3OL9A

Poliovirus polymerase elongation complex with 3'-deoxy-ctp
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
molecule keywords Polymerase
total genus 136
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3ol9A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ol9A02
1NHVA 3QLHA 5JUMA 1RAJA 2OPQB 5KG7A 3KLFB 3KHLA 2VG5A 5KFSA 4O3SA 1JLAB 1DTTA 2OPSA 3DRSA 4ZVFA 3N6MA 3SFGA 1RYRA 1SV5A 4LSNB 3UDLA 4TXSA 2IM1A 5KFTA 3V6KA 4IG3B 3T5JA 1C1BA 1TKTB 4QWBA 2AGOA 4XPCA 4EBCA 2YKNB 2E9TA 1HQUB 2OPRB 4NLSA 3HHKA 2RF2B 2JEFA 1FKPB 2HMIB 1JLGA 5F9NA 4LSLA 3TAMA 1C0UB 2FVRA 4IRKA 2UUWA 4K4UA 3EZUA 4NLXA 3DRRA 4IDKA 2ALZA 2AGPA 2JEGA 4J9OA 1U09A 1JLFA 3NBPA 1RTDB 2JEJA 4KHMA 3DOKB 4JUZA 1S1WB 4ICLA 1K1SA 1DTQA 5C5JA 3DMJB 4ZP9A 4YP3A 4F4WA 4RW8B 3PJXA 2W9CB 3ITHA 5J1EB 4Y2AA 1RA7A 3Q8SB 3V4IB 2BANB 4IQXA 2V9WA 2JC0A 3VQSA 5F8NA 3T19A 3LP0B 5DG8A 4NRTA 2V4RA 1S0OA 4O3OA 1S6PA 3PR5B 2HNYA 3GYNA 3HKWA 4YR2A 4J9LA 3CWJA 2I5JB 3HVWA 3I5AA 3KMQA 5KT2A 5KFLA 5F8HA 3HVTB 3GV5B 2ASDA 1QAJA 2AU0A 4G1QA 3H59A 2IA6A 1LWFA 3GIKA 1SUQA 3FFIA 2D3UA 4ECYA 3NAIA 3G86A 5KFRA 5HP1A 3GQCA 1RT4A 2OPPB 3IG1B 3IGNA 4FBUA 3KK3B 3JYTB 1BQMA 5DQIA 3RB0A 4QW8A 4DL7A 3OL6A 3MECA 1LW2B 4ZVGA 2ZE2B 1T94A 4Y34A 3H98A 3CO9A 1S6QA 4K4TA 3KK1B 1FKOA 2QE5A 2OH2A 4KV8A 3E01A 3LP2B 3DLKB 4R5PA 2ZD1A 4ZPAA 1DLOB 1KLMB 2DPJA 4F4XA 3RAXA 1SH3A 3KLFA 5KFOA 1JLAA 4RU9A 1T03B 4I2PA 2AX0A 2HAIA 4TY8A 4WE1B 4XO0A 3KLHB 4K4WA 5KFYA 1UWBB 2YNGA 4Q45A 4ED1A 4ZPDA 2YKNA 4FS1A 1GX5A 4RUAA 3GIIA 2RF2A 2HWHA 5EWFA 5DG7A 3UR0A 4NLPA 1CSJA 3QGGA 3DYAB 2W7OA 3QO9A 3TAMB 2IM0A 2FVSA 2C2EA 3JSMB 1S1TA 4Y2CA 3D5MA 2FJVA 2J6TA 3DRRB 4IDKB 1C1CB 1J5OA 1NHUA 3MFHA 1RTDA 4ID5B 4TN2A 4DEZA 2R8HA 4ICLB 2XI2A 4LQ3A 3PW4A 4M94A 3OLBA 4ECSA 5J2NA 1S1UB 2RDIA 4RW6A 4F50A 3CDEA 4DL4A 2BRKA 5HLFB 4JV2A 3KHGA 1LWCB 3DLEB 5KT4A 2YNIA 4H4OA 3OSPA 4ED2A 1RT2B 2WCXA 3CJ2A 3KOAA 3DI6B 4KE5A 4MK8A 1S6PB 3Q8RB 2HNYB 2VA2A 4HKQA 5CYMA 4PQUB 2FJXA 3HVTA 4KKOB 2XCPA 2OPQA 2VG5B 5L1LA 1HYSA 2VG6A 3IRXA 5DLGA 4H54A 1SV5B 4LSNA 4O3NA 4O3PA 4ECZA 3PW5A 3PVXA 1TKTA 1RT4B 2GC8A 5DGBA 3OLAA 5C42B 2FVCA 4MKAA 4O44B 3BGRB 5C25B 3FDSA 5KG1A 2HMIA 1JLGB 3KK2B 2F8EX 4WZQA 1N48A 1C0UA 2YKMA 4NYZA 2IAJB 4MH8A 5KFAA 3PW7A 3E51A 2R8JA 3UQSA 4ED6A 4ED8A 5KFMA 4NZ0A 1VRTA 2XC9A 1ZETA 4EO6A 1JLFB 3BSAA 3NBPB 1TL3A 3MEDB 4MK9A 1IKWA 3TVKA 5KFDA 3GV8B 2ZD1B 3NMAA 1S1WA 5I3UB 1KLMA 5EDWA 1DTQB 4O3RA 3DMJA 1S48A 3M8QA 3BQ1A 1RT7B 4J9RA 5HROA 1T03A 1JLQA 4YQWA 3KLHA 1QAIA 2UVVA 3N6NA 2E9ZA 5L1JA 4IRDA 4K4ZA 1MMLA 3LP0A 3MFIA 3LAKA 5KFPA 5KFBA 4NLYA 3H2LA 3V81A 3QO9B 4MKBA 4B3OB 3JSMA 2QV6A 4J9MA 3CJ5A 3C6UB 2XWYA 4G1QB 4IR1A 3GIMA 2YNHB 1W25A 1EETB 3RBDA 1HNIA 3Q8QB 2EC0A 2W9BA 4WZMA 1HMVA 5HLFA 3RB3A 1S1UA 4RW6B 5KFIA 4K4VA 4Q44A 3IG1A 1LWCA 2R2UA 3DLEA 2YNIB 4H4OB 2FVQA 3M8PB 5FDLB 2AGQA 4X2BA 2WRMA 3DI6A 4KO0A 2R2SA 2ZKUA 4IFYB 1RYSA 1Z4UA 1QE1B 5J2QB 3MR6A 3T1AA 1JLCA 3DLKA 4GC6A 3IS9A 3BSNA 1NNDA 1REVB 3LAMA 4J9KA 5KFWA 1T05B 5CYQB 4IRCA 2B5JB 2VG6B 4O4GB 4I2PB 3KLEB 2WB4A 3M9NB 1N5YB 4PUOB 1S9EA 4TY8B 4WE1A 1TKZA 2W7PA 1UWBA 2YNGB 5KG2A 5F8LA 3BGRA 2CKWA 4KB7A 4MK7A 5C25A 3GIJA 5EWGA 3H40A 4F4YA 3KK2A 3MEEA 2YKMB 1S0NA 3EPGA 4OL8A 1VRTB 5KG4A 3G6VA 1J5OB 3ISND 2E9RX 3DRPA 4ID5A 1YVFA 1IKWB 4J9SA 2VA3A 2J6UA 3OHBA 1IKXB 4ECQA 4IH6A 5J2NB 1GX6A 3RBEA 2AQ4A 4WFXA 3H5XA 1JLQB 5T14A 1TKXB 2GIRA 3LP1B 3H4BA 3DOLA 3QYYA 5DQGA 3NKYA 4Y3CA 3OL9A 4EEYA 2IJFA 1XR5A 2D7SA 2D41A 4EBEA 3RB4A 2J6SA 5KG6A 1JIHA 2RKIB 2XI3A 3C6UA 3MTKA 4KKOA 4RNNA 5KFVA 3T5KA 3KLVA 2R8GA 3I0SB 4I2QA 4NLQA 1HYSB 2YNHA 3CJ4A 4WFYA 1TL1A 3IRXB 4WXWA 3RAQA 1HNIB 2UVRA 4J9PA 1TVRB 3BQ0A 1HMVB 4LQ9A 5KFCA 5KT7A 4RW7B 2V4QA 3QIPA 5C42A 1N56A 4O44A 4TYAA 2GIQA 3QGHA 3M8PA 4NLWA 3BQ2A 5EUHA 4KFBA 4NLTA 2IAJA 4TLRA 4KO0B 1RT5B 3I0RB 3IGVA 4QWAA 1D0EA 1K1QA 4IFYA 4TYBA 4K4XA 1N6QB 4I7FB 1QE1A 4QWCA 5J2QA 3OL8A 4ED3A 1TL3B 3MEDA 3FQKA 1JLCB 4O3QA 4RW4A 5I3UA 3IS9B 3M8QB 5KT6A 1RT7A 5CYQA 5HROB 2B5JA 4EBDA 5KFHA 3KLEA 2AWZA 1N5YA 4PUOA 3MEGB 1S9EB 5L9XA 5KG3A 4EYHB 4IFVA 2JLEA 2FLNA 4EYIB 4IKAA 4TY9A 3LALA 5KFNA 3FQLA 3KNAA 3RB6A 2C28A 2WOMA 2IM3A 4FS2A 3GV7B 3V81B 3FRZA 4B3OA 3MEEB 4G3IA 3T5HA 3NGDA 4IH7A 1S9GA 3DDKA 5JXSA 1TV6A 2IMWP 3DRPB 5F8IA 4M95A 4WYLA 1TQLA 3TQ1A 1EETA 5KT3A 4DG1B 2W9BB 3C6TB 1IKXA 1C0TB 4IH5A 4NCGA 3I5BA 2WHOA 2C2DA 4URSA 4PQUA 1JLEB 3QZ7A 2ASJA 3LP1A 1IKYA 1FK9A 5FDLA 1S1VA 1JLBA 2R2TA 2W8KA 4IOBA 3FSIA 4MFBA 4ED0A 4RW9B 5DG9A 4NLVA 5K14B 3ISNC 2UVWA 5DLFA 1REVA 3MR3A 1T05A 3CJ3A 4O4GA 4ECRA 2VG7B 4WFZA 1RTIB 1TKZB 3PR4A 1TVRA 4RZRA 3NAHA 4Q8FA 2C22A 3M9OB 2R2RA 3QIPB 1EP4B 3MR2A 2HNZB 5J2PA 1MU2B 3PW0A 5KFGA 3CIZA 3PW2A 4KFBB 4ED7A 5KFKA 5KT5A 3I0RA 1ZTWA 2JEIA 4RNMA 3PHEA 4NLDA 1S10A 2HNDB 4K4YA 4ZHRB 4ECXA 3BREA 3DM2B 4MIBA 5D3GA 4Q0BB 4ECVA 4YMEA 1KHWA 2YNFA 4RW4B 4TQSA 4NLOA 2IBKA 2WONA 3KLIB 4NLRA 1JXLA 3N6LA 1VRUB 1KHVA 2IC3B 4YR3A 4PWDA 4KBIA 2BE2B 3HVAA 5KFQA 4ECWA 1TKXA 2BQUA 4IFVB 4H4MB 3DOLB 3PJWA 