1SH2A

Crystal structure of norwalk virus polymerase (metal-free, centered orthorhombic)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
502
structure length
502
Chain Sequence
GTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVNED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of norwalk virus polymerase reveals the carboxyl terminus in the active site cleft.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase
molecule keywords RNA Polymerase
total genus 157
structure length 502
sequence length 502
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 1sh2A02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1sh2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sh2A03
3I0SB 1TVRB 1QUVA 2WB4A 4IG0B 3LP2A 3E51A 3DLEB 3CDWA 3DM2A 1S9FA 4QWCA 1KLMB 2RKIA 4WE1A 5KT4A 1S9GB 5FDLA 2B5JA 2YNHB 3KK2A 4PQUB 1C0UA 4O3OA 4I7FB 2QE5A 3DI6B 5JUMA 3V6DA 2VA2A 1MMLA 5HROA 4KKOA 1KHWA 2IJNA 1HYSA 4O3PA 3KMQA 4KV8B 1RTHB 2VG6A 5J1EA 3BR9A 1HMVB 2HAIA 3GV8B 3H59A 5CYQB 5KT3A 4Y3CA 3KLFB 4NLYA 4KHRA 3QO9B 5EDWA 1S0MA 3UR0A 4MK7A 5KT7A 4Q8EA 4DL7A 2D7SA 5I42B 2JC0A 2R2SA 4O3RA 2J6UA 2AX0A 2W9CB 4URQU 2V9WA 2E9TA 4Y34A 2HWIA 2VG5A 3LP1A 3NGDA 1QE1B 3Q8SB 2WHOA 3I0RB 4WXOA 3RBEA 5C24A 1QAJA 2FJVA 5JXSA 3DLGB 2BRLA 5F8HA 2AU0A 4QWBA 1RTIB 4MK8A 1NNDA 2AGPA 2F8EX 4GC6A 1DTQA 4MKAA 5KG0A 1FKPA 5KFRA 1IKYB 3QIPA 5DLFA 3FDSA 5DQHA 5J2MA 2JLEA 1C0TB 2OPPA 3HKWA 5KFPA 4J9RA 1IM4A 4EBCA 3PHEA 4ED2A 3CJ5A 4QW8A 2FJXA 3C6UB 4IFYA 4NCGA 5F9LA 5KG7A 1XR7A 2YNGB 3E01A 4F50A 2WONA 4EBEA 2JEIA 1HNVB 4PUOB 3CWJA 4R8UA 4QWEA 4NLUA 2OPQA 3GQCA 3KK3A 3V4IB 4ID5B 4K4VA 1RA7A 2ZE2A 1RYRA 4MKBA 1T03A 5J2NA 3HVWA 5K14A 2ZD1A 3EZUA 3DOKB 5HLFB 1EETA 3LP0A 3KK1B 5KT2A 5KFSA 4ECXA 2W8LA 5J2QA 4KE5A 3N6MA 5KG2A 1RAJA 5C25A 3T5KA 3FQKA 1N56A 4K4WA 3MEEB 3LALA 4LSLB 5KFUA 4RUCA 2UUTA 2VA3A 2DPJA 4IG3A 5KFMA 1TQLA 4RW6A 3SFUA 4TYAA 3IGNA 4IFVB 4H54A 3KLEB 1NHUA 1TP7A 2GIQA 2OPSB 3DLKA 3OSNA 1J5OB 2V4RA 3BSNA 3C6TA 2RF2B 4WFXA 4O44A 3H5SA 4ZHRA 2AQ4A 4J9MA 3CJ3A 1S1VA 4Q43A 3T5HA 4Q44A 4TQRA 3BJYA 4FBTA 5L9XA 3ICLA 4TLRA 1WNEA 4ZP8A 3MR5A 1TV6A 2ASLA 4RW9A 5HBMA 2WCXA 1RT3B 4R5PB 4PWDB 2FLPA 4J9SA 4O44B 3KLHA 1C1CA 3Q8QB 3HHKA 3MECA 2J6TA 2J6SA 5DG9A 4DL2A 4JV1A 5J2PA 2XI2A 1RT6B 3DLKB 3GILA 4JV2A 3KLEA 4IFVA 4O4RA 4WZQA 4XO0A 5DG7A 4M95A 4Y2CA 4NLWA 1HNIA 5KG6A 1D1UA 2FVRA 1HQUA 3I5CA 1JLGA 1RT5B 3QLHA 4K4TA 2FVQA 4K4XA 2IM2A 4PQUA 1EETB 5KT5A 4H4MB 3V6KA 2FLLA 4IRDA 4NLGA 3DRSA 1S1WA 4NRTA 1S48A 2WRMA 3KHRA 4LQ3A 2BQUA 3M8QA 4ID5A 3TAMB 4Q45A 5KFOA 3KK3B 5L1IA 1S49A 2OPQB 4EBDA 3IRXB 4ZPDA 3KJVB 4R8UB 4WYLA 1MU2B 2JEGA 1OS5A 4WZMA 5CYMA 2BE2A 4U7CA 1C1BA 4KAIA 4QWAA 5KG1A 5KFHA 1S6PB 3C6UA 3H4DA 1VRTB 1QAIA 3NAIA 3BSAA 3VQSA 1C0TA 4URSA 3RB0A 5J2MB 2GC8A 2IJFA 2UVVA 4J9NA 1NHVA 4ECTA 1JXLA 2WOMA 3TAMA 1LWCA 2VG7A 4EO6A 3M8QB 5F8NA 3MR3A 2R8HA 1R0AA 3KLIB 1GX6A 2FLNA 4RW4A 5C24B 4F4XA 4IRKA 4RUAA 3LP1B 3DRSB 3H5YA 5KFKA 1REVB 2W9CA 2I5JB 3MFIA 2YNFB 1T05A 3CDEA 5I42A 1DTTB 1U09A 4KO0A 2V4QA 1JLFB 1N5YA 1JLGB 2JC1A 3M8PB 3M9OB 2C22A 1HQUB 1CSJA 2HWHA 1RT1A 4H4OA 2R2UA 3RB4A 5KG5A 3OSPA 1N48A 1I6JA 2E9ZA 4ZVFA 3JYTA 5KFYA 5J1EB 1S10A 2R8GA 1TKXB 4GC7A 1S1UB 2ASDA 1HYSB 4ZP7A 3ITHA 4JV0A 5F9NA 3RAQA 4B3OB 4IH7A 3DI6A 4I7FA 1JLBB 4EO8A 3CO9A 3KLHB 3PW2A 3DRRB 3DRPA 5FDLB 4R5PA 4PWDA 1TV6B 1KLMA 2RKIB 3I5AA 1S0OA 2XWYA 4IG0A 4ED3A 1TL1B 1D0EA 4ZPAA 4DG1A 3CVKA 4YR2A 3KNAA 3PW7A 2UVRA 4ZHRB 2IA6A 4ZP9A 3OHBA 2IM0A 1JLBA 3OL9A 3RB6A 4K50A 1KHVA 3ITHB 4FS2A 1S1UA 4NZ0A 3NMAA 1LW2B 4MFBB 5KFTA 2ASJA 1YVFA 4RNHA 3JYTB 3JSMA 1RT4A 4KFBA 1TKZB 3UQSA 4ED6A 4O3SA 3SFGA 1SV5A 4NLSA 2OPRA 3IG1A 2ALZA 4ZVHA 3LAKA 4NLPA 2E9RX 1JLEB 1RTJB 4H4OB 3KLVA 2FVCA 3M8PA 1N5YB 1JLQB 5J2QB 1DTTA 1W25A 1C2PA 2YNFA 3BGRA 4ECVA 1T05B 1N6QA 3LP0B 4LQ9A 5F8LA 1IKVA 5HLFA 2UVWA 4G1QB 1VRUB 1LWCB 1SH3A 1SH2A 5L1LA 2C2DA 1R0AB 2WOMB 3DYAB 3PW0A 5HP1A 3MEDA 3KHGA 3T5JA 2YNGA 4WFZA 3E01B 2R8JA 2GIRA 4IFYB 4NCGB 3IGVA 2BQ3A 2IM3A 1VRTA 3QZ8A 3T19A 2OPPB 4ZPBA 4EYIB 2BE2B 3OL7A 3DDKA 5CYMB 2W9AA 3QIPB 3MEDB 1MU2A 3KJVA 3IRXA 3GYNA 4J9KA 4IQXA 3DLGA 4MH8A 4RNMA 1QE1A 1S1WB 4QW9A 2VG5B 2OH2A 4NLQA 1TL3B 4R0EA 3FRZA 4H4MA 4YQWA 3QZ7A 1IKVB 4DL6A 4KHMA 3PW5A 2YNIA 3H40A 1JLQA 3EPIA 1RT5A 5KFEA 2FVSA 1GX5A 1S1TA 3OL6A 1RTJA 2CJQA 4FS1A 2YKMB 4KBIA 4DG1B 4NLOA 4RNNA 1HNIB 4DL5A 1JLAB 1SV5B 2OPRB 3IG1B 1TKZA 1HMVA 3JSMB 3G6YA 4J9LA 2R8KA 4K4SA 3RB3A 1HARA 4KV8A 1LW2A 4MFBA 2W7PA 2IC3B 5F8IA 1FKOA 1RT6A 4X2BA 4KKOB 5J2PB 5HROB 5EWGA 3EPGA 4EYHB 3TQ1A 3N6NA 3N6LA 3MECB 4ECUA 3KHHA 1C1CB 2HMIA 3I5BA 3TVKA 1S0NA 3M9MB 3OLBA 1RT3A 2B5JB 4NLDA 3KK2B 4TQSA 3FSIA 3BSOA 2AWZA 3GIIA 4WE1B 3PW4A 1TL1A 2JEJA 4Q8FA 4RZRA 4Q0BB 2AGOA 3BREA 3MFHA 2W8KA 5I3UA 2FVPA 1S1VB 4TXSA 4J9PA 4M94A 4ZVEA 3DRPB 3DRRA 5KG3A 3CJ2A 1TKTB 4IRCA 2RF2A 3SI8A 3C6TB 5KFDA 1J5OA 4B3OA 1JKHB 5DLGA 1K1QA 2R2TA 4YP3A 1IKXA 2C2RA 1S97A 1T3NA 4WFYA 1TKXA 3OHAA 1XR6A 4U6PA 2V0NA 3ISND 4RW6B 1JX4A 2IBKA 4IG3B 3QYYA 1RT1B 5L1KA 3MEEA 4LSLA 1EP4B 2BRKA 5KG4A 4DL3A 