4K4SA

Poliovirus polymerase elongation complex (r3_form)
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
462
structure length
462
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Structures of coxsackievirus, rhinovirus, and poliovirus polymerase elongation complexes solved by engineering RNA mediated crystal contacts.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 148
structure length 462
sequence length 462
chains with identical sequence E
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4k4sA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4k4sA02
5KT7A 4NLWA 1K1SA 1RT2A 3M8QB 4G1QB 4O3OA 3FDSA 3MEDB 5KG5A 3IN5A 4K4YA 1IKYB 2HNZA 3QZ8A 5DLFA 4ED0A 4K4TA 2HAIA 4RNFA 3IRXA 5KFFA 3GIJA 4EYIB 2IM2A 1T05B 1VRTB 2JEIA 3DLKB 4ZP6A 5DG9A 2ILYA 2VG5A 2FVRA 1JLCB 4O3PA 3RAQA 1SV5B 1TKXB 3QZ7A 1C2PA 4KFBB 4J9LA 1NHUA 4MFBA 4ED3A 2YNIB 3M8QA 4G1QA 3BJYA 1HPZB 3MEDA 1S48A 1IKYA 3DRPB 1TVRB 2FJVA 1DTTB 2GIRA 4R5PB 1T05A 4ECUA 1VRTA 4ZPAA 3DLKA 3QYYA 3G6XA 4DL2A 1LWCB 4ECYA 5KFWA 4B3OB 1IKXB 3LP1B 4YR2A 1JLBB 4QWEA 4F4ZA 2AGQA 5L1JA 1JLCA 4JV1A 1SV5A 1TKXA 3ICLA 3KK2B 3FSIA 4KO0B 1JX4A 4KFBA 3GV8B 4K4WA 3PW5A 2YNIA 4WFXA 2JLEA 3V81B 1HPZA 4TYAA 5F8LA 1NHVA 3H98A 4NLDA 3MTKA 4LSNB 2W8KA 3OL6A 1TVRA 1DTTA 4R5PA 2BQ3A 3OLAA 1S4FA 1S0OA 1LWCA 5DLGA 4RNMA 3KLEB 4B3OA 1IKXA 3LP1A 3CDEA 5F8MA 1JLBA 2R8IA 3KK2A 5F8HA 2D3ZA 4MIAA 3PW4A 1I6JA 4MKAA 4H54A 4MK7A 1ZETA 4Q8FA 4PWDB 4WZQA 4WFYA 1T03B 3T5LA 4LSNA 1S9FA 3GIMA 4QW8A 4NZ0A 3KLHB 2AX1A 3KLEA 1HNIB 4ZP8A 5KFDA 2QV6A 5J2QB 5EWFA 4WFZA 2VG7B 4YR3A 1RA7A 2RDJA 5KFYA 4J9RA 1JLQB 2B6AB 3T1AA 3V4IB 4Q43A 4PWDA 5KFOA 4O4RA 5KFQA 4XPEA 1T03A 1XR7A 2BE2B 2DPJA 3HHKA 3T5KA 5HBMB 3BREA 3KLHA 3CWJA 1J5OB 3G6YA 1HNIA 4DL6A 1BQMB 2YNGB 5J2QA 3GIKA 2VG7A 4WZMA 3PJWA 3TQ1A 4HKQA 3ISNC 1JLQA 4URSA 4WE1B 2B6AA 2J6SA 1TKZB 1MMLA 3V4IA 2UVVA 5FDLB 2WOMB 1S49A 4WYWA 3E01B 2BE2A 4ZHRB 5KFJA 5HBMA 3G6VA 4FBUA 4IR9A 1D0EA 2O5DA 1LW0B 4QPXA 4Y3CA 3OL7A 1J5OA 3NMAA 1XR5A 1BQMA 2YNGA 4TLRA 4EO6A 4GC7A 3NAIA 2BQRA 4R8UB 5KG2A 5JXSA 3MF5A 3KOAA 3QIPA 3D5MA 3LP2B 1S1VB 4WE1A 3M9MB 1TKZA 4M94A 1N4LA 5FDLA 1IM4A 2WOMA 4JV2A 3QO9B 4NLTA 3E01A 4ZHRA 4EYHB 2WONA 4IH6A 4YMEA 3Q8QB 3DLGB 1LW0A 3NAHA 1DTQB 1S6PB 4IRCA 4ZVHA 4KSEB 3RB0A 2ILZA 1NNDA 4U7CA 1RTIA 1HARA 5L9XA 1REVB 2AGPA 1TL3B 1S1VA 1EETB 3LP2A 1RT3B 3Q8RB 2ZD1B 4IDKB 5J1EB 4NLQA 1IKVB 1SH3A 4ED2A 3QO9A 3CJ0A 5KFPA 3IS9B 3DLGA 3H5XA 4KHRA 1DTQA 1RTHB 1S6PA 4Y2AA 3DI6B 4RW9B 4URQU 5KFEA 4ECRA 2JC0A 3KJVB 3BQ1A 4ECWA 3QIDA 2WRMA 3H59A 4ID5B 4IR1A 1REVA 3KNAA 5DQIA 1RTDB 1TL3A 1EETA 3MECB 1RT3A 4H4MB 4MK9A 2ZD1A 4IDKA 5J1EA 1IKVA 4F50A 4O3RA 2FLPA 1CSJA 4DL5A 2VG6B 2YNHB 3IS9A 5T14A 2OPRB 3KLVA 2I1RA 3DI6A 1RTHA 4ECVA 4RW9A 2YKMB 1SH0A 5KFUA 5KFVA 4J9PA 3OHBA 3KJVA 3CIZA 1C1BB 3MR3A 4ID5A 3KMSA 1N48A 3CDUA 4NCGB 3MEGB 2B43A 4IOBA 1TL1A 3MECA 4H4MA 3GILA 3RBEA 3OSNA 3FFIB 2C2EA 5L1KA 3BSNA 5D3GB 2VG6A 2XI3A 4KHMA 2YNHA 1BQNB 1IKWB 1JLAB 2OPRA 4F4XA 1HMVB 2YKMA 3ITHB 3HVAA 4K4SA 2IM1A 4ZPDA 4NYZA 3SFGA 1FK9A 5F9NA 2XCPA 2W9AA 1C1BA 2FLNA 5KFIA 2YNFB 4J9MA 4ECZA 3EZUA 5DQHA 1FKPB 5KFSA 2WTFA 4JV0A 3H4BA 4NCGA 3MEGA 4GC6A 3KLFB 1ZTWA 4O4GB 5KFXA 1JKHB 1RT5B 2OPQB 3GV5B 4IQXA 3FFIA 2XCAA 2IMWP 3M8PB 4ED8A 1DLOB 3GYNA 2UUTA 3Q8PB 2HMIB 2V9WA 5D3GA 4ECQA 1BQNA 1IKWA 1JLAA 3DOLB 3GQCA 1GX6A 5EWGA 1HMVA 4RUCA 1JLEB 3ITHA 5DGBA 3KHGA 4F4WA 5HP1B 1HNVB 2QE5A 2YNFA 4DEZA 2FJXA 1JLGB 2IAJB 1FKPA 5J2PB 1D1UA 1W25A 4RNNA 5I42B 2FVSA 3DLEB 3KLFA 1S97A 2XGQA 4O4GA 1JKHA 1RT5A 2OPQA 3NBPB 3V6KA 2CKWA 2WHOA 1S9GB 4IH5A 2AQ4A 3M8PA 1DLOA 1HQEB 3KLGB 1RA6A 3OL8A 2EC0A 4RW7B 2HMIA 2DPIA 3DOLA 2JC1A 1WNEA 4ZP7A 1JLEA 3EPGA 5HP1A 2IA6A 1HNVA 3M9OB 1JLFB 4TXSA 3KMQA 3ISND 3LALA 1JLGA 2IAJA 2OPPB 4XPCA 5J2PA 2IBKA 4IG0B 4RU9A 2R8HA 4J9SA 3DLEA 4U6PA 5I42A 3IGVA 1HYSB 4MIBA 1MU2B 4NLXA 3NBPA 5J2MA 1XR6A 3UQSA 1S9GA 3BSOA 3KLIB 4QWDA 5CYQB 3DRSB 3I5CA 1HQEA 3KLGA 4O3QA 2OPSB 4KB7A 4RW7A 5KG3A 3N6LA 4QW9A 3T5JA 5KT5A 3C6TB 5I3UB 4YR0A 4DL7A 2BRLA 2BANB 5DQGA 4YQWA 3E51A 1JXLA 3RB3A 3H5UA 4RW8B 3RB4A 3G86A 1EP4B 1JLFA 5EDWA 2BRKA 3CJ2A 3BQ0A 4EEYA 2OPPA 4IG0A 1HYSA 3NGDA 3RBDA 1S1WB 1MU2A 4EBCA 2J6UA 3QIPB 3KLIA 5CYQA 3DRSA 2UVRA 4IFVB 3LANA 5HLFB 2OPSA 1RTDA 3C6TA 3HVWA 5I3UA 2WONB 2BANA 4HYKA 4RW8A 1C1CB 3BGRB 1EP4A 1ZTTA 4LQ9A 1QAJA 4KKOB 1S1WA 5F8IA 1RTIB 2JEFA 1RTJB 3UDLA 2WCXA 3BSCA 4IFVA 2IJFA 5HLFA 4ICLB 4K4ZA 3CVKA 2FVQA 4XO0A 2E9TA 2W9BB 3BR9A 1C1CA 3BGRA 3KK3B 2AGOA 3PW7A 4IG3B 4Q0BB 4RW4B 1U09A 4KKOA 3OSPA 2R2SA 1UWBB 4KBIA 4TY9A 3NL0A 1S9EB 5KFZA 5KT2A 2AX0A 1RTJA 3T19A 5L1IA 1JIHA 2V0NA 4ICLA 4ZPBA 2W9BA 3DDKA 4ECTA 5KFAA 3KK3A 3I0SB 2IM3A 3SFUA 4IG3A 4X2BA 4RNOA 1LW2B 1LWEB 3IGNA 4RW4A 4Q0BA 1UWBA 1S9EA 2HWIA 3T5HA 3PZPA 1TL1B 2D3UA 2FVCA 5K14B 5C25B 4TQSA 1RT4B 2I5JB 4RNHA 3MFHA 2HWHA 4NLOA 1SH2A 4J9NA 4IRKA 1SUQB 1S1TB 3MR2A 4O3NA 2RKIB 3I0SA 4QWBA 1FK9B 1LW2A 1LWEA 4ZP9A 1C0TB 1TKTB 4KV8B 2HNDA 4TY8B 2C22A 4MKBA 4MK8A 4IH7A 2ASJA 3DOKB 4ED1A 1T94A 4WYLA 5L1LA 5K14A 