3G6YA 3D28A 3KJVA 1RT1B 3SFUA 4DL2A 3KHHA 3BSCA 4R8UB 2O5DA 2RKIA 1HNVB 5C24A 1QUVA 1TV6B 1BQNA 3DLGA 2W9AA 3I0SA 4I2QB 3KLGA 3H4DA 1TL1B 4DG1A 2W8LA 3LANA 3CJ0A 4K4SA 1RDRA 4NRUA 4URQU 1RTJB 4RW7A 1S1XB 1HQEA 1RT3A 5F8MA 5F8GA 4JV0A 4K50A 5KFXA 1IKYB 1FK9B 4TQRA 3QIDA 4RNFA 2XGQA 3UPFA 1RT5A 1JLBB 3I5CA 5J2MA 1N6QA 4MFBB 4I7FA 5KG5A 1C2PA 1DTTB 2OPSB 2XGPA 1RTHA 4Q8EA 4QWEA 4RNHA 1I6JA 3PZPA 4IG3A 2FVPA 2AX1A 2JC1A 2IJNA 2UUTA 3MR5A 5KFUA 4J9QA 1HQUA 2OPRA 3MEGA 1RTIA 1FKPA 2IM2A 5KFZA 4IG0A 3H5YA 1SH2A 3BSOA 3T5LA 4DL6A 2V0NA 4U6PA 5J2PB 1MU2A 1JX4A 2BRLA 2B43A 2WOMB 1XR7A 1LW0A 1HARA 1IKVB 2I1RA 3CVKA 3DOKA 1LWEA 1RT6A 1S9GB 4URGA 4RUCA 3V6DB 4JV1A 1HPZA 4KHRA 2W9CA 2R8KA 5HBMB 3KMSA 2RDJA 2YNFB 2ILYA 1R0AB 3C6TA 2ILZA 1S49A 2WONB 2BANA 2CJQA 1C0TA 3KLIA 4NCGB 3GILA 3V4IA 5I42A 1S97A 2B6AA 2WTFA 4ZP6A 1JKHB 2IC3A 3KHRA 1JLEA 1OS5A 4H4MA 3OHAA 4HYKA 3KJVB 2I5JA 1S1VB 1TP7A 3QLHB 4ZMMA 4RW9A 1LWFB 4ZVHA 2FLLA 4ZP8A 1XR6A 3DRSB 4ECTA 4ZVEA 3FFIB 5K14A 1HNVA 1C1BB 5L1KA 4NLUA 2FJWA 4FBTA 3V6HA 4U7CA 2VG7A 5EWEA 2BR0A 3G6XA 2XCAA 4F4ZA 4LSLB 4ZP7A 5F8JA 1S1XA 3OL7A 1EP4A 3MECB 1LW2A 1HQEB 2HNZA 2ASLA 3OSNA 1S9FA 4J9NA 3KK1A 4ECUA 5F9LA 3E01B 3SI8A 3H5SA 4KSEB 3QZ8A 4R5PB 1D1UA 4ZPCA 3CDUA 3V6JA 5J2MB 2HNDA 4ZHRA 2UVUA 3DM2A 4RW8A 5D3GB 1S4FA 4Q0BA 3ITHB 5J1EA 1WNEA 3CDWA 1RTHB 2ATLA 1N4LA 4DL5A 4DL3A 2BQRA 3MF5A 5DGAA 4Q43A 3Q8PB 4GC7A 4ZPBA 1VRUA 2R8IA 2WK4A 3H5UA 4R0EA 4PWDB 2BE2A 3DYAA 4IG0B 4MIAA 1S1TB 1IM4A 2D3ZA 1RT1A 1S0MA 1C1CA 4NLGA 1LW0B 5KFEA 4R8UA 5KG0A 1IKVA 4QW9A 3IN5A 1SUQB 1LWEB 1RT6B 4YR0A 3QGIA 4QWDA 3V6DA 5HP1B 3BJYA 2C2RA 5C24B 2BQ3A 4RNOA 1HPZB 4WXOA 1BQNB 3DLGB 3NL0A 2HWIA 2OPPA 5DQHA 3KLGB 3BR9A 5HBMA 1T3NA 3M9MB 4IR9A 3KK3A 3JYTA 1R0AA 1BQMB 5I42B 4KAIA 5L1IA 1RTJA 1RT2A 4EO8A 2B6AB 1JKHA 2ZE2A 4QPXA 1SH0A 1RA6A 1RT3B 1S6QB 3ICLA 2DPIA 4O4RA 1FKOB 1ZTTA 5KFJA 4KV8B 4XPEA 5CYMB 3EPIA 3LP2A 4WYWA 2FLPA 5KFFA 1DLOA
chains in the Genus database with same CATH superfamily
2MZJA 4C48A 2GX8A 2OPQB 3OTDA 1B64A 3KLFB 2DY1A 1JLAB 2KYZA 3NY0A 4CM0A 3SFGA 1SV5A 2V2ZA 3W1YC 4B9VA 1TKTB 1SBRA 2F9DA 3KXDA 2D74B 4PKDB 3JQMA 5D78A 2VJUA 2RF2B 5DZ6A 4EK2A 2NZCA 5F9NA 4LSLA 1ZZFA 3CCTA 4FKYA 3ZZZA 2FVRA 2UUWA 3R5BA 3OR1A 4QIEA 4IDKA 3K58A 1B7FA 2UV8A 3OQ2A 5CA5A 5H9FK 4J9OA 3DU6A 1P9QC 1RLDA 1U09A 1JLFA 2DNOA 2KJVA 3M32A 3M7VA 3NBPA 2V5HG 1RWWB 1YBUA 3DOKB 4GMKA 3P45B 4JUZA 5KOXA 2VONA 2ZVSA 4FVCA 4LF8J 4OYBA 4CDIA 8RUCA 4ZP9A 1O51A 3CCJS 1RB0A 4Y2AA 2YX4A 4F25A 2GQCA 3N5FA 4WKYA 3VCDA 5HO4A 4IQXA 1WACA 3V4IB 1HD1A 2QX0A 3MD3A 4AQYF 3BPSP 3NWGA 1TK8A 1S0OA 1VJWA 1X31C 2IRXA 1RU1A 1U24A 1SL1A 3PX0A 3GYNA 3VWSA 4ZN1A 3CWJA 3R8YA 2I5JB 4BWMA 5E3RA 3I5AA 3G4SS 5KFLA 5F8HA 3HVTB 2FIUA 3OTEA 1MN7A 3MEKA 3IP0A 4G1QA 4QIVA 5RUBA 2AU0A 4IOAQ 1XWLA 1A7GE 1NCLA 1SUQA 3ILOA 2B9XA 2DJWA 2D3UA 5HP1A 5KFRA 5M2RA 1ZBTA 1RT4A 1VR6A 2HYIB 5IWAF 4WU2A 4UQTA 5GAHI 4ETZA 4LUBA 2BOAA 5A6WA 4OX7A 1A0OB 2F4FA 4DL7A 3I96A 2FC9A 3MECA 1RADB 5CHCB 2F5GA 1T94A 3GJQB 4ZVGA 1TK0A 4DBQA 2E5LJ 4B3SF 4TLQA 4K4TA 3WZ0A 4P2SA 1AXQA 2KKHA 2B4OA 2QE5A 3ZTRA 4FDFA 3NNCA 3RYLA 2DR8A 1UW4A 4XIUA 9ATCB 1SH3A 5KFOA 4L72B 3JSBA 1TFWA 2AX0A 3CGIA 1D8ZA 5D4NA 4L3KA 3T6JA 5B09A 1U45A 4K4WA 1NKEA 1HNWJ 3ISZA 5KFYA 1B0PA 1NU4A 4ED1A 2ZZMA 3MURP 4DV6J 2VBXA 3GIIA 4KPYA 4OLOA 1VQ8S 2DR6A 4NLPA 4M5LA 4Q2MA 2W7OA 5AXLA 3JSRA 2IM0A 2GV1A 5HJXA 3TAMB 1DQAA 2H5EA 2L48A 3D5MA 2EKNA 1HNXF 4OV6A 4OYPA 2OD4A 4UTGA 3MUMP 3THVA 1RAIB 2IRYA 2A3JA 2MPUA 4M5HA 5B0GA 3RZAA 3IAS9 3R7BB 4WP9A 3QAUA 2OSRA 4RW6A 2EVZA 3NOCA 2A0FB 1LWCB 4I68A 4BS2A 2WB1D 2YNIA 4H4OA 3OSPA 4ED2A 3W66A 1RT2B 1VK3A 3B82A 4MK8A 5G0RB 1YQHA 2VQFF 1S6PB 2ZBIA 2ZITA 3SSRA 4AL5A 2FJEB 4P52A 4PQUB 4PXEA 1T9VA 3ZZ0A 4DPYA 5B7WA 1FJCA 1Q95G 2DGTA 2U1AA 2UXCF 3HHLB 1MWZA 4LSNA 1HBMB 2EFPA 2X3DA 3IBCB 2K3IA 2A10A 3AB4B 4LSZB 4X62J 4PXBA 2AMCB 1TKTA 3AFGA 4CNYA 3UW1A 3CD7A 4BCAA 5D0GA 2ASYA 3N4WA 3OFGA 4MKAA 5DGBA 3DLHA 3BGRB 1KEKA 3M6UA 5ETLA 3FDSA 3PO5A 2XS7A 1QDUB 3HJFA 2R7UA 1N48A 4WZQA 1YK9A 3MMBB 3D0HE 3N28A 2IAJB 3UDEA 5KFAA 5EGYA 3PW7A 3OR1B 4L74A 3THPA 4KGKA 1WHVA 4NZ0A 4HHHA 5KFMA 5LSRA 4EO6A 1JLFB 3M32B 3NBPB 1TL3A 1V5VA 5KFDA 4BHQA 2YWEA 3BS9A 1T9TA 1N34J 2QMXA 4D3GA 5FD1A 1KLMA 3M2RA 5KTQA 2PMZD 3ZFVA 1IQTA 2AYMA 3M8QA 4J9RA 1RT7B 2O67A 3K7RA 5HROA 3CMAS 4HHJA 1WSVA 2ZH3A 2VBYA 2COLA 4CLLA 3N6NA 2MQQA 5GAGU 5JVGQ 5L1JA 2UVVA 1KOHA 1U02A 3TUZC 2IJRA 1RXOB 2MZTA 3A8KA 3LP0A 3MFIA 2AW0A 2PE8A 1L5UA 5KFBA 1X5TA 1YJRA 1GEHA 5E3CA 3QO9B 5A8KB 3JSMA 3D3CJ 3ELHA 2ZH5A 2ZFHA 3P3DA 2BX6A 4OQJA 3CJ5A 4Y28C 4ALZA 1T11A 1X0FA 4G1QB 2ZH4A 1Q82T 1MROA 2BE7D 2QL7B 2YNHB 1NK9A 2W9BA 3AJ2A 4QYRA 3Q24A 5KFIA 3IG1A 4KGXB 3HZEA 1RHMB 5DDRC 3BBFA 3DC2A 3OFFA 2ROPA 2E1CA 3TUJC 2M88A 2RS8A 2PFDA 4IFYB 4LF5J 1NDPA 5B0BA 4LFAJ 3MR6A 1WEXA 2Q6BA 2HS3A 5E3AA 1JLCA 4K8RA 4E2FB 1YG0A 1TMJA 3FCWA 3BSNA 2LQJA 3TP2A 1VIOA 4F0KA 5KFWA 2DR5A 1T05B 1WUUA 4DR5J 1R7IA 2B5JB 2VG6B 4ZCLA 3FZBA 2DGVA 2WB4A 3OFEA 5LMNJ 1VOMA 