1SH2A

Crystal structure of norwalk virus polymerase (metal-free, centered orthorhombic)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
502
structure length
502
Chain Sequence
GTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVNED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of norwalk virus polymerase reveals the carboxyl terminus in the active site cleft.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase
molecule keywords RNA Polymerase
total genus 157
structure length 502
sequence length 502
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 1sh2A02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1sh2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sh2A03
3DLEA 3MEGA 4YR0A 1RA6A 4URGA 4MFBA 2UVWA 1EP4A 4ED8A 1WNEA 5HP1A 3DRRA 4ECUA 1MU2A 3IS9B 1JKHB 3DRSA 1S6PB 4Q8FA 1SH0A 4LSLB 5L1KA 2OPPB 4J9RA 2IA6A 2BR0A 2OPQB 1BQNB 4KFBA 1S1TA 4U6PA 4YMEA 2VG6B 3CJ2A 3FDSA 5KFBA 1J5OA 4ZP6A 4RU9A 3IG1B 3H5SA 3QGHA 2IM2A 3QIPA 1TVRA 5J2NB 4Y2CA 1T05A 3H4DA 5I3UA 3KLFA 3KLHB 3MF5A 3CDUA 1RT4B 4U7CA 1S1WA 3FQLA 2UVUA 1HNIB 2ALZA 4TY8B 4R5PB 4LQ9A 2OPSB 1TV6B 3BGRB 1FKOB 3BQ0A 2FLPA 5K14A 3GV7B 5KFCA 2ILZA 2R8HA 4Q0BA 4KSEB 3CDWA 3BSAA 3GIIA 4TXSA 4DL7A 3LP1B 3JYTB 4NLXA 3C6UB 4TLRA 4RNOA 3KK1B 3GQCA 1NHUA 2IC3A 3KLIA 2O5DA 2XCPA 5DLGA 4ID5B 2XC9A 1RTIB 5C25B 3DRRB 1S9EA 3M9OB 4RNMA 3LP1A 3DM2B 5J2QA 1TKXB 3C6TA 3LAMA 4LQ3A 5DQGA 3SI8A 2XGPA 3V6JA 3OHBA 1BQMB 5KFPA 4ZVHA 2FLLA 4NYZA 3MEDB 4QPXA 2W9CB 4NLDA 1RYSA 5CYMA 2OPPA 5C5JA 4RUCA 5KFFA 3MR6A 1IKWB 4Y34A 2VG5B 1S1TB 4J9LA 4ED6A 2OPQA 4DL2A 1LW0B 4KO0A 1S49A 4H4MA 4J9SA 4NLQA 1IKXA 1S1UA 3ITHA 3SFUA 5KFWA 5KFEA 3OL9A 1EETA 2W9AA 3DOLA 2FVQA 4NLGA 3PJWA 3I5CA 2RF2B 4QWCA 2C2DA 4TYAA 2WOMB 3DOKA 3BJYA 2ZE2A 4WFZA 5L1LA 1J5OB 3DMJB 2BRKA 4IH7A 3M9NB 1HMVA 3OL6A 4NLUA 1MMLA 4DG1A 1CSJA 3QIDA 3DLKA 3BQ2A 2AX0A 4QWAA 1SH3A 1EETB 1ZTWA 1N4LA 3I0SA 3ICLA 3FSIA 2AGPA 3IS9A 1RT1B 4MH8A 4J9QA 2ZKUA 3V81A 2JEIA 3KHGA 4MK9A 2R8GA 3LALA 2UUWA 3NBPA 3FRZA 4IFVA 1S0NA 4FS1A 4JV2A 4NLTA 3KK3B 4DG1B 3M8PB 1N5YB 4RNNA 1JLEB 3H5YA 3HVTA 1VRTA 4WXWA 1RT3A 2HNZB 3EPGA 2I5JB 1S97A 4O3NA 1LWFA 4IDKA 5KFOA 4ZPCA 4ZPBA 2WRMA 2D7SA 5CYQB 5L9XA 3D5MA 2UVRA 4Q45A 3N6LA 1IKYA 1S1UB 1IKXB 4QW8A 4K4TA 1LW0A 4KO0B 1DTQA 4KKOA 4NCGA 5F8LA 1LWFB 3CWJA 4RZRA 4EYHB 4M95A 4F50A 1JX4A 5CYMB 3GIJA 4ED0A 3GV5B 1RYRA 2VA3A 4O3OA 4IFVB 2AU0A 1T94A 2CKWA 3QGGA 1S48A 2IBKA 4NLWA 3QO9A 3OL8A 1UWBB 4G1QB 5C24B 3M8QA 3RBDA 4IG0B 2OPRB 5DQHA 1RTHB 4QW9A 4IKAA 4F4WA 3VQSA 4HYKA 3T5HA 1S1VB 2HWHA 4K4YA 2YNGB 3KK1A 3EPIA 3RB0A 3E01B 5F8JA 2HWIA 3BREA 2YNHB 4TYBA 3N6NA 3MR3A 4WZQA 1RT5B 1FKPA 5KFJA 4IH6A 1TKXA 2YNFA 3OSPA 2BANB 4O4GB 4NLVA 1SV5A 3H2LA 5C42A 5KT5A 4ECRA 4PQUB 1LW2A 5KG3A 1RT2A 3T5LA 4FBTA 2ZD1A 5KFZA 3NAIA 2JEFA 3PW4A 1IKWA 2IAJB 5C24A 5DG7A 1EP4B 2GIRA 4TQSA 1NHVA 5HLFA 1HYSB 1FKPB 1C0UA 2V9WA 2FVCA 2EC0A 4NLSA 5DQIA 2YNFB 4YP3A 2W9BA 1JLBA 4H4OB 1RT6A 2WONB 3CIZA 5KG4A 1TQLA 5K14B 1VRUB 2YKNB 3PR5B 2YNIB 5J2MA 1QUVA 2HNDB 4QWBA 5C25A 2WB4A 3PJXA 1T3NA 1DTQB 4NCGB 4LSLA 2DPIA 4K50A 5KFLA 1RTDA 2C2EA 1RTHA 3DRSB 5KT2A 4I2QA 4ED1A 3M8QB 4DEZA 2HMIA 1RA7A 1TVRB 2IJNA 5J2NA 2R2RA 3IG1A 1S1XB 5KG0A 3TQ1A 3HVTB 2YNHA 5KFRA 2VG6A 2W8KA 2RKIB 4IG3B 4MK8A 3UQSA 4H54A 3E01A 5DGAA 3DRPA 5KFDA 2BQ3A 3TAMA 3TVKA 3BGRA 3KK2A 4J9MA 1S1VA 3T5JA 2IMWP 4X2BA 2XWYA 1S6PA 4URQU 5KFGA 5DG8A 4DL6A 3I5AA 3BQ1A 3FFIB 4R8UA 3UDLA 2XGQA 2W7PA 3GILA 3Q8PB 4ZVFA 3NAHA 1D0EA 3BSOA 3CO9A 4IFYA 4MFBB 4PWDB 1HARA 1KHWA 4RNHA 1XR7A 1VRTB 4RW6B 4ED7A 1JLGB 5HROA 4QWDA 2VG7A 1XR6A 5KT6A 3RB6A 2R8KA 3HVAA 2B43A 5J2PB 2BE2B 4YR3A 2E9RX 2OH2A 5FDLA 1DTTA 4ZMMA 4NLPA 3V81B 3MTKA 4TN2A 4ED2A 1C1CB 2R8JA 4ECSA 4IR9A 2AWZA 4IFYB 4PWDA 3HKWA 2HNYB 3V6DB 5HBMB 3H98A 1QE1A 2XCAA 4EBEA 4RW4B 2RDJA 3MEGB 4MIBA 4F4XA 4ZP7A 1RT3B 2HNZA 3H59A 2JLEA 5J2PA 2BQUA 1TL3A 2W9CA 2WCXA 2YKNA 4ZVGA 1ZETA 2B6AB 3M8PA 2YKMA 4MK7A 4KV8A 2JEGA 4KE5A 1QAJA 4ZHRB 1S6QB 1YVFA 4K4ZA 3IRXB 5F9LA 4XO0A 2HAIA 3CJ4A 3Q8QB 3ITHB 2GIQA 1QE1B 3BR9A 3IGNA 3ISND 1RTIA 3IGVA 3DOLB 2V4RA 4J9NA 1RT2B 2AQ4A 1U09A 1JIHA 1JLAB 2WHOA 1KHVA 3V6KA 5J1EA 2E9TA 3PVXA 3OLAA 1HPZB 1S9GB 4MKBA 4RW7B 1N56A 3DLKB 3RAQA 2FJWA 3KMQA 2AX1A 3DRPB 2V0NA 5L1JA 4NLOA 1HMVB 4IG3A 5F8GA 3KLGB 4KB7A 1VRUA 1IKVB 3CJ0A 4WXOA 2VA2A 4H4OA 5KFXA 3KHRA 2B5JB 3DM2A 1DLOB 2BRLA 3QZ7A 5J2QB 1C0UB 3CVKA 4EBCA 5I42A 3UR0A 2FJVA 4KBIA 2W8LA 3HHKA 5KFNA 1SUQB 2IAJA 5KFQA 1RTDB 3MR2A 3H40A 2R2UA 4FBUA 3KLEA 2ASDA 1S1WB 3KMSA 1S9FA 1D1UA 3QGIA 3KJVB 4ECWA 1SV5B 5I3UB 2AGQA 5KFKA 3QYYA 1DLOA 3MEDA 4YR2A 2RKIA 1JLQA 3MEEB 4JV0A 1KLMB 1HNVA 4F4YA 3PW0A 3CJ5A 5F9NA 1N6QB 1RT5A 2DPJA 1K1QA 4KHMA 4ZVEA 3PR4A 2WTFA 1TKZB 4I2PB 1S10A 3RB4A 5DG9A 4K4XA 1BQNA 2F8EX 4ID5A 3T1AA 5EWEA 1REVA 3G6VA 1RTJA 4PUOA 3G86A 1JLAA 2IC3B 4Y3CA 3KLIB 1JLCA 1LWEB 5F8HA 4ZPDA 1HQUB 1MU2B 3DLGB 3MECA 5C42B 1SUQA 1TKZA 4I2PA 3QIPB 3KLHA 4WE1A 4ECVA 4F4ZA 2XI2A 3KOAA 3RAXA 4TY9A 1C1BA 1JLBB 4B3OB 4URSA 5KG5A 2YNGA 5KG6A 4RW9A 1TV6A 1HPZA 4ECQA 3Q8SB 