11A 4DCJB 3W60A 2EBGA 5E3CA 4DI6A 4ZKAA 1RKJA 3SSRA 5AJ3F 1I1GA 2BBEA 4YDDB 3CDEA 3C15A 4A47A 4HL9A 1GFWB 1IN0A 2V8DA 2GHWA 2HNDB 2PA3A 1X60A 3W9IA 3GJTB 3CEDA 3BM7A 4PUOB 2BOPA 4JI5F 2MEWA 4XO0A 4P2FA 5HMXA 3TZWA 1G6BA 4NLVA 2HW3A 1KN6A 1DLOA 3UDLA 3QFWA 4FYDA 1PYOB 2H51B 3G96A 3PDNA 2V8GA 4XAKA 3ADAC 4F2RA 4JI4F 1ZA2B 2MQ8A 2LQJA 2AGPA 1HYSA 2QE5A 4CLYA 1WUUA 3DDIA 1WF0A 4DSEA 4DSLA 1LWEB 2WSFC 3V5RA 1GXTA 5J2MB 5AXNA 3QBCA 4OV1A 2WVFA 7FD1A 3POTA 1LFPA 1FTRA 3CJQA 3H7HB 5H9FJ 3V6KA 1JLAA 1UJ6A 1X9MA 1NB7A 2BVZA 3VAJA 1L3VA 2ZUAA 3O8WA 5EWFA 3BR9A 4C0OC 1G4CA 2JZ5A 4KGKA 2YNFA 2J0QD 4RKUC 4PWDB 3LH2S 4P2XA 4WK1A 4DFMA 2GMLA 3MM8B 2M8HA 3R27A 4CI0B 2B8QA 2XI2A 2UUCJ 3GFHA 2ZJPQ 4ECVA 3LP1A 1UZDA 4ECYA 3M30B 3HI9A 2GIFA 5KFUA 2FLOA 2J76E 4P2SA 1VC0A 2RDIA 2ZH3A 4DQRA 4WCEQ 2WVCA 3VAMA 2YNIA 3D66A 4C3KA 4LF2A 1MSWD 2V2QA 2VQEJ 1HNXJ 4NCAA 2OH2A 1NJYA 1N0VC 2W4DA 3IC1A 4DV2F 1MN9A 4B9UA 1TKDA 2KJVA 3BQ0A 1RABB 3ENAA 3MEKA 3EPIA 3BEGB 3NGKA 2AJ4A 2JWNA 1N34J 1ITPA 4CRJA 3KYLA 3S6EA 4WXOA 4DOZA 3ISNC 2UXBJ 1IR1A 2UXDF 2GMJA 2ZITA 3DRYA 2DGUA 3N79A 1RWKB 1M5VC 1WHVA 2JVOA 4OHVA 4DMZA 1GQEA 1KQFB 2VDHA 3MCNA 2AWZA 1TKZB 3T5HA 5H1SV 1QSLA 2JOQA 3LOUA 2LEAA 3EGZA 2RDDA 3TRGA 3M2UB 2PEBA 1FJGJ 3PFOA 3L95X 1M1KT 1P6TA 4UQTA 5DS7A 1NO8A 1V3ZA 4K50A 4DHVA 3W66A 3R7NB 4Y34A 2FUG9 4TY8A 2O66A 2QA4S 2BR0A 2ZHBA 3C3LA 2MKSA 4QYZK 3CCWA 3I87A 3IFEA 4ZP9A 4G1PA 4JI8J 2IA0A 2VPYB 1H7XA 4I7FA 4LREA 5DJBA 3UN2A 3AJ2A 1UVNA 3MR5A 1TAUA 1UL3A 4MK8A 1Q7YT 4Q0BB 1CJUA 2XC9A 2DGOA 3GJRB 1RT7A 3OR1B 3TQEA 3RRGA 1HD1A 1T9YA 2OPRB 2RS8A 3KJNB 4A8KA 1OY8A 4FKXA 1UKUA 2GJFA 1HL6A 2A3JA 1KLMA 1SI9A 1JNRB 1QAYA 3R8YA 1WWHA 2MYFA 1IJFB 5T14A 5I3UA 