3OL9A

Poliovirus polymerase elongation complex with 3'-deoxy-ctp
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords Polymerase
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 136
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3ol9A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ol9A02
2V9WA 2I5JB 4XPCA 2WONB 4Y34A 2C2DA 1C1CB 1TKTB 2QV6A 4K4YA 4KV8A 3DOKA 3GYNA 5KT5A 4ECQA 2YNHA 3CWJA 5F8NA 5KT6A 3I5AA 4QWAA 5JUMA 5KT4A 2CKWA 3I5CA 1K1SA 3KK3B 4ECWA 4K4XA 4K4WA 5JXSA 1JLEB 2AX0A 4Y3CA 5KFIA 4F4WA 4DL7A 4MIBA 4NLSA 3MFHA 3FDSA 3VQSA 5KG5A 1LW0B 2C22A 1IKVA 2AGQA 2IA6A 4RW6B 4K50A 1JKHA 4KKOB 4TXSA 4QW9A 1SUQA 3IRXA 4J9SA 2BR0A 3DLKA 5C42A 5HROA 4NRTA 3T5JA 4B3OA 2OPQB 2YNIB 3DRSA 1LWEB 2BANA 3JYTA 3MR2A 1GX5A 1OS5A 4F4ZA 3ITHA 5EWFA 3GV8B 4IG3A 4RW8A 1DTTB 4H4OB 3I0RB 3HHKA 2WOMB 4ED1A 3CIZA 1RTDB 4Q8EA 4NLGA 2WK4A 5C24B 3KLHA 1C2PA 5KG6A 5F9LA 3M9OB 3RB3A 1KHVA 3NBPB 5I3UB 4KFBA 1IKWA 2IBKA 2JLEA 2D7SA 4I2QB 4FBTA 1QE1B 2ZE2B 3G86A 3H5UA 4J9RA 3KLIB 4M95A 5K14B 2DPIA 4IRDA 3OSNA 3C6TA 4ED7A 2WB4A 2ASJA 3GV7B 3QGGA 4JUZA 3BSNA 4WFYA 1LW2A 3KMSA 5DQIA 3OHAA 2W8LA 1SV5B 2R2RA 4F4XA 3V4IA 4FS1A 4MFBA 4ECSA 4KO0A 3KJVB 2OPSA 2HNZA 4TQSA 4Q0BA 4QWCA 1JLAB 2B6AA 2FVQA 1C0UB 3QO9B 4ZHRA 2C2RA 1IKYB 2JEJA 3CDWA 2XC9A 2W9CA 5KFRA 5KFBA 4YR2A 3CJ4A 2HNDA 5DQGA 4EYIB 1HYSB 3LALA 1S9GA 5J1EB 4WE1A 4ZPBA 3QIPA 4NYZA 3D5MA 1EETA 3KLEB 3KK1B 3UR0A 2R8JA 2V4RA 3DI6A 4JV1A 3DLEA 4O4RA 1ZTWA 4U6PA 2HNZB 3IS9A 4NLTA 2CJQA 2IAJA 3DDKA 4QWDA 4KV8B 1LWFA 3DOKB 1NHVA 3G6YA 1UWBA 2YNHB 2JEGA 4QPXA 3H5YA 2GC8A 1D0EA 2AQ4A 3RB4A 2GIQA 4NCGA 1JX4A 1JIHA 2JC1A 4RW4A 1HMVA 2RF2A 3RB0A 3M9MB 5KFSA 2ASDA 5F8JA 3TQ1A 3BQ0A 5I42A 2J6UA 1QAJA 1IKVB 3KHRA 2XCPA 3G6VA 1JKHB 3NAHA 4RNFA 1KLMA 1SUQB 3IRXB 3QGHA 3DLKB 4TN2A 5C42B 1JLGA 1XR7A 2IM0A 5KFMA 5HROB 1N56A 3DRSB 4B3OB 4PWDA 2BANB 3JYTB 3RAQA 2VG5A 3ITHB 3SFGA 3DOLA 4IG3B 4O3RA 4K4SA 4RW8B 1XR6A 4YR3A 2J6SA 5DG7A 4QW8A 4IH5A 3PJXA 3KLHB 4ECVA 3H59A 2XWYA 4EBCA 4KFBB 2UUTA 1IKWB 1MMLA 2HWIA 4KB7A 3DYAA 2HNYA 5KFXA 4KE5A 3H40A 3C6TB 3QLHA 4MK7A 3FRZA 1TVRA 3GIKA 5KFGA 3H5XA 1LW2B 4EO8A 2DPJA 3V4IB 1ZETA 3TVKA 1HNVA 1HQEA 3I0SA 5EWGA 3V6DA 3GIIA 2R2SA 4MFBB 1I6JA 1S4FA 2BRLA 3CJ0A 4NZ0A 3ISND 3OLAA 4KO0B 5KFZA 2OPSB 3PW0A 2R8KA 4PQUA 4Q0BB 1TL1A 2UUWA 1T94A 2B6AB 4GC7A 2VG7A 4ZHRB 3GQCA 1RTIA 4R5PA 3BSCA 4WYLA 3UQSA 3BR9A 2W9CB 4DEZA 2HNDB 3IG1A 5KFKA 4ED6A 1RYRA 4NLXA 1S9GB 4WE1B 3MR5A 3NMAA 2IM1A 3QIPB 2R8IA 3PW5A 4ICLA 3GIJA 1EETB 1R0AA 1REVA 4G3IA 5KFDA 4ECZA 3BQ2A 3NKYA 3CDEA 1T03A 3DI6B 2UVVA 3DLEB 3KLGA 1QUVA 1TV6A 4J9KA 3IS9B 5EDWA 4DL4A 3FSIA 5D3GA 2IAJB 4NLOA 1LWFB 2RKIA 1UWBB 3M8PA 4LSLA 3V6JA 2V4QA 1S1VA 2YNFA 2EC0A 4WFZA 1HPZA 5EWEA 1N6QA 4NCGB 3RAXA 3SFUA 3BQ1A 4J9LA 4Q43A 2JC0A 3MECA 4RW4B 1FKOA 1HMVB 4O3PA 2RF2B 2R8HA 4WXOA 4O4GA 2WTFA 4OL8A 1MU2A 5I42B 4RW9A 2C28A 3PR5B 2F8EX 4IDKA 3QIDA 4DL2A 1S6QA 2ZKUA 1BQNA 1RYSA 1KLMB 1TKXA 4NLVA 1JLGB 2W7PA 1DLOA 1C0TA 3T5KA 5DGAA 4PWDB 4RU9A 3H4DA 3KLVA 2VG5B 3C6UA 3MEEA 1RA6A 3DOLB 3V81A 4PUOA 1QAIA 4IRKA 5HBMA 2IM3A 3RB6A 4EYHB 1S0OA 2B43A 4KBIA 4NLRA 1W25A 2XI3A 3H2LA 1RT5A 3LP1A 5C25A 1HQUA 1JLFA 3QZ7A 3DYAB 5KFOA 2HNYB 3OL7A 3H4BA 4IG0A 1RT6A 1S1XA 2VA2A 3QLHB 1FK9A 1TVRB 2JEIA 2ILZA 1C1BA 2QE5A 1HNVB 1HQEB 5HP1A 4MK8A 3I0SB 3V6DB 3PJWA 4ED8A 4NLPA 4PQUB 1RTHA 3MTKA 4QWBA 4O3OA 4J9PA 4Q44A 1TL1B 3UPFA 2AWZA 5KG0A 2VG7B 4ZVHA 2W9AA 3JSMA 1RTIB 3TAMA 4R5PB 2XGQA 5KFJA 5F9NA 3KHGA 3LANA 3BSAA 5T14A 2C2EA 4RW7A 3MR6A 5L1LA 5DLGA 3Q8QB 3IG1B 2ZD1A 4KHMA 1RT4A 3QGIA 4WFXA 1RT7A 4GC6A 1TL3A 4ICLB 4IR1A 3E01A 1R0AB 1REVB 2ILYA 4NRUA 2BQRA 2WRMA 1N48A 3BREA 4KHRA 2D3ZA 1T03B 4I2PA 3KLGB 2B5JA 2FJWA 1TV6B 3QZ8A 1WNEA 3PW2A 2W9BA 4F50A 5D3GB 3EZUA 1KHWA 3M8QA 3HKWA 2RKIB 4LSLB 3M8PB 4H4MA 4TLRA 3IN5A 5F8IA 4KAIA 1S1VB 3BGRA 2YNFB 2AGPA 4K4ZA 1HPZB 4G1QA 4O3QA 2E9ZA 1N6QB 3SI8A 1S1WA 1RT3A 3MECB 3GILA 1FKOB 5J2MA 1J5OA 1VRTA 4EO6A 2W7OA 3KOAA 4O4GB 1MU2B 1JLCA 4RW9B 4YMEA 2UVUA 4IDKB 4QWEA 1FKPA 4ZP7A 1Z4UA 5KG7A 4O3SA 4Q8FA 1S6QB 1BQMA 1BQNB 3CO9A 1EP4A 1TKXB 2V0NA 4WYWA 1DLOB 4J9OA 1C0TB 3T1AA 2UVRA 3OSPA 4FS2A 1S9EA 4URQU 1ZTTA 2IMWP 4F4YA 4M94A 3C6UB 3MEEB 2ASLA 1S1UA 1TKZA 3OL6A 1CSJA 2AX1A 3V81B 2D41A 3DRRA 5KT2A 4PUOB 1DTQA 4FBUA 5HBMB 3GV5B 3FFIA 4MH8A 1IKXA 4ECTA 4IFYA 3N6MA 2YKMA 1U09A 3I5BA 2I1RA 4JV0A 1RT5B 5KFPA 1RT2A 2BE2A 3LP1B 3PZPA 5L9XA 1HQUB 5C25B 4URGA 3KK2A 5J2QA 1JLFB 1LWCA 4J9NA 1SH0A 3CJ5A 5KFVA 3Q8RB 4ECXA 3CVKA 2FJVA 4IG0B 1RT6B 1S1XB 4EBDA 2GIRA 3LP2A 2XI2A 1FK9B 4IH7A 4NLYA 3KLFA 2R8GA 3DM2A 3PHEA 1HARA 1C1BB 3MF5A 4ZVFA 4HYKA 5HP1B 2R2TA 3UDLA 4RUAA 3LP0A 4URSA 1RTHB 4TQRA 4ZPDA 4ZPCA 4MK9A 2J6TA 3BJYA 1RTJA 1NNDA 3ISNC 4MKBA 3JSMB 4HKQA 1RDRA 5CYMA 3TAMB 2HMIA 3LAKA 4IRCA 2YKNA 4TYBA 2XGPA 4RW7B 1N4LA 2BQ3A 3IGNA 3KHLA 1S0NA 4ZP6A 4TY8A 5KFCA 3OLBA 3OHBA 3EPIA 3FQKA 2ZD1B 1RT4B 4XO0A 4NLDA 3OL9A 1RT7B 1GX6A 1TL3B 4ED3A 3MEGA 1RA7A 3E01B 5L1JA 2JEFA 2IC3A 2IJFA 5F8GA 1N5YA 5KFUA 