4HKQA 2ASLA 4NZ0A 1LWCB 4O3QA 2AGOA 3MFHA 3CJ3A 4IG0A 4K4WA 1T03B 1IKYB 3T19A 4ECZA 4EO8A 5HP1B 3H5UA 2E9ZA 1FK9A 1JKHA 5I42B 1XR5A 2B5JA 1TL1A 2C2RA 4O3PA 3I0RB 1RAJA 5KG1A 4ZHRA 1TL3B 5KFIA 3DYAA 4EO6A 4KHRA 2YKMB 3NGDA 5KT7A 2FLNA 4O44A 4O3RA 4NLRA 4KFBB 5D3GA 4RW6A 5HROB 2RF2A 5KG2A 5EWFA 5KFMA 4Q44A 3LP0A 3V4IB 1GX6A 1R0AB 3I0SB 1RDRA 4WYLA 2VG5A 1OS5A 4IQXA 4IRCA 3PZPA 4IRDA 4RW8A 5FDLB 4WZMA 4O44B 4RNFA 5D3GB 1I6JA 2QE5A 3KK3A 1JLGA 5EDWA 3QLHA 3OHAA 3DMJA 1BQMA 3KHHA 2VG7B 5DLFA 5KG7A 1TL1B 4ECXA 2WOMA 3DOKB 5KFAA 3RBEA 4RW4A 4J9OA 3N6MA 3LP0B 5KFYA 3V4IA 5F8MA 1R0AA 4I2QB 5KFUA 1LWEA 3LP2A 2I1RA 3OL7A 3JSMB 4IRKA 4I7FA 4DL5A 4H4MB 2ASJA 4IDKB 2FVRA 3C6UA 5KT3A 3V6HA 4XPEA 3JYTA 3PW2A 3QLHB 5L1IA 3TAMB 5JXSA 4WFYA 4IR1A 1S1XA 1RT6B 1KLMA 1HNVB 1JLQB 2IM1A 3MEEA 2IM3A 4M94A 5EUHA 5HLFB 1HYSA 3DI6B 3C6TB 4MKAA 1FK9B 3QZ8A 1T03A 3IN5A 2OPSA 2HMIB 2ZD1B 3T5KA 1JLCB 1W25A 3MECB 4TY8A 5JUMA 4ZPAA 1HNIA 4DL3A 4K4SA 2D3ZA 5DGBA 2ILYA 3G6XA 4ECTA 1C0TA 2HNDA 4MIAA 4JV1A 4R0EA 2D3UA 3DYAB 2R2TA 3PW5A 1IKVA 1C2PA 1S0MA 4WE1B 2UUTA 2JC1A 4Q0BB 2FJXA 4QWEA 1HQUA 5KFTA 1LW2B 4PQUA 4NRTA 1IM4A 3PHEA 1LWCA 3UPFA 2JC0A 3H5XA 2OPRA 1RT4A 3MR5A 2YNIA 3IRXA 5J2MB 4O4GA 4K4UA 3CDEA 3GYNA 1QAIA 4K4VA 1GX5A 2WONA 4Q8EA 1N6QA 4XPCA 5KFSA 3Q8RB 4Y2AA 2W9BB 2B6AA 3H4BA 4LSNA 1FKOA 5KFVA 1C0TB 3NL0A 3PW7A 1S9EB 5EWGA 2C22A 3DLGA 1JXLA 4O3SA 4G3IA 4R5PA 1S9GA 4RW7A 1RTJB 4IOBA 4PUOB 1REVB 5F8NA 1JLFA 3M9MB 2HNYA 4RUAA 5KFHA 2R8IA 3V6DA 3MFIA 4OL8A 5CYQA 3KHLA 1ZTTA 2BANA 2W7OA 3GV8B 4EEYA 4B3OA 2IJFA 1DTTB 3DI6A 1RT7B 3I5BA 3LAKA 3DLEB 2XI3A 4ED3A 3OLBA 1S6QA 4KV8B 3ISNC 3GIKA 4WFXA 4FS2A 4RW8B 4KKOB 3KJVA 1TKTB 4GC7A 1S0OA 3NKYA 3G6YA 3NMAA 4ICLA 3KLEB 2ATLA 3FQKA 3LP2B 3JSMA 3HVWA 3KNAA 1N48A 4NRUA 4I7FB 4EYIB 1SH2A 1RT1A 4NLYA 4R8UB 1UWBA 4G1QA 3D28A 3QO9B 1TP7A 2QV6A 3KLFB 2WK4A 1T05B 2J6TA 1S4FA 1HQEB 1TKTA 4J9PA 2GC8A 2FVPA 3OSNA 1N5YA 3KLVA 2BE2A 4KAIA 3KLGA 1JLEA 3NBPB 3I0RA 4O4RA 4DL4A 2ZE2B 2FVSA 1RT7A 2JEJA 4JUZA 4TQRA 2UVVA 1HQEA 4YQWA 3LANA 5HBMA 5J1EB 2RDIA 3E51A 4Q43A 1K1SA 3BSNA 5KT4A 2R2SA 3EZUA 1JLFB 3SFGA 1C1CA 3RB3A 2C28A 2J6UA 3FFIA 4WYWA 4ZP8A 2V4QA 4EBDA 4ICLB 3DDKA 2IM0A 4J9KA 2I5JA 3GIMA 4RW9B 4GC6A 5T14A 4ECYA 1Z4UA 4ZP9A 3KK2B 5F8IA 2D41A 3BSCA 4IH5A 4LSNB 2J6SA 2CJQA 1NNDA 1C1BB 2BQRA
chains in the Genus database with same CATH superfamily
3HDSA 3JQMA 3DLEA 2EPIA 2C42A 4MFBA 1DJ0A 1EP4A 2WVEA 2RRNA 2UVWA 1WNEA 1TTHB 3DRRA 4RUBA 1MU2A 2AY0A 1JKHB 2XNQA 3GFXA 4ECUA 2XB2D 3U27A 5IM0A 4LFBF 5IC4B 1SH0A 1WI6A 3HF5A 2WBRA 2BR0A 1FVQA 4NL5A 2IA6A 1U02A 4JI6F 2VG6B 3CJ2A 1P8GA 4PRFA 5KFBA 1MN7A 1R0CB 3EYZA 1J5OA 4JYAF 4ZP6A 1AA1B 1HIYA 4PXEA 2E1AA 2PEHA 1YX2A 3ILLA 2IM2A 3PRDA 4X66J 3K0JA 4JV5F 2CQ1A 4M5LA 3AA9A 1T05A 3H4DA 3GZ7A 4ZKAA 3KLHB 2H5EA 5A8WA 1VR6A 4U7CA 2YWEA 4LR7A 3FQLA 3IP0A 3M4XA 1HNIB 3KDOA 4GRSA 1M5OC 2QFIA 1YKWA 2VJVA 3FEXB 3EWGA 2VH7A 3BQ0A 3MUVP 1X8DA 4ZPTR 2ILZA 3GCWP 4BBYA 3VGUA 1D9FA 1O6XA 3GIIA 2D9OA 3M2UB 3K5OA 3HT3A 2ERRA 3LO3A 1H2VZ 3W1YC 1FJGF 3NCPA 3LP1B 1VQYA 4C48A 1FRHA 3MMCA 3C6UB 4QIWD 2D1CA 3FUYA 4KC5A 3KK1B 1X93A 1NHUA 1WSRA 2H4YB 3CSKA 3KLIA 1VC0A 2G4BA 2O5DA 3VAHA 2XCPA 1QD1A 5DLGA 3FCVA 3VGVA 2HEKA 1S9EA 1IWAA 1T9XA 4PXDA 3LP1A 3DM2B 4TNOA 5DQGA 3K5LA 2CJKA 2V5HG 1W2IA 4YB6A 4DR6F 3MEDB 2KT5A 2IHR1 3RZAA 4JI0J 4RJVA 2CAJA 3VAJA 4UZCA 4Y2MA 3K58A 3T1YF 1UMJA 2CA9A 4NOHA 5KFFA 3UD4P 3I9V9 2XULA 3CF5Q 4DL2A 2OPQA 3OFEA 4CLPA 3W2VA 1S49A 2V2ZA 2VPXB 3BYPA 8RUCA 2CPFA 2ZOFA 1IBKJ 1IBMF 1F5CA 1S1UA 2Q43A 1T9VA 3AJ1A 3OL9A 5HVGA 1WG1A 2H3EB 2K5JA 3C19A 3SQGB 1WOPA 3I5CA 3PJWA 2RF2B 2ROEA 3D68A 2XMKA 4DR4F 2HHSA 2A0FB 1HWLA 4WFZA 1FDBA 2C2MB 2DCUB 3HKZD 4MAKA 4CYUB 5K8NA 1J5OB 1AZSB 4HHHA 1WUUA 3MM9B 3OL6A 1EQMA 1NMEB 1CSJA 1Q79A 3CCTA 3ZZTA 3HHNB 5D3GA 2NXEA 3CCWA 4B9VA 1IBKF 1F5AA 3GTYX 3HSDA 1EETB 1ZTWA 5H1SV 2AJQA 3GLJA 5IT4A 2V8HA 1V3SA 3FJ2A 4GVBA 3M8RA 1VQLS 1RT1B 2MJNA 5K8OA 1IRQA 1X31C 3V81A 4QCLA 2ADCA 1T95A 4RLEA 4CO2A 5HMXA 4A8QA 2HHHJ 3LALA 3G4SS 4FS1A 4NLTA 3KK3B 2ZJQQ 1FWLA 3W5YA 2VU5A 2F63A 4DG1B 4RNNA 1JLEB 3BPDA 2KELA 3H5YA 4WXWA 4Z2XA 1RT3A 2BUNA 2I5JB 1LFPA 4HV0A 3VVTA 1Q5YA 4CH1A 3S8SA 1YIJS 1NK0A 2P5VA 1UETA 4ZPBA 2QIFA 2WRMA 5CYQB 2UVRA 1B28A 3BH6B 4QYZK 3JS9A 2HVDA 3WZ0A 1XMQJ 1YBTA 1APSA 2CADA 2GGPA 4KO0B 1WKKA 5L46A 4DV1J 5F8LA 5DZ7A 5AE3A 3CC7S 1JX4A 4J90A 5HN0A 2GFFA 3SCLE 3GE9A 4HH1A 3AXMA 4PYAA 1LXNA 3GV5B 2GHPA 4O3OA 2KU7A 2Z2LA 3DN9A 4DZDA 4PZVA 4U8VA 4O0IA 1DRZA 3SV4A 4X4NA 4ZK7M 3O44A 1DQ9A 4USJC 1OO0B 2IBKA 1MYLA 3AA8A 3RBDA 4IG0B 3X1LB 2OPRB 3CIMA 2A6OA 4ZVPB 4LF4J 2V8PA 1CULB 3L95X 1ICEB 3TJAA 2HURA 3BN4A 1S1VB 2BE9B 4K4YA 1RHMB 2HWHA 2L9WA 4KGVB 4DV5J 1K9MT 1BE4A 3TUIC 1ZS6A 2H1OE 4MKVA 3CC4S 2HWIA 2DR9A 3GP9A 2KKHA 3MR3A 4GKKJ 1CJUA 1HBMB 1QY7A 2YNFA 3MZIA 3TNVA 5DDOC 3UDVA 1HNZF 5IXUA 1JB0C 3PIOQ 3D54A 3H2LA 2DRBA 1NJIT 4PXBA 2GVZB 2H9ZA 3QRRA 2AKWB 2I0XA 3BKFA 3MAAB 4ECRA 1VQ6S 2XZTB 5KG3A 3W2VB 4LRAA 5KFZA 3NAIA 3GG0A 3H90A 4M5MA 2GO8A 5DG7A 2HFNA 4GVLA 1S7HA 3T1YJ 1FKPB 2FVCA 