4K4SA

Poliovirus polymerase elongation complex (r3_form)
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
462
structure length
462
Chain Sequence
b'GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Structures of coxsackievirus, rhinovirus, and poliovirus polymerase elongation complexes solved by engineering RNA mediated crystal contacts.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
total genus 148
structure length 462
sequence length 462
chains with identical sequence E
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4k4sA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4k4sA02
2OH2A 2W9CA 3N6MA 3KLIB 4PWDB 4RW8A 3CO9A 4ZPBA 2OPRA 5C25A 1S9EA 3TAMA 4NYZA 3KK2A 3KLHB 3MEGA 1C0TB 4R5PA 5EWEA 2XCPA 2VG7B 4X2BA 2R8IA 1ZTTA 2QV6A 4ICLB 3T5HA 1BQMA 1RT4A 1HMVB 4TY9A 5KFDA 4I7FB 4ZPAA 1RT5B 2YNHB 4MIBA 5C42A 2XI2A 2WOMA 4ED1A 3LAMA 2BQ3A 3SI8A 2ZE2A 1C0UB 4H4MA 4XPCA 2IM0A 3E01B 3Q8PB 3TVKA 3DRRB 3GIMA 2UUTA 3KLFB 3QLHA 5DG7A 1JLEA 1VRTB 1GX6A 3OSNA 3N6LA 1NHUA 3NAIA 3DDKA 2I5JB 2V0NA 3LP1B 3Q8SB 5J2PA 1S0OA 3GYNA 4RZRA 4YMEA 3H5YA 4ED8A 3V6HA 4JV0A 1S10A 3KK3B 4PUOB 1HYSB 4MFBA 5F8NA 4ID5A 3T19A 3V6DB 4WFYA 5EDWA 4O44B 5KG0A 3JYTB 3MEDA 1S0NA 1N5YB 4MK9A 2IA6A 3UQSA 3GV5B 2FJXA 3M8PA 3CJ5A 1S1TB 3MR6A 4F50A 3JSMA 4MK8A 4WZMA 4TQRA 1RYRA 3CJ2A 1RTDA 1RA6A 4DL7A 3NAHA 1UWBB 3FDSA 3VQSA 3MR3A 2WK4A 4IH6A 1BQNB 4NLGA 3BREA 3QGGA 3BSNA 3KLIA 4ECTA 5I42A 4PWDA 4K4TA 4WYLA 1K1SA 4XPEA 3IGVA 2ASDA 5KFUA 1S9FA 3KLHA 1C0TA 1S1XB 1TV6B 3SFUA 2J6SA 4O4RA 4K4WA 4NLXA 1HMVA 1S1VB 4I7FA 1RT5A 5F8GA 4Y34A 3UR0A 4WE1B 4O3RA 3BQ2A 1C0UA 2C2RA 4J9PA 2JLEA 4KHRA 3IN5A 3MECB 3DRRA 2RKIB 3KLFA 3PZPA 2C2DA 2XWYA 4MKBA 1KLMA 2B5JB 1T03B 3OHBA 2I5JA 1N56A 3BGRB 3PW7A 3MFIA 3HVAA 1JIHA 3SFGA 5F8IA 2W9BA 3PW5A 4PUOA 3MEEB 5EUHA 2HWIA 3KK3A 1HYSA 4K4SA 5DLGA 3V6DA 1S1WB 3M9MB 4Q8FA 3OL9A 1S9GB 3PW4A 4O44A 3JYTA 2W7PA 2BQRA 1N5YA 1XR6A 2BANB 4R8UB 4DL6A 2FVRA 2R8KA 3Q8QB 2R2UA 1S1TA 4DL2A 3H2LA 3GQCA 1HQEB 1FKPA 3DLEB 4F4XA 5F8JA 4F4YA 5J2MA 3RB6A 1UWBA 4IKAA 1JLFB 5DGBA 4K4VA 3H4BA 2XC9A 1RT2B 4J9LA 2IC3B 4KE5A 1LW0B 3PVXA 1HQUB 2WCXA 4WXOA 3IG1B 5L9XA 1TV6A 4KFBB 3OSPA 4ECSA 3MR5A 4PQUB 4YR2A 1SH2A 4NLWA 3NL0A 1ZETA 1S0MA 1RTHB 4ZVGA 3KHRA 4O3NA 3CJ4A 4WE1A 4RW6B 4ZVHA 3I5BA 5J2QB 1S4FA 3MECA 2YKMB 1TKXB 2RKIA 5KFOA 1T03A 1REVB 3IGNA 4RNMA 5KG1A 1YVFA 2JEJA 1IM4A 5KFFA 2R8JA 3HVWA 3MEEA 1JLGA 1S1WA 4TLRA 4WXWA 5C5JA 1VRUB 1S9GA 2V4RA 1SUQB 2ASJA 5L1LA 1HNVB 2BANA 4R8UA 3ITHB 3Q8RB 5K14B 4IFYA 4NLSA 1C1BB 3IS9A 2HNZB 1HQEA 3DRPB 5KT7A 1S6PB 3M9OB 2ATLA 4ZHRB 1JLCA 3FFIB 4QWEA 1JLFA 1IKXA 3V4IB 2J6TA 1RT2A 3BSAA 5KFWA 3QZ8A 1SH3A 1EP4B 1OS5A 2IC3A 1LW0A 4F4WA 4WFXA 2OPQB 1LWCB 1RA7A 4KKOB 3DRSA 1J5OB 3IG1A 1C1CB 2IM3A 4KFBA 3RB3A 4PQUA 1TP7A 4URSA 1RTIB 3PHEA 3KHHA 3GV8B 2AQ4A 2FVQA 1RTHA 4NLTA 3QIPB 5KFXA 4RUAA 3GV7B 4EBEA 5HLFB 3KLVA 2YNIB 1QAIA 5C24A 2V4QA 5J2QA 5KG4A 3KLEB 2ZD1B 4IG3A 2JEIA 5KT6A 1TKXA 3MF5A 4EO6A 5DQHA 1N6QB 1REVA 4EYHB 3NBPB 4NRUA 4Q0BB 4ZP7A 2YNFB 3H59A 5HP1B 5L1KA 3GILA 2ALZA 1VRUA 4I2PB 3LANA 1SUQA 3CVKA 3T5KA 1HNVA 3D28A 5KFPA 1JLQB 3ITHA 3FRZA 5K14A 4QWBA 2R8GA 5CYMB 4DEZA 1C1BA 3DRPA 4HYKA 2IJFA 5KG3A 4TQSA 1R0AB 3LALA 1TQLA 1S6PA 2AGQA 3MR2A 2VA3A 1XR5A 5KT2A 4ZHRA 3DMJB 3FFIA 4RUCA 2OPPB 1S97A 3H5SA 5KFSA 1EP4A 4B3OB 3OHAA 3RAQA 3CJ0A 3H5UA 1LWCA 3I0RB 4KKOA 1J5OA 2CJQA 4QWDA 3TQ1A 4IRKA 1C1CA 1KHVA 3EPIA 3KJVB 3RB0A 1RTIA 2B6AB 4G3IA 3RBDA 3QIPA 4RW9B 1JKHB 2YNIA 4NLOA 3QYYA 4H4OB 3KLEA 2VG7A 2ZD1A 4NZ0A 1SH0A 3OLAA 4ICLA 4EEYA 5KT3A 1N6QA 2YKNB 4O3QA 4NRTA 4K4ZA 2YNHA 3NBPA 4I2QB 4RNOA 2YNFA 4ECWA 4FBUA 3BSOA 4J9SA 3E01A 4RNHA 2R2RA 2W8KA 4I2PA 2GIRA 4J9KA 1LW2B 1I6JA 4M95A 1VRTA 1JLQA 3OLBA 3CJ3A 1LWFB 3KMSA 3HKWA 3LP1A 4ED7A 3ISNC 4MKAA 5DQGA 5CYMA 3M8QB 4FS2A 5F8MA 2FVPA 4LQ9A 2D3ZA 1TKTB 1R0AA 1JLAB 4IRCA 4DL5A 4K4YA 2F8EX 4TYBA 3DMJA 1XR7A 2E9ZA 1NHVA 2OPPA 4G1QB 4O4GB 4MH8A 4K4UA 1IKVB 4B3OA 2HMIB 2RDJA 2UVRA 3I0RA 1D0EA 1BQNA 3CDEA 3BR9A 3I5CA 4LSNB 1TVRB 4ZPCA 4TXSA 3GIKA 4Y2CA 5F9NA 5KFKA 3KJVA 4EBCA 3MTKA 4ECXA 3KHLA 3T5JA 2B6AA 3T5LA 1IKYB 4RW9A 5JUMA 1JKHA 3C6UB 1CSJA 4KB7A 2OPSB 2IM2A 4H4OA 2BE2B 2R2SA 3RBEA 2V9WA 1S1XA 3I0SB 4Y3CA 3KNAA 2JC0A 1RT3B 3DLGB 5KFLA 2UUWA 4U7CA 4Q45A 2YKNA 