3T1AA 1JLFA 4ED0A 4K4YA 4KO0B 1SUQA 4ZMMA 3MR6A 2I5JA 2R2RA 1REVA 4MK9A 3UDLA 3GIMA 3DOKA 1ZTWA 2YKNA 3V81A 4TY8B 3NAHA 2ZD1B 2D3UA 3DOLA 4O3QA 4I2QA 4OL8A 1T03B 4RW4B 3KLIA 2EC0A 4KB7A 2BR0A 2VG7B 5F8JA 1LWEB 3V4IA 1HQEB 5KT6A 4G3IA 1HNVA 3PR5B 2BANA 1RT2A 4IDKA 2ATLA 4F4YA 4NLRA 5DGBA 3G6VA 2ILYA 1S6PA 5KFBA 5EUHA 1C1BB 4TYBA 4RW8A 5F8MA 3RBDA 1LWFB 1FKPB 5D3GB 1DTQB 2AGQA 2W9BA 1RDRA 4O4GB 5EWFA 1RTIA 1K1SA 2D3ZA 3CJ4A 1S9EB 3DMJB 3HVTB 1RT7A 3NBPB 4F4WA 4I2PA 2ILZA 4ED8A 4NRUA 3MTKA 4J9OA 3H4BA 2RDIA 3Q8RB 2XCAA 4K4ZA 3HVTA 5DG8A 4ED1A 4ECYA 4IR1A 4RW7B 3QLHB 2W9BB 1DLOB 5EWEA 5D3GA 5KFLA 3D28A 1S6QB 3LANA 4DL4A 4RW8B 5L1JA 3BQ1A 2HNZB 5KFQA 4ZPCA 1RTDB 4DEZA 2BANB 4IDKB 4NLTA 4MIBA 3FQLA 4ECRA 3V6DB 5KFFA 1BQNB 3M9NB 1LW0B 1S4FA 2YNHA 3GV7B 1LWEA 2R8IA 1S9GA 3PJWA 3H5UA 2B43A 4RW9B 3D5MA 5HBMB 3GV5B 3G6XA 2XI3A 4I2QB 3LP2B 2CKWA 3V81B 1RYSA 2YKNB 1TVRA 3V6HA 3CIZA 5T14A 3H98A 2DPIA 3GIJA 3NKYA 4ECSA 3KLGB 3FFIB 4O3NA 3IN5A 3IS9B 4IH5A 1N4LA 2OPSA 3NL0A 3CJ0A 1ZTTA 4TN2A 3BSCA 3PJXA 1IKXB 3IS9A 2C28A 1HPZB 4MIAA 3OL8A 3KLGA 4K4UA 1Z4UA 5C25B 2IAJA 5F8GA 2W7OA 3CDUA 1TKTA 5KFAA 4RNOA 5KFCA 3KK1A 1UWBA 4WYWA 3MEGB 4ZVGA 4FBUA 5K14B 5I3UB 3BQ0A 3QGHA 2HNDA 2HNYA 3H2LA 5J2NB 1IKWA 4Q0BA 2ZE2B 5DQIA 2QV6A 2WTFA 5KFIA 2O5DA 1JLCB 4NLXA 5C5JA 4IOBA 1LW0A 2UVUA 3BQ2A 2D41A 1BQNA 4PUOA 2HMIB 2WONB 3RAXA 3QGGA 4TY9A 1BQMA 1FKOB 2IC3A 4F4ZA 4ECZA 1RTDA 2HNZA 4YR0A 4URGA 4ICLB 2XGQA 4IR9A 2XCPA 2AX1A 5KFGA 4NYZA 1JLAA 5DQGA 2YKMA 1S6QA 5KFZA 1IKYA 2B6AA 4RNFA 1S1TB 3MF5A 1DLOA 4RW7A 2YNIB 3QIDA 4KSEB 4QPXA 3H5XA 1S1XA 2FJWA 1TL3A 3I0RA 4LSNA 4LSNB 2C2EA 4JUZA 1S1XB 4IH6A 3Q8PB 4I2PB 2XGPA 1RT7B 1S9EA 3DMJA 3NBPA 1JIHA 4O4GA 3OLAA 3G86A 3PR4A 1LWFA 2B6AB 5KFVA 3QO9A 3MR2A 3KHLA 2IMWP 5CYQA 3KLFA 2WK4A 2XC9A 2RDJA 4ICLA 1RTHA 2VG6B 4QWDA 4RU9A 1ZETA 1BQMB 5KFJA 2IM1A 1RT2B 1T94A 2JEFA 5HP1B 1SH0A 3QGIA 3DYAA 4YR3A 1C0UB 1HQEA 5KFXA 1JLCA 3PZPA 4ZP6A 4HYKA 1IKWB 1VRUA 2HNDB 2HNYB 4XPCA 3DM2B 3DLEA 3DOLB 4Y2AA 4G1QA 4TY8A 4WXWA 3MEGA 4IKAA 3GIKA 1UWBB 3I0SA 4J9QA 1N6QB 5C42B 5DGAA 3BGRB 1SUQB 4XPEA 2IAJB 2I1RA 3LAMA 4ECWA 1EP4A 1JLEA 1HPZA 1FK9A 1XR5A 3HVAA 4YMEA 1RT4B 4KFBB 2UUWA 4ED7A 3PVXA 5KFWA 3KOAA 4ECQA 4NLVA 1FK9B 1JKHA 3FFIA 3ISNC 1RA6A 2ZKUA 4EEYA 5KFNA 2BQRA 3V6JA 3T5LA 4HKQA 3KMSA 5C42A 3UPFA
chains in the Genus database with same CATH superfamily
1X31C 2WVCA 1P94A 4OYIA 5F3ZA 2G0JA 2ZZTA 2EVZA 3E51A 3DLEB 4GKKF 4QWCA 4CRJA 4WE1A 4DL0C 2GQ2A 3CGIA 3ILOA 4OV6A 2CZ4A 4O3OA 1ZBTA 2QE5A 2VBWA 5JUMA 4KH0B 1MMLA 1VLYA 1VYAA 4W4MA 3T1HF 2VBZA 1Q53A 4OZNA 4RR5A 4DCJB 3DFEA 4TKTA 2A1BA 4FP9A 4NWBA 1M0SA 1KDNA 4CO4A 1H6KX 2I8EA 3QO9B 4KHRA 5GADU 1NK6A 1RI7A 3CMQA 5I42B 3CTRA 4PXEA 3ZZOA 2F9DA 2ZFHA 1HR0F 2HFUA 4M1KA 3KYLA 2WZ1A 1UA1A 3RGIA 3E8OA 2HWIA 2C2ZB 2CQIA 2DNMA 1QE1B 2CZ9A 3IBFB 4GO5X 3Q8SB 3RBEA 2XB2D 2FZKB 3GIRA 4OZ2A 1FDBA 4X66F 1NNDA 1RAGB 5B0FA 1N32F 2F8EX 4PXCA 2Q43A 2WVEA 5KFRA 1GTHA 3R5JB 2RH3A 2ZWOA 2GPEA 3HKWA 5KFPA 4J9RA 4GVBB 3PR5B 3PHEA 4YY3J 2KDOA 4IFYA 5AE2A 4DU7A 5F9LA 5KG7A 3CMAS 1XMQJ 4NXMJ 2G4BA 5HMZA 1TFYA 4L73A 5MAOA 3HO1A 2JEIA 1R0CB 3FZ2A 5IWAJ 2MGZA 2CQ1A 3MMBB 3SQGA 1RWUA 1IWGA 1RBAA 1AZSA 5HQMA 3V4IB 4XAKA 3JSYA 2CFXA 2ZE2A 2NREA 1KBRA 2WBRA 3C15A 3GMGA 1QD1A 3EZUA 4LREA 5HLFB 4DN9A 3D3BJ 4GKJF 3KK1B 1R8CA 3AY0A 1WDDA 2GQQA 3MD3A 5KT2A 2W8LA 4FF1A 3S1TA 2LECA 3TJ8A 1YZ7A 1RAJA 4OYBA 3S7RA 3SSQA 5C25A 4UQGA 3MEEB 5KFUA 5DDQC 4PRFA 1S4EA 2DPJA 5CQGA 3LGMA 4CWBA 4NYOA 1ZOTA 1NHUA 2MZTA 1TP7A 2QGFB 4XIUA 3DLKA 1Y9OA 1DQ9A 4HEA9 4HDGA 3SSRA 4USJC 7FDRA 3BBCA 4QU6A 1F1BB 2RF2B 3D6FB 1NB7A 2KKEA 2DRDA 1RACB 3M2VB 4J9MA 1NZ8A 4CNYA 1Q82T 3HULA 1YJWS 5B0CA 2PEBA 2HQGA 1S1VA 2DHGA 3DHWC 3AQOA 4YY3F 5L9XA 3ICLA 4FPRA 3BGLA 3D68A 3M4XA 1M1GA 4ZP8A 4DR3F 3F41A 2BKOA 5HBMA 4QPTA 4TNOA 2J9CA 4J9SA 4O44B 2OHDA 3KLHA 1U8WA 2CJKA 3HHKA 3MECA 4ZCKA 2F65A 5J2PA 3W60A 1S99A 3GYGA 4ED5A 1WORA 1KQFB 4AD6A 2DEIA 2DGWA 3FEXB 5LJ5Y 2HHVA 4GMKA 4LR7A 2DO4A 3I55S 2K8GA 2X1GA 4M95A 5KG6A 3TUIC 3S8SA 1FVQA 5HI7A 2AD9A 1T9VA 2RU3A 3I5CA 2FVRA 2OO4A 3AJDA 4B3SF 1RKJA 1OSDA 1NSAA 2BJ7A 5DZ6A 2ADCA 1A9NB 3TX0A 4R25A 1FJ7A 2L3MA 2LLZA 5MLCV 2ACYA 1EETB 2M52A 3Q83A 4H4MB 2FLLA 1J5EJ 4NLGA 3DRSA 2ZJPQ 2DRBA 4FNHA 1S48A 2WRMA 3GFYA 3MPWA 4X84A 1E6YA 3RAMA 4NCAA 1FI4A 4Q45A 1AFJA 1AZSB 3K5MA 3UVJA 2CPEA 2OPQB 5B0EA 5GVQA 1B0VA 4ZPDA 2HURA 2V2VA 4R8UB 4WYLA 3AHPA 4OZ5A 2GZOA 1JJ2R 1SJ4P 2GVDA 1UJ5A 5KG1A 4UOGA 4ZK7M 4OLPA 3BSAA 3UNYA 1C0TA 3ZZYA 3MM8A 5J2MB 1CJUA 3DLJA 3NWRA 3P45B 4USMA 1HBOA 1RBLA 3TVYA 2IY5B 2AJ1A 5DDRC 5CAAA 2ABYA 1LWCA 3G4SS 4FKXA 2EFVA 3MUMP 2P9EA 3KLIB 1GX6A 4I4BA 2YQ3A 4RW4A 2XO7A 3CUNA 2ZUGA 2HBRB 4K2JA 3LP1B 3DRSB 1UAWA 2RAQA 2YVSA 5IM0B 5KFKA 1REVB 4C8NA 2C3YA 3RJMB 1G3OA 2ADLA 3CDEA 3DKDA 5I42A 1VIOA 1T05A 2V4QA 1UEVA 2DIUA 3B54A 3KDNA 1JLGB 3T9ZA 2LDYA 4A8XA 4DPOA 1N5YA 2VONA 1NPRA 2OFGX 2VASA 4H4OA 4USHA 2WTFA 4X64J 1X9SA 3TANA 3IXQA 1FX4A 4ZVFA 3JYTA 3NMRA 3BYPA 5J1EB 1UVJA 3DOMB 2BKNA 2ZDOA 1PYTA 5BYQA 1PAEX 3BKTA 5F9NA 4B3OB 3CCSS 