4R8UA 4I2PB 5DLFA 2B5JB 1S9FA 2BQUA 2W9BB 3M8QB 4IFVA 5HLFA 5J2NA 4K4UA 2OPRA 1S10A 4H4MB 3DMJA 5L1KA 1S6PA 3E51A 3BGRB 2UVWA 1TQLA 2IJNA 5KFNA 4G1QB 1S97A 1T3NA 1S1WB 1RT3B 3HVTA 4O3NA 5J2MB 5KFQA 3PW7A 1J5OB 1JLQA 1VRTB 4YP3A 2RDIA 3V6HA 4O44A 2FLNA 3N6NA 4K4VA 1JLCB 1XR5A 1FKPB 4X2BA 4LSNA 4K4TA 3QYYA 1BQMB 2FJXA 3OL8A 4DG1A 4EEYA 1EP4B 4ED2A 3LAMA 3D28A 2ATLA 4TYAA 1S1TA 5FDLA 1S9EB 2VA3A 2FVRA 4ZP9A 4I7FA 1RT1A 1S1UB 1TKZB 4IH6A 3H5SA 3DRRB 3T19A 3PW4A 4ID5A 1DTQB 2FVPA 1JLBA 1TP7A 3FFIB 2E9TA 2VG6A 4H54A 5J2PA 1S48A 1IKXB 4RZRA 4IFYB 2YKMB 4ZP8A 1VRUA 1RT2B 2BE2B 2D3UA 5CYQA 4ECRA 3DRPA 5J2QB 3KK2B 1LWCB 2OPPA 4U7CA 4JV2A 4RNOA 1T05A 1SH2A 2HWHA 4YR0A 3CDUA 4ECYA 3LP2B 1HNIA 3ICLA 2YNGA 5KFHA 3KLFB 3DM2B 4WZQA 3DLGA 4ZVGA 2WHOA 4IR9A 3MEDA 4WXWA 5F8LA 3LP0B 4ZVEA 3BSOA 2I5JA 2WONA 3MR3A 4RNNA 3V6KA 1C1CA 1RAJA 1TKTA 1RTJB 5KFEA 4DL6A 1K1QA 4EBEA 5CYMB 3GIMA 2HMIB 4J9MA 2YKNB 3KK3A 3RBDA 4Y2CA 3T5HA 4RNMA 1JLEA 4TY8B 4YQWA 5KFYA 2FLPA 3PR4A 5C5JA 5KG2A 1LW0A 3MEGB 3CJ3A 4RW6A 4KKOA 2XCAA 5KFFA 3RBEA 2E9RX 2IC3B 1N5YB 4TY9A 2OPQA 4R8UB 2YNIA 5KFLA 4IKAA 1LWEA 3FQLA 3T5LA 1IM4A 1YVFA 5KFAA 1S0MA 5DGBA 2ALZA 2IM2A 4ZMMA 2OH2A 4IFVB 5KFTA 5HLFB 5F8HA 2OPRB 5J2NB 3Q8PB 1DTTA 4H4OA 3I0RA 4Q45A 2WOMA 3DMJB 3M9NB 1RTDA 1S6PB 3CJ2A 5F8MA 5C24A 4LQ9A 4R0EA 2BRKA 2O5DA 4IOBA 5DG9A 3HVTB 1SH3A 5KG3A 2W8KA 1JLQB 4NLQA 3NBPA 5I3UA 1NHUA 4O44B 4RNHA 2RDJA 4I2QA 2AGOA 2FVSA 1QE1A 2ZE2A 3KLIA 5K14A 4LSNB 5EUHA 4MIAA 4IQXA 4RUCA 3IGVA 5KT3A 4DG1B 2HAIA 5KG1A 4XPEA 1D1UA 3NL0A 4MKAA 4ECUA 1SV5A 4KSEB 1S1TB 5KFWA 5FDLB 5DG8A 4ZPAA 4I7FB 3HVWA 3HVAA 1RT1B 3KJVA 2AU0A 3NGDA 4DL3A 3MFIA 4ID5B 4DL5A 3NAIA 1JLBB 1JLAA 1C0UA 3QO9A 2FLLA 1IKYA 2VG6B 4ED0A 5J2PB 2R2UA 1JXLA 4NLUA 1VRUB 3H98A 4WZMA 4NLWA 5CYQB 3DRPB 4J9QA 3KHHA 1HYSA 2OPPB 3N6LA 5J1EA 2WCXA 1S49A 3Q8SB 1T05B 3KMQA 5KG4A 3EPGA 1HNIB 5L1IA 3KLEA 3PVXA 2YNGB 5KT7A 2FVCA 3KK1A 3DLGB 5DQHA 4LQ3A 3G6XA 3MEDB 3KNAA 4Y2AA
chains in the Genus database with same CATH superfamily
2I0XA 1M90T 3GYNA 3S7RA 3CDAA 5E33A 4QWAA 1OY9A 2CPHA 2CKWA 3KK3B 2X7IA 5LJ5Y 1GT8A 3PX6A 1N36F 5A8WB 3T5JA 4AQYJ 1FE4A 1GX5A 3O2IA 4ALZA 2OSQA 1DTTB 3NS5A 3I0RB 1R3NA 4Q8EA 2QN6B 3KLHA 3SV3A 4F4AA 1IKWA 4WTOB 4FBTA 3KLIB 4CLWA 4FYDA 3EE3A 2E5LF 4JUZA 3CPWR 2N4CA 2DNQA 1D09B 3CDWA 5HO4A 4J37A 2BJ8A 2ACMA 3UN2A 2QLFB 1EQMA 1NMEB 3DLEA 1JJ4A 4DR3J 3EJMA 2BKPA 2CG4A 2IYIA 2JC1A 3TA1A 3CO0P 2RF2A 5F8JA 1F1BB 4Z37A 4ELTA 3G6VA 4EWTA 3TAQA 3MUTP 2QMXA 1MN9A 3HHDA 4USUA 2DHAA 1Q82T 1XR6A 3TWZA 3MDFA 4PCQA 3FSXA 4WIIA 2XLJA 3UVJA 2OJ3A 4K0KJ 2ZNYA 4DCPB 4XIUA 3AJ2A 2FZGB 4O23A 4MFBB 4YS2A 2LU2A 3JSRA 2HPUA 1T94A 3AXMA 4GVBA 1BHNA 4KPYA 1RADB 4DEZA 3TUJC 4ED6A 1FNOA 3PW5A 3NXZA 2YKOA 3OTOJ 2ADCA 4TNOA 1GMUA 4ATNA 4LSLA 1NDPA 1UFWA 2NYIA 5JVHQ 1FRJA 1Y5LB 2WTFA 2DITA 4OZ1A 2MZSA 4CTAB 3KLVA 3MOZA 2F8HA 3V81A 3PFOA 1IBKF 2RS8A 5DDOC 1RT5A 4DR4J 5A6WA 3DYAB 3E2EA 1NJIT 3PJWA 4QWBA 2YBVA 3QJPA 1UUJA 1H2TZ 4DHVA 4CO2A 5KFJA 3LANA 2VC1A 5T14A 3BO4A 1FWPA 5AXLA 4OQJA 2H51B 2AW0A 4HH1A 3D0HE 1D9AA 4CLSA 2X3DA 3HP6A 2M5YA 1BE4A 1S1VB 1S1WA 5A8KB 4F3OA 3MMJA 4ZP7A 5KG7A 2OAUA 2KXFA 2YXLA 3VAHA 1C0TB 1U24A 4ES1A 1YRUA 1CSJA 4MMOA 2VC0A 1UVMA 3OJUA 2BM1A 1F9FA 4KH0B 4IYQA 1NJWA 4X4TA 4IH7A 2J6TA 4MKBA 5CD4A 4DR7J 4DZDA 1NK6A 2NPIA 2CAJA 1XNQJ 1RA7A 3JTOA 2MQOA 4M5IA 1R31A 1QDUB 4OI2A 2DHHA 1CS4A 4JI4F 3EVMA 1CC7A 2LP4A 4JB8B 1V3ZA 1UPMB 3KKFA 4LRCA 1PJ7A 4ID5A 1JLBA 2FIUA 3TJAA 2YKMB 2DGVA 3Q86A 2XMMA 1RHQB 2QA4S 4BS2A 2FB0A 3CC2S 4ZVGA 3I32A 1OWXA 4RBVA 3MR3A 3V6KA 3UW1A 2HQGA 3GSDA 4HEA9 2Z2ZA 4M63A 3OR1B 4J9MA 4ILLA 1KWMA 5IT0A 5KFYA 2ZHAA 1NCLA 5C5JA 2QIFA 1XN9A 3GMGA 4IKAA 2FTRA 3K5MA 1RTDA 4R0EA 3PRBA 2AGOA 2M88A 4OX9J 4ECUA 2ZOGA 2UXBJ 3KJVA 3VAGA 1C0UA 3TANA 1GXUA 5T41A 2HFZA 2CG8A 4WKRA 3J7ZT 1B7YB 2FUG9 4I68A 3DRPB 3DFEA 3N6LA 4OZ0A 5E3PA 1R8BA 2LXUA 5KT7A 3EZ5A 2GO8A 4DV6J 4MIWA 4Y2AA 2QFJA 2I5JB 4FP9A 4Y34A 3CE8A 4K4YA 2G4BA 3DOKA 3D4JA 5KT5A 4DR2J 1K1SA 2KFYA 3W9HA 3GCXP 4EU0A 1JNZB 1LW0B 4MKVA 1SKWA 4BDPA 4DV2F 3DLKA 1XTZA 3THTA 3PKMA 4PQAA 4LR9A 4B9LA 2RAQA 5H9FJ 4M95A 4ZPWR 2BJDA 1SV5B 3CW2C 1FRIA 2OUGA 4KO0A 2RSQA 2EK6A 3O1LA 1IKYB 1WKKA 4QYRA 1HYSB 4U9RA 3SZ2A 4P2XA 2NSCA 1TL4A 4CLZA 5BXIA 1YJTA 4QWDA 1YGYA 1RWXB 1QAJA 3GJQB 3V2UC 3WC0A 3QGHA 5C42B 4DR6F 2XQCA 3ITHB 4RW8B 5IV4A 2CQCA 3W2VB 4ECVA 3HPOA 3PIPQ 2Z58B 2HNYA 2H4WB 4X62J 1TVRA 3GIKA 2MQMA 3R5AA 4CNZA 3TVKA 4UOFA 4PKDB 3C15B 3J7A1 5K8NA 3NMAA 3HD1A 2XZDB 1REVA 3DNCA 5ITHA 2HHQA 2UVVA 2C3UA 1HNWF 1FVSA 4OJHA 2YNFA 3MI7X 5GADI 1T9UA 3PR5B 2ZZMA 2V2VA 2E44A 1NKCA 2XMKA 4WF9Q 4KBIA 4C0HA 4WJBA 3PNIA 2OP5A 1JLFA 1X4BA 3OL7A 2GX8A 2CNNB 1NSPA 4F8RA 4J9PA 2PFFB 4ZVHA 1UEUA 3UI3A 5L1LA 4F3MA 1E6YA 2FPHX 2DR7A 4NOHA 2D3OR 4NE9C 2GCFA 1FA0A 3P5BP 1WNEA 1VIXA 2RKIB 1F5BA 3HLUA 2NPFA 3IBCB 2W7OA 2EI5A 1HHTP 1RAHB 4RW9B 2UVUA 4PAAA 5CCMA 2EFNA 3TUPA 3MEEB 3LGMA 1S1UA 4PUOB 3FFIA 2PDAA 4B9MA 4GRSA 5CH7B 1VR6A 4DX5A 4KT0C 1RT2A 4C3MA 3LP1B 1HQUB 3NGRA 