1SH2A

Crystal structure of norwalk virus polymerase (metal-free, centered orthorhombic)
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
502
structure length
502
Chain Sequence
b'GTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVNED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA Polymerase
publication title Crystal structure of norwalk virus polymerase reveals the carboxyl terminus in the active site cleft.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase
total genus 157
structure length 502
sequence length 502
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 1sh2A02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1sh2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sh2A03
1C1BB 3DMJA 4TY8A 1JLGB 4X2BA 1S9GB 4RW6B 4TYAA 4MK8A 5KT5A 1JLCA 2YNHA 3ICLA 2FVCA 4ZVEA 3KK1B 2HNYB 3PW5A 4IDKB 1QAJA 3UR0A 4WE1A 1T94A 1JLGA 4O3RA 4FBTA 4I2PB 1S9GA 4RW6A 4QWCA 1HNVB 3ISND 1U09A 1LW0B 3T5HA 2UVRA 3V6HA 4IH6A 3PZPA 4KE5A 2HNYA 3KK1A 3RBDA 4IDKA 4ZPCA 1N6QA 4I2PA 2V4QA 3DLGB 4RNFA 4IRCA 1HNVA 3QZ7A 3UQSA 4ED6A 1TKXB 3CDEA 1JLBA 2W9AA 1LW0A 4YR3A 3MR5A 3IG1B 3EPIA 2XI3A 4PUOB 4WYLA 2OH2A 4RNNA 4NLUA 4MKBA 2D7SA 2RF2B 3JYTB 1OS5A 4ZPDA 3KHHA 3CJ3A 5KG2A 4Q8FA 3FQKA 5C24B 4ECXA 2HNDB 5JUMA 4PUOA 3IG1A 2JEFA 4EYHB 2OPPB 3OL7A 1JLQB 4OL8A 2IJNA 5KG0A 2WHOA 4EBCA 2RF2A 4XPCA 3JYTA 3Q8PB 4F4XA 1J5OB 4NLDA 5KFUA 5J2PB 3C6TB 1LWCB 5DG8A 1JLFA 5C24A 2O5DA 3M9MB 3ITHA 2HNDA 3KJVB 5EWEA 3MECB 5DLGA 3GV8B 1D0EA 1J5OA 5DLFA 2IM0A 2WB4A 4URGA 1ZETA 5J2PA 5DQHA 3C6TA 4GC7A 4O44B 3MEGB 4NCGB 1RT3B 4KHRA 5HBMB 5KFOA 3MECA 5C5JA 3MR6A 2R2TA 4MFBB 5F8LA 5J1EA 5EWFA 1KHVA 3IN5A 4O44A 3HKWA 1RA7A 3MEGA 4WFYA 4NCGA 1YVFA 3N6LA 1RT3A 2XWYA 3BREA 3T5KA 2VA2A 4KAIA 5DQIA 4EBDA 4MFBA 3TAMB 2W9BB 3MF5A 1RYSA 3BR9A 3PR5B 4LSLB 5F8NA 3QYYA 3IRXB 4EO8A 3KLFA 3HHKA 3QIPB 4ZVGA 4TY9A 3V81B 2AX0A 1Z4UA 5KFHA 3EPGA 3KHGA 3TAMA 3MFIA 1EP4B 5CYQB 2JEJA 1ZTWA 3IRXA 1VRTB 2IBKA 2AQ4A 1IKVB 3QIPA 2I5JB 4I7FB 4IFYA 3V81A 2JC1A 2R8JA 3V4IB 3DRRB 3IS9B 4Q44A 1K1SA 1MMLA 5CYQA 4H54A 3JSMB 4ECUA 3RAQA 3QZ8A 1MU2B 3BSCA 1VRTA 1IKVA 1C1CB 2I5JA 2AWZA 5L1JA 2DPJA 3DOLB 2IJFA 2WTFA 2OPSB 5CYMB 1RDRA 3I5BA 3QIDA 3MR2A 1RTIB 3DRRA 3IS9A 4NLYA 2ZD1A 3E01B 4LSNA 3MR3A 3JSMA 1W25A 4G3IA 5L9XA 3QLHB 1MU2A 3I0SB 1SH3A 3DLEB 1S1VB 2JLEA 1DTQB 2V0NA 3DOLA 4NLTA 4RW9A 5J2NB 3GV7B 5CYMA 2R2SA 4ED7A 2CJQA 1BQMA 1RTIA 4WFXA 2GIRA 3QGGA 3DM2B 5F9NA 3QLHA 2B5JB 4QWDA 1RYRA 3I0SA 2B43A 1HNIB 3DLEA 4IOBA 4EBEA 1DTQA 3RBEA 4ED1A 5J2NA 1ZTTA 5HROA 4TYBA 2UVUA 3DM2A 4H4OB 5KFVA 1HMVA 2B5JA 5KT6A 2UVVA 4MIAA 1HNIA 3GYNA 4URSA 2W8LA 4ED8A 4J9SA 3CIZA 4K4VA 1XR6A 3E51A 4YP3A 5KT7A 1JIHA 3SFGA 4ID5B 3KK3B 3FSIA 5J2QB 3LAMA 2ZKUA 1UWBB 4MH8A 3H4DA 4H4OA 2DPIA 4IG3B 1BQNB 1S1XB 1JLCB 2QV6A 1SUQB 2YNHB 4JUZA 1S0NA 4IRKA 4O3SA 4WXWA 3GIJA 1IKXA 4DL6A 5KFSA 5KFZA 4O4RA 4WE1B 4XPEA 4ID5A 3KK3A 5D3GB 5J2QA 2BRLA 3KLHB 4ECTA 1UWBA 4DEZA 5KFBA 3SI8A 1K1QA 4IG3A 1RA6A 1BQNA 1S1XA 4O4GB 1SUQA 2JEIA 3M9OB 4ECVA 1T3NA 3FFIA 4MIBA 4MKAA 4TQSA 4J9KA 2BR0A 4NLRA 2IC3B 3T1AA 4TLRA 5D3GA 5KFXA 4IG0B 4WZMA 3IGNA 4ZHRB 3KLHA 1N6QB 3KHLA 2BRKA 4O4GA 2UUTA 3FDSA 1JLBB 4O3NA 3LP0B 2D41A 3MEEB 2C22A 2IC3A 3OHAA 1RTHB 2RDIA 1S1UB 1S1WB 4IG0A 2YKMA 3CJ5A 4H4MA 3DDKA 4ZHRA 3V6KA 5KT4A 4NZ0A 1NHVA 4J9PA 1GX5A 3M8QB 2HNZA 2GC8A 5KT3A 4FBUA 2OPRB 1TKZB 3LP0A 5EUHA 3MEEA 1TL1A 3H98A 2ZE2B 3PR4A 1CSJA 1RTHA 4K4TA 4G1QB 4O3PA 1S1UA 1S1WA 3D5MA 3KOAA 2R8GA 2VG7B 1JLFB 2J6SA 1TKTA 1JKHA 3ITHB 1NHUA 3M8QA 3G6XA 2OPRA 1TKZA 4WFZA 4DL3A 1VRUB 1TL3B 1S0MA 2ZE2A 4G1QA 5F8GA 2E9RX 5JXSA 4J9NA 3H5YA 3DLKB 5EWGA 2VG7A 4EEYA 1LWFB 3CJ2A 4QW9A 5L1KA 4KFBB 3DRSA 2WRMA 5I42A 5KFPA 1VRUA 3QO9A 3MFHA 1TL3A 4ED2A 2FLPA 3LALA 1S6QA 4K4WA 1HPZB 3DLKA 4WXOA 5J1EB 5HP1A 2JEGA 5KFKA 3H4BA 1LWFA 2HWHA 3PJWA 3BSOA 4KFBA 3Q8RB 5KG1A 4QWAA 3H2LA 2AGPA 4FS1A 4K4UA 1RT5B 4Y3CA 2V9WA 4TQRA 3T5JA 3QGIA 1HPZA 4KSEB 3CO9A 3DOKB 4EO6A 4NLSA 3KLFB 2WK4A 2C2EA 1LWEB 5J2MB 1N4LA 1RT5A 2ILZA 5KFQA 3CWJA 4IQXA 3Q8QB 1LW2B 3DOKA 3TVKA 1QUVA 1TVRB 1N5YB 5DQGA 1LWEA 5J2MA 4ECSA 5KG7A 4IFYB 5KFYA 1RT4B 2WOMB 2BE2A 3GV5B 5F8MA 4QPXA 5KFLA 3TQ1A 3BQ0A 4NLVA 1LW2A 3FRZA 1EETB 4J9OA 2YNGB 2BQRA 1TVRA 1N5YA 4PQUB 2R2UA 1RT1B 2E9ZA 5KFNA 1S97A 4KKOB 1RT4A 2WOMA 4I2QB 5K14B 3IGVA 2XGQA 5KG3A 1S9FA 4RUAA 2ZD1B 4LSNB 1EETA 2ALZA 1HQUB 2YNGA 4PQUA 4MK9A 1RT1A 4PWDA 5DG7A 1TP7A 3D28A 3H59A 4KKOA 5C25B 2FVRA 4I2QA 4RW9B 4HKQA 3KLVA 5K14A 3CVKA 1BQMB 3CDWA 4ECQA 3BGRA 1HQUA 3PVXA 4YR0A 3I0RB 2BQUA 3DYAB 5KFJA 2XCPA 4XO0A 4NRUA 4RZRA 5C25A 3SFUA 3ISNC 2W7PA 1RT7B 3H40A 5KFTA 1S10A 4R0EA 3V6DA 5HROB 3I5AA 3CJ4A 2FJWA 4YQWA 4J9RA 3KLGB 4K50A 1HMVB 3I0RA 1T03B 1WNEA 3DYAA 3FQLA 4K4XA 5F8HA 1HYSB 1RT7A 2RKIB 3NGDA 3H5SA 4NLWA 2JC0A 3KLGA 4NLOA 1R0AB 1T03A 2C28A 1HYSA 2RKIA 3HVWA 1IKXB 4ED0A 2XC9A 2VA3A 4RW4B 3NMAA 3OL6A 1R0AA 5KT2A 1IKWB 3KLIB 4IR1A 2GIQA 3FFIB 3HVTB 2FJXA 5F9LA 2YKNA 5L1LA 1GX6A 3RB6A 1RT2A 1S6PA 4RW4A 2AU0A 1IKWA 3KLIA 4F4YA 4RU9A 3LP2B 3HVTA 4Y34A 3GIKA 4DL7A 3LP1B 