3OL9A

Poliovirus polymerase elongation complex with 3'-deoxy-ctp
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
molecule keywords Polymerase
total genus 136
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3ol9A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ol9A02
2C28A 4IRKA 2HNZA 5KT2A 1QE1A 1T94A 3MEGA 1RT3A 1VRTB 3CO9A 4RNMA 5DG7A 4ZPCA 3N6LA 1JLGA 5DQGA 3GIMA 4EYIB 3BSNA 2B6AA 2O5DA 3DI6A 4XO0A 3MEEB 5KFDA 4TQRA 5HROA 1RTDA 4IOBA 2F8EX 4J9QA 1RTIB 3UDLA 2CKWA 3DYAB 4RU9A 3QIPA 3I5CA 4O3QA 2YKNA 3QLHA 4G1QA 4RUCA 1T05A 5F8LA 1SUQA 1TVRB 4J9KA 2FVCA 4GC7A 3LP2A 4MKBA 3E01A 4ZPAA 5HLFB 2RF2B 5L1IA 3Q8SB 3Q8QB 1SH3A 5F9LA 1S97A 2YNIB 3ICLA 3I0RA 4RNFA 2HAIA 5DGBA 4R5PA 2W9BA 2AX1A 4PUOA 2V0NA 1HNIB 2AGOA 2W7OA 4K50A 4TY8A 3LP1B 4I7FB 5KG0A 4YQWA 1S1WB 1S9EA 3CJ4A 3BSCA 1KHWA 1RT5B 1RT1B 4ED2A 4IG0A 4F4XA 5KFSA 4TYBA 5KFHA 3I5AA 4ZVFA 3BSOA 1JLFB 1TKZB 1LWFA 3CJ5A 3DRSB 4YMEA 4O3SA 5KFNA 3PW7A 2BRLA 1NNDA 5I42A 1QUVA 3CJ3A 4I2QA 4ZP9A 1S48A 3VQSA 1S6QA 3MR2A 4ECRA 1LW2A 4IRDA 1DTTA 3JYTA 5KG4A 4H4OB 3MECA 3MEDA 1S1VB 3DRRA 5CYMB 4NLWA 3QO9A 3QYYA 5K14A 1MMLA 1RTHA 1HMVA 1TV6A 3GIIA 4NRUA 3DOKB 5KG7A 5CYQB 3DRPB 3FQLA 1TKXA 4ZHRB 4IH5A 1S1UB 3DMJA 5FDLA 3GIKA 4NLYA 4KBIA 1RT6A 1QAIA 3LAKA 1I6JA 2R8HA 3NBPB 4O4RA 1C0TB 4K4UA 4RW8A 3MTKA 4EBDA 2W8KA 3BREA 4RZRA 4HKQA 3NL0A 4PWDA 1RT6B 2VG6B 5HLFA 3OLBA 2V4RA 1JXLA 3DLKB 2ILYA 4DL3A 5KG3A 3ISNC 4EYHB 1REVB 3BGRB 3CWJA 3G6VA 4ECSA 1HMVB 1TP7A 2R8IA 5K14B 2ATLA 5KFEA 2HMIA 4MK7A 1S6PA 3CIZA 1XR6A 2AWZA 5I3UB 3BQ1A 4J9NA 5DQIA 5J2MA 1C0UB 3T5LA 2FVRA 1OS5A 5KFFA 2EC0A 4QWEA 4J9LA 3UQSA 5KFPA 2C2RA 4Y2AA 1JLCA 5C25B 4RW9B 3V6DB 4ECQA 2W9CA 4URGA 1TKTB 4J9SA 4NLOA 3PR4A 5KFKA 3C6UA 5DG8A 1IM4A 1C1CA 1N48A 3PZPA 4LSNA 2C2DA 4IFYA 4RW8B 4RUAA 4Y34A 3OL7A 3OHBA 3RAXA 5D3GB 3C6TA 4ED8A 2UVVA 1IKYB 1RT2B 4KFBA 5HP1A 1HNIA 5KT5A 2XC9A 4IR9A 3CJ0A 1JLAB 1RA7A 3M8PA 5F8JA 2YNFB 4WXOA 2R2SA 4X2BA 2BE2A 3BR9A 4TN2A 2OPQB 2AQ4A 2J6TA 4WZQA 2R8JA 1JLQA 2HNDB 4QW8A 4TQSA 4O3OA 2AU0A 3GILA 3LP0B 3H5SA 4U6PA 4XPCA 2V4QA 3GV5B 4RW6B 4IH7A 4URSA 2UVUA 2JC0A 3M8QB 4IRCA 1S4FA 3M8QA 3QIDA 4WFXA 5L9XA 5KFGA 3OHAA 3OLAA 2GIRA 4NLPA 1RDRA 3DLGA 4RW6A 2ASLA 4I2PA 3KK3B 5J2PA 3DM2B 4IG3A 3BQ0A 1HARA 2ALZA 1BQMB 1S9GA 1BQNA 3KLGA 1RT7A 1JLGB 2D7SA 3QZ8A 2D41A 2UVRA 4YR0A 4RNNA 1IKVB 4YR2A 2RDJA 4DL5A 5HP1B 1TL1A 1S0MA 2JC1A 3H5YA 1RT4A 3D28A 5C24A 4ED0A 4NLXA 3H5UA 4JV2A 4WYWA 1C0TA 2IAJA 3FDSA 4LSNB 4ECZA 4DL2A 1EETA 4RW4A 2D3UA 1S10A 4ZMMA 1N4LA 3KHHA 1FKPA 2JLEA 3H4BA 2AGQA 1JLEA 2XGQA 4QWDA 1BQNB 2B5JB 2QE5A 2UUTA 3E51A 1T03B 4NLSA 3QO9B 3SI8A 1SUQB 3MR6A 4DG1B 1T3NA 4DL4A 4KKOA 1SH2A 4NLTA 1RTIA 3OSPA 2FLNA 1VRUB 3V81B 2E9TA 4MFBA 4TY9A 3BGRA 4TXSA 4M95A 1FKPB 5F8GA 2YNHB 4MK8A 2IAJB 2RKIA 5KFMA 3V6KA 1YVFA 5EUHA 4Q8EA 3H5XA 3MF5A 1S1UA 3DMJB 3SFGA 3RAQA 1N56A 5KFYA 3FFIA 2BRKA 1RT7B 1C2PA 4WYLA 1RTHB 1TV6B 3GYNA 1N6QB 3DOKA 3PW2A 2I5JA 3MR3A 4NYZA 2WRMA 4LQ3A 2ZD1B 4F4WA 4ZPDA 4ED3A 1S9FA 3H4DA 3V6DA 4KKOB 3E01B 4F4YA 1LW2B 4IQXA 5HBMA 1FKOA 3RBEA 1HNVB 1HNVA 5I42B 2B5JA 1HPZA 3PHEA 4K4XA 4KHRA 1IKWA 4RW7B 5KT6A 2IM1A 3FRZA 4KO0A 3PR5B 2J6UA 1LWFB 3DRSA 3Q8RB 1RYRA 1REVA 2J6SA 2BE2B 3OSNA 3IGNA 4NCGA 2C2EA 4WFYA 4H4MB 2R8GA 2HNZB 2W7PA 1JX4A 5EWGA 3HVAA 4ICLB 2R2TA 4FS2A 3C6TB 5C42A 3EZUA 1C1CB 2YNHA 3H98A 2HWHA 3C6UB 3PJWA 4IFYB 4IH6A 4H54A 2OH2A 5J2QA 2VA2A 3GV8B 3KMQA 1S1XA 4GC6A 1WNEA 3I5BA 1TKTA 4KO0B 4Q8FA 1N5YA 4J9RA 5F8HA 3LP2B 3V4IB 3IG1A 3NMAA 3FSIA 2YKNB 1C0UA 3QLHB 4G1QB 3QIPB 1RYSA 3RB0A 5EWEA 3FQKA 3KLIA 3N6NA 4DG1A 1S6PB 3PVXA 2UUWA 2FJXA 3NAHA 4ID5A 5KG2A 1HYSA 3MEEA 4FBTA 2OPQA 2CJQA 1JLEB 3MEGB 3DLKA 5DQHA 4O3PA 1VRTA 3BQ2A 4ECUA 2B43A 5J2QB 4NLQA 1ZETA 2IM2A 2VG6A 1RT2A 4KFBB 4O3RA 1FK9A 2OPRB 2WONA 4F4ZA 3KJVA 3NKYA 1GX6A 1CSJA 5J1EB 4B3OA 4TY8B 1HQEB 3NBPA 5EDWA 2AX0A 3RBDA 5C5JA 4H4MA 4IFVB 3KLVA 3DRPA 5FDLB 3GQCA 5KFQA 4K4YA 1LWEA 3BJYA 3DOLA 3CDWA 4JUZA 1R0AA 1VRUA 1TQLA 2XI2A 3OL9A 1S1VA 3DRRB 1C1BA 5CYMA 2BQRA 3PW5A 2FLLA 1S6QB 2YKMB 1DTTB 3RB6A 4ECWA 2XCAA 3G6XA 3DLEA 4K4WA 2D3ZA 1UWBA 4ED7A 2YKMA 1JLBB 4Y2CA 2I5JB 2XI3A 3H59A 3HVWA 4JV0A 1JLFA 2JEFA 1NHUA 3QGHA 2YNFA 4Q43A 2XCPA 3H40A 3DDKA 4U7CA 4ECYA 4WE1B 1EP4B 1LWCA 2BANB 1EP4A 3RB3A 1SV5A 4K4TA 1TL1B 2VG5B 4QWBA 4J9MA 4ECXA 4R5PB 4IDKB 5JXSA 3TAMA 3NGDA 5KT3A 1GX5A 3D5MA 4Q45A 5KFAA 4LQ9A 1BQMA 1S9GB 4ZVGA 4EO6A 3KLGB 1MU2B 2FJVA 4RW7A 3DLGB 4Q44A 3G86A 3I0SB 2I1RA 2ASDA 1TVRA 4MKAA 2W8LA 2IBKA 4ED1A 3DYAA 5HBMB 3KNAA 2OPSB 4K4SA 3HVTB 4K4ZA 2V9WA 5L1JA 2WK4A 2OPPB 2OPPA 3KLIB 2GIQA 1RTJA 2C22A 1D1UA 4NZ0A 2WHOA 3DI6B 3DOLB 5HROB 3OL8A 1N6QA 1DTQA 3PW0A 4MK9A 3MR5A 4QWCA 2FJWA 3PJXA 3M8PB 1QE1B 4KB7A 1S1WA 1S9EB 4ZVEA 3LP1A 4I7FA 4YP3A 1IKYA 4QWAA 3ITHB 4XPEA 4WFZA 4URQU 3KJVB 5KFUA 3KK2A 4JV1A 3KK1A 5J2NA 3T19A 5KFZA 2FVPA 3V6JA 1NHVA 5KFJA 3ITHA 1LWCB 2BANA 2HWIA 2JEJA 2R8KA 3NAIA 1TKXB 4RW9A 4ZHRA 5KFWA 1RAJA 4TYAA 1LW0B 1HYSB 3CVKA 4O4GA 4NCGB 4I2PB 1DTQB 2ILZA 3QGIA 