3NRBA 1M5KC 4GMKA 5KTQA 4F0MA 3LH2S 4TQRA 4MK9A 4TYBA 2CPIA 1R43A 1N4LA 5D4OA 1LQ9A 2ADBA 2HFSA 5F8GA 1N5YA 4ZCIA 1IBMF 3CD0A 3IAS9 2DR6A 2AEJA 2W2NP 3KG1A 1FCAA 3TX0A 3PW7A 1JLQA 3EMTA 2FLNA 3N6NA 4K4VA 3UDEA 1JXEA 1I5OB 3MPUB 2QYCA 3BR8A 1FFWB 2IJRA 3GR1A 1ZZFA 1VS3A 1S1TA 5E0OA 5IM0A 2L41A 3W65A 4KHPF 1VRUA 3VR1A 3BYPA 5KFHA 4QR0A 3DM2B 2KJWA 2E5IA 1HBUB 1ZM3A 4D3GA 2YTCA 3PX0A 5CYMB 4UQTA 4RNMA 1JLEA 5AE3A 3CJTA 3MUVP 4PR6A 7AT1B 1NSAA 4YDXA 1BQXA 4LF5J 3C66A 3AQPA 3UCGA 3RBEA 1VRQC 5H9FK 3LPYA 2XMUA 4KH1B 1HNZF 1ZM2A 4Y2IA 4WFNQ 4O44B 2V8DA 4H4KC 5EUHA 4UY85 4IQXA 2HW3A 2KL8A 1CJVB 3NL0A 4DUYF 4ZPAA 1RT1B 2GHPA 1OIAA 1KD1T 4AFFA 2VQFJ 2QSFA 3RRGA 3H98A 3KHHA 2WCXA 2B9WA 2JWNA 4DV5F 5DJBA 2M0GB 4A46A 3FNNA 4OHXA 3ILOA 2A6OA 3I5AA 2MEWA 4YHHF 4E0DA 4XDDA 3UN5A 4K7QA 4B3OA 1B0TA 3CGIA 1OS5A 1QUPA 1Q86T 5ETVA 4P2SA 4Z2XA 3M9OB 5F9LA 3ET6B 2C2MB 3I9ZA 3Q8VA 1O51A 3VALA 2ALYB 4USVA 1H0HB 4B9VA 1TUWA 3BSNA 2W8LA 1RHMB 3ZZYA 4F7VA 3POTA 2XM3A 4B3RF 3PEHA 4ER8A 2FDNA 1IBLF 3C3LA 2EBGA 1SQGA 2OMOA 4S0MA 1A0OB 1N33F 2H9ZA 3AOBA 4WK3A 2YY3A 4DV7F 4QR2A 4DWIA 1AZSA 2ASDA 2KRRA 5I42A 5IFMA 1TAUA 1SUQB 3CCRS 3SBMA 1H6KX 3JYTB 3QJLA 4JOUA 1UETA 2OEKA 1NSKL 2J6SA 1VBYA 4JI3J 1L3KA 2ZM6J 1M1HA 1VK8A 1YJ9S 3UFCX 1RCXB 3X1LB 2OELA 1FNMA 4EFAC 3G82B 1LW2B 3R6LB 5K20B 3BGLA 3V4IB 4TKTA 3L7UA 1TL1A 1RAEB 3MM7B 2QT7A 2ZBQA 3T1YJ 1UMJA 4DFJA 2R8IA 4FZVA 3Q23A 3O44A 1TELA 3UN3A 4P10A 2PSZA 2IAJB 2I6WA 1LWFB 2EC0A 3C14A 3RAXA 1EX8A 1LXJA 3JAMU 4LF9J 4FN5A 1WC6A 1TKXA 3IAM9 3T5KA 1RSCA 1PBAA 3H4DA 2VG5B 3NS7B 3MTJA 2B43A 4X4OA 1A7GE 2XI3A 1K73T 4LFAJ 2O1PA 1VJWA 1U1LA 2DY1A 3ENAA 2ILZA 3BZQA 2N3OA 3A13A 2P9GA 3RUBL 4DFPA 3BSAA 3MM6B 1T9YA 3MR6A 1RT4A 3QGIA 3A4TA 4GC6A 4ICLB 1R0AB 4MTPA 1HR0J 3BREA 1JNRB 5CD4H 4H4MA 2D9PA 4TLRA 2D9OA 2H4YB 2AIRB 1MU2B 2R7SA 4KR0B 2N82B 1CJTA 3FC9A 3RJMB 4DUZJ 1EP4A 3FEZA 1DLOB 2UVRA 2J9EA 4B17A 1S7IA 3TZXA 1RBOB 1RT6B 1ZYQA 1KVJA 3MF5A 2XBPA 3T3FA 4URSA 2CWXA 1WC1A 4HKQA 3TAMB 2GQCA 2YKNA 1S79A 2VPYB 1WC0A 3EYZA 4C3LA 4QR1A 2CPXA 2Z2MA 5MAOA 3OL9A 2HEKA 2DGOA 2QTWA 2F1FA 2PEBA 3OR2A 2PMWA 1FFSB 3ILIA 1KOHA 3I82A 3EGWB 2FJXA 3M6VA 4X64J 4RKUC 3S01A 4I7FA 1OQ6A 1VQ4S 1R6VA 1TP7A 3QWPA 1YBUA 3F44A 3MPYA 1I94F 4EZ9A 3KK2B 4OZLA 2MKHA 5DZ7A 2HHUA 2M7SA 2DGWA 2E1AA 4LUBA 3UWTA 1IBCB 1U49A 2WHOA 4QPTA 3VZHA 3NCPA 1WELA 4RLEA 3HSZA 4JV5F 5LMUJ 1RU1A 5A76A 1NZAA 2VFTA 1EHWA 3G87A 3DOMB 1G7CB 2B8QA 3R7SB 3PRVA 4YQWA 5E2QA 1HI8A 4D3HA 2IVMA 4X66J 4A48A 3H7HB 5D4NA 1OYEA 3J7YU 1X9SA 3NMRA 2YNIA 4M5DA 5IC4B 5DGBA 3BV8A 4CYUB 3NNCA 2Y8WA 3DU6A 1I3OB 3FVYA 2XHCA 3LTOA 3KTQA 4DG1B 2HAIA 1NDCA 2Y0BB 2MHNA 3X3UA 4DL0C 1RLCL 4KSEB 4MYUA 3P5TL 2L9DA 4LREA 4I1TA 3MAQA 1Q1KA 4LJMA 1YBAA 3VGUA 2FZCB 4DOZA 2QA2A 2POKA 2X1BA 5L46A 3K5LA 4FF1A 3DLGB 3M2VA 4LQ3A 3R1HA 3MEDB 4OV6A 1Q0NA 5IWAF 2KO1A 4Y3CA 1Y00A 2IA6A 1IKVA 2MQPA 2AGQA 4RW6B 4EMDA 1QSLA 3EDRB 1VQ6S 2O66A 1R6YA 5AE2A 1YJUA 4LF2A 3CCSS 1KHVA 2PI4A 2IBKA 1H2UX 3ENWA 2VONA 2ACYA 1V9OA 3QPIA 5IT9U 1HL6A 3QO9B 1U1MA 2XC9A 1OPIA 2LA4A 4EYIB 2UUBJ 5IT9Y 2V2KA 1AA1B 2DY9A 2BOAA 5IT4A 1JB0C 5ETKA 4LBHA 2DTJA 1XMOJ 1BWEA 2MYFA 3G2XA 2CUYA 2KG0A 2M70A 1U1KA 1N36J 3LPEA 5I4MA 1XR7A 4RR5A 1DZ5A 3BDEA 2DNOA 1S99A 1KC8T 3NCQA 4C0BA 1CULA 2HFNA 3KG0A 1MMLA 1FDBA 2Z4PA 5RUBA 4X65F 1NU4A 2E5LJ 1HQEA 4HDHA 1WD6A 4NZ0A 3B82A 3SXLA 3R7NB 4NEZA 3O6QA 4ZHRB 4JI2F 2MXYA 5ETOA 2HNDB 3HDSA 5D6GA 2DJWA 2HQCA 5BYQA 3N5BA 1K0TA 1FX4A 4DV1F 3MECA 1D8YA 3VVTA 2WW4A 2R8HA 5IS2A 1S6QA 3OW2R 5HQ8A 1X5SA 2P9EA 2XMWA 1VCTA 4N8NA 3HMJG 3RR8A 4CZCA 4UZCA 3TYTA 2HVHA 3R6GB 5DO2A 2A18A 4A8WA 3D7SB 5B09A 2ZH5A 2W4CA 2UP1A 1YJ7A 1HD0A 2A1BA 3FZ2A 2EG1A 2HS4A 2W9AA 3IR7B 1WG5A 5HVFA 2DRDA 2OHDA 2V8HA 4Y6IA 4DR1F 1KR4A 2QC3A 1RHKB 3I4HX 1JJHA 2FJWA 5B0FA 4NASA 3M8QA 2RU9A 2DXFA 2AT1B 4K4ZA 3K5NA 3JQKA 3WDOA 1JQGA 3RGIA 3JQJA 3D6MB 3OBIA 2ZH9A 4J9OA 4B3TJ 5KAKA 2Z0GA 1OO0B 3UNYA 4ILRA 3C16B 4OYWA 1IBKJ 4FBUA 2MQ8A 3M30A 4X4RA 1XMQF 4JV0A 2BE2A 2LECA 5L9XA 5C25B 5J2QA 3CVKA 1XMBA 1C1BB 1J27A 1AUSL 2RQMA 1N0VC 1RTJA 1CJUB 3MM9A 2IRXA 2YKQA 4A8XA 4USKA 4NLDA 1RT7B 4PWWA 3D66A 1FFGB 3KJQB 4I6WA 2XTEA 4DZ6A 2RS2A 4X4NA 1S6PA 3BGRB 3IWNC 1VRTB 2KDOA 4OZ5A 2HBRB 1XR5A 4X2BA 1ZM4A 4NCBA 3IWXA 3L09A 1LOUA 2HK2A 4IH6A 2XEXA 2CJBA 1FE0A 2VG6A 2B51A 1ZAXA 5CYQA 1LWCB 5HQMA 3LP2B 3GR0A 4WZQA 2HHXA 4OLPA 5AXKA 1C1CA 1TKTA 3D2WA 2UUCF 2LQ8A 2NZCA 2W2PP 4Y2CA 3NP5A 2AEMA 4CLFA 1S0VA 2CDQA 4GO5X 3HXMA 1Q5VA 2HBYB 4AD6A 3MURP 1SKRA 3FQLA 2B4VA 2QSWA 2NUUG 1ZAWA 4NI2B 3EXCX 3TI0A 2DR8A 2MJUA 1CG2A 4JI4J 4FF3A 3P8BB 3N01A 3J7Z5 3G4SS 5DG8A 2V1SA 1YKWA 3QWUA 4ILMA 4ED0A 2JOQA 4USMA 2DNKA 5JMNA 5J1EA 1M5SA 3CDBA 5KG4A 2VOOA 2Y8YA 3TUZC 4A8OA 2HNZA 1Z2LA 3NEKA 1NDKA 2HQ3A 3PX4A 3MAAB 2EFPA 4DQSA 2QFIA 4KKOB 1X5TA 1LWEB 2ZBRA 3HHKA 3CIZA 2WK4A 2HRUA 1ELOA 1D9DA 2LQ9A 4HL9A 3NBPB 2ZE2B 3G86A 4DBQA 2B4PA 2DIUA 4KQZA 2R2RA 4F4XA 5B0BA 1TK0A 2KKHA 3A8JA 3RW7A 1JLAB 2FVQA 2P6SA 2JEJA 4CLYA 2JLGA 1X9MA 3QFHA 1TZ0A 1VOMA 3LALA 5DRKA 