1SH2A

Crystal structure of norwalk virus polymerase (metal-free, centered orthorhombic)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
502
structure length
502
Chain Sequence
GTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVNED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of norwalk virus polymerase reveals the carboxyl terminus in the active site cleft.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase
molecule keywords RNA Polymerase
total genus 157
structure length 502
sequence length 502
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 1sh2A02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1sh2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sh2A03
1FKPB 5C25B 4LQ9A 4ZP6A 2V4QA 2I5JA 2W7PA 1LW0A 4URGA 3KLVA 1S9GA 3V6HA 2VG7B 5F8JA 4KHRA 2IBKA 4K4YA 3IGNA 3MEEB 3OHBA 2IM0A 5KFZA 3CIZA 3KNAA 4IOBA 1TVRA 3DLEA 4TY8B 5DLGA 4RW8B 4RNNA 2UVRA 4TYAA 2RKIA 1JLQB 3DRPB 3KLHB 4NLSA 2FVSA 1YVFA 4KBIA 5F8NA 2YKNA 4F4ZA 3KK3A 5T14A 3IN5A 4IFYB 5KT5A 5KT3A 4O44B 1TP7A 3M8QB 1BQMB 4K4VA 1KLMA 4PUOB 1RTDB 5DG7A 1IM4A 3TAMB 1DTTA 4IH5A 5KT2A 1C0UA 3IS9A 3DOLB 4PWDB 3H5XA 4LSLA 4KKOB 4WE1B 4Q8EA 3KLIA 4Y3CA 2FLLA 3RB0A 3KK2A 1S1VA 2AX1A 4K4SA 2RF2B 4EBCA 1REVA 1TKZB 5J2MB 3GIKA 4NLXA 4QW8A 3OSNA 2FLPA 4KO0B 4Y34A 2B6AB 2IC3B 4JUZA 2FVPA 1S10A 2JEIA 4JV2A 2C2RA 3EZUA 3DMJB 1C1BA 2I5JB 4Q44A 4ZP9A 4ICLB 1ZETA 3OLBA 1TKTA 3H2LA 1S49A 2XI2A 2V0NA 5F8GA 3MECB 2AGPA 1IKXB 3BREA 2AQ4A 3DMJA 4RW6A 1RA6A 3GILA 4R0EA 4IFVB 4KE5A 3KJVB 3GQCA 1HQUA 3D28A 4KB7A 5FDLB 2W9BB 1N6QA 5KG5A 5JXSA 4IRCA 3T5KA 1HMVB 4J9SA 1XR5A 4KSEB 3MR5A 2B5JB 3PW4A 3E01B 3V4IB 2WONB 4H4MB 1JIHA 4IG3B 3EPIA 3KK1A 4EBEA 3G6XA 5KFOA 4RW7A 3DOLA 2EC0A 4DL3A 1N48A 4JV1A 3GIMA 5KFUA 5J2QB 4R8UB 3H5YA 1JXLA 4ZMMA 4RNMA 3KK1B 5I3UB 1JKHB 3OHAA 2AWZA 4K4ZA 3DRSB 3BSAA 3KLGB 1S9FA 1S6PB 4KFBB 3DRRB 4QW9A 3G6YA 5HLFA 2IM2A 4F4XA 3LP0B 4I2PB 5KT6A 3HKWA 2XCPA 4KV8B 3ITHB 2XWYA 5KG4A 4ED8A 3BSNA 3NMAA 1TVRB 4XO0A 2W8KA 1RT3A 5HP1A 5KFKA 2FJWA 1SV5B 4MKAA 1IKXA 2O5DA 3KLFA 3HVAA 3MECA 3NBPA 3NGDA 2YNGA 1FKPA 3DI6B 3QLHA 2R8IA 1S9EB 2YNFA 3FFIA 1S4FA 2ZD1B 3CJ4A 3LP1A 3BQ2A 5EWFA 1S1TA 4ZHRB 3V6JA 4ED3A 4QWDA 1DTQB 1TL1A 2R8HA 4KO0A 3MEGA 3BQ0A 3PHEA 5L9XA 4J9PA 4O3PA 3NAIA 1TQLA 5KFEA 4U6PA 3GV8B 1DTQA 1TL1B 2RF2A 5KG2A 3M8PB 5CYMB 4O4RA 3RAQA 2C28A 1S1VB 3MFHA 4YR0A 5KG1A 3T1AA 4DEZA 2OPQB 3LANA 4RU9A 4DG1A 4LSLB 4DL4A 4M95A 4PWDA 3HVWA 1XR6A 1DTTB 5KFCA 1HNVA 3GIJA 1HQEB 2OPSA 4Y2AA 2UVUA 3M8QA 2W8LA 2C2DA 2FJXA 5F8LA 1RT3B 1S1XB 1SH0A 1JLCB 3MTKA 4O3QA 3Q8PB 3KK3B 2ASLA 2YKNB 2YNHB 3ISNC 2ASJA 2HMIB 3QO9B 4TYBA 1LWFB 2ILZA 4EBDA 3HHKA 1C2PA 3RBEA 4J9RA 4RW8A 3DLEB 1Z4UA 1JLCA 3GYNA 4ED6A 4ECSA 4YMEA 4RNOA 1HARA 1JLGB 1HNIA 3MEDA 4FS1A 2GC8A 2BQUA 1T03A 1JX4A 5I42A 3I5AA 4ZPAA 5EDWA 4PQUB 4NRTA 2E9RX 3BSOA 1JLBB 3V81A 3RB4A 4WZQA 1J5OA 3H4DA 5J2PA 2R2TA 5C25A 4ECQA 5L1IA 1T05B 4H4MA 4QWEA 5JUMA 3KHRA 3IG1A 3DM2B 1S97A 3QZ7A 2BANB 1TV6A 4WFXA 4NLRA 2IM3A 3LAKA 3BR9A 4H4OB 3SFUA 5KFWA 1R0AA 3BJYA 1GX6A 1D0EA 2J6TA 3CDUA 4ZPBA 2R2SA 3DLKA 4QWBA 1QE1A 2QE5A 2UUTA 1TV6B 2D7SA 1VRTB 4J9NA 5J2NB 3DLGA 3CJ2A 2ASDA 3IRXA 4XPCA 4MIBA 2OPPB 3KLFB 4ED2A 5EWGA 1WNEA 3Q8RB 5KFGA 2D3ZA 2DPIA 1JLGA 3MEDB 3H4BA 1C0TA 2VG5A 3LP2B 3DYAB 4R5PA 4ZP8A 3V6KA 5KFTA 1UWBA 3CVKA 2W9CB 3PJWA 4I2PA 3OLAA 5L1JA 1RT1A 3OL7A 5KFFA 4QWCA 3EPGA 4GC6A 4ECVA 3KK2B 4DL7A 3M9OB 3LP2A 3OL6A 1S1XA 2W7OA 3KLIB 1S6QA 5I3UA 1S48A 1SH2A 3IGVA 4U7CA 2ATLA 1I6JA 4TXSA 4NZ0A 4B3OA 3CO9A 1EETA 3CDWA 1IKWA 4G1QA 4RW9A 4NLDA 5KG0A 1MU2B 1RT2B 4Q0BA 4RW7B 1LW2A 2BQRA 2OPQA 4O3NA 4FBUA 2XC9A 3MF5A 3UR0A 1VRTA 3C6UB 5CYMA 4ZVEA 1D1UA 5KFNA 2XCAA 3MR2A 1T94A 1QE1B 3GIIA 3DLKB 2YNIB 3QZ8A 5DGAA 4QWAA 3T5HA 1R0AB 4H4OA 4IR1A 4ED1A 5DLFA 3KHLA 3ISND 2VG7A 1IKVB 1HYSA 1S1TB 4LSNA 3MFIA 1BQNB 3FFIB 3LP1B 4EYIB 2HNZA 4IKAA 3QGGA 5DGBA 3KLEB 5KFHA 2YNGB 5J2PB 3RAXA 5KG6A 3NBPB 3N6LA 2J6UA 1K1SA 2RDJA 4J9QA 4K4TA 2RDIA 5I42B 3TQ1A 3UPFA 3DDKA 1HNIB 2BQ3A 3T19A 3JSMA 3UDLA 2ILYA 1RT7B 5C24B 1NHVA 2HWIA 2AGOA 2D3UA 2OPRB 4KV8A 1LWFA 3ICLA 4IG0B 3QO9A 5L1KA 3RB6A 3HVTA 3TVKA 5HBMA 3FQKA 3DRRA 3I0SB 5HLFB 3T5JA 1RTHB 3PW2A 1RT5A 1T3NA 4GC7A 1HQEA 2OPSB 4J9LA 1MU2A 1RT2A 5KFSA 4ZPCA 3N6MA 1EETB 1FK9A 4RW9B 2HNDA 3H98A 4EYHB 4NCGB 2I1RA 3PJXA 4ED0A 1RT5B 1SH3A 3PVXA 2IA6A 4M94A 3V4IA 4TQRA 2BE2B 2HNYA 4ZPDA 5KFRA 2R8JA 3GV7B 2R8KA 5J1EA 2RKIB 1S1WB 3KLHA 4K4WA 3V6DA 3I5CA 2YKMB 2OH2A 4URQU 2W9BA 1N6QB 1EP4B 2VG5B 4YR3A 1LWEB 4LQ3A 1HQUB 3Q8QB 2B43A 4IFVA 4I2QB 2VG6A 4WFYA 3CJ3A 4WXWA 3PW7A 1RYSA 3BSCA 4ECRA 1S9EA 2YNFB 4Q43A 1HPZA 5J2NA 2FVQA 4ICLA 3DOKA 3FSIA 4FBTA 1JLEA 2R8GA 5K14A 3RB3A 5L1LA 2E9ZA 5KFQA 1ZTWA 3KHHA 1SV5A 3UQSA 4OL8A 5DG9A 1LWEA 3QGIA 2IJFA 5KFPA 5F8HA 4MH8A 2QV6A 1RDRA 4WYLA 1JLFB 4RNFA 2YKMA 3H5UA 3ITHA 1REVB 4WFZA 1TKZA 1C1CA 3DM2A 4K50A 4K4UA 1OS5A 2BE2A 4ECUA 3KMQA 2JLEA 4NLYA 4ED7A 5C5JA 2IAJB 2ALZA 1TL3B 5KFVA 4R8UA 1RT4B 5J2QA 5DQHA 4G1QB 1FK9B 4PQUA 4Q0BB 3G6VA 1RT6B 1RTDA 1ZTTA 2JEJA 1KLMB 4PUOA 1QUVA 