1SH2A

Crystal structure of norwalk virus polymerase (metal-free, centered orthorhombic)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
502
structure length
502
Chain Sequence
GTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVNED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RNA Polymerase
publication title Crystal structure of norwalk virus polymerase reveals the carboxyl terminus in the active site cleft.
pubmed doi rcsb
source organism Norwalk virus
total genus 157
structure length 502
sequence length 502
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 1sh2A02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1sh2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sh2A03
4F50A 2VA2A 1TKZA 2RDIA 4ED2A 3LANA 2R2TA 5HP1A 4IOBA 4LSLA 4URGA 2B6AB 1KHVA 3GV5B 2F8EX 4ID5B 4IKAA 4Y34A 5KG0A 2BE2B 5T14A 3CO9A 4QWEA 1U09A 2ILZA 5DG9A 3C6TA 2WK4A 4IFYA 4KB7A 3IGNA 4IH6A 1TV6A 4I2QB 5F9NA 5L1LA 1ZTWA 4MFBA 1RT7B 2CJQA 4WE1B 1JLAB 3H5UA 4RU9A 4O4GA 2R2UA 4DL4A 3IRXB 1JX4A 5KG2A 1S6PA 4ZHRA 3RBEA 2DPJA 1TVRA 3I5BA 3TAMB 3DLEB 3E01A 3GILA 3OSNA 5F9LA 1SV5A 3LALA 4ECZA 5DG7A 3G86A 3LP1B 1LWEB 2W7OA 2E9TA 4TY8A 5KG7A 1JLCB 2I5JB 2YNHB 1DTQA 2E9ZA 5CYQA 3DRSB 3IG1B 3KLFB 2FVRA 3MECB 4PUOB 3N6NA 4LQ9A 4ECSA 4GC7A 2IC3A 2W9CA 2R2RA 4FS2A 3JYTA 2WONA 4NLYA 3IS9B 3LP0B 1TL3B 4K4UA 3DRPA 2R2SA 1EETB 3QGHA 4ICLB 3KLEA 4O44A 3HHKA 2GIRA 2OPQB 4R5PB 3UQSA 3OHAA 4OL8A 1FKOA 4I2PA 4KV8B 2OPPA 3D5MA 1XR7A 1JLGB 1QE1A 2W7PA 2OPRA 2BANB 1VRUA 1JLFB 1MU2A 3DLGB 4RNOA 1RT1A 2FLPA 3DYAB 4NLSA 5KFPA 3SFUA 3TQ1A 1JKHB 5EWFA 4WYLA 5KFIA 3H59A 4ZPBA 2XGPA 2YKNB 1I6JA 1HYSB 3BSNA 1HARA 1S1XA 1UWBB 3EZUA 3MEDA 5C25A 4RW7A 2IBKA 2VG5A 3I0SA 2XC9A 4MKBA 3RB3A 1RT4A 3MEGA 4IRDA 1S1UB 5KFYA 4RW6A 4Q8EA 1GX6A 1SH2A 4ECVA 1RTHA 3KNAA 3CIZA 4NLDA 3FQLA 2C2DA 2W8KA 2GIQA 5KFTA 5DLGA 4DEZA 2D41A 3DLKA 5K14B 4ZP9A 3KHRA 1DLOB 1C0TB 5F8LA 4IFVB 2ALZA 2WOMA 4J9MA 2FVSA 3BQ2A 4URSA 3KJVB 4QW8A 1REVA 3BSCA 4YQWA 1C2PA 3PW2A 4QWAA 3N6MA 1C1BB 3DI6B 4NCGA 4ZVEA 4O3NA 5F8GA 4RNFA 2IAJB 3FFIB 3GIIA 3RB4A 4WYWA 4YR3A 4WZMA 1EP4A 2J6SA 1ZTTA 1N56A 1QUVA 2BQRA 4PQUB 4EEYA 3DOKB 5KFQA 1J5OB 3DRRA 4TQRA 2IA6A 5J2QA 3M9OB 1BQNB 2E9RX 1FKPA 1S9EB 1S1WA 4NRTA 2IM2A 1WNEA 5KFCA 3KK1A 2ASDA 3DDKA 3JSMB 2HWHA 1S4FA 4H4OA 3CDWA 1S9GB 1SH3A 1FK9B 3GQCA 2V4QA 3UPFA 5EWEA 3BQ0A 5HBMA 3PJWA 4FS1A 4R8UB 3T5HA 1S0NA 1N6QB 5KG1A 2CKWA 4JV0A 3DOLA 1S97A 4ID5A 4U7CA 4ED8A 1RT3A 2BE2A 2HNZB 3RAQA 1RT5B 4TLRA 4I2QA 4G1QB 2C2RA 1SH0A 1IKWA 2BR0A 1S0MA 3MEEB 3VQSA 2V9WA 5F8NA 4NLXA 3Q8SB 1RT6B 3IRXA 1HMVA 2W9AA 4RW9A 2AGPA 4M94A 2ZE2B 3TVKA 3DLEA 3I0RB 2XI3A 4IH5A 5I42B 1IM4A 5L1IA 4YMEA 4MH8A 1IKYB 4URQU 2ZD1A 3Q8RB 3CWJA 4YR2A 3LP1A 1HQEB 2IM1A 1S49A 2I1RA 4ZP6A 2YNHA 3ICLA 4Y2CA 2XCAA 3GV8B 2C22A 3CJ5A 3PR5B 3KLHB 1LWFB 3MECA 4PUOA 1LW2B 4KSEB 3BGRA 4TYAA 5DQIA 2YNIA 1S1VA 1TKTB 4WXOA 3NGDA 5KFAA 4Y3CA 5J1EB 4LSNB 2BQUA 3V81B 3IS9A 3LP0A 1HNIA 5KT7A 5DGBA 4RUCA 2HMIA 5KG6A 4IG0A 2IJFA 1S48A 4ICLA 4TQSA 2V0NA 3V4IB 3G6XA 3CDUA 3OL6A 4F4WA 3V6HA 4KV8A 4DG1B 4O3SA 3CJ4A 3HVWA 5C24A 3QIPA 1S6QB 2RKIB 4TYBA 4ECXA 1RTIA 2O5DA 3ISNC 1RTJB 2BANA 3PHEA 1JLFA 3DLGA 3LP2A 3MTKA 5KT4A 4RNNA 4Q0BB 3DYAA 4ED3A 4K50A 1HNVA 4XPCA 4QWCA 5J2NA 5CYMB 5J2MB 3KHGA 4FBUA 4K4WA 2GC8A 4KKOB 3KK3B 4I7FB 1RTDA 3HVAA 5KFVA 3M8QB 1JXLA 2UUTA 1UWBA 3KLVA 2HNYA 4H4MB 3KMQA 1RT2A 1JLQA 3KK2B 3HVTB 2R8KA 4RW4A 4IG3B 1S1UA 2ASJA 3NBPB 5F8MA 4KFBA 4J9NA 1LWCA 4ECWA 1S10A 3PJXA 4LQ3A 3QO9B 4ZPCA 5HP1B 3KLGB 3UDLA 3CVKA 1RA6A 1DTTA 4LSLB 5KFZA 3EPIA 3PW5A 4ED0A 5K14A 2EC0A 1R0AA 1S1TA 1VRTB 1DLOA 4GC6A 4TN2A 4MKAA 5KFGA 4ED6A 3PW4A 2ASLA 3T19A 5I3UB 5D3GB 1TV6B 3H5XA 3GIJA 4MFBB 4DL2A 1C0UB 1HQUB 3OHBA 1N5YA 4J9SA 1YVFA 2RDJA 3QYYA 4NLWA 4O4RA 1RYSA 2DPIA 1LW0A 4F4XA 2XCPA 1Z4UA 4JUZA 1C1BA 3DI6A 4B3OB 5FDLB 1TP7A 1S6PB 2IAJA 3FFIA 4MIBA 4PWDB 3GYNA 3Q8QB 1HPZB 1BQMA 4ZP7A 2AU0A 5F8JA 3GV7B 2ZKUA 1S0OA 3Q8PB 4IRKA 4ZVFA 4PQUA 3KLIB 3KHLA 4ZPDA 4IRCA 4TY8B 1KLMB 2OPSB 3LAKA 1T05A 2HNDB 1BQNA 4WXWA 1QAJA 2C2EA 1S9EA 3BREA 4FBTA 5CYQB 2R8IA 2FVCA 4KO0A 4F4ZA 3KMSA 3C6UB 5KT3A 3FSIA 2FVPA 2FVQA 1S9GA 1FK9A 2YNFB 2IC3B 4KHRA 2IM3A 4WZQA 4MK8A 3JYTB 2WONB 3DMJA 4J9PA 1TKXA 3I5AA 4IDKA 3ITHA 3QGIA 3KLEB 1RT5A 2HWIA 2JC0A 4O44B 3E51A 3DM2B 4G1QA 5KFEA 3G6VA 5L1KA 4ZVHA 5DQHA 4J9RA 4I2PB 4J9QA 2WRMA 2OPPB 3RB0A 3HKWA 4Q45A 3PR4A 5HLFA 1RYRA 4NLOA 1SUQB 1IKVA 1QE1B 1RT6A 2OPRB 2VG6B 5DQGA 5KG3A 1W25A 2VG7B 5J2PA 5DG8A 2W8LA 1C1CB 1RAJA 4EBCA 3I0RA 3QLHA 2XI2A 1KHWA 4QWBA 1IKYA 5HROB 3M9MB 4NLGA 4DL5A 1HQEA 1TQLA 2D7SA 5KFXA 3GIKA 2B6AA 4DL7A 2BQ3A 1S1XB 3M8PB 4MK7A 5L9XA 5C25B 3MR6A 3I0SB 2OH2A 1LWFA 3MEGB 4RUAA 4RNMA 4RW6B 4X2BA 3QZ8A 5L1JA 1TKTA 2AGQA 1N48A 4WFXA 5J1EA 4EYHB 4LSNA 1RT7A 4WE1A 3V81A 1JLAA 4O3OA 4EYIB 2R8HA 2HAIA 3DLKB 4O3PA 4NLTA 5KG4A 2JEGA 3T1AA 2UVRA 3SFGA 4NYZA 3TAMA 2J6UA 4KHMA 2BRKA 1XR6A 4EO8A 4U6PA 2WOMB 2QE5A 1NNDA 3I5CA 4DG1A 5C42B 2JLEA 4ZVGA 2JEFA 4K4VA 1REVB 1LWEA 2RKIA 2AGOA 3NL0A 2RF2B 1JLCA 4Q0BA 2XGQA 2I5JA 