1SH2A

Crystal structure of norwalk virus polymerase (metal-free, centered orthorhombic)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
502
structure length
502
Chain Sequence
GTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVNED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA Polymerase
publication title Crystal structure of norwalk virus polymerase reveals the carboxyl terminus in the active site cleft.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase
total genus 157
structure length 502
sequence length 502
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 1sh2A02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1sh2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sh2A03
4Y3CA 3MFIA 3CIZA 3DLKB 5KG2A 5J1EB 3GIJA 3HVAA 5KFQA 1S10A 4NLRA 4PWDB 5KFPA 3UQSA 1LW0A 5KFOA 4KO0A 3KLEA 1JX4A 3QGIA 4URGA 4ECZA 4ECSA 5HP1B 2R2SA 4XO0A 3EPIA 1TVRA 4ZVHA 2C2RA 1JLQB 2VA3A 2YKMB 3M9NB 3JSMA 5F8HA 1FK9B 1XR6A 2XGPA 3NGDA 3PW0A 4GC7A 1RTHA 4ED2A 2FJXA 4K4SA 2IC3A 1TKXB 3CDWA 2RKIA 3PW4A 3QGGA 2IM1A 1ZTWA 5KFVA 4J9OA 3LP2B 2VG5B 2E9ZA 3H5XA 4ED8A 2C2DA 1S6PA 3FRZA 3HVTB 3IG1A 4J9QA 2WRMA 1RYRA 1S0NA 5K14A 5KFDA 1JLGB 1SV5B 5KFAA 4WXOA 3KHHA 1J5OB 1LWEA 4G3IA 2FJVA 4NZ0A 4KHRA 4XPEA 3JYTB 3CJ3A 4YR3A 5EWFA 3QZ7A 4R5PB 3SFUA 2YNGA 4RW8B 3V6DB 3I0RA 1XR7A 4H4MB 4NLUA 4MK8A 4PQUA 2OPPA 3I5BA 4JV0A 4IH5A 2XI3A 2BE2A 4Y2AA 3DLEB 2B6AA 4YMEA 3GILA 4NLSA 1JLEB 2J6UA 5C24B 3DRRA 4EYHB 4O3NA 4J9KA 1R0AB 2BQUA 1N5YA 3MECB 2XWYA 1JLAB 1FKPB 4LQ3A 1FKOA 1OS5A 4O44B 4URQU 5CYQA 2D3UA 4RU9A 2XCAA 1RT5B 4O3OA 2IMWP 3V6HA 1HYSA 1RT4B 4EYIB 5KFKA 1W25A 5KT7A 3GIMA 1NHVA 4K4TA 2JLEA 3FFIB 4R8UA 2VG6B 3CVKA 2XI2A 1T05B 4ED3A 5KFFA 3CJ4A 3PHEA 4Q8FA 4K50A 1Z4UA 3RBDA 4QPXA 4ZHRB 5KFEA 4IH6A 1TKTA 3PR4A 1N6QA 3E01A 1WNEA 1C1CA 5KG7A 2YNIA 1REVA 3I0SB 1TL3B 2OPSA 4QW9A 1RDRA 4ECXA 1HMVA 5KFGA 3KJVB 5HLFB 1JLBA 4ED6A 5FDLA 4MIBA 4ECWA 3LAKA 1RA6A 2R2UA 2C28A 1BQNB 1VRUB 3UR0A 5DQGA 2OPRB 1HPZB 3M8PB 3PW7A 1JLFA 1RTIA 3V6KA 3DOLB 2R8JA 2OPQB 3KHLA 4H54A 5J2PA 2B5JA 4ZP8A 3LAMA 4LQ9A 1S1XA 1S1UB 4ZVFA 5KFSA 3I5AA 3HHKA 5DQHA 3OL8A 3MEEA 1S1WA 5CYMA 5KFLA 2ILZA 1RT3B 4IFYA 3C6UA 4B3OB 3QO9B 3C6TB 3GV7B 4DL5A 4DG1B 4K4YA 3DRPB 1S6QA 3KK1B 1S97A 2IJFA 2HNYA 5DQIA 2DPIA 3D28A 5I42A 3KLGA 5DLFA 4H4OA 4ICLA 3V81B 3T5HA 5EUHA 3BGRB 2BRKA 4KV8B 4JUZA 4RW4B 4RW6B 1LWCA 5F9LA 4IDKB 3MR5A 5J2NB 3TQ1A 3QLHA 5KFMA 1JKHB 4WFZA 1DLOA 2RF2B 3MR6A 4ED0A 5L1JA 2FLPA 2ILYA 1S1VA 4I7FA 4G1QA 1JLCB 1T3NA 3N6NA 3RB4A 2D7SA 3CJ2A 3EZUA 4MFBA 4QWAA 4EBDA 4Q0BB 3CJ0A 4FS2A 1YVFA 2FVQA 4IR9A 4QWDA 1DTQA 1T03B 4ZP7A 1GX5A 2YKNB 4NLWA 5KFYA 5HP1A 4QWBA 3QIDA 1HNIA 3KMSA 2RDJA 3OL7A 3IRXA 1KLMA 4ZP9A 4MK9A 3T1AA 3KLHA 4RW9B 2F8EX 2AX0A 1S9GB 1QE1B 3NMAA 5F8NA 1HARA 3GV8B 3KLFA 3G6VA 5C42A 4WYLA 2HNZA 5KG1A 3DM2B 3LP2A 3NL0A 5C5JA 1IKWB 3DDKA 5KFBA 4WFYA 3IGNA 2I5JA 1RT6A 2D41A 3IGVA 3MEGA 5KFXA 5DG9A 4DL4A 3DYAB 3G6XA 3BSNA 2R2TA 1JLGA 2ZE2B 2IAJB 3ITHB 5L9XA 2FJWA 1EP4B 2FLNA 2HNDB 4RNMA 3QIPA 2IA6A 4NLTA 4PUOA 3NKYA 2XC9A 3N6LA 4I2QB 4TLRA 3NBPB 1K1QA 3OHAA 4HYKA 2YNFB 3DOKA 4H4MA 4RNOA 4NCGB 4DL7A 4GC6A 2HMIA 3BJYA 1S1TA 1HNVB 1KHVA 3ICLA 4ID5B 4MKBA 4YR2A 1NHUA 3G6YA 3H40A 4WE1B 4LSNA 1RT1A 1EETA 2JEIA 4IG0B 1R0AA 1LWFB 2AU0A 1HQUB 5KFTA 2W9BA 5DLGA 5L1IA 4NLDA 1S0MA 5F8LA 2JEJA 1K1SA 4KAIA 3T5KA 1MU2B 1TKZB 4YP3A 5I3UA 5JXSA 1RTDA 2W8KA 2VG7B 1HQEA 5KFJA 5D3GB 4KKOB 1BQMB 1S48A 4YR0A 4IOBA 2ASJA 3FFIA 4ECYA 1C0UB 4ED1A 1S4FA 3GQCA 1C2PA 1T05A 3HKWA 4O4GB 2O5DA 4RW7B 5HROB 1UWBB 2R8HA 2QE5A 1MMLA 1RT7A 4TY9A 1RT2B 4Y34A 1RYSA 1NNDA 3SFGA 2IM0A 3PJWA 3V4IA 3Q8QB 3H59A 2YNHA 1LW0B 3MR3A 3V6JA 2C22A 4KO0B 5F8JA 3KLEB 5KFHA 1S9EA 4K4WA 2WHOA 1RTJA 3DLGA 5DGAA 3RB3A 3CWJA 3DMJA 1TV6A 4ZPAA 1IKVA 3JSMB 3T5LA 1T94A 4I2PA 5JUMA 1C1BB 1RTHB 5KFZA 1VRTA 2I1RA 3DOLA 2RKIB 2IC3B 2OPQA 5KT4A 3RAQA 2R8IA 2FVSA 4RNFA 4IH7A 1S1UA 1D1UA 4FBUA 4Q44A 3KLIB 3IG1B 4NRUA 3QGHA 4U6PA 4IRKA 3KNAA 4RUCA 3RB0A 2WOMA 1D0EA 5K14B 5KFRA 3UPFA 3C6TA 3G86A 3GIIA 3CDUA 2W9CA 4J9MA 4WZMA 5J2MA 4IG3A 5KT5A 3RB6A 5KG5A 4KHMA 2IJNA 3FQKA 2WK4A 2UVUA 3V81A 2YNGB 3M8QA 1KHWA 3I0RB 3BGRA 4TQSA 3PR5B 2UUTA 3LP0A 4KFBB 2OPPB 3FDSA 4RW4A 3Q8RB 3OSNA 4IDKA 5J2NA 5HBMA 3TVKA 2WB4A 3MR2A 3LP1A 2B6AB 3DI6A 2XGQA 4U7CA 3KK3A 4HKQA 2HAIA 3DRRB 5J2QA 4NLOA 1N5YB 2BANA 2IM2A 1JLCA 2GC8A 2AGQA 1IM4A 1FKOB 1C0TA 5CYQB 4KB7A 4O3RA 1HYSB 4Q45A 4TN2A 3BQ0A 1T03A 3IS9A 4EBEA 1U09A 4J9SA 2BQRA 2VA2A 4TY8A 1TP7A 3KK2A 2WONA 2AX1A 4MIAA 3TAMA 5C25A 5DGBA 1IKXA 1SH2A 5KG6A 4M94A 2EC0A 4NLVA 1IKYA 5KT6A 5KT3A 1SUQA 2ASDA 1LW2A 4IRCA 4MK7A 4IFVB 3M9OB 1TKTB 1N6QB 4WYWA 3E01B 4J9PA 3IN5A 1C1CB 3DRSB 1REVB 1IKWA 3UDLA 2OPSB 3DLKA 5KFNA 5J1EA 1HMVB 1JLBB 4PWDA 2UVRA 4J9NA 3KMQA 4ECRA 2AGOA 4QWEA 3I5CA 5F8MA 1ZETA 1JLQA 2UVWA 2YKMA 4ZVEA 3PVXA 1SH0A 4DL6A 1FK9A 4LSLB 1JLFB 1RTIB 4F4ZA 4F4YA 4X2BA 4MH8A 5J2PB 2B5JB 1GX6A 1TKXA 5F8GA 2WTFA 2HWHA 1HNVA 2R2RA 4EO8A 5KG0A 2VG5A 2CKWA 2UVVA 3MEEB 1S1WB 3HVTA 5CYMB 4RUAA 4IFYB 4IG0A 1S0OA 3ISNC 3BREA 