5C25A 2C2DA 1RT4A 2I5JA 3BSAA 3HKWA 5HROB 4NLGA 2OH2A 4ECSA 3N6MA 1SUQA 1S1TA 4M95A 2B5JB 2RKIA 2J6TA 3MR6A 4Q45A 1K1QA 4NRTA 2R8KA 4DG1B 1C0TA 3MEEB 1TKTA 4KV8A 4TY8A 3PHEA 1RT7B 5KFKA 1N56A 5KFGA 2HNYB 4FS2A 5KFNA 3DOKA 4FS1A 2ASLA 4IRDA 4J9KA 4DL4A 3UR0A 4NLUA 1RDRA 1YVFA 5HROA 3GIIA 2BR0A 2R2RA 1QUVA 4K4UA 2RF2B 2B5JA 5KFTA 1S1UB 3PJXA 3BQ2A 4MH8A 2FLLA 3N6NA 4O3SA 4RUAA 4DG1A 3H5YA 3MEEA 4EBDA 4EBEA 1RT7A 5KFHA 3JSMB 2HNYA 1R0AB 1RAJA 2IM0A 4R0EA 3I5AA 5KFLA 3I0RB 4TYBA 4IFYB 3PW2A 4OL8A 5J2MB 3NKYA 4RZRA 2CJQA 3H2LA 4H4OB 3LAMA 2RF2A 3OHAA 1S1UA 2ZKUA 3CO9A 4KAIA 3DRRB 5DG7A 2AU0A 3MFIA 5KFRA 1TV6B 3KHRA 2R8GA 3DRPA 2BQUA 3JSMA 3DYAB 3HVTB 3QGGA 5C42B 1R0AA 2ASDA 3CDWA 2W7PA 1RT6B 1VRUB 3I0RA 4IFYA 4O44B 3TVKA 2V4QA 5KT6A 2W8LA 3V6HA 4H4OA 1S6QB 3Q8SB 2AWZA 4KO0A 3QGIA 4ZVGA 1KLMB 2XC9A 4FBTA 3DRRA 2R2UA 3V81A 1TV6A 2GC8A 2WB4A 5F8NA 5KFMA 3H40A 2ATLA 3V6DB 2E9ZA 1OS5A 3CJ4A 2XGPA 3D28A 4K4VA 2XWYA 3VQSA 3DYAA 3HVTA 2YKNB 5C42A 3I5BA 4K4XA 3RB6A 1QAIA 1RT6A 1VRUA 4O44A 1KHVA 1RT1B 3JYTB 5C5JA 5KFCA 1TP7A 1FKOB 1S6QA 1GX5A 3OLBA 3UPFA 3DM2B 3DMJB 4I7FB 2JEJA 1S10A 1KLMA 4NLRA 3C6UB 5EUHA 4I2QB 1QE1B 3PVXA 3IG1B 3V6DA 4ED6A 1RYRA 4LQ3A 2ZE2B 1RYSA 1N5YB 1HQUB 4I2PB 4G3IA 3MR5A 4NLVA 2YKNA 4F4YA 3V6JA 4JUZA 2IC3B 4WXOA 4EO8A 1RT1A 3JYTA 4Y34A 5KG4A 1FKOA 5CYMB 3TAMB 3SI8A 3DM2A 3DMJA 1Z4UA 4K50A 3QLHB 4I7FA 5KG1A 4ZMMA 3KHHA 1S0NA 4PQUB 3FQLA 3LP0B 3OL9A 3C6UA 4I2QA 1QE1A 5KT3A 4J9OA 3IG1A 4LSLB 2D7SA 2UUWA 3FRZA 2ZE2A 3PW0A 1N5YA 1HQUA 4I2PA 5KG0A 3KK1B 4KE5A 2D41A 2RDIA 3RAXA 5KG6A 2IC3A 3GV7B 5F8JA 4RW6B 3H5SA 4YP3A 4URGA 4TQRA 5CYMA 3TAMA 2VA3A 3CJ5A 2UVUA 3LAKA 1C0UB 2R8JA 3QLHA 4Q44A 4DL3A 4IKAA 2C28A 4PQUA 2XI2A 3LP0A 2GIQA 3PR5B 1KHWA 4LSLA 4TN2A 5KG7A 5EWEA 3EPIA 1T3NA 5J2NB 3PR4A 2UVWA 5C24B 4PUOB 1TQLA 4NLYA 4J9QA 3KK1A 4Y2CA 2HNDB 3H4DA 5JUMA 3QGHA 5DG8A 4ECXA 2ALZA 1N6QB 4RW6A 2JEGA 5F8GA 4NLSA 1S1XB 2W9CB 1C0UA 4R8UA 2WK4A 1LWFB 4NLPA 2IJNA 2VA2A 3FQKA 4QWAA 3KHLA 4WXWA 1S0MA 3CJ3A 2FVPA 1RT2B 5KFBA 4ZPCA 5J2NA 4QWCA 5C24A 4PUOA 2HNZB 3M9NB 4ED7A 2F8EX 4Q8EA 3IRXB 4ZVEA 1N6QA 5KT4A 2C2RA 5DGAA 1S1XA 2W9CA 4NRUA 2VG5B 2V4RA 2W7OA 4ZVFA 1LWFA 2E9RX 2R2TA 2FJWA 5F9LA 4MFBB
chains in the Genus database with same CATH superfamily
1K1SA 3NMRA 1DQAA 4OZ2A 4L3NA 2LQBA 4P72A 4O3PA 2E1RA 2MB0B 1EJ7L 3W66A 3BH7B 1IKYA 5HL7Q 2DISA 1X4BA 3DLKA 3QYYA 3LP1B 3VTIA 3UD5A 3MAAA 4HLBA 3FMBA 4DS4A 3EZOA 1RE1B 1HPZA 5JVHQ 1TVRA 1S0OA 2D9OA 3NCQA 4MKAA 2IPOB 3PKMA 2M7SA 3A12A 2J7UA 3LH2S 1HNIB 2YVSA 5J2QB 4DSFA 3T6BA 2J0XA 2RHSB 1F9HA 1WOSA 1N52B 1ZA1B 4Q43A 1B4SA 1T03A 1YG0A 5K9FA 3BREA 5GADU 4OI6A 3KLHA 3M2RA 2ZBCA 1IBKF 1IBKJ 4JV5F 3PJWA 1N36J 3ETOA 4WYWA 2HGNA 4OI0A 3MM8A 2OI2A 2HS3A 4O23A 2L08A 3U02A 1IM4A 1N0UA 4CO2A 3HM9A 3D6FB 1ZPVA 3RR7A 1S1VA 1RT3B 3M8RA 4NLQA 3VAFA 4W98A 4K0KJ 3CJRA 3H2VE 1NDKA 1UWAA 2DH9A 3NP5A 1S6PA 4YDDB 3BQ1A 3R7NB 1HI0P 3S8SA 2DNGA 1WHVA 2YKMB 2DNMA 3OTCA 2V94A 2C2EA 1LK7A 2GJ2A 2OPRA 3RYLA 4EUVA 2HPUA 5A2QU 3EDQB 4B3SF 1RT5B 2M3DA 2KT2A 1FRXA 3M8PB 4PYAA 1JJHA 3SIPB 2ZH6A 3I56S 3H25A 1GX6A 2O67A 2YWWA 1Q1KA 3OXFA 5DGBA 3PDNA 1WC1A 1HD1A 2H4WB 1GMWA 3VGVA 2CPEA 4WPAA 1RA6A 5H1SV 1HBOB 4PAAA 4K5SA 2ZOMA 3ZZRA 2R8HA 1AUDA 2M52A 1WTFA 1TL4A 3I5CA 2KM8C 1Y3JA 2MQOA 4YEAA 1MU2A 3QIPB 1GTHA 2AV5A 3HJVA 4IUFA 3BGFA 1R89A 1S1WA 4WJBA 1RTJB 1MROA 4ZVPB 1XNQJ 2E9TA 2VU5A 4LF1A 1UEUA 4B9VA 1ZH5A 5KT2A 3QT6A 3PX4A 4I67A 1XBWA 3SCIE 2P6SA 4DZ6A 4ZJOA 3DLJA 4IG3A 3IGNA 2G2ZA 1OM2A 5K14B 3DOMA 2I5JB 2VL1A 2MMYA 3O8WA 7FD1A 3I0SA 1WI8A 4BC7A 4MKBA 3EICA 4L73A 1O8BA 5IT9Y 4CLLA 2KO1A 2MZTA 1JNZB 3MR6A 1UJ5A 3JSBA 3MEEB 2HNYB 2BJ3A 2A2CA 4NLUA 1X9WA 2FGOA 1YVFA 2R2RA 3C14A 4HHUA 2Z57B 4A8KA 4LR9A 2YWFA 1RWWB 1VGYA 3LGNA 2ALYB 2J9EA 1U7LA 2LQJA 1M5SA 2G4BA 2WVBA 3HD2A 1S7HA 2ACMA 1UPPA 2GW8A 4KAIA 1K47A 1P9YA 3R6LB 3FUYA 3TVZA 5L39A 3R5AA 4WTYA 1HLWA 3QGIA 1VK3A 4FBTA 2VHGA 1Y10A 3CCQS 4OZLA 4K4VA 1X5SA 4O44A 1S6QA 3SDEB 2HHUA 2KJVA 1X5TA 3NEKA 4ED6A 3PACA 1KR4A 1KLNA 4NLVA 4MTPA 4ZLPA 2GCFA 1SXLA 3CPWR 3L95X 5HO4A 2CQ1A 2PGCA 1N5YA 5FJ4A 1EARA 4IO9Q 3DGVA 4C2MA 2QT7A 3PJ9A 1SIZA 4OYPA 1F6TA 2RIJA 1PYSB 4X66F 3FZBA 2FTRA 2MSTA 1BUXA 2CZ9A 5F8GA 1S1XB 1IBLF 3POTB 2JHEA 3IR7B 1AW0A 4LREA 4ZCLA 1HQ2A 2DNZA 3D0IE 3TAPA 5KT7A 3W1YC 3ZNJ1 2HNZA 3J7ZT 2RUGA 1T05B 2VBZA 3UO0A 1VRTB 3J81U 2ZJQQ 1SV5B 4PG6A 4J9LA 1RTZA 3IBCB 2Q6CA 1CLFA 1FF2A 5HVFA 1Q16B 1TKXA 1LKZA 2IBOA 2LKZA 3QJJA 1NB7A 2KTQA 5ETQA 4ZCKA 1IN0A 1I6JA 2XTCA 4PWUA 4MK7A 4PWDB 3K89A 3FBEA 3N01A 3KLEA 2A6MA 2GFFA 1FEHA 3VGUA 5HAOA 1IR2A 2RDJA 5KFYA 1QAYA 5D78A 3G6YA 3ISNC 4IYQA 1L3TA 3KNGA 1S12A 2Q66A 5KFJA 4FBUA 1RU1A 3NMAA 3X3UA 2A6OA 3NAIA 1LFPA 3MF5A 3MM9B 3MM7A 2B9WA 2V2KA 2MPUA 3P49B 4YMEA 3RTVA 3NAHA 4BBYA 4ANEA 3P5BP 1OQ6A 1REVB 2MGZB 3QO9A 4DSJA 1HKAA 3BZQA 1OPIA 3R1HA 1BC6A 1OPZA 5KFEA 3QIDA 2GGPB 3D1HA 1J5EF 1J5EJ 1SH0A 1RXOB 1I3OB 2CJXB 3OSNA 1VHIA 5IZHA 4JI1F 3MPYA 5KFIA 2OPQB 2L41A 5D77A 5D3GA 3LA0A 3D0GE 2QJ3A 4CQ1A 4TU9A 4RNNA 1TMMA 3KLGB 3EJMA 1CULA 