2QJ3A 1TKZA 2CQHA 2QIFA 1FEEA 2C3PA 2CJYB 3BN7A 5KG2A 1NBEB 2CKWA 1X5OA 2H4YB 2OP5A 2XSJA 3HX9A 4KB7A 4HT7A 3H40A 1R8AA 1HBUB 2XZDB 3JTNA 4DR6F 5IXUA 1N5VA 5DO2A 4NYPA 4CZCA 3EPGA 1UTAA 1D9AA 1VRTB 2ZHAA 2ZHOA 3UO0A 1WG4A 3DRPA 1RACB 3FEXB 5GMEA 2XLJA 2E1AA 2ZH1A 1Y4ZB 2G9OA 4DV7J 1IKXB 3ONQA 4ECQA 4IH6A 4ZVSB 1ROFA 4YOEA 1M5KC 4M5NA 4WFXA 2GFFA 2QFIA 3M6WA 4HTIA 2EK1A 2GHPA 2VFTA 5T14A 2L9DA 5H9EJ 2DRDA 1CJTB 4LVNP 1QAXA 2GIRA 2YQ3A 3LP1B 5F3TA 2O1PA 3VR1A 3H4BA 1TTHB 2CQDA 2HG4A 2IMOA 1BY9A 5G0RA 5E7OB 3I87A 1JQGA 3SQGA 2RDDA 2E5GA 2IJFA 1DFDA 2D7SA 2D41A 1PJ7A 5K20B 5BXIA 1N8RT 1J5EF 2HS0A 2PI4A 4LR8A 3HJVA 4KKOA 3EGVA 5KFVA 1IBKJ 1KONA 2ZKTA 4NLQA 4IQMA 3CJ4A 3BO4A 3UI3A 1SC4B 2J8AA 3TWZA 3HCXA 1HNIB 1HBMA 3BB5A 2FQQB 2UVRA 1RJJA 2RJZA 2AP6A 3BQ0A 1HMVB 4LQ9A 3C15B 2M8DB 2NXEA 3IRWP 3OJUA 4P10A 4DPXA 4PXCA 5AE1A 2ZBCA 3Q89A 3K5PA 3IBFB 1ZPWX 5LJ5Y 3DKDA 1NK8A 4RL1A 4PYAA 3BQ2A 5EUHA 4KFBA 2IAJA 4CH7A 3G6ES 4KO0B 4CCHA 2ZOMA 2YKPA 2C3YA 1KSPA 1S6OA 4TYBA 2PT0A 1N6QB 4I7FB 5HK4A 4QPTA 1PGZA 4C8ZA 3OL8A 3GPAA 3OXGA 2PIIA 3FQKA 3L95X 4X4QA 1W2BR 4YEAA 4ZOSA 2HURA 2VV5A 3ET6B 2PSZA 3M8QB 1RT7A 5HROB 4XTTA 3WC2A 2XSFA 1N5YA 4PUOA 3MEGB 5KG3A 2V8PA 4WWSA 3UN3A 1TR0A 4EYIB 4IKAA 4TY9A 3LALA 4OV1A 3FQLA 3GCXP 3NCQA 4DCJB 2C28A 1V6HA 2IM3A 1F5AA 4MMOA 2B51A 5LXRA 1Q78A 3MEEB 5A8KA 2R7RA 4B3OA 4G3IA 3ENAA 4F0HA 4NI2A 5E3PA 1WTFA 3DDKA 5JXSA 3TQ1A 1TQLA 1CEZA 5F41A 1OWXA 3B8HA 3S1TA 2W9BB 3C6TB 3J7AN 1VFJA 4NCGA 4U7UK 3I5BA 3PIOQ 4DLEA 4C3MA 3D1OA 4URSA 5GAGI 3AOBA 1R0BG 4L75A 3R6LB 2GW8A 1JLEB 4JYAF 1YGYA 1NZAA 3PV8A 2QGFB 2ASJA 2NCKL 2DXDA 1MWQA 2DVIA 1I1GA 3UD3P 1X9SA 3C46A 3LH2S 2W8KA 1XJWB 4IOBA 2XYHB 4I4BA 2RT3A 4CP5A 2LQ5A 3H42A 2AEMA 2WVDA 1OYEA 2VHGA 4N77A 2H51B 2GAHC 2HLUA 3FRYA 2HHVA 2UVWA 4I64A 3VGTA 5DLFA 4YB1P 3MR3A 1Q8BA 1WD6A 3M8SA 4B02A 1Q7LB 1DARA 1BHNA 1FXLA 3GSDA 2WBRA 4RZRA 3NAHA 2C22A 3M9OB 3I4HX 1RTZA 2AJ4A 1FFGB 3QIPB 4KHPF 2QLFB 2XSJB 2NXJA 4DV0F 1FD2A 1NXIA 1AUDA 3CIZA 1HBUA 1LXJA 2JZ5A 2GVDA 1V9OA 2ZVIA 4RNMA 3TARA 4DV2J 3OVBA 4QU6A 2X7IA 4ZHRB 5D8HB 2QEXS 2CJXB 3K8VA 4FXWA 3MHYA 2HFSA 3HSZA 2W2OP 3UWTA 3ILIA 1F9HA 1KHWA 3N5BA 4OIXA 4NLOA 4AQYJ 2V67A 4NLRA 4YUDA 2HK2A 3W2WB 1SJ1A 2B7BB 5IT0A 1KHVA 4JI5F 5ETVA 3ZTPA 4JI0J 4JI1F 2VB6A 4X4NA 3FK4A 4KYZA 4W4MA 4ECWA 4IFVB 3DOLB 3PJWA 3L7PA 3S7RA 2J7WA 3H25A 4DL2A 1TUVA 2N7CA 3MMCB 4JB8B 3IWNC 4R8UB 2O5DA 1F2GA 1MLAA 4DFKA 1NKCA 4LF1A 2VQEF 5C24A 2MJUA 1VS3A 1FNMA 2P2CB 4WU3A 7AT1B 1T7PA 1M5OC 2JL9A 2NSCA 2IBOA 3FC9A 3E8OA 2Z58B 2DO4A 1R89A 3CJ0A 5HQ8A 2X1AA 1H7WA 2W8LA 1NKBA 1JJ2R 2FZGB 4FF3A 1XBWA 1FWKA 5J1PA 2PGCA 2XY5A 5F8GA 1FFSB 4K50A 1TELA 2DH9A 2OEMA 4ZVUB 4TQRA 3QIDA 1P1LA 2UZAA 2XGQA 3UPFA 2KXHA 4MKYA 4MFBB 1B0VA 1RWNB 1WWHA 2DNMA 4I7FA 3S6EA 2DY9A 2AHOB 2EG2A 1DTTB 2DNNA 2M4MA 4OI1A 4ANEA 2J0QD 2HFUA 1Y3KA 3M30A 3ENQA 1U2RA 2FHKA 2NXNA 2HHXA 2K2PA 2RH3A 5KFUA 5LSLA 3TVZA 1VC6A 3MEGA 1RTIA 4V19J 5F0UA 1S12A 4I6YA 1DZ5A 4JI8F 3SQOP 3CJKA 4E98A 1PBAA 4DL6A 4DV5F 3GTYX 5J2PB 2VPXB 4NPOA 1MU2A 1HQ2A 3PYEA 2HK3A 4DV3F 1LW0A 2AKWB 1VQ9S 4LF7F 4GVBA 5FIIA 1NLKL 1LWEA 3POTB 1N33F 4CIOA 4A8FA 4C0HA 1QTMA 1VHIA 1Y5LB 1S4EA 2F1FA 3GYGA 2AYBA 5EX0A 1FRLA 1FHTA 1SKUB 1LV5A 4I69A 2ILZA 4MIWA 3GILA 3KG4A 2FLNA 4NCGB 1O6XA 2HRYA 5ETMA 2BVZA 3FCVA 3MM9A 1RHRB 2RRNA 1CJUA 2AIRB 1OQ6A 2G0CA 1N54B 1IR2A 3MWBA 4NZ6A 1KTVA 1OS5A 2A6MA 1RZMA 2N3LA 2NXCA 3MAHA 4PWUA 4YN3B 2W25A 1S1VB 3MR7A 4EU0A 4ZLNA 1CQNA 3M1VA 2XTJP 3LUYA 4CLTA 1YJWS 1X9WA 2W01A 3MMAB 2DEJA 2UXDJ 4RW9A 1LWFB 3BYRA 4ECTA 4DF8A 3FFIB 4QU7A 1AA1B 3FBBA 1HNVA 1VRQC 2YWHA 3SCIE 4DMZA 3PKYA 4LF7J 1RSCA 2J0WA 1VQ4S 3HXMA 4DPUA 2K1RB 5L1KA 4NLUA 1AB8A 3A12A 2FJWA 3V6HA 4LF4J 2VG7A 5EWEA 2CZ9A 3G6XA 1U1RA 5ETPA 2XCAA 4C9DA 3P5BP 4LSLB 4USTA 1KRPA 4C8OA 3OL7A 1EP4A 2B4VA 1LW2A 1HQEB 1RBLA 2V94A 2VPYB 3GJSB 3L7OA 2FY8A 4PYDA 3OSNA 1S9FA 1YWXA 3QSIA 1QSYA 4DQIA 5HQMA 2XEXA 3AXKA 1KVKA 2OAUA 4DZ6A 3PCOB 3HF5A 1D1UA 2DNKA 4ZPCA 3U1MA 2HWTA 1QLNA 1K0TA 1U48A 2UVUA 4PG8A 3TI0A 2KZZA 5IM0B 4JI6J 1LNQA 1KBRA 4G65A 3W63A 3RW7A 1RTHB 1UZDA 5J1EA 4ZVPB 2ATLA 1N4LA 4DL3A 3QWPA 5DGAA 3NCPA 2E44A 4ZPBA 2G0IA 4OZ1A 3QT8A 1TAQA 2EW9A 3CEDA 3CDAA 3CNQP 3EXCX 4MTPA 5U47A 5F3ZA 4R0EA 5CD4A 5EN1A 3JQKA 4ZPTR 3DYAA 4MIAA 1AUSL 3QRPA 1S1TB 3O6QA 4HR2A 4EGLA 1EKRA 2D3ZA 3EXYA 2GCFA 4WTOB 4NLGA 4RWWA 1RAOA 4R8UA 1IKVA 5L39A 5KFEA 4B9MA 4LF5F 1RT6B 3V6DA 4IO1A 4QWDA 3GP9A 5HP1B 2J0XA 1UKUA 3P6YC 4OZNA 5DQHA 1U1NA 1Q5YA 4CLWA 1R0AA 4BLGA 1BQMB 4LRFA 2G2OA 2DHSA 3TJ9A 5I42B 4BDPA 2ZWPA 4EO8A 2HPUA 1NDKA 3CCVS 4B3RJ 1EX8A 3MZIA 1U1MA 4QPXA 1SH0A 1UUJA 1RA6A 3N0VA 2DPIA 4M5GA 3MM7A 4XPEA 1EARA 5CYMB 3T9ZA 3OFHA 5JUMA 1HHQA 3MGJA 2OFGX 1IN0A 2LMIA 1E6VA 2IM1A 2VUGA 1S7HA 2VC0A 3G2XA 1GT8A 2UV8G 4TXSA 1C1BA 4QWBA 4OI6A 2MXYA 3HVRA 2KHDA 5A2QU 1RWKB 4DCOB 1T95A 2LLZA 1XNQJ 3R9LA 4DFMA 3HHKA 1O8BA 1U1KA 3CXCR 2PFFB 1JLGA 3TAMA 1Q86T 3MM5B 1VQ6S 4K4UA 2LDIA 4QJVA 3QNWB 3FEYB 2AZ3A 3O3LA 1GMWD 3HHLC 4NYOA 1IBMF 2MKKA 