5T14A 4F4WA 2ALZA 4EBCA 1S6QB 2HNYB 2ZD1B 1SV5A 2E9RX 3OHBA 3GIKA 1TL1B 5KFUA 1J5OA 5I42B 3KLGB 4H4OB 3CDEA 1SH3A 4WFXA 3JYTA 1I6JA 3RAXA 4R5PA 3T19A 4RW8A 3GYNA 3V6DA 1LWCB 2FVPA 3QLHB 4TQRA 2JC0A 2ASLA 1XR5A 4JV2A 1DLOB 4RNNA 4OL8A 2E9TA 2BRLA 4O3PA 5KG3A 4WXWA 3DLEA 1RT2A 1S1VB 4I7FB 4G1QB 1JLEA 2DPJA 5C24A 3MEDB 5KFIA 2FLLA 4R0EA 3E51A 4MFBB 4YQWA 3KHGA 3MECA 4O44A 1JLAA 1FKPA 2V0NA 4EO6A 4FBTA 1N56A 1DTQB 1QUVA 1RT5A 3BR9A 2W8LA 1RT4A 3NAHA 3H5UA 4ECQA 4K4UA 4Q43A 1HNIB 1DTTB 4ZPDA 2RDIA 3FSIA 4Y2CA 3IRXB 4KSEB 2QV6A 1KLMB 1C1BA 2VG6A 5EDWA 4MKAA 3KLHB 3OL9A 2B43A 3CJ5A 2W7PA 4NRTA 4ZHRA 3KLFB 5C42B 2FVCA 2HNZB 1JIHA 3ISND 4TYBA 4NLPA 5KG4A 3KLIA 2J6TA 3HVWA 5DG7A 3VQSA 3I0SA 1TL3A 4EEYA 2I5JB 1RT6B 3MEGB 3GV5B 3BQ1A 3KJVA 5HLFA 2CJQA 5KT2A 4DEZA 4WZQA 1TVRB 1BQNA 3QIPB 4PUOB 5KFCA 3T5JA 1VRUA 3OSPA 3KLVA 2J6SA 2OPRA 1HPZA 3M8PA 5F8IA 5F9NA 3DOKB 4DL2A 4ECVA 4TYAA 3PJXA 4IRDA 4Q8EA 4RNHA 4ZP6A 2WCXA 4KFBA 3OL6A 2HMIB 4NLGA 1S1TB 2AQ4A 1S6PB 4LSNB 1RT1B 1EETB 3OLBA 4NLQA 2W7OA 4J9RA 2AGPA 3D5MA 1RT3A 2W9BB 4F4XA 4B3OA 4IQXA 3QO9A 2V4QA 2OH2A 3LALA 4DG1A 3MF5A 3DRPA 4URSA 4ZMMA 3KK1A 3H98A 5I3UB 4O3QA 1LWEB 2JEFA 1RTDB 1HQEB 2FVRA 4QW8A 2V9WA 4ZPCA 3CO9A 5L1KA 2ATLA 4PQUB 3EPGA 4KV8A 2V4RA 1QAJA 1CSJA 4RW6A 2XCPA 2UUWA 2C2EA 4IFVA 3RBEA 2BE2B 1RT7B 1JKHA 4JV1A 2RF2A 2ZKUA 5EWGA 3H5SA 1ZTTA 3DRSA 4ED7A 4O4RA 4K4ZA 2GIQA 2D3ZA 4DL3A 3V4IB 4Q0BA 2YNHB 5EWEA 3M9MB 2IM3A 3H5YA 3OLAA 4K4VA 1S9EB 4F50A 1RTJB 3DLGB 2GIRA 1N48A 2YKNA 3DMJB 4ECUA 1TQLA 1TV6B 1IKVB 4ECTA 1RA7A 4R8UB 4I2PB 4NLYA 3SI8A 4NYZA 4LSLA 1JXLA 1VRTB 2R8KA 5KFWA 4RW9A 2W9AA 1S9GA 1RAJA 3N6MA 1QE1A 3KHRA 4M95A 3FQLA 3Q8PB 3QZ8A 3LANA 2YNIB 2R8GA 3DM2A 1S9FA 2WOMB 3BSAA 3BSCA 2BQ3A 2W9CB 5FDLB 3PW2A 5J2MB 3DYAA 2AWZA 2ZD1A 4IG3B 2ZE2A 2IAJA 3ITHA 3QYYA 1EP4A 1TL1A 2HNDA 2JC1A 3BSOA 5L1LA 3PZPA 5DG8A 4KE5A 4ZVGA 3M8QB 4QWCA 4I2QA 3LP0B 3NBPA 2YNFA 3H2LA 4IR1A 5HBMB 4NCGA 3KOAA 1S1XB 4RZRA 3LP1B 3DI6B 3H4BA 2JEGA 3KK3B 4ID5A 3H4DA 4XPCA 4WE1A 5J2QB 1S49A 4FS1A 2BANB 3MFHA 3MEDA 2IBKA 3C6UB 1C0TB 1LWFA 4TXSA 1HQUA 4IKAA 3BQ2A 3Q8SB 3NAIA 3IS9B 1MU2A 1TKZA 3MTKA 2VG7A 4TY8B 4ICLB 3KK2B 2WONB 1N4LA 5C25B 3TAMB 3PW5A 1DTTA 4KKOA 1BQMA 1IKXB 4O3SA 5D3GA 1C0UA 4K4XA 4NLXA 2BR0A 1IKYB 1SUQB 4ZPBA 1LW2B 4O4GA 2HWIA 4RW7A 4J9LA 5HROA 1QAIA 4KBIA 1UWBA
chains in the Genus database with same CATH superfamily
4TU7A 3H2VE 1PARA 1UVJA 3FCVA 2W2NP 3QWPA 5KFOA 4F67A 1P1LA 4ER8A 4QR1A 3IXQA 3VAHA 2D3O1 1JMTA 1VS3A 2JRSA 3JQKA 2E9ZA 2ZITA 2C2DA 2BE7D 4P2MA 5F41A 1NK5A 3MMBA 2GVDB 1HBUB 5KFDA 1J5OB 4KHRA 2IRUA 3J7A1 3MM8B 3MM7B 4LBPA 3U1LA 2RD5C 2Z57B 3EXCX 1T05B 3GWCA 3UD5A 1XMQF 3CCRS 1REVA 1TL3B 3JAMU 1W2BR 3HJVA 1JLBA 4NI2B 4K8RA 2R8JA 2XO7A 4H54A 2C2NA 3C8YA 3TW0A 3J80Y 2HYIB 4FYWB 3PKYA 1K44A 3MUMP 2QJ3A 3NCRA 4OI6A 3HKZD 2BRKA 2DJWA 2GZOA 5J2NB 4NPOA 2FLPA 3GP9A 3AJ1A 1YVFA 1BLUA 2ZH4A 2KB2A 1XEZA 1T11A 1WKLA 2MKSA 3KLFA 1FCAA 1V6HA 1Y5NB 5ETPA 1RT6A 3MEGA 2GVDA 4USHA 1HBUA 3ITHB 2VASA 2MQQA 2HK2A 2BJ8A 1N32F 2YNFB 3DOKA 2JFKA 4CO2A 3R8YA 2HMIA 4YR2A 1CPZA 1FI4A 5A6PA 3Q2TC 5JXSA 4F25A 3TVYA 1T05A 4O4GB 4USUA 3ZNJ1 5E41A 4OYMA 2N82B 3KUHA 1MMLA 4DX5A 2HS3A 2QLBB 5IT0A 2DGOA 2KVIA 4ELUA 2C22A 3KNGA 4B9UA 3M2UA 1N36J 1D1UA 4Q7AA 1SJ3P 4RKUC 3AB4B 1YRTA 2UVUA 3FEZA 3CC2S 4DUTA 1WF0A 4HHUA 5J2NA 1QSYA 3MR2A 4JV5F 3SQGA 3TQEA 5IOLA 1FERA 3SV3A 4Q45A 1TP7A 1IKXA 1YBUA 3M2VB 3BBBA 4V1Ak 3CDAA 2YXLA 2E1MC 3THTA 3RR7A 1KD1T 2JVOA 5HI7A 2GVZB 3VAFA 4J9NA 4ECRA 2CVIA 5F8MA 3I9ZA 3H25A 4X64J 3EICA 1FEEA 2XZWA 1MROA 5KG0A 2D68A 2QTWA 2UV8G 5CYMB 4IFYB 1RSCA 4N56A 2B0GA 1TL1B 4CH0S 4R5PA 3V6DA 3K7RA 3HXMA 1X9WA 4OL8A 4LF5J 1S1VB 1WI8A 3E51A 1SJ1A 4EO6A 1DTQB 1EKRA 3EGZA 1NSPA 2R7UA 2XLJA 4AQYJ 5DM6Q 2MJUA 4I6WA 1P9YA 3LH2S 3PKMA 3THVA 4Y6IA 5HLFA 1H74A 2LU1A 2HIYA 4ZJQA 2XMMA 1SL1A 2LMIA 3HZGA 2F5GA 5K8MA 3TUIC 3OL6A 2JVRA 4HH0A 2L08A 1RAAB 1RT1B 1EETB 3OLBA 1Q81T 2OMOA 3KK1A 2IVMA 2BXJA 1TMMA 4ED4A 3HO1A 1UJ5A 4XDDA 3JTOA 1N33F 3WBZA 2DHGA 2DXDA 5T7LB 2Z2YB 2D3ZA 4DL3A 1S57A 3H5YA 1H7WA 2LQ8A 1TFYA 2GIRA 1SIWB 4LFBF 2YNIB 1FJ7A 2KXFA 2R42A 3DYAA 3QYYA 1TL1A 1FRXA 3M8YA 3M8QB 1U6FA 4C6AA 4HI2A 4CO1A 4FF4A 4DUZJ 2CQ3A 2NSCA 3H4BA 3PTWA 3CPWR 5J2QB 4DV5J 3WZ0A 1VDHA 2LEPA 4AXIA 4USVA 3PRDA 5C25B 1B7FA 3PW5A 1BGXT 2KOEA 2GW8A 4Y3CA 1J5EF 3GJSB 5KFQA 4FPIA 3HT0A 2DIUA 3KLEA 3ZFVA 3VEAA 4X4TA 2F4VF 2CQPA 2MXYA 1QTGA 1FWLA 1NLKL 1S0NA 4C98A 2FJVA 5A8RA 4C8OA 3QJPA 1YSJA 4B9LA 2J6UA 3W63A 3CCSS 3P8BB 1RK8A 3TX0A 4NYOA 4URQU 5CYQA 2H54B 1H6KX 1N8RT 1SJQA 2IMOA 4OLOA 2XCAA 1HYSA 4X4UA 2HQIA 5C2GA 1U24A 1TUWA 5IC6B 3VZHA 3PHEA 1ZYQA 3UD4P 2YNIA 1VQ4S 2QLWA 2BSQE 3GJRB 4I4BA 4BDPA 4ZLJA 3J81Y 1SXLA 3ZZRA 1BQNB 3WQPA 2V9KA 2OPQB 1P6TA 3B8HA 4E0DA 2JFDA 2ILZA 1RT3B 1E6VB 3D68A 3P5TL 2HHWA 4ETZA 4LBHA 3D28A 3HZEA 1EIYB 4P10A 4RR5A 3N28A 1QTMA 3TQ1A 4IDKB 3QLHA 3NWGA 2CRLA 2JNJA 4I7FA 3CGIA 3I31A 4ITSA 1WHWA 4JI8J 4V19J 2RDJA 2FPHX 4YOEA 1AB8A 1NK8A 3RAMA 3NOCA 2MYFA 2BKOA 2HNZA 3O1LA 1NK0A 3IGNA 2I5JA 2RVJA 1WTFA 2Y0BB 2M9KA 