3I5BA 3QYYA 4IQXA 1SUQA 2VA3A 4X2BA 1T03B 2UVVA 2IAJA 4RUCA 2IM1A 2WONA 5KFYA 4HKQA 3E01A 4EO8A 2FLNA 4EEYA 1S0NA 1C1CB 3FRZA 2WK4A 1RT1B 5C42B 2XGQA 1JLQA 4NLTA 2W9CA 2OPRA 2BRLA 2ZE2A 4R5PB 2JC0A 3CJ5A 3DYAA 3C6TB 3QIPA 4TY8A 5KFLA 4DL6A 2HAIA 3JSMB 2JEFA 2WRMA 3D5MA 3M9MB 3M9NB 2FJVA 4WYWA 3KMSA 1JLEB 1LWCB 4KAIA 3VQSA 4RZRA 1RYRA 1NNDA 3DOKB 3KLEA 3DLGB 1HPZB 4RNHA 4ID5B 5EWEA 4RUAA 2WB4A 4EO6A 2VG6B 5KFXA 1N5YA 4I2QA 4ZVFA 2DPJA 5D3GA 5HROA 4JV0A 3NAHA 3G86A 1N4LA 4YR2A 2WHOA 3T5LA 4J9MA 3FQLA 4F4WA 3V6DB 3MEGB 2YNIA 1S1WA 3H59A 3KOAA 5HROB 5KFAA 5J2MA 4MK7A 1DLOA 3C6UA 4RW4B 5CYQB 1RTIA 2XI3A 3I0RA 4MK8A 4TLRA 3Q8SB 4J9OA 3OSPA 1LW2B 1MMLA 2JC1A 2CKWA 4O3SA 1GX5A 1J5OB 1XR7A 1C0UB 3IS9B 1FKOA 3PW0A 3BGRA 1JLAB 4F4YA 4ZP7A 1IKWB 1JLBA 4ZVHA 3V81B 5KT7A 3N6NA 2WOMA 3JYTA 4MFBB 2XGPA 2E9TA 2AX0A 5DG8A 4NLOA 4O44A 4TN2A 5HP1B 4NLVA 2R2RA 4ECXA 4IRKA 3C6TA 4TY9A 3I0SA 5KFDA 5HBMB 4NLPA 1W25A 2ZE2B 2WTFA 3HVTB 4ECYA 2FVRA 4IH6A 3DRPA 5C42A 2V4RA 2GIQA 3LP0A 2C22A 2HMIA 2JEGA 1RT7A 5C24A 1S1UA 1TKXB 1S6PA 2FVCA 4YP3A 2CJQA 1N56A 5DQIA 4Q45A 2IMWP 1JKHA 4G3IA 4Q8FA 4MFBA 3NL0A 2WOMB 1S9GB 3JYTB 4FS2A 4H54A 3BGRB 4NRUA 1RT4A 4K4XA 2ZKUA 3IRXB 4O3OA 1TL3A 4DG1B 4IG3A 3H40A 4O4GA 3OL8A 2HNZB 3I0RB 4QPXA 5F9LA 5KFMA 1BQNA 4HYKA 4LSNB 4NLUA 3M8PA 1IKVA 2WCXA 1HYSB 2HWHA 5KFJA 4IDKA 4ECWA 5KT4A 1QAIA 4IR9A 4DL2A 2AGQA 3FDSA 5FDLA 1VRUA 1S0OA 3PR4A 5KG7A 3KJVA 4IDKB 5D3GB 1RTJA 4I7FA 2BANA 4ZHRA 5K14B 1RA7A 3KHGA 2ZD1A 3CWJA 4O4GB 3NKYA 5F9NA 3RBDA 4WZMA 3DI6A 4NLWA 1TKTB 4KHMA 1LWCA 1C1BB 4YQWA 4B3OB 2UUWA 1IKYA 1NHUA 3MR6A 3PW5A 2IC3A 2B6AA 4MK9A 4ZVGA 1S6QB 4Y2CA 1EP4A 3QIPB 5F8IA 1S1UB 1TKXA 4MKBA 5DQGA 2R2UA 5J1EB 4NLQA 3CDEA 4ECTA 3CJ0A 1UWBB 2J6SA 2YNHA 3PZPA 3H5SA 3QGHA 2HNYB 3LALA 4KFBA 5KG3A 2UVWA 3DRSA 3SFGA 3KLGA 4ECZA 1KHVA 4WE1A 1C0TB 4KKOA 2IJNA 2BRKA 5KFIA 1SUQB 1RAJA 4NCGA 1IKYB 2HNDB 1RT6A 4MIAA 4DL5A 3PR5B 1HNVB 3TAMA 3BQ1A 1S0MA 2OPPA 1JLAA 1FKOB 3E51A 1BQMA 2C2EA 2V9WA 4IFYA 3SI8A 1RTHA 4IRDA 1RTIB 4O3RA 4RW4A 5CYQA 2F8EX 1DLOB 2B5JA 1RTJB 4I7FB 4WXOA 2BR0A 4IG0A 4J9KA 4NLGA 1HMVA 4IH7A 3OL9A 3MR3A 2GIRA 1JLFA 1VRUB 5KFBA 3LAMA 3MEEA 2AU0A 3QIDA 5F8MA 2D41A 5EUHA 4TQSA 1QAJA 1U09A 4RW6B 1KHWA 1LW0B 1N5YB 4XPEA 2VA2A 4URSA 3IG1B 4ID5A 1K1QA 3GV5B 4F50A 2W9AA 1CSJA 4NYZA 3QLHB 1T05A
chains in the Genus database with same CATH superfamily
1FKPB 1BLUA 2DRDA 2VC1A 3TANA 4CQ1A 1KOOA 2DISA 4X84A 1WSVA 1Y7PA 2BYCA 4OZ3A 1KWMA 4Y65A 3KLVA 1S9GA 3UNYA 2LQJA 3V6HA 2VG7B 1B0PA 2GQQA 1NJXA 4KHRA 1V3RA 2W01A 2O3DA 2Z30B 3IGNA 1Q0NA 1VIXA 3M1VB 3MEEB 1REGX 1D3WA 2Z2LA 1WHYA 4NA2A 5ETPA 3CIZA 5B0FA 1HI8A 1FDNA 3FJ2A 3MM5B 3HP6A 1XK8A 2FC9A 2MQMA 3N4WA 1F3FA 2DNLA 3TA2A 1YVFA 1R43A 2MZRA 5F8NA 4KBIA 3JXOA 2OFHX 2UV8G 3KK3A 1BWVA 3IR7B 2YWGA 6FDRA 2F7VA 4IFYB 1YJTA 4O44B 3PX0A 1VQ6S 1OSCA 4DFKA 1Y9OA 4WBFA 4E8UA 4M5DA 1IUJA 1VQ7S 1RTDB 4B3MJ 1U0SA 1IM4A 4DUTA 4BS2A 1SC1B 1FTRA 3FRYA 3OFEA 2LDYA 2OKQA 5HATA 4KKOB 3TARA 4WE1B 3VAIA 3KKFA 3KLIA 3C16A 4P2FA 3RB0A 1FFGB 2XZ2A 1D8YA 4K4SA 2WBMA 4EBCA 1REVA 1TKZB 3GG0A 1SJFA 2CZ9A 1B64A 1NJYA 2XS2A 1VQKS 2GVDB 1H6KX 2C3UA 1FVSA 2FLPA 3DGPB 2QLFB 4LBHA 1FF2A 1MMNA 2IIHA 4AXIA 1RACB 3H0PA 4JP8A 4M5JA 4DV3J 2F65A 1QUPA 3H90A 2C2RA 3EZUA 3DMJB 4JV2A 3O5TB 2OI2A 3TA0A 5FIIA 4N47A 1BHNA 1V6HA 4ICLB 4J9VA 4CWBA 1ZETA 4KY3A 2JH3A 1DJ0A 5DS7A 2PC6A 3UN2A 4DPOA 3J80U 5F8GA 2AGPA 3CJ8A 2AJ0A 1SL0A 4JYAJ 4FPIA 1HWUA 4IFVB 2HZAA 3M2VB 1WKKA 3GB0A 2VICA 4DPUA 1MYLA 2ADBA 3F41A 1NK5A 3J7YU 4OV1A 2W9BB 4KB7A 4LF6J 1GXLA 2BKPA 3RG6A 2PMWA 1HMVB 3K89A 2RNEA 3NY0A 4KSEB 3MR5A 4J9SA 2QMWA 1S0MA 1NK9A 3A12A 3M6WA 2V8GA 4P71A 2K9IA 3E01B 3NXZA 4H4MB 2IVYA 4IG3B 3EPIA 1PSDA 2J7UA 1D9FA 1F9EB 5KFOA 3DOLA 2JZ5A 2R7WA 4DL3A 1JJHA 4JV1A 4LF7F 4LF9F 4J37A 1H2TZ 3GFXA 1WD6A 1XN9A 2DCLA 2X7IA 2XB2D 4DQSA 4U7UD 3CCMS 1AXQA 2W24A 2ZOMA 4ZMMA 5I3UB 4G1IA 3QFWA 3OHAA 4AL7A 2C1EB 3DRSB 5ETSA 1HD0A 2P9GA 3SCIE 4X65F 3IMQJ 2MJUA 3R1LA 1BY9A 5CA5A 4B9NA 1RE1B 4UOCA 2NZCA 1DY3A 3THVA 4RUHA 2DNPA 1OO0B 2J9CA 3CC2S 4OZLA 2K06A 2XSFA 5HP1A 4EFAC 5ITHA 5A8RB 1WTBA 3CE8A 1UEKA 4MKAA 2O5DA 4PABA 3KLFA 2X51A 3HVAA 4CYUA 3R3TA 4A46A 2DNZA 1IWAA 1RABB 2FHKA 2YNGA 4R0JA 2E7XA 2CJKA 1HNWF 4OLPA 2BXJA 4ZA1A 3NG8A 1ZZNA 1T95A 3OTDA 5DO2A 3ILOA 2R9LA 4Q7AA 3WBZA 2VFVA 1H3DA 4HTIA 2HFVA 4S0MA 1DTQB 2R8HA 3JQKA 4PYDA 2Y8YA 1TUVA 1VK3A 3EJMA 3MEGA 3T41A 5L9XA 5K8NA 1L5UA 3G5OA 1N88A 1H38A 2DH7A 2UV8A 3M6VA 2IRXA 2QJ3A 4F0KA 3NGTA 3J80Y 2RT3A 3GV8B 2G2ZA 4DX6A 1TL1B 2HS3A 4ED4A 2Y8WA 5KG2A 3M8PB 1HD1A 2OTLS 2G4BA 2EK6A 4YR0A 1Z2ZA 3DHWC 2RRAA 3ET6A 1JJ2R 3U1LA 4RU9A 1WEXA 4LSLB 3B4MA 4KH0B 4CM0A 1QVFR 4PRFA 2BBEA 3O8WA 3J7A1 1Y5NB 2LLZA 1X0PA 5KFCA 2QL9B 2DCUB 3MPWA 2GA7A 3TJ9A 1RAGB 2L08A 3BH6B 2A2DA 2C2DA 4XDDA 1XTZA 1R31A 1Q8IA 2B9YA 2M88A 3EDRB 4PG7A 1YG0A 3C19A 4RUBA 4CTAA 2ASLA 1Q16A 1AZSB 4USUA 4I69A 2UXCJ 4ZIVA 4OYZA 3VAGA 1FFSB 3DDNA 2JXIA 4QPTA 2WW4A 2F1FA 5AE2A 2EG1A 2HHPA 2VBXA 2KL8A 4ERDA 1VBXA 4LRDA 3VVUA 1JLGB 1T03A 4USJC 2XZDB 3DC2A 4GRSA 4EMDA 2DNMA 