1REVA 4ECWA 2FLLA 2IM2A 1C2PA 2IAJB 1RTDB 2YKMB 4RW7B 4H4MB 4NYZA 4RNMA 2C2DA 3NAIA 4GC6A 3DI6B 2W8KA 2HNZB 4TXSA 3LP2A 1TL1B 5KFIA 3BJYA 3PW7A 3LP1A 4R8UB 1D1UA 4ED3A 1KHWA 2IAJA 5FDLB 5KFDA 1RTDA 1TQLA 4RW7A 3VQSA 3CDUA 3PW0A 2XGPA 1TKTB 1JKHB 3DI6A 4ZMMA 5DG9A 1S0OA 2QE5A 2R8HA 2ASJA 4R8UA 1XR5A 5FDLA 2WONA 1S1TB 4K4ZA 3GILA 4U6PA 1C1BA 2B6AB 1IKYB 3OSPA 3OL8A 3DRSB 4ZVFA 4ZP7A 4TN2A 5I42B 3QO9B 5F8IA 4KB7A 4DL2A 2XI2A 2R2RA 1S6QB 3I5CA 1S1TA 3GQCA 4J9LA 5HP1B 3RB3A 2B6AA 1IKYA 5KFCA 4F4ZA 3H5UA 1I6JA 3G6VA 5KG5A 1DLOB 4QW8A 3MEDB 5HLFB 3GIIA 4YR2A 4RNOA 2VG6B 4ZVHA 3KK2B 5T14A 1FK9B 2BQ3A 3QGHA 3UDLA 2ASLA 1RTJB 1N48A 4RW8B 1JX4A 4JV2A 3DLGA 2W7OA 5KFMA 1TKXA 1DLOA 3UPFA 3MEDA 4LQ9A 5HLFA 3KK2A 2VG6A 4HYKA 5KFWA 1FK9A 5KFAA 4QWEA 5KG4A 1RTJA 4RW8A 1C0TB 1QE1B 1RAJA 2UUWA 3N6NA 2I1RA 4M94A 2BE2B 4QWBA 1RT6B 5DGBA 4WZQA 1FKOB 2R8KA 2OPPA 1JLQA 3BSAA 2ASDA 1XR7A 4Q43A 3KMQA 4ECRA 2ILYA 4R5PB 2YNFB 4JV1A 2HAIA 4DL5A 1C0TA 1QE1A 1S9EB 1LWCA 3OL9A 4URQU 2D3UA 1RT6A 1FKOA 3KJVA 4WYWA 3OLAA 1QAIA 3LANA 4K4YA 1DTTB 2HWIA 4J9QA 4R5PA 2YNFA 2RDJA 2BANB 2YNIB 4PWDB 4IR9A 4NLGA 1S9EA 5I3UB 4DL4A 1HQEB 4ZPAA 2F8EX 2WCXA 2IM1A 1T05B 1S49A 4KV8B 3H5XA 5HBMA 4RUCA 4LQ3A 3NL0A 3T19A 2W9CB 3KHRA 2R8IA 4FS2A 3NAHA 1DTTA 3BGRB 4KO0B 4Y2CA 5C42B 3PJXA 2BANA 2YNIA 4F4WA 3KLEB 5I3UA 1HQEA 3N6MA 1IM4A 3OHBA 1HARA 3C6UB 4RNHA 1T05A 4KV8A 4IKAA 3V6DB 3M8PB 1KLMB 2W9CA 3OLBA 4ZP6A 4KO0A 2FVSA 4Y2AA 2W9BA 3BSNA 5C42A 2OPQB 4J9MA 2C2RA 2FJVA 4ICLB 4LSLA 2UVWA 3KLEA 4EYIB 5KFFA 4JV0A 5KFGA 3C6UA 4O3OA 3GIMA 2E9TA 3M8PA 3NBPB 3PHEA 2AX1A 1KLMA 4O3QA 2OPQA 1SH0A 3G6YA 4K4SA 1EP4A 4ICLA 3G86A 5KFRA 3M9NB 2EC0A 2AGQA 1C0UB 2IM3A 4IH5A 4IH7A 3NBPA 4I7FA 5F8JA 4ZP9A 3T5LA 2CKWA 4DG1B 5EDWA 2AGOA 4IFVB 1SH2A 3PW4A 2VG5B 1JLEB 1TV6B 2FLNA 4B3OB 4NLXA 1C0UA 1C1CA 2YKNB 3KMSA 1RT2B 3OSNA 4U7CA 3KNAA 5L1IA 3RB4A 1S6PB 2OPSA 4DG1A 3BQ2A 5DGAA 4Q8EA 3V4IA 4KHMA 4IFVA 3E01A 2V4RA 2VG5A 1JLEA 1JLAB 1TV6A 4ECZA 4B3OA 3BQ1A 2HMIB 1REVB 3DRPB 3RAXA 1FKPB 1S1VA 2FVQA 4Q0BB 2IMWP 2FVPA 3V6JA 3HVAA 4ECYA 3NKYA 4MK7A 1JLAA 4KBIA 4YMEA 2ATLA 3DRPA 2HMIA 4NLPA 1FKPA 4ZP8A 4F50A 3MTKA 2J6UA 4Q0BA 1SV5B 3PW2A 3Q8SB 1S4FA 1N56A 4TY8B 3DMJB 4IRDA 4ZPBA 3CJ0A 4NRTA 3RB0A 1JXLA 3LAKA 2XCAA 3EZUA 5KG6A 4NLQA 2D3ZA 4M95A 1S48A 2WONB 4Q45A 2IA6A 1SV5A 1NNDA 2J6TA 5KFEA
chains in the Genus database with same CATH superfamily
2QRRA 3MM8A 4RWWA 2ZVIA 4BWMA 2FHOB 3DRXA 1P27B 2UVRA 3V6HA 1U24A 1RB0A 4I2PA 1IJEB 2BNWA 4EUVA 3B82A 1JLBA 1VISA 2RF2B 4OYWA 4OJGA 5BR8J 4I69A 3JYTA 5J2PB 1LWCB 1JLFA 5H9EJ 4NZ6A 1YBTA 3W61A 2K2PA 3U1LA 2COLA 4LF9J 4M5IA 3JB9k 1X4GA 1H73A 1ZM2A 3BKFA 1YVFA 2GJFA 3GFYA 1BY9A 3MTJA 2KT5A 1ZPWX 2VUGA 4UOGA 3QIPB 2QEXS 4HI2A 1IKVB 1VFJA 3IM9A 2CJXB 2OSQA 4H54A 2YQ3A 4OYZA 4FXDA 1ZAXA 2DPJA 2WTFA 3I4PA 2MQMA 2Y1JA 1W25A 3KKFA 1UVIA 4LRCA 2XLIA 5ETSA 1S99A 3DM2B 1SB6A 2V6AA 4IOBA 4B9UA 1DTQA 4ETXA 3VV2B 4DR5F 1NZAA 2RBFA 2EG1A 4FPRA 4N56A 2ALYB 2YVSA 3OR2A 3LAMA 1NAQA 3K5MA 4O4RA 3GB0A 4O23A 1TAUA 1X9WA 1BQNA 4N5SA 1HWKA 1Q8IA 2MDAA 1W7WA 5KFXA 1N6QB 1VQYA 3SQGB 2CVEA 4DSFA 3CTRA 1T3OA 3LP0B 3FGVA 2V67A 2YKMA 3C2PA 4DR7F 3VZIA 1NHVA 2KZZA 2YQ1A 4QYZK 5DRKA 2XULA 4D8JA 4YDXA 4J91A 1DQ9A 3UCGA 5K20B 3LUYA 1Z1ZA 5A2QU 1UL3A 4DV0J 3CJ2A 3HK2A 4KFBB 4WP9A 3W2WA 2KXFA 2FQQB 1V6HA 3HFKA 4L72B 1IBMF 5HK4A 1RKJA 5CD4H 2EG2A 2BEFA 2VICA 5DDRC 3KLFB 2A6MA 2KOEA 4A8FA 3I32A 3Q8QB 4C0OC 4LF7F 4IOAQ 2LA6A 1QUPA 2Q43A 5GAHI 4FXWA 2M2BA 1WWHA 3MHYA 3ZFVA 4J9OA 1NCLA 4X4UA 4KKOB 1SL1A 2VD3A 2RB7A 3TI0A 5SUHA 1FXDA 2JFKA 4V1Ak 1WACA 3BZQA 5U47A 2ERRA 2H1OE 4C8YA 4DR3J 2W7PA 2G9OA 1B0VA 1FVQA 3I5AA 2QLJB 2EFOA 5IQ6A 1X5PA 4A8QA 1F2HA 2B4UA 4A8KA 5A8RA 1RLCL 2MZ1A 1A9NB 4XTTA 4OZ0A 1L3KA 5ETVA 1T9WA 4RLEA 2XC9A 2HFOA 3F56A 4N76A 4KGZB 1X8DA 3GG0A 2R7OA 4PXEA 1CC7A 2GO9A 4WFNQ 3KLIA 3LP1B 1JQGA 3O1LA 4ECWA 1V3ZA 7FDRA 2K7JA 1LK7A 2YPYA 4TXSA 5KFIA 7FD1A 3POTB 1GH8A 2OP5A 3C46A 3DRYA 2AF6A 1AFJA 2GAGC 1HNWJ 5HJXA 3D3CJ 3ILOA 1M5HA 3HHLC 4AE5A 2LEAA 2Y0SD 4ELTA 2GZOA 2GHWA 4AT1B 2PMZD 2RS8A 3QGHA 4FYXB 2R7TA 3DLGA 2Y3YA 3MEDA 3TX8A 5KFWA 4UZBA 1UVNA 1RT6B 4C7QA 1JLQA 2ASDA 1VBKA 1S9EB 4EI2A 4URQU 4D3HA 4ANEA 4J9QA 2G0JA 3H5XA 3FEZA 4HEA9 2OD4A 2DT9A 2ZNZA 2PC6A 5L38A 3ZZ0A 1U4BA 3AOCA 4A8YA 2HVIA 3PEHA 2EPIA 4O3OA 3D9BA 1KLMA 3DCAA 4AQYJ 4HT7A 1FXLA 2EC0A 4AD6A 2JXIA 3R6GB 3JSYA 4IFVB 2AW0A 2IPOB 1TV6B 3T9NA 4WIQA 3E01A 1DZ5A 3UVJA 4A8SA 3WC2A 1JXVA 2CJAA 2RT3A 4JV5F 4YMEA 1CEZA 3CCVS 1QTGA 3MD3A 4HL9A 1S4FA 2LDIA 3M30A 3Q8UA 1JMTA 1VQ5S 3KWMA 4HTJA 3OD2A 5THWA 4GVBB 4ZVEA 4WE1A 4I2PB 3GLJA 3U02A 1KVKA 4RNFA 4IRCA 3QZ7A 4DF8A 1LW0A 4KH0B 4YB5A 4FXEA 3JYTB 4ZPDA 3CJ3A 3N4WA 2E5LF 5JUMA 2VF3A 2OPPB 5I3QA 1GMVA 4DSLA 1SJ1A 2O5DA 4PKDB 1S77D 2KTQA 1RHMB 1D0EA 4CZCA 2UXCF 4FYDA 4ZIWA 2DR7A 4QIEA 2NXJA 1QD1A 3BREA 3GR0A 2QTWA 3IXQA 2OJ3A 3PR5B 5HVHA 3PM9A 2VOPA 4ZVSB 3QPIA 3QJJA 2B9YA 3SV4A 1R0CB 1HR0J 1PILA 2WVCA 3IRXA 1VQPS 4ZVTB 3PACA 3TNVA 2QT7A 1AXQA 1CC8A 1V5VA 1C1CB 4AFFA 2IJFA 3CJSA 1NK8A 1FRMA 4OI0A 2W7AA 3BF4A 3D1OA 