2QMUB 3C19A 1U2CA 4UZCA 1Q53A 1RAGB 3CT9A 1PIEA 2VDHA 4TU8A 2JEJA 4F02A 2IRUA 2HQIA 4ICLA 1K1SA 1DTQA 1HD0A 1M1KT 4F4WA 4RW8B 2PA3A 2M0GB 3A3PB 3ITHA 1HIYA 2LQ8A 1LKZA 2MGZA 2PEHA 4OJGA 3EE3A 4M5JA 2V9WA 2V2VA 4C11A 5F8NA 2IIHA 1R8BA 4NRTA 1FD8A 1HNZJ 2MQNA 1S6PA 4N8OA 4RBUA 1YI2S 1RAAB 4OI3A 2QL5B 2WSEC 3NRBA 3W62A 4ED5A 2XULA 1XMQF 3HVWA 3PNIA 3M1VB 3GV5B 4USIA 1JJ4A 2CPHA 4DJBA 1KTQA 4ZS6A 4RBVA 1KDNA 3IR7B 1MG7A 3ETMA 3GG1A 1LWFA 3RBZA 3W60A 1VGYA 1HWJA 1FI4A 3FFIA 4ECYA 3G86A 4BBYA 3C3LA 4DV5J 1PC4A 2K1RA 4X65F 1CLFA 2ZDPA 1KWMA 3IGNA 4J9UE 4X66J 4DOZA 3BDPA 4O0NA 4NE9C 2RS2A 1ZM4A 4MAKA 4QW8A 3OL6A 4KQZA 3W2VB 4DU7A 1LW2B 2Z4PA 2ZE2B 4Y34A 3KK1B 1VQLS 3MUTP 4KV8A 3J7YU 3E01A 1HHTP 2B8QA 3LP2B 3UVJB 4K5RA 1DLOB 3DNCA 3AHPA 1KLMB 3M2RB 4ZA1A 4AXIA 4F4XA 2GZOA 4A47A 3KLFA 3D66A 2NQPA 3OUYA 4RU9A 1PAUB 1T03B 1Y9OA 3AA8A 1K73T 5D0HA 3LTOA 2OTJS 2YNGA 3PYFA 5DDOC 1X4DA 1LOUA 4ZPDA 2YKNA 4FS1A 1GX5A 4AT1B 4RUAA 3PRBA 2VPZB 2RF2A 2HWHA 4FN5A 2B8PA 3UR0A 1JXEA 3QGGA 4DQPA 2DH8A 4JV5F 3QO9A 1WEZA 2MZQA 2VIHA 4Y2CA 1WF2A 2J6TA 3DRRB 2CYYA 4A8KA 2G2YA 5AXMA 2MY7A 2DYAA 2EBGA 3QBCA 3LA0A 4DEZA 2MSTA 2XI2A 3P8BB 4ZLJA 3D6MB 4M94A 3QAEA 4ECSA 1UVIA 4B9LA 1CPZA 3CIMA 5CQGA 4F50A 2BRKA 5IC6B 2MHEA 4I0WA 3KHGA 1D9FA 1JJCB 1CULA 5L38A 1UVKA 2CPJA 3AJDA 1PYSB 4QZVB 3QJPA 2GJFA 2DGUA 2WCXA 3CJ2A 4HLBA 5D0RA 4AFFA 2CVEA 4FF2A 1D09B 2CWKA 1UETA 5JMNA 2HNYB 3RG6A 1NJZA 1H7XA 1WSRA 5CYMA 4ZVQB 3TZYA 2VA2A 4DUZF 2FJXA 2E29A 4HKQA 1CC7A 4OYAA 1PC5A 1U1QA 1ZAVA 2Z2YB 4DUYF 3D6HB 2VG6A 1Q7YT 3IRXA 1HBOA 4DSKA 3A8EA 5E2QA 4RO0A 4O3NA 1T8EA 3QJJA 3VHQA 2GC8A 1EQMA 2EFQA 3OLAA 1J2VA 5C42B 2FVCA 3CW2C 2LQ9A 4O44B 4NL5A 1MMNA 3DCAA 3LPYA 1JLGB 2CUYA 3MM5A 2DCLA 3PYGA 2KT3A 3FEZA 3GYXB 2XY6A 4PG4A 3UQSA 4ED8A 2MQOA 1F2HA 2GMLA 2FZCB 4LJMA 1JK9B 5AXNA 2FJBB 2HLTA 3BSAA 3MEDB 3GV8B 2ZD1B 3NMAA 1S1WA 5I3UB 2NXUA 1TFYA 1T9XA 1XMQJ 2BKOA 1HW8A 3R3TA 3FGVA 3H2UB 1IWAA 3HHDA 4K2XA 4KY3A 1CG2A 4ANDA 2XZTB 2MQPA 4DU8A 2YWFA 1DQ9A 1GK8A 1Y10A 3D6TB 1CJTA 2CPEA 4ED4A 2XY7A 4NXMJ 2AF6A 5D6GA 3LAKA 3M2UA 5KFPA 3OJSA 2OJ3A 3U1NA 3H2LA 5IS2A 4DV0J 1FWPA 1NH8A 1WG5A 2BUNA 2CZ4A 4CO1A 1SJ4P 1T9UA 4J9MA 4GKJJ 6FDRA 5K8NA 4X4TA 2XBPA 1KQSR 2PO4A 2ALYB 3H2VE 4USWA 5HQLA 3FCHA 1FRHA 2C3OA 2CDQA 2CVIA 1NDCA 4CM2A 3PX6A 3RBDA 3AD7C 3B4MA 2CRLA 2XZWA 3MM8B 3NNAA 2B9EA 2ZEJA 2IY5B 4FF1A 1NO8A 4RW6B 2MKHA 4C97A 2KU7A 1LWCA 2ZH7A 3Q0AA 2R2UA 2MJNA 5C2GA 2FVQA 3TYTA 5HMYA 2LP4A 1EAYC 1T9YA 2GNKA 2J7UA 5FDLB 1KC8T 1GQEA 2VFVA 2R3VA 2R2SA 4KO0A 3NS7B 2ZHBA 4LF8F 2XMAA 2RQ4A 4ZCIA 1R8PA 2RMLA 5J2QB 1DRZA 4OX6A 3DLKA 1SQEA 1YDLA 4JI8J 2DO0A 1UVLA 3IS9A 2UXCJ 1REVB 2PMHA 4CYUB 4J9KA 1S57A 2VD3A 1G4CA 2RILA 1ULRA 3OXLA 2BKNA 3N9UC 3PRVA 1WJ9A 4I2PB 4O4GB 5T7LB 2K7JA 3KLEB 4TY8B 1QSSA 4CLPA 1B70B 2V1SA 2K06A 2QLWA 5A6PA 1REGX 1RLCL 4GKKF 3IC1A 1WTBA 3BGRA 1N5SA 3GIJA 1VQPS 1NJXA 5EWGA 5LXYA 3J7Z5 5C7PA 3PTWA 2ZM6F 3RRHA 3THTA 3KK2A 1KVIA 4B3TJ 2KVIA 2MKJA 1S0NA 1FKAF 2KDOA 5K8PA 3CUNA 3L9ZA 2DNGA 3I32A 4LT6A 5KG4A 5MAOA 1XC9A 2VQFJ 3NEKA 2UUCJ 2Z2ZA 4RUHA 2DCUB 4J9SA 2FHOB 4LIRA 2J6UA 3TRGA 2A1BA 2DHAA 3D0IE 5HVGA 5I4MA 4A8WA 4N76A 3CULA 2DD8S 1GX6A 3H5XA 3I6PA 3CJTA 4D3HA 1CULB 2HVZA 2I38A 3DLBA 2Y1JA 3V4IA 4PG5A 3QYYA 2F40A 2I0XA 2BBEA 2CAJA 4ZIWA 4Y3CA 3J7A1 3OL9A 2YX7A 3SMZA 2VDIA 2XMMA 4MT1A 4X4PA 2QA4G 4EBEA 4EEYA 1TL4A 2XYGB 1FNXH 1IBLF 1I3OB 1RQ0A 2LU2A 2YWWA 4GO7X 1PILA 2YX1A 2J9EA 2RKIB 2XI3A 2VZ9A 4CT9A 3I4PA 4PPZA 1XMOF 4I2QA 1HYSB 3NWRA 4WFYA 1A6LA 1ZS6A 3IRXB 1TL7B 6FD1A 3RAQA 3VAGA 4YY3F 3CJRA 2ZJRQ 4RW7B 3VAMA 1XERA 2H3EB 3NP5A 4I6WA 1SVDA 1N56A 3P49B 4O44A 4W90B 1FXRA 1SKSA 2CXEA 1UP1A 4TYAA 4X4OA 1K44A 3HZGA 1B7YB 3QGHA 2WAQD 4FPIA 4H4KC 4ITSA 2NPFA 2KM8C 1SJ3P 2OHDA 3RB0A 2WSFC 1JJHA 2H5IB 3IGVA 4PABA 2KM8B 3HPOA 3CPWR 1K1QA 1FX2A 1X0PA 1SC1B 2F65A 2I9SA 1QE1A 1OPIA 3AQOA 2CG8A 3PM9A 4LR7A 5EHHA 4LF9J 2R7TA 4O3QA 4AXJA 3F73A 3QT5A 3BH7B 1U6FA 2V9KA 3V2UC 5CXTA 2B5JA 5CAAA 2EBEA 3DLLQ 2QA4S 4N8NA 3HFZB 2KRRA 2WW8A 4IFVA 2JLEA 4K5SA 2ADCA 3ENWA 5KFNA 2CJKA 3M2UB 3K0JA 3D4JA 4N47A 2WOMA 4FS2A 3R5CA 1FJEB 4DSJA 4G6VB 1QD1A 1YJ7A 4F67A 1FEHA 2EFNA 2JWNA 3BN4A 3NGDA 1S9GA 2E1RA 3T5HA 1FJGF 3KJFB 1X4AA 1ITPA 5E5NA 2RVJA 2NPIA 5IT4A 4M95A 4WYLA 1EZZB 1PYTA 2BACA 4FKXA 1X8DA 4DG1B 2ZC3A 3R5DA 1NPRA 4OX9F 2BDPA 3BR8A 3AT1B 4ZDNA 4LFCJ 1L3UA 1G2EA 2C3UA 3BKTA 3K5LA 1YBAA 1KOOA 1SB6A 1QJHA 4USMA 5H1SV 5DM6Q 2BOPA 1IKYA 1FK9A 2VPWB 3HHEA 4ZPWR 3MAAB 4J9VA 2R7SA 1TZ0A 2Q43A 4DR3F 3CMQA 1R3NA 2Q6CA 3PJ9A 5DG9A 4NLVA 4HTJA 4C0BA 4HACA 3NCRA 2HHTA 5K14B 4DX8H 1N32F 3ISNC 3O1LA 1JMTA 4M5IA 3TX8A 4CT8A 5D15A 2CQ1A 3WX4A 4O4GA 4ECRA 1RTIB 4JP8A 4Q8FA 2GMHA 1CBKA 4OMFG 4A8XA 5HAOA 3CJKB 2R2RA 1VHFA 1VC5A 2HNZB 4ILLA 1AZSB 1MU2B 1Y11A 2BW2A 3QQCD 4DQQA 3PW0A 1FVSA 3KG1A 4QOTA 3T1YJ 2Z57B 1U49A 1DQ8A 1PAEX 2IVMA 3ZTSA 4ED7A 4U9RA 1ZTWA 2JEIA 4Q5VA 2W4PA 2GMJA 2WVFA 4EZ9A 2BV3A 3LOUA 2YY3A 3SDEA 4ECXA 4JOUA 3VF0B 2G13A 3LGHA 5HL7Q 2R7QA 3TANA 1FTCA 2BABA 3DGPA 3TQEA 