2W7OA 4ZP9A 1S1VA 5KFJA 4I2QA 4LSLB 5F9LA 4ZMMA 3FSIA 4J9MA 2HWHA 3NMAA 2FVCA 2RDIA 1S48A 3T1AA 1LW2A 4TN2A 5KFEA 4ECVA 2WONB 4DL4A 2B5JA 4KAIA 4EBDA 2FJWA 1LWFA 3BGRA 2FLNA 2QE5A 5DG9A 1RTJB 5J2NB 1DLOB 1TL1B 4YR3A 2XI3A 3FQKA 2ILZA 1K1QA 3GIIA 2BRLA 1TKTA 5KG6A 3RAXA 2W9AA 2AWZA 4GC6A 4ED3A 1D1UA 4G1QA 4YR0A 2J6UA 4KHMA 4ZP8A 4KV8B 2CKWA 1IKVA 3DLEA 4FBTA 5C25B 4IRDA 2HMIA 3BSCA 4GC7A 1QAJA 2AX0A 4NCGB 4QPXA 5L1IA 3QIDA 4IG0B 4IOBA 4LSNA 2D41A 2D7SA 2IMWP 1JX4A 5KFAA 3HHKA 4ED6A 5T14A 1HQUA 2BQUA 1RDRA 1IKYA 2ZE2B 4URGA 3C6UA 5DG8A 5KG2A 2OPSA 4NLVA 2BE2A 4RNNA 4ED0A 3I0SA 2GIQA 4YP3A 1RT1B 5KFIA 1SV5B 3RB4A 4NLPA 2DPJA 3CIZA 4Q43A 5KFYA 1TL3B 4R0EA 4RW6A 3M9NB 2BRKA 3C6TB 4RNFA 2DPIA 2YKMA 2WRMA 5KFRA 3CWJA 1RYSA 4WFZA 4RW7B 5KFVA 4JV1A 2BR0A 5J2NA 1DLOA 1TL1A 3PJWA 5CYQB 3ISND 3DI6B 5HBMB 4OL8A 3PW0A 4QWCA 5KFBA 3G86A 4WZQA 1S1UB 2AGPA 5KFCA 5I42B 3CDWA 2HNZA 2C2EA 2E9TA 4KV8A 3QO9B 1FKOB 2W8LA 3D5MA 2IJNA 4NCGA 2AGOA 2O5DA 1EETB 3V4IA 1IKWB 4IG0A 2HNDB 5KFQA 3DOLB 2RF2B 2YNGB 1JXLA 3KLGB 3H5XA 2E9RX 1NNDA 2OPQA 5DLFA 2IAJB 2XGPA 5KG5A 4F4ZA 4URQU 1S6QB 4HKQA 4O3SA 3NKYA 2HNYB 1MMLA 4IH5A 5KFHA 5DGAA 1KLMB 1RT1A 4ECYA 1SV5A 4J9OA 2JEGA 2W9BB 1RT7B 3LP2B 1TL3A 4NLRA 1T94A 2JC1A 5KFMA 4TYAA 4IQXA 5HLFA 2ASLA 3G6YA 4IR9A 4DL3A 2D3UA 2ZKUA 3C6TA 3BQ1A 4ECZA 4MIAA 3QZ7A 4ED2A 2HAIA 5J1EB 3V6KA 2VG5B 1RT6B 4RW7A 2EC0A 2XGQA 2FLLA 4JUZA 4Q0BA 5KT5A 4ZVFA 4JV2A 2R2TA 4QWAA 1FKPB 3BQ0A 1RAJA 1JLBB 5CYQA 5HP1A 3QGIA 1T05B 4QW9A 3DI6A 5HBMA 5J2MB 3IRXB 3PR5B 1HNIB 1S1UA 4TY8B 2IBKA 3OL8A 5L1JA 4J9NA 5KG7A 3KK1B 2R8HA 2VG6B 2VA2A 4ECUA 3QO9A 1FKOA 3FQLA 5EWGA 1QUVA 4KBIA 1Z4UA 4RW4B 2IM1A 3N6NA 3EPGA 4J9RA 2UVWA 1EETA 2XCAA 2WHOA 1IKWA 4IH7A 2HNDA 1TKZB 3DOLA 3LP0B 3HVTB 2RF2A 2YNGA 4IR1A 3OL6A 3BJYA 3KLGA 4M94A 3QGHA 2IAJA 3V81B 1S6QA 4DG1B 3GIJA 2HNYA 1N48A 4RU9A 4MK7A 2AU0A 3DM2B 1W25A 5DQIA 4IFVB 3OL7A 2FJVA 4ZPDA 3PR4A 1RT7A 3LP2A 5KFNA 3H4DA 2WB4A 4ECRA 1JLGB 3E51A 4NLUA 2WTFA 1DTTB 4EO8A 5J1EA 2VG5A 1RT6A 3DOKB 4IFYB 1S49A 3I5AA 1DTQB 3G6XA 3IS9B 1HPZB 1T05A 1FK9B 1JLBA 1GX5A 3EZUA 5KFGA 1QE1B 1U09A 4LQ3A 4KSEB 3PW2A 4ECQA 4KO0B 1JLCB 3IRXA 2JEFA 1HNIA 5I3UB 1IKXB 4Q8EA 3DLKB 4TY8A 3CDUA 3G6VA 4FS1A 1WNEA 3M8QA 5HROB 4Y2AA 3KK1A 2VG6A 3UDLA 3DYAB 1JLAA 5FDLB 1MU2B 3PJXA 4RW4A 1LWEB 5F8LA 3DRSB 4IDKB 5JXSA 2ILYA 2AX1A 5KT4A 2W9CB 4K4XA 2FLPA 1ZTWA 4K50A 1TKZA 4O4GA 1C2PA 4RW8B 3LP0A 3HVTA 2OPRB 1HARA 3ICLA 5KFZA 5D3GB 1S9EB 3TAMB 3KK2B 3MEGB 3H98A 5C24B 4R5PB 4U6PA 4NLQA 3V6JA 3V81A 4IG3B 2FVSA 4DG1A 4QW8A 1BQMB 1RT4B 1TVRA 4Q44A 3UPFA 3DM2A 4IFVA 4NLDA 5C42B 4ZP6A 2WOMB 3H40A 2C22A 4H4MB 4XO0A 2C28A 3KMQA 4WYWA 3QLHB 1DTTA 2B43A 1JLEB 5D3GA 1RT3A 3DLGA 3LAKA 4J9QA 4O3OA 3DOKA 4EYIB 5J2PB 5KFTA 1DTQA 4YQWA 2I1RA 4LSLA 1HPZA 1FK9A 4MFBB 5EWFA 4ID5B 2UVUA 1KHWA 1QE1A 1N4LA 2GC8A 3MEDB 4KO0A 2WONA 3M8PB 4ZVEA 5I3UA 3KOAA 3DLKA 4NLYA 3MFHA 1RTJA 5F8HA 3JSMB 5HROA 1RTDB 2UVVA 4H54A 3DYAA 1T3NA 5FDLA 3NGDA 1MU2A 1LWEA 4O3PA 4IDKA 3KHGA
chains in the Genus database with same CATH superfamily
1FVQA 4PWDB 1ZM3A 1LK5A 5KAKA 4C11A 2E1CA 2MXYA 3BGUA 5D4PA 3Q8PB 2EW9A 3L7UA 5DG7A 3DDKA 1UPMB 3U1NA 4YHHF 1R6YA 1HBMB 3UQSA 4FKYA 1WWHA 1BQXA 3TUPA 1RA6A 2G2ZA 4USJC 4DV1J 1TFYA 1C0TA 1S77D 1NB7A 2BUNA 1TV6B 4NLXA 4I7FA 5G0RA 1FNMA 3PO5A 2C2DA 3OHBA 1W2BR 3TW0A 3PW5A 2BDPA 2FHOB 2VPZB 3HLUA 2B9YA 2C42A 1X5SA 1GXUA 1WORA 2XLKA 1JLFB 4J9LA 3I82A 4UY8T 1S57A 2WCXA 3SQGB 3PKYA 3IR5B 2CPJA 3TZYA 2N7YA 2VFSA 2XS5A 3G82B 3PYGA 4QYZK 2ALYB 3DNCA 5I3QA 2HBYB 3OTCA 1N0VC 4P73A 2KO1A 2FJBB 2XEXA 2OPQB 4C0OC 4URSA 3PHEA 3KLVA 3OFGA 2ZD1B 4IG3A 2C3MA 4LR8A 3LF0A 4A8FA 2CZ9A 3P45B 2HFZA 2V8PA 2GJ2A 4WU2A 3X3UA 3BYPA 3DMJB 3IM8A 4PRFA 2YX1A 4DSJA 4DR4F 1LWCA 3KJVB 5LSLA 4CO3A 3Q0AA 4EEYA 1N6QA 4K4ZA 2YNHA 5ETVA 4J9SA 1SI9A 1VRTA 5B7WA 5SZTA 5ETKA 1KS2A 1FWPA 2K7KA 2EXUA 3OFFA 3B4MA 4PZVA 3FEXB 2JDJA 2MKKA 2DXEA 4L3KA 4DQRA 1LV5A 4N47A 2OGUA 1XQIA 1CSJA 2KM8B 4NEYA 1CG2A 3KDNA 2Z2LA 4NOHA 4ZLJA 3AFGA 3EZOA 2XI3A 1R8CA 5JJBA 1CJTB 1KONA 4ZP8A 3KG1A 4WTYA 2AX0A 3EXYA 4IOBA 1EHWA 3W66A 3H25A 1Q8LA 3GE9A 3PO4A 4CWBA 5KG2A 4GVLA 3LPYA 2ZOGA 1OSDA 4C4WA 1WF2A 3R2DJ 3T1HJ 3KXDA 1TK0A 2NXEA 5KOWA 5E5NA 4QWCA 3G86A 1ZM4A 2E5HA 2DNRA 4KV8A 3FCVA 1XTZA 2AGOA 2Y0BB 4IG0A 