1RTZA 4NLSA 2ZBRA 1SJ3P 1JLBA 1RAAB 2YH1A 2RQ4A 3CIZA 1LEOA 2VFSA 4A8KA 1SPBP 4OHWA 1FXRA 2YKNB 1NSAA 1NCLA 2A1BA 3A8KA 1QDUB 4ZCIA 2CWKA 2MLXA 4GO5X 2JVRA 2WVFA 1QUVA 2A3JA 3RRKA 2X7IA 1Q0NA 4DQQA 1HI8A 2WB4A 2L9DA 3CDAA 1Q5VA 1DTQB 3PJXA 2FHJA 2ZKTA 2CQ0A 1UVKA 1S7IA 3CW2C 2Q1LA 3KFWX 3S01A 3UNGC 2G13A 1TL7B 1IBCB 2VC1A 2X1BA 5KFLA 1RTHA 3THPA 1CC7A 3DRSB 4CWBA 2BA3A 1WF2A 1KNZA 1T9TA 3NMRA 3M8QB 4QR2A 4DEZA 2HMIA 3CT9A 5J2NA 3IG1A 4JI5F 2UZAA 3KUGA 3TR5A 1GXTA 2YNHA 3HVTB 3AJ2A 3M30B 5E3PA 1PAUB 4MK8A 2R9LA 2DNOA 1RKJA 3E01A 3DRPA 1VS3A 2GJFA 2OD6A 3TAMA 3FMWA 1SB6A 4O23A 3TOQA 1N5QA 3M6XA 4J9MA 3WHIA 1SQGA 4I68A 1GAOA 4P7TA 5B0BA 2ZHAA 2OD4A 3I5AA 2K3KA 4AL6A 2CQPA 1N88A 3OTEA 2CNKB 3TJ8A 2KL8A 3UDLA 1XMQF 2DCLA 1SC6A 2MGZA 1IBLF 2QX0A 4IFYA 5D6GA 4F7VA 4PPDA 1IR2A 2RILA 2MKHA 3BN7A 5GMDA 1JLGB 1FX2A 5A8KA 2BKPA 4LF5F 3K2YA 4PXCA 3PG9A 3R5BA 4QU7A 4YOEA 1ZA2B 4HT7A 1JWWA 1SJ4P 2DNQA 4XIUA 2BE2B 2V4JB 4MJKA 4ZN3A 4F4KA 2E9RX 2XTCA 1Y00A 1GXLA 4GMKA 4P10A 2ADLA 4LF8F 3P45B 4OZ2A 4YB7A 2R8JA 4PWDA 1HW8A 4ECSA 5RUBA 1HBNB 4BHQA 1FRLA 2MKSA 1TL7A 2P9CA 4QOTA 4EBEA 2KFZA 4RW4B 3AXKA 3MDFA 1B3TA 1SJ1A 2HNZA 2ZC3A 4N5SA 2HGLA 2UV8G 2ZHBA 5J2PA 1U47A 1JJ4A 2WCXA 2U2FA 2YKNA 2KOEA 2LEAA 3F0NA 2DITA 2VASA 2YKMA 3H42A 3NCQA 4JV5J 1RAIB 4ZA1A 1S6QB 3BKUA 2QTWA 1VBZA 3FZ2A 2KH9A 3TUPA 3HHLB 2MHNA 2BJ9A 3ITHB 2GIQA 4J9NA 3DNCA 1RTIA 3IGVA 1WACA 2AJ1A 2V8GA 3PEJA 4ZOSA 5EHHA 1JIHA 1JLAB 2WHOA 3Q0AA 4DR5F 3V6KA 2I2YA 1RB0A 1RJJA 2GVZA 2B4VA 1XTZA 4MKBA 3NWGA 4RW7B 4JI7F 1UFKA 5D8HB 1YJTA 3RAQA 2FJWA 2CPDA 2AX1A 5L1JA 1MMDA 4NLOA 1ZPWX 3HD1A 2ZOGA 1HNXJ 1HR0J 4B9LA 2R7XA 4LRFA 5EN1A 1RWXB 1IKVB 4ZJOA 3MM5A 1WHYA 4I67A 1Q53A 1S0VA 1EB0A 1MWYA 4DSKA 4OIXA 4P2FA 4X65J 3UR0A 1VGYA 4OJHA 2OFHX 5GAGI 2W2MP 4J7CA 2ZJPQ 3LF0A 4WKYA 4DV3F 3MM7A 3MR2A 2AJFE 1IUJA 4FBUA 1CULA 4CLSA 1WDTA 3T1HF 2Z30B 3B78A 3DGPA 2ASDA 5ETVA 1WWHA 2DB1A 1PAEX 1XJWB 2F8MA 2O1PA 1FESA 2ROPA 3QGIA 1V6HA 2FZKB 3ENAA 2AGQA 4OLOA 1IQTA 2CPIA 3CD0A 3QYYA 1KVJA 1CJVA 1KLMB 2OKQA 3IM8A 4NA3A 5F9NA 1SKWA 2DPJA 4KHMA 1NKEA 1ZAWA 2YKOA 3GIRA 2DIVA 3BGOP 2M8DB 1JNRB 2VDIA 4I2PB 3RB4A 2GX8A 5DG9A 2ZC4A 3FBBA 3JSBA 1P27B 1REVA 2VDHA 3KG4A 3UVJA 3G6VA 2OEJA 3G86A 1JLAA 1UVMA 1R3NA 3UNYA 4GKJF 1LWEB 5F41A 4QR0A 3UD5A 4KH1B 1TUVA 1OG7A 2DNPA 3QIPB 3R1HA 3BO3A 3W8GA 4C6AA 1PYOB 2XI2A 2QSWA 3RAXA 3N01A 1L3UA 3EICA 3IC1A 1I94J 1FXLA 3RUBL 3H87C 3MM5B 4KPYA 2XEXA 1KVKA 4ZIVA 1TK5A 1NJYA 3LGNA 1TV6A 2NQPA 2IVFB 4LF6J 2HVHA 2HFVA 2D3OR 1TL5A 2B8QA 4IO9Q 3I87A 3PY8A 2M2BA 3ET6A 2NZ4A 3T19A 3RW7A 1XERA 3BBCA 2WZ1A 3H5UA 4LF8J 5IV4A 2BM1A 5C7PA 2CPZA 1MSWD 3G71S 3WIVA 2C2RA 3VQTA 2Z57B 3LUYA 3LTOA 2MQ8A 2YWFA 2G0IA 2V1SA 4HACA 4O3PA 2G2ZA 1SJFA 1TL3B 5KFIA 2CQDA 4EO6A 4KHRA 2YKMB 1WELA 1FFSB 1Y0HA 1N0VC 3I32A 1YLXA 1T02A 2IDEA 1PSDA 4NLRA 3R3TA 2K7JA 2FLNA 4O3RA 1WTFA 2RF2A 4B9MA 2NUUG 5EWFA 5KFMA 2IA0A 5GADI 2FHJD 3TANA 1OSCA 1GNKA 2B7BB 4DQRA 3LP0A 2LA4A 4F26A 1R0AB 1AFJA 1RDRA 3EUNA 4K2JA 4IQXA 3K17A 2QG9B 2CWXA 4RW8A 3R6GB 2HHWA 1I6JA 2PEBA 5LMNJ 1B0PA 1GMWD 1G1XA 3D3CJ 4FKYA 1HD1A 1NH7A 1TAUA 5B0EA 3BYRA 1R8CA 3GFYA 3QLHA 3CO0P 4LFAJ 3W9HA 5EDWA 2XMWA 3W2WA 1R8HA 1WI8A 3BB5A 3DOKB 5K8PA 3O5TB 4OX7A 2FD2A 1IXKA 2IFXA 1WJ9A 3LP0B 1R0AA 3T1HJ 3B8HA 1R6YA 2IIHA 3FBFA 3K89A 3LP2A 2I1RA 3OL7A 2OMOA 5HJYA 1NK4A 2KZMA 4I7FA 1KVIA 3P8BB 4H4MB 2EKNA 3D6FB 4IDKB 5M2PA 2FVRA 3A4TA 1S59A 3C6UA 4P7VA 3MMCB 3V6HA 3US5A 2ZH1A 2MSTA 1L3VA 3TAMB 5JXSA 4PYDA 3W9JA 1ZOTA 3OD2A 4YDXA 1HNVB 3GWCA 1JLQB 3MEEA 4OI3A 2HSEB 3AOBA 2AT1B 2YKQA 1HD0A 2LQ5A 2AYEA 4DX7A 3T5KA 4CIOA 3MECB 1D8YA 2BJDA 1HNIA 1UPPA 1VJQA 2YWHA 2N3OA 3I56S 3M6VA 4JB8B 3VHQA 4K4SA 2D3ZA 4ES1A 4JI4J 4X4OA 4QU6A 5DGBA 2ILYA 2DGUA 4C0HA 3AH6A 4I64A 3CMES 4WJBA 4R0EA 1P1TA 3RGIA 5I4MA 1I94F 3AODA 4NMLA 2BV3A 4M5JA 2GVDA 1C2PA 2X1AA 1S79A 2UUTA 3G9CA 5JJBA 4DSIA 4Q0BB 3C8YA 1UJ4A 1PJ5A 5F0WA 2V9KA 2BM0A 5KFTA 2WSCC 4YY3F 1N5VA 1BWEA 3UPFA 3W7BA 2JC0A 1IWGA 2OPRA 3MAAA 1B4SA 5AT1B 2CJYB 1RT4A 1DZ5A 3CUNA 2YNIA 1VOMA 4K4UA 3KKFA 1EJ7L 3D1OA 3IBFB 3K7RA 3AAWB 4K4VA 5FIIA 2OHDA 4DR2J 4Q8EA 2Q79A 2KDOA 4XPCA 5KFSA 3Q8RB 1Y5IB 4Y2AA 3MGJA 2B6AA 4OHZA 3LWLA 4J5OA 1FKOA 4DL0C 5D0RA 4Q5VA 4N41A 1FFGB 4ER8A 2X51A 2GQQA 2C22A 1JXLA 4O3SA 1WG5A 2QEXS 2FDNA 2IRUA 4PUOB 4DPUA 3QOQA 1VCTA 1YJVA 2HNYA 2V8DA 2FQQB 5GMKa 4OZLA 3G5OA 5CYQA 4ED5A 4NZ6A 2BANA 4DV2J 4EEYA 1NZ8A 1B0TA 1T9WA 1WF0A 3DI6A 5L9NA 3KYLA 4LF9J 4ED3A 3MPVA 5G4DA 1B7FA 1HI0P 3NNHA 1NBEB 3CMAS 4FS2A 2YWWA 2BJ3A 1JQGA 2UU9J 3QFHA 4LBIA 4CLWA 2CVEA 2XY6A 1X0PA 2K9IA 2KVQE 3GSDA 3PO5A 4ICLA 3JSMA 3HVWA 4G6VB 1FTRA 2EFPA 1SH2A 1RT1A 1HHSA 3RBXA 1VQ5S 3OVBA 1UWBA 4G1QA 1ZM2A 3I6PA 3ILIA 3NGRA 2VKZG 3KLFB 3PX0A 3PX6A 3KTQA 2J6TA 1PBAA 2KJVA 2CNLB 2XMMA 3HZEA 4DQPA 2GC8A 4AT1B 2ZH5A 2KKEA 3Q24A 4KAIA 3PIPQ 3D2WA 1JLEA 2Y1IA 4WKRA 2E5JA 4ME7E 3I0RA 1NDKA 3FBEA 2JEJA 1HA1A 2HFSA 4JUZA 4TQRA 1N6QB 2EK1A 2IPOB 3U1MA 1EAYC 1X4DA 3E51A 5E2QA 5B7WA 3K57A 4CLUA 3OTOJ 4NWBA 3TAQA 1R8BA 2FZGB 2J6UA 1WSVA 3AHPA 2DH8A 4JI4F 1S6OA 2C3UA 