2OEKA 2V50A 4HT5A 1R7IA 3HHEA 5EDWA 3V81A 3BSOA 4WP3A 1S59A 1M5KC 3CMQA 1X4FA 2Z2YB 1WEZA 3I96A 2R7TA 3IG1A 2VH7A 1HR0J 1KEKA 5GVQA 1YBUA 4NLRA 3AT1B 4XTTA 4ZPVR 5L46A 3DOMA 3EX7B 2VQFF 4DFMA 1X4AA 1VI7A 1WC6A 3D0IE 1HBMA 3BR9A 2XNRA 3W64A 1J27A 2PIIA 4JI4J 1KTVA 2CQBA 1SL2A 3UDCA 2XYPB 1JNZB 2QLBB 4QWBA 1TUGB 3T1HJ 2XMWA 4OZ5A 1NKEA 3CMES 1N33F 2D7SA 4F4KA 2CQHA 1N5TA 2P9CA 3GFZA 4M63A 4J9NA 1UJ5A 2C2ZB 3DLGA 2ZH9A 4X4NA 3I9ZA 3GPAA 3PJ9A 4KGZB 8AT1B 2UXBF 5JJBA 3U1NA 1VQMS 2CQPA 3OUYB 3W65A 2CDRB 4ED2A 1M5SA 5EWGA 1VC6A 2BW2A 3W2VB 1C0TA 5CQGA 2W4DA 3QWPA 1U1QA 3QJLA 1T0TV 1RWKB 3FBFA 3MMCA 1UWBA 1HHQA 3J7ZT 4Z37A 2W9CB 3OLAA 1RT1A 2RIJA 3N0VA 3SEOA 5KFFA 4DL7A 1QAXA 3KK2B 3LP2A 1RHRB 3SV3A 1TL4A 1S6QA 5I3UA 3SDEB 4NA3A 1OYDA 2NCKL 3JAMY 2XG8A 1CJVA 3M7VA 4U7CA 4DSJA 1S7IA 2D9PA 4NZ0A 4DU8A 2ADLA 1EETA 2BJDA 4PAAA 4RW9A 3IWXA 4NLDA 2V2QA 1RT2B 2CNKB 3FSYA 3Q89A 3ZNUA 2BA3A 4FPRA 4Y0FA 1SKRA 1LW2A 2AYGA 2RRNA 2PA3A 1YJVA 3UI3A 5BR8J 3BPSP 4NPOA 3CCES 3L9ZA 2H51B 4UW2A 3F73A 4DV4F 1UZDA 3UCUP 3LF0A 5CYMA 3W1YC 1U1LA 4LF7J 1KN6A 3MOZA 3GIIA 1KKHA 2BJ9A 2YNIB 3QZ8A 3W8PA 2VKRA 5AJ3F 5DGAA 3P96A 4LFAF 4HHJA 2UZAA 4H4OA 4ED1A 3IRWP 3WZ0A 3MM7B 2R7XA 2VDIA 3TUZC 2OELA 2FY1A 1HYSA 4OZ1A 1HNZJ 1V5VA 2M7SA 5JMNA 1Y10A 2J7WA 2HSEB 3KLEB 1G6BA 2GHVC 2HIQA 2YNGB 3EE3A 4OJ3A 5J2PB 1PAUB 5KG6A 5KFHA 2XY5A 4PR6A 2HBRB 4U8YA 2JXGA 1K1SA 2RDJA 1U1NA 2F3JA 1Q8KA 2DB1A 3UPFA 2B9WA 2GNKA 1R8HA 4FF2A 4EZ9A 3MURP 2M8DB 1SJ1A 4QR0A 5HMXA 4LRFA 2IRYA 4TU7A 3PHTA 2DNOA 4FNHA 4BHQA 3POTA 5C24B 2VHGA 2HBQB 1VQ4S 4CT9A 2OD4A 3L7OA 4KV8A 4IG0B 2A6MA 3QO9A 4NOHA 3RB6A 2F8HA 3D1QA 3HVTA 3MM8A 4PEOA 4PQAA 2K2PA 5HQLA 5IT9U 4OJGA 1WUUA 5ADZA 3VAKA 3OJSA 5IT4A 2UP1A 2KVQE 4GC7A 2EWHA 1A9NB 1W2BR 1GFWB 1MU2A 1H73A 2XMUA 4OI6A 4ZPCA 3N6MA 2RMLA 3B8HA 1VJQA 1VQOS 4MT1A 3R7SB 2AD9A 1G1XA 4HACB 1IM6A 1SKSA 3V4IA 3IR7A 5EX0A 2BMBA 1ACMB 2BE2B 4TQRA 2HNYA 5K9FA 4DZ6A 2F4VJ 2EC2A 2C3MA 2ZBRA 3GV7B 2WSCC 2ZC3A 2RKIB 2C2NA 3GG1A 4RLEA 4DR6J 3Q2TC 2H54B 4F04B 2KFYA 3V6DA 4JI1J 2KHDA 1EP4B 1TELA 4ZITA 3QT6A 3NO7A 2IA0A 1LWEB 1XMQF 1X9MA 1HQUB 1FRLA 3HT0A 1VQ9S 1KDNA 1SC3B 4IFVA 3M30B 2EVZA 2V4JA 3PCOB 3WC2A 4NMLA 2CYYA 3PRBA 4FYVB 1U47A 1CJTB 1M1GA 1UMJA 1GK8A 1RWPB 2CPYA 1MW7A 1N5SA 1ZS6A 1S9EA 2YNFB 4ZDNA 2WVFA 4ICLA 3FSIA 1X4BA 4USMA 3IA0A 1FRMA 3C66A 1WORA 2E9ZA 4KH1B 1SV5A 3G8QA 2I0XA 3UQSA 4F36A 2LU2A 2B0GA 1LWEA 2OUGA 3N01A 4I67A 4MH8A 4NMXA 4RNFA 3CJQA 2ZH6A 2PI4A 2YKMA 1M90T 3ZZTA 2HGMA 2EKNA 3VR1A 3G9CA 3HSGA 1MNEA 1B4SA 3GIRA 1C1CA 2F4FA 2HAFA 2U1AA 1OS5A 5E3QA 4F2SA 1UCNA 2B56A 5ETTA 4JI1F 2ALZA 3PYFA 4JV5J 4ILLA 3MAHA 1CJUA 4RU2A 4YS2A 2QO3A 1Q8LA 4G1QB 1T9YA 5DQHA 1A6LA 3G6VA 1FCAA 1RT6B 1RTDA 4F02A 2H5EA 2WVCA 4PUOA 1QUVA 3QYYA 1L3TA 2VA3A 3ILIA 2G2OA 4X2BA 2QTWA 4J7CA 3TP2A 2WONA 4QOTA 3BO3A 2FLNA 2D1CA 1KNZA 3FRZA 3NWGA 1QDUB 2XGQA 1BDTA 5C42B 1UW4A 2ZE2A 1KP6A 3ZXWA 1ZM4A 3PM9A 3DYAA 4R5PB 1PBUA 5IZHA 4DL6A 2HAIA 4DV7J 2KT3A 2WRMA 3M9MB 3QT7A 3S7RA 1LOUA 4WYWA 3KMSA 2MY7A 1ELOA 3LW5C 1RYRA 2N4CA 2UU9J 1NNDA 3EGWB 3R2CJ 3KLEA 1P94A 3GFHA 3MPDA 4F3OA 3BBFA 3MUMP 4LIRA 3MD3A 4RUAA 1HBOB 1MN9A 3FZBA 4EO6A 4KHPF 3W9IA 1OWXA 3FK4A 1TU0B 4ZVFA 2DPJA 2YWEA 3A8EA 1BD6A 5HJYA 4X62J 5HROA 3VZIA 3A1YG 5D3GA 1FI4A 3IBFB 3MM7A 2MKCA 5HO4A 1WC1A 2HK2A 4C3LA 2KXNB 3JB9k 3V6DB 4B3MF 2KH9A 3PRVA 2RQMA 4WK1A 4DLEA 2CFXA 3O1LA 3DDIA 4MK7A 3EXCX 3GJQB 1VISA 3C6UA 5CYQB 3EYZA 2QA4S 2NREA 2FJEB 1NSAA 3I0RA 2VODA 1WF1A 4EI2A 4LF1A 5AJ3J 1NPKA 3TX8A 3D54A 4RX6A 1J5OB 4F8RA 4DSLA 4PWDA 5FLXU 3MCNA 4C98A 4F4YA 1P6TA 5FLXY 1IKWB 3TO8A 3M4XA 3MCOA 3ZTPA 2B9EA 1PAEX 2A2CA 2WOMA 2CJBA 1FDDA 1LK7A 5B08A 2E9TA 1LNQA 2FZCB 5A0YB 2DRBA 1VK8A 4CH7A 5DM7Q 4TY9A 3QGPA 5KFDA 4NLPA 2DHXA 2ZE2B 3HVTB 3QSIA 2FVRA 3DRPA 2GS8A 5C42A 2GIQA 3THTA 1YLXA 1VLOA 1N56A 2HFUA 3MAAA 2NUUG 3CUNA 5GAHU 1U6FA 1YJWS 3IC1A 1WF2A 1ZA1B 1FXDA 3LGMA 4RR5A 3AX2A 3ELHA 4G3IA 2XLKA 2DGQA 2DNYA 2N7YA 1L3KA 4MFBA 3JYTB 1RHJB 3VVTA 2V68A 2IDEA 2ZKUA 4C97A 2LU1A 3GSDA 5IT0A 1TL3A 4FYWB 4MTPA 1IVZA 4WU2A 1SQFA 3VF0B 4U7UK 4B3SJ 5KFMA 2H5JB 4HYKA 2AEFA 3PX6A 4LSNB 4ZLNA 4AUKA 1KOHA 3TEHB 4NLUA 1R6YA 1RKIA 1S6OA 2KYXA 2Y0BB 1HYSB 4IDKA 5H9FK 3Q8YA 2H4WB 3A8JA 2KRBA 4B9UA 3BB5A 2DGTA 2HVZA 2I8EA 3PEHA 1RBOB 5MAOA 2X1FA 4RPFA 1T11A 1RWOB 1RWNB 2ROGA 3FZ2A 1HBMB 5LM7E 4ES3A 5G4DA 4ZJQA 3ETMA 3PR4A 1YSJA 3KJVA 3R9LA 1AUDA 3PYGA 1FJGJ 2BJ7A 3BZQA 2JL9A 2D68A 3D9BA 3SBMA 4K2JA 3ZZUA 2J76E 4EWTA 2DVIA 3KHGA 5IV3A 4A8QA 4PYAA 3RBDA 4WZMA 3DI6A 1FO1A 4NLWA 1B0VA 4DSKA 2H48B 3JTOA 1U8WA 2R7OA 4DFJA 3TNVA 2KVIA 2MGZA 5KOWA 3LGNA 1LWCA 4B3RJ 4IYQA 2YKQA 4CRJA 1VS3A 3PW5A 2Z58B 2IC3A 5DM6Q 2B6AA 2V63A 2XZTB 3OR1B 3SDEA 4RBTA 2X1AA 4Y2CA 3QIPB 2GMLA 5AE3A 2K1RB 3H20A 4MKBA 1T02A 2GMHA 3HZGA 5DQGA 1GMWA 1ICEB 4HH0A 2DXFA 3HSDA 5J1EB 1D09B 4YHHF 3I56S 3R7BB 2AEMA 3BYPA 1UWBB 2J6SA 2EBEA 5CHCB 3H5SA 2UVWA 2HNYB 3AOBA 2B8QA 3IM9A 2YQ3A 4KFBA 2NXNA 5M2RA 3FC9A 5KG3A 4X66J 2CA9A 1VLYA 1WTFA 1UVKA 1C0TB 2XEXA 2XYGB 3QT5A 5KFIA 4WCEQ 1S12A 1R89A 3W2VA 4GKJF 1RSCA 