4DJBA 2HAFA 1PYSB 2V1TA 3QAEA 4L3NA 4OLOA 5EX0A 3JB9k 3CIMA 3MMBB 2QL5B 2CJQA 3HFZB 2YNHB 3H5YA 2UV8G 5HVGA 2HQFA 5KFSA 1P1LA 1WWHA 3AJ1A 4DV2J 3GJRB 3CUNA 3HULA 3FBEA 4JI7J 2Y1IA 3I6PA 1EAYC 3RZAA 4Y00A 2HFOA 5LM7E 3UD4P 2V94A 2OSRA 2GA7A 4MK7A 3HHLB 3GU0A 1GK8A 1HNVA 3MM8A 5E5NA 1O6XA 2CADA 2Z2LA 1WHYA 2G1DA 1P1TA 2YVSA 3RR7A 4DV4F 2DYAA 3AAWB 2CPFA 3WX4A 1Y7PA 1NK7A 3GIJA 2EWHA 3ENQA 4ANEA 5KFDA 1T03A 4QYZJ 4F67A 4B3MF 4MJKA 5B0EA 2PN6A 3IS9B 1R89A 3N5FA 4FNIA 4NLOA 3PRDA 3KYLA 1AUDA 2AJ1A 2JC0A 4O3PA 1TU0B 3VV2B 3K89A 2DH7A 4QIWD 4NLVA 4AXJA 1JLGB 2ZH2A 1L3TA 1PGZA 2YX1A 3PHTA 4NLRA 2UXDJ 3B4DA 2UUAF 1IVZA 1H7XA 2ZOFA 4WFAQ 2F65A 2XYGB 3I0SB 4O0IA 2W2MP 2F3JA 3Q8QB 5B0CA 1RWUA 4E8UA 4WFXA 2JX2A 1TL3A 4QOTA 2ILYA 2OTJS 2ZKTA 3KLGB 2PD1A 2DCLA 1HNWJ 2VKRA 2BA9A 1Q78A 3GILA 4C3KA 3NWRA 2Y1JA 3HF5A 2I9SA 2EG2A 1OYDA 3GFYA 1WC5A 3S1TA 3T1AA 2QG9B 4HVZA 4ZIWA 2E1MC 4ECTA 3AODA 1VGYA 2EKNA 4I67A 4M5LA 1TUVA 2R8GA 4CCHA 4HYKA 3IR5B 1BLUA 1YRTA 4OYXA 4DSJA 2C42A 4IRCA 1N88A 1G1XA 2GGPA 2CZ4A 4NPOA 1FO1A 1FKAF 4ETXA 1IXKA 1R0CB 2DNMA 2GS8A 3W2WA 3P45B 1QAXA 3MAHA 2OPRA 1PSDA 3HJVA 2D74B 4QU6A 1HD1A 1TUGB 1JLCB 4K4TA 2Y1LB 2XYPB 2LEAA 4WK1A 2E1CA 2ATLA 4MAKA 1S9EB 3M32B 3M2UB 2A3JA 4P71A 3DLHA 4LR7A 2L08A 3CDUA 2M8HA 4Y0FA 1KDNA 3BSOA 1FDAA 3W60A 2RMLA 3M05A 2CDRB 1TMMA 5KFFA 3QBCA 2IC3B 2J0WA 5LSRA 1OJ4A 3EWGA 3MM5B 1N34F 2YWHA 1OMSA 3LGNA 4O0NA 4U8YA 5H9EJ 4QJVA 1PC5A 5C24A 3VHQA 2WW8A 2DHGA 3PO4A 3NS6A 4N76A 3Q89A 1BWVA 6FDRA 1ROFA 4RWWA 1DURA 4X84A 4JYAJ 1VQ7S 2RQKA 3AX2A 1A6LA 3R5GA 3MPVA 3CD7A 1RHUB 2ERRA 1R8PA 2KRBA 3IBFB 2VHGA 5E3RA 2MLZA 2AF6A 2OPPB 3KLEA 3KK1A 3EVWA 1U6FA 1HW8A 2GV1A 4GO7X 1KRPA 4KV8A 1RKIA 2L9WA 2KZMA 2Q3PA 2VKZG 3R8YA 2XO7A 3IM8A 1AXQA 4JI5F 1IR0A 5KG5A 3MEKA 1MSWD 1R8CA 3GE9A 4I4BA 1NDLA 1HNZJ 4NLGA 2DNPA 4OJGA 3DN9A 2ZBIA 4HDGA 2HLUA 2ASYA 4KFBA 4P7TA 2Q6BA 4J9RA 4ED7A 2JH3A 5LSLA 3PV8A 1SJ3P 4DUYJ 4I0WA 2RHQB 1Q8BA 2OPSA 1WOOA 1HI1A 3W61A 2B6AA 2DBBA 4QYZK 1RE1B 4WE1A 3ZZTA 1WHVA 1EETA 5IOLA 4OYMA 3UR0A 4YUDA 2V4RA 3DGPA 3EGVA 1FESA 4IQMA 1LWXA 3HZEA 2WSFC 1D0EA 2K2PA 2GIQA 3B78A 3BN7A 4V19J 2YWWA 2P9CA 4FYYB 4P6QA 1KLMA 3IRXB 4TN2A 2IM0A 1RQ0A 3DRSB 5G4DA 4K2XA 2HVIA 3SFGA 3M8RA 3KDNA 4OX6A 1DBDA 4QW8A 3PJXA 1F5AA 5M2UA 1DY3A 3DDNA 5GADU 4ZA1A 2HWIA 4G1IA 2DNYA 2GVZB 4GC7A 2RILA 2RUSA 4R5PA 2HQDA 1QSSA 4B3RJ 1PAEX 3IG1A 2KI2A 4OX8A 4YEAA 2XMVA 4G3IA 1TL7A 2GW8A 3HI9A 3CDEA 4ZVPB 1BC6A 2CQPA 2MKIA 1ZPVA 1N33J 1HPZA 3SFUA 1QJHA 4RW4B 1HKAA 1HHSA 1VQMS 5D8HB 3VAMA 4IDKA 1NKBA 3QIDA 1B99A 3QMQA 5DGAA 1EIYB 1X4CA 2E5JA 5HSPA 3DOLB 3CSKA 4EYHB 4TLQA 4PG8A 1H2VZ 5D77A 4YDDB 1RWKB 4FYWB 1L3SA 3I31A 4IG0A 4N77A 1HI0P 2NXCA 4P2MA 4QU7A 4N7TA 2IPOB 4NLPA 3H25A 1VLOA 1EZZB 2W2QP 4A8KA 5JJBA 4KHMA 1FI4A 3TP2A 1ZH5A 5HVHA 1YTYA 2OO4A 2C2NA 1F5CA 2D3ZA 4UW2A 2XTJP 2HRYA 3QZ8A 1F60B 7FDRA 4B3SJ 1S12A 4FPRA 5FLXU 3SI8A 4M5MA 3QATA 2MGZB 4YB7A 3IP0A 2R7UA 1ITPA 3CO9A 1FDNA 1BQNB 3MOJB 3M2RB 5FLXY 2OKQA 4USTA 3ZTSA 3C6UB 1TKZA 2Y0SD 5KT2A 1DTQA 1KBRA 4MH8A 1SI9A 2DISA 1U09A 1VI7A 3UO0A 5KFVA 4C4WA 1X4GA 2F4VJ 5BR8J 4ZVFA 5HP1B 4DF4A 1GH8A 3LP0A 4Y2KA 1K9MT 4ZPDA 3Q8UA 1V3RA 1UJ4A 4RW7B 2RQ4A 1S0NA 3M1VB 2GMLA 1VFJA 5H9EK 1XQIA 4BLGA 1YBTA 1RKJA 1S9FA 2BQUA 3A3OB 4K4UA 5L1KA 4RU2A 5G0RA 3IBWA 3TZZA 1FKPB 3QYYA 1BQMB 3CXCR 4L6V3 3DLBA 3P96A 3I4PA 2DNNA 3E3XA 2HGMA 5ETNA 1BXNA 4CO3A 3UD5A 4DSFA 1IKXB 4ZP8A 4U7CA 4A8SA 2FGCA 4ECYA 2YNGA 3KLFB 4I56A 2JRSA 1NJXA 3W64A 4L74A 1F0XA 5K8OA 5GMKa 1VQOS 3QT8A 4ERDA 2HMIB 1U1RA 1NRKA 2V67A 3T5HA 2DEIA 2FLPA 3PR4A 1VQNS 2DRAA 4NMLA 1Z2ZA 3AOCA 2DT9A 4LFBF 5KFAA 1S0MA 2F9DA 1WF2A 2ZH8A 2J7UA 4Q45A 2YQ1A 3K58A 4CT8A 4NLQA 1V5VA 2KB2A 5K14A 4ITSA 1V3SA 3B54A 5KFWA 2AYGA 4RUHA 1JXLA 4WZMA 4NLWA 1I94J 3Q2TC 2JFKA 2AV5A 3BBBA 3Q2SC 5CYJA 5L1IA 3PVXA 1SBRA 1VISA 4JV5J 4N8OA 4PG6A 1AW0A 3KUGA 3D68A 4DL7A 2EVZA 1XNRF 1KONA 2G0IA 1KFDA 3DLLQ 4J9SA 2HIQA 3FZBA 3OUYB 5HROA 1KN6A 2K1RA 4DPYA 3MPDA 5BYSA 4QCLA 4DQPA 5I3UB 2D7SA 3IXQA 2WB4A 4HT5A 3H8YA 3FUYA 3FBBA 1RXOB 2OD6A 1PJ6A 1FD2A 2MDAA 2COLA 4DPXA 5F41A 4NX9A 3CJ4A 1UFLA 1T02A 1S9GA 1NH8A 2AMCB 1D9FA 4FF2A 3DI6A 1WF0A 3QRRA 1U26A 3G8QA 3NGSA 4AQYF 2XSJA 2DNGA 4XAKA 3BQ0A 3AX5A 3PM9A 4E2FB 1N56A 2IBOA 2BANB 4IG3B 4O3RA 1U2FA 2HK3A 2MKJA 4WIQA 4KC5A 2CPYA 2XWYA 2GMHA 2LKZA 2MJNA 3GZ7A 3G71S 1ZETA 3GIIA 1T8EA 1WC4A 4LRAA 1UW9A 1RTIA 4DR3F 2MZTA 5J1NA 2B56A 3HHEA 3W66A 4K5SA 3A3PB 1N52B 4C11A 3MMCB 3QIPB 3DLJA 4U95A 1TV6A 4P72A 5EDWA 3M8PA 1GEHA 4A47A 1FJGJ 2VIHA 1WSRA 2C28A 3HFKA 1X5PA 3ZTPA 2W7PA 4K0KF 3EGZA 2ZH4A 2DRBA 3HT0A 4LF8J 1UPPA 3BH6B 4FXWA 4NWBA 1WEZA 5HBMA 3RB6A 1NJYA 1IJEB 2NCKL 3H4BA 2VA2A 2H54B 4X65J 4NZ7A 1UTAA 1WG4A 2V4JA 4A8YA 2E5GA 3JSMA 4JI2J 1CJKB 2VPZB 3BGFA 1HBOB 1N48A 4UOCA 5LT5A 1WG1A 4F4KA 3EZUA 2GHWA 2HHHJ 2NREA 1FRMA 4G1QA 4DV1J 5J2MA 1FKOB 1J5OA 2XS7A 4CM2A 5HANA 5K5MA 3AA8A 2KHCA 2HZCA 3CJQA 4DR4F 2V0NA 4NMXA 3CC7S 1N32J 3T6JA 4FS2A 4URQU 3HHNB 2MKSA 3W62A 5HMYA 4IFYA 1QVFR 3ZC4A 4HI1A 