4RUBA 4OFZA 3I82A 3ETMA 4QZVB 1DTQB 3GV7B 5DM6Q 5CYMA 4WFXA 1KTVA 2GIRA 4WPAA 4ZJQA 2OEJA 2HS0A 3OR2B 2KYXA 1EB0A 1HMVA 2H48B 4ZIVA 4F7VA 1HBNB 3R1LA 1QAXA 1BQNB 4O3SA 4DV4F 1K73T 4OZ5A 2NS1B 1KP6A 4IG3A 1RA6A 1SCJB 3LWLA 1SUQA 4RJVA 2B8QA 3GJQB 4WZMA 3JAMY 3R3TA 2DIVA 4WK3A 3LGHA 4NWBA 1BDTA 1VS3A 2A10A 3CJ5A 3V6KA 5A8KA 1GX5A 3ONQA 2HHUA 5CHCB 1TKTA 3M8QA 5LT5A 2MKYA 3W2WB 4X4QA 2IRUA 4CCHA 5E33A 2XYPB 2HGLA 2LKZA 4PYDA 2VODA 1XBWA 2AGPA 2V9WA 4TQRA 4CLPA 3CO9A 4DSEA 4K0KJ 2ILZA 2CG8A 4FYWB 3A12A 5LL6d 2R2UA 3ZNUA 2HQ3A 1F6TA 4DR1J 1HNXF 4LSNB 4PWDA 4NXNF 5DG7A 3G96A 2X1BA 3OJSA 5A8RB 4DSJA 1Q79A 3IP0A 2NYHA 4NXMF 2HGMA 2ROGA 2MQ8A 3FK4A 4B9SA 3PIOQ 1HYSA 1D8YA 2UU9J 2XY7A 1OM2A 3OL6A 3KLIB 4GKKJ 2NXUA 3K17A 1VLYA 2YTCA 1S6PA 4ZPTR 4RU9A 2K06A 2POKA 3H0PA 1VQOS 2F40A 2K3KA 2FB0A 4BC7A 2XGPA 3F73A 2MPUA 1N34J 3TZXA 5C2GA 2W4DA 3K5OA 2JLFA 4Z2XA 1FE0A 2R2RA 4OZLA 1AUDA 3MEDB 1RWXB 4RNOA 2VJVA 2IDLA 2NCKL 1WKKA 3TZWA 3PX4A 1DLOA 5HLFA 4N47A 2R7RA 3F0NA 4HYKA 3QT7A 1Y4ZB 4LFBJ 4ZLLA 1YTYA 2VOOA 4RO0A 1RBLA 1FO1A 4L3KA 1HI8A 4PWUA 2H54B 1N0UA 4DR6F 4GKJF 1KLMB 4RBUA 4Y2AA 3ELHA 1FA0A 2VQFF 4JV0A 2E9TA 3G6YA 3G86A 1RAOA 4B3TF 4IH5A 1S4EA 2GHPA 4CO1A 3VHQA 2HFSA 2UV8A 1CQNA 1B7FA 3JTOA 1GTEA 4F36A 1KKHA 4CO4A 5HAOA 1ZYQA 3AH6A 5B0GA 2MZTA 4ZP8A 4IRDA 3S1TA 3NS5A 4C8NA 1S48A 4LF8J 3DMJA 3LF0A 3HT0A 1U48A 4FBTA 1S9GA 4PG8A 5JVHQ 1LW0B 4WIIA 3R7BB 3KHHA 1M1KT 2PIIA 2H3EB 2K1RA 4P9SA 1NK9A 5KG0A 4XPCA 3PFEA 2MKHA 3WHIA 1S0VA 3A8KA 1J5OA 1RACB 1ZETA 5LSLA 2LDYA 3H2UB 5IT0A 2GHVC 2FJBB 3MR6A 3G8QA 3MEGA 3T5KA 2YKOA 2RIJA 2DGSA 3IRXB 4K2JA 3UN3A 2EXUA 1H3DA 3EPGA 2HQFA 3OFFA 2XHWA 2HW3A 2U1AA 1NSAA 2JC1A 4WP8A 4HHJA 3OVSA 2AWZA 3D0HE 2LECA 1EAYC 5CYMB 3QIDA 3V4IB 3NCQA 2WSCC 5L9XA 2V0NA 4ED7A 2LYVA 5F9NA 5KOXA 4UQGA 5EX0A 2DO0A 1HQ2A 3NWRA 1JWWA 1ZTTA 2CQ1A 2X3DA 4MKYA 2HRUA 1R31A 3JQKA 1UAWA 2OD6A 1BWEA 4IG3B 1JLCB 1SUQB 2QA4S 1HBMA 4F3OA 2Y0BB 1VYAA 4NLRA 3T1AA 1Y7PA 3NEKA 3IGNA 5A8KB 2OHDA 4O3NA 2Z2YB 5C2CA 3M8QB 4RWXA 2GC8A 5LXYA 5EUHA 3MEEA 4C8MA 3HSDA 2XS2A 1JKHA 3CD0A 1OY6A 1S0MA 3C19A 2I8EA 3NMRA 5AE3A 3CCQS 1MWZA 2HFNA 4L76A 3DRSA 1TL3A 4B3RJ 3NGKA 4WXOA 4DQQA 4P2XA 1X4HA 3CB4A 1HW9A 3W1YC 3O3LA 1X60A 3DN9A 1PAEX 2NXCA 5KFYA 3GV5B 2FY8A 2QL5B 1CJVA 4R0JA 4OX8A 2SXLA 1IM6A 3HJVA 5KG3A 3CUNA 3B4DA 4OIXA 4ED4A 5BYRA 3IBCB 1S59A 1SL2A 5E2QA 4QR0A 3W2VA 3AX5A 2BJ1A 1VQLS 5B08A 4ME7E 2V4JA 1SIWA 1N36J 4K50A 4RR5A 1S72S 3R27A 1HYSB 4QYRA 3R2DJ 2OFHX 3AXMA 1SQEA 3P45B 4NYPA 4RX6A 2FZGB 4OYOA 2AEJA 3NMAA 4OX9J 1KONA 1F0XA 5KT2A 4DN0A 1NKCA 1RT2A 4PEOA 3EM1A 4USVA 2IAJA 1SBRA 3ILLA 3DI6A 1HI0P 1Q7LB 3K57A 4E0DA 2ZM6F 3A13A 1GXLA 1S1TA 4ZDNA 2CZ9A 1F3FA 1WOSA 4QBUA 1VQ7S 2IIHA 1DLOB 5HLFB 2LP4A 2RUGA 5DO2A 5SZTA 8RUCA 3R5DA 2QG9B 2LU1A 4LF6J 4OYAA 4X4NA 2F5GA 2CPFA 4QWBA 3NNEA 4Q43A 2J0SD 4OZ3A 1RXOB 4JOUA 2RVJA 1QAIA 4PCQA 4J5OA 2RDJA 3CCRS 4MT1A 1P6TA 4IR9A 1R8CA 3Q22A 3HZEA 3ZXWA 1WEYA 3NAHA 4KTQA 1MN9A 1OWXA 2DHSA 1T05A 4KV8A 3V6DB 2HLUA 3BN7A 3WIUA 2YY3A 2DNQA 3BR8A 2DNGA 3ZTRA 1PJ6A 3G8SA 1E6YB 1U1NA 1IVZA 2FLNA 5IWAF 1OY9A 2Q3PA 1FT8A 3HFZB 4DG1A 4B3OA 4OHXA 9ATCB 3MUTP 3QRQA 3ZZPA 1T9VA 2RJZA 5M2PA 2HMIA 1FKPA 2A1BA 2GQQA 3DMJB 2GV1A 1RK8A 2HHWA 2YQ0A 1S9GB 4RW6A 3ISND 2CPHA 4IDKA 2EK1A 2EC2A 2VKZG 5HN0A 1XERA 3UQSA 2K1RB 2RNEA 3VALA 3QFWA 3U1NA 2BMBA 1JJ4A 5KG2A 1LFWA 3BYRA 1J5OB 2HQIA 3SIPB 5IS2A 2OIHA 5HQLA 3NLCA 3C6TA 3THTA 3MEGB 2H1YA 3SV3A 3Q8VA 3M32A 1GXTA 5D0EA 2UXBJ 2EFPA 5DQIA 2CPZA 2C3YA 2DO4A 1ZTWA 3EZ5A 2G0CA 1RWUA 5BR8F 3FBCA 5L1JA 3NNHA 3GXQA 2LQ8A 3I55S 3IC1A 1S1VB 2JLEA 4HDGA 1OYEA 1SJRA 3ZTQA 2GA7A 1T7PA 4AXJA 3Q23A 1RSCA 1VQNS 3BDPA 4ED1A 4NOHA 2AJ1A 2F9JA 4EMDA 1NH7A 4M5DA 2RDDA 2AN7A 4ZOSA 1FJ7A 2IVFB 1M5OC 1Y00A 4LF1A 3SFGA 3FSIA 2YNHB 1R6YA 2V2VA 4OYPA 3FFIA 2XYGB 3KUGA 2C2KB 2PEHA 2D41A 2P5VA 3MEEB 2IC3A 5DJBA 2LQJA 4NE9C 4BLGA 2XY6A 4J9PA 1ZM3A 2B7BB 3HI9A 4O3PA 1D09B 3D5MA 4UT4A 3G6XA 4AL6A 2P6SA 1TL3B 2J9DE 2DD8S 3WZ0A 3MFHA 1U8SA 4DV6J 2RU9A 4DR4J 2HWHA 2MY7A 2MYFA 4P2FA 2KJVA 3X3UA 4PR6A 2VC1A 1P9QC 4BS2A 3P4UB 1RT5A 2RS2A 1UP1A 1SI9A 4OYBA 1CJVB 4H4KA 1O0PA 4X64F 1L5UA 1F9HA 2BQRA 4DUYJ 1FDNA 2YBVA 2AV5A 3VGTA 3IGVA 3SMZA 1SC3B 2ZD1B 3T1YJ 5K14A 2FPHX 1SIWB 2XSFA 3PVXA 3PDNA 4P73A 2BJEA 2ZH7A 4DV5F 1JB0C 3CJ4A 2MQPA 4YQWA 4AAIA 4DQSA 5H9FJ 3DYAA 2RHSB 1S57A 3KLGA 3W66A 4MMOA 2OI2A 3ULHA 4ED0A 2DHAA 4DUTA 4BWJA 2DY9A 4WK1A 3EVWA 3VAHA 1Q7YT 2IAJB 2W2OP 3DI6B 3TJ9A 4CLSA 3J81U 5J1PA 5H9FK 1S1TB 5BYQA 4DU8A 1GT8A 3MOJB 4LBHA 3OTDA 2ACMA 4GO5X 1DRZA 1U6BA 1R27B 1PYTA 5CZVA 2BE2B 4DLGA 1DAXA 2R8KA 2E5JA 3EGZA 4G6VB 1O5JA 3KJVA 1PBAA 3LANA 3E8OA 3K89A 3HX9A 3G4SS 4DR5J 4KV8B 1T05B 3T19A 2XYHB 1DTTA 1RHUB 2ZC4A 4NA1A 4W98A 1G3OA 2W9CA 1U1LA 4KO0A 4F3QA 1YWXA 2V63A 3H90A 5CQGA 1WUUA 2GCFA 4DG1B 2BZ2A 2WVEA 1WI8A 4B3OB 3JTNA 3JQJA 3OJUA 2OTLS 1A7GE 2HMIB 1FKPB 3LGNA 2HIQA 5EHHA 3NKYA 1AUSL 2CJYB 3T6BA 3PW2A 3Q8SB 1N56A 4NRTA 2ABYA 3K58A 4IQMA 3P5BP 2CPYA 4I4BA 1S7HA 2EFNA 1NK7A 4RW6B 2GGPA 1O51A 4AQYF 2PFFB 2AJQA 3ICLA 3W5ZA 2K8GA 