4RNMA 4NLTA 4P74A 3UR3C 2GQCA 1KHVA 3PNIA 1B0TA 2QL9B 1F5BA 2G1HA 5HJXA 1SCJB 4Q2LA 3VV2B 3HX9A 2ROPA 2ASJA 2HVHA 1NHKL 1YRXA 5SZTA 9ATCB 3Q8QB 2E7XA 2BJ1A 2B7CB 4J5OA 1L3SA 2P6TA 1VRTA 3K5LA 3UDEA 2OPQA 5G4DA 2ZKTA 3HI9A 4QJVA 4RNFA 2R8IA 1MG7A 4Q44A 2MZJA 2UUBJ 3AX5A 1YK9A 2M70A 1U1PA 2EKYA 1S5ZA 5KFRA 2W9CA 2LU2A 1KR4A 1ZM9A 3HPOA 2CJKA 4IDKA 2XZDB 3NMRA 2B6AB 2XGQA 1V5VA 3DRRB 2GQQA 5GMKa 2OLWA 4A48A 4WKYA 4O3RA 4EBEA 1LFWA 1DZ5A 4X62F 2RNEA 1YI2S 2ASDA 2IDLA 5DO2A 5CCLA 2HBQB 2CAJA 5KFNA 3DLKA 1U45A 5HK4A 2W4DA 2YBVA 3T6JA 3D0HE 2KG1A 4X65J 3DC2A 3IR6B 4EZ9A 1WOSA 4F4YA 1CJVA 2C1EB 5GMEA 4FF3A 2CQHA 4WIQA 2J8SA 4M1KA 4U95A 3IRWP 1KOHA 1VQOS 3TUPA 3OUYB 2NZCA 1YHQS 1WSVA 1DAXA 2ASLA 2MTLA 1OQ6A 4RNNA 2XO6A 2Q6CA 1UKUA 2YKQA 2DPJA 4G1QB 1JLEA 4DV7F 3KHGA 2R7WA 2R4FA 2LQ9A 2A3JA 1HR0J 3CJSA 3K5PA 2VG6A 2SXLA 5L8RC 2NYHA 2AMCB 4ZVSB 3SXLA 4KPYA 1JIHA 3FCWA 2AJ2A 3GV5B 3LA0A 2V50A 2VIHA 2CJQA 3OR1A 5MAOA 3BDEA 4OHYA 1RU2A 3M8WA 4DL2A 1IBLF 1EJ7L 3G87A 3C66A 2AGPA 1Y5IB 3DRPA 4KH0B 1IBKJ 3WIUA 2VUGA 3PIPQ 2ATLA 3R7NB 1QAJA 4LF1A 3CCQS 2RF2A 5LOQA 2BMBA 1VISA 5CAAA 5EWEA 2IM3A 4WIIA 4CLYA 2O66A 2F4FA 2ZBRA 1VQ8S 2PT0A 3GB0A 1H98A 4ZDNA 4RWXA 3TJ9A 2WOMB 3QSYB 2HVEA 3K5OA 2W4PA 1UEVA 2IRYA 4CYUB 3ENQA 2Y1RI 3CT9A 2FIUA 1SKUB 3MFHA 2RMLA 2OEKA 2AN7A 2PE8A 4N8NA 2V1SA 2HBRB 4YY3F 2XSJA 2MQOA 4NZ7A 1F6TA 1SC3B 2NUHA 4F8RA 1VQSA 1UFWA 1FKAF 2P5VA 4ECSA 3FCHA 3MPVA 1VHIA 2ZHBA 1XIQA 3GFHA 3V5RA 2PI4A 1TK8A 4A47A 1VQNS 3IG1A 1Q78A 4J9QA 2DXFA 1JLGB 3EGVA 1T02A 3E8OA 2HRTA 4KJIA 3QT8A 5IC4B 4YR3A 5LT5A 3S8SA 3I82A 1R6VA 5ETNA 4NLUA 2OPPA 4Y2AA 5LM7E 2DNQA 4J9KA 3RZAA 4NE9C 1OS5A 2F9JA 1YJRA 1NJZA 1I1GA 2XI2A 3D6TB 2DR5A 4HDGA 4K50A 1VC5A 3BO2A 4N76A 2YY3A 2E5LF 3D4JA 5KFGA 1XWLA 3SDEA 4DR5J 4F2RA 3K5MA 4F7VA 4UTGA 3HHKA 5DQHA 5KFLA 2MKYA 2XMTA 2P9CA 3NS6A 3DN9A 2IJRA 2Y8WA 4P6QA 1VQ5S 4RW6B 3HP6A 5L1JA 1BUXA 5CH7B 2YX1A 4KQZA 1HNXF 1LKZA 4CO4A 1XNRJ 2Z0GA 1WELA 4WYLA 4DXLA 3DHXA 5IV4A 2XMAA 3VAKA 1JLGA 5B0EA 1X7VA 2B4UA 4YS2A 1EP4B 2MQMA 2HNDB 2E7WA 1W7WA 5E7OB 4DX6A 2VONA 3HSDA 2EFQA 2KXHA 5F8LA 1F0XA 4YP3A 3HHLB 5I3UA 4C8MA 5D4LA 1C0UB 1HKAA 2B3TB 4QOTA 3DHWC 5LJ3Y 2G9OA 1N36F 2R8HA 5A2QY 4F3QA 5DM7Q 4WF9Q 2CJYB 3QAUA 1R6YA 1RTJA 3NRBA 2VBXA 3JSMB 1T94A 1T95A 1OYEA 3RAQA 2KJWA 2PEBA 4I64A 2BVZA 5KG5A 4KHMA 4LF8J 3QWUA 3EZOA 2AF6A 3OXLA 4DV2J 2V8HA 3OQ2A 3DXBA 3UE2A 4NLOA 1HWJA 2AGQA 2M52A 4E2FB 3ZTPA 3KK2A 2V6AA 3CCWA 4X64F 2CDRB 1C1CB 1U25A 2Y9HA 1WC5A 2P9EA 4PAAA 1NEEA 3EUNA 1JLQA 2UVWA 3PVXA 1NJWA 2DR6A 2YKOA 1TL7B 5J2PB 2A1BA 1GX6A 3OJUA 1UP1A 3BREA 1S6QB 3C3LA 1VI7A 1X31C 2CNKB 4RW8A 2FVPA 3UWTA 1U1NA 3L7UA 2RQMA 1QTNB 3MI7X 3C15A 3H5UA 3PIOQ 2V68A 2VPXB 1HNIB 2ZDOA 2J7KA 1FDDA 3GYGA 1DQ9A 2W7PA 5C42B 5GAHI 3VR1A 2H5JB 1YDLA 2G0IA 3D2WA 3KJVA 5GADI 5SUHA 1R8PA 4DV1J 2LXIA 4Q8EA 3OTOJ 4DPYA 2Z30B 1WEXA 3LALA 3JSYA 2QLJB 4HI1A 1M5KC 2XCPA 3CCJS 2H5EA 3A8JA 2GIQA 4CRJA 3M8RA 1PJ7A 3DLGB 5GAHU 3ZTRA 4RW9A 2QX0A 5CZXA 3ZO7A 1U2CA 2E7VA 1O0PA 3F56A 3BSAA 3N9UC 3DCAA 2W4CA 4ILLA 2IAJA 2UU9F 4FZVA 4LF4F 1GMVA 3AY0A 4LUBA 2PC6A 3MMAA 3NBPA 3HVRA 2W24A 3CF5Q 1LEOA 1PJ5A 2F7VA 1O5JA 4DV3J 4LVOP 2AHOB 4LFAJ 4M5IA 2EFGA 1U1MA 1Q4RA 4TY8B 4USKA 1OM2A 2DEIA 3H87C 2CPDA 2PI5A 3QSIA 4KBIA 1UWBA 4HH1A 3VWSA 4RUHA 2M3DA 1WF2A 1UFLA 5F8HA 4D3GA 2KFZA 1N5SA 4CNYA 1AA1B 5BJRA 3ADAC 1KQKA 2MZRA 3VTIA 1FJGJ 1TAUA 3UNYA 1X8DA 2EK6A 2HQ3A 4HHJA 2UXBJ 1GFWB 2RT3A 4FXEA 5LMNJ 2XWYA 4DOZA 5IQ6A 4RU9A 4RUBA 1VBZA 5CZVA 4O3OA 2IMWP 1NPPA 1W25A 2VOPA 4I69A 2JLEA 1BQXA 2ZH8A 1GXUA 3HHEA 2XULA 4ZHRB 1WD6A 3RTVA 1GNKA 2UXCF 2JXHA 1RBLA 2RHSB 2VFRA 2K2PA 4UOFA 2QYGA 4BLGA 3KJQB 1NPKA 5KOXA 3MEEA 1S97A 4M5DA 3POTB 1NUEA 1D9FA 4JI4J 4P2FA 3T5HA 1T9XA 3IMQJ 3PYDA 1JLCB 4E8UA 3RB4A 4EBDA 1X4FA 3BH7B 1V3RA 2CZ4A 5JMNA 1S9GB 4UY8T 3FBEA 3WC2A 1PYTA 3G6VA 3DDKA 3FT7A 4PPDA 2OD4A 5E5NA 3FNNA 3QAEA 2ZE2B 3M8SA 5D8HB 1KSPA 4J9UE 4RNOA 4HEA9 3CNQP 2C3MA 1B28A 1UW9A 2KG0A 3EGNA 1HA1A 5E3PA 3H7HB 4DWIA 1OJ4A 1OPIA 1TUVA 1NNDA 3SFGA 4CM2A 5D4PA 4A8YA 2WHOA 2COLA 3WHIA 3CWJA 2CQ2A 1IKVA 4I2PA 4QU7A 1NZ8A 4W4MA 4CDIA 4LR9A 2HLUA 5K14B 3GIIA 1M1KT 5KT5A 4FP9A 2J0SD 2GO8A 5BYQA 2HFZA 2E5JA 1WEZA 1K73T 5ITHA 3M30B 4YHHJ 4HKQA 1AROP 3MMJA 1JLCA 4AUKA 4DQIA 2CXEA 1W2IA 3P4UB 4JP8A 1WC6A 1U0HA 2HHHF 5THWA 1N6QB 2HZCA 1RLCL 4YB6A 2VKRA 3IR5B 3T1HF 2OAUA 1XN9A 4R0JA 3MCOA 2J0WA 3MUTP 2B5JB 2XM3A 2R2RA 5EX0A 1RHKB 2ALZA 1PKUA 2W1BA 4NYPA 3OHBA 3OVBA 3B6BA 3CSKA 3SEOA 8ATCB 3RAXA 1HWUA 4FNIA 2OSRA 4JV2A 1XR5A 5LMUF 4O3PA 4N7TA 4O44A 4KT0C 1RT4A 4ECQA 4K4UA 2L41A 4MKAA 3OL9A 1LQ9A 4ED5A 1TZ0A 3R5AA 2BJ3A 2VOOA 2VFSA 4TYBA 4USIA 3HVWA 5A8KA 2O1PA 3BQ1A 4QBUA 2LXFA 4I1TA 5KT2A 1IBKF 3B4DA 4OJ1A 4IO1A 4OZJA 2WCXA 2CPGA 2VKZG 3R7BB 1RGVA 4HR2A 4DG1A 1HQEB 2KFNA 3AXMA 2HW3A 3TRGA 3OBIA 2OEMA 4B3SJ 3M9MB 2ACMA 3DMJB 4LIWA 2CNOB 1TQLA 1RWXB 2FTRA 1JXLA 3MOJB 5B7WA 2MSSA 2R8KA 1EAYC 3MM6A 2UV8A 3N6MA 3AFGA 1UUJA 3LWLA 2LECA 4OX7A 1I5OB 1EHWA 2ZBQA 5AJ3F 2GPEA 4TKTA 3EM1A 2CPXA 4RZRA 4KR0B 1YZ7A 3U1MA 2IBKA 2C3OA 4QYRA 2LKZA 