5C5JA 2WB4A 3LAMA 4NCGB 3DRSA 3IG1A 3KLFA 3BSAA 3V6DB 5CYMA 3T5JA 4K4XA 5KT6A 2BRLA 2D3ZA 4RW8B 5KFJA 5F8IA 4I7FA 3KK3A 1IKXB 1K1QA 4M95A 1JLEB 2IMWP 1JLBB 4ZPAA 1TL3A 3G6YA 5J2QB 4DL3A 3KK2A 2AWZA 2UUWA 3KOAA 4K4ZA 1EETA 3BR9A 3CJ2A 4IG3A 4JV2A 3NBPA 3KK1B 4XO0A 2OPQA 4R0EA 4NLRA 1T03B 4R5PA 4H4OB 1NHVA 3QO9A 3MF5A 3KLGA 5KFLA 2YKMB 4NLPA 5HBMB 3MFHA 4ED7A 2UVVA 1JLGA 3RBDA 4MK9A 4QW9A 3DOLB 2YNGB 4ED1A 3KHHA 1VRTA 2AX0A 5EUHA 1N4LA 2ATLA 1RT3B 4ZP8A 1K1SA 3BJYA 5I3UA 1TL1B 4EO6A 5D3GA 1JKHA 5KFOA 4EBEA 4G3IA 4IQXA 1IKWB 1C0UA 1HQUA 4IR9A 5EDWA 2YKNA 4NLVA 5KFSA 2FLLA 4ECQA 4QWDA 1HYSA 4B3OA 3NMAA 2W9BB 1HMVB 5FDLA 4RW9B 5KFWA 4NLUA 2B5JB 4HKQA 2D3UA 4PWDA 4ECRA 2AX1A 1HPZA 3H2LA 3KLIA 3BSOA 1TKZB 2ZD1B 3OLAA 1KLMA 2OPSA 4KAIA 2FLNA 2HNDA 4Q8FA 3FQKA 3H98A 1C0TA 5KG5A 3C6UA 2IJNA 4IFVA 5KFDA 3BGRB 3NAIA 2YNFA 3EPGA 3C6TB 4IFYB 1T94A 1S1VB 2YNIB 3ISND 3KJVA 1S9FA 4J9KA 3M9NB 3H5YA 4H54A 3H4DA 4Q44A 1HNIB 5KFBA 2FJVA 2HMIB 4IG0B 1NHUA 3OL8A 4O4GB 1ZETA 2JEJA 4ZHRB 4ECUA 3DM2A 1TVRB 4TXSA 3QZ7A 4J9OA 3E01B 4YR0A 1SV5B 5KFUA 1SUQA 5C24B 3V6JA 3DOKA 3OLBA 3QIPB 1J5OA 2VG6A 1RA7A 1RTIB 2VG7A 3D28A 3MR5A 3LP2B 4MIAA 3N6LA 1C1CA 1DTQB 1HNVB 5J2NB 3NKYA 2UVUA 3CJ3A 4WFYA 5DLFA 3JSMA 5HROA 4WFZA 2C28A 3T5LA 4IH7A 3IGVA 1RTDB 4R8UA 2W9CB 3MR3A 1N6QA 2HNYB 3M8PA 3UR0A 3GIMA 3H4BA 1RT2B 1JLQB 3DRPB 3BQ1A 1JIHA 4RW4B 4K4YA 2HNZA 3MFIA 3CDEA 4KFBB 4IR1A 1LWCB 2AQ4A 5JXSA 1FKOB 3MEEA 1MMLA 1DTTB 5KFFA 4J9LA 2JC1A 2V4RA 4K4SA 1R0AB 1S1TB 2ZE2A 1VRUB 1MU2B 4XPEA 1RT1B 5KFMA 5I42A 2UVWA 5KFHA 3H5SA 2ILYA 5C42A 2J6TA 4KE5A 1N5YB 4YP3A 4ECYA 3FDSA 4KBIA 4JV1A 4NRUA 2B43A 2RF2A 3H40A 1LW0B 2R8JA 5KFKA 2JEIA 4K4TA 3MEDB 3FRZA 4RW7B 2VG5B 5KFNA 2XWYA 3KLHA 3T5KA 1RT4B 3V6DA 4TY9A 3NAHA 1LW2A 4F4YA 4ECTA 1BQMB 4RW8A 4Q43A 5KT2A 1XR5A 1IKXA 3QGGA 1JLEA 1RTHB 1RDRA 2WTFA 3OSPA 4NZ0A 2IM0A 1JLBA 3PZPA 4DL6A 1D0EA 4Y2AA 5KFRA 1T05B 1D1UA 1QAIA 2VA3A 3RB6A 3OL7A 3V6KA 3SI8A 3CJ0A 4KO0B 1T3NA 2WCXA 1CSJA 5JUMA 3PVXA 3V4IA 3PW0A 3RAXA 3MR2A 1T03A 4ZMMA 5DGAA 4O3RA 2YKMA 3OL9A 4RNHA 5F8HA 1OS5A 1S6QA 4EBDA 2YNGA 1RTJA 3DMJB 2R8GA 1TKXB 4O3QA 4IDKB 4NLQA 3ITHB 4HYKA 1TL1A 5KT5A 5J2MA 1EP4B 2FJXA 4QPXA 4KKOA 4RZRA 2WHOA 5EWGA 5HLFB 2FJWA 3M8QA 2QV6A 3QIDA 1IKVB 4H4MA 2W9BA 3DRRB 3IN5A 5J2PB 2B5JA 1GX5A 3HVTA 1FKPB 3PW7A 1S1WB 3QLHB
chains in the Genus database with same CATH superfamily
2LQ8A 3U02A 3MPWA 1X5TA 2XZWA 1U7LA 2A18A 3CO9A 2PFFB 2DYAA 2GJFA 2DPJA 2DR9A 5BXIA 2BE9B 1UPMB 4OZ3A 2R4FA 2ZBQA 4KGVB 3T6JA 3MURP 4ECSA 2MSTA 3IS9B 3R8YA 1T9XA 1L5UA 2PDAA 2GIRA 5F3ZA 1L3TA 2DR6A 4PKDB 1CS4B 4ZVQB 3SZ2A 2GS8A 2XGPA 3OPKA 1GX6A 4OX7A 4NLDA 3KNAA 3CIZA 3VGTA 5A0YB 2BA9A 2A3JA 1QVFR 1YQHA 3D3CJ 1RXOB 3T9ZA 5H9EJ 3JSBA 2MKSA 3QNWB 1PJ5A 7AT1B 5AT1B 1SQGA 1TK5A 5I3QA 1FRJA 3W65A 1YZ6A 2BQRA 1G3OA 2P5VA 4EEYA 2KT2A 2ERRA 2APOA 3QBCA 4OHVA 3TUJC 4KGZB 1SH3A 1B0VA 4FS1A 3M2VA 1WG1A 3RAQA 1H2VZ 4USHA 3KXDA 2CQIA 4YEAA 3S1TA 4PR6A 2G9OA 4LF5J 4IH5A 4LIRA 4MH8A 4YY3F 3CCSS 3W64A 2J0WA 2EFVA 3WQPA 4NXMJ 1LWFB 4W92B 2PGCA 4F3OA 1TKTB 1UJ6A 1TAQA 1MNEA 5T7LB 4KQZA 4P7TA 2R7XA 3IP0A 2MLXA 3JAMY 4ECXA 4XPCA 4FBUA 2MGZB 5KFVA 3R2DJ 2ZJPQ 2R8KA 1PYSB 1NZAA 4KTQA 5JVHQ 2RH3A 3UDLA 3OVSA 5E5NA 1EQ0A 5F41A 4M5LA 4ZVTB 3ET6A 5FIIA 4F67A 1KLNA 1RAOA 2DGVA 5HMYA 5DJBA 2BJ9A 1S9EA 1OHNA 3SDEA 3D3BJ 2IRYA 4HV0A 4KHRA 1YGYA 3LGNA 1GMVA 5LMUF 4RBUA 2FHKA 2DGOA 4XDCA 2AEMA 2RE1A 4ZVHA 3LF0A 2GPEA 3UCGA 1HNWF 2LQ9A 4MK7A 3ZZTA 1FRLA 4F25A 2FTRA 2RUSA 1B7YB 1IJFB 1KOOA 3MAAA 2J9CA 8RUCA 3DRXA 2V1TA 2E7WA 4MYTA 4OYWA 4K5RA 1VHIA 2Z2LA 2M8HA 2V69A 3W8PA 4X4TA 2HPUA 4JI6J 3GTYX 5EUHA 2XQCA 3HDSA 5B0FA 1MLAA 1RHMB 2YH0A 1I94J 3M7VA 4HKQA 1P94A 3KLIA 2A1BA 2XSJA 1WKLA 4AXJA 2M5YA 2WVFA 3NAIA 4DDFA 4LSZB 4IFYB 5GMDA 4P73A 2FJVA 4ED5A 4CO0A 4FKXA 4QU6A 1AW0A 1OY8A 1XIQA 2CPYA 1SL1A 2DIVA 1E6VA 2HQCA 2DNNA 3HSZA 2ZBPA 1NZ8A 2GX8A 4X84A 3H4BA 1JLQB 2AW0A 3MFIA 3R5BA 2P9EA 5LJ5Y 3CCES 4NE9C 4A47A 4F2RA 3CMES 3VAFA 1BWVA 5KFHA 3FRYA 4DR3J 1S12A 3R7SB 2W01A 2HWTA 2XWYA 2IJRA 4ILLA 1XR5A 1U02A 1JLEA 5CQGA 1VBXA 5KFRA 1T05B 3GXQA 1H2UX 3SI8A 1HKAA 2GVZA 2WCXA 5KOWA 2KG0A 4DCJB 2YKMA 4J9UE 2V2QA 1IXKA 3TQEA 2AJ1A 2XHWA 1PC4A 3TX8A 4FNHA 2MB0B 1LWXA 4X65J 2FJAB 1NSAA 2KELA 2B5JA 3ZC4A 4NXNF 1CVJA 1FKPB 5AE1A 5CZVA 4CWBA 2R2TA 5HP1A 1KS2A 2FZCB 4J7CA 4ID5B 5D78A 4IH6A 1LFWA 4W98A 2B4OA 1JX4A 2LEAA 2MZ1A 3ZZYA 3W5YA 2ZNYA 1JLCB 3KKFA 4JI5J 2VFVA 3FMBA 1TL3B 3K58A 1EETB 4C8OA 3MCNA 3KJFB 3MMAB 3UQSA 5LSRA 2FGOA 1MU2A 1UKUA 5B08A 2XY5A 3ZO7A 4RUHA 4LFCF 3HK2A 4ANCA 3VAKA 4RW6A 4B17A 5DLGA 1KFDA 2NPFA 1P1LA 1UPPA 1APSA 2HG4A 3JS9A 3EUNA 4BBYA 3K89A 1UEVA 1L3VA 3PKYA 3M9OB 2P6TA 3R7NB 2XS5A 2XNQA 4DLEA 1QM9A 4J9VA 2HK3A 2UUAF 2C1EB 5K8OA 4B9NA 4F8RA 4ZPWR 4HDHA 3E8OA 4L74A 3IRXA 4DV5F 4USMA 2WB1D 3AXKA 2ZDOA 1PYOB 4DUZJ 3TJ9A 2HS0A 3GV8B 3TI0A 1HI8A 3MECA 1KNZA 2GQQA 1HNIA 4CLUA 4MKVA 1M0SA 2V0NA 2IY5B 3W9IA 3BBCA 2DHAA 2NXCA 3C19A 3M2RA 4CLKA 3WDOA 4IG3B 2M3DA 1T3OA 3FNNA 2MHNA 4ZPCA 3EPIA 5IV3A 3U1MA 1UJ4A 4TN2A 4MKAA 3HFKA 3I96A 