5KOWA 4IDKB 4K7QA 3US5A 5F0UA 2Y8YA 2YKAA 2IYIA 4LF7J 2HNYA 4B9VA 1WOPA 1Q95G 1HNVA 3KJNB 5HMYA 2D7SA 2CQIA 4KJIA 2MY8A 2W2MP 5KFUA 3C6TB 2ZHBA 3O2IA 1TK0A 1RHQB 3ZTOA 1UCNA 3GV8B 4PXBA 5B0FA 1T9XA 4URGA 2AEFA 5DQHA 3BO2A 1FEEA 1P9YA 3U1MA 5C5JA 4B02A 2MZQA 2YWWA 1WEZA 2CJBA 4DV2F 3TA2A 2YH0A 4MFBA 2NREA 2GQ2A 4DFMA 3RGIA 1SVDA 2YWEA 2XNQA 4WFBQ 4J37A 1EIYB 2QX0A 2VB6A 1VRTA 5G4DA 2I5JA 1Q0NA 2K5JA 2W25A 1FNMA 4M5DB 1RYRA 4OZ1A 2ZVSA 2OTJS 2LXUA 1RZMA 5AXLA 3AD8C 3UE2A 2E5GA 2GJ2A 5BXIA 3VAGA 4YP3A 4LT6A 2HHVA 1G6BA 4H4OA 2Y9HA 1TKDA 3NO7A 3B8HA 4HHHA 1K1QA 4QQBA 2JWNA 4J9KA 2DNLA 2IC3B 2GMJA 2EBGA 4WWSA 4DN9A 2UUTA 2R7WA 2FY1A 1FJEB 5KT4A 2H65B 4NASA 3OUYA 4C8ZA 1TL1A 1QTMA 1KEKA 5GVQA 1X5TA 3Q86A 3VAFA 2DYAA 2Z2MA 2VQEF 4J9UE 1EJ7L 3QO9A 2F7VA 4HT5A 3MCNA 2C2MB 3LH2S 5KG1A 1YJVA 3AXKA 2MB0B 1RT5B 5E5NA 5I4MA 1HPZA 4FYYB 4EO6A 2WK4A 4CNYA 2C2EA 3W8GA 1OHNA 2DGOA 3DOKA 1B7YB 4OI6A 3R7NB 5KG7A 4ZN1A 4MKVA 3UI3A 3MM9A 2L9DA 5KFNA 2WOMA 5K14B 3D66A 4MYUA 3SCKE 5B0BA 4HKQA 2KT2A 1FCAA 2VFVA 3DYAB 2DHXA 4LMZA 1HA1A 2ACYA 1WJ9A 4R0EA 3UNYA 3KDOA 2FJWA 3BGLA 3KLGB 3I0RA 2XZDB 3PRDA 3H5SA 4K0KF 2PEBA 2BBEA 3NS7B 2UZAA 1RQ0A 4MAKA 4DOZA 1J5EJ 3QOQA 4N41A 2F8HA 3VF0B 2E5LJ 2PMWA 1HHTP 1W2BR 2B4VA 4P7VA 4GC6A 1NDLA 2HNZB 3CJRA 3IMQJ 1D1UA 4ED3A 1KHWA 1AFIA 3QFHA 4ED5A 1PGZA 1ZBTA 2ATCB 2P2CB 2YWGA 3J7Z5 1YZ7A 2WONA 4EWTA 2QL7B 4OHVA 4PG7A 3OSPA 1RWWB 3ZZUA 2QMUB 4ZKAA 8ATCB 3EJMA 5LOQA 4KHPJ 2A2DA 2NPIA 1LXJA 2EBEA 1YRTA 5IM0A 1I6JA 4ZA1A 3QAUA 4GKKF 2H9ZA 5IXUA 3OR1A 1HBUA 3R1HA 4W4MA 3M05A 2MKJA 5M2RA 3CW2C 1FK9A 5KG4A 1RTJA 2KZMA 4LR9A 3T9ZA 2FHKA 3ILIA 1TL4A 3BSAA 5CCLA 1G2EA 2V2QA 2V8HA 3OL9A 2E7WA 1NSPA 1S76D 1DTTB 1RI7A 2R7UA 2DNNA 3GFZA 2YNFA 3HFVA 2CVIA 1DQ8A 4KGMA 1HKAA 3EXCX 2W9CB 4KO0B 3NXZA 1HQEA 2DH7A 3AAWB 4FKYA 5C42A 4DV4J 1VIXA 5CZXA 4X65F 4X66J 1WKJA 2FLOA 4K4SA 1EP4A 5KFRA 2B4OA 4KT0C 4ZVOB 5LM7E 5FLXY 4OI1A 2DCLA 2Q1LA 2XMTA 3CD5A 2OPSA 3BQ2A 2AZ3A 2V4RA 2PO4A 2EFVA 4ZLPA 2JOQA 4P2SA 4RBVA 4Y6IA 4DPYA 2GGPB 5CABA 4DXLA 4C6AA 1SV5A 3CC7S 4DDFA 4FYVB 2K7KA 3TZYA 2Z56B 2ZFHA 2HNYB 1KTQA 3J81j 1HNVB 1UTAA 3PG9A 1PYOB 3AOAA 3BBCA 2Z2ZA 1SJFA 2XI3A 2FJDB 2L08A 5G0RA 4M5NA 2M70A 4OL8A 4LIRA 4F4XA 1KVIA 1X31C 2CQ4A 5HJYA 1J2VA 4MFBB 2GO8A 1VC0A 2ADCA 2KM8B 4WFYA 4NCGA 1N54B 2W9BB 1RYSA 4EO8A 2YX4A 3FC9A 1F2GA 3FSXA 2CXEA 3MAAA 4EGLA 4CTAA 4B3MJ 1VRTB 2AQ4A 2I5JB 4A48A 4F8RA 4IYQA 5CYQA 1Q78A 4ECUA 3RAQA 1IR1A 3S6EA 1MW7A 3AX2A 1Y5NB 2XLKA 1JNZB 4OHZA 2CJQA 3DDNA 2AY0A 1IN0A 1LV5A 3DLEA 3IWNC 3KG4A 2J0XA 2O1PA 4ANDA 5HROA 2BX6A 4H4OB 2KELA 3CIZA 3VAIA 2LEPA 3LWMA 1BUXA 2DXDA 4XPEA 3IM8A 7AT1B 4HLBA 2ZNYA 1T3NA 1R8AA 2XO6A 3OTOJ 3AOBA 3OUYB 4NX9A 4NCBA 1Y0HA 3N0VA 2FTRA 4H4MA 3DDKA 2ZDPA 2W1BA 1CLFA 2ZWOA 4PXCA 1WSRA 1Y5IB 3ITHB 2OPRA 4CYUA 2C2ZB 3E2EA 3FMWA 4OLPA 3H5YA 4YB6A 2I0XA 5L1KA 4GKJJ 2HBQB 4CH0S 1S6QA 3M8ZA 1HPZB 5J1EB 1LWFA 3I96A 3P49B 1NBEB 3T5JA 2HZVA 3DOKB 4B3TJ 3M8WA 3ZTPA 2CRLA 3MM9B 3MAQA 2WOMB 1UETA 2ZH4A 4OI2A 5F8MA 4QOTA 2XMVA 1TVRA 1U25A 1UW9A 4LBIA 1RT4A 3UFCX 2GJIA 1TFYA 3D28A 3L95X 4LFAF 1BQMB 3I0RB 2W4CA 1N5QA 3D4JA 2BXJA 2VBZA 5CD4A 4CLWA 1CBKA 3M6XA 2EKNA 2YWHA 3FBBA 1RHJB 2AMCB 3QJLA 1IKXB 3CMES 4KH1B 2VDIA 2MJNA 1KWMA 2J5AA 2JDJA 4GO7X 1GX6A 4JI2F 3LGMA 1UWAA 4Q7AA 2FLLA 4DL7A 1VQ4S 1ULRA 1QTNB 1VQ9S 2C2DA 3L7OA 1IBCB 3K2YA 4QCLA 2KI2A 2EK6A 5KFDA 1FJCA 1P1TA 2BUNA 1WTBA 4OJHA 3Q24A 1N36F 1N5TA 5I42B 5IM0B 1LNQA 4KB7A 3VTIA 2OO4A 2QLWA 4MTPA 3OR1B 5KFCA 1HBUB 5KG5A 4QW8A 4KYZA 2ZOFA 3PIPQ 3CT9A 1FK9B 3RAMA 1RTJB 1TL5A 1ARQA 4LJMA 2V94A 1VRQC 4CLLA 3HM9A 3FJ2A 3I31A 5HVGA 4ECRA 2YNFB 1LWCA 1U1OA 3OLAA 1H2TZ 2YXLA 2CZ4A 1HQEB 5D77A 2CADA 1RWPB 3CD7A 4YB7A 2ZH3A 2A3JA 4FS2A 3BGRB 5C42B 2V8GA 2M4MA 3A4TA 3FSYA 1UZHA 2AYEA 4YN3B 5IT9Y 4CP5A 4A8MP 5KFFA 4LVOP 3GIMA 3O5TB 3PHEA 1R8PA 3RZAA 3G8TA 2CKWA 4Y2KA 2HIYA 1NJYA 5EDWA 1Q8LA 3MR7A 4WKYA 1C0UA 1N32J 4OV1A 4Q8EA 4KHMA 4ECZA 2PD1A 4GVLA 4ECYA 1PIEA 1Q8KA 1TUGB 1OJ4A 1LOUA 1SV5B 1WF0A 3UCUP 3CXCR 5E3RA 2O67A 5KFEA 4CH7A 2CZVC 3G87A 2R9LA 1UEKA 2HQCA 2CAXA 1U1KA 4WF9Q 5D0GA 5G0RB 5JVGQ 1N6QA 3SQGA 1ZPVA 1KOHA 4YR3A 2V2ZA 1B28A 4K5SA 3PNIA 3WDOA 2OH2A 1MWYA 1OS5A 2KU7A 2OSRA 3FQKA 1YJNS 3VAMA 5DG8A 1DBDA 4C48A 1SC6A 4F26A 3ZZOA 2BJ8A 3M8RA 2IBOA 2MEWA 4NCGB 5HBMB 3NNCA 3ETOA 5F8LA 2R7SA 4O44A 3N6LA 2CQGA 1BMQB 2DH8A 2HZCA 4B3SF 1YG0A 3NCRA 3KLFA 2CNOB 1FDDA 5KFHA 1WG1A 3GPAA 2E29A 5CYQB 2Q66A 3CMAS 1LEOA 5GAEI 1X5SA 5ETQA 2IBKA 4FP9A 1AZSA 1RGVA 3MAHA 4G65A 2QO3A 3BH6B 1PG5B 1TUWA 2DGVA 2OMLA 4NLYA 4JI4J 3CGIA 3S01A 1SH3A 3DLEB 1R8BA 4ES3A 4WJBA 1XMQF 1K47A 1FJGJ 5J2NA 1UJ6A 2UXBF 2XEXA 2UVUA 5KFVA 4URSA 1KFSA 4K59A 2QV6A 4JUZA 5HL7Q 2KG0A 5KFZA 2DGTA 1SKRA 1D9DA 4DEZA 2FD2A 3M9OB 1CJUA 5D3GA 2LMIA 2C22A 2MKCA 2IJRA 3GSDA 2OPRB 2B9EA 4CYUB 1S1UA 4M5HA 2NXNA 3IR5B 3MMJA 3W9HA 3MMBA 2MGZA 1LWFB 2ZEJA 3AD7C 4JI7J 3H4BA 4DBQA 3W9IA 2D9OA 2QGFB 1XWLA 2DHHA 3MCOA 3EWGA 2DBBA 4TNOA 4OZJA 2HGNA 2N4DA 1FI4A 3LA0A 3FCHA 1QUVA 1TVRB 1RT4B 4I56A 4TU8A 2Y1IA 4LRAA 3GJRB 1RISA 4CI0B 3MM6A 3BGUA 