2A18A 5A8RB 2MKCA 3KLGB 5G0RB 3A8JA 1QTNB 1U1QA 4L74A 1H7XA 4J9OA 5KFMA 1XMOF 2E5IA 2Z4PA 2ZHAA 1RT6B 2W2QP 1P9QC 3VZIA 2XO6A 2G9OA 5KT5A 5CYQA 3BDEA 1IWAA 1RHKB 3OL8A 2XB2D 1AFIA 2WVFA 3QGPA 4N5SA 5CAAA 4J9RA 2A0FB 3IXQA 1TKZB 4QR2A 3W61A 3OTBA 3HVTB 4IR1A 3R6GB 2NCKL 2AF6A 1ZAWA 3M05A 1NH8A 4FPRA 4ZPWR 4OJ3A 1HPZB 4B3TJ 2HFOA 4U7UD 2LEPA 4NL5A 3GFZA 4NMXA 4EI2A 1X0PA 2OHDA 4CT8A 2G2YA 2GCFA 2HHQA 3ENVA 2ZH7A 3HPOA 1C2PA 1PC4A 4R5PB 4IG3B 1TVRA 4CIOA 3UWTA 3KMQA 2VPXB 1NKCA 2IPOB 4O3OA 2XHCA 3H2UB 2I1RA 4KT0C 2GC8A 2HLUA 2LQBA 2KXFA 2WONA 1RE1B 2KKHA 3KOAA 3E2EA 2VBWA 3DLHA 3K5PA 2UVVA 1R89A 1LWEA 3KHGA 2PO4A 2VQEJ 3DGVA 1S9EA 2PFFB 4MYUA 4ZPAA 2YNHB 5C42A 1HWKA 1RBAA 2WOMA 3MMBB 5ETTA 1VRTB 3C3LA 2GZOA 5A2QU 4I6YA 4YMEA 2FJAB 5C2GA 2ZZTA 1CULA 4DPXA 4WFYA 1UTAA 2CQCA 4K5SA 3JYTB 1S0NA 1T9WA 1ZAXA 2FJXA 3OJSA 3JSMA 1GEHA 4ZN1A 4DL7A 3R7SB 3M8WA 4NLGA 2KHCA 3P49B 2DNMA 4XPEA 3ILLA 1Q79A 4F36A 1EQ0A 4W4MA 5T7LB 3KLFA 2UXBF 2VONA 1LOUA 2RDDA 1HFEL 3SFGA 4QU7A 1GMWA 4Q8FA 4ZITA 2R8KA 3CCRS 2R2UA 1R27B 2G0IA 1HQEB 3DRYA 3TEGA 4IYQA 2VD3A 4OJ1A 4ZLLA 2VOOA 3H4BA 2XC9A 1RT2B 3GJQB 1G7CB 3BO3A 2V8GA 3AOAA 2B4OA 4QIEA 1NKBA 5CCMA 2B56A 5DS7A 3MEEA 4DS4A 2W2MP 2HZAA 2G0JA 2V4RA 3DN9A 4NASA 2G4BA 4OZLA 3HI9A 1OY6A 4PG7A 4P71A 2DD8S 1VJQA 1IVZA 2KI2A 2QMUB 5M2RA 2EBEA 1R6VA 3H7HB 3KHHA 3GV8B 3QIPB 3CJRA 2WSCC 2WBRA 2OTJS 4ES2A 1GNKA 5L1KA 3D28A 2EG1A 4Y28C 2POKA 3ZZOA 4HYKA 1H2VZ 1R0AB 2M8DB 1A9NB 5KT2A 5E7OB 3CCLS 3ZZZA 3W9JA 2EFQA 3DOMA 2J76E 4KKOA 5CYJA 2AEMA 2MYFA 3C16A 2NZCA 3RB0A 4XIUA 4DF8A 4NA1A 4YHHJ 4M1KA 2R7VA 4WP9A 1U45A 3MGJA 2GVDA 4ECWA 3CO0P 2H65B 5A76A 2HQ3A 3OLBA 1HWJA 3LP1A 2CPEA 3VAKA 5HMYA 4S0MA 3TUJC 1B3TA 2F8EX 4X4UA 1U4BA 1VDHA 7FDRA 2V8DA 3PFOA 4HR2A 3GIKA 5BJRA 1TVRB 5F9NA 2FGOA 3DU5A 1FDDA 4XDCA 4KB7A 4B02A 2JX2A 3SXLA 2ADCA 4ZOSA 1APSA 3ADAC 3T1AA 2WONB 2RS8A 3G8SA 4EK2A 5KG6A 5F0UA 4CH0S 4OI6A 3IAS9 4CZCA 3R5JB 1SC3B 3MI7X 2N3OA 4KYZA 2OFGX 3CF5Q 3X1LB 4P7VA 5T14A 4URGA 2KG1A 2XS2A 1NSQA 3RR8A 1YRTA 2VODA 5J1NA 5DDPC 3CCVS 1L3SA 4LF8F 3HSDA 2FHJA 4B9TA 4ANEA 2CQDA 3D7SB 2FY8A 3C66A 1U47A 2XTJP 3VR1A 5DM6Q 4H4KA 2DHSA 2O5DA 3BZQA 4D3GA 4ANDA 1D8ZA 4ZIWA 2A2DA 4O3SA 4DZDA 1U26A 2Q1LA 2QGFB 4WF9Q 3G96A 4X4VA 3DLLQ 1WI6A 4DX5A 2VG5B 3PKMA 1NU4A 2LA4A 4KGVB 5FLXY 1T05B 2X1AA 3U1LA 4DR4J 1HNIB 2W2NP 2RQMA 3KK1B 1N0UA 2MY7A 4ETXA 3EPGA 5KOXA 1T9YA 3EVWA 1NDPA 3MMJA 3R9LA 3W1YC 3OVBA 4X84A 4X4NA 2FJVA 2YXLA 3HDSA 4LFCF 3HT3A 1S49A 3IWXA 3CXCR 1WACA 2CQHA 4PYDA 2LP4A 2HSEB 3DYAB 3HSJA 1Q78A 2OEJA 3MMAA 3MM8A 1Q7YT 1RWOB 4FF2A 3DM2A 4IFVA 1FDBA 4ZPVR 3DGPB 4XO0A 4DR7J 2BA9A 2B43A 4N56A 4L75A 4NYPA 2GMHA 1UW9A 4ZPTR 1I94F 2CG4A 5B09A 4BDPA 3TAMA 1OIAA 2XCPA 1BLUA 1PILA 2JNJA 4QJVA 2Y8YA 3LP1B 3DLJA 3NAIA 1YJRA 3EMTA 3QJLA 1HYSB 3J7AN 2IA6A 4I64A 2XG8A 3M8PA 3MR6A 5D15A 3M6VA 3MAAA 5I42A 1FRJA 2DJWA 1XMOJ 1KQSR 5FJ4A 3BM7A 1V5IB 2JLEA 3BN7A 3NWGA 1G6BA 3KK3A 1S1WB 2HS0A 2YPYA 2YWKA 4FXWA 4F04B 4DL6A 3Q8QB 4DL2A 3B82A 2BKOA 3S6EA 4MT1A 1HBNA 1RKIA 4AL5A 4DF4A 1WC4A 2A2CA 2G13A 1RWPB 3MR5A 4I68A 2HKEA 4WE1A 1O5JA 2C3UA 5HVHA 5LT5A 3EM1A 2E7VA 1Q82T 3Q8VA 3MXHP 4R8UA 1JNRB 3M9OB 1VBXA 5IM0B 1VR6A 1WUUA 3BSAA 4A8MP 2FHMA 1GMVA 3IMQJ 2LKZA 1RTIB 3VGTA 2W4CA 2DO0A 3BEGB 2CWKA 2BX6A 2P9GA 3IA0A 4YOEA 1YJTA 2V2QA 2CQPA 4QWBA 2YWWA 2HHXA 4A46A 4K7QA 2AGQA 1NXIA 5HJYA 2ERRA 5D8HB 3FFIA 4FF1A 2OPPB 2JL9A 1VFJA 3D0HE 4LFAJ 1S79A 2UV8G 5CH7B 4DHVA 3QYYA 4H4OB 4ZJOA 2VG7A 1J2VA 2YKNB 3AX3A 3M2RB 4FBUA 1Q16B 5MAOA 3GWCA 3M6WA 3I32A 2VQFF 4K4YA 1TUWA 1OM2A 2E9ZA 1NHVA 1X0FA 2ZEJA 2IYIA 2XY7A 2ZWPA 3SDEA 4G1IA 4LSNB 2ZUAA 2V9WA 1KQGB 5D77A 2G2OA 1YG0A 5E3PA 3TA0A 4RKUC 2X1GA 3T41A 5F9LA 1I5OB 5IV3A 1Y5LB 1EIYB 5MLCV 3SV3A 2BKPA 1LW2A 1A6LA 2V67A 1KN6A 1XMQF 2QMWA 2ZJPQ 3ZZPA 5CHCB 2HIQA 4KHMA 2RUGA 1HBOA 2DGVA 3FGVA 5LMNJ 2DH8A 3CCQS 1LEOA 3PX0A 2HQGA 3RB4A 4Q43A 4WPAA 5KFYA 4DV0F 1RCXB 5EX0A 4LF6F 3GR0A 4RW7B 3THVA 1TL1A 3DXSX 2L9WA 4PXDA 2HHSA 4Y2IA 5I42B 2UUCF 4W92B 2HNDB 1DZ5A 4GVBB 3CCUS 2RS2A 4AFFA 4ZLPA 3J7ZT 3RZAA 3NKYA 3VGSA 4UQGA 1SV5A 3LP2B 3KUHA 2ZJQQ 5K9FA 1FTRA 3G6YA 1X9MA 4FPIA 2KH9A 2U2FA 3V6KA 3PCOB 2EC0A 3QSYB 5HO4A 1KTVA 4QIGA 4WTOB 3PEHA 4F2RA 3MUTP 2IM1A 3FZBA 3NS7B 1OPIA 5THWA 4KGXB 1UUJA 1SCJB 4CO1A 4LBHA 2IAJA 