1UVIA 2HBZB 1BDVA 2QYGA 4DX5A 4BC7A 4GC6A 1UCNA 1O0PA 4ZP9A 3KK2B 4UUXA 2ZH9A 5ITHA 2IYGA 3MWBA 5H9EK 2J6SA 2HYIB 4ZVOB 3MM9A 3IM9A 3UR3C 1HWUA 1HWIA 4DR3J 4LF5J 4B3OA 1AZSA 3MEKA 4X64F 5LSRA 2H4WB 2XHWA 2B4OA 3MEGA 1CPZA 3KJNB 4ED8A 5HP1A 2MMYA 1AB8A 1D9AA 3O6QA 4R0JA 1UVLA 1Q82T 1RHJB 2MKCA 5IOLA 4F0MA 1UZDA 4QBUA 3GSIA 2IY5B 5L1KA 1RABB 3H2UB 2BA9A 2OPQB 1BQNB 1TMMA 2DVIA 1VIXA 2LECA 3J7Z5 3EDRB 4YMEA 2HHXA 1IM6A 1GMWA 2OI2A 1RP5A 3FDSA 4HACB 3MUTP 2NXNA 3IG1B 3HLUA 4PAAA 3HSZA 3GJQB 2P6TA 3QGHA 2DXEA 1OYEA 3PYGA 4J9VA 5J2NB 4NXNJ 4Y2CA 5LXYA 5I3UA 1RI7A 4DV4F 1RAOA 3CDUA 1F1BB 4G1IA 4WU2A 3H25A 2U1AA 2UVUA 1HWJA 5CHCB 4CZCA 2ALZA 2B0GA 2P9EA 2ZBIA 3GB0A 4LQ9A 4FDFA 1TV6B 3IWLA 2RQCA 3BGRB 2VQFJ 3HVRA 1LV5A 4FXDA 4HL9A 3GJRB 4OHXA 2FLPA 4CNZA 1FVSA 2XBPA 4X4QA 4KSEB 3BSAA 3FC9A 3M8SA 3LJPA 4LF1A 3SEOA 1HNXF 1HR0F 2FY1A 2BW7A 1F3VA 4DL7A 2V34A 3ZTOA 3THVA 5CA5A 1MN9A 3QJLA 3G8TA 2BJ1A 1F9FA 2BW2A 2CXEA 2K7KA 4M1KA 3MD3A 4RR5A 4RNOA 3J7YI 3RR8A 1RGVA 2GQCA 2QFJA 3TI0A 3EVMA 2DNHA 1UJ5A 2DNZA 4U95A 3DRRB 1KOOA 2F4FA 2LLZA 4HI2A 3T6BA 5J2QA 1KWMA 3C6TA 3LAMA 4LQ3A 4EUVA 3B82A 3OHBA 7FD1A 3MPWA 3LPEA 2NREA 3G87A 1G2EA 1CJVB 4IQMA 4DR1J 1OYDA 1MLAA 2W9CB 2D3O1 1IBLJ 5CYMA 2OPPA 4RUCA 3IWXA 1K44A 4ZDNA 4Y34A 2VG5B 4M95A 2I9SA 1GH8A 1XN9A 2E29A 3A8IA 1IKXA 4E0DA 1Q1KA 4XK8C 4LJMA 3ADAC 5BR8F 2W9AA 4LF7J 3FRYA 4GKJJ 1U7LA 1UEKA 2LQJA 2PO4A 5K20B 4J9LA 2PDAA 3R7NB 3BJYA 2DJWA 2ZE2A 3R5AA 3V4MA 5D77A 1KKHA 3WC2A 2PIIA 1NK7A 2MTLA 2Y0SD 3LPYA 2M3DA 2OFGX 3AOAA 3QIDA 1H3DA 4P72A 2VICA 2RRAA 2AX0A 4ELUA 3R7SB 3IAS9 1SH3A 3EX7B 3I0SA 3ICLA 2UUCF 2HQCA 1DAXA 1WHXA 1JK9B 4DXLA 1Y5NB 4PR6A 2JOQA 3ZFVA 4ALZA 4Y0FA 2XY7A 1BD6A 1WORA 3CB4A 1E6VB 2LA6A 3KHGA 2JEIA 2ABYA 3IFEA 1UTAA 3NBPA 3FRZA 5B0CA 4OHVA 2PSZA 1TZ0A 2HRTA 2HS3A 2RD5C 4DR7J 4X4UA 2EEYA 1YBUA 2Y3YA 1QUPA 5BXIA 2HNZB 5B0DA 3D6TB 4NZ7A 1LWFA 1VC6A 1WKLA 4ANCA 3FCHA 3CULA 3E3XA 4FVMA 1RCOB 3CPWR 5IT9U 1VK3A 1NKBA 2QL7B 3D5MA 4Q45A 3N6LA 3E2EA 1IKYA 1VMBA 1IKXB 4QW8A 4CI0B 3KUHA 1M90T 4J9UE 4NCGA 3CJKA 1XEZA 4RZRA 1U0HA 5CYMB 5GVQA 3B54A 2KYXA 3CCJS 3EM1A 4D8JA 3BPSP 3CJQA 4OMFG 3BKTA 1PIEA 2VQFF 2VA3A 1UFLA 4IFVB 5A2QU 4USHA 2CQ4A 2HRUA 3MPDA 3ZZRA 3QGGA 1OPZA 1S48A 2XY5A 1NXIA 4NLWA 3QO9A 2A2DA 4KGZB 5ETOA 3OVAA 1VLYA 5ETLA 2IBOA 2YQ3A 2VZ9A 3SXLA 4LBHA 1RBOB 3VQSA 2LU1A 5HANA 3ZZUA 1N54B 3JB9k 4OYBA 2CPHA 4WP9A 2YNGB 4GO7X 2G2YA 1U8WA 3CGIA 3SMZA 4DZ6A 4PG8A 2J8AA 3K5MA 3RB0A 3P49B 3E01B 5F8JA 4Y6IA 1RAGB 4DBQA 4LFAF 4ZVUB 2YNHB 3M30A 4TYBA 4A46A 2CG4A 3GFHA 5B0AA 2MPUA 1VBYA 3OUYA 4IH6A 3TZWA 2GPEA 1Q8KA 1FF2A 1U1PA 1KR4A 3K59A 3OVSA 4NLVA 1V9OA 1VQNS 1UA1A 3CCRS 1W2BR 1NB7A 3C16A 4DV2F 4KGKA 4PQUB 3GXQA 3OR2A 2GCFA 4FBTA 1KQKA 1GFWB 4EZ9A 1O5JA 1IKWA 3OTCA 2IAJB 2ZITA 5C24A 3AQOA 3RBZA 4RUHA 2BOPA 4OL8A 1NHVA 1AT1B 2XMVA 1HBOA 1TL4A 1HYSB 1C0UA 3AB2B 2DD8S 2JH3A 2W9BA 5DQIA 1M5VC 4WPAA 4YP3A 1H73A 3EVOA 5DETA 4HHUA 2WONB 2Y8YA 1SI9A 4A8XA 1FWPA 1SJRA 1VRUB 3BO2A 1T8EA 4CRJA 1WDDA 4P9SA 1S99A 2HZCA 4XDDA 2DR6A 2HNDB 3AY0A 3N4WA 4FYWB 4RO0A 4D3GA 3QT6A 4LF7F 3K8WA 2HHHF 3GG1A 1RE1B 1SIWB 4DN9A 4K50A 1NH8A 1OY9A 3LH2S 2V2VA 2QMXA 4PQAA 4N8OA 1NM2A 5DRKA 2XWXA 1NLAA 2C2EA 3IR6B 2KB2A 2F5GA 2WB1D 4OYMA 4K2XA 4PG6A 4ED1A 2IJNA 2K1RA 2W4PA 1FWKA 3CCZA 4WK1A 1S1XB 3R6LB 1NHKL 1P9QC 1JJ2R 2AJ0A 2VG6A 1X60A 4ZLNA 5DGAA 5KFDA 4ZITA 2BQ3A 3NXZA 1LK5A 2CIMA 3CMQA 4BCAA 3KK2A 1S1VA 3AJDA 4DV6F 2IMWP 4X2BA 2B9XA 1WC5A 2XG8A 5KFGA 2K6LA 1BY9A 3LW5C 3TJ9A 5DG8A 1VQ8S 1B01A 3AWRA 3UDCA 2XGQA 3GILA 4NMXA 1UFWA 1DHMA 3BSOA 1NU4A 4ELVA 2XS2A 3CO9A 1K73T 4MFBB 4UOCA 2XMJA 1KHWA 1UKUA 5AXMA 1XR7A 2B4PA 4ED7A 2LDIA 5HROA 4JI2F 4QYZJ 4UOFA 1SL0A 1M1HA 1TUWA 4DV7J 2O67A 2KHCA 3HVAA 2CZVC 3N28A 1X4AA 4AXIA 3RW6A 4J91A 2DNRA 4CQ1A 1HBUA 5FDLA 4PCQA 4ZMMA 4NLPA 2EFGA 2LVWA 2QN6B 2QRRA 2ZVSA 2EFVA 5CXTA 2VBYA 3I96A 1SC1B 2BNZA 3LGMA 3EDQB 3Q2TC 2B9YA 1RBAA 2HNYB 3HKWA 4A8SA 2PMHA 3H98A 2M9KA 4TKTA 2FC9A 2KG0A 1RZMA 4MIBA 4M5DA 4ZP7A 1RT3B 1M5HA 2VFVA 2JLEA 3H59A 3PFEA 4DX6A 5HL7Q 2CPEA 1UEUA 2EVZA 3A1YG 2B6AB 3GPAA 3I55S 2CDRB 3G2XA 2GHVC 2IVMA 4KE5A 4ZHRB 1QAJA 3HO1A 1ZA1B 4UT4A 2QA2A 5T7LB 1KTVA 4P2MA 5E3CA 6AT1B 2ZNZA 2F7VA 2ZOMA 1IJFB 2R4FA 3OXGA 3R5GA 3CJ4A 2C2OB 2W2OP 5E3QA 1EQ0A 3QWPA 1RT2B 2MSSA 1U09A 2H1YA 1LK7A 2VPZB 2AQ4A 2XNRA 4DF8A 4DF4A 1HPZB 3IAM9 4AAIA 2DNMA 2FZCB 1OJ4A 2HQ3A 2V0NA 2HS4A 5AJ3J 2VHGA 1K8AT 4FXEA 1SC4B 1Q4RA 3NGKA 4LIRA 2HVIA 6FD1A 4QR1A 1RHQB 2ALYB 2Z8QA 3CEDA 4WXOA 4CYUA 1F2HA 2HS0A 4H4OA 5ETTA 3OV7A 1YWXA 2VKRA 3R8YA 5HO4A 2OGUA 4L73A 3CVKA 1R43A 4P52A 2AEMA 2CQHA 4UOHA 3MCOA 4EBCA 1QLNA 4XAKA 2W8LA 4JP8A 4LFBJ 4DLGA 3LOUA 1RTDB 4W98A 2EBEA 4ZVQB 3W63A 4F8RA 3F41A 9ATCB 1S1WB 2QMUB 1Y5LB 3HT0A 1VC5A 2HBQB 2KRRA 4K8RA 1SV5B 2NXCA 3R5CA 4L6V3 4OFZA 5D78A 5IT0A 1WD6A 3D0IE 1DLOA 3MEDA 2B8PA 2HK3A 3AX2A 1JLQA 2BNWA 1HNVA 1G3OA 3MEEB 2ZH7A 3CJ5A 2Y1LB 1FRMA 1OY8A 1RT5A 4P74A 3PW0A 1K1QA 1Y11A 2NYHA 3PR4A 2HW3A 1XNRJ 1N52B 2WTFA 1IR1A 1KP6A 1TKZB 1G4CA 3RTVA 4K4XA 2EW9A 3W9IA 3N0VA 3MXHP 3WX4A 5EWEA 1R6VA 