3MECB 3T5JA 2HNYA 3KLHB 1KLMB 3LANA 1HQUA 1K1SA 4I2QB 1IKWB 4O44A 5L1KA 3T5HA 1RTDB 4ZVHA 4LSLA 3IG1B 1XR7A 2WOMB 3QZ7A 3MFIA 3V4IA 1T03A 2IJNA 4EO8A 4KSEB 5F8MA 1S1TA 1TL3B 4RNHA 4ECTA 3JSMB 4ZP6A 4Y3CA 1EETB 4RW4B 4PWDB 1JLAA 2E9ZA 1R0AB 5C42B 5F9NA 3M9OB 2VA3A 4EBCA 2R2UA 4IKAA 5KFIA 3KLFB 2IC3B 1DLOA 1JKHA 4M94A 4NLUA 5F8NA 4NLDA 3KLEA 3ISND 3I0RB 3KLEB 3KHGA 4DL7A 3KOAA 4DEZA 3GV7B 2BQUA 4FBUA 5CYQA 4R8UB 4G3IA 2VG7B 3CDUA 2JEGA 1J5OA 2E9RX 2RKIB 1FK9B 2OPRA 3H2LA 5KFVA 3M9NB 3DM2A 4IG3B 2JEIA 3MEDB 3G6YA 2XWYA 4OL8A 3CDEA 3JSMA 3HKWA 2AGPA 2ASJA 2WOMA 3TQ1A 4R0EA 5J2MB 5I3UA 2UVWA 1XR5A 1QAJA 4ZP8A 5KFXA 3EPGA 3DLEB 4KHMA 2DPJA 3KLHA 2YNGB 2ZE2A 5F8IA 1HQUB 3HHKA 5KG6A 2BR0A 1KLMA 2B6AB 4RNOA 4IG0B 1N5YB 5KT7A 3IS9A 2WTFA 4ECVA 3PW4A 4Q0BB 2FVQA 1S1XB 2W9AA 3IGVA 4IFVA 4NLGA 1S0OA 5D3GA 5KFRA 3KK2B 4KV8B 4KE5A 3QGGA 3CJ2A 4KV8A 4TLRA 3KK1B 3GIJA 2VG5A 2R2RA 5J1EA 1SH0A 4B3OB 5DLGA 5C24B 2BQ3A 4WE1A 4ED6A 2DPIA 1JLCB 4MFBB 1IKVA 5C25A 4MH8A 3TVKA 2FVSA 4NLVA 1W25A 5KFBA 3IRXA 4H4OA 4KAIA 3T1AA 3EPIA 3JYTB 4QPXA 3KHRA 2IMWP 1KHVA 1K1QA 2YNGA 2ZE2B 4MIBA 2WCXA 5T14A 3N6MA 2OPSA 1HPZB 2HMIB 2IJFA 4LSLB 4QW9A 1RA6A 3LAMA 1TKZA 4F50A 1IKXB 4PQUB 4FS1A 1MU2A 3OL6A 1RT1A 4O3NA 3T5KA 2ZD1A 1JLQB 2HNDA 5DG9A 5JUMA 4IDKA 4R8UA 4IR1A 4ZPBA 3TAMB 1ZTTA 4WXWA 2IA6A 2W9BB 2ZKUA 2IC3A 5EWFA 4PUOB 3KLFA 4J9OA 1DLOB 1JKHB 4Q0BA 3SFUA 3KMSA 1SV5B 2YNIA 3IS9B 5KFCA 2QV6A 2WONB 1U09A 3RB4A 5J2PB 3KK3A 1S0NA 5KFOA 1IKXA 1S1TB 1TL3A 5KG1A 4PQUA 1UWBB 4EEYA 1JLBA 1ZTWA 1T05B 3V81A 5L1LA 5KFLA 1RTJB 3V6HA 4ID5B 5KFTA 5KG5A 4O44B 2GC8A 3LP0A 3MFHA 1D0EA 4NLRA 3HVTA 1FKOB 1C1BB 1S49A 2HNYB 5KT4A 1RT3B 4J9PA 4ZP7A 2IM0A 1LW0A 1RT5A 3IRXB 4O4GB 3I0SA 1J5OB 2IM3A 2VG7A 1LWEB 2FLPA 4WZMA 4NRTA 3BSAA 3UR0A 4K4VA 1Z4UA 3FFIB 4YR3A 2XGPA 3UPFA 3KHLA 1HQEA 3IN5A 5J2NB 4EBEA 3M9MB 2WB4A 3Q8PB 3LALA 5DLFA 2RDIA 4HYKA 4DL6A 5DGAA 1JIHA 4MIAA 4ICLA 1RT4B 2RF2A 2W9CB
chains in the Genus database with same CATH superfamily
3D4JA 4UOCA 4IRKA 1VYAA 4FVMA 1T94A 3MEGA 1QAXA 2I0XA 4ZVTB 2NZCA 5JMNA 4RNMA 1JLGA 2EK1A 1RCOB 7AT1B 1MROB 2O5DA 4ZOSA 3MEEB 5KFDA 2KYXA 2PE8A 2M2BA 4M63A 5HROA 2F8EX 4B9VA 4GO7X 4JI4F 1I94J 3J81Y 3AX2A 4FF3A 3I5CA 2V9KA 1HBUA 1FTCA 3QLHA 5HAOA 4BWJA 1U47A 3QT6A 3BEGB 4X4TA 4V1Ak 2QMXA 1EKSA 1T3OA 2F7VA 3G6ES 3FBEA 1KOHA 3E01A 1TU0B 2AYMA 3CCMS 1WF2A 2CJYB 2W2PP 4ZCIA 4KJIA 2RF2B 2WVDA 2NZ4A 2BABA 3DGVA 1JB0C 4LVOP 1E6YB 3C19A 5AT1B 3W62A 3B8HA 3Q8QB 1HR0J 1RZMA 4DDFA 4DV2F 3PNIA 3I0RA 3A8EA 2J76E 5IFMA 2W9BA 4ZS6A 2YWGA 2F9DA 2IA0A 2ZH4A 4W4MA 4B3MJ 4PUOA 2AGOA 3TYTA 1XN9A 4K50A 2EBEA 3J7ZT 4ILLA 4I7FB 4YQWA 2DR7A 1R8CA 2PIIA 4QYZK 2PD1A 2DIVA 2UU9J 3BSCA 4YEAA 1RT5B 2E7XA 5G0RA 5KFSA 1WHYA 5HQLA 5KFHA 5IWAF 2HLUA 3ZTPA 4DHVA 1O0PA 1Q16B 4OI6A 4OYXA 1YJ7A 5MLCV 3BN7A 4YMEA 3MURP 3CPWR 3W3SA 2YPYA 1TFYA 4DX8H 3HT0A 5IV4A 2ZKTA 4Q7AA 1NNDA 1XNRF 3H7HB 5A8WA 4RLEA 4I2QA 4ZP9A 1S48A 3RTVA 2CPHA 4N41A 4TVAB 3NGKA 2MKSA 3JYTA 3H2UB 2MDAA 3D1OA 3DHXA 3OR1B 2KN4A 4H4OB 2XY7A 2XLKA 2J0QD 1Z2ZA 4DUTA 1U0SA 2HS3A 1MMLA 3MMBA 1HMVA 4NRUA 2PO4A 3DOKB 2ZVSA 3IWXA 3TEGA 8AT1B 3DRPB 3K5OA 4ZHRB 2NLWA 3D2WA 3U27A 2ZOGA 4ID8A 4GVLA 4DUYF 4KBIA 1VQYA 2CNLB 2HEKA 1XMBA 3LAKA 5B0CA 2KU7A 2ZHOA 3NEKA 4J9UE 5D15A 3RG6A 5LJ3Y 3AHPA 4OJHA 5CA5A 3R6GB 4C8LA 2HHHJ 2EKYA 2DHXA 2K1RA 2YQ1A 2J0WA 4RO0A 1YKWA 2VG6B 4KR0B 4USTA 3W65A 4ZKAA 2V4RA 1WEXA 2K8GA 1JXVA 3HD1A 4OYZA 4CLKA 3MPYA 4CM2A 1REVB 4JP8A 4CO5A 2B7BB 3P96A 5K14B 2R8IA 2HMIA 1RJJA 4N77A 2ZUGA 1EIYB 3UDEA 1Q0NA 3K2YA 3RBZA 1KQGB 1NK9A 3CIZA 4J9NA 3BQ1A 4OLPA 4DN9A 2V34A 4LFBJ 1S59A 1A0OB 4OYMA 2EC0A 2BZ2A 4JOUA 1WORA 3W66A 1FTRA 1JLCA 2VZ9A 2H65B 5HMWA 2KM8C 4LJMA 4J9SA 4MIWA 1Q82T 4DF8A 2OFHX 1VBKA 3CJSA 1KNZA 2F9JA 3NWRA 1UMJA 2WVEA 1RI7A 3KKFA 1C1CA 2VKRA 4LR7A 3TEHB 3UNGC 3PZPA 3LGHA 4U7UK 2M3DA 4RW8B 4RUAA 4Y34A 2GJIA 3OHBA 2DRBA 1VC5A 3C6TA 1IKYB 3I31A 3TA1A 4KFBA 2UUAF 5THWA 1HNIA 2XC9A 4C8ZA 3CJ0A 4WXOA 2R2SA 2HG4A 3TI0A 1XMQJ 2B4PA 1X7VA 3BR9A 4ETXA 2B9WA 4WZQA 1UAWA 4NI2A 2CUYA 2HNDB 2QRRA 2E1PA 4OI1A 1IBLJ 2CPFA 2HHQA 1EQMA 2YKQA 1XIQA 2V4QA 3GV5B 3A3PB 1U8SA 4DUZF 4HTJA 2R3VA 3EDRB 1ZPVA 4WCEQ 1WHXA 1IXKA 1TL7A 3QAUA 3KJFB 4BLGA 2ADCA 5D0RA 3M6XA 5EN1A 2CQDA 3UN2A 3OHAA 2GIRA 2ASLA 2VF3A 3HLUA 1KOOA 2JDJA 1DQ9A 4NOHA 2LECA 5JVGQ 4X4QA 4KHPJ 1S9GA 2CPIA 2YVSA 4ZLNA 2Z2LA 2OI2A 2X7IA 3VVTA 3D54A 2FC8A 3WC2A 3TZZA 3QZ8A 2D41A 3FEYB 4YR0A 4RNNA 1OWXA 1FHTA 3LH2S 3Q24A 1B70B 1RT4A 1KS2A 1MWYA 4OHYA 1U02A 4JV2A 2AJ0A 4KPCA 1ZM2A 3OTCA 2GMLA 1FERA 2HRYA 1NUEA 4OYIA 3AX5A 2D3UA 2FZGB 2QIFA 4KC5A 2EEYA 4NEZA 1FKPA 4X65F 4UY85 2MZRA 3I4HX 1X9WA 3JXOA 4WP3A 3MM9A 1T03B 2B5JB 3E51A 3MMBB 1A9NB 4NLSA 1AXQA 1SUQB 3C16A 1G1XA 5GADI 2VB6A 2DNQA 2UZAA 1ICEB 3M30B 3QFHA 1S7HA 3SQGA 4DL4A 1SH2A 4NLTA 1RTIA 1AYEA 5FLXU 2QEXS 3AFGA 4DX6A 1VRUB 3NGSA 3V81B 3CD7A 3P3DA 2J7UA 4ZA1A 1AW0A 4ZLLA 3KFWX 1Y5LB 2H1YA 3K17A 2HGNA 1S79A 3TAQA 1U1LA 4UUXA 1RK8A 3NXZA 1HNWF 4FYWB 1APSA 2LFVA 3ULHA 2RKIA 