4QR0A 1W26A 1C0UB 4J9SA 2XEXA 2K6LA 3CCTA 3HFZB 2BJ3A 4Z2XA 4DSKA 3IM9A 1S0OA 2ZKUA 4LF7J 2XTJP 4FBTA 2C2EA 1G4CA 2LDIA 4L6V3 1S9GA 3JYTB 4HHUA 3CD7A 3DC2A 3H20A 1IBLJ 4RLEA 3HKWA 2QLWA 3QLHA 3CCJS 1IKYA 3CDAA 3B6BA 3W62A 3LWLA 3NMRA 2NR0A 3W66A 2MZRA 3NRBA 1KRPA 1OQ3A 4O3PA 2JEGA 2PMWA 4NLTA 1RKIA 4MJKA 4DJBA 4KHPF 3RGIA 2I5JA 2W2QP 2DRAA 3FZBA 2DRDA 3CJ2A 4JI7J 1IUJA 3T6BA 4R0EA 4C0OC 2DEIA 3KHHA 3W2WB 4EO6A 4G3IA 2WVCA 1HQUA 5EDWA 3W61A 2DNGA 1IBKJ 4N76A 2D3O1 3M8ZA 2XO6A 5JMNA 3HX9A 1FRKA 3EICA 2B7CB 1B3TA 4BDPA 4ZK7M 3US5A 2V2KA 5KG5A 1LK5A 3AQPA 3P49B 1T94A 2EC2A 3JQKA 5B0CA 1BE4A 5GVQA 4CNZA 1Q7YT 1H2TZ 4WKRA 4WP3A 4QYZK 3ZNUA 4UT4A 1SCJB 4HH0A 4DV1F 4ANEA 3M8SA 1D8YA 3D28A 2P8IA 1Y7PA 3N5FA 1WC0A 1N6QA 2GMHA 2WVEA 4K59A 1U24A 4HHJA 3J7YI 3MEEA 2JC1A 5E3RA 2V4RA 4NA2A 3G87A 4DX6A 4YP3A 2KG1A 2RF2A 4M5NA 2HQGA 3FRZA 3T5KA 1U2CA 3D68A 2R7QA 3QGGA 1N33J 3ZTSA 1XTZA 3CJ0A 4LRVA 1CSJA 2Z30B 1OQ6A 4ZDNA 2ZH4A 5F8HA 4HR2A 4EBDA 2R8GA 4M8LA 4PRFA 3C15A 1AROP 3CCMS 2VPYB 1IBMF 3TEHB 2K7JA 1GXUA 4KB7A 3PYDA 3IGNA 4N56A 2MKHA 3CMQA 3HHEA 2HHSA 4ZHRA 2CAXA 3WC2A 3E01A 3I32A 3G86A 1NM2A 1U2RA 2ZOFA 4FXVA 4AYBD 2CQ2A 1TK0A 4GC7A 2UU9F 3DU6A 2KHDA 2N4CA 4C98A 1VYAA 2VD3A 4USKA 5E41A 4I2PA 2OPPA 3MM9B 3VVTA 1F60B 2R7UA 1N5QA 2AP6A 2DBBA 3QQCD 1WHYA 1S1XA 1X4FA 4MKBA 2ZHBA 1NDKA 3KG1A 3THPA 4DV6F 1WTBA 3BZQA 2R7SA 4NX9A 2YX7A 5FD1A 2HLTA 3G6YA 4WYWA 4WZMA 4R25A 2MMYA 3MMBB 3LPEA 1ZH5A 4B3SJ 1FK9B 3T5HA 1TK8A 2DNPA 4U7CA 2R42A 4ZCLA 2NZ4A 3FEXB 9RUBA 2G1HA 4BC7A 4NLXA 2DHSA 1FI4A 2CWXA 3I0RB 3S01A 4YR2A 1LOUA 1T95A 4JI2J 2J7KA 3CJ5A 3DHXA 2GO8A 1UMJA 3IS9A 5DGBA 2FB0A 1ZM2A 2UUBJ 4F4WA 4DG1B 2HHTA 4O3SA 3ZZRA 1M5VC 1OJ4A 5FJ4A 4ED3A 1HNVA 4QWCA 4WJBA 5D15A 2L9WA 2UP1A 2UUTA 4LF4J 4LRFA 5LXYA 4GO5X 2CQGA 4ECWA 4P7VA 5IQQA 4QIGA 5A0YA 2FJWA 2BJ7A 1LQ9A 3HZEA 4NMXA 3BBBA 3UNYA 2QX0A 4MT1A 1FA0A 2V8DA 5A8KA 4CP5A 3HD2A 3TW0A 3AODA 2YKQA 3OQ2A 1KLMB 2R8IA 1U1OA 3IMQJ 4DR5F 2BSQE 1R8PA 1FE0A 2E5GA 4LRBA 3VALA 3QGIA 4MIWA 3KLEB 2E66A 5SZTA 2EBEA 5K5MA 1WHXA 4X64F 3L4BC 3RB0A 1FRXA 2DNOA 4E2FB 3AD9C 4DL5A 2M4MA 4KGXB 3W5ZA 3RRGA 1LWFA 2HVDA 4RUAA 2RVJA 1TKTA 3CGIA 2OEMA 4O3OA 3EJMA 4DSLA 3DLBA 3TX0A 3VZHA 2JEFA 2KT5A 2XGQA 5GAGU 4Q7AA 1S59A 2CYYA 3UVJA 3GJRB 1F0XA 3WHIA 2E1RA 1RP5A 2IMWP 3HKZD 4PABA 2BEFA 1MG7A 4XO0A 2OPQA 1HWIA 3L95X 3HT3A 4I6AA 3F0NA 2RUGA 2OD6A 4ALZA 3AFGA 4WU3A 4ECQA 1Q1KA 3UDCA 1WHWA 4ECRA 1AFJA 1Y5NB 2KYZA 3GZ7A 1DBDA 4PXCA 2F9JA 1FJEB 3EPGA 3R6GB 2CJYB 3EZ5A 3H5YA 4ZCMA 3H4DA 3R5AA 2XWXA 1R43A 4HEA9 1WC5A 4YR0A 3K2YA 3UO0A 4QIVA 3X3UA 3F44A 1DFDA 4BS2A 3ILOA 1XBWA 4OI1A 1LWCB 8AT1B 1DTTB 1B64A 4DUTA 1U6FA 2V1SA 2RD5C 2ZE2A 4JYAF 1JK9B 3GE9A 4KE5A 4OHZA 2MY7A 2R8JA 4GKJF 4Y2KA 1U8SA 1BQMB 4NZ0A 2H3AA 4PYDA 1VS3A 5D8HB 4L3KA 2OELA 4M5GA 1S6QA 3BEGB 1N34F 3CJKB 1RTJA 1UZDA 3PO5A 5M2PA 1IKVB 4WU2A 5J2PB 5DZ7A 2BW2A 4N8OA 3DLHA 3AB2B 2RDIA 1AA1B 2JLGA 3J7ZT 1EKRA 4URGA 1TL5A 1I5OB 3T1HJ 2CUYA 4DF4A 4B3TJ 2WK4A 4IFYA 1YITS 4C6AA 4MFBA 3H5UA 4ES3A 2ZM6F 2K1RB 3RRKA 1BC6A 2DNYA 3C14B 2VPZB 3AY0A 3UN3A 4DPTA 3BH7B 4DS5A 3Q22A 3DKDA 2V5HG 2KRRA 4QR2A 4P75A 1QDUB 4UTGA 2C3YA 4LF8J 4FS2A 3FT7A 2CG8A 3A13A 3EDQB 2GFFA 3HHKA 4OL8A 4QQBA 1XR7A 1QE1A 1HBOB 2DXFA 3VQTA 3DYAB 2Z58B 3TQ1A 1NLAA 4ZVSB 5L9NA 2MLZA 4EZ6A 4NEZA 1FJCA 4F0MA 2GIFA 1Q5VA 3BQ2A 1Y4ZB 1Q16A 2KVIA 1AUSL 3GIIA 1C4CA 1OYEA 1P27B 1XNRJ 1LEOA 3FBCA 1OG7A 1FKPA 4NZ7A 3ZZOA 2ASDA 4H4OA 3UPFA 4WFAQ 4R8UB 2MDAA 5ETQA 4ID5A 5B0DA 2ZBRA 3IR5B 2HNZB 1NK9A 1MN7A 4I0WA 5F8NA 1Z1ZA 2AGPA 1HMVA 4M94A 4DV7J 4CCHA 1Q8BA 2W24A 2O3DA 4P9SA 2Z2MA 4WPAA 3EVWA 2MXYA 4ZOSA 1BLUA 3B4MA 4OZNA 5KFAA 3V81B 2HMIA 2QYCA 4K2XA 4DZDA 3MMAA 2OFHX 1SKRA 3H0PA 3Q8VA 1YRUA 1XQIA 2GC8A 4LF9J 5HQMA 3KLVA 2K3KA 2DGUA 4L3NA 4KFBA 3TZZA 3QO9B 1UVMA 3PW5A 5LM7E 2K2PA 2AYMA 3K8WA 4CO3A 1J5EF 4LFAJ 2DGQA 4HI1A 1N5YA 1HNXF 4O4RA 4HDGA 3VVUA 3SCIE 3FSYA 4C97A 3OD2A 2F4VJ 4X62J 4ZPDA 2HNDB 1ZPVA 4KO0A 4F4ZA 2BXJA 2IM3A 5HSPA 4A4JA 2WONB 1TKXA 4LVOP 5LSOA 1JQGA 3D1QA 3N79A 5KG3A 1PIEA 4QYZJ 1JNZB 1FJGF 3GIKA 2RS8A 1GMUA 4QBUA 3LQVA 2IDLA 2BUNA 1QAXA 3SV4A 5E33A 4IOAQ 4DQIA 2NCKL 4DS4A 2Z56B 1VI7A 2WOMB 3QT5A 5C42B 2DY9A 1LWEA 2E5LF 2V8VA 5F8IA 3BB5A 1P8GA 3BKFA 4HT5A 4C3MA 3OJUA 4X66F 1HBMA 4IG3A 1N0VC 3MAQA 2UVVA 1CULB 2NSCA 2A2DA 3BJYA 3IO1A 1JKHA 4PG4A 4NCBA 1C0UA 4YS2A 4NLVA 1VK8A 2CZ4A 4QWDA 4RW9B 1LV5A 4KIAA 1IR1A 1IBCB 3DXBA 4HTIA 3UDVA 1XMOJ 3EWGA 5JVGQ 1S1VB 3ISND 4OYZA 1FVSA 3BN7A 2KJWA 1YHQS 1R31A 4U8YA 3A1YG 2AZ3A 1Q86T 2W2PP 1RA7A 3N6LA 5J2NB 1D3WA 2CDQA 2VFUA 4CZCA 2C3PA 2HNYB 4M5MA 1WEYA 3DRPB 4K4YA 4K8RA 4QJVA 2ATCB 5DO2A 3D4JA 2GMJA 1GAOA 4PWUA 1WF0A 3PACA 3C46A 4NRUA 5D4NA 2B9YA 3NAHA 2PT0A 4DFJA 4YOEA 1O51A 3M6XA 3L3CA 4AL7A 3V4IA 5B7WA 3GWCA 5IOLA 2UV8A 1NU4A 3W2WA 1HWLA 3ITHB 4UUWA 5J2MA 4QIEA 5E3PA 5ETPA 3QIDA 1ZM4A 3TEGA 2HHPA 1VQNS 4LF5F 1RAFB 2B6AB 5ITHA 2HHXA 3OJSA 2ILZA 2OSRA 4I2QB 2Y0SD 2N82B 2MZTA 2K29A 1FKAF 4NXMF 2W7AA 2LLZA 2ZHOA 3TAMB 2M70A 4Y6IA 2RT3A 2W7OA 2KOEA 4TY8A 1JB0C 5I4MA 2E9ZA 3IG1B 4C3LA 2CVIA 