2XNRA 4TVAB 3KNGA 4YFUA 1U49A 2QYCA 2ASYA 3R8YA 1IBKF 3EZOA 4NMXA 1QSYA 3AJ1A 4DV6F 1V3SA 4OZ2A 4WTYA 3ISNC 2YKQA 3PFOA 1VQKS 2ZZNA 1EKRA 2C42A 2AJ4A 4O0NA 4USIA 4QJVA 2J8SA 4AL5A 2FUG9 1N8RT 2KHCA 1RCOB 4HV0A 1M90T 3D6MB 5T41A 1R0AA 1MG7A 1EQMA 3NP5A 3RB6A 4P10A 2LU2A 4DUYF 3CIMA 3MMAA 1PYSB 4F4YA 3T1YF 4PABA 4J7CA 5HVFA 2DTJA 4O0IA 3PJ9A 1A6LA 4P71A 2R7XA 3NOCA 4DMZA 3CDUA 3MPVA 2UUCF 3ZC4A 1U02A 3HHLA 4HACA 4M5GA 4GVBA 2MZSA 2QIFA 5GAEU 4C9DA 4Y00A 1JX4A 4W92B 5E3PA 2W7OA 2HS4A 1F3VA 2CNLB 3CCTA 3FT7A 2DNZA 5KFAA 3MPDA 2OPPA 3AB2B 2UXDF 5FLXU 4H4KC 3B6BA 4DL5A 2RAQA 4FPIA 2G1DA 4HI1A 4USUA 3PYFA 4Y2CA 5I3UA 1RCXB 4IKAA 2IHR1 2UVWA 4K8RA 2KL8A 3C6UA 3M8PA 3BDEA 4KGXB 5B0AA 1KQKA 1C0UB 4JP8A 1FD8A 1GMWD 4ZP9A 3RR7A 2CQ0A 2RE1A 5IOLA 2ZWPA 3A3PB 1TK5A 1C1CA 3J7YI 4U7CA 4QYZJ 3N5BA 3A8IA 2KO1A 1VQSA 1REVB 1WELA 1VK8A 1BWVA 3KXDA 4ELVA 4JI8J 1JLAA 2ATLA 2CDRB 4FZVA 3JSBA 3D6FB 3RB0A 2ADBA 5KG6A 1HBNA 4B17A 2HBZB 2V50A 2XO7A 3J80U 3LW5C 1F5BA 3T5HA 1BXNA 4ENOA 4ZCKA 3AY0A 2F9DA 2QLBB 3TQ1A 1WC3A 5B09A 4X64J 4WFAQ 1ROFA 4NLUA 1RWVB 3ZZZA 2WVBA 1FX2A 1GQEA 2CWKA 4JI0F 2MTLA 3Q89A 2D74B 3CNQP 1GMWA 2WB4A 5AJ3F 4DV5J 4O44B 2V1TA 2DRDA 2DRAA 4CQ1A 4RUHA 2D3OR 4B9TA 4KGVB 1Y5LB 4E8UA 2VA2A 3MF5A 3BR9A 4Y65A 4U96A 2ZBQA 3QYYA 2XMJA 4C11A 1AZSB 2AX0A 2J0WA 4USTA 1N5VA 3PO5A 2QMWA 4JB8B 4P2MA 2VKRA 3BSCA 3B54A 3TAQA 3ADAC 2HS3A 1RAHB 3RBXA 2CJKA 4LSNA 2JVOA 3GU0A 1H98A 5J2NB 2B8PA 1UMJA 4P52A 2X1GA 4QWDA 4ZVPB 1PJ7A 4F2SA 4OI3A 1B70B 4TYBA 3MUVP 2QZ8A 5KT6A 2B5JA 4YEAA 2UVVA 4MIAA 3QATA 1WC6A 2PSZA 3BPDA 3TEGA 1FRIA 2WZ1A 4WXWA 1CJUB 4DL6A 1YLXA 3G71S 1WDDA 3IA0A 3KK3A 5D3GB 4DX7A 1X4CA 1XNQJ 2RUSA 2CQBA 3HD2A 2DR5A 3FEXB 1S1UB 2IA0A 5A76A 3EDQB 1I1GA 4IG0A 2J7KA 2MKSA 1VBYA 2KXNB 2JX2A 2CPJA 2VBWA 3MMBB 3H98A 3CMQA 4K4TA 1ICEB 5IQQA 2MGZB 2R8GA 1CQMA 1KC8T 4DL3A 1NHUA 2ZE2A 1TUVA 5F8GA 2XQCA 2FLPA 5KFPA 4EFAC 3D6TB 3LJPA 3ENAA 2VFSA 2AP6A 3BV8A 1QY7A 1H6KX 4KSEB 2F65A 5J1NA 3HVRA 1UFWA 3CWJA 3J7YU 2ZJRQ 4WKRA 1MYLA 2H5EA 2W2NP 3MM6B 3DU6A 3OTEA 1ZS6A 3AA9A 2U2FA 2XMMA 3EVMA 2CNNB 4UY8T 1WHXA 2V68A 3M4XA 4MK9A 2XWXA 3L9ZA 4RW9B 4TU9A 2GMLA 3TYTA 3CDWA 1TR0A 1X9MA 4YR0A 3EDRB 2BM1A 5KFTA 1S10A 2DITA 1NM2A 2N4CA 3FQLA 4NA2A 2CPIA 2NSCA 1AW0A 2Y1LB 2X1AA 1R0AB 1T03A 3UD3P 1SL0A 3UD4P 1K9MT 3MMAB 3K5LA 4B9LA 3J7A1 3LTOA 4LUBA 1RAIB 5EX3A 2M8DB 2HPUA 2N3LA 1G7CB 5DG9A 3HHLB 3BPSP 4HACB 1T8EA 1Q86T 5D6GA 4DV2J 3TJAA 3CO0P 1UPPA 5D78A 2OLWA 1J5EF 4PXDA 5E7OB 1QSSA 4ZS6A 4FDFA 2GS8A 1ZA1B 4Y28C 1CULA 2UUWA 2WVDA 1NMEB 1ZM4A 2DY1A 4ZLNA 2BDPA 2L48A 3M1VA 1QE1A 1VJWA 2D3UA 3ISZA 4K4YA 4RL1A 3C16A 5I3UB 1RWOB 1PAUB 5A2QY 2IM1A 1FFGB 2IVYA 3PJXA 2YNIA 4KHPF 2HQDA 3GWCA 2F1FA 2JRSA 3C6UB 5ETMA 3M8PB 5GMKa 1VR6A 3VGVA 3BGOP 4AL7A 2OPQA 1SH0A 4LRDA 2A2BA 3T5LA 3OQ2A 1LKZA 3HD1A 3IAM9 3P8BB 5JMNA 2YKNB 1IUJA 2B0GA 1HW8A 3HCXA 1L3UA 3V4IA 1BE4A 2XZWA 2VBYA 1JLAB 4HTIA 3ZO7A 4M5MA 3FVYA 3X1LB 1YBAA 4MK7A 2VQEJ 3MTKA 3PEJA 2EKYA 4EK2A 4ZCLA 4YR2A 3SSQA 2ZJQQ 3TUPA 4X2BA 2NUHA 3TUZC 1JLCA 4X66F 3DGVA 2DCUB 4JBCA 1YRXA 2DR8A 1BLUA 3ZZRA 2MXYA 5HATA 1TKXB 3RRKA 3MCMA 4DUZJ 2JEFA 3L4BC 3EGNA 3GONA 1V9OA 2Z58B 4DCPB 2IM0A 3L7PA 4A8OA 2LQ9A 5IFMA 4F04B 3ET6B 1RA7A 2CIMA 2P9EA 1RT3A 4C11B 4EBDA 3ENWA 4LSLB 1O8BA 2M5YA 2XY5A 3RUBL 1VQ6S 5GAGI 1U6ZA 1TL7A 2OEKA 4WP3A 1FEHA 4KGKA 2KYZA 3DXSX 2W01A 1BQXA 2HFZA 1S6OA 1KQSR 2R2SA 1M5VC 2B5JB 2OAUA 4BDPA 2VPWB 3QNWB 3HO1A 1PO6A 1N88A 2ZH5A 2G4BA 1HNIA 2FJAB 2B7CB 3GYNA 4J9SA 1XR6A 4EU0A 2EFGA 3KK3B 1OYDA 3Q2SC 3MD1A 4CM0A 2JFDA 3HHEA 4B3MF 2BRLA 4OLOA 1UWBA 4HHUA 4ECVA 2HBRB 2XTCA 4X4VA 1B0TA 1X7VA 4IG0B 3KLHA 3DU5A 4O4GA 3AWRA 2RDIA 2BJ7A 4NZ0A 5KT3A 4IOCQ 5ETTA 3DLHA 2CQCA 2ZE2B 4XDCA 2JHEA 4Z37A 1VGYA 1UVJA 2J6SA 4G1QA 4J9NA 1VHFA 2VG7A 3HHNB 3ENVA 1G1XA 3N5FA 2GFFA 3DLKA 3PYDA 2JEGA 5A0YA 4X65J 2VIHA 1QVGR 4PQAA 3QGIA 5B7WA 3OTOF 3FMBA 2ADLA 3HSZA 3CCZA 4A8WA 3SZ2A 2XMKA 2JJ4D 5AXMA 3BEGB 4IFYB 3SXLA 2ZBIA 1N5YA 2CQ2A 4OMFG 2FZCB 3VEAA 1ZAVA 2H51B 4RUAA 3T3FA 1S9FA 2HVHA 1EETA 2HURA 4USKA 4PQUA 3C14A 1TP7A 2M3DA 4DX8H 3PXGa 3KLVA 2V9KA 1QJHA 3VAJA 2BM0A 4DCOB 2QSFA 4G1PA 1T9UA 5ETNA 4XO0A 3V6DA 1B4SA 4DF4A 3D6HB 2DGQA 3CC2S 1T03B 3W63A 2N3OA 1GAOA 3ZZTA 2F4VF 2C28A 2WSFC 2HQGA 2WBRA 1RABB 1R0BG 2BSQE 2HAFA 1E6YA 4JI3F 4OX7A 1FNOA 3RW7A 2JBVA 4DZDA 5F0WA 4DSKA 4FN5A 1TQLA 3U7JA 3BBBA 1H72C 4ZMMA 3IWLA 1W26A 1VLOA 2RRAA 3G9CA 2JH3A 3GQCA 3WC0A 2AJ0A 2FHJD 5GAGU 8AT1B 5LJ3Y 1APSA 2M52A 4JV2A 1CULB 1IXKA 2I2YA 2ZH8A 3M1VB 4QIFA 1QE1B 1ZZFA 3C16B 1C0TA 1C4AA 3CPWR 1EARA 1ITPA 1FKOA 4DX5A 2YNIB 1XEZA 4OX6A 2QA1A 2PI4A 2XS5A 2BANA 3UDCA 3OHBA 3CSKA 4DQRA 2PFDA 2OPQB 1UEUA 4ICLA 1H2VZ 1ZOTA 1FE4A 1E6VA 3CEDA 2XBPA 3A1YG 1VHIA 3OSNA 4UOFA 2FHJA 2B4PA 4YB1P 3KUEA 2GX8A 3PYGA 1S1VA 4USJC 1VC6A 2FVPA 2OMOA 3DRPA 4BBYA 4NLPA 1GK8A 2J6UA 2HHQA 2K3IA 3MGJA 1EQ0A 2L9WA 2IA6A 4MIWA 3VR1A 3UDVA 1S6UA 5A8WA 4AXIA 4TYAA 2C2OB 4MK8A 1PJ5A 3MOZA 2JXHA 2YNHA 1X4BA 3F44A 1SQFA 1DY3A 4QWCA 3AA8A 3KK1A 3NY0A 3RBDA 1N32F 4IO1A 4C98A 2VZ9A 1UFKA 4WYLA 3OW2R 4J90A 4MKBA 