2KRBA 2HVHA 4HT7A 5AJ3F 1SVDA 3CO9A 2E66A 5DRKA 4NASA 3I5AA 3M05A 1OMSA 1SC3B 2HSEB 2QLXA 2W2QP 3MDFA 3E3XA 3N28A 1JXVA 2Y1RI 2J76E 1S0OA 2BJDA 4B3TF 3GP9A 3PIPQ 1GNKA 1KD1T 3POTB 1N5VA 4QIGA 2B0GA 3M2VA 5CHCB 4DMZA 5B0DA 4JI5J 1CJTA 4K2XA 2LCWA 3OL9A 1X60A 1VDHA 2J7UA 3TEGA 1TMJA 1VR6A 3PRDA 5AXKA 1KHVA 4LF6F 1S1UA 2AYBA 2DY1A 3NMAA 4DI6A 2AYGA 1N34J 2AP6A 5GAEI 3NP5A 5D15A 3JYTB 5JMNA 1T11A 2HRTA 1U1OA 1SIWB 2BJEA 4OZ1A 4H4OB 1U26A 2W4PA 3QT8A 2EBGA 2CNOB 4ZPWR 1HHQA 4MJWA 1OY6A 4NL5A 3MM6B 5BXIA 1IKVA 4LFBJ 3PYFA 1V3SA 3R3TA 2HWTA 3PJ9A 1I3OB 2B9EA 2DGSA 3ILJA 1GEHA 2F3JA 2F1FA 1VRUB 3MD1A 5D0EA 1HNWJ 1NJWA 1LWCB 5L1LA 2C2DA 2R9LA 3ZTSA 4ZJQA 2HIYA 3GFZA 1U6FA 4USTA 3WQPA 3PW0A 5E7OB 4CYUB 3KHGA 3T5JA 3CMES 3MMJA 2XSFA 1UEKA 2PFDA 2YNGA 1U25A 3E01B 3ZTPA 5JJBA 3UCZP 1PILA 4KHPF 2R7XA 4NCGB 2BQ3A 2DGQA 3J7ZT 1F0XA 1DZ5A 2DGVA 3T19A 2ZVIA 3OL7A 3DDKA 4OYWA 3TUZC 3SCIE 2E5JA 4ZCMA 3KJVA 3AH6A 3C16B 1WI8A 3GYNA 4HT5A 1NB2A 1M5VC 2V9KA 4UZCA 4IQXA 3JTOA 3OJUA 1FWKA 1X4EA 4QW9A 1FWLA 1T0TV 4H4KC 3KXDA 4C97A 2JXHA 4R0EA 1MG7A 2YPYA 4H4MA 1IKVB 4ALZA 5M2UA 2XLIA 1VQ5S 2K3KA 2VOPA 1RAIB 1CULA 4DL6A 1GMVA 2YWHA 2VPXB 4FXDA 5KFEA 2DEJA 3K0JA 1GX5A 2HPUA 1S1TA 4DX5A 1UA0A 2XBPA 3HSZA 4KBIA 2AEFA 4DL5A 1HNIB 2ZH3A 3B78A 1SV5B 2OI2A 3R7SB 3VGTA 1S76D 1WG1A 5D0RA 3G6YA 2R8KA 3QRPA 4KY3A 4K4SA 2EG2A 2NSCA 5HMWA 3OPKA 5CD4A 1SL1A 4LF8J 2KRRA 3OUYA 1Q0NA 1FKOA 2J9DE 3EZ5A 3C46A 5J2PB 1YJUA 3N01A 5HROB 2N7CA 4DR4J 4Y2KA 2D3O1 1SKWA 4ECUA 3MECB 1WACA 3KHHA 4P71A 4BCAA 2VL1A 4RL1A 3TVKA 4I0WA 4O3RA 3MCNA 3MPUB 5A6WA 2DRAA 2W2MP 4EFAC 2U1AA 3QT7A 3NG8A 4WE1B 4TQSA 3EWGA 2VD3A 3PO5A 4Q0BB 4ELTA 3MFHA 5I3UA 1ZM4A 4J9PA 2A2BA 3SCJE 3X3UA 5KAKA 1UUJA 2QG9B 2VFVA 4OYMA 4OZ3A 5HQLA 5KG3A 4OX9J 2UXDJ 3AX5A 2RF2A 3HD1A 2HFVA 3H0PA 4USVA 2IVFB 5KFDA 1YI2S 1VBYA 2F4VJ 5I3QA 4B3OA 5CZXA 5DLGA 3KJNB 1IKXA 2CQBA 2HGLA 3EUNA 2Z8QA 4MMOA 4WFYA 4QBUA 2FGOA 2H1OE 2GQCA 1XR6A 4DFPA 3M30A 3FKBA 3ZXWA 2XTCA 3ISND 3TUPA 4RW6B 2RILA 2IBKA 1YDLA 1LEOA 2DNGA 4LF2A 2CQDA 2CNNB 1RT1B 1MMNA 3ZTOA 2H65B 3MEEA 1EP4B 2BRKA 4PXDA 2HHWA 1QY7A 3T1AA 4C8OA 4WFNQ 3O1LA 1NDKA 1SUQA 2BOPA 4HDHA 3MR6A 3EM1A 3GONA 4PPZA 1M5OC 2I5JA 1PJ7A 3FBBA 3CD0A 4I67A 1HBUA 5E3CA 2FD2A 4TY8B 3NAHA 5IM0A 2D3UA 1RP5A 2Z30B 4DLEA 1M1KT 3FJ2A 1I94F 4RW4B 4W90B 4KB7A 3TW0A 5LJ3Y 2BR0A 1BUXA 3MMCA 2Z2YB 2XTEA 1MW7A 3V4IA 1QAXA 3F44A 3SQGB 4A8OA 2FC8A 1HBOB 4ED6A 1FRJA 4MIWA 5IQ6A 4KJIA 2AEJA 1MMDA 2BANA 2XZ2A 3G6VA 1RWOB 2XQCA 2ILYA 2DNRA 2MLYA 2RS2A 2F7VA 2MPUA 4B3TJ 2JH3A 3FT7A 2CAXA 1R6VA 2G2OA 2M3DA 2RB7A 4HVZA 1FESA 1PC4A 2N3LA 1AYEA 2H3EB 1PCAA 1TR0A 2QFIA 2W9BA 2VJVA 4D3GA 2AKWB 3NBPB 4ED8A 4F4WA 4JI1F 4CLUA 1XERA 2RJZA 1NAQA 4CO2A 4J9OA 2OTJS 1NKCA 3G9CA 4TU8A 3QPIA 2HHHF 4EZ9A 3VAKA 5DG8A 5HL7Q 3RRHA 1S72S 3BR8A 4ED1A 3C19A 3EYZA 1R8AA 4UOHA 3A8JA 1GK8A 2CNKB 3K5OA 4ZN3A 5D3GA 3CJTA 2IYGA 4E2FB 2GFFA 3D28A 3GPAA 5IV3A 4X65F 4DUZJ 1VBZA 4RW8B 3D2WA 3D4JA 3VZHA 2GGPA 1J5EF 1XQIA 3P8BB 3HJFA 1ARQA 1F2GA 3W2WB 4ZPCA 2BE9B 4DV2J 2XSJA 1OIAA 2EFNA 1NPKA 3M8YA 1IRQA 3M6VA 2PEHA 2AF6A 4OX9F 1L5UA 1S59A 2YNHA 1ZH5A 4PQUA 1T9XA 3MAAA 2YBVA 4L3KA 3G6XA 2MMYA 2CQ4A 1UKUA 2XI3A 2N4DA 4LBPA 3QAUA 4IO1A 1OYEA 2CKWA 3V81B 1NCLA 2GS8A 3CIZA 2VB6A 2Z57B 2NXEA 4LSZB 5T14A 4N76A 1NHKL 2KM8B 2DYAA 3D0HE 2MJNA 2DPIA 2KO1A 2DNZA 4CI0B 4CM2A 3FFIB 3VALA 4LFCJ 4BHQA 1S77D 3IN5A 3IS9B 3R7BB 2P6TA 4KYZA 4AQYJ 1CQMA 1B28A 1LNQA 1ZA1B 1HBNB 2AJ4A 3CJ0A 2AIRB 2GVZB 3UW1A 2XO6A 1VCTA 1MN9A 2P9CA 2H9ZA 1Y0HA 4TN2A 2C28A 3MM7B 4DWIA 3OL8A 2OEKA 3KLGA 5C25B 2IAJA 3E2EA 3IC1A 1VS3A 2R7QA 2MB0B 3VAGA 2ZZNA 2HS3A 5KFAA 4RNOA 5KFCA 2DNNA 2KXHA 5D4NA 1UWBA 5HANA 3TA2A 1C4AA 1CVJA 4WK1A 3PEHA 4YS2A 1FVSA 4AL6A 1IKWA 3R5CA 4NOHA 2MKCA 1U6BA 1OY9A 1JLCB 5C5JA 5H9EK 3BQ2A 3MPDA 1H3DA 3MPVA 3NRBA 5T7LB 2DNPA 3UNGC 5AXLA 3RAXA 3VGSA 4TY9A 2QZ8A 2M2BA 3Q86A 2XZWA 4F4ZA 4DFMA 2HNZA 4YR0A 4ZLLA 4URGA 1JNRB 2DNYA 2QMXA 3GG1A 1N36J 5B09A 1EAYC 2CWXA 2HBQB 2GO8A 4LFCF 4PG4A 1S6QA 2OMOA 4B9NA 2GJFA 2QLWA 4FF3A 1DLOA 3Q89A 4EGLA 4ANEA 2YNIB 5LM7E 4QPXA 2BJ1A 4BC7A 5GAHU 1DQ8A 2NQPA 3BB5A 3BGUA 2BJ3A 2C2EA 2XWXA 2XGPA 1RU1A 4IH6A 4I2PB 3LWLA 1RT7B 2XULA 3T41A 2GHWA 1BE4A 3UN5A 1ZM9A 4K5SA 3R5BA 4O4GA 1LK7A 2R4FA 4KRWA 3PR4A 4A4JA 1Q8KA 1LWFA 2CDRB 4OHWA 2MY7A 4DV2F 1TK0A 4ELUA 5CYQA 4UOCA 1VGYA 3PKMA 3GSIA 1FE0A 4Y28C 4QWDA 5D0GA 1SQGA 1HWUA 3R7NB 4C98A 1U1RA 2JEFA 2EK6A 5KOXA 1H73A 3D0IE 3QGIA 3DYAA 1FRLA 2C42A 3OTCA 1GFWB 4CLFA 1KONA 5HQ8A 4B3MF 2G2YA 2GJIA 1QSYA 2X51A 3HLUA 1YKWA 3DLEA 1U2CA 4Y2AA 4G1QA 4NXMF 2HHUA 3MEGA 3GIKA 4UW2A 5E33A 1N6QB 1MNTA 1GMWA 3Q8UA 5DGAA 1U0SA 4WTYA 5BYRA 4DV1F 1KVJA 2N3OA 1KOOA 2L48A 1LKZA 2E7XA 1R0BG 2I1RA 1ZAXA 2RUSA 1U8SA 3LAMA 1HPZA 2JRSA 4QYRA 4PG8A 4DR1F 4K0KJ 2HW3A 4P52A 4QR0A 4JI2J 3HT3A 3HVAA 1FXLA 3OW2R 2UUWA 3KOAA 1A6LA 1WI6A 1WOSA 2LQ5A 2HK3A 1JKHA 3EGNA 3GCWP 4I68A 4CO0A 4WTOB 5KFNA 4WF9Q 1PYOB 4MJKA 3VCDA 2DVIA 2GNKA 3VVUA 1D3WA 3F0NA 4WIQA 4FXEA 3UPFA 1RWPB 1VK8A 3I0SB 4DG1B 1TVRB 3CCUS 1N88A 1QUVA 2M4MA 4IG0B 4M5HA 