4EWTA 1VRUB 2VQEJ 1NUEA 1HR0J 1QY7A 4DR6J 1IJEB 3KJQB 2RQMA 3IR6B 5T41A 1H72C 1SQFA 3FBFA 3DFEA 4KBIA 3U02A 4CO3A 3TA2A 2BQUA 3B6BA 3SSQA 2J9DA 3KJVA 4OI2A 5THWA 2QLJB 4RR5A 1T02A 4YDDB 4DR5F 1YITS 2GO8A 2QZ8A 1WG1A 2KFYA 1KFSA 2JSXA 3GZ7A 1IBMJ 4LMZA 3R7SB 4NI2B 1WI8A 2XMUA 1BQNA 2F7VA 3I0SA 2J0SD 3KLGA 3LWMA 1TL1B 4DF4A 3MD1A 3TA0A 3UFCX 3AJ1A 4K4SA 2HBYB 4OX9J 1S1XB 3W7BA 1I51B 2I8EA 2VL1A 3ZXWA 4NA1A 1VQOS 1B3TA 2N82B 2ZBPA 1T0TV 2G4BA 4RNFA 1WKKA 1VIXA 3I5CA 1R43A 1JLBB 1X5PA 2W2QP 3SCLE 4DV7F 2AD9A 2HVHA 1N36F 1FNOA 2NLWA 1MW7A 5KG5A 1C2PA 1IXKA 3IXQA 4C8KA 2CNLB 1Q0NA 2OPSB 5IM0A 1QSLA 3IM8A 1YKWA 4YB5A 4DSIA 2FDNA 1I6JA 3PZPA 1S59A 1CJVB 4IG3A 5M2UA 1YJNS 1BLUA 2IJNA 2R7OA 4LBHA 2CPZA 2Z2LA 2OPRA 5AJ3J 2X3GA 3IA0A 2IM2A 4KT0C 2EFVA 2QA1A 5KFZA 1RAHB 4P2MA 3H5YA 4P9SA 1W26A 5AE3A 3BSOA 1ZH5A 2RE1A 3UDCA 3EMTA 3ZNJ1 3PIPQ 2DR9A 5HMZA 2ZWOA 4ZK7M 1F6TA 2WOMB 2B43A 3Q83A 3RAMA 3RTVA 1XR7A 3WX8A 2A18A 2C42A 2F8MA 2CPIA 2KB2A 3BPDA 3DOKA 2NUUG 1RT6A 5LL6d 4HI2A 2IVFB 3NLCA 4URGA 3V6DB 1RHQB 2MQLA 3GLJA 1VMBA 1SJQA 3BGFA 1CC8A 4K2JA 4KHRA 1LK5A 2KT2A 4FNIA 2W9CA 3VALA 2R8KA 1BUXA 2VF3A 2JVOA 4BWJA 1VBYA 3QRQA 2ILYA 1YJVA 1Z2ZA 1FRXA 1GAOA 2C3MA 1S49A 2BANA 1C0TA 1HW9A 2MDAA 2KXNB 4U8YA 3SZ2A 1S97A 2Y8WA 4ZP6A 1RBOB 2XO6A 4WJBA 3WBZA 3TAQA 2MKCA 3KHRA 4CO2A 1OPZA 2VFRA 2YH0A 4A48A 3MOZA 3MAAA 4OYZA 2JLGA 4F3QA 3DHXA 4B9TA 1NSPA 1ZPVA 4L73A 3R27A 2U2FA 2AZ1A 4TNOA 2EEYA 1ZA1B 3A3OB 2GHWA 4ZP8A 3Q8UA 1YLXA 4ZVEA 1ZAXA 5K14A 4M5KA 3S01A 5DM7Q 2GVZA 2H1YA 3CJQA 2DHGA 1C1BB 2CJBA 2HFNA 3VGSA 4CWBA 1XIQA 2V8GA 4P7VA 4B17A 1VQ7S 4FBTA 5I3QA 4ZP7A 5F8JA 2G0JA 1KKHA 1X5SA 1R8HA 3MECB 4UOHA 4ENOA 2RQCA 2PMWA 1RCXB 4ECUA 4AD6A 4F3MA 4Q7AA 3AOAA 3QZ8A 1UVMA 4R5PB 5IV3A 3OTOJ 2O3DA 3SDEB 3AOCA 1UJ5A 4Y6IA 2D1CA 2G1DA 5D3GB 3R1LA 3ITHB 1WNEA 3CDWA 4LIWA 3EM1A 1OSCA 3C14A 4B3MJ 2CWXA 1Q81T 3MF5A 1XNRJ 4B9NA 4GC7A 2WBMA 3C66A 2WK4A 1LXNA 2APOA 2OGUA 3DRYA 4M63A 4Z7CA 2R7VA 2BE2A 4CH1A 1NZ8A 2LKZA 1TMMA 2DR7A 1U8SA 1C1CA 1KN6A 4MYTA 1GNKA 3BV8A 3T3FA 2JH3A 1LW0B 1YZ7A 3GSIA 1FE4A 4QW9A 1LWEB 2LA4A 3CDBA 3HFKA 2GHVC 3POTA 3QGIA 1JNRB 2OELA 3W64A 2E66A 4RNOA 4KIAA 5ETOA 1HPZB 5A8WB 3BJYA 1BQNB 2RUSA 2HWIA 3CCWA 1VQSA 4G1PA 4M8LA 2DITA 5HBMA 1WOPA 5DRKA 3CD0A 3TA1A 2Y1IA 1TKDA 3EZ5A 1RKJA 4DX7A 3W9JA 4ERDA 1NEEA 2DNRA 4KTQA 1RT2A 2B6AB 1QAYA 3HD1A 3LP2A 4P71A 4F7VA 2ZE2A 3J7ZT 4YB7A 3CCLS 1X7VA 3ICLA 1RT3B 5BYSA 1HR0F 4O4RA 4HEA9 1Y3JA 1ZTTA 1FT8A 3GB0A 5KFJA 2MLXA 3KUHA 4KV8B 4OX8A 5HI7A 4C8MA 1RUSA 4WYWA 4OZ3A 4BC7A 3CCES 1DLOA 1NHVA 3QLHA 1JB0C 4LRCA 1RAJA 3EGWB 3QFWA 1F9EB 4Z37A 5KG7A 4LFCF 1H3DA 2VG5A 3G8QA 4O3SA 2OPSA 1RYRA 1WKLA 3BZQA 1M5PC 4LSNB 1S5ZA 4J7CA 2ROGA 2CFXA 1NPKA 2V68A 1CJVA 2DKOB 4IG3B 1XTZA 2VICA 3T5JA 1N33J 4FZVA 2PC6A 2YKNB 1EQ0A 1HQUB 2DGQA 2OPRB 4NLSA 2QRRA 1N0UA 3R97A 4DV3J 1FKPB 3H7HB 4BC9A 4EUVA 2HMIB 2E5IA 4DR7F 4ER8A 4GVLA 4F2RA 3HMJG 4IRKA 3D7SB 3EZUA 1KFDA 3DRRA 2ALZA 2AGPA 3UCZP 2LEBA 4DN0A 2QN6B 1ELOA 5D4OA 4KHMA 3PX4A 3KG0A 3PFOA 4DN9A 1R31A 1RWXB 3VZHA 2Q3PA 4DZDA 4CQ1A 1NJWA 2CPXA 4YP3A 1PCAA 2W9CB 2UUBF 1N88A 3BEGB 5J1EB 4O23A 2X1BA 2Z2MA 1RA7A 4QBUA 3Q8SB 2VOOA 3EDRB 2BANB 2XMWA 3TZXA 2D68A 2JC0A 2N4DA 4LREA 4LF6J 3T19A 5DG8A 3LP0B 2V4RA 4W98A 4O3OA 4RPFA 2KVQE 3CC2S 3B4DA 4Z2XA 3PR5B 2HNYA 4GO5X 4KGMA 2HBZB 3Q86A 4J9LA 3CMES 3ZZPA 3TAPA 1QAJA 1FO1A 5DETA 4F4AA 3U1LA 5CCMA 1YJTA 2EK6A 1WDTA 2B7CB 2BJ9A 4LBPA 2CQGA 3BO3A 1MROB 3ILJA 3ZZRA 4NCBA 3GIKA 1HBOB 2RSQA 3AXMA 4IYQA 3NAIA 4WPAA 3TW0A 4YY3J 3K59A 4DV1J 3GQCA 2VASA 4NOHA 3W65A 2HEKA 2OPPB 2Q79A 3DDNA 3IG1B 1YRUA 1H38A 3NMRA 3KK3B 3JYTB 4A8QA 2FHJD 1BQMA 2NS1B 3BYPA 5DQIA 1N5QA 2EFOA 2C2KB 3PKMA 3E3XA 3CCMS 1KQFB 1NHKL 3CO9A 4HDHA 2BEFA 4LF9F 1J27A 2J9CA 4UOFA 1FKOA 2OH2A 5SUHA 5AXKA 1VLYA 4Q2LA 2ZD1A 4R5PA 2M8HA 1SPBP 2E7WA 3HSJA 4ZCKA 1FRIA 1AROP 5A76A 3NS5A 1D8YA 2QLBB 1WI6A 3JTOA 2X1GA 1E6VB 3A13A 4WE1B 1P27B 2QC3A 4XO0A 3KLHB 4DCPB 1UWBB 5ETSA 3AD9C 2MZ1A 4ZPVR 2RB7A 3DN9A 4OYWA 4LVOP 5EWFA 5DG7A 3RBEA 2MHNA 3G82B 3R7NB 4ETXA 4A8OA 4CRJA 3K57A 2C2EA 3P96A 1EIYB 2HHWA 2VFSA 2W4DA 2BJDA 1SQGA 2KFNA 1C1CB 3HI9A 3LGMA 4PAAA 4QYZK 1NHUA 2ZUAA 3D9BA 4HHUA 4ID5B 4TN2A 2JFKA 3MPYA 3ZZYA 3CD5A 3MFHA 1RTDA 1VQNS 1GXUA 4ICLB 3K2YA 3VV2B 3NGTA 2RRBA 2XTEA 1S1UB 1WC0A 2RDIA 2QSWA 1M5SA 3CDEA 2VKZG 3OXFA 3BF4A 4DL4A 1TUWA 3MCMA 3QSYB 4JV2A 3DLEB 3M6VA 4IO9Q 3J7YI 1S99A 2HHPA 3CTRA 2DIVA 4ZVTB 4ZJQA 3EGZA 2M70A 1U8WA 4WCEQ 4N5SA 3C2PA 3CCSS 1D3WA 4JI3F 2H4WB 3EJMA 2R9LA 5A0YB 1VI7A 1NJIT 4KKOB 2HBQB 2OPQA 3GJRB 2XCPA 1OIAA 2Q66A 1BWEA 2VG5B 2ZUGA 3CCQS 1BQXA 1SV5B 3RW6A 2NSBA 2IFXA 3BKUA 1OSDA 3HSGA 2D9OA 1YJUA 5BYRA 2ZM6J 2I2YA 4WP3A 1HI1A 1NAQA 4MJKA 4F26A 2HMIA 2LFVA 3M2VB 2HQCA 3KK2B 2Y9HA 3Q8VA 4L6V3 2YKMA 3T9NA 1NDLA 4MH8A 3E51A 4DLGA 2POKA 4P6QA 4OZ2A 3V4MA 4X84A 4DSLA 3B54A 1HKAA 1GXTA 4ES3A 1K47A 2W1BA 1FDBA 3FKBA 1R6YA 4NWBA 1L3VA 2ZOGA 2QSFA 1XMBA 2E7XA 1YTYA 4O3RA 1M5HA 1S48A 3G96A 2FJDB 4JI2J 2BJ3A 2P9GA 1RHKB 5B0FA 4YQWA 