5F0WA 3VZIA 3Q8SB 3OVSA 2KKHA 2MHEA 3K89A 2ZJPQ 4OHVA 3TAMB 1IKYB 1SUQB 2HWIA 3GFXA 1VQMS 3ELHA 4KYZA 3GIJA 2ERRA 4UUWA 3RW7A 5KFPA 1HBMB 4MYUA 3QRRA 2VA3A 5HVFA 2XGPA 2AT1B 3AAWB 3BZQA 3V2UC 4DR2J 4ED8A 1FXDA 3B54A 5KFAA 4FXWA 3QNWB 1XK8A 1OIAA 1HBOA 3I0RA 3K0JA 4LRBA 2J9CA 3BBCA 4BWJA 1WWHA 1N5YA 1RB0A 2DXEA 2J8AA 1RQ0A 1SVDA 3HHLC 1OY8A 3W60A 4QPXA 4B3TF 1RACB 5KFEA 2X1FA 3PR4A 2DGXA 1U49A 3D7SB 4LF7J 4ECXA 1HMVA 5AXKA 3I4HX 3LAKA 2ATCB 4G1IA 2OPRB 1REGX 4QCLA 3V6KA 2AIRB 2J9DE 1G7CB 4OYAA 3LJPA 3QO9B 3C6TB 2NQPA 3JTNA 2DPIA 4FKXA 4CLUA 5EUHA 3W2VB 4ED0A 4QWAA 1A7GE 2FVQA 1LV5A 3F41A 4J7CA 5KFYA 3DOMB 1D9DA 2LYVA 1VR6A 5ADZA 5F8NA 2WZ1A 1FD2A 1FFGB 1GMUA 5B0DA 2HAFA 2IA6A 3FMTA 5CHCB 5GAGI 3MURP 2AKWB 4I2QB 2VL1A 2ZZMA 1ZOTA 1HNVB 4WE1B 3NCPA 4B9SA 2W9BA 4ZVOB 2K3IA 4CLKA 1R8HA 2NSBA 2AZ1A 4IOBA 5HAOA 1CULA 4OJHA 1S4FA 2DHAA 2KHCA 1CLFA 1LFPA 4WK3A 2XTCA 2Q6BA 3T5LA 3A8IA 2X3GA 1FRKA 4DV2F 2QMXA 4OX6A 3LPYA 2GAGC 1RABB 2V63A 3EDQB 3C6TA 2IYIA 3OR2A 2G2ZA 5IS2A 3PV8A 1KS2A 1YKWA 4CLTA 3DI6A 4A8FA 2IM2A 1T9TA 1YG0A 1NK9A 4DU8A 3PYFA 5EHHA 5DGBA 3D1QA 2HHPA 4FNHA 1YJUA 4HHHA 5KT6A 2AD9A 4N47A 3PRVA 1IJEB 3VF0B 3UDLA 1IWAA 1ZPVA 4B3MJ 4PWDA 1XTZA 4DHVA 1SH0A 2EK1A 3NY0A 4DL6A 2WBMA 5AE3A 3M1VB 2UUAF 1HNVA 4EO8A 2OFGX 1OO0B 3HVTA 4EBCA 1UEUA 2MGZA 1V3SA 5AXMA 1F60B 4DFPA 1I6JA 3TWZA 3A3PB 1JXVA 1T9VA 1CJTB 4DFMA 1DLOB 1ZPWX 5KG3A 5C24A 1KFSA 3VGVA 3MD1A 2IIHA 5JVGQ 3K2YA 2NXJA 2K06A 3W2WA 3KDNA 4ZN1A 5EDWA 1NJXA 4IOAQ 1QM9A 4IO9Q 3BV8A 5H9EJ 2DRBA 2CJXB 4DV6J 3TAPA 2QG9B 2DNPA 2B8PA 2K29A 1NDKA 4TYAA 4RNHA 3TEHB 1WG1A 5IXUA 1OY9A 2L9NA 2W7OA 2YQ1A 3H98A 3DU5A 1LWEB 2CJ9A 3EPGA 4GRSA 3RBEA 2ROGA 1QVGR 3EJMA 5M2PA 1YITS 3IR7B 3KG0A 2YKNA 3SI8A 3JXOA 2YTCA 2F3JA 3DDIA 4CNZA 1TR0A 3PW2A 2KT3A 3UD3P 1D3WA 3AOAA 1UL3A 3KOAA 4OZ5A 1SJFA 3KFWX 3KK3B 1R8CA 1VIXA 2BANB 4P9SA 1K8AT 2F1FA 4A46A 1TU0B 3MM9A 1BQMA 1FX2A 5K9FA 2MKJA 4NLXA 4ZPBA 4RW7A 1URRA 4YUDA 2CZ9A 2E5IA 3VALA 1S10A 4NLRA 3R2DJ 3UQSA 4FYYB 3N0VA 4GKKF 2NXCA 3NGDA 1F3FA 4GC7A 1HWIA 2X51A 1U7LA 1Q7YT 4FPRA 4ENOA 1CBKA 4DDFA 2AJQA 2YH1A 1UVKA 1FTCA 1LWEA 2MSTA 4OYXA 3JYTB 1FJCA 1B0PA 2VFTA 1LWXA 4YMEA 4NLSA 2Y3YA 4DQSA 2BQUA 1ELOA 4CT9A 1JLAB 4P71A 1FKOA 3R3TA 2RSQA 3GR0A 2F8HA 1NHVA 2PA8D 4DV4F 2VICA 1IVZA 4CLSA 2YWHA 4JI3J 1XQIA 2W01A 4JI1J 2ZM6J 4ECWA 2DGWA 2XMWA 2H1OE 3OVAA 3R7SB 1HPZB 2OJ3A 4ZVFA 4A4JA 2GJ2A 2N4DA 1FA0A 5DQIA 2RU3A 4KV8B 5F9LA 1SQGA 2DRAA 1N0VC 1JKHB 4B3RJ 2DHHA 1KTQA 4MFBA 2VFUA 3SCJE 2H5IB 4ZP7A 4USJC 4F04B 2K1RA 3T1AA 3JAMY 1IKWB 3J7YI 2HBYB 1HIYA 3M6WA 2XMKA 2LXUA 3HJFA 1KTVA 2Y1IA 5IWAF 4DL7A 2RS8A 2WVBA 3NP5A 1LWFB 4OZLA 4NLDA 1HNWJ 1K1SA 3K59A 5KFJA 2OD6A 5FJ4A 4ECYA 2RS2A 3OTBA 4CO0A 2DK2A 3OXFA 3NGUA 3MOZA 4OYIA 1GAOA 4KO0B 2DB1A 2ZC4A 4W92B 5HMXA 3RB3A 2Y0SD 4C0BA 4DFJA 1RTHB 4NEZA 2RKIB 1CJKA 2D9OA 2ZJQQ 4AL7A 3KLIB 4DMZA 1FVSA 4U6PA 2R7XA 3RB0A 2HFUA 4WZMA 2IJNA 3QRPA 2ZZTA 4C0HA 3PR5B 4P72A 5HBMA 4FDFA 3LP1A 2Q79A 3CD7A 2E1CA 1CC7A 2NXEA 1SL2A 1SKWA 2KL8A 1L3TA 2V4JA 2GC8A 2ZEJA 3EXYA 2BA9A 3FEYB 2L48A 3K58A 4PPZA 1A0OB 1LW2A 3VQTA 3AD9C 4JOUA 4WYWA 1YJTA 4J9PA 4IUFA 2FJAB 2HGLA 1IKWA 2OPSB 1IQTA 3BYPA 1RWOB 4JYAJ 1FHTA 3KMQA 5LSOA 1FWKA 2YKMA 2DKOB 1FK9A 3VGUA 1FE4A 5BXIA 3HD1A 1TKXA 2HWHA 3MM5B 2CQGA 5E0OA 1JJ2R 1YBAA 4GKJJ 3M32B 4L74A 3I32A 2EBEA 2ZBIA 2MQNA 2W2MP 2ASYA 2JHEA 3PX4A 3EGWB 2ZVIA 1ZH5A 1SJRA 3K5NA 4TQRA 1UA0A 1YJNS 1RADB 2CWXA 4B02A 3VAIA 2ZC3A 3MXHP 3QOQA 3NAHA 4W90B 2KH9A 1XBWA 2ZHAA 4M63A 4CO3A 2MHNA 3N79A 1AZSB 3KLIA 2DY1A 3I0SA 4LJMA 4UUXA 3PYGA 2RJZA 4M5MA 4DEZA 4PUOB 2ADBA 3QQCD 4F36A 4HT5A 1S1TB 4P7VA 2GAHC 1HW8A 2OHDA 4UOGA 3D5MA 2MZTA 4B3OA 2FGCA 4O3QA 1C4CA 1NCLA 3S6EA 1NSAA 3ZTQA 1RT7B 1IM6A 4O4RA 4WP8A 2KHDA 2Q2KA 1J27A 4RBUA 4DR3J 3CCUS 1IBMJ 4S0MA 3DGPB 4X4SA 1XMOF 3RRHA 2PMHA 3O44A 5J2MB 3ZZPA 4IG3B 5ETLA 1PBUA 2CFXA 3LP0B 1QLNA 2RBFA 4NCGA 1SJ4P 1FVQA 1VQLS 4XPCA 3C6UB 5H9FK 1NDPA 3IS9B 3MTKA 4OZ3A 1RLDA 2MY7A 3W9IA 1RI7A 2E1AA 4KHPF 3I87A 3HSZA 3O2IA 1LW0A 4L3NA 2RB7A 1HD0A 3PW4A 5CYJA 4C9DA 4DV0J 2YPZA 4LBIA 2VHGA 3FRZA 3B4MA 1RYRA 1FNXH 1SV5B 1EB0A 2VBZA 3KHHA 2XY6A 5ETQA 3NGTA 3ZXWA 2YNGA 3MCSA 2JH3A 3DLEB 3A4TA 3GILA 3FK4A 1XJWB 4OX8A 4PG6A 2D3UA 1QSLA 1RWUA 5BR8F 3CJQA 3FFIB 4JI2F 4ED3A 1TKTA 3E01A 1X4AA 2V1TA 1T8EA 1OYDA 4M8LA 1RDRA 1Q16B 3PACA 1P94A 1NRKA 3M8PB 4HV0A 1PGZA 1GXLA 4X66J 3I5AA 5LSLA 3C6UA 1E6YB 5B08A 1L3KA 2GV1A 2HNYA 5LXRA 4YB1P 1S59A 3C19A 4NXMF 4JUZA 4RW4B 2VFVA 1LWCA 1YWXA 3MMCB 4WFZA 4LF9J 1WI6A 4HLBA 3A1YG 2VZ9A 3C46A 1NH8A 7FD1A 3ILJA 3LTOA 1CQNA 4XAKA 3R1LA 1I94F 2FLNA 2FJWA 2MJNA 3QIPA 2FUG9 3GMGA 3Q8UA 2RE1A 1K1QA 3C14B 2BUNA 4MKBA 3GG0A 4UW2A 2DITA 4CZCA 1HQUB 2FHKA 3T5KA 1MU2B 3TVZA 1YQHA 1RTDA 3FUYA 4FVMA 2AYEA 3FFIA 3CC4S 2CPJA 2K5JA 4Y34A 3PO4A 2HHUA 4A8XA 2CPEA 2VV5A 2JJ4D 2M8DB 2DNGA 3PO5A 1SB6A 1RWMB 1BDTA 4ZA1A 3TP2A 1D0EA 5CABA 2DT9A 3LOUA 4NOHA 1PC5A 3PCOB 4BCAA 4LFCF 4USWA 2MQLA 1FRJA 4TQSA 3LF0A 5IQQA 4RW4A 3OSNA 2A2BA 3PJ9A 1X4DA 2LDYA 4F4KA 2M5YA 3KDOA 3AJ2A 1DJ0A 4KB7A 1VRQC 3I55S 