3SFUA 1ZYQA 1RGVA 3RW6A 2B7CB 2IRXA 2VKRA 3KK1B 3QZ7A 1DQ9A 3NL0A 1T9UA 3HHNB 3NXZA 1RHKB 2HFNA 1VQ6S 1RBLA 4X64F 4F4KA 1KBRA 3GLJA 3QT7A 2ZOGA 2CPFA 3OXLA 4IG3A 3K58A 3CJ2A 2PSZA 1FKPB 4DR3F 1IKVA 5E0OA 3IS9B 1T3OA 2VPZB 3E51A 1N8RT 2EVZA 3V6HA 3CIMA 1PJ5A 4BS2A 3DMJB 1S9FA 2KM8B 1J2VA 3KLFB 2XO7A 1HBUA 2CQHA 3I0SB 2OMLA 3PJWA 4BHQA 3UE2A 4ZLLA 1U1QA 5IXUA 1S6QA 4J9UE 3QPIA 3Q8RB 2OO4A 2MHNA 1HIYA 4C6AA 3LAKA 4K7QA 3D0IE 1UZHA 3M6WA 1NDKA 3K2YA 3CCSS 2CG4A 3FNNA 3PZPA 1MROB 4JI7J 2H5JB 2UUWA 3MFHA 5AE1A 4L75A 2IA6A 2C2EA 4RUBA 4CLLA 4M5DA 1HNIA 1RUSA 2LA6A 5A8WB 3U1NA 3H8YA 2YVSA 5HBMA 4LF5J 5KFQA 3VVUA 2W2PP 2VG7B 1WOOA 3MR2A 2VB6A 2AJ1A 4Z7CA 4ZITA 3N6MA 1NK8A 3W8PA 4DX8H 3DLKB 3VGUA 3KKFA 2CWXA 1QUVA 4WP8A 4GKJJ 1JKHA 3KK3A 2GV1A 2G2OA 4K4XA 2FJVA 3EVOA 1JX4A 1GX6A 5A6WA 3TW0A 2CPZA 3W5ZA 3W65A 4FF4A 4U95A 4I0WA 1U7LA 2V6AA 2ROEA 5T7LA 2AGQA 3GIRA 2X51A 4WPAA 4ZPCA 5JXSA 3R5DA 3H2LA 5DG7A 2L08A 3KG0A 5J2PA 1RZMA 2DEJA 1S1UB 2ILZA 2XY7A 3LUYA 4QPXA 1TP7A 2YX7A 4HT7A 4DSKA 1RK8A 2XMAA 3AA8A 4HI1A 2DVIA 1F60B 4ANEA 2A1BA 4L6V3 4XDCA 1R8AA 3OT9A 2LQ5A 3O5TB 4ZOSA 3I32A 2DIVA 1AUSL 2DBBA 2MY7A 2NXCA 1NJWA 4DJBA 1Q82T 1NDCA 1SC4B 3C15B 2AKWB 6FD1A 1UAWA 4OZ2A 2Z58B 1UEVA 2VU5A 5ETKA 5A2QU 3LW5C 2GIRA 5KFFA 3MPYA 4DR2J 2E9TA 5E2QA 4HACB 4QIGA 1YKWA 3GYXB 4RBVA 1Q79A 4IOBA 2AF6A 3FCVA 4K5RA 4P72A 4OYPA 1E6VA 2A2CA 2D3O1 1DQ8A 3PYDA 4DF8A 3TJ8A 4GVBA 4RNNA 2B5JB 4JV1A 3UCGA 3TX8A 5CYQA 6FDRA 4U7UD 3UDVA 2HQIA 3POTB 1WKKA 3THVA 1SQEA 4N76A 4QBUA 2WB1D 3AD8C 5KG0A 2VG5B 4LF6J 3GTYX 4HT5A 2UXCF 1JLAB 4OFZA 2KFYA 2UVVA 5DGAA 2MKIA 1IBCB 3QMQA 2OD4A 1KQSR 3CVKA 4N8OA 2YQ0A 3AXMA 3CCES 1UVMA 2YNFB 2HWIA 3ETMA 1RWOB 2OSQA 