1HWUA 4TXSA 3DFEA 5CZVA 3DRXA 2B9XA 3NBPA 2VV5A 5M2RA 5K8NA 4DJBA 3T5JA 2PMWA 1HBNB 4YR0A 1U25A 3DDIA 3G86A 1JLFA 2BRKA 4KGVB 1PG5B 2ZH9A 4ZVRB 2O3DA 3H0PA 4YB7A 3W65A 1E6VA 1NPRA 4CT9A 5CZXA 1VI7A 4LBPA 1FDNA 4KKOB 3ADAC 4LR7A 5F8IA 2C2MB 3JTOA 4XDCA 4M5MA 4USKA 2HZVA 1S59A 3O1LA 2Q3PA 4ES3A 4AFFA 2DD8S 4H4KC 2VPYB 3BGUA 3KK3A 3M2UB 3SFUA 4B3TF 3S1TA 4B3TJ 3L3CA 2BV3A 2NYHA 1KVJA 1TKTB 3C15A 1NM2A 1RT4A 1V5IB 1OY9A 5HROB 1RI7A 1I1GA 2E5JA 3GR1A 2LDYA 4EZ6A 2VFRA 3UR0A 1B0VA 3MURP 4L6V3 3NWGA 1EZZB 4KJIA 1HI1A 3JSMB 3CJQA 3I5AA 1FRIA 2F65A 5J2MB 2FHJD 2GV1A 1WACA 2DEIA 1S1UA 1IR1A 2QMWA 4LF6F 4JI4F 4JI4J 3QGGA 1TU0B 3I82A 1IBMF 3NOGA 3GYGA 1IBMJ 3DCAA 4R25A 3D6TB 4DV7F 5F8NA 1WC6A 4DV7J 4K4XA 2ZZNA 2V5HG 2JEJA 1SQGA 2NXUA 1SB6A 5EUHA 4JI3F 2DY9A 4WXOA 1RT1A 3QFHA 3OVAA 4OYWA 4I2QA 4XAKA 5JVGQ 2UUWA 2JLFA 2Y9HA 4KE5A 3CULA 2D41A 4ILLA 5KOWA 3QBCA 3V4MA 2K3IA 4DSIA 2UVWA 4GKKJ 5DG8A 2K8GA 3P5TL 4NLSA 3MPWA 4UUWA 2UUBF 1F3FA 3HP6A 1NPPA 2ZZTA 1L3VA 2V6AA 2D68A 4PUOA 3A8KA 1VQKS 4DCJB 4QOTA 3IRXB 4OX8A 2F5GA 4YUDA 1YBAA 3M8QB 4G1QB 2MYFA 3ZO7A 4K4YA 3EX7B 4Y00A 2AW0A 2M8DB 1UKUA 4QWEA 2AGQA 2IDLA 3MGJA 1PGZA 3HF5A 3EMTA 1YJVA 4KQZA 2BE9B 2GO8A 1FDDA 3BO3A 3R5BA 3BV8A 2DO0A 5KFDA 1Y7PA 4OJGA 2LFVA 2ZH5A 2HS0A 1LWXA 5KFQA 4F4KA 3PTWA 3SV3A 3ISZA 2ZHOA 4WP3A 2XM3A 3HJFA 2A0FB 1Z2LA 4OMFG 2BE2A 3D2WA 1N8RT 3Q22A 3WX8A 1RHMB 4C8YA 3LF0A 2AJ4A 3D5MA 1NAQA 3AY0A 4EYHB 2W4CA 3M8YA 1WJ9A 3OR2B 3RAMA 2ZH1A 4H4KA 3W2VB 1CVJA 2JC0A 3KJVB 3T1HF 4F8RA 3T1HJ 3KNAA 2HIYA 1TK8A 4KTQA 4IDKA 4F50A 3DNCA 1VQ7S 4G1IA 3NGKA 3IS9A 5T14A 2UUAF 5BJRA 5L9NA 2UUAJ 3MM5A 3I6PA 4MYTA 4NCGB 3MEGB 4IOBA 3GFZA 4USJC 3MECA 1MWZA 2QL9B 3IC1A 2Z2LA 4F0KA 1RK8A 2XI3A 3CCTA 3A3OB 3CC2S 3NXZA 5IV4A 3R1LA 2GS8A 4O4GB 1Q53A 2XCAA 1TZ0A 3UCZP 5HQMA 2DXFA 3ITHA 5HP1B 3ONQA 2YNFA 5J2PB 3LO3A 4QYRA 4DX6A 2HEKA 3HO1A 4LFCF 5H9FK 4HHJA 4LFCJ 1HQEB 2HFNA 3BH6B 4OZ5A 3DC2A 1HYSB 1ZPWX 2C42A 1S9GA 2BMBA 5D6GA 1V3SA 3DRSB 5I3UB 1JXVA 1RJJA 1A6LA 2CVEA 1EP4B 4UT4A 4EEYA 2BKPA 4DV5J 4RWXA 4C11B 4LMZA 3CCUS 4EBCA 1NK0A 5E3CA 1IM6A 1RTDA 2MHNA 4M5DB 3GJSB 5HVGA 2BJ7A 2Y0BB 4HYKA 3RBZA 2XMJA 3BEGB 3NGSA 1RB0A 5E0OA 4U9RA 4K4ZA 5AT1B 3OPKA 4K7QA 3OFFA 4IQMA 1WSVA 2CWKA 1UWBB 1UA1A 4PRFA 4ECTA 4B9SA 4RW4A 1RLDA 1S9EA 3TOQA 3PZPA 1R0CB 2WB1D 2I2YA 1SI9A 3MR2A 4QWBA 1FK9B 2R7OA 3MMJA 2GHPA 2WVCA 1Y5NB 4EMDA 3GIRA 4BWMA 4CLKA 2VIHA 2ADBA 2HFSA 2FC8A 4C48A 3D7SB 5LMUF 3UE2A 1Y3KA 1UVKA 4AYBD 3HFZB 1XTZA 2GZOA 3BQ2A 5A8WA 1MW7A 4EBDA 3UNGC 1N32F 1R0AB 1RAJA 4PZVA 3I0RB 4TYBA 5L46A 4NCAA 3EM1A 2HFZA 2AU0A 5DG7A 3MFIA 1S5ZA 2X1FA 4X4TA 4NYOA 2ASDA 1OWXA 1MWQA 2HRUA 4KO0A 1TFYA 3GZ7A 2CPIA 3DGPA 3V81A 2CPHA 2DRBA 4DFPA 3HVTA 1YJWS 2QFJA 4ZVTB 1QTNB 3IFEA 1FKOB 1GX5A 2UZAA 1VR6A 1RAFB 2N3LA 2MKHA 2ADCA 4ILRA 1HNWF 3V6DA 1NK4A 2IYIA 2LA6A 1HNWJ 4Q2LA 4BHQA 2CJAA 5KG4A 2ZH2A 1QE1A 1RBLA 3GMGA 4ZK7M 1GXUA 3Q89A 4RWWA 3J7Z5 2HQCA 4KY3A 2HBZB 3G87A 5F0UA 4JI0J 3T6JA 4Y2CA 3R9LA 1C0UA 1LWFB 1IJFB 5KFBA 2OTLS 3Q8YA 1UEVA 1UVLA 2VDIA 3G8TA 1KQKA 2N82B 2Z8QA 2LECA 1NZAA 3MPVA 2ZEJA 2E1AA 4A4JA 2HAIA 5E41A 2RJZA 3A8IA 3MEDA 4XTTA 5LT5A 3DRPB 2OP5A 3UR3C 3PYEA 1JMTA 1NXIA 3IWLA 4FDFA 4DL2A 3R2DJ 4OLOA 2MEWA 2KVQE 4P2FA 5F8LA 4HACA 3MTKA 4F04B 4RNMA 4PG7A 4B3OA 3IA0A 3CDEA 1JLBA 3ZNUA 1PBAA 4PQAA 2HWTA 5LSRA 4B02A 3GIMA 1VQYA 5HSPA 1FDBA 3QRRA 4KT0C 1H2VZ 4X64F 2C2NA 3GFYA 3U7JA 4TU8A 3ZTQA 3FGVA 3THPA 1VLOA 3BDPA 1DBDA 4DQPA 2B6AA 1KONA 4F3QA 3W8GA 2ROGA 2VDHA 3AHPA 4N7TA 3KJNB 5HMWA 2LQ8A 4DFKA 5FDLA 2G2YA 2YQ0A 3TAQA 3LTOA 3J7AN 4P2SA 2QMXA 1Q78A 2F4VJ 2RMLA 3OTEA 1IKVB 1UW9A 1KC8T 1YRXA 2GJIA 2HQ3A 2JDJA 2LXFA 2GVDB 4OYIA 4OHWA 3AQPA 2QYCA 4P52A 2FLPA 1WEZA 2VUGA 3SQOP 3KLVA 1NJXA 1U2CA 4CI0B 5GMDA 2DGWA 1NB2A 4H4MA 2XBPA 5B0BA 1QLNA 3FBBA 4E98A 4K4SA 3R6GB 1Q86T 1QM9A 3EZUA 5DQHA 4JV0A 3KLFB 5E7OB 3RZAA 3DOLB 5CA5A 1HMVA 2FJXA 2ZH7A 5I42B 4WBFA 2EBEA 2H9ZA 4P10A 2IYGA 1JLEA 3PRBA 3M9OB 1M5PC 3M8WA 3KMQA 2IAJA 4CP5A 4W90B 3WX4A 1X7VA 4ZVSB 4WKRA 2OPSB 2EI5A 2YKQA 2BANB 1H74A 3W61A 3QNWB 3CCJS 2AIRB 2P9EA 5EN1A 2K06A 1GXLA 4GO7X 2NZCA 3AB2B 1HNZF 3RBXA 1C1CB 2GHWA 1U2RA 2JLGA 1D9DA 1VQSA 3UDLA 3BSCA 2QA2A 1RSCA 2OTJS 5J1PA 5ETKA 1I51B 4MAKA 1L3UA 3BR9A 3W7BA 3HFVA 2CRLA 1IXKA 3CJTA 1UW4A 1RAAB 2V0NA 3Q24A 3DDKA 3PHTA 2IM3A 3AD7C 4RNOA 1NK7A 1FT8A 1M1HA 1GMUA 2HNDA 4MK8A 3TZYA 2GHVC 4P71A 3R2CJ 3OD2A 3UN5A 2CUYA 1SUQA 2FD2A 4AL7A 1C0TA 3P96A 3PHEA 3BDEA 3HT0A 4XK8C 2W7AA 1RDRA 3QAEA 4U96A 1FRKA 3M6VA 1RWPB 1ACMB 1WKJA 3PIOQ 3NKYA 4TKTA 4DPWA 2E5LF 2DHGA 3CO9A 1LK5A 1FWKA 1LOUA 1NSKL 4DI6A 3ZZUA 4LBHA 5GAHU 1SJ1A 4H4OA 4TNOA 3CCZA 4N8NA 2HVHA 1TL7B 3BYRA 3I5BA 3JYTB 1U1LA 3M2VA 1UFKA 4JI7J 4I7FB 5U47A 3W3SA 2FZKB 2U1AA 4I2PB 4G3IA 2HQGA 4X4OA 1H6KX 2IC3B 1YKWA 2RRAA 4Y34A 2KXNB 3OL9A 2CG4A 4MT1A 3EGVA 3FEYB 2B4OA 1RUSA 4DV6J 4URGA 3J81j 3LAKA 4OIXA 4Q44A 4YS2A 2W2MP 3ILJA 2CPFA 3GP9A 4NI2B 4RW6A 5E3PA 4OV1A 2XHCA 4R8UA 2FB0A 2B56A 4Y2MA 3D67A 1S0MA 1IJEB 1RT2B 1BMQB 1N6QA 5CQGA 2W9CA 3KYLA 2AD9A 3PX0A 1XERA 2CIMA 