1QSSA 1RCOB 2HZCA 3CB4A 3TAMA 2OPPA 1YJUA 1JLAA 2AEJA 2D9OA 2QG9B 4AT1B 4F25A 1EX8A 4B3TJ 3TJ8A 4C3KA 4I68A 1TAQA 2JX2A 4RO0A 4PXEA 2ZH5A 4O3RA 2QIFA 1UJ6A 1HIYA 1DLOB 2AYMA 2EPIA 2W2QP 3Q83A 4OJ1A 5HMZA 3VHQA 4IG0A 8ATCB 4NLGA 3GSIA 2LYVA 4DSEA 1JLFA 2HFOA 2AKWB 3MMBB 1UEVA 2DXDA 2AU0A 5F8MA 4DLGA 1U09A 2QC3A 4HV0A 1LW0B 5HMWA 3Q86A 2DH8A 3IG1B 5EGYA 1O0PA 1WI8A 2VQEJ 2AJ2A 1SIWA 2W9AA 4NYZA 2ASDA 1T05A 1WF0A 2DNHA 2IJRA 4XDCA 2V4QA 4DV7F 3U02A 4LRBA 4URGA 2ZM6J 5LMUF 3LA0A 4GKJJ 2HQ3A 1FKAF 3JQMA 3NEKA 3PFEA 5F8JA 1TZ0A 1K47A 1YGYA 2CJAA 4K4YA 4LRVA 2IBKA 2PGCA 3MMAB 3NCPA 1WJ9A 2X3GA 4K59A 2IM0A 3M6XA 3P3DA 4TY8B 3NNHA 5DLGA 3DLEA 4AQYJ 1VBKA 3MDFA 3PDNA 4RW8B 5HJXA 1V3SA 4RNNA 4GMKA 1JLQB 3DRPB 4OYWA 3KLHB 2W2PP 2FVSA 4DL0C 4A8YA 5CXTA 1U0HA 1Q78A 1MSWD 5KT5A 2GQCA 3JSRA 1RAEB 1R6VA 1TP7A 4TVAB 3W5YA 5KT3A 2E1MC 3FGVA 3KUEA 4K4VA 3KNGA 4CLTA 3CCSS 5DG7A 4OZ2A 3TAMB 3VZHA 1FX2A 4IH5A 3UR3C 5KT2A 1C0UA 3UN3A 3DOLB 2FUG9 4CP5A 4PWDB 4LSLA 5LXRA 2DNKA 2Z2ZA 2MZ1A 1Y3KA 3FBBA 4Y3CA 2JVOA 1FERA 3G87A 3CXCR 1Q79A 3KK2A 5E3AA 2HEKA 1PBAA 3AA9A 2AX1A 3ZZYA 4DSIA 2W2MP 1N33J 3EVOA 1FJ7A 4DPXA 1Y4ZB 3CD0A 4PZVA 4Y2MA 3C14A 3G82A 1U45A 1RBLA 1FA0A 3SCJE 1IBLJ 3HI9A 2J0WA 2ZWOA 1EHWA 3HULA 3M8YA 2BNWA 2RRBA 1TL7A 4KO0B 1P1LA 4YEAA 2G1DA 5LMNF 3SZ2A 4CO2A 3LQVA 3P45B 2MEWA 1C1BA 1NUEA 2N7CA 4Q44A 1HLWA 4ILRA 4ZVPB 1K73T 1EKSA 4KTQA 3RR8A 4C6AA 1HKAA 5IOLA 3ZC4A 2R3VA 3KJFB 2V0NA 3G8SA 3AB4B 4DCOB 3BREA 2KM8B 3FMBA 3DMJA 2AQ4A 1RA6A 1AUSL 2MKJA 4B17A 3GILA 3CMAS 3KJVB 3M8RA 3DGPA 4L76A 3Q23A 3D28A 4JI8F 4ME7E 1RK8A 2ZH2A 4DR1J 3T5KA 4WIIA 1XR5A 1UL3A 3BKUA 2ZHAA 2AMCB 4JI6J 4PWUA 2LFVA 2WVDA 1IN0A 1FWLA 3KK1A 1NJZA 1NSQA 4C8ZA 2EC0A 3BS9A 4HDHA 1JMTA 3GIMA 3UW1A 3PRDA 2DGOA 3BN4A 1CJUB 1Q53A 4WKYA 2MZJA 2HRYA 1U2FA 3D0GE 1ZPWX 4RNMA 4P2SA 1S9FA 2C2MB 3BSAA 4OV6A 2ZH8A 4KFBB 3G6YA 4QW9A 4WKRA 2AT1B 3AQPA 1RI7A 3AOAA 3N5FA 4A47A 3CD6S 4B3RF 3ENAA 2QLJB 2CVIA 2XWYA 3ITHB 4UF4A 3SXLA 4LFCF 3NMAA 1U8SA 5DDPC 4XO0A 3D2WA 1WG5A 2JHEA 3M2RA 5K8PA 5A8KB 2AP6A 3UO0A 4U67Q 3L95X 3KFWX 3SCKE 3TJAA 2KTQA 3H2UB 3NGDA 3UN5A 4B08A 1H0HB 3HD2A 2BOAA 4C0BA 2V8HA 2ZITA 1GNKA 1YJNS 1KSPA 5GMKa 1ARRA 4M8LA 2MQOA 2R8IA 1S9EB 1U7LA 2YNFA 3W2WA 1HNXJ 2JEGA 1YRTA 3CIMA 3CJ4A 5FD1A 1CJTA 3P5BP 4NI2A 5EWFA 1S1TA 2K1OA 2BV3A 2DJWA 4KGMA 4OI3A 4QWDA 1FWPA 2ZDOA 5DDRC 3AODA 2ZH3A 1RYSA 1AFIA 3WHIA 4NYOA 2G1HA 4J9PA 3VQTA 4FXDA 1U1OA 3UE2A 4H4KC 3NAIA 4U6PA 2ZBPA 1DTQA 2HURA 3F56A 2ADCA 5G0RB 4O4RA 1FNMA 5DRKA 1T9VA 2EFPA 2XULA 4DEZA 4ETZA 1RWWB 5D4PA 1IR2A 2QGFB 4YB1P 2JRSA 1ZPVA 3NCQA 2VPYB 4DV2F 4LF4J 2V1TA 1Q4RA 1HNVA 2CQCA 3KWMA 4PG4A 3OTOJ 1U2CA 5D4LA 2DIVA 3CJTA 4Y2AA 1WOPA 3M8QA 2XM3A 1CQNA 4K0KF 2FJXA 5F8LA 1RT3B 2GPEA 1S1XB 1JLCB 2W4PA 3DXSX 3FBCA 3MTKA 3NGSA 5B7WA 3Q8PB 1YRXA 3NGKA 2FLOA 3KK3B 4WWSA 5DETA 1ZM3A 3QO9B 2QEXS 1NCLA 4I64A 3PYDA 3W61A 4CNZA 4J9RA 3T3FA 4QJVA 4ZVUB 3FT7A 2MZSA 1Z4UA 2MKYA 4P6QA 1OY6A 3GYNA 4QIEA 1YTYA 3T9NA 4C8KA 2HHVA 2HHSA 1NKBA 3MEDA 2AJQA 5ETNA 1JX4A 5I42A 2RS8A 3DLJA 3I5AA 5HVHA 4PQUB 5ETKA 2E9RX 3MMJA 4V1Ak 1UETA 1CC7A 3FUYA 2R2TA 2GX8A 1HHTP 4H4MA 2RSQA 2E5LF 1DQ9A 2KU7A 4ES1A 3KHRA 3NWRA 4N76A 3HCXA 3K5PA 3OT9A 2WZ1A 4ZVQB 3GCXP 3AD8C 2HVHA 1Q7LB 2EFVA 5F3ZA 3C2PA 4H4OB 2LVWA 1RXOB 5D4NA 1VC5A 2KT2A 4USTA 3RAMA 3SSQA 1NKCA 4B9MA 2FC8A 4ZPBA 2DNNA 2R2SA 4N8NA 4EU0A 2QE5A 2RQ4A 1FHTA 1MYKA 4FNIA 2M4MA 1ZBTA 1YITS 1PJ5A 2K5JA 1SIZA 2ZZNA 2N82B 3EWGA 1QY7A 1WHVA 1T8EA 2OP5A 3TZWA 2QA4G 4MJWA 4A48A 1S79A 2E5JA 3IRXA 4XPCA 4L75A 4MIBA 1V5IB 4B9LA 3X3UA 3HHLC 3MXHP 5D4OA 2LEPA 2BJ8A 3GYGA 3M30A 1WNEA 3TOQA 2MQQA 2D3ZA 1DFDA 4X4TA 4CNYA 2E5HA 2JDJA 3H87C 1A7GE 2X1BA 1J2VA 2MQNA 4I6WA 3GCWP 2FPHX 4ZP8A 1HNZF 5KFTA 3CVKA 3TQEA 4XIUA 1VJWA 3NMRA 3ETOA 4RBVA 4I2PA 5L1JA 2EEYA 1KQGB 3EPGA 2Q66A 2P5VA 3W8GA 5FJ4A 3M9OB 2HLTA 2VQFJ 1S1XA 3TWZA 5IV4A 2W7OA 1NK0A 4P2XA 3IGVA 2CDQA 3K57A 1CPZA 1N0UA 2GHPA 1I6JA 4IQMA 1CQMA 4HEA9 4FF4A 5KG0A 4G1QA 4CO5A 4DFPA 2QRRA 1MU2B 3B78A 2F40A 1FVQA 4M5DB 4J91A 4M5KA 4JI6F 1B99A 3R5BA 3H7HB 3VAMA 1LEOA 2OPQA 3R6LB 4O3NA 2BQRA 1K44A 3L7UA 5D15A 3RBEA 3ZZRA 4MAKA 2FJAB 1PYTA 3I32A 3MGJA 3MM8B 3R8YA 4D3GA 4RL1A 2XCAA 3MR2A 4DR2F 4KGXB 2K3KA 1QE1B 4ZKAA 3NNEA 3DLKB 3MM5A 1YBAA 4UY85 4B3OA 4QWAA 3VGTA 3MPYA 1N5VA 3BDPA 1HHSA 1SBRA 3BGLA 5B09A 2MKIA 4DI6A 3HFKA 4ELVA 2GQ2A 2DNGA 3R6GB 3FCHA 1IKVB 4BC7A 4JI7F 1S1TB 3MFIA 4YUDA 3RRHA 1UWAA 2HNZA 3C3LA 3AFGA 3QGGA 4F26A 1RQ0A 4ANCA 4CO0A 3QRRA 2P6SA 1GT8A 3NBPB 3N6LA 3N9UC 3FMTA 4AFFA 2J6UA 4KGKA 5B0AA 4K4TA 2RDIA 3TQ1A 1Z1ZA 1ZM9A 2R7RA 4I4BA 2ASYA 3DDKA 1D9AA 2BQ3A 4B9SA 1Q5VA 1QVGR 2LA6A 2DEIA 2GJIA 4JI7J 4AL5A 3UDLA 1C4AA 1WEYA 2ILYA 1N32F 1NHVA 2AGOA 2D3UA 2OPRB 3M8WA 5KTQA 2HLUA 2NXCA 3ICLA 3OFGA 5L1KA 1G7CB 1Q8BA 2CNNB 3I0SB 1HBNA 2JSXA 1FRHA 2LEBA 1RTHB 2CVEA 3PW2A 1DAXA 5C2GA 2VFUA 4C0HA 5HL7Q 1S77D 2MKKA 3RW6A 4ES2A 1HQEA 3TX0A 3TW0A 3GE9A 1EETB 1FK9A 4RW9B 3GXQA 3PXGa 2I1RA 4DX5A 1YQHA 1WHXA 4ED0A 4DS5A 4V19J 1U26A 4U96A 1RGVA 3O44A 2IA6A 4ZPDA 5KFRA 2R8JA 1VIOA 2FTRA 4YB5A 