2FHOB 3PYEA 5K5MA 3JTPA 3L7UA 1YIJS 3HDSA 3MCOA 2Y8YA 2ZOMA 1HI8A 3NMRA 3CDBA 4FDFA 5GAGI 3H5XA 3MF5A 3P5TL 3PG9A 4LRFA 1UJ6A 3SFGA 3RAQA 2AEFA 2YBVA 5H9FJ 3D9BA 2C3UA 1FRHA 5B0GA 1RT7B 3GYNA 1R27B 2ZJPQ 3DOKA 3PW2A 4C0HA 1HBNB 4NYZA 2WW8A 4LQ3A 3OD2A 1HWJA 4F67A 4ZIWA 1EJ7L 2HFSA 1NJYA 3PO5A 2HVIA 1RSCA 1GTEA 4DOZA 3E01B 3NCRA 3ZZUA 1PBAA 3SCKE 4F3MA 1F5CA 4F2SA 2MQLA 1U6BA 3RBEA 4M8LA 1WG4A 2EWHA 4PXEA 2NQPA 1RWVB 1HNVA 4P6QA 4I1TA 5A8WB 3FEZA 2UUBF 4K4XA 4KHRA 4RW7B 5M2RA 1S72S 4LMZA 3FRZA 4KO0A 1WC4A 1NDPA 2K2PA 2RQMA 3BH6B 4J7CA 3PR5B 2W25A 1U1NA 2KZZA 2YWEA 4PWUA 4PXBA 1GTHA 3WQPA 3LQVA 3Q8RB 4K7QA 1FDNA 2J6SA 1QAYA 3M8ZA 3U1LA 4DV4F 9ATCB 5HJXA 5EWGA 5E33A 1PJ6A 4C48A 4PKDB 2DCUB 1X8DA 2V6AA 4FS2A 3CCES 4OJ3A 3PYGA 4CDIA 3SYZA 1OPZA 2OH2A 3H98A 4KGMA 3MMCB 2KHCA 2O66A 2VICA 4H54A 1NJIT 1RAOA 1YG0A 1S1XA 2OEJA 2EW9A 1WNEA 4KO0B 1TKTA 2XO7A 2CJXB 2XLIA 3QWUA 2DGTA 3V4IB 3LP2B 3MWBA 1WG5A 2KH9A 3QIPB 3AAWB 3EZOA 1UZHA 1HBUB 5EWEA 4DV0F 1RHJB 3OFFA 4HI1A 4UW2A 4OYOA 5HI7A 4CTAA 4F3QA 1S6PB 3VAIA 1F3VA 3P5BP 1Y0HA 4ID5A 4WKRA 3VTIA 3MEEA 4DU7A 1V9OA 5ETNA 2GVZB 2VH7A 2QA2A 1HNWJ 3PX0A 5DQHA 3D6TB 1RT2A 4O3RA 4DQIA 1BLUA 3R27A 3VGSA 1YDLA 3NKYA 4J90A 4A8WA 5J1EB 1S6UA 2V63A 4TY8B 2G0IA 1GXUA 1HQEB 3DOMB 3NBPA 4WK1A 5AJ3F 3CUNA 2M8DB 4JI7J 4H4MA 1VQPS 1IR1A 2DNRA 4DSIA 3W5ZA 4DR6J 3L7OA 5D8HB 3FNNA 3THTA 2WBRA 1QVGR 2EFGA 1R0AA 3THVA 3JQJA 1VRUA 1TQLA 2DGXA 3RBXA 1HHTP 4B9LA 1FI4A 3DRRB 4EZ9A 3F44A 3G82B 3PDNA 1FJ7A 2ZBQA 1HBOB 4HACB 1H73A 2J7WA 4PZVA 2XCAA 1GMWD 4K4WA 2QFIA 2NSBA 4X62F 4LF4J 3MM9B 2ZHAA 1Q8LA 3HJVA 3T1HJ 2IDEA 5ADZA 1JLBB 2P9CA 2MY8A 4DV4J 2IRUA 2JEFA 3QGHA 3FZ2A 2C3OA 3GFHA 5B0FA 1DAXA 3UCUP 1X31C 2AEJA 1AZSA 2PEHA 4WFNQ 1EP4A 2GHPA 2XMUA 2KFNA 4LIWA 4DUZJ 4ECXA 4R5PB 1T9WA 2NXJA 3PEHA 4I6AA 4IDKB 2MQPA 3TAMA 3QT8A 2DNHA 5L46A 3D5MA 2MJNA 5KFAA 1S9GB 2DR8A 1L3SA 5E5NA 4FYXB 1FF2A 4P7VA 1OMSA 2G2OA 2LLZA 2M8HA 4MKAA 4OX9F 4B17A 4DN0A 2FJBB 2W8LA 2SXLA 3DYAA 4LR8A 3KNAA 5E3QA 2RUSA 1XMOF 3MAAA 3PKMA 3PRDA 1NKCA 4B3RF 4X4PA 3GB0A 3KLIB 5AE2A 2QA4S 2GIQA 2CQPA 1Y3KA 1Q95G 1VGYA 4CH0S 3LA0A 4PYAA 2BW2A 2C22A 1NEEA 1D1UA 2DGSA 4USUA 1HNXJ 1KVJA 4BBYA 1M5KC 5DO2A 1DTQA 4P72A 1YBAA 1VQ6S 2FJWA 1I5OB 2CQCA 1LQ9A 1U1OA 1S1WA 3IXQA 1RHUB 1TMJA 4HEA9 3QRQA 3OFHA 2UXBF 4YP3A 1IKYA 2W1BA 1V3RA 3JB9k 4GKKJ 4NXMF 2PGCA 2ACYA 3KJVB 3ZFVA 3WDOA 1U25A 4EU0A 4YY3J 2EFVA 3T19A 2CYYA 4M5DA 2QLXA 1NHVA 4X62J 3ITHA 2XY6A 2HWIA 1PYOB 2J5AA 1VC0A 2GMJA 1TKXB 1RHRB 3HHLB 1IWAA 1R8AA 5GAHU 1X4DA 1LW0B 3ENQA 2MZTA 4QCLA 2H5JB 3Q2SC 4NCGB 2DHSA 4O4GA 4ZVRB 4TU9A 4LF6F 2LKZA 1QSLA 5ETRA 5IC6B 3MECB 4F36A 1HFEL 2HNYA 4CLSA 2GGPA 2MQ8A 5EHHA 3T5JA 3OBIA 1HQUA 4B9SA 4BDPA 4I2QB 2CA9A 1IKWB 2KZMA 3V2UC 5CZXA 4O44A 2H5IB 4ZVHA 2XM3A 2WOMB 3MFIA 4C4WA 2ADBA 2N7YA 1DQAA 3LOUA 1P27B 2IVMA 2FIUA 2PFDA 3CMAS 5F8MA 2EFNA 4RNHA 4NASA 4K8RA 4Y3CA 2I38A 2LEAA 2WVFA 2K1RB 2MKIA 1HWIA 1JLAA 1V5IB 2VA3A 2U2FA 3I4PA 2D3OR 2V5HG 3ET6A 3VAHA 2O1PA 5ETPA 5KFIA 1I3OB 4NLUA 5F8NA 1P9YA 4I0WA 2C2MB 3I0RB 3TX8A 3KHGA 4TU8A 4FKXA 3TO8A 3R2CJ 4AE5A 3CDUA 4B3TJ 5ETLA 1NK0A 1J5OA 2EFOA 1FK9B 2LA4A 2OPRA 3PV8A 2CPJA 3NCQA 4XAKA 4DLEA 3ZC4A 3JSMA 1NK5A 3J7A1 2KT2A 4M5GA 3HHNB 1VI7A 4R0EA 2H5EA 5CD4H 3CJKA 4AYBD 5GMDA 5I3UA 1XR5A 1HWUA 1FXDA 1QAJA 3DC2A 1UFLA 1CS4B 4QR0A 4XDCA 3WX8A 5LM7E 4DR3J 3A1YG 3A3OB 2V50A 2UXCJ 3AB4B 1YHQS 5IXUA 3IA0A 4RNOA 3BV8A 2J9DE 1K73T 5IT9U 1CPZA 2BJ3A 2CQ2A 2HBRB 1J2VA 2DNPA 3V5RA 2E5IA 4B08A 5FLXY 2CZ9A 3H2VE 5K8OA 3K5LA 1OQ3A 1X9SA 1N5YB 2RE1A 5FIIA 2MSTA 1XTZA 2JOQA 3AD8C 3DKDA 3FMWA 5KFRA 4DPUA 3IR7B 3UD5A 1WOOA 3QGGA 3CJ2A 4KE5A 4TLRA 4AL7A 1OYEA 2VKZG 1T9TA 1VLYA 5DLGA 2C2ZB 4PYDA 2CDRB 3DLBA 3ET6B 4OZJA 2H3EB 2VJVA 4DBQA 1BHNA 4ED6A 3M8WA 5C25A 1IKVA 4DFKA 4LF1A 4DV6F 2RS2A 1U45A 2ZNZA 1S0VA 1GH8A 2V2ZA 1XERA 3IRXA 4DJBA 3C14A 3SSSA 3MEKA 2UV8A 3VGVA 3EPIA 2G0CA 4QPXA 4M5MA 5E3PA 4OV6A 3ZZPA 4OZ5A 5T14A 3N6MA 2Y0BB 3GSIA 5L9NA 4DV5F 3JSYA 4C98A 1IBMJ 1IQZA 4QW9A 3K57A 3PIPQ 1YX2A 3EWGA 3OTEA 5H9EJ 3FSXA 4OJGA 4EK2A 2HYIB 3NY0A 1QUPA 1PJ5A 5B0DA 5HMZA 2BV3A 3R5DA 3SV3A 5K8PA 4PQUB 4DL0C 3CD5A 3OL6A 4NA3A 1RADB 2MQMA 4ZITA 1RT1A 1VQ4S 4DR7F 2P6TA 3EMTA 2CG8A 3T5KA 4HL9A 1ACMB 2OAUA 3TJAA 3HX9A 5HANA 4Z7CA 1N88A 2GNKA 4CLYA 1LXNA 5EWFA 3KLFA 1RUSA 1SV5B 2N7CA 2YNIA 2RHQB 3PJ9A 4DS4A 2XS2A 3MTJA 3BKUA 2KTQA 1X4BA 2XB2D 3HSZA 4K2JA 1GMUA 7FD1A 1Z2LA 1TL4A 4DFJA 1IKXA 2K7JA 1K0TA 3PYDA 1CBKA 1UWBB 2DXEA 3TVYA 4EEYA 4LRCA 1VC6A 4RR5A 1Q79A 1T05B 3TX0A 2B8PA 3KYLA 3V6HA 2ERRA 4CCHA 3W2VA 5KG5A 4Y28C 4O44B 3EGVA 3W61A 3AQOA 2QG9B 2Q79A 1XK8A 4LREA 4LUBA 1FKOB 4CLPA 3BYRA 1C1BB 2E5GA 2ZUAA 2A0FB 2V1SA 1S49A 2HNYB 4DF4A 2RAQA 1MNEA 1SKRA 4Q2LA 5FD1A 3VALA 4O4GB 2DXDA 3MDFA 3BZQA 2XS7A 1AUSL 3RR8A 3Q8YA 4YS2A 4NRTA 3UR0A 4K4VA 1Z4UA 2MJUA 3FBFA 4O0IA 4CM0A 3V4MA 2KJVA 4JI3J 3LALA 1D9AA 1R3NA 2HS4A 2RDIA 4GKKF 1ZBTA 5DGAA 4DU8A 3HMJG 1CC8A 1GK8A 2Q1LA 3QMQA 4DR2J 2HNZA 2CDQA 4JI0J 3N4WA 2ASYA 3CO9A 5DG7A 4ZPCA 