4DV7F 2KFNA 4NL5A 4ETZA 1MWQA 2B56A 4OYIA 3OL7A 3AHPA 3BO3A 4LFAJ 2P9GA 5EWEA 3O8WA 2HLTA 4I6YA 1WOOA 3W7BA 4OHYA 4FVMA 3DXBA 1RT3B 4CO3A 2B51A 1NLAA 4YHHJ 1TK8A 1VJQA 1TL7B 3DDIA 1T11A 2OEMA 2Q2KA 1IBLF 4JI2J 4UUWA 3W8PA 1L3TA 5LMNF 4I7FB 4J9VA 2RILA 3G2XA 1U9PA 1S79A 5D0HA 3MR2A 2ZD1A 1NXIA 3I6PA 1S12A 1M0SA 4U8VA 4N77A 2C3MA 2M0GB 3M6VA 3QGGA 1KFDA 1OQ3A 1HNIB 4EBEA 5DDOC 4ER8A 2BW7A 3W64A 2GVDA 2PDAA 3HDSA 3I9ZA 1JIHA 1UWBB 3H4DA 3GR1A 3TVYA 3MEKA 5IC4B 3KLHB 1HNZJ 4O4GB 1K0VA 4TLRA 3CJTA 4JI4F 3JS9A 1K0TA 1FRKA 3CJKA 2ZZTA 3HPOA 4G1QB 3BBFA 1S1WA 1YQHA 2YPZA 1FJGF 2VG7B 5FJ4A 4WFZA 5C7PA 3DLKB 4CLKA 1XNRJ 5L39A 5A0YB 1U2FA 2HZAA 2WRMA 3HSJA 2P8IA 4ED2A 3UNGC 3BSOA 2J9CA 3H2LA 4K4UA 3D3BJ 2HFUA 2KKHA 3I4HX 2GW8A 6AT1B 1N4LA 4XAKA 4F2RA 4LRVA 1XIQA 1N5YB 5DQGA 5J2MA 2BE2A 3HSGA 4QPXA 4YY3J 1EETB 4PQUB 3C14B 1KLNA 4BHQA 4NI2A 3QBCA 1RT1A 3H59A 4LF4J 1KQFB 1SIZA 5H9EK 1BDVA 4JI7F 3SDEA 3SSSA 1Q8BA 4NCAA 4NRUA 2KB2A 1NK4A 3CCLS 1RU2A 4HR2A 1XTZA 4LBPA 3NGDA 2R7QA 1D8ZA 3TVZA 2RMLA 2A6OA 1WHVA 4FF4A 1YK9A 3N9UC 2QYGA 5CH7B 4JYAF 3OFEA 2HVDA 2AD9A 4DV1J 4LRFA 3MPUB 1UFLA 4WCEQ 3QJPA 3M6WA 3TP2A 3DLLQ 2E1RA 2AU0A 1TMMA 3M2RA 1RLDA 4LFCF 4NZ7A 2W8KA 2F4FA 3PYEA 4F4KA 4DPWA 1WC1A 1S0OA 2QE5A 2PE8A 4ZJLA 2K29A 4B3SJ 4ZP7A 4TN2A 3FBFA 5F8IA 2XI2A 3M7VA 5HP1B 2B6AA 1KBRA 1U2CA 1YJRA 1VC5A 3GIIA 4LIWA 5T14A 4C4WA 5EGYA 4L73A 3OFGA 2VG6A 2HG4A 4C3MA 2PT0A 1C0TB 3N6NA 2I1RA 1FKOB 1RUSA 3LPYA 1XR7A 4DQPA 4F4AA 3NWGA 2ILYA 1QSLA 1X4FA 2LXIA 1U2RA 1XMQJ 3MWBA 2BANB 1NPPA 1MN7A 1TAQA 3GIRA 4LF5F 1S49A 4CLZA 1SKUB 2V69A 3N28A 4CDIA 3V4MA 1VQ8S 1HFEL 3OLBA 4ZP6A 1WTFA 4DPTA 4ICLB 3BH7B 3TX0A 3GG1A 1RHRB 1E6VB 2OKQA 3WX4A 3M9NB 2XTEA 4X62J 4F67A 3EVOA 2I9SA 1WC4A 3JAMU 4X84A 5L1IA 3AJDA 4KRWA 3NGUA 4EZ6A 2O01C 2ZH9A 1K8AT 3DRPB 4B9MA 4C97A 3V6JA 3DNCA 2V8VA 3WX8A 2MKKA 1A0OB 3DC2A 3CCWA 1P8GA 2QL9B 3CJ0A 5A8WB 1JXLA 3EZUA 2DB1A 4M95A 3IWXA 2FC9A 4DV3J 3RW6A 3W9JA 4Q45A 1NNDA 2ZUAA 1C1BB 3EUNA 5HQ8A 1MYKA 3HF5A 2FVCA 3KK1B 1T94A 1JLGA 2HBYB 4OV6A 2DXEA 4KPCA 3RRGA 4ED6A 3MMCA 2W9AA 3EPIA 4K2XA 5ITHA 3A8EA 4OHWA 4Q8FA 4ECXA 4L75A 4DL0C 1ACMB 4JI8F 1PSDA 4UW2A 3NGTA 1IBKJ 5DLFA 4MYTA 4Q5VA 2HHPA 2OFGX 1QLNA 2N82B 4FXVA 5KFOA 2R2TA 3HULA 2KRRA 4DS5A 2MJUA 4C3KA 1WG4A 3V5RA 3FKBA 4F02A 1MMDA 3L09A 5F8NA 4N8NA 4NMLA 3KHGA 3D2WA 3MFIA 1SKWA 3BO4A 3NCPA 1YRUA 2HHSA 3OFHA 1SJ4P 4N8OA 2G1HA 4CWBA 4BC9A 1RDRA 5B0DA 3CCUS 3UCZP 3UO0A 3R6LB 2UUCJ 2GVDB 5GADI 1FNXH 5K8OA 3GYXB 1XC9A 1UPMB 2E1CA 2ZH6A 1AROP 2G0IA 3T6JA 4Q2LA 3SCLE 2J9EA 4FKXA 3TWZA 4ED8A 3E51A 3HMJG 1T95A 2ZKUA 5D15A 1FFWB 1RJJA 2DPIA 3MM8B 2Z57B 2KFZA 5KFBA 4ZPVR 2LXFA 1K44A 2BR0A 1UVKA 5HMZA 2BYCA 1JLBB 2UXDJ 3CJKB 5GAHU 4X4RA 1S1WB 3HHDA 1RBAA 2HNZA 1X4DA 2AHOB 2Q79A 3CULA 1JLFB 2E5IA 1UA1A 1GNKA 3DLBA 1WG5A 3WQPA 5CCMA 4C8KA 2W2QP 2ZBRA 4TKTA 3AODA 4NA3A 4UQTA 5IV3A 4ZJOA 4EZ9A 1FKAF 1XNQF 3D0IE 5J2MB 3FRYA 5KFQA 1YJ7A 2Q6BA 4ZVUB 3AT1B 4NI2B 1RT1B 1FVSA 1NSKL 5MLCV 4D3GA 3SDEB 2YWKA 2CAJA 3QQCD 5KFJA 2XCPA 1B3TA 4M5KA 2APOA 3W5XA 1Q53A 2CPEA 1VIOA 1RT7A 1EZZB 4F0KA 3OTCA 2ZHOA 3K5PA 2G13A 3MDFA 2XMAA 5HSPA 4WU3A 2LVWA 3M2RB 4USMA 1CG2A 3P5TL 4RW4A 1RADB 4F25A 3FZBA 2DNOA 2YH1A 4JI0J 1T02A 2EWHA 2Z0GA 2IM2A 2YKMB 4PPDA 4P74A 2GNKA 3BJYA 2UUAF 5AJ3J 2F3JA 2R4FA 5LSOA 4USWA 2B6AB 2J8AA 3VVTA 2CJ9A 1YGYA 4F4ZA 5K5MA 1WHYA 2X7IA 2VG6B 1FTCA 4ZVHA 2BQ3A 3UDLA 5F41A 4DQIA 2RD5C 4LQ9A 3VQTA 3ILJA 1QDUB 2MSTA 1YJWS 5A6PA 5GADU 1D3WA 1NJXA 1H2UX 4C3LA 1EA4A 4RBTA 1ZM9A 4NLGA 3THVA 2K9IA 5IC6B 2R8IA 3G5OA 1REGX 3SEOA 4KIAA 2W9BA 3KLEA 1R43A 5KFGA 2Z4PA 2H3AA 3E3XA 1PC5A 4HDHA 4ES2A 1HI1A 3AB4B 4KQZA 1CJKA 1U1RA 3PW4A 1FDBA 2NUUG 1JXEA 2IMOA 2D9PA 2CA9A 4R25A 4Y2MA 2VG5A 2FGOA 4CLYA 3A8JA 2DNKA 2J7WA 4E98A 4I1TA 4Q0BA 4M8LA 4NPOA 4QU7A 2AKWB 1JLGB 1Q5VA 2FGCA 2CQDA 1VMBA 3NGRA 1AYEA 3NNAA 1DARA 3MMCB 2MLYA 4IH6A 4KE5A 2CQHA 1RWKB 1CS4A 3DLGB 3PKMA 2YX1A 2VDHA 1WDTA 2QFJA 4Z7YA 2MQNA 1N33J 1R89A 4EYHB 1JLQB 4EBCA 4DS4A 4NLDA 1BAZA 2DKOB 3ITHA 3J81Y 2DEIA 4B08A 3L3CA 2PA8D 3EXYA 2GVZA 1NK0A 3M2VA 1B0PA 3VVUA 2J7UA 1MROA 5J1EA 3QRRA 1AB8A 1YKWA 2XWYA 3PX6A 1RHKB 5A6WA 3WIVA 3CDAA 1ZA2B 2FJEB 1M1GA 1RKIA 3TAMA 2JLGA 3M2UA 2NXEA 4ZVQB 3ZTSA 1I94F 3V81A 3PCOB 4DUZF 1K1SA 2R7VA 5T7LA 3QZ8A 2N7YA 3IS9A 3E01B 4OYXA 3JSMA 2C1EB 1YJTA 4NEZA 2XHCA 3UVJB 2XSJA 3TUJC 1BQMA 4ITSA 3QLHA 1U7LA 3I0SA 4U7UD 3RBEA 3M30B 5F3ZA 5AE1A 4I6WA 2EI5A 4LR7A 4C0HA 5AE2A 3I56S 3BYPA 1X0PA 1FERA 3R9LA 1IKXA 2VFTA 4WE1B 5J2QA 3SI8A 4E2FB 4MKAA 1NJWA 1KS2A 4JI6F 1HWIA 3FDSA 2V34A 2HRYA 4OQJA 3OHAA 4I68A 4ZLJA 4XIUA 5DETA 3KOAA 4I0WA 2F8MA 1Y10A 4FVCA 2ZDOA 4PG4A 3TOQA 4U7UK 2KVQE 5I42A 1AA1B 2E66A 2CG4A 1OQ6A 1X93A 2RRBA 3QGPA 4A4JA 5HQMA 4Y3CA 4WU2A 3PX0A 4NLSA 4DPUA 1JJHA 4QR2A 3OXFA 3TVKA 4LR8A 1LWEA 4ECSA 1YHQS 1B64A 4Z7CA 5KFLA 4NLVA 5K8MA 2BOPA 2XM3A 2VPYB 2QLFB 4QU6A 3D7SB 2VPXB 4I2QA 4ECQA 2BE9B 3BGRA 3GMGA 2MSSA 2ROPA 2MQLA 1RT7B 3FUYA 1HMVB 3M6UA 3GJTB 2YKPA 1HWJA 2DHGA 2HRTA 4NLWA 4JI1J 4ILRA 2AYBA 1NPRA 1LK5A 1JK9B 2MZJA 2VA3A 3T1HJ 4RW4B 