5KFFA 3OV7A 2J8AA 2ILYA 3X1LB 8AT1B 2ZHAA 1JLCB 5E3AA 3D6MB 3K2YA 4DCOB 4HH0A 3BJYA 1DJ0A 2WVFA 1OSDA 2MHEA 1JJ4A 4ZPAA 4OJHA 2CJBA 1PC5A 1LWCB 5L1JA 1UJ6A 3ICLA 3W60A 2BM0A 2OLWA 3FNNA 1SC6A 3AAWB 1DTTA 5DLGA 1TUVA 5BR8F 2A10A 5BR8J 3KK2A 2PT0A 3TA1A 2PI4A 3IWNC 3TZZA 2XMKA 4QW8A 4JB8B 1JLQB 4ED5A 3LPEA 4LIWA 1OY6A 2HS4A 3VAIA 2L48A 3W9JA 1K0TA 5IT0A 4DF8A 5BYQA 1YBUA 2VOOA 4DSKA 1FXLA 2LEAA 2DKOB 2H51B 2HQDA 4TLRA 5CCLA 4WKYA 4UW2A 5JXSA 2LA4A 4KRWA 2PEHA 3E01A 4DR4F 2QTWA 1KWMA 2BJ9A 4DR4J 3M32B 4CT8A 4QQBA 1W7WA 3LP2A 4C6AA 3C66A 4F4AA 4F3MA 2Z4PA 1YX2A 3CJ0A 1T7PA 4KHRA 1RTHB 2KFNA 4OJ3A 1VISA 1T3OA 4DL0C 3HULA 3WIVA 1SKSA 5D4NA 4GKJJ 4KH0B 3KG4A 2C3UA 3FCWA 3MR3A 3W64A 2VJUA 3FFIB 2CQIA 1FNXH 4M5GA 3NGRA 3OR1A 1B0TA 3HVAA 4USVA 2B4VA 2CQ3A 1TUWA 3GV5B 2BOAA 1RWUA 4ED8A 2HMIB 1JLAA 4CO4A 1F1BB 1YSJA 3PRDA 4YDXA 1FCAA 4U67Q 2GAHC 3ENQA 2MLZA 1IQZA 5G0RA 1HNVA 4IG0B 3DLEA 2X1BA 4QWDA 1FWLA 2KT5A 5KG3A 3N6LA 2ZWOA 1YJ9S 1HD0A 2OPPA 2KI2A 3P6YC 1MLAA 3KLIA 4IFVB 5HLFB 5E5NA 2W2OP 2I0XA 2E7WA 2WW4A 2DCUB 5IWAF 4U8VA 5IWAJ 2GMJA 3CCMS 1YHQS 4OYMA 2H5EA 2PA8D 1MWYA 3CVKA 1Z1ZA 3W5ZA 2VQEF 2VQEJ 3BBBA 2ZKTA 2E5IA 3ZZOA 4WU2A 2AX0A 1Q5YA 4B9LA 4DUYJ 5AXLA 2YXLA 4ALZA 1G2EA 2MY7A 3TJAA 4DOZA 2N4DA 5T41A 4IRKA 1S1TB 1NLKL 4DWIA 1R8PA 4PG5A 3FCHA 1YZ7A 2Q79A 1CJTB 4ECSA 5ETRA 4WFBQ 2GA7A 4A8SA 2BX6A 3HSJA 2HQFA 4TY8A 4L3KA 3I4HX 4Q5VA 4FF1A 4P2MA 1SPBP 2MZ1A 2RF2B 3PJXA 1FKAF 2CPDA 3HSGA 2K2PA 1RGVA 3HZEA 3PW2A 1Q8IA 2MZJA 3GSDA 2ZHBA 4D3GA 1H72C 2WW8A 3CDWA 3TVKA 2LXUA 3HSZA 2DEJA 4DR5F 4DR5J 4NZ7A 5KAKA 3DRRA 1QAIA 2ROPA 1U8SA 1VLYA 1WDDA 3N0VA 3UFCX 1KLMA 3QT7A 4NLRA 3JAMY 2GX8A 4DHVA 3KJFB 1RYSA 3SBMA 2WBMA 2R7XA 3IMQJ 5HANA 1FFSB 5B0GA 2BVZA 4B9NA 3QLHB 4K50A 3ZZZA 5D8HB 3FRZA 2D3OR 1FNMA 1UVJA 4DV1F 4DV1J 3TAMA 2VA3A 1GXTA 2FZCB 4P75A 2XTEA 4ELUA 1CG2A 2WSCC 3CO0P 4B17A 1I94J 3TW0A 2VICA 1SJQA 1PCAA 2HZCA 4OX9J 1JNRB 3VAJA 3MD3A 2V4JB 3NCPA 2FVPA 3WBZA 3M9NB 2Y1LB 2DGSA 3W5YA 3CUNA 2R7QA 5KT4A 3T41A 3VZIA 4NRUA 1X9MA 2LVWA 3CJSA 2VZ9A 4NLWA 1S76D 4GVBB 2JVOA 5DLFA 4EYIB 3L09A 2IM2A 4ZP6A 3THVA 2JFKA 1V6HA 3RAQA 2WAQD 5F3TA 1C2PA 4HI2A 4ED3A 1UZHA 4LRFA 3U1MA 3DHWC 1IKXB 2DNQA 1RHRB 1ZM4A 5KTQA 4F67A 1YGYA 5CD4A 3OL6A 3BKTA 1I5OB 5G4DA 3AD8C 3M05A 1SL1A 3LP1A 1YDLA 4PWWA 1RISA 2D3ZA 3PW4A 2QL7B 1D9AA 2HVDA 2J0WA 2ROEA 2V67A 1FRLA 2NUUG 1HNIA 5J2QA 3TUJC 3GIKA 3GFXA 1T11A 4OX6A 4IOCQ 1X4EA 1U26A 5A6WA 4QR2A 2R7VA 4OHZA 1MMNA 2DT9A 3MM6B 2AP6A 2NXCA 2YH0A 1QY7A 2WONA 2XZDB 3RU0A 1DTQB 4DR3J 3FJ2A 3E3XA 4PEOA 4X62F 1RTIA 4X62J 1IQTA 3S6EA 5CYJA 3CCES 1T8EA 2PA3A 4ECRA 1RAOA 2XYPB 4ID5B 1IWAA 2B4PA 2GIFA 1RT3A 4MK9A 4X4VA 3ZC4A 2C3OA 5KFUA 2HLUA 4YB5A 4NPOA 5HATA 2YKMA 3CEDA 4AL6A 5KFSA 2DNHA 1J27A 1DLOB 1NMEB 2PSZA 4Y2KA 1KSPA 3L9ZA 2KH9A 3ETMA 1X5OA 3N28A 1W25A 2CYYA 1RT5A 2CNOB 5IQQA 3M8PA 2ZM6F 1FFGB 2ZM6J 3CCWA 2CNKB 1U45A 2IA6A 4OZ3A 3PCOB 4J9SA 3UD4P 2CQ0A 1Y5LB 1KFSA 3K17A 4O3QA 4DL7A 1HBOA 5GADI 3QRQA 4K8RA 1DQ8A 4WK3A 4UQTA 3OVSA 3MM7B 2UVRA 2OFGX 1Q0NA 2NXJA 1W2IA 1RU2A 3BPSP 2UXBF 2DY1A 2UXBJ 2O01C 4PPDA 1U1QA 3KFWX 2QIFA 3M6UA 4Q0BB 5KFZA 1RTJA 1JIHA 1PAUB 1VDHA 4DR7F 4ZPBA 4DR7J 3A8EA 2QA4S 4GO5X 2YTCA 5C25B 3IBWA 4RR5A 2YQ1A 2HURA 2RQ4A 4JOUA 2KKHA 4RJVA 2VOPA 2ASJA 3DN9A 5K14A 2CJKA 2I5JA 3CMQA 4DS5A 4DG1B 5IM0B 5EHHA 2CQHA 4LF5F 4C4WA 4LF5J 4CM2A 2M4MA 2PN6A 2F8MA 2FLLA 1G4CA 3MEEA 3J7A1 2HNYA 4R0EA 4DR1J 4IFYB 4PKDB 2ZWPA 3KJQB 4K2XA 4P6QA 2B9YA 3AOAA 2W7PA 3OTDA 2WB4A 4WU3A 3KUEA 2YKNB 2QLBB 3UW1A 3JQJA 1S10A 1RQ0A 4V1Ak 5F41A 2J8SA 2V9KA 1REGX 4OJ1A 5ETNA 3SV4A 4HH1A 3SDEA 2R3VA 4ZVUB 3LP0B 4J9OA 3GG0A 3LGMA 1HHSA 3QAUA 3GV7B 2F40A 3V5RA 3IWXA 4DL3A 3PR5B 1QAXA 1ZM3A 2JEGA 2X51A 2HBQB 2C2KB 4QPTA 2L9DA 2CPZA 2DYAA 1PKUA 4ED7A 4Q8EA 2FJAB 3W5XA 3G82B 2IRYA 2PE8A 4ITSA 2RAQA 2YWHA 1S1XA 1KN6A 1DHMA 3P8BB 3KDOA 3POTA 3BR8A 2FJWA 1CQNA 1ZM9A 1QSYA 3SCKE 2JEIA 3CDBA 4F2SA 5DG9A 1Q81T 1NHUA 2VASA 3LW5C 3MMBB 1UFWA 4ZCMA 4JYAF 1T05A 1VRTA 4JYAJ 4ECYA 1SV5A 1CJVB 5E3RA 3W9HA 5BYSA 2JLEA 4LSNB 2DHSA 2R7WA 3NNCA 1S4FA 5K8PA 6AT1B 1YJ7A 3J80Y 5A2QY 4M1KA 4Q8FA 1XIQA 2AX1A 3H20A 2E5GA 4YR3A 2J9DA 3PFEA 2Y8WA 3T1AA 1VOMA 3V4IB 4PWDA 1NK6A 3HHKA 3T5KA 3MUVP 3Q83A 2ZNYA 4URSA 4WE1B 2PC6A 2QN6B 2WOMB 5AE1A 2JX2A 3TO8A 3G6VA 3I55S 4MMOA 2C1EB 3G71S 2ZZMA 4NXMF 4BC9A 3M9MB 1SIWB 4NXMJ 1UTAA 7FDRA 2D9PA 2HBRB 2UU9J 2EG1A 3KXDA 5ETOA 2HK3A 5L9XA 3MM9A 2LMIA 2ZD1B 4N47A 1U6FA 2YKAA 3DI6B 2VFUA 1JJ2R 1REVA 2MGZA 1JQGA 4O3RA 1CS4B 4QR0A 1OY8A 3UWTA 5KFVA 3OHBA 4LSZB 1OYEA 2GGPA 2B43A 2MXYA 1TL1A 2RQMA 2VODA 1Q5VA 3GLJA 3VVTA 2DNLA 4K5RA 4FVCA 2XCPA 3G2XA 2G1DA 2A1BA 2W01A 4GC6A 2G2OA 5KFXA 3NGTA 3IM9A 5EWGA 3CGIA 4UF4A 1D8YA 3K8VA 2JRSA 2UUCJ 3HHLB 2FZGB 2OPQA 3HT3A 4Y0FA 3A3PB 1XK8A 1RWKB 3D54A 2KHDA 1AT1B 2YY3A 4U6PA 3IGVA 5AXNA 3EGWB 1XR6A 3BSOA 4DXLA 4J7CA 3KLGA 2ZVSA 1TR0A 2QYGA 2BJEA 1HBNA 1DARA 3BGRB 1U1MA 3MCSA 1GMVA 4W92B 2Q43A 3M30B 1AROP 4KKOA 3V2UC 3NL0A 5L1IA 3MPDA 2ZOFA 4NXNF 2XLKA 4NXNJ 1EQMA 4J9NA 4DPXA 2RRNA 3AX2A 1B0PA 4Q7AA 