1EKSA 2YX1A 1OMSA 1RWNB 1MMDA 3SMZA 2GVDB 3M6UA 3QJPA 3R1LA 3DOMB 2YVSA 1NJXA 2RILA 4O23A 2ACYA 4OI4A 1MNTA 2HHWA 1D8ZA 1HBUB 1NKBA 2RRNA 5GADI 3TZYA 3CJQA 2A10A 2WVDA 1RWMB 1U0SA 1TUGB 2ZDPA 1DLOB 5F8LA 3DCAA 2OP5A 2YWHA 2J76E 3NNHA 2VFTA 4LBPA 3MUTP 2I9SA 1SC6A 1B0PA 3TVYA 2KKHA 3RR8A 2ZZMA 1BQNB 1UEKA 2DNZA 2UUAJ 4BHQA 2DIUA 5EWEA 4M5IA 2YH1A 4P10A 1ZAXA 2LCWA 3D0IE 1URRA 1VQ5S 2IVYA 2XI3A 4UOHA 1RKJA 4X4SA 1VQSA 3I87A 4EZ9A 3V4MA 2GQ2A 3QRPA 1DHMA 2WW8A 2RHQB 3G4SS 2Y8YA 3MM9A 2QLBB 2XLIA 3BS9A 4JI6F 1CJKB 4QOTA 3D66A 1I94F 3J7A1 1WEZA 4OJ3A 5KAKA 4YUDA 2QMWA 4ED6A 4EI2A 3T19A 1RABB 1SIZA 2B3TB 1ITPA 4NLWA 2UV8G 1IQZA 2BJ1A 2J9DA 2K9IA 3N5BA 1OO0B 2VDIA 3NNEA 4U67Q 1EARA 1QAJA 3K7RA 3MMBA 4DSJA 1NPPA 2FVCA 2FVPA 1FK9A 5B0EA 2CJBA 4Q2LA 3W1YC 3TYTA 2XTCA 2H4YB 5L1KA 1YIJS 2JFKA 3AOBA 1HHSA 3GCWP 1SBRA 1Y5IB 2AHOB 1A0OB 2JXIA 3I0RA 1VISA 4A8KA 1BGXT 2OH2A 4ZS6A 2XSFA 3QSYB 4DR3F 4USVA 4FF4A 1JLAA 2ZC3A 3ZZZA 4B9TA 3CD6S 1Q0NA 3N9UC 2QE5A 4DG1A 2XZDB 3MM7B 5EN1A 1VHFA 1NK0A 3QRRA 3GR1A 3DRSA 2LXFA 1U49A 3D6MB 4HVZA 4K4XA 1F9FA 2ZH7A 3SYZA 3KWMA 4PPDA 1JLBB 3MMJA 4X65F 1WTFA 3MCMA 1X5SA 2OMOA 3I82A 4NLPA 3WX8A 3T3FA 4DCOB 1WF1A 3M2VB 3MAHA 2G2OA 5KFSA 2FIUA 3AQOA 2VFRA 2J9EA 3H90A 1KLMA 2HS4A 2AKWB 3D6HB 1NEEA 2CPEA 3HM9A 2KFZA 4JI5F 4O4GB 1NAQA 3AAWB 3HT0A 1S72S 5HATA 1PARA 5K8MA 3W63A 1OM2A 1VOMA 3GIMA 3BQ1A 4IR1A 4E98A 3VF0B 4YN3B 4J9LA 3NNAA 5CCLA 1RE1B 4CH1A 3SQOP 3BO3A 3NGSA 1RT1B 4RBVA 5GAGI 5I42A 5HK4A 3H5SA 1CJTA 1GEHA 4UOFA 3EGZA 2MZQA 2JHEA 3M8WA 2RQ4A 3ET6B 3NS6A 1X4BA 3JAMU 4GKKJ 3PZPA 4TU9A 2Y0BB 3SDEB 3TOQA 5T41A 2H1YA 2RRAA 3Q23A 4HYKA 1ELOA 2HZAA 4E0DA 1B70B 1F5BA 2XY7A 4JI3J 2F8EX 2C2KB 1BMQB 1ZTWA 1KQGB 4DUZF 4Y0FA 3MAAB 1MYKA 4RU9A 3RBEA 1B4SA 2M2BA 1SC1B 5KG7A 2UU9J 2YNHB 1VC6A 1N88A 2QMUB 2O66A 2XZTB 5F0WA 2UXBJ 2MQMA 3BO4A 2AJ2A 4ICLB 4ERDA 1WKJA 1JLFB 4M5JA 4A8FA 1U1RA 3SXLA 3BPSP 2WSFC 3CE8A 3OXLA 4CO5A 2YKOA 5H9FK 1X7VA 2CPDA 3FBEA 2BKOA 3KHRA 2M0GB 2YPYA 1SJ1A 4LF7F 1PC5A 2ALZA 1GXTA 4KGMA 3N6MA 4NCGA 5E7OB 2C42A 5DDQC 4NL5A 2CQDA 4KGKA 2HQFA 3RUBL 1WDTA 1IBLF 2KN4A 1GMWD 3GQCA 2E44A 1UUJA 2D3OR 2BYCA 1KOHA 3DOLA 1RT3A 2ZH3A 2BJEA 1S0MA 2BNZA 5B09A 1UAWA 2W9AA 3TVKA 3C14A 1FD8A 1RBOB 1X0FA 4CO2A 5D4OA 4IOCQ 1U1PA 4RU2A 1V6HA 1NB2A 1Z2LA 2KJVA 4FXEA 2GVZB 4OX6A 1WOPA 3G6XA 2Z57B 2OFGX 3I9V9 2QG9B 4JI7F 2X1FA 2RKIB 1HBOA 4RNNA 3IXQA 3DYAA 1S79A 5CYMB 2BJ8A 3QGPA 4I7FB 1CJUA 2ASJA 2E1CA 5F8MA 3RAMA 2LQBA 1IBKF 5HP1B 3R2CJ 4UQTA 5BYQA 1S1TA 2E29A 2F65A 2ASLA 4OX9J 3SSRA 2VDHA 2VUGA 2AN7A 1HNZJ 2R3VA 4N41A 3VAIA 4PWDB 3RZAA 2W2OP 3MR7A 3S8SA 5ETKA 2XBPA 4C8MA 1IN0A 1VLYA 3I5AA 4IDKA 5HL7Q 2JC0A 2X1AA 2WRMA 3H2UB 3CMAS 2W8LA 1GNKA 1RAJA 2RBFA 3OR2A 3PTWA 3OVAA 3CC7S 3QT8A 4TU8A 3SEOA 3ISZA 3UN2A 4RW6B 2V34A 3V81A 5GAHU 2J6UA 3GP9A 1N33F 2N4DA 3I5CA 5BR8J 4O0IA 3HHDA 3KLFA 1HBNB 3BKUA 1K1QA 5IXUA 3F56A 2QSWA 2AWZA 3KOAA 4K4ZA 3KUEA 4NLRA 3VAGA 4OI6A 3QO9A 4NWBA 4F04B 4C3KA 2XTEA 4DX7A 2YKNA 2QJ3A 1E6YA 2ZUGA 2VPWB 4I68A 3SBMA 2GGPA 2UUCJ 1TKZB 4QZVB 2HNDA 1CEZA 2MSSA 2IJNA 3CO0P 2B8QA 2VA2A 3OFFA 3KJVA 4FYXB 1HNIB 4CRJA 4B9SA 1ZETA 2DNLA 3MUMP 2LEPA 4DQPA 5CD4A 4B9UA 4B3MJ 4MIAA 1TMMA 1YKWA 3IFEA 1JWWA 3IGVA 1NJIT 5CAAA 1MWQA 3UR0A 3RG6A 2HFVA 5A6WA 2HQIA 4K0KJ 5K8PA 3ENQA 5C42A 3LPYA 2BOPA 2POKA 3MEDB 1BXNA 2E1MC 2Z8QA 3CW2C 4RW7B 1RT4B 4TY9A 1U25A 2WTFA 4M5KA 5CZXA 4OLPA 1YBUA 1U48A 5DGAA 2H5JB 3IR6B 2FLOA 2G0IA 4B3SF 2FHOB 2QFJA 4CT8A 4RX6A 4KKOA 2QV6A 1PO6A 3DRRB 5J1NA 3QLHB 3TNVA 3A8EA 1R6VA 4KYZA 4QWEA 3G9CA 5DETA 4JI2F 2CJQA 2V68A 2MPUA 1T7PA 1FFGB 1S6PA 1EQMA 2NPIA 3GILA 4KR0B 3G2XA 1HD1A 2WSEC 2UUBF 3HFVA 2LA6A 2I5JB 1GTHA 2DXEA 3MEKA 2MYFA 2Q2KA 3LP0B 4WP8A 3DRPA 1D9AA 4DUYJ 2V50A 2HSEB 3CD5A 4LF4F 4KV8B 3D5MA 2OPRA 2B0GA 5KFIA 4KRWA 4K5SA 2IBKA 1TUVA 2ZVIA 3HD1A 5IT0A 3P3DA 2C2DA 2O1PA 3R27A 4C48A 1Q8IA 1UFLA 2NYIA 4URSA 3EE3A 3MD3A 3S6EA 2IAJB 1LNQA 5F0UA 2J6SA 1BDTA 1H72C 4TQRA 2PI5A 4ANDA 3DDKA 2HWHA 4LMZA 3SIPB 1N6QB 4MKYA 3VGVA 4I2QA 2MKJA 1U0HB 3MEEB 3POTA 4GMKA 3HJFA 1PKUA 1QY7A 2CQBA 1R8CA 5L38A 2ZEJA 3H87C 2IM1A 2K1OA 4DBQA 1RAGB 1LFPA 1N54B 1DQ8A 1W2BR 4Y3CA 3C16B 3EGWB 4LSNB 4C7QA 1TL7B 5KT7A 2H5EA 4I6WA 2J0QD 4CLLA 2CQPA 3DOMA 3J7Z5 1WUUA 4FXWA 1RTIA 3ISNC 2JBVA 2H65B 1K47A 1SL0A 1MSWD 2VBXA 4JI1J 4R0JA 5AXMA 1JXLA 1HBUA 5CXTA 3SSQA 3VEBA 1SJQA 3EYZA 4LUBA 1R0CB 4LQ3A 3KLGB 3CVKA 2XMJA 2ZWPA 1WOSA 4RPFA 1DLOA 1BHNA 4L73A 5I3UB 5D3GB 1T8EA 5D0EA 3GIJA 4WTOB 3ZZPA 3GFXA 2GHPA 2JFDA 1ZBTA 3MM5A 1VGYA 2VU5A 1BQNA 2KL8A 1Y9OA 4TVAB 1HLWA 3QJJA 1RBLA 2BMBA 2ZJQQ 2CG4A 2HWIA 4I2PB 2OPPB 5HLFA 4Q45A 4NYPA 1W25A 2VG7B 1WSRA 4E8UA 2CJKA 1FE4A 2VJUA 1S1XB 3WIVA 4ITSA 2YWEA 1BD6A 4TKTA 3WBZA 3OFHA 4WP9A 2VF3A 5B0BA 4O0NA 2VODA 1QTNB 1NNDA 4ENOA 4ZVGA 4C11A 2CNKB 4JB8B 4K2JA 4XDDA 2FHJD 3GFHA 3TJAA 4RW8B 2CJXB 1CJKA 4QCLA 2AV5A 4PPZA 4C8NA 1M5HA 4C0BA 1R6YA 2FYXA 1DRZA 1D9FA 2AZ1A 1OY9A 4ZP8A 5BYSA 4B3RJ 1RZMA 4ZVUB 3SQGB 2HRTA 1YJ7A 1G2EA 1HYSA 3T1HF 1XMQJ 4B3TF 2AF6A 2E5JA 3HULA 3TZXA 3BSOA 3GFYA 2XS2A 5IC6B 2NUUG 