4J9SA 2EEYA 2GMJA 3L7OA 4OFZA 1REVB 4NXNJ 3IWLA 5J1EA 1JLBB 2AGOA 1TMJA 4F4ZA 4GVBB 2KZZA 4WKRA 4RUAA 2LEBA 2ACYA 4QIEA 2UP1A 3P49B 4I0WA 4N8OA 3BS9A 3PRBA 3NEKA 4JI0J 2V5HG 3HM9A 4JI6J 1Q0NA 3BM7A 1Z2LA 4R0EA 2G2OA 5A8WA 1QVFR 3MECA 1X5OA 1FKPA 4FBTA 3BR9A 4EUVA 1NB2A 1HHTP 3A12A 3M6VA 3PEHA 1YZ6A 3CCZA 5CA5A 3KLFB 2AJ4A 3LQVA 3ISND 3PYEA 2RDDA 2VQEJ 3VQSA 1RT6B 3MEGB 1WHXA 3PX0A 4ZCLA 1N0UA 3CUNA 1HD1A 5KFCA 2KTQA 1VRUA 3QRQA 2K1OA 5F9NA 2DO4A 3DOKB 1FEHA 4UOHA 4FN5A 2HMIB 2LQJA 2JLGA 4U8YA 4CLZA 2L9WA 2JEFA 2JXIA 1RISA 3LWMA 3JS9A 3CO9A 2BV3A 2V4RA 1U1LA 1SKSA 5AE2A 2C2OB 4ZJLA 3HDSA 1FDAA 1B01A 4K4ZA 2B51A 4Q0BA 3AHPA 3W8GA 1U4BA 1DFDA 4WFBQ 3JQMA 3M2UB 4GVBA 2W9AA 1QE1A 5IFMA 1F2HA 1SQEA 4NX9A 3SQOP 1UAWA 4X4NA 4F3OA 4P7TA 2Y1JA 3L09A 4ZVGA 1URNA 3H2LA 3AOCA 3SQGB 3UVJA 4ID5A 3HLUA 2G4BA 4OZ1A 4TXSA 5IV3A 2DR9A 5FLXY 3BQ2A 1Q8KA 1TKZA 1N4LA 1IKXB 1TL4A 2BR0A 5HROA 3MAHA 2PA3A 2CQIA 4I67A 5HN0A 4OYBA 1N34J 2IC3A 1MROB 1MYKA 3ETMA 2C3PA 1B0VA 2WRMA 3KYLA 2CA9A 1ICEB 2G0CA 2M88A 1SBRA 1X4HA 2KVQE 4R5PB 3V6DB 2U1AA 4Y2MA 3CCTA 4Z37A 3B82A 2MLYA 4MJWA 4EYIB 3GIMA 3CJ8A 3CEDA 5D4NA 2GFFA 2AZ3A 3G6ES 2DH9A 1CVJA 1G2EA 1KONA 1IBCB 1I51B 5HLFB 1X9MA 1IQZA 4LT6A 4DR6F 4WJBA 4BWMA 4C8NA 1RTIA 3UDVA 3KHLA 2P2CB 5KFSA 2J9EA 2C2MB 4DUYJ 1S1WA 3GV7B 3KK1B 1UETA 2YH0A 1QY7A 3KLGA 5DLFA 4H4OA 4JI5F 3V81B 3R2CJ 1VQ7S 4C4WA 1GMWD 1YJ9S 1T3NA 5CD4H 4FS2A 1VLYA 2Z2MA 1UW4A 4EFAC 2VODA 5JVHQ 2I8EA 5C7PA 1KLMA 4MK9A 2MQPA 1FWPA 2DNZA 4AE5A 1F9HA 2C42A 2EWHA 4U8VA 5C5JA 3NL0A 1KKHA 1M0SA 5HJYA 3T1YJ 1PC4A 4DL4A 4P2XA 3DYAB 3IWNC 2YKAA 3R5DA 2BACA 8RUCA 1X9SA 3G6YA 3H40A 3T6BA 4DQQA 4LSNA 3P96A 2VQFF 3FVYA 5KFTA 4X4RA 3TJAA 4ZIWA 1WC0A 2F40A 2QE5A 1WKKA 3VAGA 1L3UA 3GFYA 2P9GA 4DZDA 3KLEB 4QYZK 3CXCR 2E66A 4PXCA 5DGAA 3P3DA 5ETSA 2I1RA 3VGTA 3R5GA 2ZBCA 2VBWA 3M2RB 5HL7Q 4OJGA 4MJKA 3KNAA 5CCMA 3CDUA 5D6GA 3ZZZA 4J9MA 2R9LA 4X4QA 4X4OA 4PXBA 2JWNA 3V81A 5A8RB 3QMQA 4X84A 4F0MA 4Y2KA 2DISA 3KJFB 1XMQJ 1WDDA 3R1HA 3DDNA 3RUBL 1D09B 4F02A 3HK2A 5CYQB 4J90A 1HYSB 4TN2A 4DPXA 3BQ0A 2OO4A 1U09A 2Z56B 8AT1B 5KG6A 4DR4F 4M94A 2CZVC 4DSLA 1NKBA 5KT3A 1S7HA 3M9OB 4KGVB 3ZZYA 1BHNA 2ZH6A 3UCZP 2FHMA 2E1RA 3MPDA 1S79A 3H20A 1FXRA 4WFNQ 4A8WA 5F3ZA 1CJUA 2MEWA 4ETXA 1GT8A 2ZH5A 3GXQA 1AFJA 3S7RA 1KLNA 3ZZOA 4LSZB 3T19A 1CS4A 3QLHB 3BGLA 4C7QA 4LRCA 4I7FB 2AYGA 1OWXA 4YQWA 1VBKA 1MNEA 1RT5A 4EK2A 1NDCA 1NMEB 2E5HA 2HZAA 4ZPDA 1DTTB 2G0JA 1N32J 3GG1A 3BO4A 4G6VB 2F8MA 2HHQA 2HNZB 3KTQA 3M2RA 3G4SS 2EFOA 3VAJA 5DDOC 2I5JB 2B4VA 3W8PA 2XWXA 4WZQA 1R3NA 3KLVA 4IRDA 4BC7A 1T7PA 1B7YB 3HMJG 5K8NA 4AL5A 2YWFA 4OHZA 4QW8A 3U02A 2HFOA 3MD3A 4DR3F 4DCPB 2XNRA 1G6BA 2L9DA 2V8DA 1WORA 4NLYA 3S01A 5AXNA 5L39A 1VRTB 2D1CA 2QFJA 1HI8A 4JV5J 3Q8PB 3QZ8A 4JI7F 3VAMA 3E2EA 2G2YA 4DR7F 3Q8YA 2W9CB 2V67A 4CLWA 5E2QA 1HNZF 3Q83A 3OFHA 3CD5A 5DG8A 2I2YA 4K0KF 3CO0P 4CTAA 1SL0A 4FS1A 2RAQA 2PD1A 2HQFA 3AWRA 4IKAA 4C11A 4PWUA 1WG5A 2QT7A 3KG1A 3NLCA 2ZWOA 1DTTA 4KKOA 2UXDF 2XTDA 1GMWA 2BJ7A 1HWKA 2HHXA 2WVEA 3DLKB 3SZ2A 4IOCQ 3PW0A 1CJVB 4A8OA 3GJTB 4ED2A 4Y28C 3QGGA 1B3TA 3DRXA 4OZ2A 2OUGA 1RJJA 1IUJA 3HFKA 4WXOA 1LK7A 4WWSA 3W5ZA 3FGVA 4G1PA 3HSJA 3CD6S 3ENWA 1JLEB 3JQJA 4LQ3A 3UFCX 2JDJA 2XS5A 3V6HA 2MZSA 3DGVA 2XYGB 4DR1F 2J7WA 1N5TA 1EQ0A 2FZKB 4CI0B 2VG6B 3QT5A 3FKBA 3H0PA 1UZDA 1KC8T 2XS7A 3M4XA 2HFNA 4H4KC 2VF3A 4LRVA 3OR1B 4U67Q 1CG2A 5DQGA 3UR0A 4RWWA 1WEYA 1N33J 2ZWPA 3NNCA 4DSEA 3OL8A 4J91A 4PXDA 3DRPB 3QFHA 1YJVA 3W66A 5I42A 2UUCF 1AT1B 3BGRB 5J1NA 3VW4A 4NCAA 4A8MP 1VIOA 2RF2B 4DFKA 4QWDA 1FE0A 1GX5A 1HBNA 3QIDA 3OL7A 3IRXA 3QFWA 3TUZC 1BC6A 3KLHA 2XBPA 3NMAA 1Q8LA 2IA0A 2A10A 3QATA 2D3OR 2ZHOA 2R2TA 1MN7A 5G0RA 4HACB 3PFOA 3NKYA 1NSKL 2FHJD 1AXQA 4NEYA 2DGTA 2XQCA 1J5EJ 2JEIA 2KT5A 2HSEB 4ZLPA 5DLGA 4CLPA 1S0MA 5HANA 5ETOA 5LJ5Y 1RAIB 2XSJB 2IY5B 2F4VJ 2KXNB 2K6LA 2CWKA 2OI2A 2ZNZA 5ETTA 1VQ9S 2OELA 3CJKA 4OX9F 3D6HB 1AUDA 4P75A 1S9EA 5KFHA 4C97A 1C1BB 4LR7A 4MAKA 3DLHA 4WFAQ 2RRAA 3PG9A 2FVSA 2HGNA 3IG1B 4RUCA 3UPFA 3G86A 1NLAA 4Y00A 3W64A 3FQKA 2DGUA 2MMYA 2HQCA 3BGRA 2X3DA 2OPPB 2WB4A 4DPOA 3LGHA 4LF6F 2EKNA 3AA8A 2BQRA 2WONA 5D0RA 3EE3A 2FGOA 4IFVB 2QZ8A 4HDHA 4NA1A 4LIRA 2ALYB 3SDEB 3I5CA 4HACA 1AYEA 1A9NB 4E98A 2ZH7A 2PEHA 2V8PA 1FNMA 2VG5A 2UVVA 2KJVA 4F4WA 5JJBA 4OMFG 3M6XA 2Q66A 3R6GB 2BBEA 2GHVC 3GYNA 4RLEA 5K5MA 3ZZUA 3OPKA 3GR1A 5CD4A 1N56A 2W8LA 4DCOB 3RBXA 2JBVA 4KSEB 1C1BA 4YDXA 5B0CA 2VB6A 3BO3A 2FVCA 3G82A 5H9FJ 3TNVA 4NLPA 2MQ8A 3GSIA 4WP3A 1PSDA 4OV1A 3F73A 3GPAA 2DNNA 4ZP6A 1HLWA 3OFFA 5RUBA 4GMKA 3MF5A 4ZMMA 5I3UB 4PXEA 5HO4A 2EPIA 4MIWA 2V9WA 3KUGA 3RU0A 1PJ6A 4FKYA 3R97A 4IFVA 4F3MA 1U48A 5EWGA 3H5SA 3LW5C 1UJ4A 1FRIA 1RTJB 3J7Z5 2CIMA 1U2FA 1PO6A 3DM2A 1X5TA 5FDLB 2AWZA 3PZPA 4X62J 3WC0A 4KE5A 2EBGA 3OTDA 4QWCA 2ZH3A 1S49A 2GJFA 2X1AA 4B9TA 4EI2A 1HL6A 1ZM2A 4OYPA 3FSYA 2VG7A 3KK2B 4ICLB 4DSKA 5D3GA 3MCMA 2A2CA 2JZ5A 4R25A 2Z8QA 4NWBA 1EQMA 4Z7YA 3CIZA 2MKCA 2Z58B 3OFGA 4ZVHA 1JLQB 1WSRA 1M5PC 1S12A 1NKEA 2DR8A 4IYQA 2WSCC 4DV7J 2AYMA 3CC7S 3SIPB 5EWFA 3GJQB 3MR7A 4RW8B 