2RKIB 3M2UA 1H0HB 1VQOS 3DOKB 4TVAB 2VKRA 3QWPA 1VYAA 3SCLE 1WORA 2D74B 2R8KA 1TKTA 3NG8A 1RT7B 4CH0S 1WKLA 5HROA 3OXGA 4X4RA 3CCSS 1GFWB 2VF3A 3PV8A 2LU1A 5AE3A 5IC6B 2IM0A 3D0HE 2E1MC 3AB4B 2AF6A 2XMWA 3LAMA 2V8DA 5LL6d 5B09A 3J81Y 4CLFA 1WDTA 3KHRA 3ET6B 3JSMA 4WFNQ 3CD6S 3VAKA 2V4QA 5KT6A 2MY8A 1O0PA 2XC9A 3D3CJ 5KFMA 1NJYA 4ZIVA 3KUHA 3SQGB 5KFCA 2FUG9 3DM2B 3OLBA 3S7RA 1R8HA 3IG1B 2KL8A 4KPCA 1RWMB 3GE9A 2VH7A 3GJRB 4F36A 1HNXF 1HNXJ 1S0NA 4JV5J 4LSLB 2D7SA 2E7XA 2ZDOA 1FTRA 3EVOA 3K7RA 3TUZC 2UVUA 1AZSB 1X60A 2C3PA 4CLWA 5C24B 4ECXA 3U1NA 4B3RF 2EPIA 4EWTA 2AYBA 2ZH4A 1WHWA 1VIOA 2RILA 2D1CA 5DGAA 8RUCA 1PJ7A 2VG5B 5L8RC 5DS7A 5SUHA 2V4RA 1YRUA 2JZ5A 5H9EJ 5F9LA 4KIAA 1KRPA 4O3OA 3GIJA 4RNFA 5SZTA 3IRXA 2FHKA 5BYRA 4P73A 2YKPA 4NWBA 4USUA 1YWXA 5F3ZA 2HYIB 4X4SA 2YNIB 3M8QA 4G1QA 1V3ZA 2DR5A 3J80U 2H65B 4WTOB 3B6BA 4RO0A 4ETZA 4JI6F 4KO0B 4JI6J 1ULRA 4B3SJ 3O2IA 3V81B 1NHVA 3W8PA 4YHHF 1N33F 1LXNA 4YHHJ 1N33J 1MG7A 5F8MA 2QLFB 5CXTA 4ZLJA 4LR8A 2DGOA 2V2QA 1YBTA 2KFZA 4ZJQA 1RCXB 1UA0A 3NWRA 2LEPA 2U2FA 2F7VA 1OIAA 1TTHB 1UJ4A 4QPXA 5A8RB 2KXHA 4E8UA 4CH7A 3AOCA 2AYEA 4DV4F 3BN7A 3RB0A 4DV4J 2ZBIA 1B64A 2AGPA 1QUPA 1U24A 3VF0B 4RW9B 1GK8A 2NS1B 3OR2A 3PRVA 2XHWA 1O6XA 3LPYA 3GJTB 1WSRA 5ADZA 5GVQA 3W2VA 2VG6B 2I1RA 2HG4A 1M5VC 3T9NA 3KJVA 1C1BB 1VJWA 2YQ3A 2MDAA 1FKPB 4NCGA 2XMVA 3MEGA 1UL3A 5MLCV 4M5NA 2V9WA 3UDEA 4QIGA 2FHOB 2BW2A 1FX2A 1VHFA 2XGQA 2DR7A 4O4GA 2CKWA 3MEKA 2BZ2A 5HQ8A 4DN0A 2OO4A 4LBIA 5HP1A 2Q1LA 3K58A 5K8MA 3ISND 4MKVA 5J2PA 2A2DA 4CM0A 3TJ8A 1S99A 3CD5A 5CYQB 2FJEB 1HQEA 2E1PA 3PG9A 3G8QA 3PFOA 1HYSA 3NGDA 3FVYA 1WOPA 4DV2F 3DRSA 4DV2J 3SMZA 5I3UA 1CPZA 1EP4A 2L3MA 1FXRA 4XDDA 5DZ7A 2ABYA 4C11A 3FEXB 4M5DA 2ZC4A 2W9BB 4NE9C 2F3JA 2AGOA 3R5DA 3OQ2A 4KBIA 1OSCA 2V8HA 4AXJA 3CC7S 4EGLA 3CCLS 3GU0A 1PILA 4X66J 2FY8A 5KFAA 1ITPA 3FRYA 4OI1A 2NUHA 1UWBA 2PDAA 3T5HA 2P9GA 1E6YB 1UETA 3FKBA 3MFHA 1IBLJ 3WDOA 1BHNA 2XEXA 4CLZA 4O3NA 5A76A 4DR6F 4DR6J 3SXLA 2HHXA 4NLGA 2B5JB 4N5SA 2OMOA 1P1LA 4QIFA 1N56A 2W2PP 1S72S 3GIIA 3JS9A 4B9TA 5KFTA 4YN3B 4O3SA 3H5YA 3OFGA 3FSXA 5KFLA 1N0VC 4OX7A 1CJUB 3RUBL 3H2LA 2CVIA 2PFDA 3CJ8A 3KWMA 5DDPC 1G7CB 1BGXT 1TV6B 2DHHA 2VC0A 3SSRA 2F9JA 3DYAB 1R0AA 5C42B 3I0RA 1H38A 3NLCA 3JTNA 3MZIA 3JQMA 3B8HA 2R2UA 2GC8A 3BGOP 4NOHA 2M5YA 3QPIA 4OV6A 3RJMB 4C3MA 4KGZB 4FYYB 4QIVA 3DMJB 2XQCA 3MUTP 2Z56B 2JOQA 2CG8A 2BEFA 1FKOA 5CYMB 3JTPA 4YB6A 2FHMA 2F4FA 5KT3A 4ZN1A 2QA4G 5EGYA 1A7GE 4OI4A 4FN5A 3OXLA 1ZBTA 2HAFA 2ZBRA 3BBCA 2BJDA 2FLOA 2HNDB 3QGHA 3B4DA 4F0HA 2XYGB 4EZ9A 3AA9A 4NLPA 4NA1A 4PXBA 2ATCB 4HVZA 3M1VB 1QD1A 1LWFA 4MFBB 3GYXB 5FLXU 4C0BA 1A0OB 4ED0A 4K4TA 2VFTA 4FNHA 1Y0HA 5A8KB 3D66A 3K0JA 1M5HA 3DU6A 4C8OA 3TUIC 3O3LA 2XO7A 1R0BG 5JJBA 4JI1J 1SJRA 9ATCB 1S4EA 1ROFA 3BKUA 3RW7A 4K4WA 4HT5A 1FX4A 2W8KA 2BQ3A 2DCLA 3PO5A 4MIAA 1L3SA 4WZQA 2RS2A 2MQPA 1AB8A 1X4GA 3CXCR 2VG7B 1HFEL 1S77D 2JNJA 4BWJA 4LRAA 2WSEC 3FSYA 2UV8A 1XMQF 3CWJA 1XMQJ 4AUKA 2FYXA 4DL6A 1EIYB 1BQMB 2IJRA 2XS5A 1N5QA 4HKQA 2B7CB 3CT9A 1VIXA 2KRBA 2HHQA 2YKOA 2O5DA 2CQ4A 1LW0B 2EBGA 3RR8A 1EHWA 4R8UB 2GNKA 1IVZA 1RACB 1HWJA 1N4LA 4LUBA 2DGQA 4QIWD 4P7VA 3AJ1A 2AKWB 3EDRB 1SKRA 3Q8QB 2BUNA 3DLGB 2XY5A 1URRA 2CWXA 4R0JA 1U0HB 1TL3B 1BWVA 1SH3A 3H5XA 1S6UA 2DIUA 2RHQB 1R43A 3ULHA 3H59A 3WQPA 2HGMA 4LF8F 4LF8J 4ZKAA 2B8QA 1IKVA 6FDRA 4JP8A 2KG1A 2MQQA 3QQCD 2DXEA 1NKEA 1AFIA 1NK9A 2GVDA 3SSQA 3GILA 3O6QA 1FE4A 2LLZA 4NYZA 4ZPDA 1JKHB 2RVJA 4IQXA 2V63A 1FJCA 5T7LB 3Q8PB 1NHKL 4RUCA 4C8ZA 3AFGA 1JLGB 1X4HA 3KLFA 2NSCA 3DOLA 2BKNA 1U1RA 1MSWD 4LF6J 4XPCA 5I42A 1X4AA 3ILLA 1Q7YT 4ZVOB 4V19X 2G13A 4FVMA 2FIUA 3EXCX 3E51A 4UOFA 2GQ2A 3IAM9 2AJ2A 5ETLA 1OJ4A 2J6UA 3MI7X 1T9VA 3TANA 5THWA 2WZ1A 5HJXA 3LANA 1NH8A 2OPSA 3HVWA 3MR7A 2BANA 1SJ4P 2E66A 4HTJA 4JI3J 2ZUGA 1Y4ZB 4NX9A 4DN9A 1UVIA 1KVIA 2YH1A 3CNQP 1C1CA 3DXSX 2JVRA 2ZUAA 1HL6A 3MAHA 3R3TA 2BJ1A 2DGTA 2PD1A 1EKSA 1W26A 4NCBA 4USWA 4UZCA 4I1TA 2H3EB 1GMWD 4LRBA 5K5MA 2UUBJ 2R9LA 3C19A 1FRHA 1KVKA 2CPJA 1R6VA 7AT1B 3NS7B 2X1AA 3W2WB 4KV8B 3GFHA 1H2UX 2YPYA 4FKXA 1TAQA 4ED1A 3QSYB 3HHEA 2UV8G 4EFAC 3J7YI 3N5FA 4Q45A 1IR0A 5L38A 1U1OA 5KFGA 5KFNA 1YTYA 4RLEA 4RKUC 3FBCA 2J0SD 2BDPA 2BXJA 1CC7A 4ZLNA 3ILOA 5HMZA 1TKDA 1VCTA 5DDQC 1JXEA 2KDOA 2V50A 3R97A 3EWGA 2CQCA 1CJKB 3EGZA 2W8LA 2J5AA 2K1RB 4PCQA 5DO2A 3CJKB 1NK5A 3BGLA 3IBFB 3E8OA 1EKRA 2XZ2A 1OS5A 3CJ4A 3D28A 4FKYA 2XYHB 5ETMA 1NDCA 1T9XA 4C7QA 1NPKA 4OYAA 3OW2R 1N5SA 1SL2A 1RYRA 1HQUB 1TL7A 3CF5Q 2Y3YA 1U02A 4CO1A 4Z7CA 3JYTA 2FGCA 4WP9A 4I7FA 5AXMA 2RQKA 3EE3A 1HHQA 3PW0A 4I2PA 2RDIA 2FJBB 2IC3A 3HFKA 5CD4H 5B0CA 3PYDA 2BM1A 5EWEA 5D0EA 3CDAA 2HVIA 2ZBQA 3LQVA 2FQQB 4WXWA 4OLPA 2KYZA 1YJTA 1U0SA 4NI2A 1OQ3A 2C3YA 2BA9A 1K73T 1J2VA 1H3DA 1HWIA 2V34A 4ZJLA 4ZN3A 4NMLA 1RT2A 1PIEA 1X31C 5C7PA 2P5VA 1GEHA 2CNLB 4DPYA 2PMHA 4KFBB 4C8MA 4ZCIA 2KG0A 3ZTRA 4R5PB 1SKWA 4ECUA 4PABA 3U27A 2NZ4A 1L3KA 2OEKA 1JLCA 3ZZPA 4CLUA 2VD3A 3PW5A 2NYIA 5LOQA 4M5HA 4TYAA 1ZOTA 1AFJA 3Q23A 1U49A 5GAHI 2HIQA 1LWCA 1UMJA 4TLQA 2DVIA 