2VBXA 3CDWA 3DM2A 1S9FA 2QT7A 1X9WA 2Z2MA 1TFWA 2RKIA 1RWVB 3NNCA 2PE8A 5KT4A 1IM6A 5FDLA 3PKYA 2FHKA 4Y00A 1IBKF 1V9OA 1C0UA 2ROGA 3QMQA 3M32A 4NZ6A 2BNZA 1XN9A 3V6DA 3AA9A 3PYDA 3R2CJ 2VPZB 2IJNA 1HYSA 5E5NA 2DHSA 2W01A 4O3PA 4KV8B 2ZNYA 4DUTA 4QZVB 1BLUA 3BR9A 4NCBA 2C2NA 3BPSP 4F25A 3W63A 2D1CA 3M8SA 3KLFB 2NSBA 4Y3CA 2XHWA 3B4DA 2PC6A 3NCRA 5JVHQ 4DFKA 4OHYA 5EDWA 3ET6B 1EQ0A 3UR0A 1WKLA 2C3UA 4MK7A 1PYSB 2COLA 4PWWA 3FEYB 5KT7A 3RTVA 4DL7A 4LF4J 2R7SA 4RBVA 5IXUA 2AX0A 2KB2A 4URQU 1Q86T 2FJBB 2NZCA 4DX7A 2E9TA 3NGDA 1WD6A 1EARA 4Q7AA 3I0RB 4WXOA 1BDVA 3R5AA 4TU7A 1N5QA 3HM9A 5JXSA 4G3IA 4IOCQ 4CZCA 4YDDB 3D7SB 4B3SJ 3C3LA 1DAXA 1SC1B 2AGPA 1NK4A 1OQ3A 1DTQA 3O8WA 4MKAA 5KG0A 4U67Q 4Q2LA 2POKA 2BJ8A 3QIPA 4OI3A 3FDSA 2XY7A 1GTEA 2JXIA 2O01C 1HW8A 2OPPA 2W2PP 2ZBQA 1F2HA 4ZLJA 4EBCA 2H3AA 2HAFA 2BV3A 3CJ5A 4QW8A 1QTMA 3L3CA 4C0OC 3IWNC 4DR7F 4DR7J 3RUBL 2BEFA 2MY8A 1L3KA 2JSXA 4JYAF 1ICEB 3ILIA 2HIQA 1R8BA 4QWEA 1RHJB 4NLUA 3VAMA 3I9ZA 3QFHA 4L76A 3L4BC 2VODA 3KK3A 2P5VA 4X4VA 3P96A 4ID5B 4F0MA 2XNQA 5LMNJ 3BZQA 3SIPB 1T9YA 1T03A 2XS7A 2APOA 3HVWA 2XTDA 2ZD1A 3SMZA 2N82B 3J7Z5 2V50A 3DOKB 4EU0A 4DF4A 2CQ0A 1SB6A 3LP0A 2ZH1A 2Y1JA 5G4DA 4ECXA 1H7XA 4N8NA 1OQ6A 5ETPA 5HJYA 3OD2A 5J2QA 5KG2A 1MYLA 2CUYA 2AZ3A 1KC8T 1HWJA 4DR5J 4RUCA 2VA3A 2HHXA 1N54B 3QBCA 5KFMA 1TQLA 5F3TA 4FYXB 2W1BA 4TYAA 1R43A 4IFVB 3NGRA 4ILLA 3KLEB 3W2VA 2BX6A 3BGFA 4HLBA 3HVRA 1QM9A 4DV6F 1NZAA 4GRSA 3RU0A 5AE3A 3OSNA 4HTIA 1J5OB 3BSNA 1CJVA 1TAQA 2HBZB 3QT5A 3KG1A 2AQ4A 4OHXA 4OQJA 2E5LJ 2L9DA 3UD3P 1SC4B 2VPYB 1B01A 4Q43A 4NI2B 4Q44A 3T5HA 4FBTA 3U1MA 7FD1A 2IVYA 6FD1A 3J7YI 4TLRA 4LFBF 3IM8A 3THTA 5LL6d 2ASLA 1B7FA 4R5PB 3NY0A 3UD4P 3DLHA 1H7WA 4WP9A 3SEOA 5SUHA 2G1HA 4M5MA 3UN2A 2J6SA 3D9BA 3Q8QB 3PM9A 3ZNUA 1YX2A 4LUBA 5A8WA 3BH7B 4OI1A 3G8QA 1HWKA 4FXWA 4IFVA 4O4RA 4WZQA 2F8MA 4XO0A 1EA4A 4QIFA 5DG7A 2EI5A 4LF6J 4NLWA 1HQUA 3JAMY 5FD1A 1RT5B 3QLHA 2FHJD 3NNHA 1PARA 2MLZA 1IBCB 1M1HA 2DISA 2IM2A 4GVLA 4X66J 3ZTRA 2RVJA 4X4PA 2YH1A 5THWA 4IRDA 2ASYA 2GMJA 1S1WA 3KHRA 3P4UB 4IQMA 1OPZA 4LQ3A 2BQUA 3M8QA 4ID5A 3TAMB 1R31A 2AYMA 1E6VB 5KFOA 1S49A 4UQTA 3KK3B 4ZVPB 5L1IA 1QVGR 4F3OA 2Y8WA 2H48B 5L39A 1Y3KA 1RAFB 2GA7A 2JEGA 4WZMA 5M2RA 2FY1A 4P74A 3HXMA 1WHVA 4B3RF 1C1BA 2HFZA 1HKAA 1VRTB 1WKKA 5CD4H 5AE1A 3T1YF 1ZYQA 2XZTB 2NXJA 3D0GE 1LWXA 3GTYX 4P2SA 4YDXA 3BM7A 3CCJS 2R7TA 1Y3JA 1X4FA 2GC8A 2WW8A 3EJMA 3MHYA 1NHVA 4J9NA 3TRGA 4ECTA 3HCXA 3EVWA 2WOMA 1Q79A 2Y1IA 1XMBA 5KOWA 4BWMA 3M8QB 1LFWA 4WFBQ 3T6JA 1P6TA 5C24B 5M2PA 3CULA 4ZVUB 4WIIA 3WIUA 5HN0A 3CB4A 4L75A 3TR5A 1EKRA 4XK8C 2JVRA 4S0MA 3MFIA 3R97A 2VDHA 1Q5VA 3BDEA 2ZBPA 1DTTB 1CS4A 3TJAA 1JLFB 2C22A 2JC1A 2YXLA 2CA9A 1HQUB 3ET6A 3T6BA 2HWHA 1AB8A 2JDJA 4RPFA 2HGMA 5E3AA 1WEZA 2L9WA 2R2UA 2ZJQQ 1N48A 3G82B 2K06A 3KUEA 1U1QA 2R8GA 4IUFA 1TKXB 4ZPTR 4GC7A 2C2MB 2H4WB 5RUBA 1VQ7S 4LBIA 4JV0A 3OVSA 4PG5A 4DSKA 2RQKA 1ZAVA 1VHFA 4I7FA 4UUXA 2CPDA 4F4KA 3EMTA 1KQGB 1KP6A 1QJHA 3FCWA 2WVBA 1T95A 4OYPA 5FDLB 3K2YA 4ZITA 2UUBF 3OXGA 5K5MA 2RKIB 4ES1A 3Q22A 4GKJJ 1F9EB 4B02A 4ED3A 4LT6A 2RE1A 5LT5A 3CVKA 3TNVA 4YR2A 2V67A 1FFSB 4GO7X 3PW7A 2IM0A 1CJVB 1JLBA 3C66A 3QGPA 1RHKB 5EX0A 1BWEA 3LH2S 4K50A 4KR0B 3Q23A 3ITHB 3K89A 4NZ0A 2CYYA 1LW2B 1SQEA 4CT9A 2HZVA 2Q79A 3O5TB 5LSOA 2ASJA 1HHSA 1TKZB 4O3SA 1VQLS 3IG1A 4DPWA 3FMWA 2ALZA 3O2IA 3LAKA 4NLPA 1RTJB 3ENAA 3PY8A 3SCLE 3WZ0A 1IR0A 1JLQB 3EX7B 5J2QB 1W25A 3V4MA 2YNFA 3GFHA 1H0HB 4ECVA 1TK5A 1N6QA 2B4PA 5F8LA 4DR3J 3H42A 3S01A 1BDTA 5HVFA 2CPIA 4G1QB 2VC0A 4DV5F 1RLDA 3BEGB 4NPOA 4CT8A 1NJYA 1RKIA 2W2OP 1WG4A 5ETOA 1T02A 1HI0P 3TA0A 1UPPA 1U1MA 1SH2A 2MZSA 2AV5A 2WOMB 4RUHA 4U7UK 2HZAA 1IJEB 3MEDA 2PMWA 3MMAA 1SIZA 3QSIA 4CO5A 2RBFA 4O0IA 2RT3A 4DPXA 2IM3A 2D74B 4DU8A 2OPPB 4ZPBA 1FRHA 4EYIB 2K2PA 5CYMB 3QIPB 2MZRA 3IR7A 1LFPA 2K5JA 4X65J 4RKUC 4DUZF 4JI4F 3HK2A 2UXCJ 1T7PA 1BD6A 1QTNB 4J9KA 3JTPA 2KFYA 1FA0A 3FSYA 1YLXA 2F5GA 2CQCA 3GU0A 1M90T 3OVAA 2PO4A 3EXYA 4MH8A 4CO1A 1S1WB 1ZM2A 5IC4B 4HV0A 3QZ7A 4FYWB 3CJKA 2RQCA 4YQWA 4MKYA 1Y00A 1IBLJ 4CLPA 1SKRA 1VQNS 5AXNA 4OJGA 1FDDA 2YNIA 4YUDA 1JLQA 3EPIA 1B70B 1RT5A 2YTCA 5IWAF 1SI9A 2BABA 3G6ES 2FVSA 1RTJA 4FS1A 2Y0BB 5D4OA 4U8VA 4KGKA 2MQMA 5IOLA 2ROPA 1N0VC 2OPRB 3CD7A 3CJ8A 3D6MB 1TKZA 4C11A 8AT1B 2W4CA 4OI2A 3JSMB 4J9LA 4DF8A 2KZZA 1O51A 2EFOA 2V2KA 4KV8A 4MFBA 5IV4A 3RB3A 3EE3A 2IC3B 1RT6A 3JQKA 1X4DA 4KKOB 2RD5C 4ZCIA 2DTJA 4AXJA 5A8WB 2JOQA 1HHTP 3N6LA 1NLKL 3GZ7A 2HMIA 2RDDA 1C1CB 3R27A 2ZH8A 2ZOGA 1X4CA 1S0NA 1RZMA 2J0SD 4JV1A 3FSIA 1NO8A 4LVNP 4NLDA 3AX2A 3GIIA 3PW4A 2AWZA 3CXCR 1TL1A 1NUEA 2ALYB 3GB0A 1VHIA 4USWA 2MQPA 1ZPVA 3SDEB 4ATNA 2AGOA 1I94J 2VV5A 3THVA 1RK8A 1FEHA 1PC5A 1UP1A 4ZVEA 5HJXA 2GCFA 1S5ZA 4IRCA 3CJ2A 3SI8A 4DV4F 3JSRA 3THPA 3IR6B 1J5OA 2FLOA 4W92B 4CLWA 1JKHB 3KFWX 1RHMB 2GVZA 5F0UA 3VQTA 1V5VA 2V0NA 1KTQA 3G82A 4ZLPA 3RBZA 5GMKa 2MSTA 1N34F 1UJ4A 2H1YA 1MNEA 2XMVA 3M6XA 3AB2B 1PKUA 3LA0A 4J9VA 3M7VA 4DL3A 2I2YA 3I9V9 1JLFA 3MWBA 1CS4B 3V5RA 4AL5A 2IVMA 3ZZUA 3HD2A 3OJSA 5I3PA 2V8DA 2G0CA 2R2RA 4A8YA 