1DTQB 1C1CA 2C2ZB 4OIXA 2QSFA 1VBYA 3CXCR 1DFDA 3LP1B 3KLGA 2YXLA 4TU7A 5E41A 4XTTA 3NNHA 1Q8IA 2MQQA 1RT4A 2KFNA 1L3KA 3OFGA 2BE7D 1HBMA 1X8DA 1GNKA 5IWAF 2G0CA 1VQOS 3HJFA 4M5KA 2DR9A 1BGXT 3H2VE 3PEHA 1WKLA 3ICLA 1FO1A 4W4MA 1RYSA 4AFFA 5THWA 4IFVA 2I6WA 4DG1A 2J9DA 5IT9Y 3RB3A 2B4VA 2GGPA 1S9EA 2BM1A 2LXUA 2YWFA 1SC6A 4PKDB 3DRPA 3HFZB 3CCRS 1BD6A 4O44A 4F7VA 1K0TA 4WFXA 5FDLA 4USHA 3M8PA 4YY3F 3MTKA 3BS9A 2ZH5A 5LJ5Y 2RSQA 3ZZ0A 2ZZNA 1S7HA 4J9VA 2HGLA 3UNGC 3TANA 3NS7B 2OFGX 1YJUA 3I9V9 4HH1A 1FRLA 2AHOB 1W7WA 4TY8B 3C2PA 5FJ4A 3KNGA 1IM4A 3Q83A 2F3JA 3W2VA 3DRXA 2W2OP 4Q2LA 1RTHA 1JNZB 4DL4A 8RUCA 1DTTB 3HSDA 2J8AA 3GILA 1KQKA 1OSCA 5IV4A 2A10A 1HHQA 2QMUB 1RA6A 4MIAA 3A1YG 5ETRA 3UR3C 3HLUA 3MPUB 1CJUB 3BBCA 4ZPTR 1R7IA 3BREA 4RW4A 1S0VA 4LFAJ 4HLBA 4A8QA 4ZCLA 1O51A 2X3DA 3MPWA 4ZPWR 1YSJA 2Z2YB 3DN9A 2R7XA 2YWHA 4NEZA 4TNOA 3UFCX 3MPVA 1ZETA 4PG6A 4F4XA 1T3NA 2QYCA 4EGLA 2V94A 3Q8QB 3IXQA 1UEKA 1CS4A 4FF1A 4FYWB 3QT6A 3GCWP 1N4LA 5HK4A 4O4RA 1NKBA 3AH6A 3DGVA 3CW2C 1NK4A 4IG3B 4ECZA 1UVLA 3PEJA 5T41A 3RR8A 4N5SA 1D3WA 1FFWB 2E44A 3CT9A 4X4VA 2CAJA 3M6UA 5IM0A 4ZCMA 3J7YU 5DZ6A 2FPHX 4UY8T 3AX2A 1HBUB 2AYBA 1XTZA 2NPIA 2YWEA 5GAGU 4FPRA 1CJKB 2HZCA 2MQPA 3CC7S 3NAHA 3UR0A 1S6QB 4RPFA 4M5MA 1W2IA 4NLXA 1WTFA 3A12A 1H2UX 1WI8A 2FHJA 3DXBA 3BGLA 1K73T 5KG6A 1R8HA 2WB4A 1JLGB 3TAQA 5CXTA 3N4WA 3KJVA 4M5DB 2UUBF 1HNIB 1HARA 2JRSA 1FE0A 1OJ4A 5KFRA 1CJVB 3DLHA 1XNRF 2QX0A 2FD2A 1A0OB 4RW9A 5A0YB 2E9ZA 5D6GA 1GMWD 5J1EA 3TR5A 3B8HA 3M6XA 4LRAA 4F0HA
chains in the Genus database with same CATH topology