1VQ6S 4H54A 3D68A 3UN2A 2V8VA 4ZP8A 2DNKA 4MIWA 2GJFA 2QA1A 5DDOC 2EW9A 2QL5B 2B51A 2YBVA 1JLQA 2W4PA 4Y6IA 3WIUA 2UVVA 1S49A 4ZHRB 5B0DA 2HKEA 4GC7A 4F25A 2M8HA 4I6WA 2C2OB 1FNOA 1KD1T 1MMDA 2RE1A 3QATA 5KOXA 2VFSA 1EETB 2XSJB 4C0HA 5J1EB 1RHUB 5KFPA 1PC4A 3M32A 2YWKA 3B54A 3HMJG 1VQLS 2C2ZB 2Z2YB 4DUTA 3A8JA 1V5VA 3DKDA 3M8SA 1FJEB 2YNHB 1RTHA 4ERDA 1ZA2B 1GAOA 2DR9A 1TUGB 8ATCB 1BQNB 1IKWB 2QLXA 1YITS 5LMUJ 1ELOA 1YRTA 3TQ1A 1ZTWA 4YOEA 3FFIA 3OUYB 4WFAQ 4P74A 4V19J 4AL5A 3JB9k 4A8XA 2FVSA 3P45B 1N32J 2DGVA 1TK5A 2HMIA 4OYZA 2V1TA 2RSQA 2V69A 4RU9A 3UQSA 1FEEA 1HWKA 1SKUB 3R5JB 5GAEU 3O5TB 4RW8B 3WC2A 1VMBA 4ELTA 3HX9A 4IG0A 3ZFVA 1URNA 1N36F 1KEKA 5FIIA 3I9V9 3I87A 2WONB 2JSXA 1ZTTA 3GPAA 2FHJA 3AX3A 1RTIB 1M0SA 2WCXA 3FCVA 4IFVA 5HLFA 4ICLB 4E2FB 3CD0A 3OJSA 4LT6A 2ZFHA 3M7VA 1KTVA 3T19A 4K0KF 1BQXA 3PEJA 2B4UA 1LWEB 3AQOA 3P4UB 3R27A 4AD6A 2HWIA 2D3UA 1D9FA 2OAUA 2G9OA 2F9DA 4IH7A 2HVEA 4K59A 4WYLA 4X84A 1YLXA 1S1TA 1F5AA 4G6VB 1R27B 4NRTA 1R8BA 3EZ5A 4AXIA 2QGFB 2DHXA 3WHIA 1CJTA 3PEHA 5ETPA 4MH8A 3N6NA 5I3PA 2NXNA 5E2QA 3NS5A 4QIEA 2B7BB 2RF2A 4CTAB 3BBFA 4J37A 1VRUB 3IXQA 1U47A 4BCAA 4HDHA 3BKFA 3HLUA 1XWLA 2E9ZA 2XWYA 3QMQA 1TELA 4CYUA 2CQPA 5CAAA 1TP7A 2IFXA 2V68A 4X64J 2J9DE 2XLJA 3C6UB 1SVDA 4EO8A 2HVZA 5LMNF 4FXVA 2YWGA 3K5LA 5LMNJ 5KG1A 1XNQF 3KHHA 4PQUB 3EYZA 3H5SA 3R8YA 3QLHA 2HHHF 2HHHJ 1SQFA 3MMAB 5J2NB 2LQ9A 1B70B 2V2ZA 1DRZA 1RP5A 2EKNA 5EX0A 2DK2A 1FI4A 5ETVA 3CJ3A 2XULA 2YWEA 4PG8A 2V4JA 2E9RX 2HRTA 1NUEA 3IN5A 3SZ2A 1NJIT 1RKJA 5GAGI 5I4MA 1N88A 3UNYA 3I31A 3F44A 2N4CA 4GVBA 4NL5A 3MMCB 4A8FA 1F0XA 3U1LA 4DU8A 3J7YU 3E2EA 4DU7A 5B0FA 3OTOF 1JX4A 3OTOJ 4RBTA 3H98A 1SC1B 3TA0A 1F5BA 3O44A 3NCRA 4MYUA 1IKXA 1HBMB 5F8HA 3Q8VA 2RQCA 4NEZA 1XQIA 4UUXA 2ZJRQ 1AXQA 2WSFC 3RRGA 4J9RA 3M4XA 1S0VA 5HBMB 1RWOB 1J5OB 2YNGB 2HZAA 2QMUB 2G0CA 2VPWB 1TKZB 2DRDA 1M1KT 1Q79A 2J7WA 2NREA 3BF4A 1HNZJ 1VC5A 4EO6A 2YX4A 1WC5A 1Q82T 3TZWA 3VCDA 3QFWA 2K7JA 3G6ES 4NLTA 1KBRA 3N4WA 2F8HA 2Z2MA 3IAS9 4ZVHA 3W62A 2Y1IA 5DDRC 3MM6A 3Q8RB 3DRYA 2EC2A 2X1GA 2G0IA 4GMKA 1H7WA 1DTQA 2MJNA 4IR1A 4ATNA 5A0YB 4GRSA 3THTA 4DL5A 3NGUA 2EK6A 1KQSR 1FTCA 2O66A 2J7KA 3EGNA 4ID5A 1GTEA 4DV0F 4DV0J 2CNNB 3RBEA 1F2HA 2M0GB 5D4PA 3HHLD 4CIOA 2CADA 1VRQC 4B9UA 4NMXA 3SFGA 4ZITA 4ECZA 4Q2MA 2WTFA 3VWSA 4PR6A 2IMWP 2AMCB 1OO0B 3GQCA 4DEZA 3AXKA 1DLOA 4RW7B 2E5LJ 3WZ0A 4ZP7A 2CJ9A 1EQ0A 1FJ7A 4MIBA 3FEZA 3AT1B 2AJFE 1WC4A 4QW9A 3C6TB 4YQWA 3RB3A 2LU2A 4A8QA 3R7BB 2DNRA 4NYPA 4CZCA 3K5NA 3IR6B 4BLGA 4L72B 1VBKA 2IRUA 2GO9A 2SXLA 4BS2A 1LV5A 4USMA 2AHOB 5ETTA 4LF4F 4Z7YA 2HHPA 4LRDA 5GMEA 4LF4J 2KVIA 4X4QA 1R31A 1JB0C 2IVFB 3KUGA 4Q0BA 1LW2B 2EWHA 1TL1B 2FVCA 4JBCA 1Y5IB 2J0QD 1ZZNA 3UVJB 4D3HA 3BPDA 3TJ9A 1WI6A 1OMSA 3K57A 4DQSA 5C25A 2C2DA 1PJ6A 3BSAA 2XO6A 3CMES 4LVNP 4M95A 2DJWA 2FJDB 4FS1A 4IRDA 3TA2A 2L9NA 2G1HA 1VJQA 2YX1A 3AH6A 3D1QA 4LFBF 4DG1A 5IM0A 4LFBJ 5KFHA 2AYMA 3Q2SC 1LNQA 2FPHX 2CJQA 4CLTA 2A18A 2R8GA 1PYOB 3HHLC 1RT6B 1G1XA 4IFYA 2COLA 3W9IA 4DQQA 3I4PA 5A6PA 3OBIA 4ZVGA 3R7SB 5AXKA 2PFFB 2P8IA 2RU9A 3VQSA 5LSLA 1HBUB 4DDFA 3JQKA 3UPFA 3A4TA 1F60B 2GVZB 2ZE2B 3N9UC 2YKNA 1ZAXA 3V6JA 3MCOA 4CDIA 4KH1B 3SI8A 4EU0A 3VAMA 4O0NA 2KT3A 2LCWA 3KK1B 4U7UD 1P6TA 4IKAA 2XI2A 3LP0A 4YFUA 4F3OA 3LWMA 3ENVA 2RS8A 3R5GA 1T3NA 2HW3A 5IT9U 5JUMA 2DGXA 5CABA 6FD1A 3BB5A 4C8KA 2R42A 1U8WA 1H73A 3HSDA 2R4FA 4QBUA 1FD2A 4ZVEA 4PPZA 4DX5A 5D0RA 4ZVFA 3VVUA 3OT9A 4DLGA 2R7RA 4KGKA 3FDSA 4FYWB 2M88A 1NRKA 1Q8KA 3D9BA 1IKYB 3G82A 3DLKB 3N5BA 2FVRA 1LFWA 3MAAB 3CCVS 1UPMB 1V9OA 1PBUA 1HPZB 4C97A 2XZWA 2NLWA 1TVRB 2ZDPA 1NH7A 2HHTA 4DR2F 3MMBA 4DR2J 2IIHA 4EK2A 3K5PA 2R8IA 1RAHB 2DXDA 4Z2XA 1TFWA 1CJVA 1T03B 3T5LA 4LSNA 3KLHB 1BXNA 2ZNZA 3M2RB 4DZDA 4RPFA 2HBYB 1NJWA 1FVSA 3MM8B 3DDNA 1APSA 1N34F 3I96A 1N34J 2MKKA 3F73A 4WZMA 5ETSA 2XY6A 2Z58B 2FC9A 3V4IA 1EX8A 3ZTSA 1GT8A 4A8WA 1XR5A 5D0HA 2BKOA 5KG2A 1AYEA 1S1VB 4WE1A 1RHJB 4U8YA 2WOMA 4JV2A 4GKKF 2W2QP 1KOOA 2NR0A 1S6PB 4UOCA 4IRCA 1O5JA 2FY1A 2MKYA 2G0JA 4Y2AA 2QLJB 4FZVA 1X4CA 4FF4A 1BLUA 1XNRF 2H4YB 2ZD1A 1XNRJ 4DSEA 1Y11A 3HHNB 4M5IA 2OPRB 2JJ4D 3DI6A 2H1YA 3QT8A 2OGUA 3CIZA 3KMSA 4Y28C 1KNZA 4ZPVR 3LWLA 5L1KA 1CS4A 2EFQA 4ELVA 3AXMA 2PMZD 2VPXB 5F9NA 2W9AA 2VQFF 5D4LA 2VQFJ 1SC3B 3A13A 5GAGU 2IDEA 1K44A 4RL1A 1VFJA 2UUTA 1WOOA 2MKJA 2HHVA 3OTBA 5LSOA 3KHGA 3RG6A 2QE5A 3ZTPA 1DY3A 3V6KA 4BDPA 3D1OA 2DPIA 1EB0A 1YZ6A 3B78A 2IBKA 4DPTA 3HHLA 1MU2B 5IT4A 5MAOA 4FP9A 5DQGA 2PIIA 3GG1A 4QYZK 1S1WB 4OYXA 1MROB 2R7UA 1ZZFA 3KKFA 2RDDA 2JEFA 1T9TA 1UZDA 1VQ4S 1JK9B 1NKCA 2FVQA 3BGRA 5HQLA 3IRWP 4OZ1A 4N77A 3VR1A 4LJMA 2W24A 4IG3B 4X4NA 1U09A 1G3OA 1UVMA 3DOMB 4RBVA 3C16A 4J9UE 3M30A 3I0SB 4X2BA 3Q2TC 3I9ZA 3FZ2A 2E1CA 4DF4A 4FF3A 4RNHA 3NNHA 4HR2A 4NLOA 1SH2A 2XS7A 2B9EA 4OFZA 1WC3A 2C22A 2VB6A 4UOHA 2DR8A 1XC9A 5IOLA 3JSYA 5M2UA 2OH2A 2Y8YA 3C14B 1RWNB 2F63A 2V8GA 5B7WA 1S57A 2RKIA 4HI1A 1K1QA 1KP6A 1U6ZA 4YY3F 3DOKA 4J9KA 4YY3J 1C4AA 1XEZA 4OYOA 5LXRA 4OI2A 1K8AT 5I3QA 2HLTA 1SL0A 4ETXA 4EBEA 1R3NA 1RT7A 3CC4S 4ES1A 