2IFXA 3U27A 3MCOA 2X1FA 3BDPA 4X4PA 3FBCA 1RDRA 3HX9A 4DPOA 3LWLA 3W9JA 3BPDA 4DR1J 3OLBA 3OHBA 4YN3B 1M1GA 3MEGA 3E01B 5L1JA 4KYZA 1TFWA 4I2PB 2W9BB 4WP3A 5HLFA 5J2NA 3DMJA 2B9YA 1J5EJ 1H98A 2RDIA 1KOOA 3V6HA 2Y1RI 2BJ9A 3VAFA 3K7RA 4FVCA 2GVDB 4PZVA 1UCNA 2FVRA 3T19A 3DRRB 5D15A 4F04B 2GJ2A 1RWPB 1SJFA 3CNQP 2C2OB 3KJNB 3SCIE 4YR0A 3CCVS 4DR7F 3SQGA 2DNRA 4WXWA 1H7WA 2WONA 3GIMA 5IV3A 3N0VA 4TY8B 2C3YA 5D0RA 5GAGI 3DKDA 1S4EA 4HR2A 1F3FA 1YVFA 1FEHA 3CCUS 3OTCA 4H4OA 1B0VA 2WOMA 5F8MA 2VOPA 3CF5Q 2K06A 4J5OA 5KG3A 1H74A 2ZJPQ 1QY7A 2RDJA 1QE1A 2FQQB 1NPKA 4NYOA 3UCUP 2HGNA 5FDLB 3HVWA 1C4CA 4L76A 3GTYX 3HK2A 4J9QA 3KMQA 2KT2A 1HNIB 3WX8A 2U2FA 1VQ8S 1U8SA 3AB2B 4M5JA 1OSDA 2UXCF 2UUCJ 4K4XA 4HACA 2CQ4A 5JXSA 4FYXB 4K50A 4NRTA 3OTBA 3MR2A 1RHRB 4OX9F 2Q6CA 1QTNB 3T6BA 1E6VA 3DHXA 1N54B 4I2QB 2QLJB 3C6TA 3DCAA 3HZGA 4U7UD 3QGGA 4FYVB 1W26A 4Q0BA 4C8OA 2R7WA 1UZDA 1RJJA 3CJKA 4DR2F 2CFXA 3OT9A 1YLXA 4DFMA 4QZVB 4O4RA 2NLWA 2LXIA 1P9YA 2BYCA 4HHHA 1TTHB 2GC8A 4NCGA 1JIHA 2CNOB 5E7OB 3FK4A 2J6UA 1U0HA 4ZN3A 4KGKA 5GAEI 2HHSA 3K0JA 3L95X 3US5A 4KY3A 2LYVA 4CWBA 2XTDA 4L75A 4KGMA 3KLHB 3ZZUA 3VGTA 5DETA 1IKWB 3FKBA 4KE5A 1CBKA 1RACB 1LKZA 2DPJA 3V6DA 3ISZA 1S4FA 2BRLA 1NB2A 2R8KA 2VBXA 4F2SA 3AD7C 2E7XA 2VG7A 3HD2A 3HSDA 4ES3A 2LEPA 4PEOA 2CVIA 3PY8A 1OY6A 2VV5A 3DLEB 1RHJB 2QL7B 4DL4A 5D3GA 4DMZA 1DFDA 3CJ8A 3SV4A 2RF2B 4PPZA 4O4GA 1YHQS 4LF7J 2DGQA 2ZKUA 1RYSA 2M3DA 1S7HA 3H42A 3VCDA 3G9CA 4X62F 1T9TA 2AYEA 3VWSA 1QAIA 4A8FA 5CQGA 2B4OA 2MKCA 3UVJB 2RH3A 1N5SA 2BX6A 4ED8A 4U8VA 1RTHA 1FX2A 1ZOTA 2KT3A 2AWZA 3GJTB 4GVBB 2XGQA 5F9NA 3KHGA 1U1NA 4DV4J 1MW7A 3VAIA 3M8SA 5I3PA 4LFCJ 2ZD1A 4CIOA 4I6YA 4N41A 5ETTA 2RRBA 2B5JA 2MZJA 2WVCA 1V5IB 4P74A 4LSLB 4OHWA 4O3QA 2WB1D 5E3CA 1RT3A 2RDDA 5AJ3F 1B4SA 1PKUA 3Q24A 3SDEA 1FDDA 1SVDA 2D69A 1ZTTA 2EBEA 2QYGA 2K7JA 5THWA 3V81B 3TARA 4C0OC 3GV5B 1VHFA 4ZPVR 5F3ZA 1RT5B 5C2CA 1NSQA 3SSQA 1HARA 2R2TA 3UDLA 1PC4A 3BJYA 3BO3A 3DXBA 2WVFA 5CZXA 3W9IA 3FQKA 4ZLJA 1QTMA 3PIOQ 4YY3F 2VJUA 3ILJA 4R8UA 3OVBA 4ZJLA 4HHUA 4IFVA 1UA1A 1S1WB 3HVTA 5KFQA 4YP3A 2WBMA 3D54A 4LSNA 4OV1A 3TVYA 4RJVA 3AHPA 2J7KA 1GAOA 2VH7A 2PA8D 3CJRA 2XNQA 3GFHA 4H54A 1S48A 4RZRA 3WIVA 1SPBP 4HHJA 1KLNA 1VQ5S 1FD8A 3CMQA 2CQDA 1U45A 3QRQA 1S59A 4P9SA 2OPQA 2DB1A 1IM4A 5DZ6A 2IM2A 2BKOA 3M9NB 5E3AA 3OV7A 1CS4B 4V19X 4FKXA 5A8RA 5A0YA 1LK5A 3NGDA 3MFIA 4ID5B 1JJCB 1JLBB 3QQCD 2X51A 3D9BA 3Q8YA 2U1AA 3ZTRA 2GAHC 3PACA 2RJZA 1PG5B 4ID8A 4LF5F 1R8AA 2QV6A 4Q7AA 1BUXA 2P8IA 3I5CA 5HN0A 4QIGA 1ZA1B 1Y9OA 3M8ZA 2VDHA 5AXNA 3VQSA 4YB6A 1NKEA 1JKHA 3TA2A 1YITS 1N34J 3R7BB 2VBWA 1RTDB 2VZ9A 4JI8J 3IM9A 1H38A 2KVIA 1KKHA 2G1HA 3CJSA 2CJAA 4C8LA 4LBIA 2DPIA 3QJJA 2B9EA 5AE1A 4QQBA 1YJRA 3GV7B 4V1Ak 1XJWB 3KJVB 4PWUA 4TQSA 1C0UB 2W9CA 2DEJA 2MLYA 1G6BA 1SQFA 5ETMA 1W2IA 3DOKB 1UWBA 1HMVA 4N47A 4AL5A 3NAHA 4RNFA 3DLKB 3U02A 4PWDA 1SJQA 3GJSB 1HHQA 1MROA 1QD1A 2DIVA 5ETQA 1Q4RA 1HBMA 1T95A 2YWGA 3K17A 5LXRA 5F0WA 1HBNA 2ZFHA 2HS0A 4UUXA 3QLHA 1YI2S 1HW9A 3MCMA 4PQUA 1MWYA 4KO0B 3AB4B 1YZ7A 1URNA 5IZHA 4DSKA 2UUWA 2K3KA 2EPIA 4WYLA 2PA3A 5KFKA 5KOXA 1Y5IB 4A4JA 4CLLA 3VAJA 5I3QA 2XZ2A 1QUVA 3W3SA 5EGYA 1J2VA 2QRRA 4DSIA 4LF6J 4WFZA 1N6QA 2UU9F 3P4UB 3LWMA 4OL8A 4J91A 2GAGC 4JI3F 1MMNA 3DRYA 3R2DJ 1NJZA 2DR5A 4PXDA 1UJ6A 2MLXA 4IRKA 3ILLA 1RAFB 2CXEA 2VASA 2HNYB 1S1XA 3PTWA 1FK9A 1TVRB 4DQIA 3T1YF 5ADZA 2BE7D 2QE5A 1P6TA 3V4MA 2KXNB 2CPDA 3CD5A 1H73A 3QT5A 1KVKA 1VQKS 3WBZA 1S6OA 1REVB 3U7JA 2BQRA 3RRKA 4M5HA 4FPIA 2HGLA 1KHWA 3HSJA 3R97A 2YNFB 4ANCA 2E9ZA 4WPAA 1NBEB 3TVZA 4JI6J 1Z4UA 2W1BA 4Q8FA 2DVIA 4LFAF 1X4AA 4LRFA 3OSPA 1F9HA 5B7WA 2DKOB 3LF0A 1Y10A 5A2QY 4ELUA 2M8DB 2W2OP 2HFVA 3IWLA 4OZ3A 1JLFB 5SUHA 1L3UA 4ECXA 2MQLA 1N5VA 1RWOB 2FJVA 4NLYA 1RWVB 3MMAA 2G0CA 1UVIA 3EXYA 3D6HB 6FD1A 1HR0F 3TA0A 3ISNC 2H5JB 1B70B 2ATCB 1E6YB 4ZP6A 3N79A 5KFCA 2FHJA 2MQNA 1AFIA 2FHMA 2PI5A 5DDRC 2RUGA 4LVNP 3MCSA 1S10A 4DUZF 2IIHA 1G4CA 2HHVA 2R9LA 2O01C 4J9UE 2HURA 3ZZ0A 1JK9B 5HQLA 4L73A 2QLWA 3M8YA 3T41A 2HIYA 5T7LA 4OI1A 4ED4A 1S1UB 1CPZA 3FFIB 3TJ9A 1NK5A 5J2PA 1LEOA 4GKJJ 2GZOA 1RT2B 4ECRA 2AJ0A 2OLWA 1K8AT 2KXHA 1T05A 2RB7A 3PFEA 4TVAB 2CJKA 3HCXA 4XDCA 4ANDA 1ACMB 1WI8A 4EK2A 3KK3A 1WOSA 5A8WA 3EGNA 2E9RX 1N5YB 4Z7CA 2D68A 2OH2A 3Q8PB 1DTTA 1YSJA 2JSXA 3I0RA 3S6EA 4NXMF 2X3GA 2RNEA 1JLQB 1S57A 3TUIC 1U6ZA 1RUSA 3KLIA 2BDPA 3PYGA 1UL3A 1ZZNA 4B9TA 1S1TB 3HVAA 5IM0B 4DL3A 4Y28C 2R3VA 3T1HJ 2R2UA 1VRUB 5LMUF 3W5ZA 2CQIA 2OMLA 4X66F 4FXVA 4ECQA 1JWWA 3D1QA 1U25A 5JUMA 2AP6A 3OXFA 2DNZA 2ZC4A 1JLEB 3MPWA 2Q66A 2C1EB 3MFHA 3GWCA 2C22A 2BR0A 1CQMA 2XO6A 2B9XA 4Z7YA 1DJ0A 4F4ZA 3ZZOA 3TX8A 4HTJA 5KG6A 4I6AA 4AL7A 3OJSA 4OYBA 3PJ9A 1YWXA 4MFBA 1MLAA 3ZNJ1 4JI0J 2GMJA 2ZDPA 1RBAA 1QAYA 8AT1B 2RVJA 1R27B 1U4BA 3TNVA 2PC6A 1K47A 1UP1A 4QPXA 5FD1A 1FTRA 3L7OA 2FY8A 2LQJA 2HKEA 1S5ZA 2KFNA 2MKKA 1UVLA 4CTAA 4B3OB 3RAQA 3I96A 4LVOP 3W8GA 2KJVA 3AY0A 4PXCA 3IR6B 3DYAA 5KFXA 1EKRA 3FRZA 4ZOSA 3H5XA 1WF1A 1IQZA 4EO8A 1NK0A 5JVGQ 2UUBF 