2YKNA 3OHBA 4OHXA 2JC1A 3UI3A 5J1PA 4P6QA 1RT3B 4X65F 3NMAA 4CNYA 4WZMA 1V3SA 2ZJQQ 1VLYA 1NKCA 4B3OA 1X4EA 2ZVSA 1XMOF 2YKOA 3G8QA 1B0PA 4N47A 2X1FA 2HHQA 3GFXA 1KTQA 1T03A 4DQQA 2N7YA 4NYPA 2J6SA 1K1QA 1YQHA 3QWUA 2BJDA 3NS5A 4ID5B 1OO0B 3M32B 2LDYA 3VZHA 4ALZA 1JLQA 1HWKA 1B0VA 1KRPA 2ABYA 2E66A 2RF2A 5E3RA 4F67A 3ENWA 4Y2MA 5E3AA 3MM5A 3ZZUA 4QWAA 2VFSA 2FHJD 5F8LA 2WRMA 3LAMA 4CQ1A 2EKYA 1Y7PA 2P5VA 2V8HA 3QO9B 2W9CB 3OSPA 1XR5A 2UUTA 1JLQB 3HHDA 3HVTA 2ZDOA 4NOHA 5JUMA 5F41A 5J1NA 1QVFR 1LFWA 3HMJG 5CD4H 3FEYB 3MM5B 2D1CA 2MZJA 3FSIA 2RRNA 4JUZA 2E1RA 1WD6A 3MEEA 3F56A 3NLCA 3DI6A 4QIVA 4RNFA 5A2QY 5GADI 3RB6A 1FRHA 2RQ4A 4Y2KA 1HBOB 2LXIA 3N28A 2Y1JA 2DH8A 1A9NB 1X4CA 2KRBA 4RU9A 1J5EF 3BN4A 2QV6A 2RIJA 2Q6CA 3E8OA 5LSRA 4DR2F 3W7BA 3PM9A 1IUJA 3DU6A 4LT6A 4J9OA 4DSFA 1GAOA 2XG8A 2V9KA 2ZE2A 3BN7A 1KTVA 5J2PB 2E29A 4WKRA 1BQMA 1Q8LA 2ALZA 3C8YA 1S6PB 1IKWA 3C6UB 1Y4ZB 4EU0A 4ED7A 1XR6A 5FIIA 2FLPA 3CTRA 4A8OA 2P9GA 4ATNA 3TO8A 2ZHAA 4LMZA 3C46A 1RT2B 2MQNA 2ZJRQ 4A8SA 4EYIB 3LWLA 2NQPA 1BQMB 2K7KA 5EX3A 1C0TA 3TOQA 3KHGA 1OQ6A 1ZPWX 4OX8A 4IO1A 1IKWB 5F0UA 4Y6IA 1DJ0A 2IC3A 3WX4A 1ZZNA 2MQOA 4B9LA 3PNIA 2RJZA 2GJIA 2IBOA 1LWCA 3MDFA 4KIAA 1T95A 5DM6Q 2VBZA 4Y3CA 3CJ0A 3EGNA 2PIIA 3CD0A 3SYZA 1H98A 4ECTA 3R1HA 1VQ5S 4TLRA 2IC3B 2R2SA 3K0JA 4UW2A 4QCLA 3MZIA 4P7TA 2YKMA 2NREA 1YG0A 3TA2A 1LWCB 3AB2B 1L3SA 3BO4A 4ZP8A 4OLOA 1IKXA 2FTRA 4C8LA 4OZ0A 5A8RA 3NCRA 2APOA 2MQLA 4LUBA 5DLFA 4O4GB 3QAEA 4A8XA 3OHAA 1KHWA 3GE9A 2FGCA 4Z37A 3SV3A 3O3LA 2RS2A 1UWBA 2EFGA 4ITSA 1IKXB 1U6BA 1N5QA 3NG8A 2BJEA 4LFBF 2QO3A 4B9NA 1GXLA 2DNHA 3H20A 1D1UA 1MMDA 3HHEA 4XPEA 4LVOP 5KOWA 4LF6F 4TYAA 1V9OA 4NCGA 5LSLA 3EPGA 4ECRA 4PUOA 5AXMA 4Y28C 3QIDA 5LSOA 4K59A 1YHQS 1ZAXA 4IRDA 2VC0A 2EFPA 4WFNQ 4ZHRA 1JJ4A 2DH9A 2KT2A 3QIPB 3THTA 3TUZC