1T03A 1SKRA 3LQVA 1QAIA 2E9ZA 2XLKA 2VOPA 3P4UB 4IRDA 5ITHA 4K4ZA 1OJ4A 1HNWF 4DDFA 1UPMB 4NXNJ 4MKBA 4DR1J 4B3OB 4C3KA 2B4PA 4TKTA 1TUGB 2JDJA 3W61A 3C6UB 4J9PA 2XWYA 3TUIC 4ZVOB 2HGNA 2OMOA 3SEOA 1W25A 1EETB 4FNHA 4J37A 1TL7A 2F4VF 3Q8QB 2O01C 4YHHF 4WZMA 1APSA 2CPDA 2ACMA 5HLFA 3RB3A 2MB0B 3FSXA 4JBCA 4DHVA 4K4VA 2ZH8A 1WC6A 2ERRA 4ZN3A 2Q1LA 3AQPA 2WVEA 1I94F 4YDXA 5FJ4A 2NR0A 1SIZA 3DI6A 3DXBA 2FC8A 1F60B 1Z4UA 1QE1B 1VQ5S 2VBWA 2XQCA 4N7TA 3CD6S 4GC6A 3KWMA 2V1TA 3DOMB 3KJNB 3MPUB 5CYQB 2CQIA 2GAGC 2HFOA 2V50A 4XDDA 4CLYA 3IAM9 5CABA 4DR2J 1OM2A 4WE1A 4YB6A 1W7WA 2JHEA 1U7LA 2XG8A 5HJYA 2W7PA 3CCUS 3P5TL 1UWBA 2N7YA 3MUVP 1FDDA 1AT1B 3UCGA 3JAMU 3HLUA 1WOOA 2GGPB 5C25A 4DUTA 5K9FA 3EZOA 5CH7B 2WVBA 2ZZTA 3DHWC 1RKIA 2N4CA 4LBIA 2IPOB 5HVFA 3AH6A 3G82A 4PG7A 4DPWA 1A9NB 3JAMY 1X4FA 2PA8D 1F1BB 2GVDB 2QG9B 2VH7A 3GFYA 2FB0A 1XEZA 3TJ8A 3VVUA 1XMOJ 4OL8A 3G6VA 1M90T 3WHIA 1WEYA 2E9RX 3ISND 4ID5A 1YVFA 4N56A 1IKWB 4UT4A 2KH9A 1NJYA 1N36J 2VA3A 5K8OA 1UL3A 1PSDA 3HFVA 2DNPA 3AODA 4ZIVA 2CQ2A 1JLQB 2H54B 2YPZA 4K7QA 1EJ7L 1TKXB 2IHR1 4UOGA 3DOLA 3Q8YA 1URNA 3SIPB 5DQGA 3NKYA 1IM6A 3ILLA 2E5JA 4X4UA 3LF0A 4U95A 1XR5A 1VQKS 3CC7S 3RB4A 2J6SA 4GRSA 1S0VA 2V6AA 2YQ1A 2AJ0A 4EMDA 1JIHA 4YR0A 5GADU 4RNNA 2MKYA 3T5KA 1FTRA 2W24A 5GAHU 5D0EA 4RJVA 3UDVA 2Z30B 4DR3J 1ZOTA 1X60A 3HHLA 1UFWA 2R7WA 4WXWA 4X4VA 2HQ3A 4UZBA 1L3TA 1I94J 3D1HA 3W5ZA 4ID8A 5KFCA 5KT7A 1OY6A 2V4QA 4PEOA 3TR5A 2B4UA 3LO3A 2HZVA 4CI0B 2CQBA 1FRKA 2E7VA 2GIFA 1HLWA 2ZC4A 4XAKA 1VQMS 4HI1A 2L9WA 1R0CB 2EWHA 3M8PA 3MMBA 3UN2A 1U26A 3D68A 2LDYA 4NLTA 3OVSA 2UU9F 1RT5B 3U7JA 4QWAA 3BDEA 4K4XA 2X51A 5J2QA 4ZKAA 4K0KJ 5LMNF 2HBRB 4ED3A 1TL3B 4PZVA 1U6ZA 1VLOA 1WDDA 2HRUA 2HAFA 4JI2F 3IS9B 2Y3YA 3M30B 3KDNA 4FYWB 3GFHA 4EBDA 5KFHA 1LFWA 3KLEA 2VJVA 3UR3C 1S9EB 2BJEA 5L9XA 1FDAA 4CLKA 4EYHB 1UJ4A 3VQTA 3O5TB 3PDNA 2RAQA 1Y5IB 2ZBQA 2HVEA 1BGXT 1X4CA 2BM1A 2W4CA 3KNAA 5DZ7A 5AE2A 3RB6A 4JI0F 1KS2A 3FRZA 3FJ2A 4IH7A 3HK2A 3UD4P 1Q5VA 1NK0A 3HSDA 3MM6B 4UF4A 3KNGA 4FVMA 2IMWP 4GKJF 5F8IA 2XO7A 4QCLA 1EETA 3RR8A 3HD2A 4UY85 5B0DA 2EG1A 1HBNB 3ZC4A 2H5JB 3MM9B 4Z7YA 1YHQS 1E6YB 4LRBA 5IV4A 1HI0P 2J7KA 3WC0A 4ZLPA 4JI4F 2V4JB 3K89A 2FUG9 1OMSA 2VBZA 1S1VA 1R8CA 2XMKA 1JLBA 2R2TA 1BD6A 3MMAA 4ED0A 1N52B 4RW9B 3CO0P 4NASA 5D4PA 1PG5B 4J5OA 1IWGA 4OZJA 5CZXA 3WDOA 3DDIA 5HVHA 4DR1F 1Q1KA 3SCJE 2B0GA 1ZYQA 2FY1A 1T05A 2XS5A 3VGVA 1OY8A 1RAEB 2VG7B 3OD2A 8AT1B 1TKZB 1TVRA 4AUKA 2M3DA 3MR2A 1EP4B 3MM8A 5B0CA 2D69A 5A8RB 4USVA 2P6TA 2JX2A 2LA6A 3OPKA 5KFGA 5H9FJ 3T6BA 2K7KA 3U27A 5GVQA 1SI9A 3GONA 5KT5A 3I0RA 2NZ4A 2L3MA 2UUCF 1FDNA 2KXFA 1SC3B 4NLDA 2KN4A 1S10A 3BREA 1M1GA 3DM2B 4MIBA 1PYOB 3GFZA 4DR2F 1V3RA 4Q0BB 1RISA 3ADAC 3VAKA 3F41A 4RW4B 4TQSA 2F63A 2IBKA 3I82A 2DTJA 3KLIB 3MI7X 3TZWA 1Q79A 4KR0B 3G8TA 1JXLA 1FWLA 3DGVA 4O0IA 2V2QA 3T1HF 2XMVA 3PFEA 3K5NA 4YR3A 1NM2A 1UJ6A 4WKRA 3HVAA 1G6BA 1TKXA 3W5XA 3JS9A 3G6YA 3D28A 2ACYA 2DH7A 1IBLJ 1RT1B 3OR2A 2DK2A 1NK4A 3CB4A 3G87A 3SFUA 1VQYA 4HL9A 3FMWA 3KHHA 3BSCA 4PRFA 1C4AA 1RWOB 5ETRA 3SBMA 2RHQB 2MTLA 3IM9A 2UU9J 2GVZB 2XB2D 1QUVA 3CE8A 2YKAA 2YQ0A 1TV6B 2ZH6A 1V3ZA 4LF4F 3GJTB 2W9AA 5SZTA 3QWUA 5LJ3Y 3TNVA 4DG1A 2ZOFA 4LF2A 4USJC 2CADA 2V8DA 2YH1A 3MCSA 5B0AA 4ILMA 4OJ1A 3OTBA 1JNZB 3VAIA 2XMJA 1UVJA 2DNZA 2QT7A 4P74A 1IKYB 1FK9B 3W3SA 1VJQA 1RT5A 4M5DA 4C3LA 3NOGA 4WK3A 4DUYJ 5J2MA 1N6QA 8ATCB 2M52A 4CTAA 2P8IA 2JLFA 1UWAA 2JFDA 3MXHP 1Q8IA 5BR8F 1Y7PA 2BE9B 2MMYA 1RHJB 4OHZA 2KFZA 4KH1B 2KHCA 3ET6A 4UY8T 4HDGA 2DT9A 2JC1A 2UUTA 1WF0A 3T41A 3MR5A 4OYXA 3TVYA 3UN5A 1UZHA 4C0OC 3BH6B 1NB7A 2ZBRA 4IG0A 5DS7A 5LOQA 1SH2A 7FDRA 3T5LA 2HKEA 1H74A 1SC6A 3QPIA 5IC4B 4U6PA 3I56S 2OIHA 2Z0GA 4FYVB 1NK6A 2BRLA 1KQKA 4HH0A 3RU0A 2RRAA 1L3KA 3R2DJ 2I1RA 2MY8A 2AV5A 2RIJA 4FXVA 3H90A 3UE2A 1UPPA 4FP9A 4A8SA 1HPZA 3JQJA 2ZJQQ 5HBMB 2RDJA 4I67A 4JYAJ 2YNFB 1N0VC 1Z2LA 1NMEB 2IYGA 2Z8QA 1WORA 2ROEA 2WONB 1U25A 1HBNA 2CJQA 3C6TA 4G1IA 1H6KX 3W9IA 5BR8J 2B6AA 2XS2A 3IWXA 3C16A 2IC3A 2K8GA 2QA2A 4PPDA 4R0JA 4K59A 1JLEA 1YJ9S 3BGLA 3O8WA 4H4MA 3OTOF 3OHAA 4HYKA 1QM9A 3KJVB 1TP7A 3QLHB 4WFAQ 2PDAA 1N32J 5MLCV 3NGRA 3RJMB 4HH1A 3A1YG 1F5CA 1XR6A 2XTCA 1HWUA 1F9FA 2KYXA 3F44A 3MDFA 1UA0A 1ZM2A 4DS4A 1KLNA 2HW3A 1YZ6A 3VZIA 2MLYA 3H8YA 4WTYA 2HQFA 2W2NP 2P6SA 4CLFA 3J81U 3NGSA 5I3PA 4ES1A 2BR0A 3CC4S 4LFBJ 4F4ZA 1KNZA 1Y5NB 3A8IA 1S1XA 5J1NA 1ZZNA 4QYZJ 4KGZB 5A8RA 1C4CA 2KO1A 3FNNA 2QL9B 3JSYA 2DB1A 1SIWB 3KK1A 2CPFA 1U1OA 3PXGa 5F9LA 2HVDA 3E01B 3GU0A 3SI8A 4KSEB 1WOSA 3UVJA 3RBXA 2CQCA 4FPRA 1HWKA 4ZHRA 3G9CA 4RU2A 4JI1J 1K0VA 3OUYB 3DM2A 4Q0BA 1S4FA 2YWKA 3EVWA 4U67Q 3MAQA 2W7AA 1NB2A 2YTCA 2PN6A 3BBBA 2MKIA 2BQRA 3QJLA 4Q43A 1WELA 1X4GA 3ZZOA 2P9EA 2Y0BB 4NXNF 2AYEA 3M05A 3GMGA 3M8YA 1R27B 2LCWA 4WFNQ 3GR1A 5B08A 1RT1A 3OR2B 1VBXA 2YVSA 1EKSA 3FBCA 3VVTA 1AFIA 2N3OA 4A8MP 2L41A 3FBEA 4B9SA 4EFAC 5KG0A 3IN5A 1SUQB 2CPYA 3NNHA 3W8PA 4B9UA 2R7XA 3CF5Q 5C24B 4WXOA 3M4XA 3NL0A 2OPPA 3BR9A 1RAFB 1T3NA 3M9MB 4ZJLA 4DR4J 