3TA1A 4DFPA 4ZPWR 1OPZA 2MMYA 4Y34A 2HVZA 3EICA 3H7HB 3PTWA 1HIYA 1NH8A 3TO8A 3VCDA 3D1HA 3I87A 1TKTB 1NJZA 2ASJA 4U6PA 1HHSA 2JNJA 3W65A 1OPIA 3KG1A 2V2KA 3HP6A 6FD1A 1F1BB 4MJWA 1NLKL 5KFMA 4LF2A 1WC5A 1X0FA 3AD9C 4JI5J 2RQCA 3RYLA 2LQBA 1NDKA 2ROEA 2KG1A 3KMQA 4JV1A 3IBWA 2IFXA 3HZGA 3P96A 2HK2A 3VEBA 3MURP 1YBUA 1YIJS 4PWDB 4DL4A 4I6AA 5HBMA 4LQ3A 2QSWA 3S8SA 1M1HA 3KLEB 1IM4A 1HARA 1DURA 1DJ0A 4NYOA 1U26A 3Q8YA 1CJKB 1KRPA 2BVZA 3EGVA 3JSRA 2IM3A 1CPZA 3NBPA 4A47A 2VG5B 3KDNA 3GYGA 2YX7A 3KNAA 3RB4A 1S6PB 4OI4A 2NYIA 2EFQA 1TFWA 4DJBA 4Q0BB 5E3AA 1OSCA 4F3MA 5DM7Q 1WF1A 4KBIA 3AJ2A 1URNA 3VGUA 2KH9A 3TR5A 1LFPA 4X4PA 1TELA 2L9NA 4A8XA 2WW8A 4UZCA 2VPZB 1WC0A 5DS7A 1CS4B 3CC4S 1WHWA 2GIFA 2F63A 4CLTA 4ZPCA 3GP9A 1VDHA 2DEJA 4ZVRB 1QVFR 1IR2A 4ERDA 5ADZA 3IG1A 4UOCA 2DVIA 2IJNA 2WHOA 1FWPA 1MSWD 5C24A 2BJDA 2GVZB 4HVZA 3M2VB 1FF2A 1MROB 2AJFE 3MUMP 3MECA 2H4WB 5EWFA 1KHVA 2HHHF 1OO0B 1D9FA 3MZIA 4KAIA 2F4VJ 1WORA 3TAMB 3TJ8A 3M2UB 2BJ9A 3C8YA 1WKLA 4TY9A 3V81B 1Z4UA 5ETKA 1UVMA 2JEJA 4JI3J 5T7LB 4L6V3 4V19J 4G1IA 1KDNA 2DXFA 3IS9B 3JSMB 2XSJB 1FRXA 1FRLA 2FYXA 3DRRA 4G3IA 2KHDA 3QLHB 3I0SB 1NB7A 1KNZA 1QM9A 2Y1RI 1RTIA 3G6ES 3PKYA 2KFYA 2UUBF 4YHHF 2M9KA 4X4SA 3H42A 1DHMA 1Z2ZA 1F5AA 1AT1B 1N5SA 3H2VE 5J2QB 1NDPA 4IRKA 3P3DA 2ZBCA 4DR2J 5KFSA 4ID5A 5RUBA 2HSEB 1RTZA 4MIBA 3UR3C 1XQIA 3DHXA 3OT9A 4YUDA 1UA0A 4KC5A 5D4PA 3RG6A 4ES1A 4CM2A 3BGFA 3BM7A 2XMWA 4PWWA 1XMOF 4Y2IA 2ZH1A 2NLWA 3CDBA 5EWGA 4AYBD 3LQVA 3D54A 3CCES 4I64A 3Q0AA 2HKEA 4FS1A 1HNZF 1P94A 1X4EA 1LWEB 4QIVA 5LMUJ 2K1OA 1G4CA 2ZITA 3C3LA 4PRFA 2ZUGA 1YJUA 2QMXA 3FCVA 4OZNA 2RU3A 4I2QB 2YNGA 4RPFA 4PAAA 2VASA 1XNRF 4USHA 1J27A 3HLUA 1EX8A 2DK2A 1HQUA 2QLXA 2KRBA 5FIIA 4LF9F 4J9RA 5D4LA 2KKEA 1XMBA 2P6TA 2VH7A 1SJ3P 3PV8A 1HBMB 4V19X 1L3VA 1B01A 5B0CA 4DV7J 4YY3F 2FJXA 2G2YA 3VWSA 3JXOA 3GIKA 3HVTA 1REVA 1C2PA 2B9XA 4LF4F 1I51B 3FZ2A 2DH9A 4S0MA 4PG5A 2VBXA 3V2UC 2IVMA 4RKUC 1EKSA 4UY85 2BA9A 1JKHB 2L41A 2R8HA 1FD2A 1XR5A 5FDLA 4K4ZA 4CH1A 4YDDB 3GILA 2D68A 3OL8A 3DRSB 2B3TB 4DL2A 3I5CA 1IKYA 4DV1F 1IBLJ 1FHTA 2KDOA 2QFIA 2DNRA 1CVJA 4M1KA 5LMNJ 5MAOA 3OBIA 2WW4A 3KK2A 2XTDA 1H38A 3RTVA 1BD6A 3QSYB 2R42A 1U47A 3RJMB 2XZ2A 2HAIA 3TW0A 5LSRA 3W3SA 4WYWA 4U67Q 4R5PA 1NRKA 1ZAWA 2F8EX 2WCXA 3SQOP 3NOGA 3W2VB 5KTQA 4F4WA 4DV0F 2V4JB 3FEYB 2KJWA 5IZHA 3K59A 2XS7A 2C2RA 3OV7A 3F41A 3NBPB 3UDEA 2AX1A 1XJWB 1FESA 2JSXA 3C15A 5F8JA 3AX3A 2O66A 2MKIA 3KMSA 1RT2B 5DGAA 1JLEA 2O3DA 6FDRA 3EMTA 3HVAA 1HBOA 4UOHA 4DX6A 1RWMB 1RAAB 2JVRA 2NPFA 4P72A 4DR3F 4TY8A 3C66A 3PW5A 4X62F 1QAJA 3UR0A 2DRBA 2R3VA 4HH1A 1YDLA 1U8WA 2RSQA 2M7SA 3TARA 3MR5A 3IG1B 3RRHA 4UUXA 1UVLA 1NZ8A 2CPXA 1W2IA 5C24B 2QA4G 3MM5A 4PUOA 1U1PA 3CJQA 4PZVA 1FWKA 3M9MB 1Q1KA 3R5JB 3MECB 1OMSA 3MCSA 2E1MC 2VONA 4GRSA 4DV3F 1H0HB 4MJKA 4KHRA 2BKPA 3BS9A 1HNWF 3HKWA 4CO2A 1SKSA 3S7RA 3ZZYA 2Z30B 4JYAJ 1FRJA 3HHKA 3KUHA 2WAQD 2A18A 2CUYA 1VOMA 2GPEA 3HHLD 4UF4A 3DRRB 2LLZA 1NKEA 1ZZNA 4LFCJ 1MNEA 4ZCIA 5GMDA 9RUBA 1HLWA 3MR3A 1RTIB 1SJQA 1MU2A 3Q83A 3K5NA 1N52B 5K9FA 4DR7J 3DOLA 4RW9A 1NDCA 2ZBPA 2OELA 3CE8A 1YJ9S 1NUEA 2B43A 1TZ0A 1IQTA 2GQCA 3A3NB 4F0HA 2FDNA 1F5CA 3A3OB 2N7CA 1OSDA 1IR0A 1WF2A 2CYYA 4K4VA 4ID5B 3BKTA 4QPTA 5FD1A 2D1CA 1S0NA 1WEXA 3QMQA 3GIJA 1IBMJ 2XTJP 1RAFB 1V5IB 2IDEA 4ECTA 1S1XA 4AUKA 2JEIA 4DI6A 2HHXA 2E7VA 2CQ3A 4ILLA 3R5GA 2GAHC 5L46A 4ZHRA 2VFRA 1V3RA 3RBZA 4OJ1A 3PR4A 1RTHA 4ZN3A 2VU5A 2C3OA 4LF5J 1DQAA 3DGPA 2ZOMA 1TKZA 2V1SA 3IO1A 1VBZA 5JXSA 2DNHA 3UN5A 4CLUA 3MM7A 3R5CA 3GTYX 2HK3A 3LALA 3EGWB 2PA3A 3M32B 2E44A 4IO9Q 5KFKA 4ZITA 3PJWA 4QWAA 1YZ6A 3EYZA 1S7IA 2CPDA 1WD6A 4IQXA 1ARRA 3IFEA 1RAGB 3NGSA 2D69A 2YNGB 1SC4B 5JJBA 2XLJA 1YITS 5L9NA 1NB2A 1HQUB 2JL9A 1NEEA 3ZNJ1 2FVRA 4DFKA 3GFHA 4CNZA 5AT1B 3N79A 3H25A 1PCAA 5GMEA 5C25A 3H40A 2RHQB 3QWUA 1WNEA 1NHKL 1GTHA 2JC0A 2AYMA 2A2CA 2RKIA 2BABA 2KXHA 2CPGA 1IQZA 4QR1A 3FNNA 5D0RA 1HR0F 4IR1A 2GIQA 3FFIB 3HVTB 3W60A 2DNMA 2YKNA 5L1LA 3GSIA 3M8SA 1U6FA 1UW4A 2KT3A 3CF5Q 2DR6A 2QN6B 1YSJA 4PPZA 4DCJB 3J7AN 1RBOB 3ENQA 3LP2A 3PW7A 1IRQA 4ID8A 5FDLB 4ZK7M 2DGXA 3VQSA 1UJ4A 2JZ5A 1PC4A 1URRA 2IRYA 3PRBA 4R8UA 3R97A 2CNKB 1IKYB 1I3OB 3QRPA 3TZZA 1GEHA 3AQOA 1Y3KA 4M5JA 2WSEC 5DDQC 3KK2B 2AZ1A 1NJIT 1N48A 2ASLA 2AIRB 3P6YC 1TKXA 2I6WA 2RRNA 5HMWA 4CO0A 4RW8A 2BA3A 1KN6A 5DGBA 2FHMA 1WSVA 4R5PB 5D8HB 1IWAA 3R7SB 1BGXT 3UW1A 4ZPAA 2D3O1 1CJTA 4JV5J 1L3SA 4P6QA 3ET6A 4NEYA 4YS2A 4RNHA 2G2ZA 5E3QA 2FVSA 3KG0A 3BSNA 4J9MA 1M5PC 4LSLA 1B99A 3C15B 2BJ3A 4DU7A 3K8WA 2BV3A 2B9WA 3QT6A 4K5RA 4ATNA 4LSZB 4CLFA 1SH2A 5I3PA 3PY8A 2J76E 1JLEB 2PMHA 3VAKA 2LEBA 4NLXA 2BE7D 5ETPA 1HBOB 3B4MA 3BQ1A 5BYSA 2IMWP 1NKBA 3TAPA 1RE1B 5H1SV 4DR1F 4B9NA 4L3NA 2H4YB 1Q16A 4F50A 5CA5A 4TY8B 3LOUA 1Q82T 5EN1A 2XCAA 2W4PA 5IT4A 2UXCJ 1RAEB 1KOOA 4F0MA 1Z2LA 5LXRA 2E1AA 2G2OA 4O3RA 1LWXA 1HWUA 1U09A 3U27A 3DOMA 1U0SA 5LJ5Y 5D4NA 2UU9F 3RR8A 1PBUA 2V4QA 2BNZA 3MM5B 4PUOB 1Y3JA 4RNNA 3DFEA 4U95A 3HXMA 2BW2A 1F9EB 2LFVA 5CXTA 3EE3A 2HNDA 4C8OA 3KJVB 5DDPC 3OXGA 4LREA 4X4OA 3MXHP 1VQMS 2KVIA 2HEKA 