1XR7A 3QBCA 4JV0A 4ZITA 2XI3A 3FBFA 2P6SA 4EYHB 2BW2A 3PM9A 2POKA 3C15B 3L9ZA 2PFDA 3CJ4A 3TEGA 2ZUGA 6FD1A 1VC0A 3C16A 1IBLJ 2X7IA 4DPTA 5KG7A 4LR8A 2C3YA 1QUPA 2DNYA 3KJVB 1H72C 3AH6A 5FDLA 1EKSA 4RU2A 1JLFA 2PSZA 1T0TV 1SPBP 3EVOA 4G65A 3PX6A 4ICLA 5E3QA 2CQ0A 2GGPB 2XYPB 2NLWA 3BEGB 5KFMA 3D1OA 2OIHA 2DGSA 1NB7A 3N6NA 3CJ2A 3EZUA 5IZHA 2EC2A 1PG5B 3E3XA 2M2BA 4RJVA 5ETKA 4ZP9A 4RW9B 2F8EX 2DYAA 3GYXB 3GV8B 2KYXA 3RG6A 2PGCA 4LF5F 1IR1A 2XHCA 2JSXA 1RWWB 5EN1A 3IGVA 4ILRA 1N52B 2QA4S 3MPWA 2IAJB 3Q24A 4U7UD 4YY3J 3RRGA 3MCNA 7AT1B 3VCDA 2HVZA 3HULA 3MMAB 3NBPB 4WTYA 4AQYF 3GU0A 2KFYA 3ICLA 4J9VA 5L1IA 2JEJA 2B7BB 3BR8A 4LVNP 1S48A 2YQ3A 4HTJA 1C2PA 2VH7A 1UWBB 4Y65A 3RJMB 5F0UA 2CJAA 3V4IA 3OTCA 1Q7LB 2YNHA 4N77A 3BPSP 3KKFA 3GCWP 1TV6A 1KEKA 5JUMA 2CPFA 3NOGA 1TUGB 1JNZB 2BYCA 4IH7A 4FBUA 2HK3A 3Q23A 4Z7CA 2WW8A 4MKYA 1Y0HA 3N5FA 4TLQA 1KHWA 2GGPA 2ZFHA 4PCQA 4U7CA 2CJBA 2E5LJ 1U26A 1C0TA 1T9YA 2HWTA 2VA2A 3ILIA 4DUZF 1RXOB 3GE9A 1DURA 5GADU 4I68A 4L72B 5HATA 4DV5F 1VLOA 2HQDA 1C4AA 2V8VA 4F0HA 1P27B 3NS7B 4X2BA 1PILA 4OZNA 3RYLA 1Q1KA 2ZH2A 3MEEB 2ZH1A 1IJFB 4M5DB 1GTHA 1HNXJ 1FTRA 2HFVA 1J5OA 4CP5A 2R7OA 1N54B 2YVSA 3MM8A 2DH7A 4WXWA 3TYTA 3Q0AA 2OFHX 5KFIA 2VDIA 1P1TA 3MM7A 1R43A 4Y2CA 1UFKA 2B43A 2LEAA 1U8SA 4ZCKA 2D9PA 1T9UA 2J6TA 1TL3A 2XEXA 5C2CA 2AV5A 2APOA 2DD8S 2XTJP 1NK4A 4NI2A 1UJ6A 3EVWA 3CMES 3PJXA 1Y4ZB 2A0FB 3AQPA 2IDEA 4J9RA 3UI3A 4IQXA 2V4QA 5IT9Y 1HQ2A 2CPYA 3EX7B 4PQAA 1Y5LB 4NA3A 2BNZA 5L1KA 4FYDA 4YB7A 2GMLA 4M5JA 3MZIA 2ABYA 1UEKA 4MYTA 5LSRA 3X3UA 2C3UA 3OLAA 4ECUA 4QZVB 4ECTA 1IKVB 2QSWA 4I2PB 4NYZA 1Q5YA 3J81j 3P45B 4ZLNA 3DNCA 1BE4A 3LANA 1Q5VA 1R8BA 3ITHA 4JI8F 3EWGA 2YNFA 1RZMA 4U9RA 3H4DA 3NXZA 1K0VA 2QIFA 3K8WA 1NJIT 3NAIA 2DR7A 4M5LA 1U0HB 2YQ0A 4O4GA 3NS5A 1FESA 3MUVP 5M2UA 2IFXA 2VDHA 4F4AA 4URGA 1O6XA 3MTJA 1FRHA 5HQMA 2WVCA 1XC9A 1NAQA 5L38A 3LP2B 3H5XA 3I96A 2AJ0A 3FMWA 3FC9A 4P73A 2HS4A 1HWLA 3TA0A 7FDRA 1I3OB 1Z1ZA 3CJ3A 4WU2A 4ANCA 3QZ7A 3SFUA 1RWNB 1G3OA 4ES2A 2IBOA 4DQRA 2VBYA 2UUBF 2KU7A 1RAEB 1R0AB 5ETRA 4O44B 3P6YC 3D54A 1RT4B 2LA4A 5KFKA 5B0AA 1GK8A 4YB5A 1N5QA 1KVJA 3M2VA 2BJEA 2BKPA 1HI1A 4L76A 3TJ8A 5A8KB 4KY3A 3CMQA 3R5JB 2IYGA 2GVZA 2GS8A 2BA3A 4ZPVR 2C28A 1U6ZA 1MWYA 3PW7A 3U7JA 3DOLB 2FC8A 4ZVQB 1S1UB 2RQ4A 4QYZJ 5CYMA 1ZA2B 4F2SA 4IFYA 3LPEA 4PR6A 4DL5A 4QQBA 4DG1B 2IJFA 4C3MA 4X65F 4C8ZA 4QIVA 4HT7A 1WTBA 1Y11A 2ILYA 1S1VA 2BE9B 4CLFA 1RKJA 4U7UK 1NU4A 1DTQA 1WC3A 2AJ1A 1YLXA 2UU9J 3M05A 5E3RA 2HBZB 3RBZA 4LF4J 3D6MB 5HVHA 3MM6B 3NG8A 3ZZTA 3LP2A 4FXDA 3Q89A 5KFBA 4K5RA 3H42A 2D41A 3G6XA 3BSNA 1O51A 1DY3A 1HR0F 3GFZA 2XC9A 1Z2ZA 3OJSA 3UN5A 2QYCA 1G4CA 4MT1A 1RT1A 1EETA 1R0AA 4KAIA 4KGXB 1T9WA 4YR0A 4OQJA 3OFEA 2M0GB 4JB8B 5IM0B 2M4MA 2VPYB 2G1DA 1RCXB 5T7LA 2LDIA 1GQEA 3PJWA 4UZBA 1WG4A 3V4MA 1SIWA 3ENAA 4Q5VA 2HVIA 1OSDA 3DOLA 2CPIA 2IVFB 2HG4A 1S1UA 4CM0A 1VQYA 4M5GA 2PO4A 2FDNA 2PMWA 2RRBA 1HBOB 3M8QA 3I0RB 3G71S 1YJ7A 1WDTA 3HSGA 5J2QA 1N5YB 1FX4A 1S7IA 4B9NA 1NDLA 2RHQB 2UXCJ 3GCXP 3EVMA 1M1HA 3CW2C 4GO7X 5C25A 2EFVA 3DKDA 1WKJA 4NLVA 4LREA 4NZ6A 3VEBA 4PKDB 2LA6A 1HMVB 5J1PA 2B9XA 2WBRA 2H4WB 2UVRA 2V94A 4AYBD 5HVGA 1VHFA 4ZVEA 4LSLB 1R31A 4FF2A 3VGSA 2XTEA 4QIWD 1ZA1B 2XY7A 5T14A 3IP0A 3MHYA 3BKUA 2CUYA 1SC4B 1SH3A 1X4EA 2OTJS 4A8KA 1UPMB 2VJUA 4NCBA 2JOQA 2DO0A 5IM0A 4K7QA 3R5BA 2AP6A 2FQQB 4KTQA 1QUVA 4AXJA 4PG5A 4C8YA 5KTQA 3FSIA 4OHWA 1EA4A 1WHYA 2QL5B 2VPWB 3H90A 5DG7A 3FJ2A 3W9HA 2QLFB 2DHSA 1MLAA 1BQNA 3SV4A 2ZUAA 4YEAA 3T5JA 3BB5A 2VC0A 1ZZFA 2HURA 2AQ4A 3RGIA 5CXTA 4K59A 2W9BB 1RT3A 1E6VA 1K9MT 3MGJA 3GSDA 1KVIA 1WACA 1CULB 2K7KA 3ZZ0A 4DR5F 1Q53A 4PQUB 5DDPC 2ZKUA 4DL0C 2HPUA 3RRKA 2KM8B 2R7SA 4PYAA 3KUEA 3G8QA 3A8EA 5EX3A 2FJEB 2DNLA 4TNOA 1AW0A 4LSLA 1FDNA 3C2PA 3O3LA 1U1KA 4B9MA 3GTYX 1Q95G 1Y3KA 4PG8A 3OR2B 4ANDA 3PDNA 2HRUA 4ILMA 2RU9A 2EFNA 4YFUA 1VJWA 2HHHJ 2MY8A 1XNRF 3DI6B 2JEGA 1KWMA 1ZM4A 2FB0A 3T1HJ 1JNRB 2RUSA 3G96A 2QGFB 4O3SA 3OD2A 4L73A 4FVCA 2HFSA 1YGYA 3Q2SC 1EZZB 2QSFA 2RUGA 4PWDB 1V5IB 3MWBA 1RHRB 2BJ9A 4IQMA 3QGIA 4XO0A 5D4OA 4OI4A 6AT1B 4LRDA 1OPZA 2K3KA 5LMUJ 3TX8A 1LK5A 2ZOMA 2DCUB 3HVTB 2NYIA 2EFPA 4L6V3 2EW9A 2MGZB 2MKKA 3UO0A 3Q8VA 4USTA 3J80U 4G3IA 2A6MA 2AEJA 2QC3A 3UDCA 4PQUA 3NCQA 4MK8A 2HZVA 2B6AA 4AL6A 5C24B 1NBEB 3DRRA 2E44A 1IR2A 3W2WB 2IVYA 2CQBA 4ANEA 1F9FA 4LF8F 5FLXU 4QIGA 1M90T 2GO9A 3B78A 3CCES 1YRUA 5HQLA 5GAGU 4QW9A 2HGMA 2J5AA 2NUUG 2B9EA 3HF5A 1NM2A 1UCNA 2MKHA 3ETOA 3AD7C 4BHQA 2GNKA 5K8OA 5DDQC 5H1SV 3JSBA 1M5VC 4DS4A 4DBQA 1YBTA 2CVEA 3BYRA 1EX8A 3OUYA 2FY8A 3I56S 3HHLD 2PDAA 4BS2A 3MR5A 3O5TB 1UVLA 3MR6A 4G1QA 2D7SA 1T03B 5H9EK 3DLBA 2YKNB 4QWBA 4ID8A 3KMSA 1IXKA 4AD6A 5AJ3J 3S1TA 1LXNA 2BOAA 2HEKA 1MSWD 1CC8A 1JB0C 1O8BA 1HARA 3N5BA 4ERDA 2NR0A 4D3HA 4WFYA 3G9CA 2BDPA 1R27B 2H51B 4RO0A 5L9XA 3MAAB 1KP6A 1T3OA 1KOOA 2HS0A 4TLRA 3F44A 3OHAA 1NZAA 3QPIA 1NHUA 5I3PA 3HD2A 2ZOFA 2WB1D 3MM9B 4DI6A 1BQMB 4DV1F 3SSSA 3BGUA 2PMZD 3OTOF 2O5DA 4RW7B 1EARA 1TFWA 2H65B 1V9OA 2IM0A 3H59A 4OLPA 3V6JA 5F8JA 3R27A 1VCTA 3UNGC 2Y8YA 2X1BA 