3D1QA 4JI0J 1UL3A 2DITA 1VQSA 4PQAA 3UDLA 1ZTWA 1VQ8S 1R27B 3V81A 2OSRA 4V19J 3CCES 1WUUA 1VFJA 5ETNA 3RR8A 1CPZA 1U1PA 4K0KF 2KZMA 3TJ9A 2V94A 4B9VA 3WC0A 5KT6A 1URNA 5FLXU 1SC6A 4IDKA 1RT2A 1SJRA 3DU5A 2ATLA 3TARA 2Q66A 2DIVA 5DGBA 2MZ1A 1QVFR 2LA6A 1S6PA 4OZ0A 5EUHA 4OJHA 1C1BB 4I69A 4TYBA 4RW8A 4ZLNA 5F8MA 2J5AA 3FVYA 3GSDA 3KKFA 4PYAA 2QX0A 1FKPB 4C6AA 2K1RA 3J81j 2AGQA 2HGNA 4C8ZA 1RDRA 3FK4A 4CDIA 1K1SA 3GG0A 1HLWA 1T8EA 3FBFA 1RT7A 2B9WA 4FXVA 5K9FA 1S57A 2E5GA 4DSFA 3JXOA 3MTKA 2XYGB 4AQYF 2HHSA 2H4YB 2DNKA 4WPAA 1NJIT 1N36F 2DH8A 1R6YA 4K4ZA 5A6PA 1H72C 3UN3A 4RJVA 4ECYA 4IR1A 2ZOMA 1F5BA 3QLHB 2BOAA 3AT1B 5EWEA 3NLCA 3CCWA 5DM7Q 2KT5A 4BS2A 4DL4A 4FVMA 2B3TB 2XS5A 5L1JA 4LRFA 4JI6F 2JLGA 2JL9A 2YQ0A 2PA8D 3BQ1A 2CQPA 5KFQA 4X4NA 2J8SA 2NS1B 2BANB 2YWWA 4NLTA 4DEZA 4A8KA 2A6MA 5LMNF 1BQNB 2NXCA 1VQ4S 5EHHA 2V1SA 2MKYA 3IP0A 1LW0B 2UV8A 3QAEA 4CM0A 3M9NB 1HD0A 4MKVA 4ANCA 2NZ4A 2DY9A 2YWEA 1ZPWX 4RW9B 3H5UA 2B43A 3LJPA 4TVAB 4WU2A 3QT6A 1V3RA 1VLOA 4ZJLA 3EVMA 1FXRA 3OBIA 3BO2A 1TVRA 3V6HA 1KEKA 4LF9F 2KL8A 2HQFA 1N8RT 3H98A 1VQPS 1Z2LA 1IBKJ 2CJBA 3ZZ0A 5EX3A 1XNRF 3NKYA 1UTAA 1PSDA 1JJCB 1SXLA 3PRBA 4E0DA 2EWHA 1FNXH 1XBWA 4IH5A 1V6HA 1NXIA 1RHUB 2NXUA 4Y0FA 3NL0A 3LW5C 4F04B 3KJQB 3MCOA 3PFOA 2XMJA 4JI1J 2OP5A 1S6OA 3PJXA 3IS9A 3W8PA 1HPZB 2LDIA 3B6BA 1Z4UA 3HDSA 1KQSR 5F8GA 1JJ4A 1WOPA 1EIYB 1JXEA 3MEGB 4ZVGA 3UE2A 4P7TA 4DV0F 4P2XA 3PX4A 5GMEA 4ER8A 2X3GA 3H20A 4F0KA 5K20B 2HNYA 3KG0A 2ZH6A 4DR1J 4DQIA 2XLKA 3R8YA 1VQYA 2K29A 3NS7B 5DQIA 1R8PA 3MAAB 1FT8A 4M5LA 2O5DA 5DDPC 4MYUA 3OFHA 2FGCA 2ZH9A 1Z2ZA 4A8SA 3ELHA 2FDNA 4Z37A 2D41A 2X1AA 2BM0A 2AJ0A 4MAKA 4NXNJ 1T9WA 4YFUA 2QEXS 4X4TA 1F9HA 1FKOB 3TYTA 2KFZA 4FF4A 3C14B 1NJZA 3N5BA 1WJ9A 3TZYA 1WC5A 2QIFA 1DRZA 4B3MJ 4QU7A 3C8YA 2YKMA 5KFZA 2ZBCA 1IKYA 3RBDA 4RNFA 2MKIA 1S1TB 3W3SA 2IBOA 3MF5A 4HHJA 2CJXB 4JV5J 3QIDA 2ZC3A 4LRAA 3R2DJ 1CULB 3W7BA 2OD4A 1ACMB 1FJGF 1TL3A 3NCPA 2QLFB 1OPIA 1H74A 2CNLB 4ZVOB 4ZCLA 1IXKA 4LR8A 4HL9A 2QLBB 4DFJA 3DMJA 2KJVA 3PHTA 4JI2F 2EKYA 2QL5B 2VFSA 3FSXA 3R6LB 2RMLA 5HATA 4LRDA 2BNWA 2B6AB 2DJWA 3H2UB 3W5ZA 3KHLA 3A4TA 4ZPVR 2VDIA 2XC9A 4AUKA 4JI3F 2I6WA 1JMTA 4ICLA 2RDJA 2CQ2A 2ZBRA 1L3SA 4DSJA 3FZBA 3S6EA 2FHJA 2MYFA 5HP1B 1EQMA 2G1DA 1P9YA 1S0VA 3IWLA 1HQEA 1XNRJ 2IFXA 5G0RA 2MDAA 4EMDA 1Y4ZB 2XY6A 1TKDA 4M5DB 1RAEB 1Y7PA 1S79A 2B9YA 1IKWB 2BW7A 1VRUA 3A3NB 3HHLA 4XPCA 4JI8J 3DM2B 3K8WA 5HSPA 3ETOA 1CC7A 1AROP 1U02A 2LEAA 4IKAA 1UWBB 4NZ7A 2XMWA 5ETMA 4B17A 4J9QA 4DUYJ 5ADZA 1DHMA 3NS6A 3BGRB 2O1PA 9ATCB 1SUQB 4M5GA 3UI3A 1FD2A 2QSFA 3GXQA 4RBUA 5IQQA 3K57A 4ECWA 1GXLA 4OLOA 2H51B 4A47A 1JLEA 1FO1A 4CH1A 1FTCA 4DV6J 5LMUJ 3M6UA 4D3HA 3H8YA 1N33F 2G9OA 4FPIA 2VZ9A 2AZ1A 1NMEB 3G87A 3AOBA 3CCVS 1P1LA 2VFTA 3D1HA 4ECQA 1U47A 2HZCA 3FFIA 1NSKL 3ISNC 1RA6A 4RLEA 4ZS6A 2BQRA 4EUVA 1EJ7L 1TMMA 4N47A 4CLLA 3TAQA 1WF2A 1N5TA 3CCQS 2C3OA 3POTA 2DXFA 2N4CA 4KHPJ 2CVIA 1G2EA 2UU9F 2UU9J 4LF8F 4E98A 2GW8A 2IMOA 2J0WA 2DB1A 1HQ2A 2CWKA 3VV2B 2GV1A 2B5JA 2YNHB 4PQUB 2W2NP 4A48A 4C3LA 2CPXA 2QSWA 4RO0A 1AUDA 2VA2A 3HF5A 5HROA 2ZJRQ 1KHWA 5B0GA 2JNJA 3PACA 4G65A 5GMDA 2BJ9A 3VF0B 3OUYB 2Z4PA 2VG6A 5E0OA 5J1EA 3PCOB 4ZJOA 2HAIA 3ETMA 3GV8B 3H59A 4USKA 5CYQB 3PYGA 3GYXB 3FCHA 1FNOA 4UT4A 4NLYA 1NJXA 2KU7A 4K7QA 5A8RA 2VICA 4F2RA 4DR6J 2Z2LA 1YJNS 1S0MA 1Y5LB 4G1IA 4Q8EA 3TZWA 2D7SA 2LEBA 2O67A 3BKFA 2JC0A 3TZZA 2DXEA 2J6UA 3IMQJ 2ZZMA 2V68A 3PEJA 2EXUA 2VQFJ 2E1AA 3IAM9 4UOFA 4DPUA 1L3VA 3FEZA 3LP1A 2K1OA 1QAJA 1OYDA 2FJVA 1FCAA 2WHOA 3OR1A 3HMJG 4X62J 1WSRA 5F8HA 1B64A 2AU0A 4QWBA 3R5DA 3V2UC 4PXBA 2VKZG 4GC6A 4J5OA 3LGHA 1NH7A 2KYXA 1UFLA 3A8EA 4HH1A 3B4MA 4UY85 5J2MA 4N8OA 5DQHA 2JLEA 1XJWB 1C0TB 3LPYA 3J7YU 2B8PA 2YKQA 1IM4A 3HHDA 4ED2A 1D8ZA 3LUYA 2FJXA 4NCGA 2JBVA 1XR7A 1DY3A 2DH9A 3KG4A 4HH0A 2YNGB 3E01A 4EBEA 3DGPA 4CYUA 2XHCA 2DR8A 4R8UA 4PUOB 1NLAA 3N5FA 4LMZA 3GCXP 2AYEA 4K59A 2AN7A 2OPQA 2ZH7A 3W66A 1NDLA 2BBEA 1VRQC 1RYRA 1W2IA 2J7KA 4MKBA 5J2NA 3MGJA 4YOEA 1IQZA 4C8KA 2CPYA 3UR3C 1EETA 1F3VA 2GJ2A 3IAS9 3MM6A 5CYJA 5E3RA 4HR2A 1YIJS 2KN4A 3VW4A 5KFSA 2GHVC 4FDFA 4KE5A 4HI2A 4FBUA 3T5KA 2HRUA 1B4SA 2PSZA 3FQKA 4BWJA 3LALA 3GR1A 3VAJA 4B9TA 3CCTA 3FUYA 1QUPA 1TL5A 1UFKA 2ZHAA 2R7UA 3ISZA 3SFUA 4RW6A 3CC7S 1HBNA 2YWFA 1KOHA 2IDLA 4H54A 5ETVA 4MYTA 2HHHJ 4U95A 5IT9U 2H5IB 3LQVA 2CPZA 3C2PA 4AFFA 4NYPA 2LXFA 2ZNZA 1HIYA 2K7KA 3GJRB 1YBTA 2V4RA 3HT0A 2G0IA 2LMIA 2Q1LA 3C6TA 1M5SA 3HHLD 3HX9A 4O44A 4ZHRA 5IZHA 1VC6A 2V8PA 4P72A 3W9IA 2HLUA 4ZIVA 3VHQA 3BJYA 2GX8A 1REGX 1WNEA 3G2XA 2ZH4A 2VF3A 3IM9A 1ZM3A 4AXIA 3M8ZA 1R8HA 1FD8A 2FLPA 4C4WA 4X64F 2UXDF 2VUGA 9RUBA 1KWMA 1ZS6A 3P6YC 3DHXA 4QCLA 5DG9A 8ATCB 2M9KA 2HFNA 1PBAA 2XSJB 2XI2A 4OJ1A 3DLKB 3SSSA 1SJ3P 1Q78A 3HZGA 3DOMA 5DO2A 3W2WA 4ES3A 3NOCA 3G71S 1U4BA 4JV2A 2XNRA 1QDUB 1MN7A 3Q8YA 2GGPB 2EC2A 3RZAA 4AYBD 4FN5A 4Y2CA 1HNIA 2RS8A 3Q8VA 1D1UA 2QYCA 1WC1A 1F3FA 1JLGA 1P27B 1U0HA 5E3QA 2CDQA 1HNXF 1UMJA 2Q6BA 3GLJA 4ILRA 3AJ2A 4K4XA 5LXRA 5HK4A 5ETRA 4PKDB 1ZAWA 4C0BA 4Y6IA 2CQ3A 1UVIA 4NRTA 1GH8A 2GMHA 