3UVJA 3ZTSA 4CLWA 3QSYB 2CNLB 1LXJA 2CQGA 1YZ6A 2CJXB 2ALYB 3IAM9 4QR2A 2M5YA 1PO6A 4PCQA 1N6QB 2L9WA 3ILLA 2KRRA 2BJ3A 1VQSA 2Y1JA 1TKDA 2I2YA 1G2EA 2HBYB 3PO4A 3QRPA 4LF8F 3EDQB 3MUVP 3D1OA 2VG6A 3GR1A 2EXUA 2HZVA 3CJ3A 3DFEA 4PG6A 4Z2XA 3EGZA 4ECRA 3CNQP 5IWAJ 4PQUA 3TZZA 2NXEA 2Y0SD 2FVQA 1SIWB 1IXKA 2MQLA 3DOKA 3HFZB 2ZKTA 4FBTA 5IM0A 2XSJA 3PYEA 4ZN1A 5K14A 1M5PC 2R8GA 3AOCA 2XS5A 2O01C 3BR8A 2VPZB 3K5OA 4MMOA 3V5RA 4K2XA 2ERRA 4L6V3 2NYHA 2LQBA 2QMUB 2JFKA 1NDCA 1ZM2A 1RDRA 2QV6A 1JLFB 3JSBA 3WDOA 3BO2A 3HD1A 5K5MA 3TA1A 2PEHA 3VAFA 3GR0A 3DOMB 2E5LJ 2E7WA 2AZ3A 5IXUA 1CJKB 1RTZA 3KMQA 3K5NA 4NLYA 4OX9F 4BCAA 5KOXA 5E33A 4UOFA 1GH8A 1UVMA 5KFVA 2BM0A 3R5GA 1RT4B 4R8UA 4YDDB 3U1MA 5J2QA 3KJNB 1X4EA 4CLSA 1FK9B 1F9FA 4KRWA 5DZ6A 2M3DA 3FSXA 3BKFA 1ZTTA 1U1KA 1KLMB 2RUGA 2CQIA 1VR6A 2D69A 2YH0A 3EGNA 4OHZA 1PKUA 2H9ZA 2IAJA 3K8VA 2K8GA 1FRXA 4EGLA 4X4OA 2RBFA 4TKTA 3LWMA 3IAS9 4EO8A 2Q79A 4EEYA 1U0HB 1FRKA 1ARQA 1RT1B 2ATCB 3HSZA 4JI3J 2WSEC 1JLQA 1BWEA 1WHWA 2M0GB 2W9CA 1JB0C 3EICA 2UUCF 3MMCB 4JB8B 3OTCA 3C6TB 3QIPA 3CDBA 4NYPA 3JSMB 1XNRF 3OTOF 2JEFA 4DPWA 4E0DA 1IJEB 2FJVA 3KYLA 2CPHA 3UD4P 3J81j 2DD8S 5IM0B 3VQSA 4CLKA 3DOKB 1X4DA 3KG4A 2D3OR 3DLGB 1W26A 2JVRA 3OXFA 2GO9A 1HA1A 3UDVA 3ONQA 5EWEA 3SCLE 2LDIA 4PG8A 2VFSA 2VG6B 1WKLA 3HT3A 1VQNS 4JV5F 3M6UA 1SKWA 1SC4B 3O2IA 2NXJA 2B4OA 2RVJA 1SJ3P 4D3HA 4YOEA 4ZCLA 4YR2A 2GVDA 2WHOA 1GMWD 1GTEA 3AJ1A 1S1WA 3H59A 3TRGA 2BVZA 1I1GA 1MWQA 3M05A 1NK6A 1QD1A 1DLOA 3MWBA 1TK5A 3OVAA 1IBKJ 3TAPA 4FP9A 3PY8A 3HO1A 4FYYB 3ZTRA 2OD6A 4MK8A 4J9OA 1ZA2B 5LXYA 3RW7A 3OSPA 2C3OA 4AE5A 2LCWA 2CKWA 4QR1A 1KFSA 1XR7A 2C42A 3PW0A 2XHCA 4LF5J 1HBUA 4ZP7A 3V81B 2HQFA 4ZVHA 4WFBQ 4NXNF 4TU9A 1UVLA 2UXDJ 1K9MT 1IQTA 4PKDB 3M8ZA 1NZAA 1GAOA 5DG8A 2OJ3A 2YKPA 4NLVA 3MEKA 4PG5A 4Q5VA 4HLBA 3C6TA 2R2RA 2RILA 2YBVA 3CJRA 3I0SA 5HQMA 1RCXB 1W25A 1FEHA 2BE9B 4M5IA 2LKZA 2V4RA 2BUNA 3CD7A 3SSRA 4A4JA 2CZ4A 1RT7A 2Z0GA 2CPIA 1F60B 1S6PA 2K1RA 4YP3A 5BYSA 5DQIA 2L41A 2IMWP 3W60A 4N41A 1Q5YA 2YKOA 3AY0A 2WOMB 3MTJA 1S9GB 4DUZJ 1N34F 4W90B 2ACMA 4ATNA 2R7QA 3A4TA 3ISZA 4H54A 1LV5A 1RT4A 1FTCA 1V3ZA 2POKA 1WWHA 2VPWB 1D8ZA 2LP4A 1EKRA 3C8YA 4CCHA 4DG1B 3L4BC 4IG3A 3H40A 4LF6F 4DR1F 3OL8A 3I0RB 2W2OP 2BACA 2NSBA 3IP0A 4QYZJ 3DU6A 4NZ6A 3I82A 3M8PA 1IKVA 4ZCIA 2HWHA 4I1TA 5B0CA 3G8TA 2XWXA 4HTJA 4ECWA 4LF5F 2UXDF 4HVZA 1EZZB 2XTEA 1VRUA 2DHAA 3E8OA 4AD6A 3I55S 1S0OA 2NQPA 2HW3A 1F9HA 2Q3PA 5KG7A 1VRQC 2VB6A 4DR7F 1RWXB 4IDKB 1IBMF 4ILMA 1RTJA 2E1RA 4ZHRA 5K14B 1CC8A 1JJCB 2D74B 2CIMA 3CCWA 3H8YA 2DGUA 3CWJA 4J90A 4YB7A 2PMZD 4CO1A 4Z7CA 3NKYA 2KG1A 4DQRA 3Q2SC 4JI0J 2F8MA 1TKTB 2Z2MA 3PACA 4OFZA 3O6QA 4LUBA 4ELTA 2UUWA 2A6OA 1NHUA 4LF8J 2DR6A 3MR6A 1NLAA 1NM2A 4KJIA 2B51A 4FVCA 4MK9A 1CEZA 4JI5F 3MAQA 4UZBA 5A6WA 6AT1B 2H1YA 4M5HA 5F8IA 2XZWA 1S1UB 4LJMA 4CLFA 4IOAQ 3A8IA 1NH8A 2DIUA 5T7LB 5U47A 4OLOA 4ECTA 4LFBF 1NO8A 2YNHA 1GMUA 4HI2A 4N56A 4ELUA 3FBEA 1MN7A 1M5HA 1YRUA 3SFGA 4JOUA 5LMUJ 5CABA 2JJ4D 4BWMA 3AJDA 1RT6A 1U02A 4P75A 4UOHA 1HWIA 2WSFC 5J1NA 4BC9A 3PR5B 2DNQA 2XQCA 5KAKA 1OQ3A 3BQ1A 2Y1IA 5GAEU 2C2EA 2OO4A 3K59A 2W25A 4IFYA 3SI8A 2V9WA 1HWJA 1NHKL 5CYQA 4ZS6A 3DRYA 2XY6A 4I7FB 3I4PA 4OHXA 4OYPA 1FWKA 4J9KA 3UCZP 3RBZA 1HMVA 1YIJS 1S7HA 2BR0A 2L3MA 4QYZK 1F0XA 1VRUB 1IQZA 1B0TA 1NU4A 4I56A 3S8SA 5HVFA 2B4UA 2HHUA 3MEEA 1RZMA 3MM9B 3QIDA 5EUHA 2VOPA 3GU0A 1QAJA 4NE9C 4RW6B 1KHWA 1N5YB 1F6TA 4NI2B 4XPEA 2Z56B 1HBOA 4URSA 3D4JA 4F50A 3CPWR 4IH6A 2PFFB 4Q2MA 1NXIA 2DT9A 1YZ7A 1YKWA 4A8WA 2XMJA 1S99A 2DYAA 2CQ2A 4K8RA 3RBXA 2V4JB 5IFMA 1NBEB 3KUGA 5D0EA 4ZLLA 1RP5A 2M8HA 4C4WA 3TZXA 2NUHA 5KFZA 4DN9A 1TVRA 3EUNA 2YWFA 2UVRA 4TYAA 2RJZA 2RKIA 4UUXA 2PSZA 3BBCA 3K17A 4RWXA 2Z4PA 2BABA 3GJRB 4LIWA 4WPAA 1YI2S 1MLAA 2GVZA 1XNQJ 1B7FA 5T14A 1NSPA 3BN7A 3M8QB 2MHNA 5D0GA 1BQMB 2FDNA 2QLWA 4OHWA 1RB0A 4CZCA 4PUOB 3CD5A 3QT8A 1JWWA 3W5ZA 2E1AA 2CUYA 1HBUB 3I87A 2EFQA 4KQZA 3IS9A 5IC6B 4Y00A 4YB6A 3H5XA 1OPZA 1N52B 5H1SV 1JXVA 1F5CA 2IYIA 2DHGA 3C46A 2PD1A 1Y11A 2FZKB 2NS1B 4P10A 3CO0P 4P74A 3ZTOA 5E41A 4KC5A 3T1HF 1KVJA 5JVGQ 2FJDB 4DV0J 2RF2B 2I6WA 1KVIA 2WAQD 5J2MB 2HGNA 3OW2R 5ETMA 4QW8A 2ZM6F 1KS2A 4XK8C 1GMVA 4LF9J 4KGVB 1HFEL 3OSNA 1UP1A 1BE4A 2GMJA 3ULHA 4JUZA 1RAAB 4ZLJA 2W4CA 2C3PA 3CF5Q 1KVKA 1S10A 1TFYA 5LSRA 1NLKL 1EQMA 1SXLA 1UFWA 3K5MA 2K7JA 3W9HA 3HHLD 3OLBA 1TKTA 2V9KA 1S49A 5ETRA 2YX4A 3CULA 1UFKA 1L3UA 2XI2A 3QFHA 3NLCA 3FCWA 1DQAA 1TL5A 3HFVA 2G0JA 1O51A 1RAFB 4RW6A 2B4VA 4CT8A 4DOZA 2XTCA 4R0EA 2QA2A 1VBZA 1FXLA 3GQCA 2BSQE 1HQUA 2GIFA 4L3NA 4DR5F 1M5VC 4WF9Q 2DR9A 5HSPA 2ZHBA 3D67A 2YX7A 2AY0A 5JXSA 3TUIC 3KG1A 3MPUB 4IRCA 2BZ2A 1L3VA 2ZOGA 4G6VB 2B5JB 3OVBA 2YWKA 3Q8VA 2BNZA 4HT7A 4A8SA 5BR8F 2FY8A 3V4IB 1JIHA 2VJUA 4EBEA 4WJBA 3G6XA 2E29A 4RW7A 3B6BA 1IRQA 1TUWA 2VBYA 4P72A 1T9XA 1YX2A 5AT1B 5KFUA 1F5AA 3MPVA 2KM8C 4R8UB 5J2QB 3H5YA 3BYRA 3KK1B 2KDOA 3N79A 2P8IA 2AWZA 4K4ZA 1V9OA 1S6PB 2G2YA 2DXEA 2RQCA 5HLFA 4F4XA 3ZZOA 2OMLA 3ZTQA 1BDVA 3ZFVA 4QU7A 3N28A 4KV8B 2CG8A 2E66A 4LR8A 2CAJA 3CSKA 2OHDA 2ZH4A 