1XEZA 2HGLA 4P2SA 1NK7A 1HW9A 1SC3B 1SI9A 2HK2A 1SL2A 2HHWA 4EFAC 2JJ4D 3QT7A 2OO4A 1OYDA 2RRAA 1H3DA 4PR6A 1T9XA 4KQZA 1HBMB 1XWLA 1T05A 2AHOB 3RYLA 1N32J 4DR7J 2VFVA 2FVCA 1T9UA 4LF7F 4MKBA 4F0KA 2YTCA 2NXNA 1RB0A 2ZH5A 4DPOA 2CQ0A 3FBCA 4QIWD 3E3XA 2BBEA 2C2KB 4DZ6A 3G9CA 2VPXB 1SH3A 3AB2B 5F9LA 3DGPA 3EUNA 1S97A 1K8AT 2QLBB 2YNIB 4DR4F 2HAIA 5DGBA 4KT0C 4R5PA 1NSPA 4C3MA 2DGOA 4U67Q 1JMTA 2H51B 3J7Z5 1B7YB 4TY8A 3DFEA 1S9EA 3CJ4A 2PI5A 1R89A 1JXEA 2QL9B 3PFEA 1RT1B 5D0HA 1VDHA 1EAYC 4F4XA 1I94F 3O3LA 4TYBA 3IR6B 3LGMA 3AXMA 1KFSA 2KL8A 3BSOA 1FXRA 4UOFA 1LWFA 3CJ5A 2NUUG 3UD3P 1N52B 4USMA 1QY7A 5CABA 1H2TZ 1MN9A 2BRLA 4B9TA 2DGWA 3CB4A 5M2UA 1NKEA 1UWAA 2L08A 1T0TV 5I42A 1N33J 1LFPA 2AYEA 2QL7B 3UN5A 4UZBA 2DNYA 2IRXA 3MR2A 1D8YA 2JZ5A 1WKKA 2KXFA 4NZ6A 4ELUA 2EVZA 3DRRA 4CO0A 3SCJE 1HD1A 2Z2MA 2DHHA 1RTHA 2DK2A 3GIIA 5KG7A 2LYVA 5CYQB 2D1CA 3Q8UA 3FQLA 2Q6BA 3M32A 4NLYA 3DN9A 2XZ2A 3SXLA 2HAFA 1OSCA 2R8HA 3NBPB 2RU9A 3HFVA 1U6FA 1SKSA 3IWNC 4K4UA 2AKWB 3L7PA 4C8YA 3MTKA 3TUJC 2VV5A 2LXUA 5LXYA 4RZRA 1RHQB 3P45B 1RT6B 4UQTA 2W8KA 5HLFA 3ZZOA 4HKQA 3G96A 3OLBA 4O0NA 3ZTOA 2LQ9A 4ANCA 5D6GA 2HRTA 4ZLJA 4Z37A 2UUAJ 5LJ5Y 4DV3F 1YZ7A 1SJ1A 1WC1A 1KONA 1SCJB 4WPAA 4A46A 3VR1A 2ATLA 1V6HA 3GFYA 3BO4A 3D0GE 4USWA 1S6PA 4YB7A 4JBCA 1XR6A 2AWZA 3CJKB 5I3UB 2AJ1A 2CQBA 1DRZA 1C0UB 1FJEB 2VC1A 4U96A 1D8ZA 1LFWA 4J9LA 3H8YA 4N8OA 4YB6A 6AT1B 5KFPA 2C2RA 3QRPA 2P9EA 5ETTA 3AJDA 1KVIA 2CQHA 5C25B 3HO1A 2HFNA 5GAEI 3PTWA 5BYSA 3NNAA 1TKTB 3EXCX 3CCUS 3CCVS 2UXDJ 3C6UA 1WUUA 1OQ6A 4QJVA 1WKJA 3M2RB 2ZOFA 4JI4J 1B0PA 1VHFA 2MZSA 3OL7A 3RAXA 2XBPA 2W2OP 4M5KA 2JVRA 2QA1A 1NH7A 1KQFB 5KT5A 1Q8IA 1JLAB 4W92B 3M8PA 2R7TA 1Q5YA 4X2BA 3S6EA 4TN2A 2OPQB 3GIKA 1CJKA 2J6TA 2Z4PA 2XMMA 2R8JA 5IM0B 3VF0B 5D77A 5B0EA 4A8XA 1K9MT 4QIGA 2BDPA 1ZETA 2EK6A 4F26A 2BJ9A 3NNCA 2HW3A 5D4NA 1VBXA 5D0GA 2LXIA 3EVOA 5LMUJ 3R5AA 5AE1A 3LPYA 1M1HA 4IRCA 2HVHA 1WOSA 3C66A 5A8RA 1NK4A 3Q2TC 3SBMA 2NYHA 4RW6A 1GQEA 2HQCA 2VBZA 3KK3B 2QSWA 2ZBIA 3VZHA 5J2PA 3BQ0A 5ETSA 1BQMB 3KLGA 3TJ9A 2ABYA 3G87A 1B7FA 3MPVA 1YBUA 2F5GA 4ZVOB 2KM8B 2B4OA 2Z30B 1IKVB 4YB5A 2RDJA 1LOUA 1S57A 1L3KA 2NSCA 3H5YA 3D28A 3RU0A 5E41A 5MAOA 4ED0A 2J0SD 3FKBA 4WYWA 1C0TA 2KXNB 2IAJA 4UF4A 4JI5F 2DB1A 1FCAA 4DL2A 2ZZMA 1VQNS 2CADA 1S10A 4LF6J 4OQJA 8RUCA 1OY6A 4ZN1A 1DURA 4BCAA 3HM9A 3HXMA 3M8SA 2CPDA 3R5CA 1G3OA 1F60B 3DU6A 1H2VZ 2XGQA 2U1AA 3QO9B 3TQEA 1M1KT 1MWZA 3JTNA 4MMOA 3EDQB 4X84A 5L8RC 3KUHA 3W2WA 4DG1B 3B6BA 2AJQA 3HK2A 1VJQA 1FFWB 3FCWA 2CWKA 3R8YA 2FLNA 2F8HA 2VJUA 1FEEA 4MFBA 3IAM9 2WBMA 3BGRA 4ZVSB 5HQ8A 3POTA 2DY1A 5F8GA 4U8YA 1FRLA 5T41A 2V67A 2VL1A 2YNHB 3IM9A 1FWPA 3US5A 2L9NA 5IZHA 5D4OA 3HHEA 4G1PA 1PYTA 5EUHA 1QD1A 3T1YF 5IOLA 2XYGB 2VDIA 2B3TB 4Q8EA 1Q78A 1KEKA 2Y1JA 2HHSA 1R7IA 2COLA 3VAFA 1P9QC 1RTHB 1VHIA 4DR5J 2WSFC 1YWXA 1EB0A 4F4WA 4ED3A 1J5EF 2V68A 2WRMA 2BUNA 2L48A 1NK6A 1UW4A 3H4DA 5AE3A 4KKOB 1B0TA 4F4YA 1NXIA 2AYBA 2CNOB 2YXLA 1CQNA 1HBOA 3K5PA 3B4DA 2DTJA 2X1BA 2YKPA 1HPZA 1IKWA 2UP1A 2GQQA 2IM1A 3EVMA 5KT6A 4NWBA 2CPZA 3TNVA 4JI1J 5GAEU 1REVA 2QYGA 2BE2B 2XMKA 4I68A 1LK5A 2E1RA 4NCGA 3T6BA 2C2EA 4CLLA 4WFYA 3A12A 3QNWB 4H4MB 3NGRA 5I3PA 2V8GA 4L72B 1NKBA 3N5FA 1UFWA 2QZ8A 2BKOA 3HT3A 2JHEA 5HL7Q 1JJ2R 3RRGA 4QU7A 3C6TB 3HSDA 2V2KA 4OHZA 1H2UX 2E5HA 3AXKA 2RUGA 3ADAC 1XNQJ 2HWHA 4NXNF 2VA2A 3GV8B 1H98A 3KMQA 3H20A 4DCJB 1B99A 5KAKA 4GC6A 3I5BA 4Q8FA 1WSRA 4ELTA 1HIYA 3IG1A 3OQ2A 2H4WB 1U0HA 3NMAA 4FKYA 1WACA 5B0AA 2HK3A 2RRBA 3AY0A 2DHGA 3FQKA 3KLIA 4LFAJ 4DG1A 1WF0A 3ENWA 4O3QA 4DPWA 3PVXA 1PGZA 3CCTA 2FTRA 4CQ1A 4Y2KA 4C3LA 2GQCA 2R7SA 2C3PA 3OTDA 3DLKA 3GG0A 4O3PA 1VRTA 5K8MA 1FE0A 1CVJA 1VFJA 4CH7A 2VIHA 3FVYA 4RWXA 2VQEJ 2FZCB 5K9FA 4CNZA 4X4OA 4DV7J 2VG6A 5G0RB 2GV1A 3MMAA 3R97A 1Y11A 5HSPA 3FEXB 2A6MA 2N3OA 1Q8BA 2W7AA 1CSJA 3DNCA 4P2FA 4HH0A 5DS7A 2MQNA 2GMHA 3KLVA 3BS9A 3TA2A 1TUWA 3WBZA 3GQCA 4RWWA 2ZZNA 1LWEA 1JQGA 4WU2A 3TW0A 3CCWA 3BJYA 4FF2A 1BD6A 1XJWB 4JUZA 3R5GA 2XI2A 3A4TA 1RWWB 1ZPWX 4TLQA 1C1BA 1N0UA 5E7OB 3SMZA 1S6QB 2FLLA 5A8RB 3MGJA 3PO4A 1G6BA 3H25A 1X4FA 3BGLA 4AT1B 3RB6A 3G6XA 4DPXA 1KC8T 2W2NP 3GIRA 5DDRC 1RGVA 3UWTA 1ROFA 2D3ZA 3MMJA 1UWBA 4HH1A 3H59A 2GVDB 3MM7A 2XMAA 4X64J 2CQ3A 3JS9A 3MOJB 1UVKA 2YNFA 3FBBA 4ZJOA 3KJQB 4ZPVR 3H40A 2HBQB 2POKA 4WE1B 2MGZA 1LWCA 4A47A 2EG2A 2GFFA 1TL1B 3AOAA 3P4UB 4NA1A 4J9MA 4QWBA 3R9LA 3G2XA 2FLOA 2GHVC 4OHVA 4Q45A 1AFIA 5B7WA 3ZZRA 2OD6A 1X4HA 1YSJA 2HRUA 2RD5C 2DYAA 3GMGA 3CC2S 2NXEA 2YWFA 4RW7A 3DLGB 1UJ4A 3I0SB 4JI0F 3OVSA 3OVBA 1TVRA 4AD6A 3KWMA 2XG8A 5E3CA 2MQOA 4ED1A 1W2BR 3CCSS 3PX6A 3LF0A 1M90T 1NRKA 4K4ZA 1KQSR 5L1JA 6FDRA 4CTAB 2HZVA 4B9MA 1B0VA 5C2CA 2CZVC 1MROA 5HROB 2ROEA 5HN0A 4X4VA 2V4JA 1WC3A 2Y1RI 2GO9A 3PW0A 4OYBA 4JI8J 2BYCA 1RLCL 3KTQA 1RABB 1XQIA 3N01A 4LF7J 3LP1A 4X4UA 4C0BA 1FRMA 2C3MA 4QWAA 4JYAJ 4L76A 3C15A 3UVJB 1YJTA 4XPEA 1FFSB 2YWWA 4JV1A 2XYPB 4OZNA 3KK1A 2R7VA 1U1RA 3BYPA 5J2NA 3MHYA 1MMNA 3VAMA 2KKHA 3V6JA 5KFJA 1LWCB 1ZM4A 2R8KA 2JLGA 