3C16B 2RIJA 1VRQC 3KLIB 3MECA 1HQUB 4ZPDA 4Y2IA 3WDOA 4JI1J 4ILLA 2MQNA 4OI0A 3OW2R 1YITS 2BX6A 2EKYA 4B3MF 1OPIA 4TY9A 1FE0A 2P2CB 4NXNF 2GMLA 2RT3A 2CPXA 2VD3A 2E1RA 2DTJA 2HLTA 4K5RA 2FJEB 4URSA 1PYTA 2YNGA 3IMQJ 2J0WA 2ZDPA 3MM6B 4RW9A 4U8YA 5KG6A 3Q8SB 4ECQA 1AXQA 4DWIA 4ES2A 5DS7A 3QJPA 1ZAVA 4OI2A 4C8ZA 4K4WA 4ZLPA 5LMUF 1P6TA 4EO8A 1F5BA 3O1LA 4ECZA 5HP1B 1SQFA 2OJ3A 3X3UA 5HI7A 4LFCF 1HL6A 5I42B 4C8OA 2B5JA 2OELA 1WHVA 3OPKA 1CG2A 3SIPB 2G2OA 1BXNA 1GQEA 4QJVA 4ED4A 3OUYB 2XYPB 1XMOF 1WOOA 3OTDA 3MUMP 1FFWB 3A13A 3BGUA 2FHMA 3NLCA 4RW6A 4JI7J 2HHVA 3MM8B 4RWXA 4Q44A 2Q2KA 3JAMY 1TK0A 5HK4A 2GNKA 2J8SA 4USUA 1W7WA 3KJFB 3V4IB 1GX6A 4WYLA 2FPHX 2OP5A 5A76A 1H2UX 1OS5A 4IRCA 2QL9B 3OXFA 4LR9A 1A9NB 1VDHA 1LWXA 5D3GB 1D3WA 1QM9A 2K2PA 2QE5A 1AUSL 3HFZB 2RE1A 3QFWA 5KOXA 5H9EJ 3DMJA 1VQPS 3KHHA 4KRWA 5KG7A 2D69A 2MXYA 2EXUA 4QIGA 2WOMA 2GMJA 1S77D 3OJUA 3N6MA 4OHYA 1FDAA 4JBCA 3TEHB 4I2QB 1LWEA 1V3ZA 2V8VA 3NS7B 2COLA 3ZZ0A 3JSMB 3J7AN 1RBLA 3Q89A 4DCJB 3C66A 4IRKA 3IWNC 4NEZA 1DFDA 4C3MA 2ASJA 2F8HA 4W92B 1RUSA 5KT3A 5CABA 3JYTA 4Z37A 2MZJA 5L8RC 2UXDJ 1F9EB 2H51B 1U49A 3SCKE 2DHSA 4KY3A 1RHUB 4EK2A 2DO4A 1IQZA 2GW8A 1U26A 2AHOB 1KLMA 4W90B 3IO1A 3UD3P 4M94A 1VJWA 5HLFB 3DI6B 3DXBA 1E6VA 1FK9B 2FUG9 3FCWA 3EGZA 4AL5A 2AEFA 3P3DA 3PCOB 3IN5A 1T03A 3PX4A 4CDIA 1RWKB 5A6PA 3W3SA 5JUMA 2ZZMA 2EBGA 4PEOA 4FF3A 2B9EA 1GTHA 5IQ6A 2PI5A 5H9FK 3J7ZT 4ZVSB 4HHJA 3SSRA 3G6XA 4ECTA 8AT1B 4Q7AA 4HTIA 3H0PA 4PG5A 3DYAB 2XSJA 3M8WA 2R2TA 3RU0A 3PW5A 1KLNA 1IKVA 2JRSA 2QLJB 1P94A 2N7YA 3UCGA 2JC1A 3GCXP 3AD9C 2DT9A 2QGFB 1EZZB 3H8YA 2LXUA 2JZ5A 2HIQA 1LW2B 3DDIA 2ZFHA 2FGCA 4WBFA 4ZVTB 2H3AA 5GAGU 5E41A 3EZ5A 3QJJA 1A7GE 1LWCA 2BMBA 2W4CA 2YH0A 3PHTA 4C11B 3DLHA 4X4VA 1S57A 4C8YA 4A8YA 1X4EA 1N0UA 2KT3A 4ZVGA 4CO3A 3MR5A 2ZM6J 1X9WA 4RWWA 3BBFA 2HRYA 3CDEA 1SKSA 3GYNA 3TQ1A 2MKJA 4C2MA 3VW4A 1QAIA 2EG1A 5HQMA 2DHGA 1SL1A 3ZZZA 2MZQA 4N76A 1C4AA 2E5LJ 2UXCJ 4MYTA 3FVYA 4LSNA 2HWTA 3NL0A 3JSYA 3VTIA 3PW7A 1CS4B 5FD1A 5EWGA 2PT0A 2V94A 3DLGA 4DR4J 2ZH6A 2W7AA 4LIWA 4RW7A 4X62J 3R1LA 1RTJB 1T0TV 2B7CB 1JLFA 2O66A 3PYDA 5HMWA 2RAQA 2E1MC 2X3GA 3TO8A 3HP6A 4X4TA 3MFIA 1N36F 3M05A 2N4CA 3KHLA 2UXBJ 2W7OA 2KFYA 3M1VB 4Z7YA 2IJFA 1HNZJ 2B9WA 3SSQA 4NE9C 1F3FA 1RT7B 3I5BA 1GXUA 3LAKA 3CCUS 2XI3A 5FJ4A 1S6QA 1SIZA 2JDJA 2YX4A 4OJ3A 4CM2A 2UXCF 4QIFA 1YRXA 3D4JA 1FI4A 2LDYA 3NOCA 4ZVRB 3DLBA 4FF2A 1KD1T 3FSXA 2JJ4D 1N33F 3FBCA 1OHNA 4KKOB 1ROFA 2ASYA 1TKTB 3ZO7A 3KDNA 1NAQA 3KJVA 2BSQE 5AXNA 1GT8A 2B3TB 1I3OB 7FDRA 1ULRA 2A6MA 2ZZTA 2VBZA 1VFJA 3FQKA 3LP2B 3KLEB 1YQHA 1VQOS 1N48A 4I7FB 4B3SF 4OI1A 4NLYA 2RB7A 3B6BA 1V5IB 4OZNA 3VEBA 5CCLA 3MM8A 4AFFA 1HQEB 4J9PA 4C9DA 2FVPA 5D4NA 1X4GA 5IWAF 4DQIA 2HGNA 4JI8F 1EA4A 1YRTA 1N5YA 4LF2A 2BE2A 2V4JA 3KLGA 3C15A 1Z1ZA 4P71A 3FGVA 3KJQB 4O4RA 4DL4A 3ZTPA 4BS2A 4B3MJ 1U6FA 1FRXA 1HQEA 4ETXA 1UWAA 2W2QP 1Q16A 4YQWA 4ID8A 5HBMA 5J1EB 4F4YA 5HATA 2R2SA 1K1SA 1U1KA 1YGYA 3I9ZA 3BDEA 2AP6A 1C1CA 3OTBA 3VAGA 5LJ5Y 3L7UA 3TP2A 1VISA 2H54B 2NYIA 3G82A 3DDKA 2B4UA 3O8WA 2M7SA 4J9KA 3GIMA 2VUGA 3MM6A 4RW9B 4ECYA 4USWA 5A0YB 3CCQS 4DV7F 1FE4A 3BSCA 4X66F 5KOWA 1KEKA 4EGLA 2CNNB 4YFUA 3MPUB 1PCAA 2BQRA 1NK9A 2FJBB 5BYSA 3Q2SC 5DO2A 3C2PA 4YHHF 4YR0A 1RA6A 2YPZA 2Y8WA 4ZPVR 3QT5A 5KTQA 2LFVA 3IS9B 2JBVA 3QWUA 3DRSA 1FJGJ 5DJBA 2M70A 3ET6B 2HZAA 5M2RA 1I5OB 2J9DE 4L76A 4OYWA 3VCDA 3I4HX 5C2GA 4J9RA 4U7UD 2RHQB 4KFBA 4U6PA 1YJ7A 1RAFB 3OQ2A 2W2NP 1KN6A 1KRPA 2D74B 4LRDA 3T6JA 2XZWA 4IUFA 2V69A 4RL1A 5DDPC 2LQ9A 1EIYB 3QIPA 4BWJA 2YQ0A 1TKDA 1TVRA 2MQMA 2GZOA 2NSCA 3KLFA 3NO7A 3VF0B 3M32B 4DI6A 3MF5A 2QA4G 1S1WA 2G0JA 3QT8A 2XYHB 5CD4H 4EU0A 4TY8B 3L3CA 4C0OC 1SCJB 4RU2A 2VONA 4NI2B 2OPSB 1UL3A 1WC0A 2ZWOA 3EGNA 4NX9A 1GK8A 2XQCA 1FKOB 5CD4A 5K14A 3GV7B 2R8HA 2NCKL 3BZQA 2WVCA 1T3OA 1OMSA 1X9SA 1FNMA 3VVUA 1R7IA 2E1CA 2VF3A 2OAUA 1QVFR 2D68A 1H6KX 1UA0A 1YZ6A 4NI2A 1YHQS 1Y10A 2PI4A 5LMUJ 3GQCA 4RBUA 1ELOA 2C2KB 3HHDA 2J7UA 3MM7B 2CDQA 3FMBA 1VBXA 1KQSR 2G1HA 2KRBA 2FIUA 5C25B 2GV1A 2WW8A 2E7VA 3DGVA 3TVZA 1Q8IA 4RNMA 5F0UA 3M9OB 4NXMJ 1TKXB 3SI8A 1M5KC 3PXGa 4DV3J 2RDDA 2MZ1A 1BQMB 1U2RA 4FNIA 1XWLA 1KQGB 3A8JA 3DKDA 4M5IA 4WTYA 1MYKA 1B7YB 1K0VA 4NYZA 1CJKB 2BBEA 2ZBPA 3DRXA 4C3LA 1RLCL 2X1GA 1XQIA 1YTYA 5C5JA 4ED6A 3MR6A 1RYSA 1S5ZA 2FVQA 3DRYA 1S1TB 1ZBTA 3KWMA 1NDCA 1F60B 1RWWB 2GGPB 3D0GE 4KO0A 5F3TA 2XMAA 1U48A 2VL1A 3W60A 4UF4A 2J0QD 5J2QB 3UWTA 3AD8C 2AGPA 1QVGR 3ITHA 3SFUA 3R5DA 4YEAA 1FX4A 5CZXA 1EETA 3ONQA 4JI1F 3KG1A 3THTA 2F9JA 3TVYA 1M1GA 4I0WA 4C8MA 3UO0A 3D3BJ 4DS5A 1N32J 1XNRF 5IQQA 4TYAA 2WOMB 2C2DA 2RQMA 5L1LA 2Z0GA 2V6AA 1FA0A 3C14A 3DMJB 2BRKA 4M5KA 5LM7E 2IYIA 2ZM6F 1YJRA 4A8MP 1HFEL 1HMVA 4B9NA 2VB6A 4DG1A 1MMLA 2OEKA 3ULHA 1A0OB 2BZ2A 3BQ2A 2JWNA 3PACA 2YQ1A 5K5MA 3HFKA 4UQGA 3FNNA 4KJIA 2Q3PA 1HBNA 4G1PA 3SCIE 3U02A 3VR1A 3FSIA 2MYFA 3IS9A 4A8FA 4MH8A 4J9QA 1BLUA 2ZKUA 5BYQA 3ILOA 1R27B 1RADB 1D8ZA 4YS2A 1S6UA 2DGOA 4MK9A 3W2WB 2W24A 3ZNJ1 4DMZA 2R8GA 3WBZA 3HFVA 4EI2A 2H65B 4JV2A 2AF6A 2RH3A 1U9PA 2RHSB 2UU9F 1J2VA 