3QOQA 2IPOB 1OHNA 2K7JA 4CLZA 2J7WA 2CQGA 4DX6A 2PGCA 1M5PC 3DN9A 2HHQA 4KPCA 4PG6A 3Q2TC 1F60B 1OJ4A 3HKZD 2KG0A 3AX3A 1OSCA 1AW0A 1Q5YA 3MMBA 3U1NA 2MGZB 3KJVB 1MU2B 2X1FA 5CCMA 1OS5A 3KJFB 4F0HA 2BE2A 4U7CA 2EKNA 2YY3A 3LPEA 3M2RB 4KAIA 1OY8A 5KFHA 1QLNA 3H4DA 4I6YA 3JTNA 4NX9A 1YHQS 4ANDA 2AW0A 3M2RA 3VQSA 4URSA 1K0VA 1X4HA 2FB0A 3PRVA 1JK9B 2XMTA 3I87A 4J91A 2E7WA 3A3PB 1RTZA 5IFMA 3OV7A 4EO6A 2VG7A 4OIXA 2IYIA 5F8NA 1X5TA 3M6WA 1IBLF 2K9IA 2FLNA 4IRKA 5J1PA 2YH0A 1U49A 1NKBA 4DR4F 3FGVA 3DU6A 4RUAA 4NA1A 5L8RC 1VQ9S 3K5PA 3H5YA 1HBUB 4EWTA 1K9MT 4F36A 2I5JB 4BDPA 2HS0A 3IFEA 2NYIA 1NEEA 1U09A 3MOZA 2IRUA 2OMLA 3I32A 3ZZPA 3M9OB 1C4CA 2BA3A 1L3TA 4U96A 4LF1A 1GAOA 2DNHA 1RT1A 3UDCA 1SIWA 4EK2A 1VMBA 2RUGA 4UTGA 3RB4A 5D8HB 2E9ZA 2FYXA 2A10A 1K0TA 1U2RA 1YJTA 2JFDA 3M30B 5KFYA 5IT0A 1N0UA 3W62A 3UWTA 1S1UB 5ITHA 2D3OR 1CC8A 3KDOA 2BSQE 2B4VA 4DV3J 2JJ4D 2DT9A 2L08A 3RAQA 3TUJC 1SBRA 4WWSA 2W25A 4EO8A 2Z2ZA 3W61A 3KLHB 2PI5A 1SL2A 3PW2A 3DRRB 1WDTA 1YJVA 3DRPA 3AAWB 3UD5A 3K59A 4QIEA 1OG7A 2QJ3A 4P9SA 1SKSA 4JI3J 1UPMB 3QATA 4DR2J 2BZ2A 2YPZA 3A3OB 3DC2A 3QWUA 3QWPA 5E3PA 3W65A 4CO3A 1D0EA 2ZBIA 4JI7F 2HLTA 1A7GE 5DZ7A 2DO0A 3I31A 1YJ9S 4WBFA 3PYEA 3KNAA 2MQNA 4U8YA 3H87C 2UVRA 3CPWR 3VGVA 4ZHRB 4JI5F 2MTLA 3OHBA 1CEZA 1X4AA 1X4GA 1UEUA 3SYZA 4DN0A 2Q6CA 4USUA 3VWSA 2ERRA 8RUCA 4FYVB 1YBAA 1FXDA 2XMUA 2BYCA 1YVFA 2V63A 2GIFA 3DRYA 1RT4A 1TL7A 3CEDA 3UQSA 4KFBA 2Q2KA 1SV5A 3NS5A 3O44A 3G8SA 3UCUP 3QJLA 2O66A 4M5NA 4RBTA 2E9RX 1JLEB 2E5HA 4ZVHA 4WFAQ 4FYDA 3KLVA 1N5YB 4USIA 1XWLA 2DGOA 3BGRA 1C2PA 1T05B 1RWXB 1WELA 3TZXA 1TL4A 2H5JB 3IBCB 3VVTA 3EDQB 2AHOB 3PIOQ 4CNZA 5HLFA 2ATCB 3O3LA 2ZC4A 1WTFA 2ZUAA 3C15B 4XDDA 3WIVA 1WC6A 3MM5A 3T1HJ 3KTQA 4WU3A 2UUBJ 3EDRB 1XTZA 4V19X 1S6UA 1TUVA 1SH3A 2EFQA 4CP5A 5JVGQ 3C16A 1UZHA 3CCLS 1NK5A 5HP1A 2NR0A 3OTEA 3DGPB 1CJUB 3MM8B 3WC2A 1NPPA 1JWWA 5ETLA 2R8JA 4CTAA 2QA4S 4A8WA 4CH0S 1T3OA 4IFYB 2IDEA 3IGVA 4AL7A 4DQRA 1W26A 2FHOB 4GVBA 2GVDB 4CTAB 3Q24A 3CCMS 1FKAF 1AT1B 2BE2B 5EGYA 2GAHC 1FRMA 3SXLA 2W9AA 4I1TA 4Z2XA 3CF5Q 3BYRA 1MU2A 4ELVA 2DXDA 5F41A 4YEAA 3B8HA 1U6ZA 3A8KA 2CPHA 2NPFA 3UVJB 1BXNA 4B9SA 1E6YB 4XDCA 1UFWA 4N77A 4CLKA 1APSA 2P6SA 3MM5B 4RNMA 2DD8S 3CDAA 1QE1A 1DFDA 2OH2A 4O0NA 3RG6A 4NLQA 1TL3B 2P2CB 3FRZA 4A46A 4ZVTB 3N4WA 2F9JA 2JFKA 5HAOA 3QSYB 2RQ4A 4NMLA 1FWPA 1G4CA 2KH9A 3OL6A 5A8RB 2CJQA 2YKMB 4Q2MA 2MXYA 4NLOA 4RNNA 4RU2A 4DSLA 3ONQA 2OJ3A 2ZH5A 3C14A 3RW6A 1Y11A 3UDVA 2W7PA 2XMAA 2DNOA 1KFDA 4X2BA 4EYHB 3H25A 2EEYA 1I5OB 1PAUB 3FRYA 3P3DA 5EWGA 1QSSA 4DV7J 4ITSA 2B56A 1URRA 4KGVB 4OZLA 2XY5A 3I5BA 1CJTB 5BYSA 3CJSA 2OD6A 3CW2C 2J0QD 2ZDPA 3M9MB 2B5JB 2JX2A 2NLWA 4FYYB 3OVBA 4Y65A 4B9LA 1HFEL 3MEKA 1S1VB 3QRQA 5CZVA 5F0WA 2V1TA 2Y3YA 1Z1ZA 3DRPB 3DRRA 1TKTB 2YKAA 4X4RA 1DJ0A 3C6TB 1JB0C 1NK0A 2B4UA 2OLWA 3GFXA 4RX6A 1H2UX 3EVOA 1FE4A 5HMXA 3M8RA 2VIHA 3BO3A 4QIVA 3GJSB 1S97A 2QA2A 3DDNA 3QJPA 3AQPA 3OHAA 1UW4A 4U6PA 4YN3B 4I56A 4C3KA 3QYYA 3QFWA 4DZ6A 5KG4A 3DLBA 4U7UD 3BPDA 4QYZK 4ED0A 4ZMMA 2W24A 1RUSA 3K5NA 1REVA 4MK9A 1HL6A 1RCOB 1PJ5A 2WB1D 5I4MA 1NKEA 4O3QA 4ENOA 2LQJA 4F67A 1WKJA 2CXEA 4OL8A 2KYZA 4DS4A 1SCJB 1UWAA 1Y5NB 3KLIA 4OYXA 2VG7B 5F8JA 2MKJA 4EZ6A 1HQEB 2PFFB 1KRPA 2V8VA 2E29A 2MHEA 2XM3A 2LVWA 2OSQA 3T9NA 1ZZFA 1MROA 2DNQA 2DK2A 2LKZA 4LVOP 1S7HA 4NLRA 3HJVA 3MPYA 3WX8A 3RYLA 3T3FA 4BBYA 5K8PA 5KFBA 3MAQA 2X7IA 4HHHA 4AE5A 2OTLS 1SJFA 2IA0A 4M63A 5GAGU 2VQEJ 2J9EA 2ZVSA 2D3ZA 4KT0C 2KT3A 2NYHA 3CJ4A 3DMJB 4J37A 2CPJA 1WC3A 3HVTB 3IWXA 4ETZA 2ILZA 1YBUA 3MAHA 2AEMA 3TX8A 1U7LA 4NRUA 1FJCA 3DNCA 1EHWA 1VIXA 2BM1A 3H4BA 5HO4A 3Q8RB 1HNZF 5HVGA 1MSWD 2OFHX 1DQAA 1N32J 3HFZB 1U0HB 2Z0GA 3AXMA 2K1RB 2RNEA 1TZ0A 5KFLA 3CCRS 3LANA 1VBKA 4A8FA 1XNQJ 3PO4A 3SV4A 2YX7A 2DR6A 1GMWD 2CJYB 3LF0A 1NDCA 2OEMA 3ZC4A 4IDKB 4MIBA 3HFKA 2E5IA 2K3IA 3FQLA 1NBEB 3GE9A 4QR2A 5KFFA 4ECRA 3OFEA 1LOUA 4F3QA 5HVHA 2XLJA 1XK8A 2P9GA 1XEZA 3IRWP 1LWEA 2CJ9A 3GWCA 5HBMB 3GV5B 3EZOA 2R8IA 3D5MA 3BQ0A 3HHNB 3BGOP 1OWXA 2HVDA 3R9LA 4I2QB 3US5A 1G7CB 2YKNB 1Q95G 4N7TA 1FDNA 2Y0SD 1IWAA 4M8LA 4LF4F 4D8JA 2PD1A 3OT9A 5GAEU 1Y10A 4X4SA 4GKKJ 3DDIA 1TAUA 1N4LA 4ZVRB 2B7CB 3OTDA 2MKSA 3HZEA 1MYKA 4P7VA 1HBMB 3KWMA 3OR2A 3SQOP 2A0FB 2C1EB 4MIAA 2UXCF 6AT1B 3L7PA 1RE1B 2VQEF 1HD1A 1PJ6A 2W7OA 3BDPA 1F5AA 4F8RA 3KK1A 1L3UA 3HSDA 1WHXA 1O8BA 4OI0A 4PPDA 3MCMA 3QGHA 2F4FA 2HNDA 5J2NB 2QLJB 3H2LA 3RRKA 4CQ1A 1WEXA 3HHLB 2ZE2B 2Z58B 2QV6A 3CT9A 3NGSA 2AJ2A 3KUHA 2E7VA 2I9SA 4P2FA 5L38A 4NLXA 2W4DA 4IOBA 1LW0A 2CVEA 7AT1B 1FTRA 1BQNA 4PUOA 2HMIB 3W9JA 3J7AN 2V4JB 1BWVA 1D8YA 4NMXA 1RTDA 2IC3A 1VQKS 2VKRA 4I6AA 1IBMJ 4IR9A 4ICLB 1S7IA 1BQXA 1PG5B 3I4HX 2KTQA 4PABA 2RU9A 5KFGA 1JLAA 2D69A 5DQGA 1P1TA 3MM9A 2B6AA 2HQIA 1NK7A 3UCGA 2A18A 4QYZJ 1ULRA 4WCEQ 4RW7A 3BH6B 5D4LA 4FKYA 5ETSA 1I6JA 4KSEB 3QQCD 4P2MA 3ENVA 2XYPB 2ZHOA 1S1XA 3OR1B 2FJWA 3D6HB 3H2VE 2GAGC 5B08A 3K5LA 3OTOF 4LSNB 4ZIWA 2L41A 5CA5A 2DCLA 3Q8PB 3CCZA 3CC4S 3NGTA 1UVMA 1S9EA 4OX8A 2CJAA 1JIHA 1FEEA 5DM6Q 2VFRA 2FY8A 4JI8F 3QO9A 4X62F 3MR2A 2NXNA 