1NDLA 4RW9A 4Y00A 5KFWA 2ZH3A 2ZH2A 3D6HB 4HI2A 1TTHB 4TYAA 4CLWA 5ITHA 1HI0P 2CAJA 2HWTA 1N5QA 2CJAA 2X3GA 4B3MF 1KLMB 2MKCA 1LK7A 2FUG9 3D1QA 5DZ6A 5A8KA 1RAHB 3TANA 1U24A 3BGFA 2FYXA 1RTDB 1CQMA 1I51B 2JFKA 2UU9F 3IG1B 1XR7A 3PACA 1T03A 4JI7F 3E8OA 2IJNA 1RBOB 4OFZA 1HD0A 1DARA 3JTOA 4U9RA 4UY8T 2NPIA 2UUCF 4ZN3A 4ZP6A 2OD4A 3PKYA 1D09B 4PWDB 5HK4A 2DNMA 2BKPA 4BC7A 2E9ZA 2QJ3A 1XNRJ 4EBCA 2NCKL 2R2UA 2LDIA 1N36F 2EBGA 1M5VC 1DLOA 1JKHA 2DR5A 3KLEA 4NLDA 3E2EA 4KGVB 4ZIVA 2CPXA 3KOAA 2WAQD 9RUBA 3GV7B 2VBXA 3O5TB 1Q7YT 1SIZA 2D9OA 3PRVA 4LRAA 2E9RX 2RKIB 2JEIA 3M9NB 2A2CA 3G6YA 2R42A 3HHLC 4W98A 4OL8A 2BKNA 1H0HB 1WC0A 3HKWA 3IBFB 3QSIA 3QJJA 1F6TA 3U1NA 2J8AA 1ZAXA 2WOMA 2HQDA 3GJQB 1RKIA 4P7TA 3IR5B 2ZM6F 2UVWA 1FX4A 1JK9B 1OJ4A 3EPGA 2RILA 1FD2A 4C8OA 2DPJA 2GGPB 2ZE2A 1ZYQA 1HL6A 3VVUA 2ROPA 1RWPB 2ZH7A 2LEPA 1N34F 5KT7A 2KXHA 3IS9A 2WTFA 3BO2A 4ECVA 2MMYA 3JAMY 4LFBF 2I6WA 1UEKA 4MYTA 2BJ7A 3FRYA 3GU0A 2EXUA 1B64A 5EX3A 1FJGJ 1CJVA 2DRDA 4P52A 2LQ5A 2VG5A 3W8PA 3OT9A 4A8OA 5BYRA 4BC9A 1YJUA 1SB6A 4RBUA 4F25A 2BQ3A 4I4BA 2W2MP 1JLCB 4MFBB 1T95A 2O01C 4P10A 3TVKA 2B56A 4USIA 4H4OA 3J80U 3JYTB 3KHRA 4DZDA 1K1QA 5B0BA 5JJBA 1SKWA 2FJEB 2YNGA 1LV5A 4OYWA 2WCXA 3GE9A 1P1TA 2DEIA 1HPZB 2HMIB 4LSLB 2MTLA 3CIMA 1RA6A 4P9SA 1SJQA 3GJRB 3LAMA 4RKUC 1YGYA 4C8MA 3O44A 1GT8A 2HNDA 4OZ3A 5HJYA 2QTWA 1SBRA 2LEBA 2DO4A 3TJ8A 4IDKA 4R8UA 4IR1A 2GA7A 4PXCA 2XMJA 4WXWA 2IA6A 4LT6A 4H4KC 2W9BB 2RT3A 4PUOB 3C46A 1X5OA 1KN6A 3QAEA 2H54B 3IS9B 3EZ5A 5EX0A 2R9LA 4NX9A 3D3BJ 3NS6A 4F4KA 5ETMA 2WONB 3VCDA 2G2ZA 1U09A 1UKUA 3LUYA 3RB4A 5J2PB 1Y10A 3D3CJ 3KK3A 3K5MA 4DSJA 3F73A 4WJBA 3OXFA 5KG1A 4DV6J 4PQUA 1RACB 5A0YB 3LWLA 3CMES 5A6WA 4FVCA 5KFTA 1UVNA 2XMWA 4JI2J 2GC8A 3MUVP 3OTOF 3IBCB 4USKA 5BR8J 3NRBA 1KP6A 2QT7A 3HVTA 1UP1A 3HP6A 4F7VA 3SQOP 1D0EA 3J7AN 4PRFA 2ZBCA 1UUJA 2GAGC 4QZVB 2HBZB 2IM0A 1RT5A 2N3LA 3IRXB 2IRYA 3D66A 2IM3A 2YPZA 2GO8A 3CD0A 1KD1T 1AFJA 3MXHP 1WD6A 1W7WA 2FLPA 4WZMA 2B0GA 4GVBA 2MKKA 1HNZF 1FX2A 4OX6A 2Z56B 2FJAB 1HQEA 3IN5A 3H0PA 3M9MB 4KGKA 2XLJA 3M7VA 1VBZA 4HYKA 3Q8VA 3G71S 2DNLA 4ICLA 1U26A 2GW8A 2RF2A 5H9FK 4CI0B 4EWTA 3BBCA 3NWGA 2XHCA 4WF9Q 1WC5A 3OV7A 2XY5A 3EGZA 1QE1A 1A7GE 2B4UA 2BA9A 1ZS6A 1RT3A 1HW8A 1RU1A 2B9YA 1FRXA 3EGNA 4N7TA 3TWZA 1OY9A 4AFFA 1HWKA 5DQGA 4PWWA 3GIMA 4EYIB 1VQMS 3P49B 4TQRA 1RTDA 4DR5F 4IOBA 2QL5B 4J9QA 3ZZ0A 3UDLA 4ETZA 3K59A 4RU9A 3QIPA 3NOCA 3EJMA 4RUCA 2YH1A 2UXCF 1JWWA 5F8LA 4J9KA 1TVRB 2E5LJ 3LP2A 3TAPA 2APOA 1R31A 1F9EB 4ZPAA 1R6YA 2IHR1 1R8PA 5F3TA 3PFOA 1FVQA 3SCLE 4EI2A 4DS5A 2KYZA 3PX4A 5HLFB 1VQ5S 4KGZB 2DXFA 2DITA 2DD8S 2WVCA 3WC0A 4DXLA 1IN0A 4OYAA 4N76A 2X3DA 5LSOA 3W9IA 4L3KA 1R8HA 3HSJA 4C7QA 2ZDOA 3P6YC 2YWKA 3M32B 3I9V9 2RQCA 2W7OA 2OP5A 3UW1A 1MSWD 3LP1B 4OX8A 3JQMA 3K5NA 4X4NA 3MOZA 4ED2A 4IG0A 3HD2A 4OZ2A 5DRKA 4AQYJ 2GVDA 3MM7B 3QJLA 3DRSB 4I64A 2EPIA 1WG1A 4DSEA 4JI3F 1YLXA 2XWXA 5D0EA 5KFNA 2N4CA 5IT4A 3PW7A 2AYGA 4LSZB 2R7XA 2DISA 4DV1J 2GAHC 1QUVA 2G13A 3CJ3A 1FXLA 2XULA 3GR0A 2WSCC 5CHCB 2OGUA 3VQSA 1S6QA 2XSJB 4ECRA 4IRDA 1DTTA 2KJWA 3GYXB 3M2UA 1PAEX 4FNIA 1IWGA 5CQGA 1E6VA 2FY8A 5KG4A 4B3SF 3MECA 3BB5A 1S1VB 3MEDA 2GIFA 5CYMB 2ZH8A 4ZVUB 3M6VA 4NEYA 1RWKB 2K3IA 2PC6A 1HNZJ 2YKAA 2VFRA 1HHQA 1TKXA 3HHLA 4L3NA 3MCNA 3EX7B 1X60A 3I82A 4PG4A 4ILRA 1BQXA 2EFPA 5FDLA 1RT6A 1Q53A 2HPUA 3I96A 3U02A 2VHGA 3B78A 1I6JA 3SCIE 5DJBA 1QM9A 1FDDA 3KG1A 1F0XA 2IYIA 4MT1A 5I4MA 5DDQC 2XMVA 5IT9Y 1BMQB 1VR6A 2A10A 1JXLA 5C7PA 3AJ1A 3DLKB 4CO1A 4CO4A 4X66J 2HURA 3BBBA 3ISNC 2HS0A 2AF6A 3CWJA 4WP8A 5KG3A 3G8QA 4EYHB 4ER8A 1NMEB 4DFMA 3DU5A 3PY8A 5KFEA 1X4EA 3MM8B 4ZDNA 2QFJA 1T11A 3CJTA 2X1GA 3SQGB 5J2MA 1NJWA 3BGOP 1YJWS 1O51A 5KFFA 2HHHF 4QWEA 2HVZA 3UQSA 4Y2AA 3C3LA 5DM6Q 4ITSA 1L3UA 1YQHA 5CYJA 2XSFA 5K8NA 2ZEJA 4ECQA 1RKJA 4LF8F 3KDOA 3NCPA 4URGA 2F4VJ 2A2DA 3D6MB 2WZ1A 3L95X 1Q4RA 1FO1A 3PR4A 5DG8A 1IM4A 2RQ4A 2ZDPA 4IFYA 1PKUA 2C2DA 4FZVA 3BKFA 2DIUA 2QC3A 4LF4F 4RL1A 1R0CB 2DNKA 4ED8A 3O1LA 1JJCB 4Z7YA 3MMAB 4CRJA 2XZWA 4IR9A 2BX6A 5SZTA 1RA7A 5F8JA 2L9DA 4YDXA 1H6KX 2HHXA 2OELA 2BE2A 2MB0B 4NCAA 2AJ4A 3HVRA 5AXKA 1RWUA 2AQ4A 2M9KA 3DGPB 2ZH1A 2F8MA 1JLQA 2XQCA 2QX0A 4O3OA 2BM0A 4YY3F 2OIHA 3GILA 2C42A 3HULA 4RUBA 1QJHA 2VBYA 3H5SA 3RAMA 2MEWA 4QU6A 2P2CB 4A48A 3M2VB 4CLFA 3W60A 4IH7A 1TL7B 4MJKA 2UVUA 1DFDA 2JC0A 3M8QB 4LRBA 3M8QA 4RBVA 4C11B 4BS2A 3N0VA 4NLPA 1RDRA 3MD3A 4I2PA 1NSQA 1WHVA 3W63A 3DM2B 2ALZA 4IUFA 1PJ7A 1RE1B 2ZITA 2FGOA 1BQNA 4ZJQA 2MYFA 4DUYJ 2C2OB 1F1BB 1FRIA 4ANDA 4JI2F 3OJUA 2UVRA 2JRSA 2AZ1A 4NZ7A 4YR2A 1HKAA 4I6YA 3VQTA 4DL5A 2VFTA 1NPKA 3LPEA 2JC1A 2QLFB 1O8BA 1B4SA 4GMKA 4CIOA 2JL9A 5L39A 3R7SB 1F2GA 4LFAF 5LOQA 2FJVA 3L9ZA 2DCLA 3FDSA 1R43A 5GAGU 2N4DA 1EETA 2D74B 3L3CA 3N9UC 4ZMMA 2OLWA 4X66F 1XMOJ 3AD9C 2JLEA 3AH6A 3H4BA 3K7RA 1PILA 5GVQA 2A1BA 1T9YA 2GJ2A 1FWKA 3T1YJ 3GCWP 2GVZA 1C4AA 3ENAA 4LVNP 1NB7A 2FDNA 2V1TA 2O3DA 1XNQF 4DQQA 3W2WB 1P8GA 3MR6A 1T3NA 4KKOA 2BW7A 5ETVA 4OLOA 2KFZA 3C14B 2N82B 2FZKB 1EX8A 