4U96A 3M8PB 1X0FA 1N5YB 4JI3J 4LF9F 2YX7A 2HIYA 5HQLA 2C3MA 3MMJA 3EPGA 1XMOJ 4OJGA 4O3NA 2HFOA 2IJRA 3P4UB 4IDKA 3TA1A 3CJTA 4A47A 1VQSA 5SZTA 3MURP 1QSSA 4ZPCA 4DUTA 4WFBQ 4ZIWA 5ETPA 4LFCJ 4USTA 1RWVB 2DO0A 1S1UB 4ETZA 1Q16B 4L3NA 4K4TA 2NS1B 4KKOA 2MQQA 3D6MB 4EYHB 3CWJA 3QMQA 4F50A 3AOCA 4PWWA 2HVEA 3UN2A 4TVAB 2E66A 3M2VA 2A2CA 3EGWB 4UUWA 3ZXWA 1T94A 4QYRA 2F3JA 4JI8J 2RNEA 2KXHA 4I6YA 2L41A 2R7VA 3OL8A 5C24B 1NKCA 3M8QA 4F4AA 5ETMA 2GJIA 1UP1A 3EJMA 3HULA 5DQHA 3NY0A 1OIAA 1RTHB 2KFNA 3GMGA 2EFQA 1WG4A 4F4WA 4HYKA 2Y1JA 3CJSA 1UUJA 1M1KT 5T41A 1CS4A 4LRCA 4FF4A 2J7KA 3KK1A 1ZH5A 1FHTA 4DR1F 2EFOA 4X64J 2M5YA 3BREA 2BJ8A 1PG5B 4P2SA 3NWRA 3N6NA 1RHRB 2VIHA 2RBFA 4WZQA 1RT5B 2PN6A 4DFKA 1FKPA 4I69A 5KFJA 2VC0A 3R9LA 4Y2KA 2B51A 2DNGA 1D09B 3Q83A 3OSPA 3SQOP 5GMEA 1P1LA 1FRIA 2Y1RI 4O4GB 1SV5A 2MZTA 3FEZA 4LRBA 4C11A 3P6YC 3VAKA 3UVJB 2DYAA 3DDNA 1LW2A 2PGCA 3K5PA 4FPIA 3T5LA 3M8ZA 2ZD1A 3CTRA 3PJ9A 5B09A 2JEFA 4FYDA 3WQPA 4DV6J 5J2MA 2OTJS 4DHVA 4DFPA 5G0RA 1EP4B 2GIRA 2A10A 1ZM9A 3NGUA 4QQBA 4TQSA 3DCAA 1S4EA 3VEAA 2CQCA 2YNFB 5CCMA 4H4OB 1RT6A 1ZM3A 2RRBA 3GYGA 2APOA 1TQLA 1C4CA 3GR1A 5MLCV 1NJWA 3PR5B 3F73A 4B3RJ 4GKKF 4P2XA 1RU1A 1FXDA 1FEEA 4KHPJ 4WFAQ 3MCMA 5C25A 3RJMB 4LF4F 4NCGB 2ZJRQ 3MOZA 1KONA 3DGPB 1PC4A 4LVNP 4USVA 3WX8A 3PNIA 4DN0A 2CQGA 2ZVIA 4O0NA 2ZHOA 2DPIA 1MG7A 1M5PC 1DARA 4Y00A 2DHAA 5KT2A 2BACA 3M7VA 4ES3A 4B3TF 5A8RA 5IC6B 2R2RA 1RSCA 4KH0B 1V3RA 4DFMA 5AE2A 3I31A 1NRKA 1KFSA 2CJ9A 2OUGA 2R42A 2R7OA 4A8OA 4DV0J 3UQSA 2E5IA 4UOGA 4OX9J 3W5XA 1TUGB 2NLWA 3JQJA 3TVKA 2AD9A 2R7SA 3ILJA 3T5JA 4OZ1A 4URQU 1R8AA 1S6PA 4DL6A 2C2NA 1RXOB 2ZH8A 3FFIB 4R8UA 2B56A 3R5JB 2XLJA 3OFGA 3POTB 2W7PA 1U25A 1U1MA 4ZVFA 3BH7B 2V2KA 4NCAA 2AN7A 1HARA 2ACYA 2CPYA 2J9EA 3LQVA 4LUBA 1Y4ZB 1YK9A 5A2QY 1QTMA 2HFUA 5E0OA 4M5HA 2VG7A 4QWDA 4AL7A 5KT6A 2XMUA 3RB6A 2QJ3A 2R8KA 2B43A 1TMJA 3EXYA 5J2PB 4YR3A 3OR1B 4CTAA 1MROB 3GFZA 1JNZB 3UFCX 2OH2A 1DTTA 2CNOB 2N4DA 3FSYA 3G8SA 3V81B 1FCAA 4DPOA 1FTCA 4TN2A 4OYAA 2ZH2A 3TWZA 2UXDF 3MCSA 1VHIA 2AWZA 3E8OA 4KGMA 2OO4A 3CXCR 5IV3A 3HHLD 2XCAA 4L74A 1BDTA 4ZCMA 3PYEA 1EKRA 1B70B 2RDJA 1KC8T 1VQ4S 1NO8A 1HLWA 2OMLA 3L4BC 4FP9A 2BQUA 2WSFC 3UDEA 1FD2A 5AJ3F 4HT5A 2W9CA 2F9DA 4MK7A 1WF1A 3DLJA 4KV8A 1X5TA 3OFHA 2J9DA 3HI9A 4M63A 1U1NA 2CJBA 4NA2A 2ROGA 1YVFA 4I56A 1T7PA 4TU9A 4LREA 2WSEC 3IRXB 3NGTA 1BGXT 2HAIA 5F9LA 3Q8QB 3J80U 3BR9A 3MMBA 3IGNA 1S12A 1LFWA 4ZN1A 2V4RA 3CC2S 3PVXA 1KHVA 3IXQA 2E9TA 2I8EA 2OSQA 5J1EA 3T9NA 3OLAA 1S9GB 3FMTA 3D7SB 1GEHA 1FNOA 2W2PP 3DLKB 3KMQA 2FLOA 1KDNA 1TAQA 2GMHA 3DRPB 1RQ0A 3JTOA 1ZYQA 3DXSX 5F8GA 2FC8A 1FJCA 2NPIA 3EXCX 3KLGB 1VRUA 3W5ZA 4YN3B 1TFYA 3LA0A 2DH9A 4MIWA 3CD5A 2B5JB 3DM2A 4NPOA 5A8KB 3KHRA 2HFZA 1C0UB 1R8PA 1Y9OA 3DHWC 3HJVA 5I42A 2FJVA 1F2GA 3FEYB 3HHKA 3TA2A 4DDFA 5KFNA 1ACMB 1MNEA 1SUQB 2IAJA 1DURA 3NCRA 3U7JA 3VZIA 4DV1F 2R2UA 2Y0BB 1YG0A 3KLEA 1Q7YT 3KMSA 2ZEJA 4V1Ak 3KJVB 1ARRA 2KHDA 3Q8YA 5I3UB 2CVIA 1UVJA 4CNYA 1HWKA 2Q6CA 3DC2A 4YR2A 4FVCA 4JV0A 4HLBA 4Z7CA 2DXFA 4QPTA 4ZVEA 2PFDA 1PARA 3ZNUA 3NGSA 3VGTA 4B3TJ 2JFKA 2JXGA 1BQNA 1L3KA 2F8EX 3GR0A 3MHYA 4N77A 2G1DA 2KVIA 1HW9A 1M5SA 4ID5A 5ETKA 4ZJQA 3Q22A 2MQPA 1RTJA 4DSLA 4IYQA 1T11A 2IC3B 5A8WB 4CLLA 1JLCA 2Q66A 2FGOA 3TARA 1H7WA 3DLGB 3MMBB 1SUQA 3S1TA 1TKZA 3KLHA 4JOUA 4WE1A 4ECVA 3GYXB 3UE2A 1G7CB 2DK2A 2WVBA 2E44A 1JLBB 1KQFB 3ZZOA 4B3OB 1LKZA 1N5SA 3HSGA 3R97A 5F3ZA 3TEGA 5FLXY 5KG5A 3PKMA 3K8VA 4KYZA 5IT9Y 1HPZA 2DY9A 4MYUA 2AIRB 2LYVA 1ZZNA 5IM0B 4NZ0A 1LWCB 2MJUA 4O3QA 2F1FA 4IG0A 1IKYB 2BE7D 2YXLA 1JKHA 2L48A 2CQ3A 4N8NA 3QRPA 1I1GA 5BYRA 3OBIA 4B17A 1HBMA 1PBUA 4X84A 3PO4A 3I0RB 4TU8A 4B9TA 2I6WA 5KG1A 4DUZJ 4I6AA 5ETRA 1LXJA 2I38A 3DYAA 3TA0A 2W25A 5BJRA 3NGDA 2KYZA 2MKIA 4O44A 4MJWA 2XM3A 2J9CA 2Z4PA 1XNQF 2EFNA 1RWOB 1WC6A 3AT1B 4M5NA 4OV6A 4KGXB 3ETOA 2LEBA 2BOAA 2D9PA 4DSJA 3POTA 4FF1A 1J27A 2J0XA 3I0SB 2DR5A 2Z56B 1RKIA 2XHCA 1IVZA 5HVFA 4C4WA 1B64A 3PZPA 1X9MA 4IRDA 4WZMA 2HG4A 4PWUA 3SCJE 4K5SA 2LP4A 1WKJA 3KK3A 5C2CA 3OHAA 1BQMA 2VG7B 1Q8BA 4M5DB 2L08A 5DLFA 1TL1B 1LOUA 3HXMA 4ECXA 1JJHA 2QLWA 1NSQA 1CBKA 1NPPA 1U6ZA 5KFAA 5A8RB 5E33A 4J9OA 4U67Q 1WOSA 2E1PA 1FJEB 2R7WA 5KFUA 1URRA 3IR5B 4B02A 2VODA 2W8KA 4F2SA 3W61A 4CT9A 1U6BA 4WP3A 3NP5A 4BWMA 2M0GB 4M5GA 3M6UA 4XPEA 5L39A 2XTJP 4QIVA 3HJFA 1XNQJ 5GAEU 4JI3F 5D0HA 4JI2J 4IR1A 1S1XA 1IN0A 3O3LA 2WBMA 1RT6B 3BEGB 5ETNA 4F3MA 3ENVA 2IM1A 4B08A 4F25A 3J81j 1NSKL 1ZZFA 2QZ8A 2VFRA 4XTTA 5EUHA 1MWQA 2QLXA 3C6TB 4MKAA 5G0RB 3TX0A 2QC3A 5DDRC 1S76D 1O8BA 3A12A 2OPSA 2YBVA 3PKYA 3CCES 2JFDA 2ZD1B 1SIWA 4GVBB 4HTJA 4TY8A 2JL9A 3U1NA 1XIQA 2K3IA 1ZM4A 1O51A 3IBCB 4DX8H 4DL3A 5ETSA 3RG6A 2P8IA 3M32A 3VV2B 1U1QA 3A3PB 2HQGA 3DU5A 1NLKL 2FTRA 4H4KC 5DM7Q 1V5VA 4MIAA 2D3UA 1AYEA 5HVHA 2AYBA 2O01C 4K0KF 4Y65A 1FRKA 1RWMB 3M2RB 4WE1B 4HH0A 3SQGA 4P6QA 1Q81T 2FJXA 4QWEA 4LR8A 4PABA 4C3KA 4CO0A 4CLKA 2ZH3A 1NK6A 2PC6A 2FYXA 4N56A 1IBMJ 4PQUA 4LMZA 4KQZA 3PHEA 4ENOA 3RRHA 3CNQP 6FDRA 2MEWA 2N7CA 4AUKA 3AB4B 2LMIA 3KNGA 4O4GA 1UPMB 1NPRA 2VFUA 