3R3TA 2HNYA 2KB2A 3BPDA 4ZPDA 3W2WB 2WB4A 2HRYA 2ZH6A 2B4VA 2YKQA 3LPEA 2VPWB 3AD9C 3A8IA 4FS1A 1WNEA 2Q3PA 4F3QA 2R7XA 2AX1A 4ZVOB 3W3SA 1X5TA 2EEYA 2LXUA 3NY0A 1F1BB 1RT4B 1RWUA 1T8EA 4ILMA 2QMXA 2VJVA 4O0NA 2C3YA 2NUUG 3BS9A 2E44A 4KGKA 3CCMS 1HQ2A 3NP5A 3GYGA 1MSWD 1XJWB 3O3LA 4DCJB 4LF8J 2VG7B 4LIRA 1QSLA 4A8XA 3OVAA 1DURA 1HMVB 1WKJA 4DOZA 3B6BA 4DXLA 2GVZA 2Y9HA 1EKSA 5HATA 1JLEA 3CC7S 2HHUA 3CE8A 3N6LA 3EDQB 4MFBA 4ID5A 3KUGA 3MEDA 3AOCA 3QMQA 4JB8B 3JQKA 1CC7A 3NAHA 4MAKA 3VQSA 3NGKA 3BREA 1MW7A 2UP1A 2RU9A 2L9NA 3BQ2A 4HT5A 3G8TA 2HGNA 4OZ1A 2UUAF 3HVAA 4DV3F 1FXLA 3V6DA 4B3SF 4EUVA 3PW4A 1MN9A 4LRAA 1N5YA 4U8YA 3W62A 3HHLB 2V68A 3ZNJ1 2V8HA 2IC3B 2CJBA 4CYUB 1PCAA 1SKWA 4LFCJ 4USHA 2BW7A 4NLWA 2A6MA 3K5MA 2CJKA 3U7JA 2XLIA 3R2CJ 2EFPA 1REVB 5BXIA 3A4TA 2FC8A 2FIUA 5HVGA 4TLRA 1IJFB 2D69A 1M1KT 5E41A 2IYGA 1NO8A 3H2VE 4UT4A 4ZHRB 1FEEA 3CCSS 3BN4A 3LWMA 1NPRA 1LW0A 2ZWOA 4QCLA 1VQ7S 1HA1A 5B0FA 2IM3A 2R7QA 3AX2A 4UUXA 3UNYA 3M6UA 3KYLA 2XBPA 1CS4B 4P10A 4YEAA 3GILA 1SUQA 3G2XA 2R8GA 1WSVA 2JHEA 3GFXA 3OJUA 1NSKL 1TQLA 2LLZA 4CTAB 2DEIA 3B78A 3M2VA 1WEZA 1EP4A 4B3OB 2RIJA 2RRNA 4QQBA 1HBUA 3ENQA 2N82B 4M63A 4Z37A 3TQ1A 3RW7A 3LOUA 4G3IA 2YNIA 3HO1A 1VBKA 1SQEA 2AEJA 3W7BA 5DRKA 2DNHA 2YNFA 2CJYB 3AHPA 1N36F 3TVYA 1I6JA 2CPXA 5F3TA 4FS2A 4DPWA 4C8KA 2HK3A 1Q81T 3W64A 1T9UA 1F9FA 2BM1A 2Y1JA 1H38A 1IN0A 1OPZA 1XNRJ 2HGMA 2X1FA 4ECVA 4MYTA 1LWFA 2PN6A 5E2QA 5E3AA 3NOGA 2GIFA 2E5JA 5D0GA 3UN3A 2QN6B 4DLEA 4QU6A 1IKYA 1B99A 2DNYA 4I56A 2L9DA 3MOZA 1EZZB 3R7NB 1XIQA 4EGLA 4R0EA 4DV5F 3T9NA 1YTYA 2WRMA 4I1TA 2HBRB 2WSEC 4K0KF 5HBMB 4OL8A 1U1RA 2MJUA 4ZIVA 1FKOB 3MPUB 2PA3A 4U95A 2OO4A 2RMLA 2N4DA 2EFVA 2KU7A 4JI8F 3UDVA 4CP5A 2Q66A 3CDAA 4ZK7M 2AKWB 3SCLE 4TU9A 1OMSA 1IWGA 2LXIA 4IQMA 5KG7A 2HG4A 2CPIA 3R1HA 4RW4B 1Z4UA 5B0BA 2RF2A 2V9KA 2LVWA 2ZOFA 3V81B 1S6QA 4WFNQ 1N48A 3UN2A 3PRDA 3S01A 4UZCA 1KSPA 3BO4A 2VQFJ 2KRBA 3A3OB 2H9ZA 2C3OA 1JB0C 3SCKE 1UVIA 2H48B 5LXRA 2YWHA 4RWWA 1FESA 1EKRA 1IUJA 2IHR1 4OHWA 4DG1A 1B7YB 1XMQJ 3GB0A 1RT3A 1RB0A 1E6VB 3ETMA 2K06A 3GFHA 1SL2A 1WOPA 3CD5A 2GHVC 3DCAA 5C25A 4DV0J 3KK2A 4USTA 2Q6BA 2F8HA 3SSSA 3QATA 3WC0A 2XMTA 3B8HA 5F41A 2DNGA 2Z2MA 2DGWA 2AJ1A 1ZA2B 4QBUA 2UUCJ 2ZBPA 3T19A 1KNZA 4NPOA 4ZJQA 1RTDA 3HM9A 2O67A 3MR3A 3PYFA 3GG1A 3QGGA 2CQ0A 1O8BA 2FC9A 2Z2ZA 2ASDA 4B3RF 4EMDA 1LK7A 2DCLA 2C2RA 3MECB 4QIFA 4MKBA 5A8WB 2C2KB 2F4FA 4WIIA 4PUOA 2NPFA 1YKWA 3TZZA 3LH2S 3D66A 1X4HA 1S9GB 2DCUB 2KT5A 4Q5VA 3BH6B 3FBCA 3W9IA 4K4VA 4GO7X 3W60A 5GADU 2ROGA 2G1HA 4YR2A 1IBCB 3KHRA 2NR0A 1DJ0A 2CXEA 1YSJA 1GFWB 2FJEB 2JEJA 3OW2R 2HQDA 2XMKA 3F0NA 4IFYA 3IS9A 1R7IA 1JLCA 2V6AA 2XYPB 1WTBA 4KPCA 3K17A 2K7JA 3SSRA 4OLPA 4AXIA 4UOCA 4PWWA 3VAMA 3M2UB 1AA1B 1N33F 2F65A 3K57A 1CQNA 3MF5A 1VLYA 3NBPB 4NRUA 4RUBA 4P74A 4PAAA 5CYMB 3MWBA 1UFKA 2VA3A 4RUCA 4OHXA 2MJNA 5KFSA 4LUBA 4LF7F 3OHAA 2QZ8A 3RAQA 3BKUA 2C2NA 3H5UA 1MWZA 1KOOA 4DDFA 3C15A 2I38A 2BOAA 1T7PA 4NLOA 2OFHX 8AT1B 1SBRA 3TJ8A 4KC5A 4DPYA 1UFWA 2CDQA 4C6AA 4DR3F 2B4UA 2M88A 3KDOA 2BE9B 4MH8A 1IKVB 4ED5A 4PEOA 5L9NA 2UVRA 3I0RA 4NCBA 1W7WA 3MR7A 3BR9A 3OXFA 4ECXA 2B6AA 2CIMA 3UVJB 1SPBP 3NEKA 4DV3J 4D3HA 2BE2B 2R2SA 4Y3CA 2A1BA 1RT3B 4Q45A 3HXMA 3RR7A 5KFJA 1P8GA 4L3NA 4DL0C 2FLNA 2PE8A 3BGRA 2K1RB 3RRHA 5HK4A 3GIIA 3N79A 4A8QA 2KYZA 2J8AA 4BCAA 3DLEA 5C25B 4GC7A 1R0BG 3N4WA 1RI7A 2D1CA 3VV2B 4PCQA 1TK5A 1B0TA 2YBVA 1FD2A 1RT1B 4KH0B 3AAWB 4NLPA 4WBFA 2NXJA 4RNFA 2DPIA 5H9FJ 3NGTA 3A3NB 2NPIA 5H9EK 2EK6A 4DX7A 1RHMB 1KKHA 3QRQA 3OTEA 3NS6A 1GXTA 3SEOA 1JJHA 3O44A 4NCGA 1EETB 1RKJA 1K0VA 1HNXF 2AIRB 4RU2A 3TANA 3VQTA 4ECZA 2HHWA 1SJFA 4N76A 4DCOB 2EBGA 4JV2A 2R2TA 2FZKB 4DV4F 2BOPA 2C1EB 3RGIA 4DV2F 4KBIA 4C48A 1IKWA 2FZCB 3IR6B 2HWTA 2DRAA 1Y9OA 3P96A 4QR0A 1KD1T 3L3CA 1N36J 2LMIA 3GIJA 1TUGB 2CZ4A 2AU0A 2DNLA 1PAEX 1RAOA 4R0JA 1U1OA 3H4DA 2C2MB 1OY8A 2WTFA 1DTTB 4GKJJ 3PX6A 3QAEA 4IFYB 3I5AA 3IS9B 1VQNS 1KTQA 4C8OA 2CWXA 4X65F 4OI3A 3CB4A 4KSEB 1JLCB 3IRXA 1TU0B 3F73A 3ZO7A 5HROB 3UDLA 2BMBA 4IOAQ 1ZTWA 3ZZ0A 3ICLA 5KFZA 4DU8A 3OFEA 2FVSA 3V6JA 3M30B 2DVIA 1S4EA 2YQ1A 3CD7A 3FSYA 1RAIB 3OD2A 4PG5A 1VC6A 5ETRA 2DGTA 4LF1A 1FJCA 3U1MA 1B4SA 5GAEI 2MZSA 4HH0A 4CH1A 4OFZA 2CQ2A 5KFDA 2O3DA 3LAMA 2O01C 1YDLA 4K0KJ 3DRRB 4L72B 2V0NA 5IV4A 