1VBYA 4OL8A 4RZRA 4C3LA 3MTJA 3TI0A 2EFNA 3MWBA 1OYDA 4O44B 4OHYA 1S6QB 2AWZA 2POKA 4W4MA 2ATLA 3ET6A 4FXDA 4DV5F 5C5JA 3MXHP 4CNZA 3RGIA 4LQ3A 1N5YB 2VC1A 2RUSA 4WIIA 2NQPA 4JUZA 3VQTA 3SQGA 4HT7A 3DM2A 2AJ1A 3RW6A 3IG1A 3VHQA 5IS2A 5K20B 1D3WA 2VBYA 1WF1A 3RAXA 2K3KA 3CJ5A 2R8JA 1F2GA 2DHAA 2AEJA 2ACYA 4LSLA 4TN2A 3CW2C 5KG7A 2V1SA 2W1BA 1BD6A 1QDUB 5HN0A 1NU4A 2B8PA 3EVWA 1AZSA 3TEHB 4HHHA 1AA1B 1F9EB 2L9WA 1RCOB 2X3DA 4QWCA 5C24A 2HNZB 1LXJA 3SCJE 3UDVA 2AZ1A 3AX5A 5HI7A 5KG5A 2VONA 1RABB 2QZ8A 2VG5A 1TKXB 1R8CA 1YK9A 4G65A 2CZVC 3MOJB 2ASYA 1WTBA 3G6XA 1KQGB 3GCXP 4HDGA 2YNIA 1XMBA 4QYZJ 4NLDA 3GONA 4I4BA 1VBZA 1V3RA 2PEBA 3KLEB 4LF2A 1RWXB 3EVMA 1EAYC 2KM8B 4A47A 1U4BA 1N5VA 4NZ0A 3DLHA 4WCEQ 1M5OC 1O51A 2M9KA 4CLSA 1T9UA 1RA7A 5KFOA 4O4RA 1XMOF 1XMOJ 4OHXA 3PKYA 3VV2B 1YJRA 5DM7Q 1UCNA 1MMLA 1U2FA 5B08A 1ZS6A 1D0EA 2PI5A 1YJNS 2CA9A 3QIPA 3VGTA 3QO9B 1Q95G 2PO4A 1WHYA 4JI0F 1HR0F 1HR0J 3HHDA 3TUPA 3S01A 4KSEB 5A8RA 4U7CA 2A3JA 5HMXA 4QCLA 2OSRA 5DRKA 4URQU 4OQJA 4CO3A 1PAEX 4I6AA 5GMKa 5DQIA 2QO3A 3HCXA 1QSSA 2V8PA 5DJBA 5IXUA 1CSJA 2DH7A 3DXBA 5H9FJ 4RW9A 3RRKA 4J9PA 1SCJB 2MLXA 3OVBA 2VKZG 2XG8A 3BSNA 3I32A 2VG6A 5D3GB 3DLLQ 2E7VA 2XZTB 2IM1A 4F02A 2FLNA 1C1BA 4IOAQ 1BE4A 1WELA 2BE7D 3GYNA 2VBXA 4ECQA 1CULB 4F4WA 9RUBA 1P8GA 1ZYQA 1FKPA 4C0OC 3NBPB 1KTQA 2EVZA 2ZH3A 2ZJPQ 1JLFB 1Q7LB 4FYDA 2DNOA 3F56A 1E6VB 1R6YA 2MQNA 1RBAA 3H5UA 5EDWA 2IVMA 3HI9A 4OZJA 4C9DA 3JXOA 5CYQA 3HD1A 1GNKA 1NDLA 4LQ9A 2V2VA 3BM7A 3ZXWA 2I6WA 4LF9F 2HSEB 3G8SA 4DFMA 4LF9J 1VQ8S 3KK3B 2F4VF 2R2SA 1RLCL 2EFGA 1A9NB 1PJ5A 1F9FA 3HZGA 1JJCB 2DB1A 2OMLA 2W9BA 2Z30B 2EFPA 2XTDA 3C15B 2XB2D 3AODA 4TQSA 1RT4B 1NSPA 1LQ9A 2EEYA 3H42A 4ZP9A 3RRHA 5EX3A 2OELA 2GAGC 1E6YA 3N6MA 3CD7A 2MZSA 2J6TA 4O0IA 2I9SA 5KFKA 4RUHA 1WF2A 4P2XA 4ZPWR 4LRCA 2B5JA 1S1UB 1WHXA 3M6WA 3MD1A 2O1PA 4DQIA 2BOPA 4NEYA 4QU7A 1P1TA 3PIPQ 3TR5A 3OHAA 2CDQA 1X4FA 5KFRA 2UP1A 3PYGA 2HHWA 1CJUA 2XSFA 4I68A 2ZH8A 3LUYA 2E29A 1TV6A 2XGPA 2BABA 3CIMA 3DYAA 5C42A 1NBEB 1GQEA 3K5MA 1RT1B 1U1NA 3TP2A 3Q0AA 1CC8A 4K2JA 1MN7A 4I2QB 3PVXA 4CH1A 3MR5A 2GMHA 4F4YA 4UOGA 1T0TV 5D0GA 3DMJA 4ZMMA 2AZ3A 2C3MA 2QFIA 2MLYA 1WEXA 1UVNA 2R7SA 4FPRA 3PM9A 3UCGA 2CQBA 4TQRA 4QU6A 5CYMA 3IR5B 1UP1A 2HHSA 2OUGA 2W2NP 1KHWA 4KPYA 4NA3A 1N5TA 5LJ5Y 4PUOB 4J9QA 3H4DA 2ALZA 3T9ZA 1YI2S 1FESA 4HTIA 2WK4A 2VA2A 1R7IA 1S79A 1G6BA 4LF7F 4DPOA 4DUZF 4LF7J 2XMAA 4DUZJ 3H8YA 3D6HB 2C2RA 4ER8A 4LVOP 3GB0A 5LM7E 3M1VA 4AT1B 3EXYA 3M8ZA 4USTA 4A8OA 1VQ9S 4MFBA 1NO8A 1RAEB 4DFJA 3PO4A 3MCMA 4DCPB 5A8KA 2ZBPA 4ES2A 4YR2A 3PX6A 2UXDF 2JH3A 3GV8B 4X4PA 2UXDJ 3SYZA 4WFXA 4USIA 3OLAA 5H9EK 2OEJA 2ZC3A 1FERA 2HK2A 3L7OA 1DFDA 2ZOGA 1X9SA 1H98A 4WF9Q 1IUJA 4ZOSA 5B0AA 4C8NA 3OJUA 4JI7F 1UAWA 4WFZA 2E5HA 5AE2A 3EUNA 4XPEA 3C46A 2BE2B 1XJWB 4DPUA 1ICEB 1NK8A 1WG1A 2VG7A 1GH8A 3N79A 2H5JB 4F7VA 1K0VA 2RT3A 4DV6F 4U95A 3F41A 2QEXS 1BQMA 2NXEA 4M94A 3KG1A 3PNIA 1SC4B 1LW0A 2Y0SD 1NNDA 1HARA 2IA0A 1MNEA 4IDKB 4MJKA 3DLBA 2CXEA 3IS9B 3DLGA 4I56A 2MQ8A 1VC6A 2EG2A 3UN3A 4TU7A 3MM5B 4PYDA 1U0HA 1WEYA 4I0WA 1TL3A 3MECB 2RB7A 2DIVA 3A3NB 2OEMA 3CTRA 1N48A 3CDUA 1JWWA 2DITA 1RBOB 3VALA 2XMMA 2XLIA 3GTYX 3ITHB 2J9CA 1X5PA 2YNFB 3H4BA 5C2GA 1WF0A 5ITHA 3BO4A 1U48A 3LOUA 2AT1B 2GQCA 3HPOA 3QWUA 1TK0A 3D4JA 3KG0A 2BW7A 1S97A 1JKHA 2HRYA 2WHOA 1S9GB 4IH5A 1VS3A 5T7LA 2Z0GA 4X4UA 1KDNA 3GR0A 2JC1A 1WNEA 1JLGA 4NLXA 2ERRA 2YX7A 5J2MA 4I64A 1B99A 1RTDB 2OKQA 1FHTA 5KT5A 2BRLA 1JXLA 3RB4A 3BQ0A 2P6TA 4L74A 1VK8A 3RBDA 4RBUA 5IQ6A 1U1PA 4CO0A 1RKIA 1ZM2A 3QSIA 1VQ5S 2HFUA 2HQIA 2NCKL 4XO0A 3Q86A 2QX0A 3PW7A 4KGXB 4RW4B 4CCHA 2X3GA 1WWHA 3H7HB 1S9EB 4Y2IA 3HK2A 5DETA 4KHPF 4KHPJ 3L7UA 2M2BA 2BACA 1HIYA 2EXUA 4OZNA 4B3RJ 1ZAVA 4GKJF 3TVYA 1FXDA 1SJFA 4CRJA 5CH7B 4P9SA 3D3BJ 1T94A 2VFVA 4QZVB 3UI3A 1M5KC 2MKIA 1CEZA 4J9VA 3M6XA 3TQEA 5A8WB 2RRBA 3W2WA 3GWCA 1WKKA 4KV8A 3MCNA 2XMUA 2ASLA 3IP0A 4DL4A 1NKBA 2BJ8A 2BR0A 2CFXA 1QUVA 2H48B 1T9YA 1K9MT 4HEA9 4EI2A 1D8ZA 2KZMA 3HVRA 5FLXY 1QTMA 3K8WA 4JI5F 2ZKUA 3DGPB 3IO1A 4PXCA 3G4SS 4JI5J 1FRJA 2BQUA 3HVTB 1D09B 2QRRA 2LEBA 1QJHA 3Q8SB 5D4OA 5B0EA 1W2BR 3H40A 3V6DB 3ENAA 3OFEA 3RB6A 1YQHA 4AE5A 1CJKA 2VPZB 1N54B 2CQ2A 2K1RA 3ZZ0A 1R8AA 5RUBA 2Q6BA 3CJKA 3ELHA 1QE1B 3AWRA 3VZHA 1X0PA 3QJPA 1Q8BA 5HVHA 2CPXA 2RD5C 4DX8H 1HQUA 2RU3A 4OZ0A 1WD6A 2NPFA 1FFWB 4YP3A 3CSKA 1C0UB 3NY0A 2OFHX 4DUYF 3HKZD 3AJDA 3F0NA 4L76A 5HK4A 2RH3A 3EPIA 2J76E 1TQLA 2Y1RI 1B7FA 2OSQA 2Y1JA 3TNVA 3FQKA 1C4CA 4ZPCA 2NSBA 1H2TZ 2DR6A 1HA1A 2MTLA 4UY8T 3H2UB 4USHA 3JSRA 4RU2A 4F26A 3MEDB 3QZ8A 3QRPA 4JI8F 4JI8J 4ZDNA 2R7TA 4DBQA 3HXMA 5E3QA 2EFVA 5F0WA 1LEOA 4HACB 4N41A 1S48A 2QG9B 4M63A 3C3LA 5KFWA 2XNQA 4B3OB 4F4ZA 1JLBB 3LGHA 2DGUA 4JV1A 4J91A 4KFBA 3TZXA 2W25A 4R5PA 4CYUB 2APOA 2OJ3A 1RHQB 1TMJA 1X4DA 3PXGa 3K5OA 3MUMP 2QV6A 3OFHA 2B6AB 2D69A 4ZIWA 2DPJA 3NS6A 2CJYB 4JI2F 3MAQA 4JI2J 5HJYA 1U6BA 1BY9A 1PSDA 1P27B 4WP8A 5FDLB 4ZA1A 3GCWP 4IR9A 5J1NA 3B82A 1Y9OA 4Y3CA 3OL7A 1NJZA 4KGMA 2BQRA 1I94F 3CCRS 4ZHRA 4QR1A 4OX9F 3GSIA 2ILZA 4UTGA 