4XAKA 4EMDA 2X7IA 4OHXA 3C6TB 2J8AA 3CCRS 3IAM9 4U7UK 1TVRB 4J9OA 4LF8F 2HRUA 2K8GA 4ED4A 3KNGA 1HNVB 4DMZA 5DLFA 3JSMA 4WFZA 1OWXA 1XMBA 1F2HA 2DH8A 2OGUA 1NRKA 3AH6A 1Q53A 5JXSA 2MZSA 1MMLA 4CYUA 1CC7A 1M1GA 4ZPVR 1RWVB 3DLLQ 2QL7B 4LF1A 3M2UA 1U8WA 2HBYB 4ECYA 3MM7A 4KBIA 1SQEA 1R8BA 2M52A 3HCXA 4K4TA 5A8KB 1YJUA 5IC4B 2V8HA 4ECTA 5KT2A 3Q0AA 4I67A 2AYEA 1RTHB 1RDRA 5ETRA 1JLBA 1D0EA 4CLZA 1CPZA 5E3AA 3L7UA 3A8KA 1SC4B 5H9FJ 1XNRF 1PAEX 2MKCA 2K06A 4CLSA 1AXQA 1VQ8S 1UVJA 2AJ0A 3HVTA 3R5GA 1YJ9S 2OLWA 3N0VA 2B4PA 2DNRA 3ZTRA 4P71A 5EGYA 4DV7F 4V19X 3TVZA 3O1LA 2A0FB 5F9NA 4C8ZA 4O4GA 4AE5A 3RU0A 5L46A 5D77A 1QSSA 2HK2A 1REGX 2ZHAA 5CYQA 3E3XA 5AXNA 1V5IB 2FVRA 2QL5B 4RUBA 3N6NA 2LU2A 3UVJB 3EXCX 3M6WA 1BWEA 4D3GA 3QGHA 2FHMA 4LF9F 2AJQA 2OPQB 3OHAA 2HZCA 4MMOA 3DLGB 1RT1A 2YWGA 3SFUA 1MW7A 4ZPTR 2EI5A 2C2NA 2AT1B 1I6JA 5ADZA 5C25A 4LFAF 3MEGA 3QATA 5JJBA 2W8KA 3ILLA 2F4VF 4X62F 2FVSA 1CG2A 3K59A 1CQMA 3JSYA 1DAXA 2HHVA 4DV2J 2IRXA 4MJWA 5LSLA 2ZUAA 2MZJA 1N0UA 1K44A 2CKWA 2DITA 1WF2A 1U47A 1M1HA 2DTJA 2G4BA 4OMFG 1SH0A 5CYJA 2Q79A 4DLGA 4ZIWA 2ZE2B 2FC9A 3O44A 3LGMA 5L1IA 4YMEA 1NCLA 2DEJA 4ZP6A 2YNHA 4TYAA 4UOCA 2HURA 2AJFE 4M5DA 1XC9A 4ICLA 1ZA1B 2W2MP 1WKKA 1NK4A 1WACA 3QIPA 1S6QB 3F73A 1RTJB 1JLFA 1YJTA 3IR7B 2VC1A 4PXBA 1VQ4S 1G6BA 3HHLD 2G0CA 3O8WA 1RT2A 3MM6A 3NBPB 4J9NA 2KT3A 2W2NP 1PJ7A 1RLDA 1ZAWA 2NQPA 3W5XA 1HFEL 5E3CA 2KRBA 4IQMA 1XMOF 4MFBB 3T9NA 3CPWR 1FTCA 4USIA 5A2QU 2XCPA 4U7UD 1H74A 5HVHA 2H51B 1HPZB 2AU0A 4ZP7A 1PSDA 4WXWA 1U1LA 2CPFA 4KH1B 2D1CA 2ZZNA 3IM8A 3HI9A 4GO7X 1A7GE 2GA7A 4LIWA 3DM2B 1QE1B 4OYPA 8ATCB 4QWBA 3FKBA 1QTMA 5DS7A 2FHJA 2D7SA 1Q8LA 1U4BA 5D4LA 2B51A 4WE1A 2DR8A 2DGTA 2J8SA 2HAIA 1KC8T 1S0VA 3M05A 1N32J 2IVMA 2RKIA 3T1YJ 1Q16B 1U6ZA 2Z2YB 3D54A 1W2IA 5CYMA 1YBAA 2KYXA 1O5JA 2D3ZA 4I7FA 3I56S 3TARA 4U95A 4C4WA 5A8RA 3AJDA 4H4OB 2Y1JA 2K5JA 1ARQA 1HA1A 1K73T 1TZ0A 3JB9k 4IQXA 1FDNA 2KKEA 1RWOB 2FLLA 1FWLA 4FN5A 2JXGA 1GK8A 2YPZA 2N3OA 1HMVB 2HHHJ 4PWDA 3HSDA 5ETNA 2R7RA 1IWAA 5D0HA 1FDDA 2KXNB 3PXGa 1UVLA 3FQKA 2CPGA 1C0TA 2MQLA 4JI4J 2HMIB 4NMLA 3GG0A 2JRSA 2SXLA 3P4UB 2VONA 3TUPA 4ELTA 4J91A 3V6JA 3DOKA 1U1MA 1PAUB 1WDDA 1WG5A 4OV1A 3OXFA 3KG0A 2L9NA 3QT6A 1GXLA 1SPBP 1JIHA 4W90B 4KFBB 3LA0A 5GAHI 1FKOB 4K4SA 3FMWA 2RHSB 5KFMA 4OI2A 2KU7A 2O01C 1Q4RA 1VR6A 2J6TA 2XHCA 4G65A 1P1TA 1N5YB 5KFNA 1HBNA 2XM3A 1TAUA 1D1UA 3OBIA 1QAIA 1D09B 1T0TV 1V5VA 4KO0B 2XTDA 3UD3P 1FT8A 3X1LB 3ILIA 1XWLA 4ZLNA 2JDJA 3NWRA 4AAIA 1KTQA 4FF1A 3PG9A 2DISA 1TKXB 4O3QA 3HVRA 1FXRA 1UA1A 1EP4B 4F26A 2N3LA 2WHOA 3I55S 4MAKA 3QPIA 4KPCA 1S1WB 4LRCA 3OUYA 4F50A 1TKZA 3DHWC 2WAQD 2ZH6A 4ZVRB 1R8AA 4Y34A 3PX4A 2VBZA 2GJ2A 4V19J 3NY0A 2NS1B 5F3TA 4ECZA 1LWEB 2ZH8A 1VQYA 3RW6A 2F7VA 4PUOB 1OPIA 4MYUA 1BDVA 2UXDJ 4I4BA 1S6OA 3OTEA 1HBMB 2EFQA 4LF2A 5HVGA 2HLUA 1WHVA 3EVOA 4DQSA 4UY8T 2CQ1A 3TUIC 4P2XA 4NLSA 3NGUA 1JKHB 3NCRA 1UWBB 3MEDA 4RW7A 1RT4A 1FD2A 3PYGA 4Q8EA 2BABA 1VJQA 4USJC 2H9ZA 3DLKA 1MWZA 2QO3A 1HHQA 1RWKB 1HHTP 4WFBQ 4YQWA 3G8SA 4OQJA 4O3NA 4RNFA 3CT9A 3IC1A 5KFQA 3DRRA 4ZN1A 4EUVA 3E2EA 4JV0A 1S97A 1RWXB 4DFPA 1V3SA 2KO1A 1KVJA 1RT5B 4TLRA 1YWXA 1IKWA 2AJ4A 3G8TA 1RQ0A 4DXLA 2C3UA 1SKUB 3JQJA 1J27A 1KQSR 3FEYB 2OTJS 2XO7A 2ZD1A 1FXLA 1NH7A 1WC1A 1U1KA 2V9KA 4CTAB 3LP0A 3PJ9A 4P72A 2NREA 2IJFA 3V4IB 3FZ2A 3HP6A 4KV8A 5ETVA 5IWAJ 5C24A 2XYGB 2MQPA 2H48B 2W1BA 2F40A 2O5DA 3PHEA 5J2MB 2IFXA 4ES1A 3KK3B 2PC6A 1EA4A 3KK2B 2HIQA 2JL9A 4DR6J 2Q6CA 2VZ9A 4CI0B 5DDRC 2CJAA 4GC6A 1EX8A 1F2GA 2PIIA 3CB4A 2RU3A 1WSVA 2LMIA 1Z4UA 5FDLB 2IAJA 3Q8QB 3U27A 2YKPA 3Q8PB 5J1PA 3KHLA 1S99A 4TY8B 2EFGA 1JJ2R 4USWA 1L3KA 3JQMA 2YBVA 3IBWA 3DMJA 4DFKA 3OFGA 3CEDA 1A6LA 2IDEA 5DQHA 1U0HA 4J9RA 2BX6A 3BYRA 2VBYA 4OZ0A 2HKEA 5C7PA 2D9OA 2VPXB 4DL7A 3HHNB 3SV3A 3PO4A 1IWGA 1WELA 1LXJA 3C16A 4LSNA 1TL7A 4B9MA 2L3MA 1KN6A 5KG4A 1BAZA 5IFMA 4U6PA 4GKKF 2QA4S 3DLJA 4K4VA 3MZIA 2ZVSA 3NL0A 2RU9A 4CNYA 4RBTA 4EU0A 1H38A 1S57A 3TRGA 1ZM3A 3UCZP 2I38A 3KLGA 1RISA 1MYLA 2EKNA 3WZ0A 3A4TA 5I3UA 3R7BB 1TL1B 2LP4A 1VBZA 5D3GA 4C8YA 4HL9A 3BN4A 4JI3F 4IR9A 4A46A 1AYEA 2JH3A 1H98A 5E3QA 2A2BA 4ZKAA 3OLAA 4KAIA 3U7JA 2MY8A 3G82A 3PRDA 2DHHA 1NSKL 1UVNA 1AUDA 3UN5A 4EK2A 1NHUA 2FZGB 1QD1A 1WORA 1N5SA 3QZ7A 2UXBF 1SV5B 2DNKA 2VG7A 2BNWA 1DTQB 1FEEA 3NKYA 2YTCA 1UW9A 2AD9A 2W9CB 1M5SA 2MKYA 2RJZA 3CDEA 2XNRA 1FDBA 1NUEA 1XEZA 1MWYA 4PZVA 2H54B 2IHR1 2NXJA 1RHJB 3WX4A 4ILRA 3KLHA 1VDHA 4RW8A 4DV3J 4RL1A 5JUMA 2DNMA 3AD7C 5G0RB 4Z7CA 1IM6A 2VOPA 2XB2D 2KHCA 1EJ7L 3SQGA 4OYMA 2C2ZB 3M8QA 4BC9A 3IN5A 1S76D 1FF2A 1H7XA 4L75A 2RMLA 5HJYA 4NZ6A 4LSLA 2V4JA 3VW4A 4AFFA 3GJSB 4DV0J 3GG1A 2BE2B 3RBZA 3G96A 2OIHA 4OYXA 3C6TA 1TV6A 2HVEA 1JLAB 2R2UA 1G7CB 1TVRA 3I5BA 1RAIB 3OSNA 3LALA 2B4VA 4OFZA 4X4VA 3DRSB 2DRBA 2ADLA 2IC3A 2R2RA 2R2SA 4QU7A 3NG8A 1GT8A 2ZH9A 4CH0S 1TL4A 5D0RA 2EVZA 2PE8A 2OUGA 4X4PA 3RW7A 1CQNA 4DX8H 4LF6J 4OX9F 2JXHA 1HNZF 1S1UB 1RTHA 1XK8A 5K14B 4DQRA 1RBAA 1WWHA 3PEJA 4J37A 1C2PA 1B99A 3W9JA 4H4KC 2IRUA 5J2QA 3PY8A 3OTOJ 1IJEB 3BGFA 2DH9A 4YB5A 3CCWA 1UVIA 5B0GA 