1UPMB 4HR2A 1RT3A 2MYFA 4LF4F 1VCTA 5KFKA 2V67A 2C2OB 3SYZA 5GMEA 1CULA 1IKXA 1NDKA 2C2KB 2PE8A 1YJRA 4D8JA 1FE4A 1HWKA 1JQGA 3MECA 3OHBA 1QSLA 2MSTA 3HZEA 3K5LA 3QLHA 4RBUA 4MYUA 4C9DA 2VPXB 3FFIA 1S4FA 2JFDA 3LP1A 4NWBA 3BQ2A 1UW9A 3KUHA 5IQQA 3SSSA 1OM2A 4ZHRB 4ED3A 1D1UA 4IUFA 1LK5A 2H4YB 2OGUA 4KO0A 1WG4A 3KDNA 5EX3A 3BQ0A 2L9NA 3IO1A 1R8CA 2K6LA 4FKYA 1OQ6A 2DH9A 2ZZMA 1TQLA 5DDQC 3CCRS 2HGLA 2VC0A 3AA8A 3J7Z5 2ZH1A 2ZBCA 5CYMB 4YN3B 1EB0A 4DJBA 1S1VB 3MFHA 2C28A 1EQ0A 5HN0A 3T1AA 1D9DA 3W2WB 4ETXA 4Y2KA 4DG1A 3C15B 4M95A 1P9YA 6FD1A 1XERA 4FVMA 1XR6A 1CBKA 1DTTB 2EK1A 2Q6CA 5HI7A 5M2UA 3GIJA 4HHUA 1VQPS 1HQEB 2UVUA 3PO5A 2N4DA 3AD7C 4O23A 3TVYA 4DUYJ 5HAOA 4O3QA 1YJ7A 2M2BA 3UD5A 2X3DA 4GVBA 2YKNB 1HNWJ 3ISNC 2ASJA 2HMIB 4C8MA 4OJHA 4CDIA 1BQXA 4TYBA 2MB0B 2FJBB 3HHKA 1C2PA 4PXCA 4IO1A 1QLNA 4RW8A 2R42A 4GVBB 3DLEB 4UY8T 2NYIA 1QAYA 4ECSA 3L3CA 4YMEA 2RH3A 3D6TB 4KYZA 4QYRA 1EJ7L 1HNIA 1VYAA 3NRBA 4WTYA 4B02A 4FS1A 2NLWA 4HHHA 4QU6A 1G4CA 1JLBB 3JS9A 3CDAA 1YBTA 2HS4A 4LVNP 1OHNA 3RB4A 1AW0A 3H4DA 4LREA 3NS6A 4F3QA 4F0MA 5C25A 1GEHA 4ECQA 1T05B 3ET6B 3SQGB 2QN6B 3U27A 2Y1RI 4C2MA 2DR5A 3DM2B 1AB8A 1X4CA 2KHCA 3QZ7A 4DR3J 1JJ4A 2DGSA 1TV6A 2OMOA 2XY7A 4DV2J 1WC4A 2IM3A 3TI0A 2RU9A 4UOGA 5MLCV 3BPDA 3CJKB 3SFUA 5KFWA 1R0AA 4ZCMA 3BJYA 2YPYA 3CJKA 1U4BA 2XBPA 3CDUA 3DLKA 4DV5J 1QE1A 3IBCB 4NX9A 2K3IA 2ROEA 1FRIA 1TV6B 1X5PA 4E98A 2KZMA 2BDPA 2XSJB 2I9SA 2COLA 1BUXA 2HVEA 3FMWA 2IPOB 3SQGA 1I94F 3CJ2A 2G0IA 1APSA 4DR2J 2VIHA 3RYLA 2UUBF 3KLFB 2OPPB 4PPDA 3OXGA 4DU7A 5LT5A 5K8OA 1UVJA 1KTQA 2CQ1A 4DV3F 2DPIA 1ITPA 5H9EJ 1JLGA 1F2HA 3GWCA 1XNRJ 2LEAA 2VG5A 2YKAA 1HW9A 3FVYA 4FN5A 4X4VA 4HH1A 5E3CA 4ZLPA 4ID8A 3K0JA 4ZOSA 3FEYB 3V6KA 3EXYA 1VQLS 4TNOA 4USKA 3PJWA 3KDOA 1KQKA 2ZNZA 5AXLA 1OSDA 3OL7A 1KONA 1Y00A 4QWCA 3X1LB 3FNNA 3UWTA 3BGFA 5K20B 4DR5J 2RHSB 2CPFA 1AA1B 1S48A 3I9V9 3KG0A 4FXWA 3JAMU 2M70A 1L3SA 3CO9A 2V6AA 1IKWA 3TUJC 3L09A 1TK8A 4GVLA 4RW7B 1TAUA 1YHQS 4FBUA 4USVA 1YK9A 4ZN3A 2XC9A 3K58A 4DQQA 1HBNB 2CWKA 3HX9A 1VRTA 1BXNA 3C6UB 3MF5A 4OIXA 4ZVEA 4OYXA 4O0IA 3A3OB 4J5OA 1U6ZA 4DZDA 2VZ9A 2F9JA 3HXMA 5CZVA 3T5HA 2ABYA 4NEYA 2R7VA 4WK3A 4OYOA 2DR8A 4IO9Q 1R8AA 2ZUGA 2OIHA 1M1KT 4LSNA 5CZXA 1BQNB 1J5EF 3FFIB 3LP1B 5LSLA 4EYIB 1FDBA 5DGBA 2AW0A 1MMDA 3GJSB 3ZZZA 3RAXA 4CYUB 1UVIA 3CJSA 5I42B 2E44A 2CRLA 1RUSA 4CI0B 3AWRA 3T19A 2VASA 2FGOA 1FESA 3MMBA 1F5BA 4JI2J 2MLYA 1RISA 5BYRA 2HWIA 1U48A 4NCAA 2KYZA 5CCMA 1LWFA 3IWLA 2FHOB 3PFOA 3TVKA 5IWAF 3OV7A 3FEXB 3FQKA 1PARA 5HLFB 3D6FB 4LR7A 3T5JA 2K7KA 1WI6A 2AJ1A 4LFAJ 4M5MA 4H4KA 1RT5A 1T9WA 1U25A 4KT0C 1N36F 4Y28C 2IRUA 2OPSB 1RLDA 3GZ7A 3SIPB 4J9LA 2G9OA 3E2EA 1R3NA 4EK2A 2FYXA 3M2UB 2J9DA 2HNDA 3EMTA 3H98A 4NCGB 4EYHB 1NZ8A 5CCLA 3TVZA 3P6YC 1E6VA 2FD2A 3PVXA 1KLNA 1FXRA 1NPPA 4USHA 1I3OB 2GVZB 2QYCA 3HDSA 2APOA 4DX7A 2CQ3A 3RZAA 5J1EA 5D6GA 3R1HA 2IYGA 1F2GA 3QMQA 1EARA 1GXTA 2MKHA 3I5CA 2YKMB 2OH2A 2L9DA 4URQU 2W9BA 3AJ2A 4FKXA 2D3O1 2N3LA 5LL6d 3NNCA 2J5AA 1C4CA 2OFGX 1YWXA 5E0OA 3Q8QB 2KG0A 5B0EA 3HJFA 4OYIA 3TEGA 3NCRA 2RE1A 3UD3P 1H2VZ 3W62A 2GGPA 4WXWA 4L3KA 1EAYC 3BSCA 2BKOA 1DURA 1JNRB 2Z8QA 3P4UB 3RJMB 2GW8A 4Q43A 2HQGA 5J2NA 1S6UA 1U1PA 1OIAA 2GFFA 2GGPB 2AIRB 2OSQA 1JLEA 4P9SA 3R97A 3S01A 1N36J 1F3VA 1QJHA 9RUBA 3MM9A 5DG9A 1DHMA 3ZZ0A 5KFPA 4OYMA 4WYLA 4WTOB 1QSYA 4EUVA 1IR0A 3H5UA 1N8RT 4C0OC 1B3TA 1H7XA 1S72S 3ITHA 2HFSA 1REVB 4WFZA 1FRJA 1TKZA 2GCFA 1SQGA 2YWWA 2KOEA 2VV5A 1HR0F 4C8OA 2P2CB 3HHDA 4K50A 2BE2A 2UUAF 5BJRA 3C16B 2JLEA 3BH7B 2XTDA 2XMAA 4DR6F 3IM8A 3T1YF 2HHWA 3ZO7A 3SQOP 1TL3B 1NH7A 1UPPA 2XMVA 1NPRA 3PV8A 3IR6B 4Q0BB 1X4GA 3M2UA 1X31C 5CAAA 2JEJA 4Q8FA 2A2BA 2PMHA 1RHUB 3F44A 1SUQA 3I5BA 2DY1A 3CGIA 3V4MA 3NGUA 4RUCA 1R0BG 3I6PA 3IBWA 5KFYA 1Q81T 3HF5A 1VHIA 5A76A 3QRQA 1C1CB 3DKDA 2WK4A 4NLTA 2YXLA 2ZDPA 5KFLA 1F1BB 3RRGA 4OI0A 4I0WA 5ETVA 5B0BA 4LR9A 5D77A 3M9NB 3AQOA 1S5ZA 2ZFHA 1JLEB 2HG4A 4MKYA 3OVSA 4KR0B 1R27B 2DBBA 4RNHA 4ZVSB 3KXDA 2DKOB 3O3LA 4LBPA 3T1YJ 2NZ4A 5KFXA 1N5YA 2HFNA 1XNQF 1NK7A 2CJYB 3K7RA 2H3EB 1CG2A 2QFIA 5D8HB 3HJVA 1OJ4A 2DTJA 1H72C 2AV5A 5E7OB 2ZBIA 5L8RC 4X64F 1N4LA 4DV6F 2RB7A 1X93A 3Q24A 4J9MA 4F4WA 1N34J 2IY5B 4C11B 2YNIA 3WIVA 1ZAXA 3RR7A 3KOAA 1G3OA 3I4HX 5HROB 1S0VA 4UZCA 1BMQB 3PKMA 2A18A 3I31A 4RW4B 5D78A 2XI3A 2MXYA 5H9EK 2VFRA 4TLRA 3Q8SB 2HHHJ 1B28A 1E6VB 1LW2B 3AHPA 5ETLA 1UKUA 1GX5A 2KELA 1C0UB 5LOQA 1FKOA 2MLXA 2NPIA 1PILA 4OI2A 3D3CJ 1S57A 5L39A 1X5OA 5LJ3Y 4YY3F 1EIYB 2OSRA 1DQ8A 4U95A 3RU0A 3TR5A 2DK2A 4NLOA 2KB2A 4OX7A 5LMNJ 2GO8A 2JBVA 2CPJA 4DR4F 2FGCA 3G2XA 3B82A 3EGVA 2WTFA 4ECYA 4NXMJ 1RAOA 3LWLA 3LP0A 2X1GA 1H7WA 1OYEA 1S1UA 2FVCA 1N0VC 3OFHA 2CJQA 3POTB 5C24A 3RRKA 4KIAA 1RAIB 1JKHA 2MMYA 3EZOA 3MMAA 3UNGC 4ENOA 3EZ5A 3VGVA 4ZPWR 5L9NA 4DV6J 2ZUAA 2YQ1A 2CWXA 1N32J 3BGRB 4NRUA 2CPDA 1IBKF 5C7PA 2QL7B 4O4GA 4C8YA 2Y9HA 4QPXA 4YHHJ 4DMZA 1BQNA 4DPTA 3QQCD 4C48A 3TYTA 4C8NA 5J1PA 4I6AA 4ANDA 5KFJA 4P73A 4IR9A 1Y0HA 4GO5X 5THWA 1QTGA 3RTVA 3SV4A 5FDLA 2ROPA 4X4SA 2J8SA 3D68A 3LH2S 4ZVRB 2MLZA 4QQBA 4CLLA 