4C7QA 4IYQA 2MEWA 3ZZTA 2IMWP 2UVWA 4BC9A 4KTQA 4ID8A 1W7WA 1LK5A 3AXKA 3LOUA 2VG6B 4LRVA 4LF5J 1WC4A 1VISA 2BA9A 2B4OA 4QOTA 1BQMB 2MZJA 2IM1A 1RT2B 4DPTA 1NK8A 1B7YB 4KGZB 1AA1B 3A12A 3CD5A 3AD7C 3IR5B 4YR3A 1VQOS 3VR1A 3ZNJ1 1K8AT 2AMCB 3PZPA 4ZP6A 2PMZD 1RISA 2QYGA 1HNZJ 5B0AA 2HNYB 4WKRA 4WP3A 3DOLB 5GADI 2KI2A 3CO0P 3PNIA 2B8QA 4F3MA 1VOMA 2B9XA 5C42B 2E44A 1H2VZ 4K8RA 5LSLA 4IOAQ 1IJFB 1CQNA 3J7A1 3CJRA 4XPEA 3A13A 3WX4A 4ZVSB 1JJHA 1NK9A 1FK9A 4DCPB 2AY0A 4OYAA 1X5SA 1XR5A 3D3CJ 1M5KC 2B7BB 1P8GA 4YMEA 3ILLA 2QA4G 4FZVA 5KFWA 2ZITA 3HSGA 3ENQA 3N79A 4NLVA 1N5SA 2X1BA 5H1SV 1Y5IB 3R1LA 2VQFF 3D6TB 3V6JA 3TWZA 3VEAA 4A8MP 3T5LA 1BY9A 4HKQA 2ZM6F 1VI7A 3KMSA 1UVKA 1UJ6A 2BMBA 3FBEA 3DRXA 4LIRA 4P75A 5L9NA 4DSEA 2WB4A 1RWNB 4HTJA 5B7WA 2DHAA 3LP2A 3SDEA 4B9MA 1HI1A 4FNIA 2UXBF 2CZVC 3CNQP 1KLMB 1XC9A 4PWUA 2V34A 4M5DA 3ZTQA 1S9GB 1Q1KA 3KK2A 2VHGA 1HW9A 1N52B 3B82A 5G0RB 2D9OA 4MT1A 1RABB 2LYVA 3I96A 4I7FB 1JNZB 3DI6B 2AT1B 1FDAA 4CIOA 4KKOA 2YWGA 4OYZA 1SPBP 3KMQA 4TLQA 1RTHB 2Y1LB 2FC9A 3TO8A 3J81Y 2ZH2A 1HMVB 4C11B 1FF2A 2DKOB 3CIMA 5KT3A 1H98A 1RWMB 2WAQD 4DQPA 4CLSA 1O5JA 2HRYA 1WWHA 4NA2A 2R2SA 4LRCA 3U1LA 1VK3A 4C0HA 4DV1J 4P10A 1WF0A 1MWQA 3A1YG 2W9CB 2UUAF 3SZ2A 2V9WA 4I6WA 3BV8A 5D78A 3CJKB 2PI4A 3AOAA 4Y34A 2VG5A 1U2FA 1LXJA 2RRBA 5D77A 5C24A 3SCKE 3T1YJ 1V3ZA 3DLGB 2BRLA 2YKPA 1KTVA 1RTIB 2M8HA 4MK8A 3L09A 5AT1B 2MQOA 3K58A 3RR7A 5J1NA 1AFIA 2BE7D 2JZ5A 1FKPA 1U1NA 1IKYB 2ZHBA 4PCQA 2RSQA 5DLFA 2LXIA 2C3PA 1Q81T 2A2CA 5D6GA 3C6UB 1PBUA 3NEKA 3W5YA 2QFJA 2ADBA 4F50A 4Q5VA 2WONA 4KIAA 1HNVB 1RB0A 4ME7E 2MQLA 2ZWPA 1RWKB 3CWJA 3FMBA 1UW9A 1DBDA 4JBCA 4CH7A 4X4OA 3GQCA 1CJKA 1SQFA 2EBEA 2D9PA 3W64A 2FJAB 1LQ9A 1RWWB 4K4VA 1Q16B 1RA7A 2HQ3A 3L9ZA 3SBMA 3L95X 2IHR1 2FTRA 3Q2SC 2XG8A 1FRKA 1YSJA 5K14A 2V2QA 3EGVA 1YG0A 4JI7J 4LF7F 2QC3A 1KFSA 1ZZNA 2UUAJ 3K8VA 3VGUA 2CRLA 3AJ1A 4NE9C 1WF1A 5H9FJ 1KLNA 4HI1A 3N6MA 4OHZA 2VH7A 1FFWB 4M5JA 4ZN1A 5C7PA 2DHHA 1N56A 4K4WA 4LSLB 4C2MA 1LV5A 5ETTA 2UUTA 2VPWB 2C2KB 4IG3A 3GJQB 2OEJA 3IGNA 2F40A 1D09B 3MI7X 4Y2IA 3W9HA 3BN4A 4DSIA 4UZBA 2GIQA 2OPSB 1R7IA 2CPFA 1RBOB 4O23A 5BR8J 4DXLA 3CC2S 1FJGJ 2V69A 2E5LF 4KC5A 2YKOA 4CLTA 3D1OA 1KVKA 4WFXA 4KH1B 3H5SA 4M5IA 4DBQA 4PG7A 2E1RA 3CJ3A 2CIMA 4H4KA 4KPYA 1WHYA 4TQRA 2QL9B 5IT9Y 2DGUA 2C3MA 5K8MA 3VEBA 3MR5A 1TV6A 4UY8T 2NCKL 4PWDB 3N0VA 4RW9A 2WCXA 1RT3B 1AXQA 4C3MA 5A8KB 4C8YA 3VZIA 1NU4A 2OAUA 1C1CA 2JHEA 2A6OA 3FC9A 2J6TA 4F26A 3I4PA 4A8QA 4DL2A 1VC5A 1RT6B 2EW9A 3PDNA 3TP2A 3GILA 2M7SA 3MXHP 3KLEA 4G1PA 1XMOJ 4WP8A 2RQMA 1O0PA 1NM2A 2L9NA 1X9MA 4QQBA 1KSPA 2KT2A 1RAOA 4RWWA 1RADB 4OYOA 1TTHB 4K4TA 3M2UB 3ULHA 2W7AA 1Q4RA 2PIIA 3DGVA 2RHSB 2FHMA 3JQMA 4CLYA 2OUGA 3I82A 3PV8A 2FVQA 1GMUA 1NH8A 5KT5A 1RLCL 3V6KA 4JI6J 1VQ6S 2HG4A 1BMQB 3HHLC 3R6GB 4WJBA 1FRIA 1RHQB 4HACB 3W1YC 1KVIA 3MTJA 3M1VA 3OFFA 1RU2A 1TU0B 1FFGB 2V5HG 5A2QU 1OO0B 3NXZA 4B9UA 3L7OA 4EBDA 3IRXB 5LSRA 2J0XA 4L6V3 4DV3F 5CYMA 2IJRA 2HKEA 2J8AA 2XEXA 4QWAA 4LRBA 2NPIA 1S6PB 3C6UA 1CLFA 1RAAB 2F8HA 3NAIA 1QAIA 3PXGa 3BS9A 2R42A 1YITS 3NOGA 4AT1B 4DUYF 2FQQB 3RB0A 2J9DA 3MMAB 4RU9A 2IJFA 1EX8A 2EPIA 2UVVA 3LTOA 4R0JA 1JXLA 1YWXA 1UETA 5BR8F 3DXBA 5C2CA 2KXNB 2F63A 3TAMA 1R0AA 2E1CA 4YB5A 3MR3A 1XIQA 4LBHA 5A0YA 3VTIA 3AOCA 4HACA 3J81U 4F4XA 2FIUA 5CXTA 1Q7LB 4PYDA 2H54B 5GAGI 1X0FA 1U48A 2BDPA 3OTBA 2W9CA 2V2ZA 2PDAA 3NCQA 2XMMA 2YNFB 2LU1A 3OFGA 3RRGA 2WW4A 2BUNA 1T9TA 2LA4A 2LQ9A 3M2UA 4KO0A 3VAIA 3M8PB 1CSJA 3I6PA 1D9DA 3RBXA 3CJQA 5KG5A 2DCUB 1FRXA 4NEZA 4ZA1A 4DZDA 3OSPA 1RAHB 1VBXA 1N33J 1K44A 1YRUA 2MSSA 3NNEA 2I0XA 3G5OA 1S10A 3NNAA 5LMUF 4YHHF 2YX4A 2HEKA 4ZP7A 3ITHA 3O6QA 5DETA 2ASDA 2UP1A 1HYSB 3TAPA 1QTGA 4IH7A 2UUCJ 3DI6A 1JLBB 4DLGA 1IQTA 1RCXB 4Z7CA 4LR9A 5FLXY 4R5PA 3G8TA 4J90A 3UDEA 3ZZRA 2DR9A 1TV6B 1KLMA 2HFSA 2QMUB 3P5TL 4ERDA 2LP4A 1PO6A 1TUWA 2XWYA 3K7RA 4IG0A 1FX2A 1TL1B 4CCHA 4ZPAA 2LU2A 4DG1A 3AWRA 4U9RA 1K47A 2MJUA 4ZVQB 2KM8C 2EK1A 2IA6A 1ITPA 5IT4A 4ZP9A 1FHTA 4DQSA 4BLGA 3RB6A 2CADA 1MWYA 1M5HA 4X4UA 1AUSL 4FS2A 4QJVA 3MURP 4MFBB 3W2VB 3UFCX 5KFTA 1YZ6A 3JSMA 3SFGA 2DBBA 4NLSA 1I51B 1P9QC 2OPRA 2PT0A 2M8DB 1GQEA 4OV1A 2M5YA 4F2SA 2BW2A 3AODA 3MR7A 2FJEB 2ZKTA 2FVCA 3M8PA 3FBCA 3P49B 3RW7A 2F4VF 1DTTA 2I38A 3CSKA 1WTBA 1WSVA 4YHHJ 5D4PA 4OJ3A 3I56S 3EICA 4LQ9A 3LP0B 2RRAA 2HYIB 2FJDB 5C2GA 1I1GA 2HHPA 3DXSX 2IRXA 4C9DA 3BO4A 5A0YB 4ZKAA 1Q16A 2DNLA 1X4BA 4L3NA 1R0AB 4JV5F 1CJKB 1VQMS 1YQHA 3AD8C 2NUUG 2R7WA 3DYAB 2FPHX 1SKUB 1W2BR 1NDPA 2OIHA 3IR7B 4PR6A 1CBKA 3HFVA 4WFZA 3JQJA 2GIRA 3EXCX 3FNNA 4P73A 1VRTA 2JVOA 4K5RA 4RWXA 3QZ8A 1YTYA 1IUJA 2SXLA 4DQQA 3NGUA 1VC0A 5L46A 1U9PA 3EGWB 4V1Ak 4ZOSA 1KKHA 1YGYA 2HQCA 1FERA 3MEDB 1XNQF 5H9FK 4M5KA 3IRXA 4N5SA 5H9EJ 1E6VA 3CDBA 2R7RA 3DLLQ 2DR7A 3DLGA 1D9FA 2KELA 3IO1A 2M0GB 4YB6A 3KUGA 1UCNA 2VG5B 4L72B 2HFOA 4B3RJ 2NUHA 4MTPA 2O3DA 1LXNA 4KHMA 2H5EA 3PW5A 2M70A 2LQ8A 2KJWA 3N9UC 2LFVA 4I64A 3H40A 1YRXA 1YJ7A 3IA0A 1SJQA 1UZDA 1JLAB 4JB8B 3IG1B 4J7CA 1HMVA 5CABA 1HARA 1LW2A 2UXBJ 4YB1P 4LF5F 5F8IA 3TOQA 2WVDA 