5DDPC 4DFPA 2LU1A 4TY9A 2DRAA 3RRKA 2LVWA 4WTOB 1SQEA 4TXSA 2ZVIA 4JI8F 4E98A 1T02A 3RUBL 4DSLA 4ZVQB 3MAQA 3N28A 1WWHA 1T7PA 4MK8A 1FT8A 2IIHA 3TVZA 2IAJB 2DNGA 3B54A 5F3ZA 1X0FA 4NE9C 1F5AA 5KFMA 1QSYA 5BR8F 5A76A 1MG7A 1YVFA 2VDHA 4FXWA 4PQAA 3EYZA 2RS8A 3UD4P 1IBKF 4FXDA 1U2CA 1QSSA 3AX3A 1F2HA 2NPFA 5KFYA 1NHKL 3SV4A 1X4GA 2EG1A 2BRKA 1VQSA 2HFUA 2HZAA 4Q2MA 3WZ0A 1N6QB 4ES3A 2G0JA 2I5JA 2XTDA 1UEVA 2M0GB 1S9FA 2MLYA 1IR2A 2MQQA 3V6DA 2LQ8A 1TL5A 2E7VA 2W01A 5ETQA 2ZJRQ 5DETA 4IQXA 3M2UB 5GADU 1FKOA 5HVFA 4RU2A 2A3JA 1HNVB 1U4BA 2ZC3A 2GS8A 1F9FA 3OR2B 2Z8QA 1N0VC 3PHEA 4FPIA 4DCPB 1IVZA 1X9MA 2CG4A 3PXGa 2B8QA 5IM0A 2DH8A 4P74A 4YHHJ 4DQPA 4LF9F 1TAQA 3DRSA 2KVIA 1RYRA 2WSEC 4X4RA 2OMLA 4K59A 1KTQA 1X4CA 3UR3C 4R0JA 1TK5A 1IQTA 2R8GA 3ILOA 4KYZA 2W7PA 1M5OC 2CNNB 2D3O1 3UN3A 1WTBA 1JX4A 3NNHA 3NGTA 4ICLB 2J7KA 2R2TA 2MKHA 5LMUF 2BE9B 3A3NB 4CH1A 4A8FA 5DZ7A 2IVFB 2HQ3A 4QYZJ 3C6UB 2DBBA 2VFSA 1B3TA 4Y2IA 3SDEB 4D3GA 1N5YA 4J9RA 4DPYA 4A4JA 2ZC4A 3TZYA 1KKHA 4P75A 2RRNA 3AQPA 2RU3A 3QGPA 1C0UA 1UJ5A 3QLHB 1UA1A 1RYSA 2G4BA 3AT1B 2MHEA 3M30A 3BN4A 2DNZA 3N6NA 2OUGA 3CJ8A 2C3YA 4PEOA 2M70A 4RJVA 5KOXA 1ZM3A 4UZCA 3J7YU 4DV2J 3NAHA 1IBKJ 2BOPA 2FJXA 5KG2A 2RQKA 3R6LB 2OPQA 4DR1F 2CJQA 5A0YA 3MEGB 4MKYA 5G4DA 3HJFA 5LXRA 2V8DA 5J2QB 3OXGA 4NLQA 2M4MA 1X5TA 1FA0A 5LMNJ 2IM2A 2B7CB 4WU3A 3OJSA 1FK9A 2OPRB 2WONA 1R6VA 3O6QA 1WHWA 5ETKA 4MAKA 3KJVA 1GX6A 3DHWC 2ZBPA 1YRTA 1S7IA 1CC7A 1BXNA 3JQKA 1Z1ZA 3M8RA 2XYHB 5D78A 1N8RT 3CT9A 4DV3J 4K4YA 3MUTP 3WX4A 3Q0AA 3QWPA 3CDWA 2HHUA 1MLAA 3JSBA 4PG8A 1R0BG 2CIMA 1VQLS 4AUKA 2OJ3A 3KG0A 2YX4A 1CULA 3ZNJ1 4AL5A 1N36J 4ECWA 3U1MA 3PRBA 1H72C 4NMXA 3G8TA 5CXTA 2LCWA 3KNGA 2MLXA 2R7WA 1G2EA 4OV1A 1WC6A 2MSSA 4ED7A 2YKMA 4Y2CA 3UNYA 3HVWA 1OIAA 4WFAQ 1C4CA 2UXDF 1JLFA 4NI2B 4DCOB 4OI4A 1FKAF 2P5VA 2EI5A 1O6XA 3W9JA 3CCJS 2PI4A 1U1KA 4ECYA 1K47A 4QPTA 4EZ6A 1EP4B 4M5HA 3RB3A 5K20B 1SIWB 1NAQA 1WELA 2J0XA 2VG5B 2CXEA 1VBYA 5JXSA 1GX5A 5LT5A 3S8SA 1OY8A 3K8WA 4M5NA 1K44A 4ZVGA 4EO6A 4C2MA 4CT8A 5GAHI 1MU2B 1CJUA 4LRDA 2PA8D 4NMLA 2CPYA 4FXVA 1M1GA 1TK0A 2MPUA 3G86A 4FF4A 2HSEB 3LWMA 1FNOA 1VK3A 3HHLD 3TZXA 1VQOS 3QQCD 1NK8A 2IBKA 3CCLS 5HBMB 3OFGA 4IO9Q 3M2VA 4G65A 2V9WA 5J1NA 3ZXWA 1VQKS 2WK4A 2GZOA 1UPMB 3ELHA 3BKTA 3HFKA 4ED4A 4DX5A 1FJGF 3T9NA 1BE4A 4PPDA 2Q66A 1RTJA 1TZ0A 2FGCA 4NZ0A 1TUVA 2WHOA 3DI6B 4L74A 3OL8A 3Q83A 3W64A 3QRRA 1Y4ZB 4MK9A 1SC4B 1U8WA 1BWVA 4QWCA 3BDPA 1VLOA 4KB7A 1S9EB 4ELVA 2KG0A 2RVJA 3HCXA 4M5JA 4WP9A 4Q5VA 1X5PA 3ITHB 3FJ2A 3I55S 3AOBA 4DLGA 2M88A 1RQ0A 4XK8C 1BY9A 1CJTB 4PAAA 2RMLA 5KFUA 4OHXA 1CJVB 4FYDA 2DH7A 3AWRA 4P2MA 2OSQA 4AQYF 4Y2MA 2AIRB 2OKQA 4R25A 5IS2A 3O2IA 1Y9OA 4ZHRA 1FFGB 4DWIA 1RAJA 4ENOA 3BO3A 4GRSA 4I69A 1CEZA 5IWAJ 1DTQB 1OPIA 1E6VB 3PM9A 1TKDA 1PYSB 3QGIA 4LF5J 1UETA 3DCAA 1AB8A 5GMKa 3KLHB 3LANA 1TUGB 1FDBA 1K1SA 4OZLA 3T5HA 2F3JA 2VONA 3QZ7A 1RBLA 2HQIA 3H90A 3V4IA 4EO8A 2V8VA 4KSEB 3HI9A 5A8KB 4QIEA 2HHTA 1SPBP 4B3SJ 4NL5A 1U6ZA 3HF5A 5HMXA 4N5SA 5HO4A 3CCRS 2R7UA 4RW4B 1X5SA 3T1HF 2E44A 4X4SA 1RAIB 2IDLA 1R0AB 5F9NA 3IRWP 3KUEA 3IMQJ 5SUHA 3I56S 3MZIA 4IKAA 4XTTA 3S7RA 3KLFB 1V5VA 3IM8A 2FQQB 1PO6A 3KLEB 3DOMA 4DL7A 5F0UA 2Y1IA 1DHMA 4FBUA 3I87A 4G3IA 1ZA1B 1PC5A 2YY3A 1UW9A 4ZPWR 1S5ZA 2KHDA 5M2PA 3H2LA 4HHHA 4WIIA 4IG3B 5KFVA 8ATCB 3MEDB 2JVOA 2FPHX 2LXFA 4OX9J 1GEHA 3GTYX 3MPDA 4KH1B 3ZTRA 2AGPA 1N54B 1ZZNA 1WSVA 4HVZA 2H48B 2ASJA 1RXOB 3KDNA 4J9VA 3W2VB 4OJ1A 2V8PA 3TQ1A 2BOAA 5HQMA 4EGLA 1SC1B 2J9DA 2PEBA 5KFXA 2GX8A 4KHMA 4CYUA 4CYUB 3CXCR 3SZ2A 4JI1F 4JYAF 5F8IA 2E66A 2X51A 3HHKA 3MR7A 1KLMA 4OIXA 5KG6A 3GJTB 4YFUA 1VCTA 1YJ9S 1SJRA 3MCMA 4IG0B 4RBTA 4JI6F 2DEJA 4EUVA 1TR0A 1BC6A 4ZPTR 5KTQA 2XHWA 3TUPA 2E1MC 1S1XB 2G1DA 4D3HA 4UQGA 5D3GA 3MM6A 1ZZFA 5CH7B 1M0SA 4M5IA 4KV8B 3KK2B 3KK1B 4KV8A 2C2NA 2R2RA 4JV5J 5J1EA 3VGTA 2M7SA 4ANEA 5C24B 2VD3A 3F41A 1M5SA 1T8EA 4WE1A 2MGZB 1S12A 1S6OA 2ZBRA 3MUMP 3FSYA 5CZVA 4BHQA 7FDRA 3RZAA 2FVSA 4NLVA 5KFBA 1X4AA 2VBWA 5E0OA 2V4JB 2OEKA 4KAIA 3T1AA 4XDDA 2MKYA 5E2QA 2PMZD 2IMWP 2JSXA 1CS4A 4LFCJ 3UO0A 1RBAA 2A18A 4MIBA 3WHIA 3VAJA 3VAKA 5LMNF 1ZH5A 2LQJA 2OPSA 3Q22A 3BGUA 2IJFA 1NZ8A 2IPOB 3CE8A 2LP4A 3EXYA 5HVHA 2H9ZA 3WIUA 4U7UD 2CFXA 5AJ3J 2VQEF 4DV7F 1TKZA 3GCXP 3TOQA 1RHMB 2V2QA 2OTJS 4DSKA 3D0HE 2UV8G 1UL3A 2WB1D 4HT7A 3RRHA 3C2PA 4O3NA 4U8VA 2RHSB 3CCZA 2QMUB 4TNOA 2HVEA 2ZM6J 2F1FA 3DRYA 4QOTA 1W26A 3ZNUA 2YX7A 3W9HA 2E29A 2RIJA 5JUMA 1UVJA 3M1VA 4ZPBA 4I6WA 1ZTTA 1ZOTA 3LGNA 2R7RA 1VQ7S 2VFUA 2ZKUA 3PCOB 3CDAA 4USJC 4GVBB 3HZGA 3SFUA 1F3FA 1WEZA 2YQ3A 3MD1A 4J91A 5EGYA 3MM5B 5KFCA 1WEYA 2IMOA 4H4KA 1SJ4P 2KT5A 5IT0A 2QGFB 1UEUA 1VQ9S 3NLCA 4LBPA 1KWMA 4YUDA 3A13A 4KIAA 1L3TA 1QLNA 4B3TF 4GKJF 2Y0SD 1ZTWA 1YBTA 3CC7S 3CW2C 1YI2S 3V81A 5L1LA 2Y9HA 4WIQA 5KFLA 1RTJB 4FN5A 4DMZA 2XTEA 2J9CA 1H38A 1Y5IB 3GZ7A 4NLRA 2ALYB 2QN6B 4JI6J 4JV5F 1NJZA 3ZZYA 4J9PA 4ZP7A 4IQMA 1LW0A 4WFBQ 2CJKA 3R5JB 4HR2A 4KH0B 1J5OB 1Y5NB 1JNZB 1CG2A 1RAGB 1LWEB 2QLJB 3CF5Q 1R8BA 