4IR9A 3KK3A 3JYTA 4MYUA 1CQMA 4OZLA 5L1IA 5GAEU 1JKHA 2HIYA 1OO0B 1SCJB 4X65J 3T1HJ 1FKOB 1OYDA 1RWPB 3I9ZA 4WK1A 5GAEI 2BZ2A 3G71S 4HT5A 1IR0A 4R25A 3EPIA 1NK7A 4IUFA 2FLPA 3AY0A 1N5TA 4I1TA 2DNLA 4P73A 4CTAB 3KHLA 5KFSA 4C2MA 1DTTA 3DRSA 4ZVFA 3QRRA 3N6MA 3EVMA 3RRGA 3UDLA 4X4SA 4U96A 1M5VC 1LK7A 4L3NA 5KFTA 4Y2MA 3V6KA 4V19X 1NSQA 2AGOA 1FJ7A 4XPCA 4EBCA 2E9TA 2XTDA 2YWGA 3UNYA 2HFVA 3ETOA 3HDSA 4ES2A 2JEFA 4B3TF 1U6BA 5GMDA 2VC1A 2E1PA 1C0UB 1F3VA 2W2MP 3MMJA 2LU1A 1EHWA 4NLXA 1HWIA 1NH7A 2JEGA 2M9KA 4I6AA 2GQQA 1RTDB 2EFGA 1S1WB 2HHSA 3AAWB 1UEKA 5C5JA 3DMJB 3GFXA 2ZNZA 1DBDA 4DPOA 4NA2A 3PJXA 2JJ4D 3FUYA 1RE1B 2GO9A 3C14B 2D3OR 2C2NA 1RU2A 5BYQA 3KTQA 1U1PA 5LSOA 3D6FB 3IBWA 3OBIA 4RBTA 3VQSA 1P8GA 3PYDA 4OHWA 4DX5A 2XLIA 3C16B 3VAJA 1GTEA 2O66A 2DISA 3EUNA 4F0MA 5L8RC 1H2VZ 4CH0S 2RD5C 2V8HA 4OFZA 1LEOA 4ELVA 3HKWA 4YR2A 2EKYA 2HHQA 1XK8A 3SSSA 5KT2A 3KMQA 1DURA 1MMDA 2CQ4A 2F8HA 3M6XA 4USUA 2DEIA 2ASDA 4NXMF 2B9YA 2B9WA 1X4HA 3A3NB 3H59A 4UUWA 4ZCMA 4WFBQ 2FHMA 2AEFA 5AJ3F 2IA6A 2I6WA 4X64F 5KAKA 1IQZA 2DGOA 4DXLA 2X1FA 5A8WA 4QIWD 1KR4A 3BGOP 3R5JB 1OY9A 3MPDA 4FBUA 4N41A 3PACA 3TO8A 2BYCA 3M2VA 1V5IB 1ICEB 2MZRA 1U47A 5JVHQ 4XK8C 1S77D 5HSPA 3H98A 4EZ6A 1QVGR 2ZDOA 4K0KF 1S6QA 5IFMA 5FLXU 1SJFA 2ATCB 1WKJA 4C7QA 2DHXA 4C8NA 5IOLA 4ELTA 1SKWA 2G1HA 3DLKB 5EX3A 4ZPAA 2QFJA 1VBZA 2DGSA 2DPJA 5FLXY 1B4SA 2QYCA 4J90A 4CYUA 2NYIA 3RAXA 2V34A 4JI7J 1XNQF 1JLAA 1BWVA 4RLEA 5F0WA 4I2PA 5B0EA 1F5BA 4CO4A 3G8SA 1PO6A 2HAIA 1DHMA 4TY8A 1WF1A 3FSYA 2UUAF 2BJ7A 4JI6F 3OW2R 1QUPA 4Q45A 1NRKA 2GA7A 4KJIA 3GE9A 3EICA 3D3BJ 4HVZA 2FZKB 3T1YF 3CCZA 1CSJA 3DYAB 4OYIA 2FVSA 2KJWA 3JSMB 1S1TA 1W2IA 5LM7E 3E2EA 1IBCB 2FJVA 4IDKB 1U1LA 2M2BA 2KI2A 1J5OA 2EPIA 5D77A 3N79A 4J91A 4Y2IA 2ABYA 2E5LF 4B3SJ 4LFBF 2R8HA 1VISA 4LQ3A 1FX4A 1Q4RA 1NPPA 2HZCA 4F36A 1FA0A 3PW4A 3OLBA 5J2NA 3QT7A 5HLFB 1Y0HA 2HZAA 4RKUC 5KT4A 1SL2A 3NXZA 3HO1A 1UEUA 2QLXA 1ZAWA 1K9MT 4OJ3A 2OUGA 1X4BA 3KOAA 3IFEA 4UOCA 3DI6B 4KE5A 4M5MA 5KOWA 2UUAJ 1HA1A 3R1HA 3Q8RB 2YKOA 3MM7B 3R6GB 2JRSA 2RU3A 1RK8A 1CJKB 2HFZA 4W92B 2P9CA 1YX2A 2DNQA 3Q2SC 3HVTA 2GQ2A 3SV3A 4DV1F 3OVAA 5L1LA 1HYSA 5DLGA 1FE0A 1MSWD 2RU9A 3AX5A 4H54A 4ECZA 4O3PA 3PW5A 1FESA 5ETTA 1Q16B 1H0HB 1FXDA 4OHVA 1VYAA 1RT4B 1O5JA 3SCKE 3PVXA 3X1LB 4CLSA 1GMWA 1DY3A 4F4KA 2GGPA 5C25B 4OLPA 3EX7B 2BA9A 5KG1A 4XDCA 1RWVB 3DU5A 2F8EX 3OT9A 3HT0A 1C0UA 2H65B 4NYZA 2XNRA 3B78A 1BE4A 1UAWA 2R8JA 4LF6F 4QR0A 9RUBA 4ED6A 4DS5A 2XC9A 1VRTA 2NUHA 2D3O1 2EI5A 2HS4A 2OI2A 1ZETA 4MK9A 2CNOB 3TVKA 4YHHJ 1AW0A 1IKWA 3TUPA 3J81j 2C2ZB 2SXLA 2FD2A 5EDWA 5IQ6A 1DTQB 3ZO7A 4E8UA 3DMJA 3BQ1A 1GMUA 4ANCA 2R4FA 2YXLA 4OI0A 3OV7A 3MPWA 1JLQA 2LXFA 2L08A 4Y0FA 4JI4J 5DDPC 4JV5J 3KLHA 2V63A 2RNEA 1IJFB 1HL6A 7FD1A 5L9NA 1VK8A 4C11B 5GADI 1MMLA 3KYLA 4ILRA 1S7IA 3SQGB 4NLYA 3V81A 1AYEA 3L09A 1FERA 4PWWA 3CSKA 4OHXA 1VBKA 3M8RA 2GJIA 2QV6A 3A4TA 4PR6A 1R6VA 2V8VA 3QATA 3M8WA 4IR1A 2XWXA 3GIMA 4DSFA 2PD1A 3KDOA 2PI5A 2MEWA 1HNIA 2EC0A 1HMVA 3C15A 3VGUA 3JB9k 1S1UA 3RGIA 1FJGJ 2IYIA 2J5AA 4Q44A 4DPTA 3DLEA 1JWWA 2YNIB 2OFHX 2YBVA 3I31A 4H4OB 1Q8LA 2BKPA 3M8PB 4F2SA 1UEVA 2AGQA 3HT3A 4X2BA 2WRMA 1UMJA 2DRBA 2ZKUA 1RYSA 2BJ8A 2FLOA 5DDQC 3PO4A 1QTNB 3X3UA 3T1AA 2Y8YA 4YS2A 1NNDA 2KG1A 3LAMA 2BM0A 2MSSA 1AFJA 3AX2A 3M8ZA 4IRCA 1KVJA 4AE5A 3Q2TC 2CIMA 3LW5C 4ZJOA 2M5YA 2CNKB 4OYMA 3M9NB 1N5YB 1S9EA 4TVAB 3V5RA 4PUOB 2J76E 4B3RF 3D54A 2YNGB 1P6TA 3RRKA 4B3MF 2FHJA 5F8LA 4AYBD 1XNRF 2R42A 2FJAB 4AL7A 4RWXA 4CLZA 1AZSA 1GMVA 4MK7A 4OI4A 4F4YA 4DSEA 1D9DA 4FXDA 2UXBF 4F8RA 3MEEA 2AYGA 2QO3A 2FGOA 2YKMB 2KTQA 3D0GE 4CO0A 3K8WA 4X4RA 3KKFA 1ACMB 2OSQA 3MM6A 3OTCA 3SXLA 4P7TA 2HQGA 1YRTA 1J5OB 4DV2F 4MKVA 2JNJA 1MNEA 3ZZUA 2XM3A 3OHBA 2ZH2A 2XHCA 5J2NB 2L9NA 2AQ4A 5ETNA 3MPVA 4USHA 5CCLA 2RQKA 1R0AB 5HN0A 2LVWA 1E6YA 4IOCQ 1V3SA 2D9PA 4AL6A 5JJBA 2V4JA 1PBUA 1FCAA 2ZNYA 2OTLS 5HATA 3VAFA 4DV4J 4JI3J 1QVFR 3RUBL 2OEKA 4A4JA 2CA9A 3GIRA 4WP8A 5IT9Y 3K5OA 1FFWB 3VTIA 1CJKA 2GJ2A 5KG6A 1P9YA 1UVNA 2WVCA 3C6UA 3MTKA 2R8GA 2QMWA 2DNYA 3KLVA 1NK5A 1RWMB 2AEJA 3I0SB 2YPYA 2IDLA 2YNHA 1TL1A 3AB2B 3IR5B 3KUEA 2ZH9A 2K3KA 4QQBA 3TJAA 2DIUA 4U8VA 2Y0SD 1TVRB 1WC1A 3FZ2A 1CS4A 3IMQJ 3N01A 1BXNA 2JOQA 3QT6A 3ULHA 1HNZF 3QIPA 5C42A 1UFKA 2XMTA 1IVZA 1Y00A 3F56A 1J5EJ 1LWXA 2GIQA 2XHWA 3GCWP 1S6UA 4WBFA 3WIUA 4CO5A 1HNXJ 4NLWA 1G7CB 2AT1B 2DGWA 1GFWB 1ZA2B 2F3JA 4H4KA 4TLRA 5HMXA 4DQRA 3I0RB 1D0EA 2HVIA 4IFYA 3K5MA 3UD5A 5IWAJ 4QWCA 2XNQA 3MEDA 5HMWA 1JLCB 1DAXA 3SYZA 3DOMA 3R5GA 4RW4A 1M0SA 1Z1ZA 2DBBA 1P1TA 2DGXA 2IA0A 4S0MA 3WQPA 5I3UA 1L3SA 2G2ZA 2BW7A 5HANA 5CYQA 3W2WA 5CYJA 5KT6A 3W5YA 3BO2A 2B3TB 2AWZA 2DRAA 4NMXA 2HHHF 2EXUA 2B56A 2DHHA 4F04B 1TU0B 2C2MB 1HHSA 2F9JA 2V2KA 1U0SA 1S72S 2FPHX 2Z56B 2HSEB 4UUXA 1RGVA 1WC5A 3MMCA 4M1KA 5L46A 3GV7B 3V81B 2AJQA 4KRWA 3W9HA 2CNNB 1UCNA 1XQIA 2LXIA 4DQSA 4DFJA 1ZM9A 1URRA 3BBCA 1TV6A 4QR2A 3NGKA 1U0HA 3DRPB 2H48B 4P2XA 3FVYA 4P2FA 1G1XA 4KH0B 1TL5A 5KT3A 4ATNA 4OHYA 1IKXA 1PJ6A 1C0TB 4IH5A 