3ULHA 1VDHA 4U7UK 2ZVIA 3ONQA 2K3IA 3POTB 1U8WA 4W4MA 3UQSA 3TZWA 2BJEA 3BR9A 2XB2D 4NLXA 4ZK7M 3B4MA 4F26A 3M7VA 1UKUA 1S1VA 4AE5A 4C8KA 3TAPA 5A8KA 1AZSB 2J8AA 2CYYA 5I42B 1NXIA 1M0SA 5FIIA 1MG7A 1FVQA 1URRA 5IQQA 1C0TA 4RU9A 2XMAA 1NK8A 2MY7A 2R7VA 3AD9C 1XK8A 4JI1J 3QZ7A 2J9CA 4MK8A 2IA0A 1ZM9A 1DHMA 1TL1B 1IN0A 3OPKA 2D1CA 2YPYA 5MLCV 3PW2A 3VGVA 3K57A 5F3TA 4KAIA 3NCRA 3C14B 3DHWC 1BY9A 4B9NA 1WEYA 3GCWP 2MY8A 4QWEA 5FJ4A 2EFQA 1TKXB 1HNXJ 4WYWA 2W7AA 4F4YA 1AROP 2EEYA 2YKMA 3PZPA 1Y11A 1CQNA 2LMIA 1HA1A 4OZJA 4EBDA 4EZ6A 4OI0A 3ZFVA 3T9ZA 4DDFA 3QT7A 3OR1A 5EN1A 4DCJB 2OFGX 2I8EA 3KHLA 4DSEA 1G2EA 1RCOB 1RT4B 1VLYA 1YK9A 5D78A 2JEFA 4ETZA 5DLFA 2N4DA 2MHEA 2DHXA 4H4MB 4B3TF 3E51A 2V9KA 4F25A 2HHTA 1TQLA 1T9VA 2LVWA 2HSEB 4HH0A 4ZS6A 2DNHA 1CJTB 2VQEJ 1EP4B 3D28A 4DUTA 5HJXA 1Y3KA 5EHHA 4P75A 3F41A 2E9TA 3NGTA 2ZH7A 2FD2A 2OD4A 4AXIA 2D3UA 2H1YA 3DRPA 4RNOA 3QNWB 4BBYA 3O3LA 1HQ2A 3AWRA 3SSSA 3ZXWA 3K8VA 1UFKA 2I5JA 5CABA 2R7RA 5ETSA 4K5RA 3G96A 1K1QA 4EBEA 2YKNB 2MZQA 5L38A 1W2BR 1LW0A 3CJ3A 2QGFB 3G8SA 3LOUA 3ZZRA 3OR2B 1VBZA 1X4EA 2HLTA 4IOBA 5D4PA 2AJ2A 3WIUA 5L39A 4PRFA 3IO1A 4TU9A 1SV5A 4OZNA 3DU5A 4I7FB 2JFDA 1SL2A 2AU0A 1VIOA 1VYAA 1IUJA 2K7KA 1IKYA 5LMNF 3CCTA 1GMVA 1VC0A 4NLUA 3C19A 1HYSA 4C8YA 3CMES 3Q8SB 4X4QA 5CHCB 5D0HA 3OD2A 3QSYB 2P5VA 4PXEA 3FSYA 3CWJA 3FGVA 5KT4A 3CC4S 2AX0A 2CQ2A 2F40A 1KQSR 4CDIA 3PEJA 3BM7A 2CNKB 3L4BC 5C42A 2YNIB 4M5DB 1HWKA 4WCEQ 3ITHA 5EWFA 1DQ9A 3GV8B 4RW8A 1X5OA 3W2VA 3RB3A 2FYXA 2DO0A 4IOCQ 2QO3A 4KJIA 3H5UA 2WZ1A 1AT1B 5IXUA 1S6UA 4CT9A 3SCKE 4M5KA 3OHAA 4EUVA 5HL7Q 1Q16B 4FXDA 2C2RA 4K59A 2KFZA 3C15A 2CPZA 4RX6A 1SKUB 3EM1A 3VGSA 4WKYA 1Q95G 1PBUA 3PO5A 1O0PA 3GLJA 3C8YA 3M2VB 1ZTWA 4JP8A 4U6PA 4NLTA 1IJFB 3DDKA 2YKPA 2JL9A 2JEGA 1DAXA 2UXCJ 2AQ4A 2HRTA 3A8EA 1IKVB 2FJAB 3BBFA 3QGPA 1EJ7L 3JTPA 1U1OA 2XYHB 4GKKF 2ZITA 3U1NA 3I9V9 4IUFA 2AJQA 3KWMA 2JZ5A 3SIPB 1I6JA 2MTLA 2NR0A 2HHWA 3PW0A 3OFFA 1NO8A 3GSIA 3KNGA 4F36A 4LR8A 4ZLLA 1Y5NB 3BQ2A 2YKAA 1LFPA 1NPRA 2AYBA 2RKIA 1RAAB 4JI7F 2ZNZA 3BQ1A 4Q43A 1SC1B 4WXOA 3K8WA 2P6TA 4RW9A 1WDDA 3U1LA 3BB5A 2W4DA 1X31C 3NGUA 5LL6d 3MEEA 1RA6A 1C4AA 2BJ1A 4L72B 4PUOA 1CULB 2EK1A 1U2CA 1S0OA 4MKYA 3E8OA 3IMQJ 3LP1A 4BHQA 1HQUA 3V5RA 1PILA 2Z57B 4CO1A 3RW6A 2KU7A 4WU3A 1HQEB 2YWFA 3D1OA 1NH7A 3UPFA 1LNQA 4I64A 3CCMS 1SB6A 5DLGA 2QL9B 1S72S 2HBQB 1TAQA 3BN4A 4P52A 2IHR1 3TOQA 3BGUA 2QZ8A 4KHRA 1S76D 4USIA 3AX3A 3N9UC 1CLFA 2H65B 2E66A 1IWGA 5LJ3Y 1T3OA 2DR9A 2JVRA 3MECB 2QLBB 1JXVA 4YMEA 1S6QB 2UXDF 2CQGA 2WVEA 2QMWA 4B9UA 2H5IB 2SXLA 4BC9A 2PFDA 1N5QA 1NM2A 2E1PA 3WZ0A 2RIJA 1WI6A 2EFGA 2FVSA 1HWUA 1GQEA 3DM2A 1HBUA 2WSEC 2C3MA 1NNDA 5CYMA 1TK5A 4ZITA 3SQOP 2XGPA 2YPZA 2LQ5A 4W98A 2CQHA 4XO0A 1GX6A 1FRXA 1YJWS 1N8RT 4BWJA 5KFUA 1ICEB 2NUHA 3M8QB 1DRZA 2XWXA 2QA1A 2UVWA 2CWKA 3R1LA 2LCWA 3HKZD 4O44A 5AJ3J 2ZHOA 3ZZPA 5GAGU 1RLDA 2XMJA 3S8SA 4KGXB 2LXFA 2F9JA 4ED2A 3LAMA 1CJVA 3IA0A 4ZP9A 1RT1A 2NS1B 1PCAA 1QSYA 3RYLA 3M30B 1YJNS 2BE2B 2ROEA 3ADAC 5J2QB 4JV2A 3C2PA 1WSVA 2KHDA 1P9QC 6AT1B 1RTZA 2V6AA 1RTJB 3EZOA 3MM9B 1RZMA 1WHXA 4CI0B 3RBDA 3VVUA 4RBTA 2N7CA 1M5PC 3ELHA 3JS9A 4YY3J 4A8MP 1U1QA 2UZAA 2MZ1A 5CA5A 4OYOA 2AYMA 1Y0HA 1S6PB 2BRKA 2O5DA 3ET6A 2RD5C 3D1HA 1Q8IA 4N5SA 4NXNF 1GXTA 4MIAA 5D0EA 1VQLS 4MKAA 2F8MA 2L9NA 3H0PA 1RU2A 1L5UA 3W63A 2G0JA 2A10A 4USJC 1S77D 2VG6B 1EQ0A 4DN9A 5CYQB 4FVMA 1S49A 1FRKA 1UA0A 1NPPA 3OFGA 1Q79A 3FCHA 2V9WA 3RBXA 4XPCA 1C1CB 1TKTB 2ZWOA 2Z56B 1RAIB 1PYOB 5F8NA 1WC3A 2IRUA 4DX6A 4ECWA 2KVQE 4QIVA 4F4WA 1YRXA 2G9OA 2Y3YA 1PO6A 2H48B 1SUQA 2HWTA 2KT5A 2YQ3A 3JYTA 4J90A 4WTYA 4ED1A 1SCJB 4JYAF 3LW5C 2ZH1A 4DR6J 2PMZD 2ASJA 5GAEU 1X9WA 3O8WA 3G82A 1LW2A 2F7VA 5DQIA 3V4IA 2FHJD 2BV3A 2BBEA 3MM7A 4CRJA 2B8PA 1U7LA 5DQGA 5J1EB 5L8RC 1WORA 1Q53A 3R5JB 1AYEA 2BEFA 1KFSA 3R2CJ 4DN0A 2HNZB 2P2CB 4QBUA 2IAJA 1LWFA 2CRLA 1NHVA 2DCUB 2ZHBA 2QX0A 1IR1A 2OTLS 1QLNA 2UV8A 3M9MB 5DDPC 5KOWA 2KTQA 1SJ1A 5ETRA 2VG5A 2KYXA 4DR5F 1RAOA 4XK8C 5DG7A 4IH5A 2XMTA 4CLUA 4UZBA 4EBCA 1WUUA 4KB7A 1RBLA 1HLWA 4DV3F 2CPEA 2YX7A 3ZTOA 3ISND 5KFZA 3OLAA 1WOPA 3N4WA 1XIQA 8RUCA 3NNAA 2DK2A 3MM6A 1WKLA 2CA9A 4ICLA 1R0AA 3NKYA 4QIFA 5HMWA 1TFYA 3FSIA 4YB1P 3MXHP 4Q5VA 3V6JA 4J9LA 4DS5A 2QA4G 1MU2A 4AL6A 1DLOA 4WBFA 3DGVA 3BO2A 4ZVOB 2IM3A 2FC8A 4H4KA 1SC3B 1L3VA 3AFGA 4B02A 3HT3A 1NK4A 1RT6A 2PE8A 2FHOB 1TK8A 1HNVB 4W92B 3MM8B 5GMDA 3L7PA 3TAMA 2C2EA 2XLKA 3M4XA 1W7WA 1RWMB 2E1RA 1T03B 5CXTA 1G3OA 3THPA 1OQ3A 2AD9A 4Q2MA 5F8IA 2VFUA 3JTNA 3BGOP 2UU9J 4EO6A 3KOAA 1IBMJ 4DXLA 4ZVUB 5GAHI 4BC7A 2I38A 3GG1A 4RO0A 1IM6A 2GO9A 4M94A 2ASLA 1Q7YT 3LGHA 2V8VA 2XS5A 3K2YA 3I5BA 1FXRA 4I69A 4Q2LA 3SYZA 4URGA 3KK2A 4J9NA 1SH0A 3Q8RB 4X4VA 1XEZA 1ZPWX 2GIRA 4IO9Q 1I1GA 3KXDA 4KHPJ 4ZPCA 3ZTQA 2C2KB 4LRDA 3LAKA 3DOMA 1EARA 4YFUA 3EPIA 4B3SF 1TL3B 1EKSA 4PPDA 5H1SV 4ES2A 4CYUA 1XWLA 9ATCB 1SJ4P 4CH0S 1FRHA 2FHKA 2VFSA 4O3NA 3JAMY 2CJ9A 3Q0AA 3TRGA 3FCWA 4DG1A 3A1YG 1U48A 2ZZNA 4ZLPA 1BGXT 2VFRA 3CCES 4UUWA 2IVYA 2Q79A 4K8RA 