1N34F 1YX2A 3DKDA 2KM8C 2XG8A 2QC3A 5AXNA 2WBMA 1ELOA 3SBMA 1NK5A 2UV8G 4IFYA 1N33F 2R8JA 3AQPA 1MU2B 5ETLA 3DOLB 1SQGA 2BOAA 2UUAJ 3SSRA 4LFBF 3UWTA 3PHTA 1H74A 1S5ZA 1YI2S 4M5LA 4W90B 3Q2TC 2CDQA 3D68A 2MLZA 2W8LA 4PG6A 2RQMA 2DR9A 5DZ6A 1S1XB 1T9YA 1C4CA 2MHNA 2H5IB 4TQSA 2M8HA 3MPYA 2DGWA 1IJFB 4ZHRB 1MLAA 3G82A 1NO8A 2RH3A 2BRKA 2CQPA 2DIUA 5HI7A 1JNRB 4X4TA 1RTHB 2PI5A 1MMNA 3DGPB 3TQEA 5ETOA 4FBUA 1TKZB 2V5HG 1CSJA 3IRWP 3KTQA 1M5SA 1HNXJ 2PN6A 3MM7B 3O6QA 3MPWA 3UD5A 4NXNJ 3CJ8A 2C2NA 4QW9A 1VRUA 2MQQA 3AFGA 1Y11A 5IT9U 2LCWA 4LF8F 2BKNA 1EHWA 2X3GA 3J80Y 1XK8A 4NXMJ 3HJFA 1T0TV 3IR7A 5M2UA 1U1QA 1KQGB 3LPEA 4N7TA 4XDDA 3MI7X 5E41A 4KY3A 4QIWD 5F3TA 1LW2A 1TU0B 5AXKA 4L74A 1S97A 5E3CA 4CIOA 1X5OA 3SCIE 2ALZA 2NZCA 3B78A 5C25B 4M63A 3CVKA 2IRXA 4OJ3A 1F9FA 4RZRA 2J0QD 3I9V9 2Z2LA 2I38A 3SCJE 4Q2MA 1NU4A 2WB1D 1U1MA 2RKIB 4A46A 2M88A 4QIGA 5KAKA 2MHEA 3TANA 1R7IA 2JXGA 2EVZA 4FF3A 5F9LA 2NSBA 4RU2A 1IKWA 3LP2B 5L8RC 4LVNP 1TL1B 2XMUA 4DPXA 2ZC3A 4R8UB 3CCMS 2E7XA 2XZTB 1RTDA 4FNIA 4RW7A 3PW0A 1UUJA 2VHGA 4ZVFA 5CYJA 1HWLA 3QO9B 4JI1F 1DFDA 1KR4A 4ANCA 3QT8A 3RB3A 1U0HA 4DR6J 2ZKTA 3H5UA 3IBFB 3G6VA 3T1HF 1GMUA 3K0JA 2VQFJ 1I94J 4RW8B 4U9RA 4U8YA 3TRGA 4HH0A 2J9DA 4QWEA 2X51A 4M94A 4WZQA 4P7TA 1HD0A 4IUFA 1CJTB 1MNTA 3TEHB 2CFXA 4P75A 2AYGA 1Q5YA 1N0VC 3WBZA 5K8NA 4RUCA 3KHRA 1UJ5A 5HMXA 2E5HA 3N6MA 5HO4A 2VL1A 1SPBP 4C8LA 3QT5A 4B3RF 1I5OB 3EX7B 2ZZMA 4ALZA 3W5YA 3N01A 3IAS9 1X4AA 4O3QA 2AJ2A 1VCTA 2VV5A 2AGQA 1VK3A 1FWLA 4JI6J 4I7FA 2DNYA 4JI5F 2MQOA 2DISA 1HL6A 1R3NA 1JJCB 2X1FA 4KPYA 2ZJPQ 3FBEA 4XK8C 4DWIA 2HFVA 1Q16B 2OUGA 2FVQA 2PGCA 2FZKB 1PKUA 1H7XA 3OVBA 3HKZD 1WI6A 4ZPBA 1FFSB 3KYLA 2D3ZA 4ZCMA 2WONB 5ETRA 1UKUA 1GXUA 1ZH5A 3QAEA 5KT5A 4WBFA 3GJSB 4Y0FA 2DGUA 3DOMB 2HHTA 3H87C 2OGUA 3PRVA 3PZPA 3NS6A 1KD1T 3UN2A 4OX9F 3CDEA 3O44A 2HNDB 2RF2A 1X9SA 3Q8PB 2KN4A 2ZOGA 3NG8A 5DLGA 5E0OA 3VW4A 2QA2A 5J2PA 4GC7A 2ZHAA 3QSIA 2VFUA 3IN5A 3QWPA 2V8DA 3W62A 3GCWP 3D67A 4ZVGA 2Z8QA 1EP4B 1UZDA 2BKOA 3QIPA 4Q44A 1MMLA 5D4OA 2K6LA 4LF6F 1IKVA 1H7WA 3KJFB 4C0BA 2OPSB 3I5BA 1Q4RA 4NLTA 2W24A 5DZ7A 2UP1A 1FX4A 1RWNB 2P9CA 2HYIB 1D9AA 3DM2A 3CCSS 5KT7A 4MH8A 4OYMA 3TA0A 3T41A 4LRBA 1R6VA 3G82B 2RQKA 1SC1B 3TUIC 2V8PA 3KHLA 2HWTA 4DFJA 2NQPA 3D1QA 1NPKA 2CWXA 3R2CJ 3LP0A 4ELUA 2EW9A 2ZH2A 2FIUA 1FRHA 2QJ3A 3JTPA 3R5AA 1HD1A 1TTHB 1VRUB 2YWFA 4CT8A 1KSPA 2E9RX 3DHWC 3R5BA 3FMTA 4EEYA 2RQ4A 2VJUA 4K4WA 3BN4A 5HP1A 4DR2F 3IR7B 4KFBA 3Q8RB 2E1PA 3OTBA 5K8PA 2AT1B 3MAAB 3KFWX 5BJRA 1LW2B 1XN9A 4CTAB 3L7UA 3BQ0A 3FRZA 2Y8WA 3GZ7A 2DJWA 1FXRA 2E9ZA 1FTRA 3BKUA 2XGQA 3K8VA 1VBXA 3J7ZT 3OPKA 4KKOA 4CO5A 1T9TA 1TMJA 3THPA 2BQUA 1OIAA 3SFUA 1Q81T 4ILMA 5HROB 4UTGA 5CAAA 3OXLA 4K4XA 5F8HA 2ZM6J 3RU0A 4NLOA 2WVFA 2GMHA 5LMUF 3VZHA 3HVWA 2L3MA 2IY5B 1BC6A 1IKWB 4DLEA 1NK6A 4TU7A 1RTDB 4RW7B 4H4MB 4NYZA 1LXNA 2A0FB 4WTOB 4RNMA 3NAIA 2IYGA 2C3PA 3LP1A 2XB2D 2H5JB 3JQMA 3CCJS 2BACA 4GMKA 3H8YA 3IR6B 1SXLA 4PYAA 1U45A 1R8HA 2C3UA 1P1LA 2HHHJ 3POTA 5HANA 1C1BA 2FC8A 1U0HB 1OY8A 1OG7A 3FCWA 1S6QB 4J9LA 4I67A 3GCXP 2DNPA 3LO3A 3H20A 3UPFA 4DHVA 1IWGA 2MZRA 1RAJA 3GE9A 4BCAA 4YOEA 3CD6S 5IWAJ 1RT6A 1NSQA 1VI7A 3SYZA 1LQ9A 4C2MA 2HWIA 4FNHA 3NRBA 2VC0A 4FF2A 1S9EA 2UUBJ 1FDAA 3OVAA 1F60B 3NL0A 1BHNA 2MLXA 2EEYA 2Q6CA 2FJVA 4CT9A 4EYIB 3HT3A 4TLQA 3D0GE 4DR4F 3K7RA 4DZ6A 1JJ2R 1HHQA 2W2PP 3KJQB 2NR0A 4DSIA 4DPOA 1KVJA 1QAYA 4IH7A 1PARA 1RU1A 2AGOA 2NZ4A 1UEVA 1M5KC 2HVEA 1Y9OA 4IFVA 1TV6A 3RAXA 1GFWB 5IV4A 2LA4A 3DLJA 1XMOJ 3PO4A 4CRJA 3M8YA 2LQ5A 1O6XA 5B0EA 1RP5A 3LAKA 4FF1A 4NLQA 2AEMA 3BB5A 4KR0B 3GFXA 3VGSA 2J6TA
chains in the Genus database with same CATH topology
2EFNA 3SSQA 2QRRA 2ZJQQ 1NK7A 4X2BA 2WW8A 2GGPA 4RW6B 2NUHA 2VPZB 3TUZC 1O51A 3MM8A 1JLCA 4RWWA 4X66F 4AQYF 2DCUB 2AJQA 2PFFB 3ICLA 4JBCA 2K8GA 5KOWA 4IDKB 4BWMA 2FHOB 3US5A 5F0UA 5DS7A 3CC4S 3DRXA 2YKAA 1WHWA 1P27B 2IYIA 2UVRA 1YRXA 3V6HA 2HNYA 1U24A 2DR8A 4B9VA 1BLUA 4ZPCA 3ZZRA 4I2PA 1IJEB 2MXYA 1HNVA 4EUVA 1TKXB 3B82A 1JLBA 3RRKA 5HMYA 1QVFR 2D7SA 2RF2B 4ERDA 2CQIA 5ADZA 4OJGA 4KJIA 2MY8A 3IG1A 4I69A 4UOCA 2JEFA 2DVIA 2IJNA 3EGNA 2WHOA 3JYTA 1MSWD 5KFUA 5J2PB 1V9OA 3C6TB 2ZHBA 1LWCB 3O2IA 1JLFA 5C24A 1TK0A 2BJDA 5H9EJ 4NZ6A 4HVZA 3GV8B 3M2VB 4PXBA 5B0FA 2IM0A 3L7PA 4URGA 1FF2A 1MROB 2AJFE 4A8OA 5DQHA 2K2PA 3U1LA 3MUMP 3BO2A 2COLA 2LQ9A 1FEEA 5IFMA 3U1MA 3MECA 3JB9k 5C5JA 1X4GA 4B02A 2MZQA 1WEZA 1ZM2A 2CJBA 1KHVA 5EWFA 2HHHF 1OO0B 1D9FA 1RA7A 2CIMA 2P9EA 3MZIA 1YVFA 1RT3A 4C11B 4DV2F 3GFYA 3TA2A 4KAIA 1BY9A 3MTJA 2KT5A 4EBDA 2YH0A 3ENWA 4MFBA 3TAMB 3M2UB 2NREA 4LSLB 1O8BA 2GQ2A 1ZPWX 2VUGA 2M5YA 3C8YA 2XY5A 4DFMA 3QIPB 4TY9A 3V81B 1VQ6S 1Z4UA 2YWEA 2XNQA 5GAGI 1UVMA 2JEJA 1U6ZA 5T7LB 2QEXS 4WFBQ 4HI2A 4J37A 1IKVB 1VFJA 4L6V3 4V19J 1FEHA 4G1IA 4KGKA 2KYZA 2OSQA 3IS9B 3DXSX 4H54A 3JSMB 2YQ3A 2VB6A 1VRTA 4FXDA 1ZAXA 5G4DA 2XSJB 2I5JA 1BQXA 2DPJA 1FRXA 2WTFA 3I4PA 1FRLA 2MQMA 2HFZA 3DRRA 2Y1JA 4G3IA 1W25A 2KHDA 1S6OA 3KKFA 3QLHB 1UVIA 3I0SB 1NB7A 1KNZA 1QM9A 1KQSR 2R2SA 2XLIA 2Y1RI 1S99A 2W25A 1M5VC 1RTIA 1FNMA