3BSAA 2FHJA 4YR3A 3TP2A 4EBEA 2PT0A 2FJDB 1RWOB 4QR1A 3UCGA 1S4EA 5DLFA 1GAOA 1G7CB 1N5SA 4DL6A 1WI6A 1JIHA 2EKNA 1RT4B 4FF1A 1VIOA 2M52A 4B9NA 2C28A 4N56A 2L3MA 5KT2A 4F04B 2YQ0A 2W4PA 2FY1A 4PXDA 1V3SA 1VRTB 1WTFA 3N6LA 4KY3A 1VISA 2LQBA 3BSNA 2B6AA 3M6WA 3DI6A 4M5LA 4XO0A 3OUYA 1JJ4A 1PG5B 4G6VB 2F63A 1VJWA 1EQ0A 2D68A 1RTIB 3ETMA 2CKWA 2V2VA 1PAUB 2D9PA 2RDDA 3D7SB 3D67A 2YKNA 3DYAB 4G1QA 1ZAVA 4NYOA 4HDGA 2HFOA 4OZ0A 1SUQA 3C16B 3OUYB 1U1QA 1SL1A 4GC7A 4TU7A 2Q6CA 1K0VA 4UT4A 1A6LA 4CLUA 4K5SA 4E0DA 5L1IA 4DQRA 4WWSA 3Q8SB 4M5DB 4LF9J 4A8MP 1NU4A 2DT9A 3ICLA 2LMIA 2BJDA 3VV2B 4ZVPB 4RNFA 2BJ8A 2AX1A 2PSZA 2V0NA 1HNIB 4IOCQ 2I8EA 2Q3PA 1D9FA 3GONA 5KG0A 1S1WB 2EFQA 3A8IA 3EICA 1RAAB 3IP0A 4L75A 5RUBA 1KHWA 2E5JA 2MZQA 3MFHA 1NSAA 4DSFA 4LR9A 1TK8A 1S77D 1NJXA 1FD8A 2V8HA 3I5AA 4ZVFA 1J5EJ 1JLFB 1TKZB 1GFWB 3POTB 4O3SA 2FHJD 2DNOA 4TKTA 1Q8KA 3QPIA 4I56A 3RGIA 1LXJA 3DLHA 3PHTA 3NS7B 2AD9A 2HGMA 3GFZA 3G82A 5J1PA 4NXNJ 1LW2A 5C2GA 3K58A 2B9XA 3OFEA 2K06A 2VPWB 1G4CA 3S1TA 2HVDA 4NLWA 2BJEA 3NOGA 3QO9A 3QYYA 4MTPA 1AT1B 1NDCA 1TV6A 4Y65A 2YH0A 5K14A 4UOGA 3SDEA 4C9DA 3C8YA 3SSRA 1YJVA 2UUCJ 4IH5A 3VWSA 1IUJA 1S1UB 3DMJA 1RISA 4UOHA 5T7LA 1U49A 3T9ZA 1RCXB 1QAIA 1NPPA 4K5RA 1AROP 1TAUA 2Z58B 4O4RA 2CJBA 1RWNB 3MM6B 1C0TB 1WF1A 3A8JA 4FNHA 1Y3JA 2J8SA 5IQ6A 4ZCMA 5HVGA 3FGVA 4RW8A 3HSGA 4EBDA 3S01A 1HA1A 3BREA 4PWDA 3NL0A 1ITPA 3PYFA 2RNEA 2AZ3A 1UFKA 3M05A 2ILYA 1Q7LB 4DL3A 2O67A 3UDVA 4RUHA 3BGRB 1PIEA 3G6VA 1SXLA 1HMVB 1TP7A 1SVDA 4ECSA 4DR6F 3UCZP 2BJ1A 3W1YC 4MK7A 3WIVA 2DH9A 2E1AA 4HACA 4OX7A 3NGDA 2F4VF 3OR1A 4OHWA 2ZHBA 2FVRA 3DLLQ 3QJPA 3DLJA 5DQIA 4C8KA 3T5LA 1RTZA 1OS5A 3SEOA 3J81j 4LIRA 3A8KA 3FZBA 4CNYA 4P2XA 2E1CA 3GP9A 3GFXA 2CQ4A 4E8UA 3RW6A 1UZDA 4RW9B 3V6DB 3BM7A 2W9CA 1Y7PA 1D9DA 3J80Y 4NLOA 4NPOA 2CQGA 3MMCA 5KFKA 4DX7A 1N48A 1VMBA 4LSNA 3MPWA 4P71A 2G9OA 2Z57B 4KHPF 5D3GB 2UVVA 3MM5A 3C15B 3DXSX 3THPA 3UVJA 3VHQA 3TARA 1RLDA 1RT2B 3SIPB 3KUGA 5HP1A 2HLTA 3L4BC 4X65J 2YNFB 3D68A 1IBMF 1S76D 2HIYA 1ZA2B 2DVIA 1UCNA 2XO6A 1QVFR 4GKJJ 1CLFA 4QW8A 4TQSA 5E3RA 2AU0A 1H74A 3LP0B 2RSQA 4U6PA 4XPCA 4XIUA 2B51A 4RW6B 4WTYA 4V19J 3R2DJ 1VQ8S 1IR0A 3OR2A 4URSA 4OZ1A 1S4FA 1TELA 3EM1A 4A8YA 3QIDA 4WFXA 1J27A 5GMEA 5L9XA 3OLAA 3DLGA 2ZFHA 5KFGA 4EMDA 1FDAA 1KFDA 2VOOA 4A8KA 4FYVB 4IG3A 1JJHA 3GWCA 1HARA 3TZWA 1RT7A 2BACA 2CQ1A 2IFXA 1JLGB 1VRQC 2Q43A 2D7SA 4LF8J 3D6FB 4F0HA 1W2IA 5CCLA 1HNXF 4K0KJ 1S0MA 2ZNYA 3R7BB 4C8NA 3CD6S 2PFFB 5HP1B 1TL1A 2L9WA 5FJ4A 1OM2A 5AXMA 1IBCB 3IC1A 5C24A 4NLXA 3H5UA 4HHUA 3VAGA 4USHA 4ECZA 4LSNB 2FHKA 3AJ2A 3RJMB 4RW4A 3M2RA 1N4LA 4U95A 2E7WA 3KXDA 3KHHA 5IV3A 1DY3A 3F0NA 1I1GA 2FC9A 2AGQA 4CWBA 1JLEA 1NPRA 4QWDA 1BQNB 1P1LA 2QE5A 2UUTA 2B4VA 4WKYA 5B09A 1IBLF 2H4YB 2M5YA 3SI8A 2ZWOA 2OEMA 1XMQF 3NS5A 4HTIA 1U2RA 2OMOA 5F41A 3J7YI 1U0HB 4PCQA 5IC4B 4FP9A 3X3UA 4QIFA 3KJNB 4CZCA 3OSPA 3B82A 1FRJA 1HBNA 2IVYA 2NS1B 2E9TA 4PABA 5B08A 5L38A 4M95A 1FKPB 3GYGA 4V19X 3U7JA 1OSDA 3BR8A 2XS5A 1UTAA 4YHHF 2FB0A 3ILJA 2OFGX 1GNKA 3GG1A 3GPAA 3V6KA 2HQGA 1Y00A 2CQIA 3EE3A 1TFWA 4J37A 3ETOA 1S1UA 3DMJB 5T7LB 4YDDB 5KOWA 1N56A 4UUWA 2MXYA 1ULRA 3FFIA 1O5JA 2AP6A 1C2PA 4WYLA 1TV6B 2VUGA 2P9GA 2QO3A 1GMWA 5DDOC 1GMVA 4ZJLA 2ZD1B 3TRGA 3FUYA 3MR3A 2PMWA 4ZPDA 4PG7A 1Q81T 3IWLA 1KSPA 3GSDA 4ILMA 1LW2B 2XZTB 3RW7A 2X1AA 5ETOA 2KRRA 5HBMA 4HLBA 4ERDA 1Q5VA 1EARA 3X1LB 5HMYA 3IBWA 3T3FA 4DR4J 3CMQA 2W24A 2VU5A 5I42B 1UVLA 2B5JA 1UPPA 1HI1A 1EKRA 2JX2A 1CJUB 2JWNA 4B02A 3MM8A 1XC9A 4ZCKA 1YRXA 1KR4A 1PCAA 1LWFB 2HZCA 1NSKL 2J6UA 2CRLA 3EGWB 3MAHA 3ZZZA 2E5LF 3OSNA 1PBUA 1WOPA 3IGNA 4I67A 4YOEA 2HNZB 4OI2A 2MHNA 3H42A 4QQBA 2MZ1A 5JVHQ 1SL0A 2DR9A 3HVAA 3HHDA 3N79A 2Z2ZA 1FNMA 5C42A 2GHWA 3EZUA 5CAAA 3D0IE 3BPDA 1JNRB 4HDHA 1C1CB 2YNHA 3FCVA 3IO1A 3PJWA 4IFYB 4IH6A 1M5PC 2AEMA 2QA4G 5J2QA 2HQFA 2YWHA 5LSRA 2ZZTA 2GQ2A 2IBOA 2PDAA 2KI2A 1RAEB 4JI5J 1LNQA 4ZCLA 5F8HA 4ES1A 3G8SA 2CWXA 3R3TA 4QR2A 3FSIA 2JH3A 2YKNB 3CJQA 3ILLA 4G1QB 1FEHA 1VS3A 1WJ9A 1HBMA 2OSRA 3RB0A 4L6V3 4M1KA 4CO3A 4HHJA 4K2XA 2C1EB 4AXIA 3R7NB 2UUWA 2HKEA 1KRPA 2NXUA 1HYSA 3OTBA 5HATA 4S0MA 4FBTA 1NM2A 1WDDA 1U48A 5BJRA 1JLEB 5BYQA 1LEOA 1F9HA 1XBWA 1Q1KA 2Z0GA 3QT5A 1V3ZA 2PN6A 4ATNA 2B43A 1HQ2A 1WDTA 2QMWA 1NH8A 4CO2A 3BQ2A 4ECUA 2XNQA 2IY5B 2Z2YB 3TUIC 1KTVA 4KFBB 2AJFE 5A2QY 2KRBA 2KVQE 5U47A 2UUBJ 2NYIA 4B3OA 3AA8A 4CLZA 4NCBA 2DGVA 5EDWA 2AX0A 2YX1A 1NDKA 3RBDA 5C5JA 3K0JA 2P8IA 2VC0A 4IFVB 1FJCA 2CZ4A 3DRPA 5FDLB 3W8GA 3F56A 5KFQA 3CC4S 1F5BA 1N33F 3DOLA 2HHPA 2Y3YA 3IFEA 4IYQA 2I2YA 3OL9A 4F4ZA 4A8QA 3EVWA 1S1VA 5CYMA 3J81U 4WBFA 2BQRA 3R1HA 4KPYA 3PW5A 2YKMB 1DTTB 2KFYA 2IYGA 2R7QA 2XSJA 2R4FA 1MN7A 2DKOB 3BF4A 3DLEA 2BM1A 2VASA 2XMTA 3GJSB 3W5YA 3ZTSA 1SQGA 4CP5A 4F4AA 2BXJA 5A6PA 1CULB 2I5JB 2XI3A 3ILIA 2DJWA 4HT5A 1CJKB 4JV0A 3N5BA 4OI3A 3BBFA 2ZJQQ 3QSYB 1NHUA 4NA2A 3UDCA 3KG4A 3I9ZA 4PG6A 4Q43A 3D1HA 2XCPA 3DDKA 3FCHA 4U7CA 1MWQA 3OTOJ 2VQFF 2BANB 3LTOA 4GO5X 1SV5A 2L41A 4K4TA 2ACMA 3FK4A 1DZ5A 4ES2A 