1NHKL 3L7PA 2BR0A 3AD8C 1RAEB 1YJWS 3DDNA 4OZ5A 3RJMB 2EEYA 5I42B 1CJTB 3ICLA 1IVZA 1FESA 3TA2A 4BWMA 5BR8F 2H3EB 4Y2MA 3RTVA 3W7BA 5J1EB 2YQ1A 3FJ2A 2E5IA 1RWPB 2DVIA 4OZ1A 1H3DA 3V6HA 2Y9HA 3CUNA 1QSYA 3LP2A 3DLGA 1TKDA 1Y3KA 2GAGC 1UL3A 4A8QA 2W4PA 1RA6A 2KXHA 1R0AA 3H25A 2UUCF 4PXDA 1MROB 3UDEA 3NS7B 1DQ9A 2EK6A 2KZZA 3HXMA 2Y3YA 4XTTA 4B3OB 1XNQJ 3CJTA 1RWUA 5F8JA 4IUFA 1NPKA 3LAKA 3AX3A 5C2CA 1PILA 1RHUB 3A8JA 3NCPA 1X8DA 4WFNQ 3J7AN 1R89A 5A8WA 2CPXA 4B3MF 3OFEA 3DNCA 3PDNA 3KDNA 1X0PA 5DG8A 3BR8A 5HROB 3UD5A 2GJIA 3PX6A 2HBQB 4K0KF 5L9XA 2B9EA 4UZBA 1PJ6A 3W60A 2EFOA 4U8VA 4RWWA 5A2QY 1R0BG 1N48A 1X4AA 4WFXA 1RT7A 5HO4A 4EYIB 3HZGA 3U1NA 2XMAA 4BWJA 4FNIA 1R27B 1OIAA 4NCGB 3IR7A 3LAMA 2HGMA 3BSAA 3V6DB 5KT6A 2BRLA 3UW1A 1VQLS 3NBPA 4R5PA 1JLGA 3RBDA 5C2GA 3DOLB 1RT3B 1K1SA 2PO4A 2CAJA 3J81U 2HFSA 5KFOA 4G6VB 4QIWD 3QWUA 3BDEA 1AT1B 2W9BB 4NLUA 3V2UC 1HW8A 1YK9A 1HPZA 1UA0A 3CJRA 1VK3A 4U96A 1RK8A 4IFVA 3FUYA 1S9FA 5K8NA 3SCJE 1Y5LB 3R6LB 1RU2A 3DM2A 4FP9A 1U6BA 4DUYF 1YDLA 2PD1A 1XN9A 2P9GA 3RBXA 3T5LA 4IH7A 4OJGA 3CCZA 1CJUB 3A12A 4DPWA 2CJ9A 4LRDA 3R97A 3VCDA 2AQ4A 5EHHA 1ZA2B 1KFSA 4FVCA 4WIIA 3EZOA 1S1TB 2E7XA 3M4XA 2FZKB 4ZCKA 2MQ8A 2EG2A 2PA8D 2G2YA 1HIYA 3P8BB 3BKTA 3IBFB 1LW2A 2F8HA 1T9VA 2J7WA 1FTRA 2B56A 2VBWA 2VA3A 1MMNA 3PW0A 2VQEJ 1UWAA 4I56A 4Z37A 3B78A 4U9RA 2V6AA 5IM0A 5IS2A 2V2ZA 2BA3A 4WCEQ 1ZZNA 4IDKB 5A6PA 1VCTA 4DR1J 2FJXA 1UW4A 4NPOA 1U9PA 1Y10A 3FVYA 3MWBA 3WIUA 4OYBA 1SL2A 9ATCB 2VICA 4WBFA 2BACA 3OR2B 2FD2A 5THWA 4LVNP 3GV5B 3HHLC 1UCNA 2Q3PA 4D8JA 5AE2A 5GMKa 3ENAA 4DHVA 2RRBA 1NJYA 1EIYB 5DG7A 5IT4A 3KLFB 2L41A 4QR1A 5DZ6A 1EZZB 5L39A 1FRMA 2DT9A 1VC0A 3MM8A 2DGSA 3FCHA 1WC4A 4O44A 4KPYA 1FERA 2Q66A 1K9MT 4JI1F 1FKOA 5KFPA 3CDBA 2CZVC 3N01A 3QFWA 4WYLA 3VR1A 4ZPBA 2YKNB 3BSNA 4NOHA 1E6YB 4OYAA 2HW3A 2OSQA 3I0SA 3NWGA 2HFZA 7FDRA 2QC3A 2WSCC 3ZTPA 1N5TA 5LMNJ 1SH2A 2DHGA 2GGPB 4D3HA 2F5GA 3WC0A 4OYOA 3TAPA 2EFNA 3A3NB 5DDPC 3JTOA 3KJVB 2EK1A 1YLXA 1REVA 4KH0B 1EP4A 4HHHA 1VIXA 1RJJA 2V63A 4PQUB 3GLJA 4ZJOA 4NI2B 1S1WA 5KFCA 3KK1A 5FLXY 2UVRA 3CDWA 5HBMA 2VHGA 4B9LA 5K9FA 2DR5A 2CQHA 2OAUA 4NCAA 3G8QA 2RDDA 2C2RA 1M90T 1RT6B 1QJHA 2M9KA 5M2UA 1VBKA 4OHWA 2IIHA 1HQEB 2QRRA 2AYGA 4ZLPA 1DURA 1NDCA 2C22A 4PUOA 2QA4G 3BGRA 2YNIA 4CH7A 1I3OB 1O8BA 1NSQA 1ZPWX 1NMEB 4IG0A 2JWNA 1CBKA 1DQAA 1SVDA 3FCWA 1P6TA 4EGLA 3CC4S 4KKOB 1RTDA 1UWBA 4B3RF 4DPXA 1HI0P 1KKHA 3ONQA 3MMCA 1B0TA 1S10A 1XMQF 3D7SB 3UR3C 2XS7A 4JI8J 5GMEA 2HHUA 1UJ5A 3OHBA 1N36J 1RYSA 1LW0A 4F02A 1S6PB 4I1TA 3VTIA 2EG1A 1SKWA 2DHXA 2X3GA 1N8RT 5AE3A 3FSIA 1UP1A 2AIRB 3DFEA 1NKEA 5MAOA 1RT5A 5CABA 2QTWA 2OPRB 5DQGA 2CQ3A 2MLYA 3OV7A 2JLFA 1C1CB 3JTNA 3ZXWA 3M9MB 2BQ3A 3TR5A 1V3ZA 3MR6A 1IR0A 3K0JA 4V1Ak 4CTAA 3QZ8A 3DGPA 5BJRA 1ZOTA 3VV2B 3NEKA 3SFGA 4PXEA 2ASYA 1XR6A 4QYRA 5L8RC 2AGOA 3MD1A 5CHCB 2KXFA 2RQKA 3T41A 5KFJA 3KK3A 1IKXB 1YX2A 4QPTA 2D9PA 2YX4A 1QVGR 4ZPAA 3KK2A 2PI4A 1XJWB 3EDRB 1NHVA 1DZ5A 4MK9A 2YNGB 3CJSA 2AX0A 1N4LA 3NOGA 4KC5A 2J0XA 3ILJA 1NDPA 3POTB 3OTDA 2Q6BA 5FDLA 4ER8A 2ZOMA 3QFHA 4LR8A 4M1KA 4Q8FA 2HFOA 3MOJB 2DD8S 1F5AA 4DR2J 4IO1A 3OR1B 2JEJA 1X4HA 3Q8YA 4P2MA 1ARRA 4JI0J 3Q24A 4WK1A 1NK5A 3W2VA 3KUHA 3OLBA 3EX7B 1J5OA 1RTIB 2CNLB 1VMBA 2UXCJ 4DN0A 2A2CA 1YG0A 3MR3A 1ACMB 4WWSA 4C9DA 1Y11A 4OX8A 2CIMA 3BGOP 1IRQA 4N77A 2FGCA 4FPIA 4XPEA 2FJBB 4DV4J 2ILYA 3DN9A 4JV1A 2HIYA 3D0HE 2AY0A 3MUVP 4A8WA 4YB6A 1QAYA 3MM5B 2G1DA 1P9QC 1SIWB 4DV2F 2M88A 2ZFHA 2MJUA 4DPYA 4DI6A 3MR2A 2KVQE 4YB1P 3AOCA 1ZYQA 3BDPA 1TL1A 3K5OA 1GQEA 3M1VB 5HLFB 1JXVA 3I6PA 4H4MA 4AUKA 4DF8A 1RWWB 3EM1A 1NH8A 2YKAA 2JVOA 3TO8A 4IKAA 1X9MA 5T14A 2Y1IA 4LBHA 3FBBA 3OXGA 2F9DA 4PAAA 4DL4A 2LQ5A 5RUBA 3U1LA 4ZVPB 3DLEB 3MXHP 2KFNA 2CDRB 1SV5A 4C11B 1W7WA 1DTQA 1RHRB 4DR4J 4TU7A 2W9CA 5LXRA 1KD1T 1F5CA 1M5OC 3KFWX 4AT1B 4ZLJA 2W7PA 2CWKA 4RNOA 4P74A 5CCMA 2KB2A 3AWRA 3TANA 4RO0A 1T9TA 2VASA 1HYSB 3EZUA 3C2PA 1T9UA 5KFYA 1Y3JA 2B8PA 4Q2MA 3LW5C 4I6YA 2D41A 4ZP9A 5EX0A 2D68A 3AOAA 4J9MA 2P6SA 5G0RA 2F63A 1C1BB 1JMTA 1JJHA 4CLFA 1ZTTA 1SKSA 3CCVS 3RR7A 2GAHC 1NLKL 3GPAA 4IYQA 4OZJA 5GADU 2IA6A 2B4UA 4HTJA 3GJTB 3JSMB 2BM1A 2RS2A 4OI3A 2QGFB 3MPVA 2BE2A 1RCXB 4OJ1A 3I4PA 2BBEA 2YQ3A 4CLTA 3VQSA 4CYUB 2QYGA 2V9WA 1HL6A 3Q8SB 2KFYA 3C8YA 1G1XA 2CPHA 3M2UB 1TR0A 3CWJA 3FEZA 1D9DA 3PR5B 1N32F 3PFEA 3O3LA 2NYHA 3NGDA 2HQDA 3T1YF 3A3PB 1AB8A 3FMTA 2BQUA 2GW8A 1KBRA 4RUCA 5KG6A 3Q86A 2Y1LB 3M6VA 3CDUA 4ZN3A 1JXEA 4CM0A 3HVWA 1KVKA 1YTYA 1LKZA 3Q8UA 3KHGA 2G13A 4LFBJ 5GAEU 3BH6B 2W4CA 3HVTB 4RW4A 1S1UA 4J5OA 1HQ2A 3PJXA 2J5AA 2HHHF 2XZ2A 4ED0A 5K14A 4N7TA 5KFGA 3BM7A 3UCUP 3PW4A 2OHDA 3H5XA 4DL2A 5ETTA 3BPDA 1Q82T 1CJVA 2DPIA 4M63A 5ETSA 4F3QA 4JI4F 2XULA 3IAS9 3NOCA 1NK7A 2OPSB 4UY85 5CYQB 3C6UB 2YNFB 2EKYA 2VFSA 2H4WB 2N7CA 3IWNC 1YRXA 3E51A 5KFEA 4A8YA 1RYRA 4FF3A 4NLOA 4C8LA 2VG6B 2ZOGA 2OJ3A 4Y2IA 4NLGA 2ALYB 3TA0A 3V5RA 2QA2A 5HN0A 1FFWB 5C25B 3MEGB 2FPHX 2NXEA 1WJ9A 1YZ7A 4WK3A 2AGQA 5J1EA 2CZ9A 5LT5A 2MQOA 3ETOA 1K8AT 4KHMA 4EO8A 3KTQA 3HO1A 2JLEA 5C5JA 1VQ7S 3VAHA 2Z4PA 