3H5YA 4ZVRB 5B0EA 4O44B 1EJ7L 5CD4A 4YDXA 4FXVA 4JI8J 1MN7A 1QM9A 1UVMA 4OQJA 2UV8A 3HHLD 3TJAA 3OV7A 2XS7A 4RO0A 2ROEA 2JVOA 4DI6A 1UJ5A 2I6WA 2XWYA 3BGRB 2D68A 3QT6A 2RU3A 2MKSA 3AQPA 1S1TA 2ZKTA 3SV4A 2HQFA 3GQCA 3DLEB 2RQKA 4F4AA 4DSEA 1X4DA 2VIHA 3EX7B 2XTDA 2B9WA 2PI4A 3IO1A 3MM6A 3R5CA 2H5IB 4ZVUB 1ZM2A 1RTHB 4ZVGA 2V50A 1E6YB 1TKXB 2YVSA 2XSJA 3HVWA 3MPDA 2ASJA 1VRUB 3ITHB 1XERA 4ZJLA 5K14B 4M8LA 1X8DA 5IS2A 1UP1A 3BBCA 2ZH9A 2DR9A 2ATLA 3BGLA 1QLNA 4F4WA 3ZZTA 3VAFA 4WFXA 2RAQA 4KHPF 4NEZA 3VTIA 2HBQB 2NQPA 4NLTA 3GV7B 5J2QA 1YJ7A 4EO6A 4JV5J 1YK9A 3FMBA 4FF4A 4C8MA 3JSYA 3MD3A 2H3EB 3KKFA 2B4PA 4USMA 5C2CA 3PTWA 1HKAA 2VFTA 4DQSA 2NXNA 1X5PA 3FC9A 4DV1F 1J5OA 4QWDA 3LUYA 3ZTOA 1NMEB 1VQ6S 2HS4A 1U25A 4RR5A 1N32F 4LRDA 1WDDA 4U96A 2E1RA 4NRTA 4Z7YA 1S12A 4IOCQ 1P27B 2OELA 3FK4A 2LQ9A 3WX4A 1RP5A 1WEYA 2Y1LB 1Z2LA 2DNNA 4B3RJ 4TU7A 4G1QB 3C14A 4K4UA 3PG9A 2VL1A 1RHQB 1VQ9S 5ITHA 3HFZB 3I5CA 4TXSA 2J0XA 2LQ8A 2CPZA 2M0GB 2OSQA 9ATCB 4XK8C 3T5JA 2OPSB 3RBEA 4F4KA 4JYAJ 4DU7A 2RHQB 4N8NA 2O66A 2DTJA 1SJ1A 2KT2A 4RBVA 2B5JA 2XSFA 1DLOB 3IWNC 1TKTA 3RAXA 4RUHA 1HWLA 1D8YA 1NEEA 1FFSB 3BSCA 1VIOA 3LWLA 2BACA 1CPZA 4LBIA 3HHKA 2BQUA 3C6UA 3J81j 4RNNA 3HJFA 4M5KA 4GO5X 2DPJA 3S7RA 5ETPA 3TOQA 1PSDA 2RH3A 2D3O1 2BR0A 4C8LA 1H73A 1U0HB 1H0HB 1N33J 1VQPS 3A8EA 2DH9A 4BC9A 4IH5A 1UJ4A 1SC6A 4ECYA 2AV5A 1YRUA 4MKVA 2XMMA 1RT7B 2VFVA 1T94A 2ZKUA 2MDAA 1Q53A 3C6TA 4OYXA 3G4SS 2HAIA 1P1LA 2ZNYA 5A8KA 4LF7J 2QJ3A 4QW9A 2MSTA 3J80U 1BWVA 1NSPA 1S1UA 4K8RA 2LU2A 2VBYA 2EKYA 2GGPB 3MM7B 3HSZA 1NPKA 1AT1B 1Y3KA 3HVRA 4ATNA 3MAQA 1AW0A 2RUSA 3O6QA 4DR3J 1Q86T 1WG5A 3W65A 2BVZA 1D3WA 5LXYA 3TUIC 2QLWA 3H90A 3G6XA 1FK9B 1QE1B 4LQ3A 1GQEA 3RG6A 1GH8A 3DLKB 1G3OA 3VAHA 2W4PA 3WIVA 4IDKB 1U2RA 5A2QY 3ENWA 4RW8B 2NXCA 4LMZA 1HARA 1RQ0A 4F2SA 1B64A 1R8BA 2FZGB 1GAOA 3LAKA 1VCTA 2LDYA 3T1HF 1PGZA 4OYIA 1IR2A 1QUPA 5KFBA 1KFSA 2MLZA 4RPFA 3N6MA 5B0AA 3KLIB 4C8YA 3PFEA 2FLOA 2COLA 4A8KA 3T5HA 2HQCA 3TVKA 4ALZA 2XLJA 1NDCA 2HRUA 4WU3A 3ULHA 3V5RA 3LGMA 1HNXJ 4F50A 3SZ2A 5ETQA 5E3QA 2OAUA 3CJ2A 1FRLA 2QX0A 2WK4A 5I3PA 2ZZNA 4FYDA 2CG8A 2JVRA 4PWDA 1MG7A 3NCRA 4I0WA 5A0YB 1U6BA 2IDLA 3MZIA 3J7A1 3SSQA 3UR0A 4KHRA 2B5JB 2H4YB 4DV2J 2MEWA 3M9MB 1ICEB 3AJ1A 4CQ1A 2BQRA 2WSFC 3MAHA 1NK9A 4F4YA 2VC0A 3UD5A 4IKAA 2RRAA 3GJTB 4WXOA 5HMZA 1TV6A 3N01A 4N77A 3CJ4A 4BS2A 7AT1B 3IGNA 1SXLA 1IM4A 1RWXB 3VCDA 5KFFA 1AZSB 1VQ4S 1KLNA 1FRIA 4WXWA 4ELUA 4DFJA 2SXLA 1RZMA 1YBAA 1C1BB 4C98A 4X66J 5AJ3J 1S6PB 2ZHOA 1VK8A 2W01A 1JLFA 2DGOA 1D09B 1MLAA 5KFWA 2DEJA 2N3LA 4I4BA 3SQGA 4OYMA 4H4KC 1Q0NA 1QAYA 3KLEB 2JEIA 5F0WA 2HVDA 3G82A 3HFKA 3TX0A 1HLWA 5A8KB 3JS9A 1KVIA 2J9DE 1WC1A 1UVNA 1JLQB 4DEZA 4X4RA 3JTOA 2DRDA 2DGSA 3IAM9 1UZHA 3QFHA 2CJQA 4IRKA 1TK8A 1KHVA 1YBTA 4RW9B 2J7UA 5D6GA 2ZD1A 1H2TZ 2R2RA 1PBUA 2X3GA 1SIZA 2OP5A 2L41A 4X64F 4PR6A 2HHHF 4DL5A 4HDHA 4TYBA 3DMJA 2VOPA 3RTVA 2MGZA 2KVIA 5AE3A 2HMIB 1M5SA 1HHSA 4NZ6A 3K8VA 4EBCA 3KJVA 3GSIA 5BR8J 4JOUA 1N34F 5JUMA 3TR5A 5I4MA 3EGNA 3DC2A 1KQKA 3JAMU 3RJMB 3CULA 4C9DA 1U1PA 4ZMMA 2FTRA 3QAUA 3FSIA 2FVCA 2QFJA 5J2NB 4YR3A 1VHIA 2AW0A 3K59A 2P8IA 2IRYA 4ED3A 4OZ3A 2OJ3A 4PXBA 2OEMA 2QSWA 1VRQC 1CBKA 2QL5B 2DR5A 2ZM6J 3GJSB 4ED0A 4YP3A 2XMJA 3FEZA 3M9NB 4YB1P 1I51B 5D4OA 1QD1A 3ISND 2RE1A 5IFMA 2KRRA 1NK5A 4CRJA 3O5TB 4HTIA 4WP8A 5BYSA 3QO9B 4I6AA 2AYMA 1F5BA 3AX5A 2YNGB 1OYDA 2JSXA 1X4EA 2JZ5A 5ETOA 4ED4A 2JC1A 2PI5A 1URNA 1CEZA 3BQ1A 4DPUA 3HT0A 3I87A 3PR5B 3EJMA 5L1JA 2FHJD 1N32J 3EGVA 2UVWA 3N6NA 2BE7D 2WHOA 1A0OB 5A8RA 3BJYA 3KLGA 1KR4A 1TMMA 1FDAA 2IFXA 2BBEA 3FKBA 2VDHA 4DX8H 1FX2A 3M32B 3QBCA 1RT6A 2VH7A 1DTQB 2BJ8A 4OV6A 3GONA 2YPZA 2WW4A 1OY9A 5KT4A 1TKZA 2NZ4A 5F3ZA 3HVTA 1Y10A 5EX3A 4HI1A 4NLQA 1OSCA 5H1SV 1BQMB 2CQ1A 2E5GA 2XHWA 5D3GA 5J2PB 3UFCX 4YQWA 3G9CA 1HPZA 1VS3A 2IVFB 3GU0A 1ZZNA 3P8BB 1DQ9A 4P52A 3C2PA 4OI2A 4H54A 4DFKA 5KFQA 2V5HG 4C7QA 2FUG9 1SB6A 2YKOA 3KLHB 4R5PA 2R8IA 4X2BA 1H6KX 1OWXA 4F0KA 4E0DA 4JV0A 5K8PA 3M1VA 4OZNA 2NYHA 3GV5B 1L3TA 1EX8A 2MGZB 1UWBB 2LCWA 4P9SA 5B0CA 4PXEA 3Q83A 1K9MT 3CW2C 4BWMA 5T41A 1T3OA 4ZN3A 1PYOB 1QTMA 3MMBA 1T03B 1UVJA 3JYTA 2W7PA 1B7FA 2BANB 2MKJA 2IY5B 3US5A 4RLEA 4OYWA 1D9DA 1UL3A 3DDIA 1YHQS 4KGMA 2O1PA 3QRRA 3PVXA 2JFKA 5AXMA 3G6ES 3IG1B 4C3KA 3RW6A 