3CSKA 1H7XA 3M1VB 2R7OA 2KO1A 3SSQA 4CLTA 2D69A 5KT3A 3CJRA 3Q89A 1REGX 4PG5A 1E6YA 1RAFB 5F0WA 1FE4A 4LQ9A 1BQMA 2KB2A 3ZZTA 6FD1A 2CNKB 3BPSP 3KLGB 4DV0J 2FHMA 4ZLPA 4MKVA 3AODA 4AL6A 4Q44A 2I1RA 2ASDA 1URRA 2AMCB 1U7LA 2GCFA 3DRXA 1FESA 3K8VA 4C6AA 3MI7X 2FD2A 2OPSB 4K4SA 2W4CA 3HVTB 4K0KF 2OPPB 2K7KA 2MY7A 2OPPA 1KVKA 1SQFA 1YJRA 2A6OA 1EZZB 3K89A 1N34J 3LO3A 3DOLB 1DJ0A 1QDUB 1GXLA 1KDNA 1YRUA 2CVIA 1N6QA 2B9EA 3MR5A 3PJXA 3M8PB 1QE1B 3OW2R 1YZ6A 5DM7Q 3DDIA 4I7FA 4ZVEA 1FVSA 2K3KA 3CEDA 3OXLA 1AUDA 2G1HA 4LFCF 4DR3F 3PIOQ 4WFZA 4URQU 3BDEA 1RHKB 4NYPA 2BE7D 1LWXA 2XZDB 3KK2A 2HFZA 3IAS9 3T41A 3OPKA 5KFZA 4USVA 1ZAWA 2FVPA 2JEJA 2BANA 1D3WA 1BGXT 3NAIA 1S99A 1WKLA 1VIXA 1IJEB 3AA9A 4PPZA 1VOMA 2GJFA 1NZAA 4LBHA 3M8YA 1HYSB 3CVKA 2VPZB 1IJFB 4I2PB 2ILZA 3Q86A 3OVAA 2G2YA 2HBYB 3M6UA 2XEXA 2DGQA 4OMFG 3DXBA 4OI0A 4W90B 1BWEA 3UI3A 2AW0A 4E2FB 2VQFJ 4N47A 5L1KA 4QYRA 4LSLA 4WK3A 3G4SS 4Z2XA 4A8SA 1MW7A 5H1SV 3R1LA 1X0PA 2UXBJ 3I32A 4LBIA 2PMHA 3BH7B 1S1TA 1RWXB 1TL3B 4ECTA 3ISZA 3CGIA 3B4MA 1U2FA 3O8WA 3JSMB 2V94A 1KLNA 4F02A 1RP5A 1EETB 2JNJA 3NGUA 4KRWA 2DO0A 1EHWA 4DV1F 2VOPA 5C42B 1N5VA 5LL6d 5LSLA 3M9OB 4YN3B 2X1FA 2JFDA 4B3RJ 1KBRA 3CO0P 2IC3B 1T9VA 1SJ3P 1SJFA 2OHDA 1L5UA 3W5XA 4M94A 2RH3A 1LKZA 3ISND 2BQUA 1UVMA 4DEZA 3ZTQA 5CYQA 4R8UB 2VG7B 2LDYA 2Y1LB 3PEJA 5H9EK 2JEGA 4QBUA 2XNRA 3M4XA 5IQQA 3DM2A 1DBDA 2AJ2A 2XTJP 3GR1A 2XWYA 1NB2A 3CDEA 3HPOA 2KDOA 1FWLA 4P73A 1UVIA 1TMMA 3RR7A 3CTRA 2AT1B 1H7WA 1HHSA 1WI8A 1QTNB 2QLWA 5J2MB 2Y8WA 3TUZC 1URNA 4ZP8A 1NLKL 3P8BB 3DLEB 4JB8B 2I9SA 2ZH9A 2QSFA 3KLHA 2YNGB 3HZEA 2BR0A 1HQUB 4NXMJ 3FC9A 4ZK7M 2B6AB 2OTLS 1NCLA 2ZH6A 2JLFA 3CULA 4L73A 4O23A 2BVZA 3HKZD 3PW4A 1U1PA 4KGXB 2ATCB 2PA3A 4C97A 3R5BA 2FVQA 1YITS 1QTMA 4BWMA 4Q0BB 2W9AA 3IGVA 4IFVA 5D4LA 1S0OA 4NLGA 1YJNS 1CJTA 4LF5F 1P6TA 1GXTA 1DQ8A 3MCSA 4J5OA 4C0OC 3GIJA 2DHAA 4F8RA 1SH0A 2F4FA 2NUHA 3I6PA 4B3OB 2ZWPA 2CJ9A 4FYYB 4MYUA 4UTGA 1AZSB 2HIQA 3ENVA 1BUXA 2BEFA 2DPIA 4MH8A 1W25A 3L09A 1PSDA 1SKUB 5E3AA 1FRKA 4ED5A 4YB1P 1KHVA 2VPYB 2W4DA 4IO1A 1IM6A 1NO8A 2DGUA 2NXCA 2ZE2B 3DDNA 4FPRA 4RPFA 2DY9A 3NP5A 3UE2A 3VGUA 2NR0A 4C11A 3MAAB 4AXJA 1FNXH 2IJRA 1HLWA 1AA1B 2MZJA 4DR1J 2ROGA 3CNQP 4C3KA 2MKJA 4F50A 1HR0F 1IKXB 5AXNA 3QATA 4FS1A 1MU2A 1RU2A 2KG1A 2LA6A 2J9EA 5D4PA 1ELOA 4X64F 4N8NA 1PC4A 2ZD1A 1JLQB 4F0MA 2CPEA 3AOCA 3QFWA 5DG9A 2F40A 1L3VA 2WW4A 2MLZA 4LF2A 3TAMB 2YKOA 2IC3A 3HFZB 3T6JA 3JSRA 2DR6A 4G1IA 4Y6IA 1DLOB 1JKHB 2F65A 3KMSA 4J9OA 4Q0BA 4Y0FA 1VK8A 3JAMU 2QV6A 4OYPA 3TR5A 3ONQA 3NG8A 4ALZA 2RB7A 2VODA 4B9UA 2BMBA 1S0NA 1HWLA 5KFOA 3Q23A 1YTYA 1S1TB 1OO0B 1TL3A 3FMBA 4DI6A 5I3QA 2HHVA 1YK9A 4KTQA 1JLBA 2EC2A 2WVBA 4DR2F 2RJZA 2KT3A 1ZM9A 2V69A 1UA0A 4RX6A 2QYCA 4ID5B 4CT9A 5CD4A 2NREA 5CCMA 3LP0A 2CVEA 2P6SA 3ZO7A 1RWMB 1Q86T 4F2RA 3UFCX 5KT4A 1NBEB 1RT3B 1KQKA 1MMDA 3TA0A 4F3OA 3VZIA 3I0SA 3LW5C 2LU2A 2AV5A 1N5TA 2HFVA 2VG7A 3QBCA 1SC6A 4DV5J 1N32F 2XTCA 1U1MA 4IOAQ 1M5HA 2W2QP 3AD7C 3FFIB 2XGPA 3KHLA 3UPFA 3CCQS 5J2NB 4DQSA 4QIVA 2WB4A 3Q8PB 3MPUB 3W7BA 2DNNA 5A2QU 3GLJA 4MIAA 5BXIA 4DPTA 2W9CB 5AXLA
chains in the Genus database with same CATH topology
4UOCA 4IRKA 4FVMA 1T94A 3MEGA 1QAXA 2I0XA 4RNMA 1JLGA 2EK1A 1MROB 2O5DA 4ZOSA 3MEEB 5KFDA 2KYXA 2PE8A 2M2BA 4M63A 5HROA 2F8EX 4B9VA 4GO7X 4JI4F 3J81Y 4FF3A 3I5CA 2V9KA 1HBUA 1FTCA 3QLHA 4BWJA 1U47A 4X4TA 3BEGB 2QMXA 1T3OA 2F7VA 3G6ES 3CCMS 1KOHA 3E01A 2AYMA 1WF2A 4ZCIA 4KJIA 2RF2B 2BABA 1JB0C 4LVOP 1E6YB 3Q8QB 3B8HA 4DDFA 4DV2F 3PNIA 3I0RA 3A8EA 2J76E 5IFMA 2W9BA 4ZS6A 2YWGA 2F9DA 2IA0A 2ZH4A 4PUOA 2AGOA 3TYTA 1XN9A 4K50A 2EBEA 3J7ZT 4ILLA 4I7FB 4YQWA 2DR7A 1R8CA 2PIIA 2PD1A 2DIVA 3BSCA 4YEAA 1RT5B 2E7XA 5G0RA 5KFSA 1WHYA 5KFHA 5IWAF 3T3FA 2HLUA 4DHVA 1O0PA 1Q16B 4OI6A 5MLCV 3CPWR 3BN7A 4YMEA 3MURP 3W3SA 1TFYA 4DX8H 2ZKTA 4Q7AA 1NNDA 1XNRF 5A8WA 4RLEA 4I2QA 4ZP9A 1S48A 3RTVA 2CPHA 4N41A 3NGKA 2MKSA 3JYTA 3H2UB 2MDAA 3D1OA 3DHXA 3OR1B 2KN4A 4H4OB 2XY7A 2XLKA 1Z2ZA 2HS3A 1MMLA 3MMBA 1HMVA 4NRUA 2PO4A 3DOKB 2ZVSA 3IWXA 3DRPB 3K5OA 4ZHRB 2NLWA 3D2WA 3U27A 2ZOGA 4ID8A 4DUYF 4KBIA 1VQYA 1XMBA 3LAKA 5B0CA 2KU7A 2ZHOA 5LJ3Y 3AHPA 4OJHA 5CA5A 4C8LA 2EKYA 2DHXA 2K1RA 2J0WA 2VG6B 4KR0B 4ZKAA 2V4RA 1WEXA 2K8GA 3MPYA 1REVB 4CO5A 2B7BB 3P96A 5K14B 2R8IA 2HMIA 1RJJA 4N77A 2ZUGA 3K2YA 1KQGB 1NK9A 3CIZA 4J9NA 3BQ1A 4OLPA 2EC0A 2BZ2A 4JOUA 1FTRA 1JLCA 2VZ9A 5HMWA 2KM8C 4LJMA 4J9SA 4MIWA 1Q82T 4DF8A 2OFHX 1KNZA 2F9JA 5D8HB 1UMJA 1RI7A 3KKFA 1C1CA 2VKRA 3UNGC 3PZPA 4U7UK 2M3DA 4RW8B 4RUAA 4Y34A 2GJIA 3OHBA 2DRBA 1VC5A 3C6TA 1IKYB 3I31A 3TA1A 4KFBA 2UUAF 5THWA 1HNIA 2XC9A 4C8ZA 3CJ0A 4WXOA 2R2SA 2HG4A 3TI0A 2B4PA 1X7VA 3BR9A 4ETXA 2B9WA 4WZQA 1UAWA 2HNDB 2QRRA 4OI1A 2CPFA 2HHQA 2YKQA 2V4QA 3GV5B 1U8SA 4DUZF 4HTJA 4WCEQ 1ZPVA 1WHXA 1IXKA 3QAUA 2ADCA 3M6XA 5EN1A 2CQDA 3OHAA 2GIRA 2ASLA 3HLUA 1KOOA 2JDJA 1DQ9A 4NOHA 2LECA 5JVGQ 4X4QA 1S9GA 2CPIA 2YVSA 2Z2LA 3WC2A 3D54A 2FC8A 3QZ8A 2D41A 3FEYB 4YR0A 4RNNA 1OWXA 1FHTA 3LH2S 3Q24A 1RT4A 4OHYA 1KS2A