1BWEA 4KC5A 1MWQA 2R7VA 1OQ3A 4EZ6A 4NRUA 2W2PP 4IRKA 2WOMA 1JWWA 3CCMS 2V34A 2K9IA 3GLJA 4DS5A 1DRZA 2W2OP 3Q8RB 3N4WA 4CYUA 4B3TJ 4DSJA 2NPIA 3IWXA 4BC9A 2I0XA 1FKOB 3SCKE 4ES1A 1T03A 3AT1B 3FMBA 1P8GA 2Q3PA 3AXKA 1NO8A 4IRCA 2CG4A 4MK7A 4FYVB 4OV6A 3IAS9 4DV3F 4LFAF 2I9SA 1RBOB 3G8TA 3MAAA 1UVMA 3LO3A 1D9AA 2FZGB 5B0BA 4Q2MA 2NXUA 2V8GA 1J2VA 4C3KA 1UPPA 1Y00A 2JC0A 3AB2B 1VQ6S 4B17A 4MFBB 3ISZA 2V0NA 4DF4A 1FJGF 1UMJA 1RAHB 2K1RB 1MMNA 3MEKA 2B4OA 2NZ4A 2UXBF 4C3LA 3KJNB 2E5GA 4KIAA 2AW0A 3BPDA 3NWRA 5LMNF 9RUBA 1Y3JA 5ETMA 2IHR1 1U9PA 1TVRB 1HI0P 1ZAXA 2Z2LA 3D3CJ 2HHSA 4P52A 3TR5A 3EYZA 2B8QA 1MYLA 4C2MA 2KZMA 2FVRA 5L9NA 2KRRA 1U0SA 1RUSA 5MLCV 4RW6A 2D74B 1KVKA 1V3ZA 4ED7A 3X1LB 3GONA 1TKDA 1HHSA 5A6WA 2BEFA 3AJDA 3TI0A 3QJJA 4PRFA 4JI4F 2QO3A 3W65A 3RR8A 1CJKB 3TZXA 2Z2ZA 1NXIA 3CDBA 1CEZA 5E3CA 1EP4A 4AAIA 2HNDA 1RAFB 3H2UB 3TUJC 1PBAA 5E3AA 2YWGA 5HBMB 2H1YA 1DHMA 3LP1B 4ZPTR 2V4JB 1Q82T 3IBCB 2PN6A 3HHLA 2HVDA 2XS2A 4ZVUB 3MDFA 1C0UA 1LW2B 2E1PA 2D69A 2UUAJ 2H4YB 4XIUA 3FEXB 3H8YA 2OP5A 2Q43A 4TU9A 1JX4A 2C2RA 4ECZA 5HP1B 3EPIA 1TVRA 2YKMB 3JSMA 1FK9B 4ZOSA 3J81U 4K4SA 1TKXB 2IM1A 1YIJS 3HHNB 5KOWA 1NH7A 2J0QD 4WCEQ 1AUSL 2GQ2A 2Y1LB 5HSPA 1MNTA 4OI3A 2FJDB 1WUUA 2ADCA 2CPHA 2UZAA 1ARQA 5D0EA 1R0BG 4DLGA 3PHTA 2XSFA 1PCAA 2DCLA 1GEHA 1M5SA 1VFJA 2Q1LA 2XYHB 3J7YU 1U2RA 3K8VA 3RBDA 3LUYA 1WNEA 4USMA 4YHHF 1C1CA 1F2GA 3I0SB 5HMZA 1FDBA 4ED6A 4MIBA 1RA6A 1U1QA 1H2UX 5CQGA 2G13A 3FRYA 1L3VA 1TL7A 5J2PA 4XTTA 1GTEA 2C2ZB 4A8QA 4B3OB 1BDVA 5D78A 5A76A 1S6QA 3CULA 1Y9OA 2QMWA 5B0GA 1S4EA 3EMTA 4CH1A 3BGOP 4QPTA 3A3NB 3CJ0A 3HHDA 1RAGB 4UZCA 2YX7A 3L3CA 5HP1A 1HNIA 4WTOB 3IM8A 1H73A 4OHXA 5C42A 3I4PA 1R8AA 5KFXA 3IO1A 2DGQA 2OGUA 1F9EB 4HYKA 2AEFA 2KN4A 4NCGB 3BJYA 2IRXA 4ZCIA 2NREA 2LFVA 1TL5A 2GIFA 3BKFA 1KQGB 4GKKJ 1B99A 3A3OB 3HKWA 3D3BJ 3CMAS 4ZJOA 3HCXA 1S6UA 4TY9A 1FJEB 1MMDA 3MAQA 1U1RA 1LW0B 2YX4A 3MR3A 3DLGA 1UVNA 2DH8A 4DZ6A 3DFEA 1IWGA 4B3SF 1FFSB 4ZLLA 3TARA 1WC1A 2DNOA 2EXUA 4L75A 4NA2A 2XNQA 3NO7A 3TO8A 3LGMA 2CPZA 1S6OA 2YNGB 3UW1A 4DV4J 2HLTA 3FDSA 2IPOB 3TVKA 2ZJRQ 4DN0A 2HAIA 5EGYA 4Y2IA 1MN9A 4ZK7M 1X60A 1SIZA 4RPFA 4TY8A 2GCFA 3OT9A 3VVTA 1TKTB 3E01B 4UF4A 2KM8C 2XY5A 4D8JA 1RHQB 4RX6A 1QD1A 2B4PA 2ZBPA 5F8GA 4C48A 1BXNA 3CCVS 2CQCA 3BN7A 1ZAWA 3HT3A 1NK6A 1Q86T 2HNYB 4RBVA 1VK3A 3GIKA 3EDRB 5KFUA 1ZS6A 1LWCB 4DR2F 2E9TA 2B9WA 3M7VA 2K7JA 2FZCB 4MKVA 4Q43A 3W5YA 5IWAJ 3L4BC 3QT7A 4ZHRA 2V2VA 4KGZB 2OMLA 4X4PA 2RIJA 4YN3B 3QIPB 1FD8A 2H48B 2LQBA 3OSPA 2JXGA 1Y7PA 5F8IA 4NLGA 2ZZNA 2V2KA 1SC6A 4CH7A 1S6PB 4NLQA 3PY8A 4LF7F 5U47A 2OH2A 1R7IA 3POTA 4XK8C 2GJIA 1RTDB 4LRFA 3IC1A 3FBBA 1LOUA 3THPA 3DU6A 2HQGA 2HRYA 3SSQA 3BKTA 1ZTTA 3D0IE 3D1HA 1F5AA 4U96A 4CO5A 3W3SA 1VJQA 1N48A 4R8UB 5K8PA 2XHWA 3TA1A 1S9GA 1WOOA 1FXLA 1S9FA 3PEJA 2QL7B 2BM1A 2R7TA 5DZ6A 1ZZNA 2ZE2A 3R5CA 3BSOA 1PIEA 4IR1A 4NL5A 1U6BA 2BABA 4M5HA 4CQ1A 1HW9A 2GA7A 4WP9A 1RE1B 4YDDB 4PZVA 4K4XA 1R89A 1XNQJ 1QSSA 4J9LA 1QAIA 3CE8A 1BY9A 3MFIA 4DJBA 2VJVA 5J1EB 2H9ZA 1KRPA 4F26A 2CQ1A 2R3VA 2DHXA 3JB9k 1SI9A 3BF4A 1TAQA 1H0HB 1F3VA 2CAXA 1QAXA 1S6PA 3AA9A 5K14A 4I56A 3W1YC 1RWPB 3J7ZT 1S77D 4H4MB 4AT1B 3I5BA 1ROFA 4ZVTB 4IH5A 3BN4A 3M30A 4O3NA 5A8WB 3MECB 1FKPB 4FXVA 1A6LA 3NGKA 3A8KA 3OTEA 4R8UA 1M5OC 4Q8FA 2FD2A 1Z4UA 1N6QA 4MMOA 2N7CA 1BD6A 1VRUB 5DETA 1UVIA 5D0GA 2JLFA 5DZ7A 1N5VA 1APSA 2B5JA 4DX7A 3O6QA 4KGMA 4LQ9A 4K2JA 3CCLS 1KNZA 2VD3A 2LQ5A 4B3MF 4ZS6A 3ZTOA 2CADA 2KRBA 2EG2A 4ZCMA 2AJFE 2E29A 2QFIA 3I6PA 1GH8A 5B09A 5AE1A 2EG1A 1XMOJ 3TZWA 4Q0BB 1DBDA 3W9JA 5A2QU 4NLWA 1OHNA 4PEOA 3W5XA 3OV7A 4NASA 2AX0A 1QE1B 3R9LA 5KG1A 2DNKA 4WBFA 5DG9A 4KPCA 4W98A 1WJ9A 1N88A 4ELVA 1MWZA 4QR2A 1RHJB 4H4MA 4HVZA 3IAM9 3BGFA 3UVJB 4ID5B 2YPYA 1YJWS 4KHPJ 1JJHA 5FIIA 2YWKA 4P2SA 1TKZB 1X0FA 3FZBA 1RBAA 4DV6F 1HQEA 5HMYA 2I6WA 2OTLS 3GQCA 5B0FA 2RQKA 5HROB 2XLKA 1RYSA 5DDRC 1F5CA 4TVAB 1NJYA 3BBFA 3DMJA 1PYOB 3W62A 2IC3B 3DRYA 1LXJA 4UQTA 5DJBA 3QGHA 4I6YA 1U8WA 2CQ4A 5BYSA 5BR8J 3RB6A 2WK4A 2DNHA 1RHMB 4JI2J 2HIQA 2UUTA 2F65A 2ZOGA 1XMBA 1SQFA 2KT2A 1S99A 5I4MA 2AX1A 3TAMA 1SH2A 2EC0A 1IKYA 1SUQA 2KO1A 3T3FA 1S0VA 5DS7A 4CLLA 1HBMA 2QA4G 4WPAA 1ZETA 4NXMJ 1RTIB 3CD0A 5D77A 5ETVA 1S1WB 2ROEA 1DQAA 2E9RX 2O3DA 1M1GA 3CIMA 3KLGB 4H4OB 3CDEA 3M8ZA 2RRNA 3P5BP 1WHVA 3AD8C 4ELTA 3K17A 1ZM3A 2BRLA 4PG7A 2XB2D 4B9VA 2QMUB 1I94J 3IBFB 3QT6A 2PFFB 2RDIA 4N41A 1KLMB 2CDQA 1P9QC 3U1NA 3CJ5A 4ZVPB 1RCOB 1U47A 2N3OA 2DEJA 3U27A 4EEYA 3WX8A 3WDOA 1Y10A 1S76D 2OPRA 4ECVA 4OZ0A 2BX6A 2QA2A 1IR0A 1PAEX 2WAQD 4JI3F 5BYRA 3ONQA 3D9BA 4LSNB 3QJLA 4F4XA 4JI1F 2ZM6F 3QO9A 4URSA 3D6FB 4OI2A 3D67A 4EGLA 1OG7A 2RILA 4O0IA 1IRQA 2M8HA 3W2VA 1VK8A 2C2EA 2BE2B 2W7AA 4QU6A 4JV1A 2V2QA 2BOPA 2DRDA 2OSQA 3OXGA 3GIRA 2XMUA 2CG8A 4TU8A 4K4VA 2RH3A 4LFCJ 3DOMA 3SMZA 2WVDA 1Q8BA 3T9NA 4M95A 4B3RF 2R8GA 2FLOA 2R7QA 3T9ZA 2BQ3A 2MDAA 1B70B 2YWWA 5L1LA 4ES3A 6FDRA 4I2QA 1NK7A 2AY0A 1S1XB 1OMSA 4WE1A 2PIIA 4CCHA 1QDUB 1ARRA 1UZHA 2N3LA 1JJCB 5IT9U 3ILLA 2BKNA 4QR0A 4Z2XA 2I38A 5KG2A 1U02A 1HNWF 1QAYA 2AYBA 2R2SA 