2F4VF 3OTDA 5BR8F 1SC4B 2RHSB 4OX7A 1X7VA 3NY0A 1SH2A 3DLGA 2MSTA 3MEDA 1GMWA 5AT1B 3D3CJ 3TZYA 4DV5J 1CC8A 2B7CB 2GGPB 4LSZB 4RW6A 5B08A 2MMYA 2M4MA 3W2WB 2VU5A 1F9EB 3MWBA 4OJ1A 3TEHB 2J0SD 2H5EA 2OPRB 4KIAA 3GB0A 4YHHJ 2CJYB 5DG9A 3BEGB 1SH3A 2OI2A 4LIRA 1Q7LB 4C48A 3PCOB 2HVZA 4ZPTR 2FY1A 3IGVA 1D1UA 2MB0B 1R7IA 3GG0A 2C3PA 3OVSA 2XS2A 3QO9A 2Y9HA 4X4SA 4CLTA 4ZCLA 4W90B 3UDVA 5DQHA 3G6XA 2J7WA 2W25A 2G2OA 4ED5A 2KYZA 5DS7A 3HVRA 2OEMA 4DQRA 2BM0A 1IBLJ 3JQMA 4N56A 4P73A 5KFIA 3PYFA 3DRXA 1Z1ZA 4C97A 2ZBPA 4Y2MA 4DV7J 2JDJA 3LO3A 2YH1A 5LSOA 2I2YA 4NXMJ 5C24B 1XBWA 4TU7A 1T7PA 4WP8A 3BKTA 4QWCA 2CQ3A 1CEZA 4ZHRA 4AUKA 2HNDA 2CQ1A 4ZPBA 4NYZA 3D5MA 3GFZA 3UE2A 1UEKA 3KLEB 3D6FB 4DCOB 4MYTA 3KK1B 3SSRA 3C46A 1SJRA 4KV8B 3BYRA 3EDQB 1JX4A 2W4PA 2F5GA 3P49B 2FC9A 2MSSA 3CB4A 2B0GA 2BKNA 1M5VC 3QAUA 3D0IE 3J81j 4RL1A 1YG0A 3FRYA 4G6VB 3H59A 4KFBB 4X4UA 1U02A 1FF2A 3MHYA 2HG4A 1WACA 4ENOA 2AKWB 2OPSB 2B6AB 3GQCA 2F4FA 4LF4F 8ATCB 1RYRA 4WE1B 2IM1A 2X1GA 3FMWA 3RU0A 1EETB 2AJ4A 2ZDOA 3DGPB 1EB0A 4RBUA 1WJ9A 4F3QA 4CLKA 2DGTA 3R3TA 1KLMB 1Y3JA 2W01A 3HO1A 2DH9A 3KUEA 4G1PA 3C16A 1UVNA 4UQGA 3LQVA 3RTVA 2RRAA 1LK7A 5C25A 2NZ4A 2B4UA 2XSFA 5KFOA 2JEIA 1C1BA 3CCLS 3VTIA 3K5OA 3F56A 3MTKA 3A8IA 1CJUA 4R5PB 4DU7A 5L9NA 1IWAA 4P7VA 4ZVTB 3IG1B 4KTQA 1RT7A 1M1KT 1FHTA 3Q83A 2JHEA 1TL7B 4ZIVA 2WRMA 3SEOA 1FJGF 1M5OC 2L3MA 4J7CA 1DQ8A 3IN5A 3BGRA 1HPZB 4LF8F 1VRTA 3CTRA 4IDKB 2KN4A 2LDIA 1A9NB 1GTHA 1RWWB 4NCAA 4HI2A 3CCZA 3A3NB 4AT1B 2ZWPA 3EVOA 4CQ1A 2XTCA 5CCLA 3OTEA 1LWCA 1TMJA 4IG0B 3LP2A 4DI6A 5DDQC 3PHEA 4NYPA 1B3TA 4RUAA 1SIZA 1SXLA 2FJDB 4ZCMA 5DM6Q 2HHHF 3WHIA 2QEXS 2YH0A 2IJFA 4GVLA 5B0AA 4NI2A 1Y4ZB 3FBFA 5C7PA 1N32F 2V63A 4C6AA 4WU2A 1X4DA 2RQCA 3ETOA 4TYAA 4OHYA 1TKZB 4HT7A 2ZBCA 1DTQB 3GONA 3WQPA 1JMTA 3AA9A 2F63A 2AEFA 4DPUA 4UF4A 4ZDNA 4DV0F 5IQ6A 4C7QA 4WWSA 2DNLA 4IR9A 5F8LA 2ZC3A 4OJ3A 3SCLE 3LP0B 3AJDA 4RNNA 1RAJA 1X4FA 4KPCA 4B9SA 3TJ8A 2V69A 2LDYA 3MAAA 2B7BB 3FEXB 1NLKL 4G65A 1J5EF 3KFWX 4WFBQ 4KKOA 5AXMA 1LWEA 1VMBA 5IWAJ 4OHZA 2EKYA 2ZUGA 1H3DA 5G0RB 3HHLC 4NA2A 1F2HA 3NBPA 1GTEA 2ZE2A 2Q1LA 5KT3A 4IO1A 4C8ZA 2AZ3A 1JLAA 4EGLA 2PIIA 1WTFA 2CQ0A 3I56S 5EX3A 2GQQA 1GFWB 1T9XA 4LBPA 1SQEA 4CO4A 4C8NA 1U2RA 2GJIA 3FMBA 2YNGB 2FVCA 3MMBA 3KNAA 1VC6A 1KTVA 3JSBA 3I55S 2YNHA 4OYIA 5KT6A 3AD8C 3A8KA 1WTBA 2J8SA 1T11A 3CULA 2QMUB 5C2GA 3FDSA 2V8GA 4UOHA 4QW9A 2V34A 3OQ2A 1OM2A 2NYHA 3UD3P 3M6WA 2M52A 2K8GA 1PJ5A 4OYAA 3MD1A 5HATA 2JLEA 4NA1A 5K14B 2V5HG 1NHKL 3HHLA 3KMSA 4FS1A 4ZJOA 5LMNJ 1FJCA 4YR2A 1NK9A 3J7AN 1UJ5A 1REGX 3AQOA 3H20A 3OTOF 3N28A 3IS9A 2APOA 1I51B 1HWJA 1FEEA 3RB4A 2XZWA 4M5GA 1D3WA 2AJFE 5HROB 1JLGA 1FXDA 2K1RB 3R5DA 4K4SA 2BACA 2ABYA 2RE1A 2Z8QA 1UVJA 2WVDA 3H40A 2JJ4D 4DSLA 3QFWA 3I0SA 3CCWA 3HFVA 2DD8S 1ZAVA 2VBZA 2B3TB 1S9GB 1FWKA 4ECZA 7FD1A 3DI6B 3CCQS 3KLGA 1ZBTA 2XSJB 2VBYA 2F8EX 4Y65A 2RRNA 5M2RA 4GKKJ 3F0NA 1F3VA 4C2MA 1MN7A 3I87A 3TR5A 2J0QD 4UOGA 1VBKA 1VK3A 2A0FB 5LOQA 3D3BJ 4U67Q 2Z2YB 2CQBA 1XMQJ 5KG0A 1RTIB 4ZVSB 2MPUA 1KQFB 4C11B 1KVIA 4OIXA 2BE9B 3R27A 1XNQF 3KDOA 4CNYA 4LF7F 1TV6B 4C98A 1WHWA 4F50A 3HKWA 2CNLB 2A2CA 1ZA2B 3M8PB 4OFZA 1PYTA 2G2YA 2AGPA 1VHIA 1FNXH 1JLCA 1RWNB 2LQBA 4O3SA 1YX2A 3MD3A 2R42A 2EFVA 3H2VE 1S9EA 1BMQB 3AOAA 1NZ8A 3OL6A 4HTIA 4RPFA 3M32A 2LLZA 3M2UA 5HBMB 2QJ3A 3JXOA 4KGVB 1N5TA 3TW0A 3UCZP 4CP5A 5E41A 1R8HA 2C2ZB 3B8HA 3CJ5A 2LEBA 2XI2A 2KG1A 2E5HA 3D6TB 2LFVA 4LFCF 3QRPA 1TL5A 1TR0A 1KTQA 2V68A 2V4JB 3GIRA 3RRHA 3JSMB 2M2BA 2JVOA 4PG4A 2HQIA 3IGNA 2ZJQQ 1RI7A 3BPSP 2HVEA 3THVA 1U0SA 3GYXB 4ED3A 3FCVA 4FF4A 2IC3A 1Q8LA 3MM5A 2HVDA 4CH7A 3H2UB 4G1QB 1S97A 1T3NA 5J2MB 1J5OB 3W5XA 3R5CA 4RWXA 4EEYA 3W1YC 1WKJA 2CJXB 2VPWB 3MR7A 2G2ZA 2UXBF 5K8PA 3H5SA 3PW4A 2FVPA 1OSCA 5BYRA 4IFYB 1UWAA 1FTCA 2OPPA 1VQSA 4NA3A 2FJEB 5F0UA 4LRBA 4DV6F 3PG9A 1DARA 4DL6A 4ZJQA 2WAQD 2NXUA 5E3QA 3MEGB 1B7FA 2NXNA 4TY9A 3T5LA 3BKFA 1U6BA 2ALZA 2J0XA 5HI7A 5KFTA 1WDTA 5F8HA 5J2NB 5HLFB 3DMJB 3ENVA 2RT3A 4DPWA 2R7TA 3ZNUA 4RNHA 4L3KA 4RUCA 3D0GE 4XPEA 3IFEA 3EX7B 1PIEA 2R4FA 4KRWA 4NZ6A 1AFJA 4ZCKA 2FLLA 4DQQA 2HBZB 4P2FA 3CEDA 3MUMP 3EPGA 3SQGB 2O3DA 4NL5A 2WONB 5IC6B 2ZOMA 2EFOA 1RP5A 2KZZA 2OIHA 2HHPA 3HM9A 2M9KA 3DXSX 3B6BA 3MGJA 4BCAA 4TXSA 2R7XA 3IRXA 1SL1A 3DRSA 4H4OB 2WOMB 2D3O1 1C2PA 2X1AA 3KUHA 3P3DA 4NXNJ 1QE1B 4DS4A 3OSNA 1UVKA 4WFYA 4OI6A 4LF1A 1F6TA 4ECSA 2GVZA 2NSBA 1N0UA 1JJ2R 3QSIA 1FERA 1B64A 3UDCA 5KFBA 2IY5B 1KNZA 1RAGB 3F73A 3Q22A 4JV1A 2CVEA 4HLBA 2XNRA 3KG4A 3GYGA 3NWGA 4PYDA 2NXEA 4HACB 4OMFG 4RW4A 3OVAA 1RISA 3TQ1A 4B3MJ 4JI8F 3TEGA 5KFMA 2YWKA 5D4LA 3DOLA 4CO5A 1ZS6A 2PMHA 2MZRA 3CMAS 2OGUA 1FT8A 2DXDA 1E6VB 1GMWD 3NOGA 4FDFA 2UUTA 1NEEA 4ELVA 3C6TB 2GQ2A 4CM0A 5EWGA 3PYEA 4OI4A 2EC2A 4Q0BB 5CZVA 4DX8H 3BSCA 2UUAJ 3BKUA 4DF8A 3CJKB 2ZZTA 1MWZA 3CCJS 3MR5A 4DFKA 4LT6A 1KP6A 4FKYA 3VZIA 4MT1A 2GJFA 4C9DA 3HJFA 3NGKA 1LV5A 3SCJE 4R0JA 2JLFA 3BBCA 2V4QA 5M2PA 4NCGB 4ZKAA 2MGZA 5U47A 1U0HB 4DL2A 1BQNA 2VDIA 3M2RA 2RU3A 1YIJS 3C6UA 3BH7B 