2PO4A 3QJPA 5AXKA 2DR7A 1HQ2A 2IVFB 1RA7A 4NXMF 2ZD1A 3NGRA 5GADU 2HIYA 2KXFA 5F9NA 2PEBA 2ZOFA 2HVIA 5F0WA 1H74A 3QOQA 2EKYA 2DHSA 2OLWA 1WOSA 2GHWA 1RAHB 1C1BB 3HLUA 4KHMA 4P7VA 2J0QD 4LFCJ 4B3OB 4HI1A 4OHYA 1IKYA 2ZBQA 5B0GA 1TL7B 1K0VA 1P27B 1ULRA 4UTGA 4ZVGA 1Q7YT 1S6QB 3UCGA 2AN7A 1EP4A 2HPUA 1NRKA 1U1RA 1TKXA 2VD3A 3LPYA 4F4AA 2J8AA 1O6XA 5DJBA 4B3SF 4OYAA 2A10A 4K5RA 3CJ0A 3TUPA 1AZSA 5IT9Y 1LWXA 1ZAVA 4W98A 5HANA 3P8BB 1Q1KA 3NOCA 3MCMA 3KLGA 1TFWA 1KHVA 1ROFA 1TMMA 2IJNA 2BRKA 2V5HG 3R7NB 4NCGA 4ED5A 1IKYB 1UFLA 2HNDB 1GXUA 3AXKA 3BEGB 4P52A 2JWNA 3E3XA 4OX6A 4CO4A 2MGZB 1U1MA 1QTMA 1FFWB 2L48A 4X4RA 1SL1A 1W2IA 1ZOTA 4IRDA 1RTIB 2HS0A 4JI0F 3EVWA 1VFJA 2MKSA 2F8EX 3DLBA 2HQCA 2MY8A 3OXLA 2G13A 5T41A 4DX8H 2GAHC 3OL9A 3IFEA 4IH7A 5RUBA 4OYBA 1GTHA 3DXBA 2P6TA 5BXIA 4B9VA 3W63A 2XMTA 2F63A 4NL5A 2D41A 4N5SA 1CS4B 2EFOA 4TQSA 2I38A 2HWTA 4L73A 2V2KA 3CC4S 2IDLA 2M9KA 3DRXA 5C2CA 4K0KJ 4FDFA 4FF3A 3CCZA 4ID5A 3GV5B 4A8KA 1H98A 2GZOA 4C8LA 1CSJA 3QLHB 4BLGA 5I3PA 3MD1A 5C25B 2UUCJ 4ZVTB 1TR0A 4N7TA 1M0SA 4FYXB 4LQ9A 4ZP6A 5E2QA 4ZVOB 3VALA 1FNXH 2I5JA 1CULB 1Z2LA 3OD2A 1LW0A 2ZVSA 1OMSA 2AF6A 3H2VE 3K8WA 1IBLF 3D7SB 5A8RA 1XJWB 3LO3A 1T9TA 2OEJA 4AAIA 2UU9F 4IOBA 3KNAA 2XNQA 3MAAB 1JXEA 1VBYA 2YWHA 2J0SD 5F3TA 2CQ0A 4NLSA 2XTJP 3LTOA 3NS7B 2QFJA 1AT1B 1U2RA 2CNOB 4WIQA 1UA0A 2YKNA 4F4ZA 3OTEA 1URNA 3IN5A 1KRPA 3A3NB 4WFNQ 2KJVA 1RLCL 4X64J 1XIQA 1KLMA 2RQKA 2JLGA 1BGXT 1DTTA 3A8KA 3Q22A 1VHFA 2KXHA 4C7QA 4ZJLA 1OPIA 2MQ8A 4PXDA 4Q8EA 4LRAA 2VOOA 4DV5F 2HHHF 2FLLA 2BA9A 1VGYA 1S1VA 1Y5IB 3PX4A 4M5LA 2ZWPA 2VKZG 2NXUA 3OBIA 4Z7YA 3GIKA 4ITSA 4NLXA 2YX1A 2PFDA 4DF8A 2QL5B 4UT4A 4DR4J 3JSYA 2BEFA 4XAKA 2UXBJ 2CADA 2CZVC 4Y34A 2B6AB 2IC3B 4MIWA 5GAGU 3CW2C 4FZVA 2FVPA 2JEIA 2ZVIA 2V69A 2IMOA 2YVSA 2I5JB 3PG9A 3OUYA 2HHTA 4ZP9A 2ZC4A 3W5XA 4B9TA 2PT0A 3H2LA 2YPZA 1NDLA 4NCBA 2ZJQQ 2GJFA 2WBRA 5A8WB 4X4UA 3MECB 3D6MB 1UZHA 1IKXB 2V94A 3EVMA 3HM9A 1XMBA 3FKBA 1KD1T 4CO3A 4M5NA 4DUZF 3CTRA 4KE5A 4NASA 4X4QA 3AB2B 1R8BA 1IR1A 2ZEJA 3DNCA 4FF1A 2FHJD 1RBAA 1WC0A 1N6QA 5FDLB 5GAGI 3GONA 5KG5A 4OI4A 3BBBA 3AH6A 4E2FB 4USIA 5AXNA 4M1KA 3PW4A 1P8GA 3R2DJ 1HNXF 3VGUA 2WONB 2EW9A 4LSZB 4C3MA 3AAWB 2NSCA 4PPZA 1N48A 2VU5A 2CQ4A 5HMYA 2PN6A 1UVNA 1IBMJ 4DR7J 1FJCA 1ZZFA 3HHLA 3SMZA 1JXLA 4U9RA 5CD4H 4DV1J 2R7UA 1JKHB 2BOPA 3KLGB 1OY9A 3DRRB 4MJKA 2HBZB 2OEMA 2IM2A 4DXLA 3PIPQ 3LP0B 1MWYA 4LBIA 1SC6A 4I2PB 3HKWA 5KT6A 4UQGA 2XCPA 5F41A 5KG4A 5M2PA 4ED8A 2V1SA 3BSNA 4W4MA 4KPYA 1TVRB 2R7SA 5CYJA 4RWWA 2W8KA 3GMGA 5A0YA 3OR1A 4TLQA 4USWA 2DRAA 2FJWA 3M2VA 1SV5B 4OZJA 4OHVA 3T9ZA 3H25A 3ZNJ1 2AJ4A 2YQ0A 4CLUA 3CCQS 3NBPA 3GLJA 3QAEA 5D0RA 1NJWA 4LFBJ 1RU2A 2KO1A 1FKPA 2Y3YA 3DI6B 5LJ5Y 5E5NA 1RJJA 3Q8UA 3PNIA 2ZD1B 1OG7A 1AFJA 4UUWA 2EG2A 3V6JA 1TL1A 1LKZA 4C11A 5HQ8A 3PHEA 4B3TF 3BGUA 4AXJA 4DSFA 3DLLQ 3RUBL 3CCVS 2OTJS 4O3PA 4A8MP 5KFEA 2MDAA 2XO7A 1XBWA 2AHOB 2RF2A 1XEZA 4X65J 1VC0A 4AYBD 4LRCA 5SUHA 3RAQA 5KG1A 1X5TA 3N5BA 2ZNYA 2B7CB 2OPQB 3LANA 4L72B 1FJGF 2JOQA 3US5A 3IXQA 3NS5A 4DL4A 2F4VF 4HACA 3HVWA 3D6HB 5A6PA 2QZ8A 3J81U 3QAUA 4QIVA 1QM9A 1KBRA 3J7YI 1O5JA 1PC5A 2OPSA 4BWJA 4F3MA 3LOUA 1ZH5A 2W8LA 2HK3A 1SH0A 1U24A 2JXHA 1FE0A 1RWUA 2PDAA 3ADAC 3DCAA 1NK8A 3VW4A 2HQIA 2YNHB 1X7VA 2V34A 4RKUC 1X4HA 1LWFB 2C3YA 2ILZA 3OR2A 3HMJG 4EBDA 5I3QA 3JTPA 4CLPA 3BF4A 1WKJA 3MM6B 2LECA 1JLCA 2CG4A 4ED6A 2HYIB 1UA1A 4RNOA 3VCDA 1HARA 2BQUA 4ZJOA 2GC8A 2ZHOA 1JK9B 2J9DE 2H3AA 4ZPAA 2FB0A 5A2QU 4NRTA 4P2MA 3W3SA 2VFTA 4F7VA 2DO4A 4WZQA 1GQEA 1J5OA 5J2PA 1XMOJ 2CPEA 3F0NA 5L1IA 4CH0S 4ZK7M 2DITA 4QWEA 2VF3A 5HVGA 5JUMA 1FX4A 2FZGB 5JVHQ 1SJRA 1S97A 2BANB 4WFXA 1QTNB 3HPOA 3D66A 4QIFA 5GADI 2MHEA 3CT9A 2RD5C 4NEZA 2LA4A 3H42A 3LAKA 2MSSA 2SXLA 4OZ0A 1WOOA 4WU3A 5CD4A 3CCUS 1GX6A 1NK4A 1D0EA 4DUYF 2J6TA 2KFNA 3NOGA 3UFCX 3U7JA 1LQ9A 2UUTA 1NB2A 2LXUA 5ETOA 2Q6BA 1RWMB 3ENVA 4AL6A 1VRTB 2RAQA 4DCJB 1SQEA 4A8FA 1XC9A 4DV4J 5J2NB 1NDPA 2HKEA 1NMEB 3BGOP 3CCJS 2ZJPQ 1RHQB 1CJVB 5KFGA 5A8KA 3AX3A 1Q95G 3GTYX 3MEDB 3H4BA 3M2RB 3R5CA 2Z57B 4N8OA 3CCTA 3LP2B 2BJ1A 3MM6A 1XMOF 3DYAB 1Q86T 4R5PA 4DCPB 2H5IB 3LGHA 3OR2B 4CM2A 4LF2A 2H65B 2MZQA 2H1OE 4YDXA 4GC6A 4ECVA 1X8DA 2Q2KA 4A8XA 2BM1A 4OX8A 2XS7A 4JYAF 3OL6A 1XQIA 3KLIB 4P7TA 2KKHA 2XYHB 1MNTA 2LQ8A 1SH2A 2FQQB 3HHLB 2ATLA 3ILJA 2MQPA 4JI8J 2Y1LB 2YTCA 4TXSA 3OQ2A 1ZYQA 3CDWA 5HK4A 1NB7A 2AYBA 4Q0BA 3G96A 3ENWA 2MZTA 4BBYA 1O8BA 1R8PA 2F9DA 4DF4A 3WX8A 4GKKJ 2DNRA 2J0XA 3UR0A 3PKYA 2LXFA 2GV1A 5BYQA 1XWLA 5G0RA 2U2FA 4CLYA 3TZYA 3LPEA 5KFNA 1B01A 1PJ7A 1T94A 4LT6A 5F0UA 4QIWD 1I5OB 1S4EA 1KQSR 2BJEA 2BX6A 1R0AB 1VOMA 4IR1A 5DLFA 1YJ9S 5IC4B 3KTQA 3M1VA 3ISND 3KHLA 3ENQA 2AYEA 2VG7A 4QZVB 2WVEA 2CPXA 3ZZPA 4DQIA 1AROP 4TU8A 1X60A 3J81Y 4IKAA 2KKEA 2QT7A 3R5DA 2RU3A 1LFWA 3NNAA 1B7YB 1HL6A 1N54B 3GYXB 1CVJA 4J9QA 2CXEA 3M32A 2XMKA 3IWNC 1HNIB 1KFDA 1NAQA 4UQTA 1XMQJ 1I51B 1HW8A 2BW7A 3JSMA 1SKUB 4FXEA 2V8VA 2V2VA 1RT7B 3S6EA 4CH1A 4U8VA 1HI1A 1MROB 2HVDA 2QSFA 3AXMA 4IRKA 3EM1A 3W9JA 1X9WA 2J7KA 3R5AA 3HSJA 5EHHA 5HBMA 2UXCF 