3B4DA 2XMWA 1Q78A 3T5JA 4PG7A 2ZH2A 1IQTA 2HGNA 4N8NA 4DL3A 4F0KA 2KM8C 1CC8A 5KFLA 2HYIB 1CS4A 3W9HA 4YHHJ 2ATLA 3P45B 4JV5J 1MROA 4C0HA 3CCLS 4FXDA 1WC3A 1GFWB 4B3OA 3NMAA 2D3UA 1DARA 1I51B 5U47A 1R7IA 1OYDA 1VQPS 3THVA 3NLCA 4J9KA 5KFBA 4M5DB 2BOAA 2IA0A 2QSFA 1HW9A 4ECUA 2UXDF 3B82A 2ADCA 5KFUA 3QIPB 2I2YA 3PNIA 4ZIVA 1RCOB 2XMMA 4AQYJ 4KY3A 3CJ3A 2C28A 2QLFB 1PGZA 5HROA 2VKZG 1UETA 2A6MA 3BO2A 3J81Y 3M32B 2V8GA 1RT2B 4LRAA 3MM6B 1X93A 3R3TA 3H42A 5KFFA 1S4EA 4Z7YA 2Y1RI 1I1GA 3GB0A 1FFSB 5A76A 3VEAA 2DGWA 1SXLA 2JVRA 4CO1A 1AFIA 3EGVA 5DRKA 1WI6A 1FWPA 2VG5B 3V6DA 1JJ4A 1RTZA 4FYYB 4PEOA 3M8YA 4DR7J 5T7LA 4XIUA 3V6KA 2GZOA 3LWMA 1TFWA 1YI2S 3OL9A 4RNHA 5IT9U 4A8XA 3W8GA 5LOQA 3TP2A 2ACMA 4RZRA 2MGZA 3GYGA 2W9BA 4Q5VA 1NB7A 2N7YA 2I6WA 1KHVA 4YDXA 1B28A 3CC2S 2GMLA 4UF4A 3TAQA 2JJ4D 1KQFB 4WE1B 2MJNA 1X60A 3AX2A 2PA3A 1KDNA 3LP1B 2E9TA 1J2VA 4DWIA 5IWAF 4TNOA 1B01A 2Y8WA 2RQMA 3D6FB 1F9EB 5A8RB 2O67A 2HQ3A 2GO9A 2WZ1A 1M1KT 4DR6F 1YSJA 2BANB 2VKRA 2ZBIA 4Y00A 5EWFA 3F41A 3PFOA 4PQAA 3P5BP 2PMHA 2KI2A 3CJ8A 2XC9A 5EX3A 4HACB 4UZCA 3CD0A 2J0SD 3TUZC 1KWMA 1C0TB 3CXCR 3ZTOA 3BSCA 4NYOA 3PW2A 1K0TA 3DI6B 4ZVEA 4C2MA 3RB4A 4YB7A 3S7RA 1QUVA 2VQFJ 3MOZA 3DOKB 3DXSX 2E1AA 4ELUA 3MHYA 5AJ3J 3G5OA 2VJVA 1DY3A 2J9DE 3O2IA 2NLWA 4A8OA 4ED8A 2B9XA 1H0HB 2CQCA 1FXDA 4K7QA 2K3IA 2RNEA 3GFZA 1IM4A 3B54A 4S0MA 3HPOA 3PKMA 1S49A 4F3MA 3QAEA 1N5VA 4P52A 1S48A 5HQ8A 3OTBA 4A48A 1PCAA 2R7VA 3QSIA 4Q0BB 4QIFA 1SJ4P 3JTPA 1U45A 1UVKA 2C2MB 1JLQA 3OT9A 1PBAA 3OUYB 1FNMA 2I0XA 1RGVA 3AB4B 2PMZD 1JJCB 2X1GA 2L9DA 2CQ0A 3FSXA 4JUZA 1TP7A 2UZAA 3A8IA 3GV7B 1S77D 3BV8A 1QTGA 4PQUA 2YWFA 2HAFA 2B7BB 1Y00A 3ZFVA 1T05A 2B9WA 4NI2A 2V2VA 3D9BA 4WZQA 4FYVB 3KJQB 5DDOC 2H1OE 2OEKA 2LU1A 3DU5A 1X4DA 4J9QA 3PR4A 3AJ1A 2MHEA 1RT6A 1RI7A 2LVWA 4ZJQA 4EBCA 1KHWA 4A8MP 3LOUA 4DOZA 1HQEA 2BV3A 1Q8KA 1TQLA 5KFXA 2LA4A 1RSCA 1SI9A 4P2SA 3Q2SC 4F36A 4RNMA 5ETOA 4PYAA 4X2BA 3TZWA 4WTYA 1SJFA 2D74B 4YY3J 2R8HA 3DLKB 3T1AA 2DNHA 1BUXA 4DV3F 1QLNA 4RJVA 4ME7E 4DSIA 3GU0A 1JLCA 3G71S 4FYDA 4FYWB 3K17A 4ZVOB 1FCAA 1Q79A 4EFAC 1FRIA 4PG5A 1T9YA 2RIJA 4M95A 1HR0F 1TL3A 1EETA 1T03B 2ROPA 3MFHA 2Z2ZA 2ZWOA 3AJ2A 1F9HA 2AYBA 2GHVC 1H7WA 1IKWB 2DJWA 4DV0F 2DXDA 5SUHA 5KFWA 1U1NA 1ULRA 2DH7A 3H2LA 1P9YA 2ZD1B 1VC5A 4USTA 4DCPB 1EAYC 3SCLE 2OD4A 3HHLB 3M9NB 2DK2A 1KP6A 3I31A 3KG4A 5C24B 5HMWA 3MR5A 1C1CA 2OO4A 2UVUA 5LMUJ 1FJ7A 1C4AA 2RAQA 2GQCA 3FBFA 2DCLA 2RQCA 1NO8A 3DDIA 4LF6F 1U26A 3THTA 1GMWA 1HNWJ 1VRUB 2QL9B 4CLYA 3PRVA 2PSZA 2QZ8A 1HWJA 3M30B 2KDOA 2BDPA 3OVBA 2JEIA 1A9NB 3VAMA 5HANA 3CNQP 1WC6A 2BW7A 2V67A 1IKXA 2MKIA 3OSPA 2IM0A 2YWKA 3OL7A 4HT7A 2ROGA 4O3RA 1OS5A 2YNGA 3RRHA 3OTOF 4UQGA 3DMJB 1S6UA 2JX2A 3HMJG 2X3DA 4UW2A 1UZHA 3NGTA 2R7WA 2CFXA 3P96A 2XMUA 2RB7A 2I8EA 3ENVA 1OSDA 1KVIA 3J81j 5M2RA 3NS5A 3NO7A 1U09A 5D0GA 1U1QA 3OR1A 4PG8A 4F4KA 3KJNB 3ZZUA 2FJEB 5F9LA 3UWTA 1HWUA 2GNKA 1TFYA 2U1AA 4DQQA 4ETXA 4OZLA 3QWPA 3JYTA 3QAUA 3K5MA 1PBUA 1KONA 3R5CA 2IMOA 1VLOA 1Q7LB 3R1HA 2KTQA 3LJPA 1AZSB 1TTHB 1RHKB 1TMJA 1YRTA 2FLPA 4I64A 3H59A 3IRWP 2DGXA 3PRBA 3KUGA 4HLBA 2NZCA 4ECVA 1XNQF 2GIQA 4DEZA 3G82B 1SIWA 1NSPA 4CLPA 4DZ6A 2WVBA 1QSLA 1TELA 1OSCA 4RKUC 3JXOA 3R5JB 4QW8A 4L76A 4LREA 1VRQC 2DB1A 3FFIB 1FNOA 4YR3A 1RB0A 1N56A 3M1VA 4CIOA 3EMTA 2E9RX 4NRTA 1Q81T 3H2VE 3ZZ0A 3G6ES 3GSIA 2JZ5A 1S0NA 2LXIA 1S5ZA 2HVHA 4FF2A 4NXNJ 3JSRA 4G1QB 2QN6B 4BLGA 2ABYA 4GVBB 4PG6A 1YJRA 3DLEA 3LH2S 5DM6Q 5LL6d 2XCAA 5ETLA 3KLHB 3CSKA 1VQ6S 4KSEB 4WXOA 4LR9A 3AHPA 3NP5A 4TQSA 3P5TL 3CF5Q 3CJ4A 5HI7A 2CNOB 2F8MA 4K50A 2BVZA 2LXUA 3DRYA 2QFIA 2JOQA 3M8QB 2FUG9 4A8SA 4DU8A 3LTOA 4LSLB 2V4JB 5KFZA 2EC0A 1XERA 5H1SV 1VRTB 4LFCJ 1WOOA 1FX4A 2CNNB 3FC9A 1TV6B 4B02A 2PEBA 1YVFA 3QYYA 1TUWA 3C66A 1C1BA 2IPOB 2ADBA 3UNGC 1Q5YA 4ZVFA 1F6TA 4NA1A 3BREA 2MQNA 1O0PA 3GR0A 4ID8A 2IC3B 4MK8A 3IWLA 1YJNS 4J9PA 1NK8A 1LXNA 3J80U 3G6VA 2AEJA 4JOUA 4UUXA 1SUQB 2Q1LA 4DX5A 2XI2A 3GJQB 2VOOA 1PG5B 2LFVA 4AXIA 3M8PB 2LQJA 2WW4A 3PEHA 5L1JA 1FRHA 4DV5J 4EYHB 2CPJA 4JBCA 2BRKA 5GAEI 2DCUB 2VQEF 3BYPA 2WB4A 3QT7A 1NK6A 1WEXA 2OTLS 3K8VA 5J2QB 4DR1F 3BR9A 4JV2A 1KR4A 3ULHA 3MF5A 2E1PA 1FHTA 4ED1A 4P6QA 3A3OB 2ZKTA 2MKKA 4GVLA 2P9CA 3HSJA 2V8PA 2AX1A 2GCFA 3Q2TC 4N47A 3D2WA 3GCXP 3IA0A 2OPSA 3D1HA 1YJVA 3C6UA 5KFDA 2VB6A 2YNFA 2HGLA 3PX0A 4TXSA 1M5PC 3QRQA 1VQOS 2F1FA 2VG6A 3FGVA 3LP2B 2BM0A 4WFYA 2ROEA 2W4DA 3MGJA 1VQKS 7FD1A 1ZS6A 4F7VA 3GMGA 4ELVA 2J7UA 4CLWA 5HVFA 3H8YA 4FKYA 1R0AB 5LMNF 2XYHB 1F3FA 2UVWA 3QJLA 5CD4H 2B43A 3H40A 3O5TB 2FY1A 3MCSA 2HHQA 1VBYA 1R8HA 4IO9Q 1FVQA 3LUYA 3I4HX 2IVFB 3Q83A 4KHPJ 2P2CB 2XLJA 4ZMMA 3MPUB 3VHQA 5A8WB 5ETMA 5D4PA 2CPZA 1S7IA 3GIRA 4DSEA 1FDAA 3IWXA 4NLQA 4QPXA 3GYXB 1ROFA 3VAJA 1RHQB 4FDFA 1GX5A 1NBEB 1KSPA 4ED2A 5E2QA 3LANA 4IOBA 3UD4P 3L09A 2DNQA 1HD0A 3EVMA 5L1LA 3AX5A 1RT7B 1SB6A 4G1IA 5KG2A 1PYTA 4YFUA 2BE7D 5IT9Y 3AA9A 2U2FA 2CXEA 3M32A 5E0OA 4Y65A 4NLYA 2BJDA 4DV1J 4CM2A 3KLEA 3ZTQA 5HMZA 4R5PB 5D6GA 4FVMA 1RAAB 1RLCL 5IQ6A 1JLGB 4DSFA 6FDRA 1GH8A 3K57A 4C8KA 5B0AA 1HARA 1UEUA 