4RUBA 4DR5J 2A6MA 2AHOB 2V2ZA 5HMXA 2DHSA 1VBXA 2KH9A 1K44A 4DV3J 5HP1A 3R9LA 3V6DB 3W7BA 3P6YC 1D8ZA 2VG7B 1FJ7A 1LFWA 4RW7A 3M1VA 4LF6F 3A12A 2BJ3A 4IR1A 2OEJA 2EXUA 5D0GA 1OPZA 5D3GB 5B0DA 1VQYA 3U1MA 2BW7A 3UNGC 1P27B 3EUNA 4O4GB 2BZ2A 4DLGA 1M5HA 1FKPA 1BQMA 3DDIA 3NNHA 2YX4A 2ZEJA 3OXGA 2AX1A 3J81U 2D41A 5K8MA 1SC6A 1QM9A 4KGZB 1GNKA 2DH8A 2C3OA 1UAWA 1IKXA 3N6MA 3DC2A 3TQEA 1MNEA 2IMOA 1UEVA 5BJRA 3J81Y 2DO4A 4OI3A 2J9DA 2V50A 2IYGA 3KLFA 2BJ7A 2HZAA 1RTHB 2XLIA 2HMIA 5LXYA 2BQ3A 3ZZZA 3VQTA 2ZD1B 2B5JB 4JI6F 3J80U 2J9DE 3G6ES 2XG8A 1RT3B 2FGOA 1OY8A 3OXLA 2BVZA 3J80Y 3SDEB 1X4HA 1ULRA 2WVBA 5HMZA 2R7QA 2VQFF 3D67A 1P8GA 2HWHA 4EI2A 3ICLA 4M5NA 2HFUA 1V6HA 4ZVEA 2KM8C 1U47A 1SKSA 3KJFB 2BOPA 4F02A 1VJQA 3QT6A 2XCAA 3OUYA 4R8UB 5KFLA 2AZ1A 4E98A 2FJBB 4IFVB 2JNJA 4JI5J 3CJ2A 3M8WA 3HVTB 2W8KA 3AT1B 5I3UA 1TKDA 4LSNB 4GKJF 3W5YA 2FZKB 2CIMA 3RBZA 3BS9A 4OZ2A 2BUNA 3PYDA 2EW9A 4DL5A 1LXNA 1YZ6A 4UY8T 2H3EB 2CZVC 2IDEA 1MMDA 1RGVA 2VPXB 2XZTB 4F2RA 3J7YI 2MQQA 3RAMA 2O67A 2C2DA 4PG5A 4AYBD 1XERA 4K4WA 1KS2A 5GMEA 5HK4A 5DM7Q 4MIBA 4OHVA 4NLSA 2CPJA 2VUGA 3GP9A 2OPQB 2BANA 2W24A 4UT4A 4CO0A 4IG3A 3T9NA 2E7VA 3L3CA 2ZM6F 1CVJA 3OFEA 3T1HF 3WC2A 2MKYA 2PGCA 4IRDA 3TO8A 5A8RB 2GFFA 5A0YB 3PKYA 2V8PA 1IQTA 5GVQA 3ZO7A 1VQ9S 2IRYA 5KFRA 3BF4A 1HWIA 3AXKA 4CH1A 2NXJA 2ROPA 3MMCA 4R25A 3L9ZA 3LUYA 3QIPA 3CT9A 1UZHA 2BXJA 4DX7A 2VD3A 2J5AA 2R8JA 1UW4A 3RG6A 1AB8A 2XHWA 4B08A 5A6PA 3G6YA 4USHA 2DGUA 3RB0A 3VAKA 4NEYA 2WBRA 1NB7A 1GXLA 3ETMA 4M8LA 3VF0B 3LA0A 4UTGA 4LF9F 3KHRA 2XCPA 1JKHB 2N7YA 1X0PA 5K9FA 1NUEA 4PABA 4M1KA 4TU8A 2XY6A 4YR3A 3HSGA 5A2QU 5ETPA 4USWA 4JI0F 1PAUB 3MZIA 3CD6S 2VFVA 5KFGA 2YQ0A 2R2SA 1IR2A 3CJ0A 2VJVA 2DGXA 4BWMA 4U96A 3EICA 2VICA 2E29A 2W9CB 5HAOA 1CJKA 2Z30B 1APSA 1MWQA 3MCNA 2GIFA 2VF3A 1HBOA 3SMZA 1R0BG 1RB0A 1KEKA 4J9KA 4CLPA 1UWBB 3G8TA 5EWEA 1FKOA 1HMVB 2L48A 1HWLA 1HIYA 4PWDB 1KSPA 2CZ9A 1F2GA 4ZN1A 1FRLA 1MROB 2NQPA 1T0TV 4OYZA 1W25A 2XY5A 3H2LA 1HBMB 4ZVRB 2BMBA 1HBNB 2FLOA 5GAHU 1O5JA 3GFXA 3QLHB 2V2QA 1BD6A 2ZJRQ 4PQUB 3K59A 4O3OA 4YB5A 4Q44A 2J76E 2ROGA 1T9WA 4LF4J 4OYPA 1WEXA 2OFHX 1X8DA 3E01A 3PDNA 1VC5A 4NRUA 1H72C 3JSYA 2KM8B 3OFHA 4I2PA 4IOAQ 2E7WA 9RUBA 2W9BA 2R7OA 3HHLD 2XULA 3AH6A 2G13A 3R5BA 1XC9A 1N6QB 2YWEA 2ZH6A 4X64F 3K5PA 2BW2A 2BABA 2GVDA 4JI1F 2IMWP 3PXGa 4A8QA 3DRRA 1NAQA 1YDLA 1Q8KA 4LIWA 2I1RA 5KFPA 4PYAA 1SL0A 2LA6A 1S1XB 3IRWP 1FK9B 4PG7A 4JBCA 4YOEA 1FWLA 1VQPS 1FXLA 2PT0A 3UR3C 1HFEL 4TY8A 2A2DA 4F0HA 1B0PA 3IC1A 1YJVA 4QIEA 2IDLA 2VB6A 3H90A 5B0GA 1HNXF 2Q43A 3M6XA 2IJNA 2HYIB 5KFNA 4DU8A 3NLCA 4LFBJ 2DGSA 1KQKA 2IVFB 2ZUAA 2HS3A 3OL8A 4ZVQB 4WP9A 2HZVA 5J1PA 5FDLA 3M6UA 2VA3A 1K0VA 1Q5YA 3GPAA 2GNKA 4FNHA 5CAAA 5HJYA 4PXBA 1HNIA 5SZTA 2QLXA 1FJEB 3NG8A 1YQHA 3MMAB 3W8PA 4LMZA 4F0KA 4ZLNA 5KFEA 4J9VA 2N3LA 2VL1A 4DLEA 2WSCC 3FEYB 5KG2A 1RK8A 2LU1A 1X60A 2ZH3A 4C8MA 4ZMMA 4XTTA 2VQEF 2DXEA 4LQ9A 1XNRJ 1RABB 2PEHA 5ETLA 1NHUA 4I2QA 1U1PA 1KQGB 1Q81T 3FJ2A 5KG1A 1QVGR 5T7LB 2ZVSA 2PO4A 1O8BA 3NAIA 1DQAA 2VODA 5J2PB 2GHVC 3O5TB 3NOCA 1X0FA 4DPTA 1T05B 4DV0J 1SIWB 2XY7A 4K2JA 1XMOF
chains in the Genus database with same CATH topology
1Z2LA 2I0XA 4LF5F 1R8AA 1M90T 2QV6A 4ED5A 2KYZA 3GYNA 5DS7A 3S7RA 3CDAA 3HVRA 5E33A 4Q7AA 4QWAA 4DQRA 2BM0A 2HQ3A 3PX4A 2CPHA 2CKWA 3I5CA 3KK3B 4N56A 5HN0A 4QIGA 2EFPA 5KFIA 5LJ5Y 1Y9OA 1GT8A 3PX6A 4DQSA 3DRXA 5AXNA 1Z1ZA 3VQSA 1N36F 4YB6A 1NKEA 5A8WB 4KKOB 1JKHA 4C97A 3TA2A 1X5TA 3T5JA 4Y2MA 1YITS 1LWEB 1FE4A 2JDJA 3LO3A 1GX5A 3O2IA 2YH1A 2VBWA 5LSOA 4ALZA 2I2YA 2OSQA 1DTTB 3NS5A 3I0RB 3HHKA 1RTDB 3CIZA 1R3NA 4Q8EA 2WK4A 5C24B 2HRUA 1XBWA 4TU7A 2VZ9A 1ELOA 3KLHA 1D9DA 3SV3A 1H38A 2LQ9A 2KVIA 4HL9A 3NBPB 1IKWA 4FBTA 2CJAA 2ZE2B 3G86A 1T7PA 3KLIB 4C8LA 2DPIA 4DBQA 3QJJA 5AE1A 4FYDA 4QQBA 1YJRA 3GV7B 2E5LF 2B4PA 2DIUA 4JUZA 4KQZA 2R2RA 4F4XA 3CPWR 5B0BA 3KJVB 2N4CA 1TK0A 4PWUA 4TQSA 2KKHA 4QWCA 2DNQA 3RW7A 1JLAB 2FVQA 1C0UB 2CQ3A 2P6SA 1CEZA 4ZHRA 2JEJA 3CDWA 2JLGA 4AUKA 1X9MA 5HO4A 1TZ0A 2W9CA 1VOMA 2HNDA 3LALA 4J37A 5DRKA 4DJBA 2CQ1A 4ZPBA 4NYZA 3D5MA 3GFZA 3QAEA 4L3NA 4OLOA 3UE2A 3KLEB 5EX0A 4MYTA 1G6BA 3KK1B 3JB9k 3SSRA 3CIMA 3MMBB 3DLEA 1JJ4A 3C46A 2CJQA 1W2IA 1SJRA 4KV8B 3DOKB 2CG4A 1UWBA 2IYIA 2YNHB 3H5YA 2UV8G 1JX4A 2JC1A 3TA1A 1HMVA 2RF2A 2W4PA 3P49B 5KFSA 5F8JA 1P1LA 4N47A 2FC9A 2MSSA 1WWHA 4Z37A 3AJ1A 3CB4A 4AL5A 4ELTA 3G6VA 2B0GA 3NAHA 4RNFA 3CUNA 4EWTA 3TAQA 3DLKB 3MUTP 2QMXA 3U02A 4PWDA 2Y1IA 1M5VC 3I6PA 1SJQA 3QAUA 3HHDA 2DHAA 3RZAA 4Y00A 1Q82T 2HFOA 1XR6A 1MROA 3D0IE 2DIVA 1YG0A 3MDFA 3FRYA 3FSXA 4PCQA 4WIIA 2XLJA 4G6VB 1Q4RA 3H59A 1HBMA 1T95A 2YWGA 2OJ3A 5LXRA 4KFBB 5F0WA 4X4UA 1HBNA 1FF2A 3MHYA 3UD4P 2V94A 2ZNYA 4XIUA 2ZFHA 3AJ2A 2OSRA 2HS0A 4UUXA 2GA7A 4MK7A 3QLHA 2HG4A 1WACA 4O23A 1YI2S 3HHLB 1HW9A 1HNVA 3MM8A 4MFBB 5E5NA 4PQUA 1MWYA 4KO0B 2LU2A 2OPSB 3AB4B 3JSRA 2HPUA 5IZHA 2Z2LA 4DSKA 2UUWA 1URNA 1T94A 2B6AB 1WHYA 2G1DA 2K3KA 3GQCA 1P1TA 2EPIA 2YVSA 3RR7A 4KPYA 4WYLA 4DV4F 2PA3A 4DEZA 4LF4F 3AAWB 3TUJ<