2V4JA 4DX8H 3EPGA 4JP8A 2EFGA 3D54A 3N6NA 5T7LA 3WHIA 6FDRA 3TQ1A 1FNMA 3NWGA 3HP6A 2XTJP 1PGZA 1BC6A 2VU5A 2LQBA 3OLBA 1EZZB 1RT3A 3H7HB 3HHEA 3HI9A 4ZDNA 3BSOA 3KK2B 2R8HA 2JEJA 4JI4J 1WOOA 2V8GA 1BAZA 4C8MA 5A8KA 4RZRA 3BREA 4Q8FA 2W8KA 3ZFVA 2FVPA 2MKKA 4NI2A 3X1LB 3PX0A 4TXSA 4M94A 4X4QA 2KXFA 2KHCA 2Z56B 3WBZA 2HVEA 2MLXA 1EKSA 4DR6F 4OX6A 2UV8G 1T9UA 1X5OA 2IRYA 2MZQA 1K1QA 1X0PA 3M8WA 3OR2B 4YP3A 2R2TA 2C2RA 2XS2A 1T3NA 5FIIA 1HBMA 2LEPA 1TKXA 1ELOA 2A3JA 1JX4A 3L7UA 4DV5J 4IG3B 2JWNA 4J9UE 1KNZA 1H2TZ 1V5IB 5L1KA 4LSLA 4JOUA 2DGXA 5D0HA 2HHTA 2BVZA 3D66A 4K4YA 4KO0B 4OMFG 3GJTB 3BF4A 3UO0A 4E8UA 3J80Y 1A0OB 3GIMA 3DOKA 1HWLA 2YKNA 4YB7A 1D9AA 2ZD1B 3K17A 3DOLA 2CAJA 2ACMA 4I2QA 4OZJA 2CG4A 3R1HA 1XMOF 3PG9A 4Y2MA 2EC0A 1T03B 2HQDA 4UF4A 1LWEB 1X7VA 2GHPA 1KQKA 4N56A 2WSFC 2KKHA 5AJ3J 3LWMA 1GXUA 5HMYA 3ENWA 1HNVA 1IR1A 2GO9A 1UVNA 1MWZA 4LF7J 1BHNA 1CG2A 4F4YA 1RHRB 1YRTA 2FZCB 2P8IA 5DS7A 5ETQA 2WVFA 2DR5A 2XMKA 3D67A 2QO3A 3OTOJ 1IN0A 4XTTA 3Q0AA 2KHDA 2QA1A 1WHWA 2YWKA 1LWFB 3JS9A 1WG5A 3KNGA 1DTQB 3TVZA 2D68A 4ETXA 5D3GB 5EWFA 3OQ2A 2XZDB 4O4GB 4NXNF 1RTIA 3G96A 3MCSA 1IVZA 1S9EB 3M1VB 4KGMA 2G2ZA 4I2PA 2RRNA 2WBMA 2RDIA 3ADAC 1ARRA 1B0PA 4JI0F 2XCAA 1H38A 2Q3PA 3HVTA 4DS5A 1IBMF 3R5GA 4C8LA 4F02A 2KFNA 2IIHA 4RW7B 3U02A 2EFPA 5CH7B 1DLOB 4PEOA 2W9BB 3PX6A 2KOEA 5T41A 1SL0A 3TQEA 1S6QB 3MUVP 3TEHB 1XMQF 4DDFA 4TU9A 1QAYA 3NO7A 2HNZB 3CE8A 3FCVA 1U1KA 1Q7YT 1RTDB 1S12A 1HI8A 1RQ0A 4UUWA 4ILMA 4LFAF 3V6DB 3HSJA 4DV4J 3M32B 3AB4B 4EI2A 1S4FA 2M88A 3GV7B 1S9GA 3PJWA 1RXOB 3W5XA 1FJEB 2OKQA 1GT8A 2QL7B 2R7OA 4F7VA 4LF9J 1IR2A 2ROEA 1X8DA 2DH7A 3LP2B 1RYSA 1KS2A 1PIEA 3MZIA 2E1PA 3FMTA 1KR4A 3NGKA 5IC6B 4C48A 2BXJA 1HR0J 2MQ8A 3BBFA 1BGXT 1R3NA 4PZVA 2HS4A 3GIJA 2EG1A 2FUG9 2QMWA 2UZAA 4ECSA 3KLGB 3JB9k 5GAHI 2UUCF 4OX7A 4O3NA 1YJRA 1UVLA 1WC0A 3F56A 2HVZA 2PN6A 4DHVA 2OPSA 2AJFE 2N7YA 2V6AA 3DCAA 4L74A 1TELA 1TUGB 1B0TA 1RSCA 2BACA 1B99A 2PA3A 1F6TA 5ETKA 2CPGA 1VJWA 1J27A 5SZTA 1ZTTA 2ZM6J 3BSCA 1IKXB 1VJQA 2V8HA 3VAFA 4K4UA 1J2VA 1U24A 1NSPA 3QNWB 4HHUA 4RUBA 3CDUA 1TKTA 3H90A 2JXGA 4P6QA 2DGTA 4LIWA 2VFUA 5K8NA 5EN1A 4WYWA 1HA1A 4DV0J 3AA8A 3OXFA 5K14B 1HWIA 5I3UB 1Q8LA 2XYHB 1RGVA 2MQQA 4DR2F 4Q0BA 2CG8A 1ROFA 1JQGA 2WSCC 5KFIA 2LXUA 3ZZZA 2YX1A 2UVUA 2GMLA 3HPOA 1NRKA 4B08A 4OFZA 1WEYA 2DHXA 4OI4A 3U7JA 3SV3A 3WDOA 5B0BA 2WONB 3ZO7A 3VAHA 1F5CA 2PMHA 3LGNA 1BQMA 3QGGA 4KQZA 4AAIA 5A76A 2KG1A 4ECZA 3MOJB 4PWDA 3AFGA 2XGQA 5CCLA 2XCPA 1K73T 2C2OB 2AX1A 1GXTA 3JSBA 2AJQA 4NYZA 1G6BA 4ED4A 4ES2A 2X3DA 3BKUA 3P5BP 2VBYA 2Y8YA 1DARA 1X93A 2R3VA 4OHVA 2QN6B 2KVIA 3IBWA 3PFEA 1KN6A 4DOZA 1R89A 2A2DA 3OXLA 5BJRA 2QTWA 1SJ1A 2WSEC 3H5XA 4WK3A 3QJJA 2OGUA 3EGZA 1DURA 4IO9Q 3I0RA 5DDOC 4LSNA 2R7VA 4JUZA 3AD9C 2KVQE 1S1XB 2RIJA 2ZOFA 4RNHA 3NBPA 1X5PA 3TA1A 2U2FA 3GR0A 3OLAA 2RHQB 3G86A 3J80U 2VC1A 4DR5F 5KFVA 2YQ1A 2B51A 3MM9B 1U1LA 3KLFA 2MHNA 2WK4A 1RJJA 2OELA 4DJBA 2BKPA 4DPYA 2G13A 3PTWA 1HNWF 1RTHA 3U27A 1OM2A 5K8OA 3TI0A 1ZETA 1U45A 5KFJA 5FJ4A 1MROB 1T94A 4NA3A 4WKYA 4PAAA 1SH0A 2K6LA 4DV7F 4W98A 5E2QA 1C0UB 4QIWD 5KFXA 2ZEJA 1JLCA 2HK2A 3MUTP 5U47A 4F4AA 5LXYA 3MMCB 2HVIA 3BN7A 4HYKA 4JYAJ 2E1MC 4LJMA 2HNDB 3W8GA 4FF2A 3A8IA 1F9FA 4WXWA 4TY8A 3QRRA 3I0SA 1ZA2B 5LOQA 5AXMA 2MKHA 1O6XA 4FVCA 2FZGB 1MLAA 3JAMU 1G1XA 1HNXJ 2IAJB 3CD6S 5KTQA 2JLFA 1EP4A 1EB0A 3MM7A 5DJBA 4LFAJ 4KGXB 4OI6A 3F73A 4QR1A 4Z7YA 1RT4B 1TL7B 2QRRA 3LO3A 4KFBB 5IS2A 4ED7A 4DCOB 3PVXA 1B3TA 4G6VB 4NEYA 1TK8A 2CQHA 2HBYB 1NSQA 1FK9B 2Y9HA 2VOOA 4N41A 4EEYA 2ZKUA 5A2QY 5E41A 3BBBA 1Q8BA 1Q8IA 1YK9A 2VJUA 5C42A 1QSLA
chains in the Genus database with same CATH topology
5F3ZA 2EVZA 3E51A 3DLEB 4GKKF 4QWCA 4WE1A 4DL0C 2GQ2A 3CGIA 2CZ4A 4O3OA 1ZBTA 2QE5A 2VBWA 5JUMA 1MMLA 1VLYA 3T1HF 2VBZA 1Q53A 4OZNA 3DFEA 4TKTA 2A1BA 4FP9A 4NWBA 1M0SA 4CO4A 1H6KX 2I8EA 3QO9B 4KHRA 5GADU 1NK6A 1RI7A 5I42B 3CTRA 4PXEA 3ZZOA 2F9DA 2ZFHA 1HR0F 4M1KA 3KYLA 1UA1A 3E8OA 2HWIA 2CQIA 2DNMA 1QE1B 4GO5X 3Q8SB 3RBEA 2XB2D 1FDBA 4X66F 1NNDA 1N32F 5B0FA 2F8EX 4PXCA 2Q43A 5KFRA 1GTHA 2RH3A 3HKWA 4J9RA 5KFPA 3PR5B 3PHEA 2KDOA 4IFYA 5AE2A 5F9LA 5KG7A 2G4BA 3CMAS 5HMZA 1TFYA 5MAOA 3HO1A 2JEIA 3FZ2A 2MGZA 2CQ1A 3MMBB 3SQGA 1RWUA 3V4IB 4XAKA 3JSYA 2CFXA 2ZE2A 2NREA 2WBRA 3GMGA 3EZUA 5HLFB 4DN9A 4GKJF 3KK1B 1R8CA 3AY0A 3MD3A 2GQQA 5KT2A 2W8LA 4FF1A 3S1TA 2LECA 1RAJA 3SSQA 3S7RA 5C25A 4UQGA 3MEEB 5KFUA 5DDQC 4PRFA 2DPJA 5CQGA 3LGMA 4NYOA 1ZOTA 1NHUA 2MZTA 1TP7A 4XIUA 3DLKA 1Y9OA 1DQ9A 4HEA9 4HDGA 3SSRA 4USJC 7FDRA 4QU6A 2RF2B 1NB7A 2KKEA 3M2VB 4J9MA 4CNYA 1Q82T 1YJWS 5B0CA 1S1VA 2DHGA 3DHWC 3AQOA 4YY3F 5L9XA 3ICLA 4FPRA 3BGLA 3M4XA 4DR3F 4ZP8A 3F41A 5HBMA 4QPTA 4TNOA 2J9CA 4J9SA 4O44B 3KLHA 2CJKA 3HHKA 3MECA 4ZCKA 5J2PA 1S99A 4ED5A 1KQFB 2DGWA 3FEXB 5LJ5Y 2HHVA 4GMKA 2DO4A 3I55S 2K8GA 2X1GA 4M95A 5KG6A 3TUIC 3S8SA 1FVQA 5HI7A 2AD9A 2RU3A 2FVRA 3I5CA 2OO4A 4B3SF 1RKJA 1OSDA 1A9NB 2ADCA 1FJ7A 4R25A 2L3MA 2LLZA 5MLCV 2ACYA 1EETB 2M52A 4H4MB 2FLLA 4NLGA 3DRSA 2ZJPQ 2DRBA 4FNHA 1S48A 2WRMA 3GFYA 3MPWA 4X84A 1E6YA 3RAMA