3M9NB 1X93A 1DQ8A 1CJUB 4J9OA 4ZN3A 2BJDA 2KYZA 2FC9A 4XPEA 5LL6d 1CS4B 2BE2A 2NS1B 3N01A 3D66A 2MZ1A 2ADLA 1RT5B 2ZH9A 1FO1A 3ZNUA 4DF8A 1JJ4A 1KQFB 2LVWA 4LF2A 3CJRA 1XERA 4LRAA 3W61A 1NPRA 4OIXA 2R2UA 3ZTSA 3A13A 4CT8A 3KWMA 5F3TA 3LGNA 2O67A 4OI1A 3BDPA 1FF2A 4ZP8A 1Q79A 1RP5A 3M1VA 1S1XA 1R0CB 3O8WA 1RKIA 2A18A 3TZZA 4JYAF 5GAEI 3OW2R 4WU3A 2KI2A 4PABA 1CJTA 1NSQA 2JL9A 1DLOA 4GKJF 1F1BB 3SYZA 4C0OC 2EI5A 4IR9A 4GO5X 3G2XA 3ET6B 2J76E 1JK9B 4HL9A 1ZBTA 1HHQA 1LNQA 3N6LA 3TANA 2HKEA 5GAEU 4V19X 4CTAB 4XDCA 4IG0B 2KKEA 4ALZA 4C11B 4O0NA 1BAZA 1QJHA 4KKOB 3L95X 3J7AN 4K5SA 2OEJA 1H2TZ 1RT2B 4GVLA 3Q22A 3R6LB 3IR7A 2GX8A 4DN9A 5KFZA 1VQKS 3NNEA 1JXEA 2BZ2A 2XZTB 1UTAA 2NPFA 3PFEA 4PWWA 3MPYA 4OYZA 2AEMA 2DTJA 1IBMF 2U2FA 3T41A 3KK3A 2BANA 4RBTA 1GXTA 3G5OA 1U1OA 4DR6J 4MIAA 3ET6A 3SSRA 3ILOA 3EZ5A 1JQGA 3DRSB 2ZVSA 4F0KA 1VBYA 2O01C 3TOQA 3CB4A 1PYSB 4JI5J 1UA1A 2BNWA 3TZYA 3SCLE 4ATNA 1B4SA 2WTFA 3NGSA 4C8LA 2CKWA 4IG0A 4KRWA 4NMXA 1RHUB 2H3EB 5I42B 2VC1A 2RQCA 2L3MA 3JYTA 3FBCA 1RU1A 2J0XA 2GHWA 5DRKA 4DV0F 4CWBA 1RT2A 3UN2A 3MEDB 2FLLA 2P8IA 1JLAA 3KXDA 1H3DA 1HBNB 4CIOA 3IRXB 2QV6A 3KLHB 4NRTA 4ZVRB 2VQFJ 4O23A 5G0RB 1RWKB 2MLXA 4DPWA 1HPZA 3SBMA 3PXGa 3DLJA 2J9DA 4M5NA 1VYAA 2N7YA 1BWVA 4UT4A 1TTHB 3DXSX 1OY6A 4ZPCA 2XZ2A 4DU7A 3TAQA 1FT8A 4KV8A 2ZNYA 1G1XA 1CSJA 2BW7A 3IA0A 2UUWA 4X66F 1VQPS 2LP4A 1JKHA 1B64A 4X4VA 3DRSA 1CQMA 3CJKB 4JBCA 5KAKA 3SCIE 1S9EB 4F50A 4EU0A 1NKCA 3F0NA 2GMHA 3FSXA 2VPZB 4OYWA 1W26A 1RA7A 5KFWA 3RW6A 3AODA 3KHRA 3FQLA 5I3QA 4LF9F 2BM0A 3BSCA 2QN6B 1VBXA 1WF1A 4LFBJ 4FF1A 3IM9A 4DR4J 1RTZA 1XNQF 5A0YB 2QEXS 1KBRA 2CYYA 2K8GA 2DNMA 3WX4A 3MEDA 4PG4A 1LWFA 5LXYA 3Q86A 4DSFA 1DARA 2WONB 4KGKA 3G8SA 2MKIA 2JX2A 3AX2A 3HVAA 3US5A 1AFIA 4KO0A 2B56A 4AFFA 1XR6A 1RTHA 2KELA 2FJXA 2RKIA 3CDWA 1ZTWA 1K47A 5KFVA 2VG5B 1RWVB 2CNNB 4QIFA 1X5PA 2W25A 4NZ0A 4UY85 2MPUA 1KDNA 3I9V9 2F63A 5HQ8A 3CJTA 1S72S 3UN3A 5GVQA 1FFWB 1SKRA 1FRLA 3JTPA 1UWAA 2DVIA 5KT7A 4K4TA 1H38A 3CVKA 2QLXA 5KFFA 3BH6B 1SC1B 3ULHA 3NGRA 3G82B 4IH6A 2XLIA 5L46A 2OPSA 2QRRA 3IBWA 5T41A 1WC4A 4OYOA 5A0YA 3LAMA 3MM5A 4EMDA 3ENVA 3M32A 4NXNF 4J37A 4FYXB 5D0HA 2B9YA 4K4YA 1IN0A 2FJBB 3FZ2A 5HMWA 1YTYA 2X1GA 4JI7J 4DLEA 4EWTA 4DR7J 3VHQA 3KG4A 1HNZJ 2WSFC 3HFZB 2MB0B 4JI0F 4K0KJ 4JI6F 1YX2A 4DSIA 1WOPA 3DM2B 1AZSA 2H3AA 5GMDA 3UCGA 4PUOA 5M2RA 2UXDJ 3QGPA 2C2KB 3NNAA 3NNHA 4GC6A 4A8SA 1S1TA 3CTRA 2Z4PA 2KDOA 2VQEF 2AU0A 2EVZA 2MZQA 4NMLA 2W8KA 2VG7B 5D3GB 2V2ZA 4ED1A 3JSRA 4B08A 2DNRA 2FYXA 1RT7A 2YKPA 4ZKAA 2VU5A 4K4WA 2GHPA 4ZPAA 2F9DA 3M6UA 5KT4A 3DGPA 4C8KA 1FNOA 1KN6A 2LCWA 4OJ3A 2OKQA 1TK0A 5J2MA 4IG3A 4DR1J 2WSEC 1VC6A 3DLLQ 4DPUA 3ZC4A 3LP0A 4KFBB 2WW4A 4L3KA 4BBYA 2R7RA 1IM4A 1MW7A 3IS9A 3MPUB 5FD1A 1H2VZ 1ITPA 3IFEA 2A2DA 3AOBA 3TA2A 4ZPWR 3C16B 3IN5A 5AXLA 5D15A 2MLZA 2J7UA 4QWEA 5IT4A 2M7SA 2UUCJ 4RL1A 1JLFB 4MH8A 3VVUA 3WIVA 3D0GE 1S0OA 3ISNC 1HFEL 1PAUB 4KH1B 2ZD1B 1SV5A 3AX3A 4DQPA 4WFXA 4I6AA 1N34F 4UOCA 2HHTA 3DLEA 2FHOB 1VOMA 2DBBA 2QA1A 4OI0A 4M5KA 1KQSR 1KFDA 1X5SA 2FY1A 2WVFA 1RAOA 1D8YA 3K57A 3L7PA 5KG4A 4LMZA 5AT1B 1Q16A 1K0TA 5E33A 1VMBA 2NCKL 4ZIVA 4PYDA 2J6SA 5K20B 3M8PA 1L5UA 2FHJA 2W2QP 4KFBA 1ACMB 1FRMA 4WK1A 3UCUP 3MMBB 1E6YA 4OX9J 1X0PA 2XMJA 4ME7E 2XG8A 2DGVA 2HHVA 2N4CA 4UQGA 1BMQB 1D8ZA 4DX8H 3MMCA 4DUYF 3V4IB 2XMVA 2V69A 2YNHB 4Y0FA 1X4BA 1X4CA 1TV6B 2CQDA 3GZ7A 4MTPA 1RAJA 4HTIA 3HFVA 1TK5A 2A6OA 2NXNA 4K2XA 1TELA 4LF6J 3AQOA 1OSCA 2ZD1A 2LLZA 2JC1A 1M5HA 1H7XA 2ZDPA 3C14A 3W7BA 3T1YF 1C0TB 1HQUA 2YWEA 2CNLB 1ZAVA 4N5SA 1MU2A 4DCJB 2DIVA 1X4GA 1VGYA 1ULRA 1Q8IA 4H4KA 2DY9A
chains in the Genus database with same CATH topology
3H8YA 2HHXA 3DLKB 3GIJA 2ERRA 4UUWA 4TU7A 2OP5A 3H2VE 3RW7A 1UVJA 2Q43A 5KFPA 4TU9A 3QWPA 5KFOA 3SZ2A 1HBMB 4F67A 4MYUA 1JX4A 2C2RA 4ECZA 1P1LA 5HP1B 3EPIA 1TVRA 4QR1A 2VA3A 2YKMB 4IOCQ 3IXQA 3JSMA 3VAHA 1FK9B 4ZOSA 2XGPA 3PW0A 4A8OA 1JMTA 3AAWB 1VS3A 4ED2A 4Y28C 4K4SA 1TKXB 3QGGA 3BZQA 2IM1A 2JRSA 1YIJS 3DRXA 3V2UC 3HHNB 2E9ZA 2ZITA 4ED8A 2C2DA 1RJJA 1IUJA 5F41A 3HFKA 5KOWA 1NK5A 3MMBA 1FXDA 1NH7A 1HBUB 5KFDA 2J0QD 5KFAA 4WXOA 4FXWA 4WCEQ 1J5OB 1LK7A 1XK8A 4KHRA 1OIAA 2GQ2A 3FGVA 1HBOA 4G1PA 3I0RA 4OI3A 3CD6S 3K0JA 3ENWA 2IRUA 3J7A1 2FJDB 2J9CA 3MM8B 4BWJA 2ADCA 1JLEB 2CPHA 2UZAA 3MM7B 1WWHA 1N5YA 4LQ3A 3UFCX 3U1LA 2JDJA 2XS5A 3V6HA 2J8AA 2MZSA 2RD5C 4DR1F 4DLGA 1RQ0A 2J7WA 2XSFA 1N5TA 2DCLA 1M5SA 1VFJA 2Q1LA 4CI0B 2VG6B 3HHLC 3EXCX 3J7YU 1T05B 1U2RA 3K8VA 3RBDA 4QPXA 3GWCA 3LUYA 5KFEA 1XMQF 4B3TF 2X1FA 3PR4A 1WNEA 4YHHF 2DGXA 1C1CA 3CCRS 1KC8T 2XS7A 1F2GA 1REVA 3M4XA 1U49A 3I0SB 1TL3B 2HFNA 1FDBA 4H4KC 5HMZA 4LRVA 1W2BR 4ECXA 1HMVA 5AXKA 1JLBA 4ED6A 3I4HX 3OR1B 4MIBA 3LAKA 1RA6A 4U67Q 4G1IA 1CG2A 5DQGA 3UR0A 1U1QA 2OPRB 1H2UX 5CQGA 4RWWA 2G13A 1WEYA 3FRYA 3V6KA 4QCLA 2R8JA 2XO7A 4H54A 1L3VA 5J2PA 2J9DE 3C8YA 1GTEA 1G7CB 3TW0A 3NNCA 3J80Y 4DSEA 3OL8A 2HYIB 4A8QA 4B3OB 3LJPA 3PKYA 3QO9B 3C6TB 5D78A 4PXDA 3DRPB 1S6QA 3MUMP 2NQPA 3JTNA 3CULA 2DPIA 1YJVA 5I42A 3NCRA 1Y9OA 2UUCF 4OI6A 2QMWA 3HKZD 5EUHA 3BGRB 2BRKA