5BXIA 4ZPTR 3MDFA 3BS9A 3C2PA 2HGLA 1ZAWA 2AEMA 1IBCB 2DBBA 1EETA 4H4MB 2XSJA 4S0MA 5J1EA 1Q4RA 4ECVA 1SQEA 2LXIA 1RWVB 4WIQA 1S7IA 3FC9A 1DZ5A 2YNHA 2GQQA 1T02A 2BBEA 1HMVB 1SBRA 2KYXA 1FK9A 3TARA 5M2PA 5IV3A 4UQGA 3G9CA 1BQNA 1IKWA 1KOHA 2VBWA 1RADB 1JLEB 2IAJB 1D1UA 2QSWA 1TL5A 3AJ2A 4B9MA 2AQ4A 3OUYA 2B0GA 4FPIA 4C8LA 3EPGA 3LALA 2KN4A 4DQRA 4LIRA 2IRXA 4ENOA 1QSLA 2MSSA 5FD1A 1Y00A 1NSQA 3CJ2A 5E33A 4WK1A 3PY8A 4LFAF 3B4MA 4LFAJ 2KHCA 3UDCA 2AJ0A 4N76A 4RW8A 4M5LA 2MZQA 1T9WA 1CBKA 5AJ3F 2VJVA 5AJ3J 4DR3F 5JMNA 4I6YA 4TY9A 3T1YF 1RZMA 1QVGR 3T1YJ 3L7PA 4ICLA 4WWSA 1VBXA 1KS2A 1SUQB 1DQ9A 1FRMA 1LWEA 2KZZA 1C0TB 2WVDA 2EFOA 3AOBA 5L1LA 3HKWA 3QGPA 1VC0A 2EK1A 1QVFR 4NA2A 3BN4A 2OD6A 2MZRA 4FS2A 3CMAS 1U1KA 1PYTA 3TRGA 3KDNA 4DLEA 2DH8A 3SEOA 1RAGB 1DAXA 4H4OB 5DM6Q 5LXYA 3P3DA 4PXDA 3DRPA 5HMYA 3FK4A 2ZITA 4YB1P 3V6HA 1CQMA 2H5IB 3M2VB 4DV3F 5GAEI 4DV3J 2CQGA 1RAIB 1WC0A 3NRBA 4CTAA 4E0DA 1NEEA 3Q8UA 4CLPA 4B08A 1VRUA 1KHVA 3C8YA 3VGSA 3BYPA 2KJWA 2WBRA 2KXFA 2XNRA 2M70A 4UZBA 2AEFA 4L75A 1DURA 1KKHA 4N8OA 3AA8A 1FO1A 3TYTA 1B3TA 3FQLA 2MJUA 3C6UA 5KG0A 2OD4A 5F8JA 4RW6B 1KFDA 4PQUA 4AQYF 3T3FA 3MHYA 4AQYJ 2UXCF 2UXCJ 1FE0A 4KYZA 1N6QB 4F2RA 1B7YB 2W9CB 1NDPA 4QWAA 2YPZA 4ZVQB 3MMAA 5J2NA 4NASA 1RHKB 2DNPA 2ZVIA 3TWZA 2F8EX 1HW8A 2DO4A 2W7OA 2XMTA 4KR0B 3TX8A 4J90A 2DNNA 1F5CA 3VAGA 1HW9A 2KRRA 3QZ7A 2N7CA 1NSAA 3FBFA 3ZTOA 1HWLA 2FJVA 1DTTB 2GIRA 4DR1F 4U7UK 1VQMS 1FA0A 1YIJS 4FYXB 3FSIA 3KK2B 3H90A 3US5A 3MMCA 4A48A 2IY5B 3JAMU 4G1PA 4ILMA 1M1GA 4CO5A 2E44A 2DRAA 1F3VA 1ZETA 4WFYA 3VAHA 2FDNA 1S9FA 4FNIA 1TAUA 1HHTP 5EWFA 1HBMA 3ZZYA 3TX0A 4ED4A 4C3KA 2LQ5A 3AD9C 1XR7A 1Z2ZA 5IC4B 2XWXA 3DHXA 2DNYA 4A8MP 2J6SA 4DMZA 2MQLA 3E01B 5HBMA 2B3TB 1NCLA 1J5OA 4C98A 2YNGA 4CNYA 3KOAA 3LP2B 1TKZA 2Z2ZA 2I8EA 1FWPA 4IH6A 5CHCB 2MQMA 4M5KA 2EKYA 1L5UA 3ILIA 3SSSA 4ED2A 1PO6A 1H7XA 2IHR1 2QSFA 2P9CA 4ECWA 2WRMA 2NPIA 5K8OA 1UUJA 2N3OA 1BWEA 2JFDA 3OR1B 2KFYA 2CDRB 1MN9A 5A0YA 2HFOA 4XIUA 3TEGA 2QLWA 1M90T 2CAJA 3L4BC 2LP4A 2H54B 4ID8A 4KHMA 4F4XA 1JLAB 1T95A 4QJVA 1VQPS 4J9MA 4F0MA 2W4DA 2K7KA 3MPUB 1NZ8A 3NNAA 2HFVA 5G0RB 1HNVB 4KC5A 3ZZTA 3DLEB 2DTJA 1SJ3P 5CCMA 2EC0A 3OL8A 3IM8A 4PXEA 2OPPB 2MKSA 3UCUP 4MKYA 1YJUA 4CLYA 3KLIB 4KB7A 4RW7A 3CB4A 4NZ6A 2LYVA 2IMOA 3HDSA 2CQDA 2P2CB 4DX7A 3C6TA 4RUBA 4PG4A 2WVEA 1QAJA 2XY7A 2CPYA 2IJFA 1UFLA 2KB2A 4M8LA 4I69A 2RNEA 4HL9A 3A1YG 1Q8LA 3WC0A 1S6OA 2UU9F 3BO2A 3OSPA 4J5OA 1WUUA 2JWNA 5IFMA 4M5JA 1AUSL 5D15A 4ANCA 1X0FA 3QT5A 2KU7A 5DZ6A 3GJQB 2BYCA 2CZ4A 1P9QC 4P7TA 2HWHA 2IVYA 2F1FA 2XS2A 1LW2A 4ZLLA 4TY8B 1WG5A 3KTQA 3CE8A 2X7IA 2I38A 4X65F 4X65J 1KQFB 4ANDA 3UVJA 4N56A 4GVLA 2OIHA 4K4UA 3FMWA 3NOCA 3R5CA 3PYFA 2UUCF 4RUAA 1HI8A 1FDAA 3UD3P 4FYVB 2OHDA 3DRRB 4Z37A 2JL9A 3QJLA 1FJGF 1UEKA 1FJGJ 1FD8A 1KLMB 4CWBA 4Y65A 1IWGA 1RT6A 4A46A 2MKCA 1FVQA 5C2CA 1WG4A 2AJQA 4ZS6A 1HBUA 2GMLA 4DSLA 4UY85 1VQNS 3TAMB 4OHVA 1Z4UA 3C16B 3W63A 2GVZA 2ZE2A 3G96A 4OYBA 4B3MF 2LDIA 1XN9A 5KG6A 4B3MJ 3K59A 4A8YA 2C28A 2D3O1 2GIQA 4OI3A 3PR4A 4IO1A 3ENWA 2N7YA 4NLYA 3KK1A 4RX6A 1X8DA 2IJNA 2XTJP 3KHLA 5LJ3Y 2AYGA 3MOZA 4FF2A 4FXWA 2QC3A 3DU5A 2R2TA
chains in the Genus database with same CATH topology
3GYXB 1K1SA 3KYLA 3NMRA 4C0BA 2AD9A 5HI7A 5KG5A 4ED0A 3PX0A 1DQAA 4K4TA 1XERA 2CIMA 2VFTA 5KFFA 4FNHA 1Y0HA 2QZ8A 2VONA 3OV7A 2J8AA 4L3NA 2LQBA 5A8KB 2ILYA 3X1LB 3K0JA 2VG5A 1M5HA 3DU6A 2ZHAA 1JLCB 4O3PA 2E1RA 5E3AA 1TKXB 1R8CA 3K2YA 4C8OA 3TUIC 3O3LA 2MB0B 2XO7A 4HH0A 2CZVC 3BJYA 1DJ0A 1OSDA 3MOJB 2ASYA 1IKYA 5HL7Q 2DISA 2MHEA 1X4BA 1JJ4A 5JJBA 4ZPAA 3DLKA 3QYYA 2CJBA 1PC5A 1LWCB 1SJRA 4OJHA 3G6XA 1WTBA 1KQGB 3LP1B 3VTIA 5L1JA 1UJ6A 3ICLA 1ROFA 2BM0A 2OLWA 4HLBA 3RW7A 4HDGA 3FMBA 4K4WA 4DS4A 4HT5A 2YNIA 1XMBA 4QYZJ 1HPZA 5JVHQ 4NLDA 4I4BA 3FNNA 2W8KA 1VBZA 1SC6A 1TVRA 3AAWB 1DTTA 1V3RA 2BQ3A 1S0OA 5DLGA 2D9OA 3KLEB 1TUVA 5BR8F 2DCLA 2A10A 3NCQA 3KK2A 3PO5A 2PT0A 4MIAA 3TA1A 2PI4A 4MKAA 3IWNC 3PKMA 2M7SA 1L3SA 4WZQA 2KM8B 4A47A 1U4BA 2J7UA 2XMKA 4QW8A 1N5VA 4NZ0A 2RS2A 3LH2S 3DLHA 2MQPA 1HNIB 4WCEQ 1M5OC 2YVSA 5J2QB 1O51A 1X4GA 2M9KA 3CXCR 4DSFA 2VG7B 1RA7A 3T6BA 2J0XA 1JLQB 1HFEL 4ED5A 1N52B 1S77D 4Q43A 5KFOA 4O4RA 1T03A 4LIWA 4BWJA 1YG0A 1XMOF 2HS4A 5K9FA 3VAIA 2L48A 3BREA 5GADU 4OI6A 3KLHA 2WSEC 3FSYA 2UV8A 1XMQF 3CWJA 3M2RA 4OHXA 2ZBCA 3PKYA 4AUKA 4DL6A 1IBKF 1BQMB 1K0TA 2XS5A 1N5QA 4JV5F 5IT0A 1YJRA 3PJWA 4DF8A 5DM7Q 4HKQA 2B7CB 3ETOA 5BYQA 1MMLA 1U2FA 2VOOA 5B08A 4DSKA 1FXLA 4WYWA 2HGNA 2LEAA 4OI0A 3CT9A 3MM8A 1VIXA 2KRBA 2HHQA 2YKOA 1D0EA 2O5DA 2CQ4A 1LW0B 2PI5A 1YJNS 2EBGA 4TLRA 5CCLA 3RR8A 4WKYA 2HS3A 4R8UB 2GNKA 4UW2A 5JXSA 3QIPA 4O23A 2LA4A 1HWJA 1N4LA 2L08A 3U02A 4KRWA 1IM4A 4LUBA 2DGQA 3QO9B 2PEHA 1N0UA 3AJ1A 2PO4A 3E01A 1WHYA 4P7VA 4QIWD 1SKRA 4JI0F 4CO2A 3Q8QB 2BUNA 3M32B 3DLGB 2XY5A 1URRA 1HR0F 4CT8A 3HM9A 4QQBA 4R0JA 3HHDA 3S01A 4KSEB 5A8RA 4U7CA 1ZPVA 3RR7A 2A3JA 1TL3B 1S1VA 3C66A 3LP2A 5HMXA 1RT3B 4QCLA 3M8RA 4NLQA 4F3MA 1SH3A 2Z4PA 3VAFA 3CJ0A 1T7PA 2OSRA 3H2VE 2DH9A 3NP5A 3H5XA 1S6UA 2DIUA 4KHRA