3DRRA 3DN9A 4CTAB 5A2QY 3GP9A 3D1HA 1X0FA 3P5TL 2DO0A 3L7PA 3RGIA 1PCAA 2B9XA 2MJNA 2OAUA 5B0DA 1T3NA 4DWIA 1P1TA 4F0HA 3MOJB 7FD1A 1RT2A 1WG1A 3HVRA 4X4PA 2MTLA 4G65A 2JNJA 5KFSA 4DQPA 4QCLA 4M5GA 9ATCB 1E6YA 3QPIA 2XLJA 3PJXA 1SB6A 4K7QA 3WC0A 1RT5B 2YH1A 2VUGA 1SH3A 4NZ7A 1KC8T 1J5EJ 4M94A 1FD8A 2R4FA 1IJFB 4I6YA 2BKNA 1WDTA 2P9EA 3GFYA 3HKZD 5T7LA 2UUAJ 2R8KA 2LMIA 1S1WB 3KLHA 3LUYA 4K4WA 1FD2A 4WFAQ 3Q0AA 2A0FB 1Y3JA 2VG5B 3MCSA 4LQ3A 4YR3A 4IOCQ 4JBCA 2CQDA 2B43A 2K29A 1WACA 2IBOA 3OTBA 4O0NA 2VBWA 4I2QB 4WFYA 3DLHA 4JI5J 3QBCA 2XMMA 5SZTA 3PW7A 5A8WA 1PYOB 2YY3A 3OPKA 1HPZA 1X9SA 2AZ1A 2W2NP 3R5JB 4RJVA 1PJ6A 3QNWB 2RDDA 2N3OA 1PYSB 5AE1A 5L1LA 5KFQA 2FIUA 3CCLS 3KHHA 3RB3A 4Y2IA 1ZTWA 3HHNB 1CS4A 1TK0A 4X66F 2VJVA 3VTIA 4OL8A 2B3TB 3QGIA 2A1BA 2IJFA 1YDLA 5F8HA 2E5IA 3Q8RB 3PTWA 3TAQA 4L74A 3CC7S 2AJFE 3C14B 3G82B 3JQJA 5EN1A 4FXVA 5DDOC 1VDHA 4YFUA 3BO4A 4OZNA 4DR3F 1K0TA 2WB1D 3DM2A 1IWGA 4K4UA 3OFFA 1MWZA 2FHJA 3FEZA 4ECUA 2F5GA 4DN0A 4Q2LA 4ED7A 5C5JA 2IAJB 2HFZA 1T9UA 2V8PA 4JI4F 4X62F 3MI7X 1E6YB 3LJPA 1NSKL 3FCVA 1N5QA 2E5GA 1PG5B 4GO7X 1DRZA 4DS4A 2WW8A 3DGVA 2HHXA 4IQXA 1T03B 2UVVA 1Y5LB 3BM7A 2IM1A 2RUSA 2JLFA 5DZ7A 2NR0A 4HKQA 3E01A 2DGVA 3A13A 1S0NA 3G71S 3A3PB 7AT1B 1WC3A 2UUBJ 2OPRA 1IBCB 2BRLA 3D3BJ 5L38A 1SPBP 2JC0A 3CJ5A 4ALZA 3MUTP 1M5OC 1U6BA 4TY8A 4FYDA 2J9EA 4ANEA 4BDPA 2FHMA 1UAWA 3D5MA 3K2YA 2E1CA 2G0CA 4DBQA 2LQ5A 1UTAA 2B7BB 5LSOA 4YY3J 1A0OB 4RZRA 1LWCB 4KAIA 3VEAA 2KT5A 1WDDA 4MKVA 1I94J 3C15A 1W7WA 4AQYF 1ZAWA 2EFNA 1HPZB 3B4DA 5GAEI 2NPFA 1DARA 1PIEA 5ETQA 4ID5B 3G4SS 5E3RA 1LFPA 2WB4A 3MZIA 4DPYA 4OX9J 4I2QA 5AXMA 4F67A 3T6JA 2GAGC 1VMBA 1RHKB 4JV0A 3NAHA 3G86A 1NEEA 2HQDA 2DGXA 2V8DA 5GMDA 3T5LA 1K8AT 3FQLA 1FT8A 2PA8D 1SVDA 1VQYA 2DHHA 2M52A 2XHWA 3MEGB 3BDEA 1PGZA 5J2MA 5KFAA 2ACYA 2Q1LA 5H9FJ 3PEJA 3UVJB 3VAHA 1B70B 3KJQB 1DZ5A 1RTIA 2ZZTA 7FDRA 1FDAA 2EFGA 2QA1A 4R25A 1WSRA 1FEEA 1MMLA 1RHMB 1SI9A 2JC1A 4DV0F 1VQ5S 3IS9B 3WIUA 4O3SA 3QJJA 1RWVB 1JLAB 2A3JA 1JLBA 3BGRA 1SCJB 4ZCKA 5KT7A 3N6NA 4HL9A 3WX4A 4A8OA 2E1PA 2QX0A 4MFBB 3JYTA 2HHQA 2XGPA 3P49B 2AX0A 5HP1B 1S76D 4O44A 4TN2A 1U9PA 3MR7A 4ECXA 4NA1A 2MPUA 2CPGA 2KFZA 5HBMB 2CAXA 4LVOP 2EBGA 3GJTB 4CIOA 4GKKF 3JTNA 3QWUA 4KHPJ 2O1PA 2C22A 2HMIA 1Q16B 1UUJA 1TKXB 1BAZA 1KR4A 2QMXA 4K5SA 2Q43A 4Q45A 3B54A 4JI2F 3AD9C 3NL0A 5IS2A 4FS2A 1T3OA 2KJWA 1URRA 1RU1A 1UEUA 5E3PA 3IRXB 4K4XA 4O3OA 3VWSA 4G1PA 4CLZA 4ER8A 1FNOA 2QYGA 3W66A 2ZJRQ 5F9LA 2HNZB 4OMFG 3QATA 3S1TA 1CJKA 2KZZA 2KN4A 3VV2B 1NJIT 2LXIA 1AYEA 2WCXA 2XLIA 1OY8A 3BKTA 5KT4A 1QAIA 2W7AA 4DL2A 2E7VA 4MYTA 2AGQA 2VBZA 2IHR1 2CJ9A 3FDSA 5D0HA 2LQ9A 2DY9A 1WELA 3T6BA 1EA4A 2QSWA 1TTHB 4QBUA 1X5SA 5GAHI 2PI5A 1BC6A 5D3GB 4I7FA 2BANA 1TMJA 4DV1F 3WQPA 2RHQB 4O4GB 5I4MA 1RADB 1VQ8S 3HK2A 1Q82T 2O67A 2HRUA 4HDGA 4EZ6A 1WC5A 3W7BA 4YQWA 3VEBA 2RS2A 1FJEB 3DHXA 3NP5A 2EI5A 1U49A 2B4PA 5K8MA 2W7PA 3D0HE 2DGWA 3AX5A 2R2UA 2QLXA 1CLFA 4NLQA 3CDEA 2VQEF 5CH7B 1HWLA 3PZPA 3QGHA 1RKJA 3LALA 4WP8A 2GJ2A 4F2RA 3DRSA 2IFXA 4OI1A 4ECZA 1SJQA 4NXNJ 4WE1A 4KKOA 3OJUA 1SUQB 2BE7D 1KQFB 1RAJA 2VONA 4W92B 4DL5A 2KI2A 4MIAA 4N77A 1HNVB 2V2ZA 4PWWA 1MG7A 4PXBA 3UDEA 8RUCA 1FKOB 3G6ES 1SJ4P 3E51A 1BQMA 4J9UE 2VL1A 2VDHA 4ZIWA 1T7PA 1LXNA 1UJ4A 1RTHA 4OQJA 3VGSA 3THPA 4DDFA 2W1BA 4RW4A 4Y6IA 4WP9A 3DU5A 1R0CB 1RTJB 2B5JA 1P9QC 4WXOA 1MROA 2DEJA 2IVMA 2XO6A 3CEDA 3BV8A 3M8SA 3R27A 3MR3A 1DBDA 2GIRA 1H2UX 4V19X 5KFBA 2ZH7A 4LMZA 2HRTA 3LAMA 5IQ6A 1M1HA 2O66A 4DHVA 3MHYA 3M32B 3VAJA 3J7AN 3PIOQ 4QIGA 4KPCA 2VA2A 2WVBA 1HI0P 4JI3F 2B8PA 1K1QA 3IR5B 4ZPTR 1PC4A 2CPZA 3V2UC
chains in the Genus database with same CATH topology
1FKPB 1BLUA 2VC1A 3TANA 4CQ1A 1KOOA 2DISA 4X84A 2BYCA 1Y7PA 4Y65A 2W7PA 4DR4F 3KLVA 1S9GA 3V6HA 2LQJA 1NJXA 2VG7B 1B0PA 2GQQA 4KHRA 1V3RA 3M1VB 2O3DA 3IGNA 3MEEB 1VIXA 3OHBA 5GAEI 4NA2A 1D3WA 2Z2LA 1WHYA 5B0FA 3CIZA 1HI8A 1FDNA 3FJ2A 3MM5B 3HP6A 1XK8A 2FC9A 2MQMA 3N4WA 2DNLA 3TA2A 1YVFA 1R43A 2MZRA 5F8NA 4KBIA 2OFHX 2UV8G 3KK3A 3IR7B 2YWGA 6FDRA 2F7VA 4IFYB 1YJTA 4O44B 3PX0A 1VQ6S 1OSCA 4DFKA 1Y9OA 4E8UA 4M5DA 1IUJA 1VQ7S 1RTDB 1IM4A 4BS2A 3OFEA 1FTRA 3FRYA 2LDYA 2OKQA 4KKOB 3TARA 4WE1B 3VAIA 3KKFA 3KLIA 3RB0A 2XZ2A 1D8YA 4K4SA 2WBMA 4EBCA 1REVA 1TKZB 3GG0A 1SJFA 1B64A 1NJYA 2XS2A 1VQKS 1H6KX 2C3UA 1FVSA 2FLPA 1FF2A 1MMNA 4AXIA 4JV2A 2C2RA 1QUPA 3EZUA 3DMJB 3O5TB 3TA0A 5FIIA 4N47A 1V6HA 4ICLB 1ZETA 2JH3A 1DJ0A 5DS7A 2PC6A 4DPOA 5F8GA 2AGPA 2AJ0A 4IFVB 1HWUA 3M2VB 3GB0A 2ADBA 3F41A 1NK5A 3J7YU 4OV1A 2W9BB 4KB7A 1GXLA 2KZZA 1HMVB 4J9SA 2RNEA 4KSEB 3MR5A 2QMWA 3M6WA 2V8GA 3E01B 4H4MB 2IVYA 4IG3B 3EPIA 1PSDA 2J7UA 1D9FA 5KFOA 2R7WA 3DOLA 2JZ5A 4DL3A 4JV1A 1JJHA 4LF7F 4LF9F 4J37A 1H2TZ 3GFXA 1WD6A 1XN9A 2DCLA 2XB2D 4DQSA 3CCMS 1AXQA 2W24A 2ZOMA 4ZMMA 5I3UB 4G1IA 3OHAA 4AL7A 3DRSB 1HD0A 2P9GA 3SCIE 4X65F 2MJUA 3R1LA 1BY9A 5CA5A 4B9NA 4UOCA 3THVA 4RUHA 2DNPA 1OO0B 2J9CA 3CC2S 4OZLA 2XSFA 5HP1A 4EFAC 5ITHA 5A8RB 1WTBA 3CE8A 4MKAA 2O5DA 3KLFA 2X51A 3HVAA 3R3TA 4A46A 2DNZA 2YNGA 2FHKA 4R0JA 2E7XA 1HNWF 4OLPA 2BXJA 4ZA1A