3THTA 4PQUB 3JTNA 3D6HB 2Z8QA 5T7LA 1MMNA 1XNQF 4JI1F 2GHWA 2R8JA 4DR7F 5C5JA 1HNVB 1FO1A 3Q8RB 2R7RA 1HQEA 2HQIA 1FHTA 4X62J 3V4MA 4KH1B 1LFPA 1RT2A 3H20A 3S8SA 4UOHA 1RA7A 1YGYA 4M5DB 3KG0A 3GR1A 4E98A 5AT1B 3UCGA 1WHVA 4EYHB 3CVKA 2C2ZB 2GW8A 1DY3A 4ER8A 4J7CA 4P75A 2U1AA 3MR2A 4NE9C 1TUVA 3D67A 7FD1A 2DGQA 3OVSA 1LKZA 2V34A 1IM6A 1SKRA 3RBDA 2G0CA 3QIPA 4NZ0A 4UZBA 3ZTPA 4DV7J 4O3QA 3CCES 4DR2J 5LM7E 1SJ4P 1RBLA 3AY0A 2DHAA 1CJVA 4ED7A 2HBZB 5HQMA 2GHPA 3MM5B 1SIWB 1R0AA 3TVZA 4P7TA 1XR7A 1VC0A 4UUWA 5K5MA 4DUYJ 4DS5A 3WBZA 2B7BB 4DUTA 3BB5A 3CDEA 4UTGA 1HNWJ 4UOGA 8RUCA 5D3GB 1F3FA 2BV3A 3N28A 3KWMA 1U8WA 1VI7A 2ZBRA 1BY9A 2W25A 2VU5A 2WVCA 1HD0A 3W2VB 2M3DA 2VKRA 2QA2A 2RD5C 4CI0B 2Z30B 2J6UA 1P9YA 3Q22A 1M90T 2I8EA 3W63A 3R5AA 1NJIT 4QR1A 4A47A 3P3DA 1TL3B 2BRKA 3M1VB 1R31A 1T95A 4RL1A 5KFRA 3IBFB 1RK8A 4Z7CA 3G8QA 3AWRA 3IWLA 2AGPA 4M5GA 3MDFA 3SMZA 2E9TA 1NSAA 4AQYJ 3V4IA 2UU9F 1OO0B 1L5UA 2NREA 1VQMS 5AXLA 4LFAF 1VISA 2WAQD 3MPWA 2V69A 5LOQA 5CABA 1VQ5S 5J1EB 1FRXA 2FLLA 1JLBB 5K8MA 2ZOMA 1PO6A 4TY8B 2NS1B 2BJ7A 2R8HA 3D6FB 4ECUA 2MPUA 1VYAA 4DSIA 3THPA 1HHQA 4X64J 4CO5A 5KFNA 2QG9B 4LR9A 2HHHJ 4C8ZA 4PQAA 4EO8A 3FZ2A 4UW2A 2BEFA 2VG5A 3VAJA 5CXTA 1T05A 1GX5A 2HHPA 3KJFB 3PW2A 4KO0B 1HNIA 2CPHA 3KK1A 2BABA 1N34J 3FNNA 5FDLB 2HK2A 1UMJA 2ZDOA 2W9CB 2OPRB 3CDBA 1RACB 4KIAA 3M8ZA 1RBOB 3UPFA 5LMNF 3QLHB 4OLOA 2YH0A 2PSZA 2B9XA 2MMYA 3ILJA 2KT3A 4DFPA 3MM9B 2IDEA 2GQCA 4DSFA 4MTPA 4NXMF 2ZDPA 3DYAA 2XQCA 2EFGA 4NYZA 3S1TA 2BKNA 2Q6CA 4OZ2A 5RUBA 4WJBA 4TY9A 3R6LB 4MIBA 1RT5B 4YUDA 3DGPA 1ZOTA 2UUTA 3CJKB 1CJVB 3ENAA 3Q8SB 4F67A 4ED8A 1F3VA 3ZZYA 4WFBQ 1RYRA 1Y5NB 1KP6A 1SVDA 3L9ZA 1TELA 5GAEU 4HVZA 4WWSA 1BE4A 2J6SA 4LF4J 2CPFA 1NH7A 4F02A 1UKUA 2CJXB 2QO3A 1JIHA 1HYSA 3CC4S 1FRKA 1WSRA 3W8PA 2V4JB 2OD4A 4OYZA 3LW5C 1FKPA 1F9EB 5F8JA 4CT9A 5J2MA 2GFFA 2KVQE 2VJUA 4KFBB 4ZCIA 2FPHX 2DHXA 1KFDA 2P9EA 3OR2B 3AB2B 3D0GE 5KFOA 4BLGA 4DFMA 4X4SA 1YVFA 4CCHA 4JI3F 3CPWR 1S1WA 3HHDA 1TL7B 2PDAA 1RABB 3PJ9A 1H3DA 5IT9U 2DGXA 3A13A 1WC6A 3V4IB 2LQ5A 5B08A 1OS5A 4LF5J 2HPUA 1U48A 3ILOA 1C1CB 3RB3A 3FMWA 4USKA 3JB9k 5KFXA 3WX8A 3D68A 4OZ0A 4ZP7A 2R7TA 3QT5A 2ALZA 1GTHA 2APOA 3D1OA 3FRZA 1WOSA 1M5KC 3ILIA 2WVEA 2J0SD 5IM0A 3H5SA 4CM0A 2H4WB 3WHIA 2HVIA 2HYIB 4L76A 4HTJA 4K2XA 3FBEA 1WC0A 1RTIA 4PG8A 1SH0A 1NAQA 2DITA 4I2QB 3BSOA 2MSSA 4M95A 3CJ3A 3KMSA 1NDKA 3CD6S 1PYSB 2Y8WA 2OPPA 2RB7A 3D3BJ 3JXOA 1N5QA 4LF9F 3KNGA 4PG4A 1U24A 3AD8C 4Y2CA 3GCXP 4H4OA 4UOFA 2PD1A 3T6JA 3I0SB 4DR5F 4U7CA 2CJAA 3EVOA 2YKNA 4FP9A 3EVMA 2Z58B 3M2RA 1N5SA 5D0HA 2PMHA 4KAIA 4EBDA 3ET6B 2L08A 1AUSL 1AROP 5CA5A 2BRLA 2W9AA 2J8SA 4Y65A 2KFYA 4AL6A 1FJ7A 1MNEA 2F63A 4RJVA 4DV6F 1QAJA 3RUBL 3BGFA 2K8GA 2QIFA 4W90B 3DRXA 4ZA1A 4LSNA 4WKRA 1XNQJ 4OI4A 4JI1J 1HQUA 3H42A 5DG8A 1YJWS 4I67A 3BF4A 4U7UK 5KFIA 1JXVA 4KTQA 4HHJA 4DBQA 4QZVB 4ES1A 3CWJA 3CJQA 4YB5A 3QT7A 3NG8A 2IJRA 3DI6B 3L4BC 1NJZA 3VALA 3HK2A 4CLFA 1PKUA 2QEXS 3BR8A 1CJUB 2IJNA 4CLYA 3DOLB 3UD4P 4ZVQB 5HL7Q 5DLFA 2E5LF 2XGPA 5LSRA 5FIIA 3PEJA 2CQ3A 1Y00A 4K5RA 1P6TA 4RW7A 1F6TA 1FKPB 1DQ8A 5HP1A 2VFRA 3QGIA 2AD9A 5J2MB 4J9NA 2VG6B 2N7CA 2BJEA 2HAFA 3EWGA 2HNDA 3LP0B 4GVBA 3R5DA 2X7IA 5IZHA 3M8YA 1BUXA 2R9LA 3LP2A 2D74B 4NI2A 1AB8A 3CTRA 1XNRF 3DOKB 3MTJA 4ECQA 5L39A 5I3UB 2RRBA 3G6VA 2R3VA 1FDNA 1S7IA 1MU2B 2ILYA 2I0XA 4K4XA 5B0GA 4K50A 2AEFA 1NK8A 2Z56B 3T1YF 4F0HA 3MEGB 3BGOP 2MQOA 2CADA 4FYYB 4JI2J 2M5YA 4H4MB 3W2WA 4C0BA 2AYGA 5DO2A 5CD4H 1UAWA 3K5LA 4O0IA 3MFHA 5F8HA 1U1MA 2LQJA 1T3NA 1JXEA 3NGDA 1Q7LB 1S6OA 2ZFHA 1Y4ZB 4OJGA 2EVZA 5EGYA 1RT4A 4OX9J 1C0UB 1LQ9A 2AJ0A 1Y7PA 1BGXT 2I5JB 1S0OA 2K3KA 2J5AA 3GYNA 4USIA 1WKLA 1Q8BA 3OR1A 2F5GA 2UU9J 3N5BA 2J7WA 2B7CB 4IH6A 4IO9Q 2YX4A 2XNRA 2BJ9A 4ECTA 1FF2A 1CQMA 1R3NA 2E1MC 1WJ9A 1HMVA 3R27A 2WBMA 4Y34A 4O3RA 3CCZA 2RKIB 1KLMA 5IXUA 4A4JA 2HWIA 4F8RA 1TL4A 6FDRA 5LJ5Y 3RRKA 2X51A 3RB6A 2V1SA 5LJ3Y 3K89A 3CUNA 3D1HA 4LRCA 1HQUB 2M9KA 1RAGB 5IQQA 1QVFR 4JI7F 2NSCA 4ECSA 2DYAA 4O3NA 3MMCA 4JI0F 2R42A 4HACA 2Y1RI 4CDIA 2HEKA 5GAGI 3GMGA 3DRPB 1RWWB 3MOJB 4DZ6A 3LO3A 4PXCA 3QJJA 3HHLA 2DB1A 2E29A 2XYGB 3QZ8A 2IC3A 3LQVA 2JWNA 1FWKA 4CYUA 5DZ6A 2GJIA 3ISZA 1TP7A 5IT0A 4YB6A 4P6QA 5C24A 2BM0A 1REVA 2FJDB 2IVYA 2ZBIA 5HP1B 4NXMJ 1U49A 1PAUB 4I2PB 3D54A 1EARA 