4JI8F 2VG5A 4X4QA 3RB3A 4IRDA 2MEWA 3PIOQ 1N36F 3H7HB 1NJWA 4OYIA 2VH7A 4RWXA 1ICEB 2FC8A 4IFVB 5I3PA 3CTRA 4LT6A 2YWWA 4WKYA 2AMCB 3CULA 1X9SA 5BYRA 4OIXA 5F8GA 3FK4A 2JNJA 2XG8A 5AXLA 4W4MA 4H4KA 3EGNA 1S9EB 1N52B 4FPRA 4DFMA 1S4FA 2V4QA 3BQ0A 1RAHB 1KQKA 4F4AA 3UI3A 6AT1B 2QA1A 2PFDA 2KH9A 4PCQA 1IBMJ 2CQ4A 2EPIA 3M8RA 3HLUA 1SQFA 2R9LA 3AXMA 1L3UA 4X4OA 4URQU 3Q8RB 3LP1A 5MLCV 2BZ2A 1WD6A 2QEXS 1LW2B 6FD1A 4B08A 5IZHA 3ZNJ1 5LJ3Y 2DKOB 2LYVA 4TYBA 5IM0B 3CCQS 1X4CA 2BANA 2XMKA 3BGLA 4X4NA 4K4WA 2HBZB 1H6KX 3NGRA 3KMQA 1MN9A 4HACA 2MTLA 2QIFA 1LWCA 2WBRA 5H9EK 4LBIA 2KM8B 1DTTA 3N28A 3QMQA 3AA8A 2A6OA 3PIPQ 3R5DA 3Q89A 3DI6A 4ZA1A 5AXKA 5HJXA 4DR2F 4DV6J 4CT9A 1BQMA 4IRKA 3KLIB 2C3MA 3OTCA 2XSJB 4X4RA 4JI0F 3KMSA 4N5SA 2K7KA 2C3OA 3MM8B 4I69A 3CJKA 2UXCF 2NXNA 2OI2A 3IBCB 4WIQA 4O44B 5DM7Q 1IKVA 2CA9A 5J2PA 1E6VB 1X31C 3UFCX 1S7HA 1X4EA 3I0SB 4DV4F 2XMTA 2QMXA 1F3VA 3VWSA 3LO3A 3OW2R 2K1RA 2ZH5A 2ZITA 4NYZA 1REVB 4Q0BA 1FNXH 1JLEB 5HAOA 1Z2ZA 4DPUA 3KK1B 1CLFA 5HBMB 2YKMB 4ED7A 2VL1A 3PV8A 4QW9A 1SJRA 2CVEA 1VIOA 4EBEA 3NGKA 4NEYA 1KEKA 1NKCA 3D6TB 2XMVA 2B5JB 3TWZA 2EW9A 2IYIA 4ILMA 2FLNA 4CQ1A 4P2FA 4DL0C 3BGRB 4Y28C 2YNIB 2HEKA 2CADA 2M8DB 4UOGA 4Q44A 4DR4F 4IG0B 3OL8A 5G4DA 2G2ZA 2HVIA 1M5KC 4F0HA 4DR5J 1U2FA 4M5HA 1ZZFA 5FLXU 2YY3A 4JP8A 2FDNA 1RTDB 4R8UA 2NSBA 4X64J 2VC0A 4PWWA 2DY1A 2HNZA 1IR2A 1FWKA 2Q43A 3MMCB 4OV6A 3HJVA 1T02A 3EXYA 1MU2B 4USUA 3VZIA 2CRLA 3AT1B 2COLA 1LW0B 5KFKA 3PYEA 2HS3A 3R9LA 1H73A 4F4YA 4Q43A 2R7OA 4DL6A 3RB6A 3FCVA 1T3NA 3PVXA 1WG4A 1T03A 4OJHA 4AL6A 2HZVA 1BQXA 1VFJA 3BBFA 5KT5A 3SSSA 2CPIA 4OHYA 1X5OA 1B7FA 1VJWA 4CO4A 1RUSA 5KG0A 2X1BA 3L9ZA 5DG9A 3HHLA 2FY8A 3N4WA 3DGPB 2FQQB 4ZCIA 2XY6A 1R3NA 3IRXB 4J90A 1QUPA 2V94A 3PM9A 1VQMS 3MCOA 4MTPA 3MDFA 3MECB 1VQ9S 3K5NA 4LQ9A 2QLJB 1T11A 2WONA 2IYGA 4K4UA 1O6XA 3DGVA 4CDIA 2ZJRQ 4LFBF 1TU0B 4ES2A 2EXUA 1NPRA 3SCKE 1VRUA 5KTQA 1X5PA 2H5IB 4XK8C 3M30A 2BKNA 3M2RB 2XYPB 2G0JA 2L08A 2DR7A 1NXIA 1FEHA 5CH7B 4JYAJ 3FQLA 5HQLA 4F2SA 5KFTA 1EB0A 1SJ3P 2EWHA 2L48A 4GKJJ 3MPDA 3D1OA 2WOMA 2OEJA 3K5LA 2M7SA 1T9WA 1X9WA 4QWAA 3KDOA 3PHTA 2ZC4A 3W2VB 1NJZA 2ZZTA 1J5OB 1WNEA 2IM2A 1N34J 4EWTA 4KJIA 4LR7A 1SC3B 2KZMA 1S9GB 2YXLA 3PJWA 1CULA 5KG1A 1HWKA 4X4UA 1V9OA 1KTVA 4HH1A 4ZITA 1UFKA 5K20B 4YDDB 4RW9A 2IBOA 3ELHA 2VIHA 1IKYB 2I1RA 4Y2CA 2WBMA 3QOQA 1JNRB 2ZM6J 1X4GA 3PCOB 5DQIA 4KT0C 1S1VA 3HSGA 1ZM9A 4OI0A 1WI8A 3P6YC 3TJ8A 4AL5A 4ZJLA 3OL6A 2JSXA 5KOXA 2ZNZA 2BKPA 4RR5A 1AZSA 5CA5A 2LDYA 5KT4A 3MTKA 1RACB 5J2NA 3HVAA 4YHHF 2HNYA 4H4MB 4JV5F 4ETZA 2ZBCA 3VGSA 3ADAC 1YBTA 3B8HA 3HF5A 2VV5A 3O6QA 4OLOA 1HQUB 2RDJA 4F4XA 3CCUS 3FFIA 4MIBA 3GYNA 2YQ0A 1LK7A 2HFNA 2OMLA 2E5HA 4IRCA 2PN6A 5KT3A 2FVQA 1RADB 2FJDB 4AQYF 1ZAVA 3ITHA 3RYLA 4G1QA 1Y0HA 1Q95G 4GVBA 3LGHA 3MTJA 2F4FA 2GHWA 2F3JA 2Z0GA 2DO4A 4TLQA 4ZLLA 2B6AA 1OY6A 2EBGA 2OKQA 1BY9A 4DU7A 2R7TA 2C2OB 1GTEA 3UE2A 1HI1A 3TAMA 3J7YU 4DR7F 2NUHA 2RF2B 3PYFA 3I9ZA 4BCAA 3IG1A 1HR0J 2QLXA 2NXUA 3TA1A 3NXZA 3W3SA 3J80Y 2GVDA 1OPZA 2UUWA 1UTAA 5IV4A 3GONA 1NDLA 2HFUA 2XLKA 3ENWA 1VRTA 1FX2A 3NNCA 3C15B 2QT7A 2D69A 2W25A 3D67A 3L7OA 2EFPA 4NASA 1J5EJ 2RSQA 3H98A 4ATNA 1HNXJ 4DPOA 4H54A 1EHWA 4ZHRB 4AD6A 3E01B 1F1BB 1SUQA 3MI7X 3MPYA 2PEHA 2ZH1A 2HRYA 4L72B 3M8PA 3ETMA 4B9VA 2AEFA 4RW4B 4OZ2A 3KYLA 1L3SA 4LJMA 1FJGJ 1DJ0A 3C3LA 3FDSA 1UFWA 1CJVB 1RU1A 2MQQA 3BF4A 2LKZA 4WF9Q 4DN9A 1V3RA 4G1PA 1K0VA 2HVZA 2E7VA 5HMXA 3K5PA 4Y2AA 4NA3A 2DO0A 3D0GE 4FZVA 2VQFF 2LECA 2E5LJ 3RAXA 2GV1A 3VGUA 3GSDA 4HI2A 3NCQA 1FO1A 5AJ3F 2LEBA 2HBRB 4GRSA 4X66J 2X51A 5EWGA 3CIMA 3BGUA 3PW7A 1URNA
chains in the Genus database with same CATH topology
4F50A 2HHPA 1VQNS 1TKZA 3DHWC 3U02A 2N7YA 2WAQD 4LF5F 2ZH6A 3MPWA 2B6AB 5ITHA 1KHVA 1X5TA 2XZWA 4YDXA 1U7LA 1R8AA 2A18A 3CC2S 4Y34A 2GMLA 2HHXA 3OJSA 3PX4A 3CO9A 3TAQA 2ILZA 2JJ4D 2OSRA 2VBZA 1KQFB 4I2QB 2Y0SD 2N82B 2GJ2A 2MZTA 4WE1B 1FKAF 4NXMF 2W7AA 2LLZA 4V19J 2MJNA 2ZHOA 2PFFB 2DPJA 2DR9A 2PA3A 2NS1B 3TAMB 5F3TA 2M70A 4Y6IA 4ECZA 2RT3A 3LP1B 1LWEB 2W7OA 2KOEA 2E9TA 4TY8A 1JB0C 2R4FA 5I4MA 1J2VA 2E9ZA 2ZH8A 3IG1B 1VQYA 4C3LA 4DWIA 3RW6A 2F7VA 5IWAF 3T6JA 4PUOB 1OPIA 2CVIA 3MURP 4ECSA 4MYUA 4TNOA 4I4BA 2YX1A 2MSTA 1S6OA 3IS9B 1MMDA 3SMZA 2RQMA 3OTEA 1HBMB 2EFQA 1L5UA 2PDAA 2GIRA 5F3ZA 5A8RB 2O67A 1L3TA 4PKDB 3M6UA 2HLUA 3QJPA 1WHVA 3R1LA 2HQ3A 2YVSA 2GO9A 4DQSA 1NJXA 1M1KT 4DR6F 4UY8T 1YSJA 2BANB 2RILA 2VKRA 2CQ1A 2ZBIA 4O23A 3SZ2A 3TUIC 4NLSA 2ACYA 4Y00A 4OI4A 1JKHB 5EWFA 3F41A 3PFOA 2XGPA 2HHWA 4PQAA 3NCRA 1D8ZA 2PMHA 1HBUB 1UWBB 3MEDA 2KI2A 1NKBA 2RRNA 3OPKA 4RW7A 5GADI 2XC9A 5EX3A 1RT4A 1FD2A 4Q8EA 1GX6A 2BABA 4OX7A 2A10A 3KNAA 3CD0A 3CIZA 4NLDA 4USJC 5A0YB 2J0SD 3TUZC 2BA9A 2A3JA 2H9ZA 1QVFR 1YQHA 2ZDPA 3DLKA 3T9ZA 1DLOB 1C0TB 1MWZA 5F8LA 2QO3A 3DCAA 5H9EJ 3JSBA 2MKSA 3CXCR 2OP5A 1HHTP 2YWHA 4WFBQ 2J76E 3BSCA 4NYOA 4YQWA 3NNHA 3G8SA 4OQJA 2VFTA 3PW2A 1TK5A 4O3NA 3DI6B 4ZVEA 4RNFA 4C2MA 1K0TA 3CT9A 3RB4A 4YB7A 3S7RA 5I3QA 3IC1A 3MUTP 2I9SA 1QUVA 1SC6A 1FRJA 3MOZA 2BQRA 1B0PA 3TVYA 1G3OA 2P5VA 3DOKB 2KKHA<