4NYPA 2WONA 4OX9F 2HK2A 4OYOA 4MTPA 2W9BB 2QMWA 1C0TB 2VPWB 1NJXA 4UY8T 4I6WA 1FD8A 4ZLJA 4QZVB 3SYZA 2E7WA 1S9EB 1SBRA 1W26A 2MHEA 2AZ1A 3R2CJ 3G8QA 1X4HA 1B99A 4IOBA 1NSPA 5EGYA 4IOAQ 3V6DA 5KFHA 2R8IA 3OJSA 4YY3J 2HZVA 1ZTTA 3N5BA 5LOQA 3BS9A 2VBXA 4OYXA 2DNYA 3C46A 3QSYB 1HI1A 1T9UA 2R3VA 1SXLA 2RJZA 1RCXB 2LEPA 3U1LA 2R7RA 3NG8A 3A8EA 3L9ZA 2K1OA 4DUYJ 4WFXA 3IA0A 4ILMA 5AXKA 1NB2A 4RW8B 3CJKB 2ACMA 3NKYA 2AZ3A 2YY3A 5U47A 3NMAA 1Q86T 1VYAA 2AW0A 2HVZA 2J7WA 3M8YA 3KNAA 3MMAB 2RU3A 3QPIA 2CRLA 3PDNA 2UP1A 2V68A 3QO9B 1TP7A 2FJDB 2QV6A 2WK4A 2AV5A 1T05B 3CD6S 4KHPF 1H72C 1TKTA 4C8NA 3HHEA 3UCZP 1EX8A 1KSPA 1TELA 2CQBA 3KLVA 3NOGA 4DOZA 4NEYA 1R89A 4BC9A 3NBPB 3EE3A 1YJNS 4W4MA 1RT7A 2FVSA 4JYAJ 3W66A 9RUBA 2UVVA 4DV5F 3LGHA 3FZBA 1QAXA 2RDIA 2UXBF 4Q43A 4MT1A 3BDPA 1JLFB 3SFGA 1FEHA 4DPTA 4YUDA 1N34F 1TK8A 1HNWF 4WYWA 4ZP8A 1F9HA 2DNKA 4C0BA 4ICLB 1BC6A 2C3PA 4FZVA 4Y28C 5T14A 2UUBF 5F8IA 5HAOA 4C98A 4LSNB 2ZBCA 2CJQA 1RISA 4EMDA 3Q86A 2ATCB 4OI4A 2HQFA 3PYFA 4E8UA 2DNNA 3MCNA 3DLLQ 4C8KA 3T3FA 4URGA 5LJ3Y 4FYYB 4DSFA 1X7VA 1UAWA 2GS8A 3AD7C 2FY8A 1BHNA 2Z2ZA 2PD1A 4CH0S 1X5SA 1PO6A 1EARA 1WTBA 2NZCA 1H38A 1S6PB 1U24A 4Q8FA 2CUYA 3QNWB 4LSLB 3ETMA 2OPPB 1NEEA 1MW7A 3QQCD 1XBWA 5CAAA 4B9SA 1S1TA 2YPYA 4KPCA 2Y9HA 2HGMA 2CQ2A 5E5NA 1Y3JA 4UZBA 2BKOA 1AROP 1NZAA 1CJKA 2BABA 1EKSA 1VHFA 2L3MA 2RU9A 3BV8A 3W8PA 4RU9A 3H5SA 4A4JA 3CCMS 1UEVA 2F40A 1LQ9A 1XK8A 2VV5A 2ZWPA 2UUAJ 1OQ3A 3J80Y 3OTOF 3J7A1 1F6TA 1HHQA 1RT4B 2BYCA 2XS5A 3IR7B 3Q8UA 2V50A 4R5PB 1QTNB 3AX3A 2VOPA 2JXIA 3SDEA 2EI5A 3ZTSA 5HQ8A 5JMNA 4B3RF 3S6EA 1N33J 3N79A 4Q0BA 1OY6A 5KFCA 2E7XA 1PILA 4WWSA 4DV4J 3TX8A 3CDWA 4E98A 2GVDB 2P9GA 4M8LA 4TXSA 4DUZF 4I4BA 2XYGB 3JYTB 4NLXA 2ZZNA 2CAXA 4P75A 2GA7A 4FKXA 1H74A 1Q95G 4TLRA 3JTPA 2YKAA 2IC3A 3ENWA 4JI6J 1FERA 2DGQA 2CJAA 4NCBA 1CJTA 1OSDA 4ID5B 2XC9A 2MY7A 3OFFA 2HHQA 1RTIB 3V5RA 3QBCA 3NRBA 3I4PA 1U2FA 2OLWA 1SC3B 4C7QA 2XGPA 2KG1A 2XSFA 3V6JA 5CH7B 2FLLA 4ZVHA 4WTOB 4G65A 2HQIA 4C8LA 1BQXA 3DOMA 3JSRA 1JXEA 3FT7A 4QPXA 1PC5A 3W64A 2C3OA 2RMLA 4NLDA 4OYPA 2DGVA 1IKWB 2FHKA 4KIAA 5I3PA 3RAMA 5AXLA 4WCEQ 1LW0B 3OR2B 3R27A 4H4MA 4J9SA 2LQBA 4NLQA 3ZTQA 4C97A 5HJXA 4RBTA 5THWA 5KFEA 5KFWA 1E6YA 3DOLA 2F4VJ 4MMOA 4CO1A 4U7UK 3TRGA 2C1EB 3KXDA 1KOHA 2JVOA 4QWCA 3M2VB 3DOKA 1K47A 3H2VE 2M88A 3EVWA 3TQEA 2K06A 3DHXA 4IH7A 4CLYA 3M9NB 4DLEA 4XDCA 2QT7A 3HPOA 4CP5A 4NLUA 1VBKA 2EK6A 1SVDA 1VQMS 4ZJLA 5A0YA 4DR6J 1VLOA 3DLKA 1ZAXA 3HX9A 3A3OB 4RX6A 4QWAA 1U1OA 2BXJA 1NK5A 2ZNYA 3D6HB 1N4LA 4OJ1A 3I82A 5HMZA 2CZ9A 1QSLA 2PE8A 4Q2LA 4A8WA 2UUWA 4IFVA 2J76E 1S0NA 3KUEA 3R2DJ 4L3KA 2KT2A 1QSYA 3TZZA 5GAHI 1Y7PA 4A48A 2LQ8A 2ZUGA 4QIEA 2XZ2A 3HVTA 1VRTA 2NR0A 2H48B 1PJ6A 1S97A 1FO1A 2DGTA 5KFOA 2W1BA 5IFMA 2DGXA 2MQLA 2DNLA 2D7SA 5L9XA 1HHTP 3H7HB 1FDNA 2W01A 2VQEJ 3P5TL 1LW0A 2YWGA 1DTQA 2DEIA 1LWFB 1X4BA 3CJ8A 3VAFA 5I3QA 1MROA 2H5JB 4KR0B 3GIJA 4LT6A 4EZ6A 4ZCKA 4ED0A 2DHXA 3CDBA 3BGLA 4Q2MA 2QA4S 1RYRA 3HCXA 1UW9A 2XTDA 1N8RT 4DQSA 1HQ2A 4WU3A 4BDPA 4KT0C 2AU0A 2IRXA 1S72S 2CKWA 1LNQA 2QO3A 1UWBB 4G1QB 3W65A 3UI3A 2DXDA 4LSZB 1YBAA 2HBRB 3D1HA 4PG4A 4IKAA 1GTEA 3P96A 2VQEF 3T5HA 4OZ5A 3EPIA 3SSSA 3CCLS 4L75A 1CVJA 5ETQA 4F0HA 1T9YA 2LXFA 4CM0A 2NXJA 3HZGA 3GONA 1UW4A 2CQIA 2AJ4A 5EX3A 4NXMF 2XSJB 1TKXA 3EZOA 3PRVA 3FKBA 4FPRA 2BANB 2E5HA 4OZ0A 3TZYA 3M6WA 2NPFA 5C42A 1KTQA 3Q23A 3PFOA 5KT5A 3TAPA 2IDLA 3PM9A 5HMYA 1N34J 5D4PA 1RT2A 4RKUC 1UZHA 4EWTA 3PW4A 2KTQA 4WFNQ 3ZZPA 4NA1A 2AMCB 1KFDA 2M4MA 4WP8A 4ZLLA 4YDDB 4DR2F 2G9OA 5DZ6A 5HLFA 2V9WA 2EC0A 2MKKA 3QGPA 1WHWA 4FXVA 5L38A 1H7XA 5KG4A 5CZVA 5K14B 5LT5A 3MI7X 2YNIB 4CH7A 1RWPB 3QATA 4TLQA 4U9RA 1VIOA 4QWBA 5H9FJ 3TUJC 2AEJA 5JVGQ 2RS2A 1T3NA 5KAKA 1SKRA 4LSLA 2OSRA 2ZBQA 4AD6A 2GQ2A 4F02A 4HDHA 4I2QA 2KXNB 2JXHA 1YI2S 1YJ9S 1A6LA 1RA7A 1FRJA 1TVRB 3AFGA 4WK3A 2W4DA 1L3SA 1HBUB 1I51B 4KTQA 4NYOA 3BF4A 1RAEB 2DGSA 1YSJA 2RUSA 3D1QA 5KG0A 5KFRA 1DQ8A 5LSLA 3GU0A 2GHWA 2RKIB 1SQEA 3CJRA 3ELHA 3Q8VA 3R7BB 4H54A 4IG3B 1WC1A 3ZTRA 5SUHA 4F67A 4X4SA 1BAZA 2GIFA 3BGRA 3ENQA 2A2BA 2KN4A 4IO1A 2XWYA 2K29A 1Y3KA 5EX0A 1TR0A 3BQ1A 2R7UA 3MAHA 3ZC4A 1DQAA 1CC8A 1RU2A 4K59A 3Q8PB 1U1RA 4H4KA 3NAHA 2K8GA 4X4RA 1D0EA 2NXUA 4PWDB 3K5NA 1URNA 4RNHA 1TU0B 1VRTB 4RW6B 2KXFA 2FB0A 4UY85 1NJZA 3KG0A 1XR6A 4HEA9 2DH7A 4F36A 1RAHB 1RLDA 3NEKA 4OI6A 3VGSA 3JAMU 4DUYF 1RWUA 4B9UA 1QAYA 3AX5A 3P5BP 3M9MB 1PJ7A 3HD2A 1U0SA 3MTKA 2MZSA 5DM6Q 1QJHA 1UJ6A 1C1CB 4ED2A 2VFTA 1VQ9S 4IFYB 3FK4A 4IR9A 3MOJB 3NNCA 2DGWA 4E2FB 3L7OA 2XLIA 2DEJA 3VZHA 5HBMB 3V6DB 2XS7A 1QE1A 3MMAA 1AFIA 1NUEA 2P6SA 3MEGB 2V1TA 5M2UA 4DCPB 2MQOA 4F4XA 2BEFA 1TL3A 3L7PA 1ZETA 2YKPA 4FYXB 5AE1A 2V63A 3M8PA 3V2UC 2UUAF 2JEGA 2A18A 2FJAB 3UN3A 3H20A 2RQKA 4CLTA 5GAHU 1IJEB 1JMTA 1SL2A 2VBWA 4FYVB 3OT9A 1U8SA 4K4ZA 4GC7A 4XO0A 1E6YB 4ATNA 3GIKA 1QE1B 2HMIB 2LU2A 2CPJA 3ISND 3T9ZA 3DOLB 4NLGA 2AYMA 3SZ2A 2KO1A 1FKAF 7AT1B 1Q78A 1XC9A 2OTLS 2XLKA 1DBDA 4DPYA 1N56A 2BKNA 1SJQA 3VWSA 4WIQA 1XMBA 2DKOB 2JSXA 3DOMB 1HMVB 2QLFB 2YX1A 4IG3A 3M2RA 3M2UA 4KB7A 