1FA0A 2AZ3A 5HQLA 1Q8IA 5KG3A 4AYBD 4ZHRA 2PEHA 4FYVB 4KR0B 1JMTA 5LMUF 2AYBA 3CJ0A 2VBZA 4Y6IA 1VLOA 6AT1B 3EPIA 4B17A 1WTFA 4Y0FA 4NI2B 1JKHB 1DFDA 4AD6A 1IR0A 3OLAA 2ZH1A 5GMEA 1ULRA 1X4CA 3ZFVA 3GG0A 2B3TB 1CS4A 3L7OA 2DBBA 4RNHA 2DHGA 4DR6F 1KOHA 1UW4A 3HKWA 5G4DA 3AODA 2HVEA 4CTAA 2CDRB 2MZRA 4B3OA 2A6OA 1NDLA 2MZTA 1YIJS 3NS5A 3ZTSA 3SYZA 3LGHA 4LVOP 1WC5A 2V8VA 2JC0A 1MROB 4CLWA 3GSDA 2A10A 1S48A 1RHJB 4DL4A 3RYLA 2HFNA 5DG9A 1NJYA 4YR0A 2F9JA 2Q79A 3O2IA 2YWEA 4QPXA 5L1IA 1VQYA 3KTQA 1BWEA 1SJRA 1OYEA 2FD2A 3AOBA 2Y0SD 5D4NA 4JI3J 2D9PA 2M2BA 3KJQB 3SBMA 3OUYB 5DDQC 1KVKA 3HFVA 2WZ1A 3OR1B 2YKMA 1C4AA 4JV1A 2ZJRQ 2CZVC 4HL9A 1QY7A 5KFCA 3K5OA 1YQHA 2QLBB 3HF5A 1H74A 1HIYA 4FVMA 3BKTA 4OYAA 3DDNA 1KLMB 2XZDB 4YB7A 2UZAA 1NKEA 2MY8A 1QAXA 4DUZF 3M8RA 1S72S 3OBIA 1DQAA 4F0MA 3BPSP 3T9ZA 2D3OR 3RBXA 5HBMA 2EI5A 5H9FK 1FERA 1FKOA 1F0XA 2XYHB 5EWGA 4KY3A 2XCAA 3J81U 3PM9A 4V19X 3MMCB 5ETNA 5AE1A 2VDIA 2NSBA 4HACB 3PR4A 1UA1A 3HZGA 4HEA9 2MLXA 2J7KA 4LF9J 4RX6A 3QFWA 4X4OA 1V3SA 5ETSA 3NWRA 4HDGA 1W26A 4RW4A 5F8LA 5K8NA 4DR5J 2BW2A 1VQ8S 2W24A 2AJQA 4OIXA 2R7UA 3PV8A 3SQOP 2JJ4D 5C24B 3V81A 4C11B 1XC9A 2XMWA 5C7PA 3HP6A 3TZWA 1HD1A 3TP2A 4LSLA 2E1AA 5A6PA 4OI0A 4DV6J 4LJMA 3BBFA 4NLYA 1M1GA 1ROFA 3Q86A 2QFIA 1R8PA 4HT7A 2YY3A 1ZM9A 2CVIA 4OHYA 1YZ6A 2DISA 1C0TB 2AZ1A 3CCWA 3NCQA 4CLLA 5D0EA 1VQKS 4I7FB 2XI2A 3SI8A 3M7VA 1FNXH 4XPCA 2ABYA 2UUBF 1E6VA 3D6TB 3IP0A 4MK9A 4WK3A 4WCEQ 1U1KA 2OIHA 3NOCA 3ZZUA 4TQRA 1VMBA 2E5LJ 3FDSA 3VVUA 3UDCA 3EXCX 1QVGR 4K4TA 1HL6A 1WC3A 3J7YI 4O4RA 2XY5A 3C19A 1RTZA 4J9PA 4CNYA 4I6WA 3PZPA 1BMQB 1N56A 3MFIA 1X9SA 4GKJF 2FVRA 1K73T 4X4TA 4DQPA 2MB0B 1RU2A 2GA7A 4ZCLA 1A7GE 1UEUA 4HLBA 2H54B 1Q8KA 5L9XA 1SC4B 4NCAA 3IBWA 1HNZF 3NL0A 4HHHA 1ZETA 1S0MA 1I1GA 3A12A 1S4FA 3HX9A 3MECA 5AXNA 2YKMB 1Z2ZA 2KL8A 5A8WA 1JLGA 3PRBA 3AJDA 1S9GA 5L1LA 4A8WA 3T1YJ 3RRGA 2DY9A 1SH3A 1LWCB 3MCNA 2CQIA 4YY3J 2ZVSA 2AQ4A 2FVQA 2V4QA 1J5EJ 2ZBQA 4FVCA 1N6QB 2ASYA 4M5NA 2XTCA 3F44A 1WHYA 1YZ7A 4BHQA 2OUGA 1FJGF 1XR5A 3CMAS 5KTQA 2PT0A 4WKYA 2MHNA 3M2UA 1X60A 5GADI 1K8AT 3JTPA 3K8WA 4WFAQ 4GKKJ 4DWIA 1K0TA 1FNOA 1DRZA 3NBPA 1VGYA 4CLKA 4EWTA 1KWMA 2W8KA 1TTHB 3HULA 1DBDA 2IIHA 2CPYA 5DQGA 5CYMA 3TNVA 2D3ZA 3CSKA 3R5GA 1RLCL 1YX2A 1NLKL 2KDOA 2ACYA 1IR1A 2OLWA 2PMZD 1F60B 3NCPA 3VZHA 3CT9A 4WK1A 2WVBA 2CPDA 3UD3P 2Z0GA 2H5JB 2A3JA 2OD6A 2RDJA 2VB6A 1S1VA 2YKAA 1VBZA 4LSLB 3A8KA 5KFEA 2ZUGA 2QE5A 2CAJA 1DARA 1NK6A 3H0PA 4NA2A 2MQ8A 4JI7J 1UPPA 1D1UA 1ZH5A 3EGZA 4KV8B 1IKVA 3O1LA 5DJBA 3PY8A 4IG0B 3K5NA 4JI0J 2IMWP 1XN9A 2DNQA 4V1Ak 2LA6A 3UVJA 4C0HA 1IBLF 4Z2XA 3J80Y 4NLVA 2BE2A 1SKSA 3JSRA 3CIZA 4RW6A 3VF0B 1T9XA 3DXBA 4JV5F 4G65A 5KFVA 4NXNF 2K1RA 4KGZB 5CYQB 3PW0A 3MCOA 2HNZA 2NYIA 2HGLA 2VUGA 1JXLA 1RT1A 4F3OA 2NUHA 2ACMA 2ASLA 1WG4A 2D3UA 3Q2TC 3QZ7A 3R5BA 3HSGA 4USUA 4Q0BA 1KEKA 3HKZD 5LMUJ 2HHVA 1B0VA 3FQLA 2M70A 1QUVA 1EETA 4CLPA 4IH7A 1FD8A 5GAHI 1XWLA 4DR6J 4NMLA 2QLJB 1JLGB 4JYAF 1QJHA 3FEYB 2YX7A 1AUDA 2JEFA 2PEBA 4RWXA 2I9SA 4MIWA 3AB4B 2E7XA 3HD2A 1LWEB 5JXSA 3Q2SC 4O4GA 4LREA 1S9EB 2DXFA 1MWQA 4ITSA 5CQGA 5C42B 2WOMB 1TKDA 1V9OA 2DKOB 2PFDA 1DTTA 3FBFA 4QOTA 5E33A 1ELOA 4F3MA 1U1NA 1CULB 3JSMB 1RTJA 4G1PA 5ADZA 2K2PA 5HROA 1KBRA 1QAIA 4C2MA 1NZAA 1FXDA 2IRXA 4ZPBA 1NJWA 4JI6F 1D9AA 3M30A 1D0EA 2FB0A 4ED1A 2J9EA 4XAKA 3KLFB 2E66A 4DPTA 4CM2A 2MQMA 1ZAVA 3MPVA 3CJ5A 3G71S 5K8OA 4AXJA 2QYCA 5IQ6A 3AXMA 5KFUA 4DUZJ 2AJ4A 3FBBA 4FKXA 4K4WA 1S1VB 4LVNP 4QYZJ 3DRRA 3MEEB 5EUHA 1OJ4A 1S76D 1RAHB 4O44A 1PJ5A 1VOMA 3RAMA 3FVYA 4M5JA 3KJNB 4CH7A 5DGBA 3DHWC 2FGCA 1N5TA 3OSPA 2IMOA 1ITPA 3NMRA 4RW6B 1KVJA 4RNMA 5KG1A 1NCLA 4Q7AA 4DPOA 2KM8C 2QT7A 1OQ3A 2DHHA 3MD1A 4CO4A 1HWUA 1Q95G 2ZH2A 5KT7A 2HNZB 4ZS6A 3MURP 1FFWB 2GV1A 4ZKAA 3DOMB 4KKOB 4L73A 5DDOC 1PJ7A 2QSFA 3C16B 2ZNZA 2VZ9A 1RTHA 4RUAA 1E6YA 1TKXA 1ZPWX 4FXDA 5DQHA 1YBUA 4Q0BB 3UCZP 2GVDB 4X4QA 2JFDA 1VRUA 2DIUA 1GK8A 3LTOA 5KFPA 3ITHA 5K14A 4LRBA 2H51B 3C46A 1HW8A 3JAMY 3TO8A 5J1PA 2XY6A 5GVQA 2YQ0A 4USVA 2UUBJ 3BO2A 4YN3B 3G87A 3CD0A 1SQGA 4Q2LA 2C2EA 3PXGa 3W5ZA 2DT9A 2FVPA 2GAHC 4P2XA 2AJ2A 2B8PA 2AYEA 4O4GB 1B70B 2CQBA 3KHLA 2MQPA 2CNLB 2CQGA 1ACMB 2F40A 4IUFA 1S1XA 5KFLA 2KXNB 2Q43A 5AE2A 5E0OA 2GQ2A 2FJWA 1FWLA 2J9DA 4UY85 1RTJB 4OYPA 3FQKA 2ILZA 