1X9MA 2WHOA 3LGNA 2C2DA 2KT5A 3PHTA 1EB0A 5C2CA 1RABB 3D2WA 1F0XA 1NSAA 3QZ7A 1S79A 2QTWA 3LP1A 1KP6A 5FDLA 4C8LA 3R2CJ 2HHHJ 4DR7J 2C1EB 1GXLA 4M5DB 3FSIA 3CCRS 1H98A 1RBAA 1YSJA 4MFBA 3W8GA 3JXOA 4A46A 3HULA 3KFWX 4DX6A 4FYXB 3D1QA 3RR7A 3F0NA 5CZVA 4NEZA 4OJHA 2CG4A 1REVA 1B0TA 3ZZTA 4CLUA 5ETQA 1UW9A 3CJ3A 2VKRA 3DRXA 3UNGC 5T7LA 4WFZA 2OMLA 3PR4A 1GH8A 3J81Y 3PEHA 2BMBA 3WIVA 4QIGA 2AJ1A 5GMKa 4C8YA 4WIQA 1FRMA 5J2PA 1U4BA 4FYDA 1FRJA 2MZSA 3SV4A 2LQBA 1VDHA 2V69A 3PW2A 4GVBB 4KFBB 4Y00A 1HFEL 6AT1B 5KFKA 5CD4H 2HGLA 4QIFA 3PHEA 1GTHA 2MQMA 3O44A 2UUBJ 2HNDB 4K4YA 2CQPA 5LMUF 3Q23A 1H73A 5E33A 5D3GA 1RHUB 3H20A 2VU5A 3C8YA 5K5MA 4TU9A 4YMEA 1RCOB 2YNFA 4YFUA 4ECVA 2NYHA 1PJ5A 1WC4A 2CQ3A 4DL0C 1I5OB 2WONA 2M7SA 3MCNA 3N6LA 4WIIA 2XYPB 2RUGA 4KC5A 3LPEA 2P5VA 2IC3B 4PWDA 3EGNA 1N34F 2BE2B 5KFQA 4H4MB 3D67A 1H2TZ 3IWLA 1RI7A 3PRDA 1FVQA 4PCQA 2LECA 1XN9A 4NMLA 1X4EA 4TU7A 2RKIA 1HNVB 1YRXA 2J9DE 2CJ9A 4ELUA 4JI5J 2UXDF 3DLGA 1UFLA 5ETKA 4I2QB 5H9EK 3H4DA 4P72A 5IQQA 3I9V9 2IVYA 3LANA 4JI7F 3BM7A 4WF9Q 1WHYA 1O0PA 3DXSX 3EYZA 1RDRA 1YBTA 4NRUA 1CS4B 3H0PA 4URQU 3TZZA 1RTJB 4RW7A 5IZHA 2KZMA 2UXBJ 1HQEA 1KD1T 1RT3A 4KGVB 2AJ2A 5F8MA 3TEGA 4JV0A 4NCAA 3QFHA 2FYXA 2VODA 2JVRA 3NS6A 4PG6A 5KFXA 3GG0A 4U7UD 1TAUA 2DNHA 1SXLA 3PEJA 2UP1A 4OZ5A 5E3QA 3L3CA 3ZTOA 4DV4F 3HHLD 4Y65A 2A2CA 2XGPA 1RTHA 4Q8EA 4QWEA 2E1MC 4RNHA 5AT1B 2FVPA 2YKQA 2AX1A 2CDRB 4X64J 2Y1RI 2H9ZA 4J9QA 1HQUA 4UW2A 4RUBA 4PXDA 1FKPA 3UCUP 4DFPA 4C98A 4E0DA 3FMBA 1WHWA 1LFPA 1SJRA 3AWRA 1WC3A 2V0NA 2HRTA 4FYYB 1RP5A 4LRDA 2BXJA 4LFAF 4V1Ak 2BJ1A 1JX4A 1ZM3A 2HQDA 4KHPJ 4L76A 3AA9A 1IR1A 4X66F 1HARA 1IKVB 1WHXA 4QR1A 3CVKA 2C2OB 1RWUA 4LRAA 1S9GB 2J8SA 5D4LA 4CNZA 1NSKL 4RUCA 3VAHA 1TK5A 4JV1A 4NX9A 1K8AT 3L4BC 1U0HB 4ZITA 2FGCA 2MKSA 3DLJA 2PEBA 3KMSA 1MN9A 2CQ0A 3CJ8A 1FF2A 3ZNUA 1PKUA 1Q8KA 3KLIA 4LR9A 5LT5A 2LEAA 3GWCA 4OYOA 3I55S 3HM9A 5I42A 2WSCC 2WTFA 1JKHB 1HI8A 2A2DA 2ADBA 4NZ7A 1LQ9A 2NREA 3HP6A 2DXEA 5K8MA 4USKA 3MTJA 2CZVC 2VFUA 2I5JA 3TX0A 4ZVRB 1UA1A 4ZMMA 3EWGA 4KPCA 2F4VJ 1JXVA 4UQGA 5DJBA 5IT9U 4ZVHA 1OQ3A 1U2FA 3AD8C 3DRSB 3KUGA 4HACB 3TOQA 2OD6A 2FLLA 2E5HA 1G3OA 4FF4A 1HWLA 2LEPA 1VCTA 3ZTQA 2EC2A 2QYGA 3K17A 2MLZA 3GR0A 4OZ0A 3EVOA 2RHSB 4U7CA 3BGUA 4P75A 3CJSA 2WZ1A 1KQGB 3EDQB 5A2QY 1SL0A 2LXUA 2DXFA 2HNZA 2ASLA 4J9NA 4DWIA 4DI6A 3R5AA 2CJAA 4PQAA 4RX6A 3H5SA 1IBKF 3HKZD 3CDUA 3PG9A 5J2MB 3A8JA 3V6JA 2ZJPQ 4C4WA 2HNDA 1T3OA 4A8YA 4DR4F 4RW8A 5G4DA 1M1HA 5BJRA 4Y2KA 1B99A 2HIQA 2MGZB 5E0OA 3DGPB 4DUZJ 4DL5A 4GKKJ 3QGPA 3Q8PB 2Y1LB 3O2IA 1S76D 4C6AA 1VRUA 3MOJB 2HHUA 2R8IA 4ZLLA 3H5UA 5ADZA 3MCOA 4DV6F 4PWDB 3Q22A 4NEYA 4IG0B 3AX3A 4B08A 4I56A 3IO1A 3TEHB 4X62F 3J80Y 1VC0A 1YIJS 1IM4A 1MWYA 1S0MA 1BMQB 3PY8A 3S8SA 3HHNB 2A6OA 2HGMA 2AJFE 2KRBA 3J80U 1H2UX 3ENVA 2C2RA 2KL8A 2BQ3A 5E41A 2ZZNA 2WW4A 1CVJA 2OO4A 1T9WA 2OLWA 2OKQA 3DLGB 2FTRA 3QMQA 4F3OA 3KLGB 2XZ2A 1IUJA 2LYVA 4NA3A 3NGUA 5M2PA 2OEJA 2MYFA 1BC6A 3LWLA 4KAIA 1RTJA 2KG0A 3BKFA 2W2PP 2GS8A 3W2VA 4EI2A 3JTPA 1CJUB 5LMUJ 1S6QB 2MQ8A 1DJ0A 3US5A 3L7UA 3NG8A 2IDEA 4PQUA 1F3FA 5A0YA 5KFFA
chains in the Genus database with same CATH topology
2MZJA 2GX8A 2OPQB 3OTDA 1B64A 3KLFB 1JLAB 2KYZA 3SFGA 1SV5A 4B9VA 1TKTB 1SBRA 2F9DA 2D74B 4PKDB 5D78A 2RF2B 5F9NA 4LSLA 1ZZFA 3CCTA 3ZZZA 2FVRA 2UUWA 3R5BA 3OR1A 4QIEA 4IDKA 3K58A 1B7FA 2UV8A 3OQ2A 5CA5A 4J9OA 3DU6A 1P9QC 2DNOA 1U09A 1JLFA 2KJVA 3M32A 3NBPA 5GADU 2V5HG 5KOXA 3DOKB 4JUZA 4GMKA 2VONA 2ZVSA 4FVCA 4ZP9A 1O51A 3CCJS 4Y2AA 2YX4A 4F25A 2GQCA 3N5FA 4WKYA 3VCDA 5HO4A 4IQXA 1WACA 3V4IB 1HD1A 3MD3A 4AQYF 3NWGA 1TK8A 1S0OA 1VJWA 2IRXA 1U24A 3PX0A 3GYNA 3VWSA 3CWJA 2I5JB 4BWMA 5E3RA 3I5AA 3G4SS 5KFLA 5F8HA 3HVTB 2FIUA 3OTEA 3MEKA 4QIVA 4G1QA 2AU0A 1XWLA 1A7GE 1SUQA 2B9XA 2DJWA 2D3UA 5HP1A 5KFRA 5M2RA 1ZBTA 1RT4A 2HYIB 5IWAF 4WU2A 4UQTA 5GAHI 4ETZA 4LUBA 5A6WA 4OX7A 4DL7A 3I96A 2FC9A 3MECA 5CHCB 4ZVGA 1TK0A 1T94A 4DBQA 4B3SF 4TLQA 4K4TA 3WZ0A 4P2SA 1AXQA 2KKHA 2B4OA 2QE5A 3NNCA 3RYLA 2DR8A 1UW4A 4XIUA 1SH3A 5KFOA 4L72B 3JSBA 1TFWA 2AX0A 3CGIA 1D8ZA 5D4NA 3T6JA 5B09A 1U45A 1NKEA 4K4WA 2ZZMA 3ISZA 5KFYA 1B0PA 1NU4A 4ED1A 3MURP 2VBXA 3GIIA 4KPYA 4OLOA 1VQ8S 4NLPA 4Q2MA 2W7OA 5AXLA 3JSRA 2IM0A 2GV1A 3TAMB 1DQAA 2H5EA 2L48A 3D5MA 1HNXF 2OD4A 3MUMP 3THVA 2IRYA 2A3JA 2MPUA 5B0GA 3RZAA 3IAS9 3QAUA 2OSRA 4RW6A 2EVZA 1LWCB 4I68A 4BS2A 2WB1D 2YNIA 4H4OA 3OSPA 4ED2A 1RT2B 1VK3A 3B82A 4MK8A 5G0RB 1YQHA 2VQFF 1S6PB 2ZBIA 2ZITA 3SSRA 4AL5A 2FJEB 4PQUB 4PXEA 3ZZ0A 1FJCA 5B7WA 2DGTA 2U1AA 2UXCF 3HHLB 1MWZA 4LSNA 1HBMB 2EFPA 2K3IA 2A10A 3AB4B 4PXBA 1TKTA 4CNYA 3UW1A 3CD7A 4BCAA 5DGBA 2ASYA 3N4WA 3OFGA 4MKAA 3DLHA 3NNHA 3BGRB 1KEKA 3M6UA 3PO5A 3FDSA 2XS7A 3HJFA 2R7UA 1N48A 4WZQA 3MMBB 3N28A 3D0HE 5EGYA 2IAJB 3PW7A 5KFAA 2HHVA 3OR1B 3THPA 4KGKA 1WHVA 4NZ0A 5KFMA 5LSRA 4EO6A 1JLFB 3M32B 3NBPB 1TL3A 5KFDA 4BHQA 2YWEA 3BS9A 2QMXA 4D3GA 5FD1A 1KLMA 3M2RA 5KTQA 2PMZD 3ZFVA 1IQTA 2AYMA 3M8QA 4J9RA 1RT7B 2O67A 3K7RA 5HROA 3CMAS 4HHJA 2ZH3A 2VBYA