2LKZA 3B4DA 3C14B 1PKUA 3CJ0A 2VA2A 4RPFA 5KFXA 1X4CA 2GAGC 4P73A 8ATCB 1DLOB 2BRLA 5D4OA 3M1VA 3QZ7A 3D66A 4KBIA 3QT7A 5B0FA 4FXWA 3ZZYA 2JLGA 1HNWJ 1CJTB 4X4PA 3MTJA 5KFQA 1RWNB 1FT8A 2IRYA 2QA1A 2QLBB 5E3AA 3H40A 4DR5J 1Q8LA 2CZ4A 5IZHA 1N36J 1WC4A 1S9FA 1D1UA 2DBBA 3JTNA 1WEYA 4ECWA 4X62F 4OV1A 1U2CA 2CYYA 5KFKA 3PTWA 2L9NA 2EG2A 2R7QA 4UW2A 2RSQA 1MMNA 3BBBA 3NNEA 2RKIA 3HHLC 4JI0F 5GAEI 4N47A 4YB5A 4ZCLA 4CCHA 2PMWA 2O3DA 3JQKA 3SV3A 2J5AA 3J7YU 3WC0A 2BJ7A 1N5TA 2HBYB 1S10A 2IVYA 5HSPA 2DR7A 1BMQB 2NUHA 3W62A 1KS2A 2E5GA 1H2TZ 5LL6d 3T1AA 3VALA 1QTGA 2QL5B 4PUOA 1OWXA 4UTGA 2GO9A 4Y3CA 2OEMA 4LVOP 1RACB 4WIIA 5F8HA 5C42B 5CYJA 1MU2B 3GJSB 3TZXA 4QW9A 1B0VA 1AUDA 4USMA 3MAQA 1L3TA 4I2PA 1NDPA 2HPUA 5E7OB 2YTCA 2VOOA 3F44A 4OX8A 4F3OA 4F4ZA 1U45A 1J5EJ 1PGZA 3KOAA 2M52A 4K7QA 4ANDA 3LWMA 1C1BA 2POKA 3HSJA 3ISZA 3B4MA 5IWAJ 1CQNA 5FLXU 3F56A 4HKQA 2VPYB 4OZJA 1R31A 2ASLA 2PA8D 2GJ2A 4DU7A 2V2QA 2AGOA 3MFHA 3CJ3A 2UUCJ 1BWVA 4AQYJ 1T03B 4F2RA 5LSOA 2KM8C 2E9ZA 1FK9A 4DPWA 2OIHA 1YJWS 1FDDA 1X5PA 2WW4A 2HHTA 1XR5A 2C3YA 1SKUB 4R25A 4I1TA 1CEZA 1TL1A 2DRDA 2DHHA 2M8HA 4V19J 3L09A 1RAJA 4ZHRA 2CFXA 4CLFA 4PKDB 1OQ6A 5KT7A 2QSFA 4LBPA 4CT8A 4KFBB 4OX6A 5HROB 4ANEA 5KG2A 1NDLA 3AQPA 3D67A 3QAUA 4AE5A 3CE8A 4YB1P 3VAIA 4IOCQ 4LF6F 4CLZA 4D3HA 5CQGA 1D9DA 3HHLA 4USKA 3C3LA 4MKYA 2VG5A 4DPXA 2N82B 4YHHJ 3A3NB 4N7TA 3N9UC 5MAOA 3CCSS 3PV8A 3D9BA 5FDLB 4O44B 4AXJA 3N5FA 4RNFA 2IMOA 5DDQC 5LXRA 4PG7A 3G96A 1JLGA 1YZ7A 4HVZA 4FN5A 1ITPA 4ZS6A 3RBEA 3G82B 3IBWA 2K1RB 4RW4A 2KJWA 2DR8A 1IR0A 1EHWA 2N3LA 5KFYA 3V4IA 5F8MA 4DS4A 4CO4A 2HQDA 1WEXA 4WF9Q 4PPZA 2ZDOA 4S0MA 1GMUA 2XO6A 3RRGA 2HHUA 4DL5A 2PFFB 2LXIA 2H5IB 3PW2A 1VQKS 3QLHB 5L1IA 3C15B 2MLZA 4WFYA 1GMVA 4OZ3A 3G6YA 1H0HB 4L72B 5LMNF 2IM3A 2CJXB 3HM9A 3MD1A 3D0HE 1HBOB 1HYSA 2WVDA 2BJEA 3IRWP 2SXLA 5E3RA 1F0XA 2HKEA 5J1NA 2MGZB 3QZ8A 1FJ7A 5K8MA 3S7RA 1KBRA 1JLCB 1W25A 2WAQD 1VI7A 5B08A 4ZPAA 2PMZD 2J0SD 2QYCA 1RHKB 3BM7A 4USIA 5IS2A 1WEZA 5J1PA 1P9YA 4DR3F 1C0TA 4ILRA 4OLPA 3QAEA 2HNDA 2CPGA 2PA3A 3UCUP 4DSEA 3MR7A 2UUBJ 2DY1A 1YJUA 2RUGA 4F0KA 4DU8A 2JHEA 1S0MA 2XMTA 2NSBA 4ERDA 4J37A 5B0GA 1BUXA 5KFPA 3TW0A 2XZDB 1FNXH 4ELTA 5BR8J 2Z2MA 4JI5J 1HQUA 3HMJG 1REGX 2MY8A 4NRTA 1ZPVA 1IM4A 1H98A 5K9FA 1G6BA 4AQYF 3UN5A 2YWKA 3H5XA 3UW1A 2RS8A 2KM8B 5J2MB 3IRXA 1X4FA 3VAMA 2MDAA 2Q6BA 1NPKA 5A6WA 1PYSB 1GX5A 3TYTA 3J81Y 1UVNA 1RK8A 1N6QA 4OYIA 3QRQA 1C1BB 1N32F 3BR8A 2Z2YB 2EC2A 3H4BA 4DFJA 2DISA 2GAHC 5KFVA 2HHPA 4DCOB 3BGFA 1K0TA 2AJ2A 4FNHA 4OYZA 3SDEB 2G0CA 4HI1A 5D0GA 3QSIA 3WIUA 4F04B 4HR2A 2LCWA 4R5PA 2MB0B 3IR7A 1S9GA 2XO7A 5D0EA 2ZH4A 4G3IA 1MWZA 1REVB 5F8NA 2FHOB 5JVHQ 2KI2A 4RUAA 4BLGA 1U4BA 5ADZA 3GJTB 1X5OA 3GV8B 4NASA 1MNTA 4RBVA 1CLFA 4F3QA 1DTTB 3PRBA 2DIUA 1M0SA 3JXOA 4DR7F 3DLEB 3OLBA 3OXLA 1CJUB 3T41A 3HK2A 2BVZA 4KV8B 3ISNC 1Q7LB 5D4LA 2BDPA 4ITSA 1Z2LA 3BO4A 4V19X 2JX2A 3EMTA 2YVSA 2E5LF 2DRAA 4UQTA 2RVJA 1S0OA 1U0HB 2C2ZB 2UV8A 1ARQA 3DU6A 4HDGA 1R0BG 3CCVS 2ADBA 2ATLA 2AYGA 2X1FA 3NS5A 4NRUA 3J81U 4EYIB 5D15A 3PEHA 2VJUA 2R7TA 1JXVA 4R8UB 2MLYA 3D28A 3DFEA 2HAFA 4AYBD 4CO5A 1VK8A 5GADU 4JV1A 2V67A 1S4FA 5T7LA 1VQ7S 1OM2A 1AW0A 3CD7A 3OSNA 3EGVA 1RTDA 3OR1A 4CTAB 1DY3A 2MKYA 3TUZC 1JJCB 2JLFA 4DV0F 1L5UA 3NNAA 2XTEA 1NK8A 2F4VF 2ZE2B 1J5EF 3RYLA 4EFAC 2MZRA 3G6ES 2HLUA 2F65A 3LANA 2EWHA 3MPYA 1CQMA 3BSNA 2Z58B 5KT4A 3NS6A 3RR7A 3EZUA 3RB3A 1U1LA 2C28A 3FFIA 2JNJA 2CG8A 2V4QA 2X3DA 4X65F 4EBDA 1YRUA 4B3SJ 2IM0A 4K0KJ 4OQJA 2I5JA 1TFWA 4DJBA 1Z4UA 2KZZA 4LRVA 2D41A 4IH5A 4ZPWR 3O2IA 3SBMA 2ZUAA 4TU7A 1NNDA 1Z2ZA 1WC3A 1HKAA 1YDLA
chains in the Genus database with same CATH topology
3HDSA 3DLEA 2EPIA 2C42A 4MFBA 1DJ0A 1EP4A 2RRNA 2UVWA 1WNEA 3DRRA 4ECUA 1MU2A 2XNQA 1JKHB 3GFXA 4LFBF 2XB2D 3U27A 5IM0A 1SH0A 1WI6A 3HF5A 2WBRA 2BR0A 1FVQA 4NL5A 2IA6A 4JI6F 2VG6B 3CJ2A 1P8GA 4PRFA 5KFBA 3EYZA 4JYAF 1J5OA 4ZP6A 4PXEA 2E1AA 2PEHA 3K0JA 2IM2A 3PRDA 4JV5F 2CQ1A 3AA9A 1T05A 3H4DA 3GZ7A 4ZKAA 3KLHB 2H5EA 5A8WA 4U7CA 2YWEA 3FQLA 3M4XA 1HNIB 1M5OC 3FEXB 2VH7A 3BQ0A 3MUVP 1X8DA 4ZPTR 2ILZA 4BBYA 1D9FA 3GIIA 2D9OA 3M2UB 3K5OA 3HT3A 2ERRA 3LO3A 1H2VZ 3NCPA 3LP1B 1VQYA 1FRHA 3MMCA 3C6UB 4QIWD 2D1CA 4KC5A 3KK1B 1NHUA 3CSKA 3KLIA 1VC0A 2G4BA 2O5DA 3VAHA 2XCPA 5DLGA 1S9EA 4PXDA 3LP1A 3DM2B 4TNOA 5DQGA 3K5LA 2CJKA 2V5HG 1W2IA 4YB6A 4DR6F 3MEDB 2KT5A 2IHR1 3RZAA 3VAJA 4Y2MA 3K58A 3T1YF 1UMJA 5KFFA 4NOHA 3UD4P 3I9V9 2XULA 3CF5Q 4DL2A 2OPQA 3OFEA 3TI0A 3W2VA 1S49A 2VPXB 2CPFA 2ZOFA 1IBMF 1F5CA 1S1UA 2Q43A 3AJ1A 3OL9A 1WG1A 3SQGB 3PJWA 3I5CA 4DR4F 2RF2B 2ROEA 2HHSA 2XMKA 1HWLA 4WFZA 1FDBA 2DCUB 3HKZD 4MAKA 5K8NA 1J5OB 3MM9B 3OL6A 1Q79A 1CSJA 3ZZTA 3CCTA 3HHNB 3CCWA 4B9VA 1IBKF 1F5AA 2AJQA 1EETB 1ZTWA 5H1SV 5IT4A 2V8HA 1V3SA 3FJ2A 3M8RA 1VQLS 1RT1B 2MJNA 5K8OA 3V81A 4QCLA 2ADCA 1T95A 4RLEA 4CO2A 5HMXA 4A8QA 3LALA 3G4SS 4FS1A 4NLTA 3KK3B 2ZJQQ 4DG1B 4RNNA 1JLEB 3H5YA 4WXWA 4Z2XA 1RT3A 2BUNA 2I5JB 1LFPA 1YIJS 4CH1A 3S8SA 1NK0A 2P5VA 1UETA 4ZPBA 2QIFA 2WRMA 5CYQB 2UVRA 1APSA 2GGPA 4KO0B 5F8LA 5AE3A 3CC7S 1JX4A 5HN0A