4KRWA 4G1QA 1IBMF 4DLGA 1HNZJ 4ELVA 4X66F 5AJ3F 2QTWA 4IRDA 4FBTA 5GMKa 4P2FA 2MKHA 1U2CA 1JX4A 1FEHA 3TUZC 2OPSA 2GS8A 1XMBA 4EU0A 3OXLA 4OYOA 1V6HA 3N5FA 2HZCA 2QC3A 1M5OC 3AH6A 4ZVSB 1DLOA 3BKFA 2YQ3A 1TL5A 1T11A 1NB2A 5D78A 5IOLA 1PYTA 4DQIA 3HMJG 3H5XA 1RSCA 5KFHA 3OTOF 4NLRA 2EFNA 2HZVA 2GO8A 4IR9A 1FJGJ 3W5YA 2YWGA 4ED2A 4JUZA 4ZVFA 1RAJA 2ROPA 1WI8A 5E3RA 1DHMA 2BZ2A 2UXCF 3FRYA 1FI4A 2VA2A 1U0HA 4F7VA 1CJKA 1IBKF 2DR7A 1N52B 3MMAB 2MKIA 3UN5A 2UXBJ 3MM8B 4RU9A 1YI2S 3DM2B 4IFVB 5BR8F 1FX4A 1RT7A 3BV8A 4NLUA 3OTDA 4ID8A 2CNNB 3MEKA 4P2SA 4OHVA 4Q2MA 5KFGA 4XTTA 4Q8EA 3GPAA 3MUMP 2GGPA 3MM7A 3WIUA 1VIXA 2QA4S 4QPTA 3EUNA 2M52A 3TA2A 3TAMB 1YJ9S 4Q44A 1TMJA 4ZP6A 2ZM6F 4WYWA 3DLGA 2XTEA 1FK9A 3R1LA 1QE1A 3T3FA 1X5OA 3M8PB 4CNZA 3DLKA 2V1TA 2OMOA 1IBLJ 3MAAB 4IDKA 2B9EA 3QT8A 4RW8A 4KJIA 5EWEA 5IWAF 1ZTTA 2QA1A 5BYRA 4AE5A 3TI0A 1W2IA 5DETA 1HHTP 1L3VA 1UWAA 4NXNJ 1U8SA 1R8HA 2ZE2A 1B0PA 1YJUA 5HSPA 3OSNA 1NHUA 2KN4A 1S10A 3KK3B 4OZJA 3CMQA 2MQNA 1UEKA 3LA0A 4JI5F 2P2CB 4WZMA 1ZA1B 3AA8A 1HBNB 5LSOA 3QNWB 4BBYA 3KLIA 4DSLA 3CJ8A 4J91A 3EZ5A 2KHDA 3CJSA 1K1SA 2IBOA 1S1XB 5F8GA 4TU8A 4WE1B 1UVKA 1WEXA 2V63A 3AA9A 3DU6A 2XZTB 2W9BA 1D9FA 4B9NA 2B8QA 4R8UB 2VICA 5B0DA 3WZ0A 4GRSA 2WB1D 3D0IE 3TWZA 4DR1F 1SQFA 4KE5A 3QQCD 5A0YA 2GAGC 2QRRA 3D4JA 4KPYA 4ZDNA 4E8UA 3VVTA 4ZCMA 2DNZA 2P6TA 1RAFB 2BJ1A 2B51A 2JH3A 1RHUB 1M1HA 2HFSA 4G6VB 3FFIB 1PBAA 1K47A 3TA1A 3FUYA 4M5LA 4B08A 1VK3A 1WDTA 3POTA 4DSKA 2KG0A 5L38A 4DN9A 1AZSA 2HIYA 4EZ6A 4N7TA 1C1BA 1S6PA 5GAGU 4JI6J 1CJKB 2FQQB 4FN5A 1CC8A 1S6UA 3SDEB 3P5BP 2LECA 3F56A 4CLZA 3B54A 3VHQA 3QRPA 3KLEA 2ZC4A 5KT3A 3UR3C 3I6PA 5U47A 4QIWD 5IC6B 4AUKA 3R7BB 2GIRA 2DNKA 1LW2B 1JLQA 4MMOA 3PX4A 2BJ3A 4LQ9A 3I9V9 1U6ZA 1HBOB 2W4DA 4M5IA 4ZCKA 1G2EA 1WKKA 3NNCA 1RCOB 4RW9A 1IQTA 3PACA 2IM2A 3KNAA 3DLGB 3UNGC 1ZYQA 4PYAA 1SL1A 2RDIA 3VGVA 1TL1B 2DO4A 4L6V3 4ETZA 3ZTQA 3KG4A 2W2PP 4NA3A 4X62F 2AJFE 2HMIA 2X1BA 3JQMA 3QIDA 3BBBA 4CLUA 3QWPA 4NZ7A 4ED6A 1CLFA 2ZE2B 1HI8A 1FE4A 1FRMA 1SV5B 2GO9A 4B3MF 3K0JA 4OI1A 4YDDB 4DCPB 1RYSA 2F8MA 1WOOA 5J2NA 3NGRA 3GJRB 1I94J 1M5HA 4WZQA 5DM7Q 3SIPB 3OFHA 3CDWA 3HCXA 1RUSA 3D5MA 3AT1B 3HHNB 4C3MA 2JLFA 2V94A 4ELTA 4ZLNA 1MWYA 2KFNA 2IAJB 4F4ZA 4URQU 4HKQA 1YJNS 2HNYB 4A8SA 2W9BB 1H72C 5HLFA 2NLWA 2WW8A 4DV7F 4DR2F 4QWAA 3KUEA 1AFJA 4NYOA 3IR7B 4OX7A 2OTLS 2OI2A 4RBUA 2IBKA 4MJKA 1UFLA 3NRBA 3QO9A 4I69A 3CJTA 3I56S 2V2ZA 2YNGA 3Q24A 4DUYF 3QGHA 1KRPA 1U0SA 4MK7A 5DQIA 1GMUA 3SCJE 1HNWF 1HR0F 3E51A 4J9UE 5HANA 3K58A 2K3IA 2J0QD 2MZ1A 4HH1A 1H98A 1G4CA 3BH7B 2XZWA 1JLAA 2FLPA 1UVLA 1YRXA 1TFWA 2MKYA 2VFUA 5FLXU 3H98A 3MCSA 3POTB 4QW8A 3D9BA 1EB0A 4NLDA 2C22A 2GVZB 2KZMA 1ZBTA 2RVJA 3M32A 1JLEB 4J9QA 4EYIB 1JJ4A 1DTQA 1IBMJ 2L48A 4USWA 3UCUP 4MFBB 4ID5B 2XMAA 1KHWA 4UQTA 2F1FA 1UETA 3MEDB 1QSSA 1R8AA 1GMWD 5EHHA 1BD6A 1F2GA 1JNZB 4O3PA 1VQOS 3JQJA 2HW3A 3CO9A 4C8NA 1KDNA 1RWNB 1AXQA 4AQYF 1WELA 1BQMA 4A8YA 1YLXA 2ZH5A 2P9CA 2PMWA 1DAXA 2W2OP 5HAOA 1SJ3P 1M0SA 2G1DA 2MHEA 1T9VA 5J2PA 2QLXA 4FDFA 2VF3A 4HHUA 3V6DB 1N5YB 1X9WA 2FDNA 3EYZA 1C4CA 1XEZA 4AT1B 5SUHA 1NZ8A 3BSNA 3OTOJ 4WYLA 3IGVA 3WC2A 2CFXA 1S9FA 3KLHA 2ZC3A 3ZZRA 2L3MA 1RWVB 4LBPA 5IT9Y 3IN5A 2DY1A 2Z57B 3N9UC 5F8IA 2CNKB 5M2PA 2LFVA 2MZQA 2UXCJ 4K4SA 5DLGA 3OL9A 2GNKA 1SC1B 5JVHQ 4F4XA 1IBKJ 4LFBF 1UWBA 2KZZA 3CCTA 3TARA 1LW0B 2CQ4A 1CVJA 1N88A 4M5MA 2ADBA 2H1YA 3J7YU 3OXGA 4ZVHA 2EPIA 4PWUA 3PRVA 1T03A 2F4VF 2HFUA 1SUQB 2BANA 1TR0A 2XNQA 1RWKB 1T0TV 1JK9B 4J90A 1RISA 2C2OB 1F2HA 2DR8A 3CGIA 1JQGA 3M2VB 3P5TL 1EP4B 2IRUA 2PIIA 2ZH3A 4J9VA 1HBUB 3PNIA 3IG1A 2PC6A 4IO1A 4PQUA 5HLFB 2YNIB 2EK1A 4LF6J 4TVAB 5KT6A 2DH7A 2QYGA 2YNFB 3H59A 1TAUA 3T5KA 1HNVA 4DJBA 4FYWB 3HZEA 2BYCA 3PHTA 1NUEA 2IJFA 1J27A 4JP8A 5IWAJ 4J37A 2CYYA 3D3CJ 2V2VA 1Q4RA 1NBEB 1S59A 4M5DA 1R0CB 2LEAA 4LF4F 2FHKA 4JI5J 3E01A 2DNPA 4U67Q 1LWFB 3CC2S 3IFEA 2LDIA 5EN1A 4BC7A 1JLAB 1QSYA 4TKTA 1ZZFA 5HJXA 2RJZA 1JJ2R 3L7PA 4JI4F 2F7VA 1LWXA 3MTKA 2YKPA 1UEVA 1IKYB 2CJ9A 2DK2A 2UXDF 1Q1KA 4ZP9A 1GXLA 1WG1A 2HWHA 2RT3A 2DIVA 2NXUA 3FCWA 4DR1J 2YTCA 3MM5A 1MMDA 4GC6A 1BHNA 4YFUA 5HQ8A 3Q8YA 4LF5F 1RDRA 1X7VA 4O23A 3VAGA 2GIQA 5IC4B 1L3UA 2QL7B 2I2YA 1BXNA 4PPDA 3EE3A 2R7SA 3W9HA 3DLBA 2M4MA 3W2VA 2KFZA 1VJWA 2HVHA 1P1TA 4OX6A 2HHTA 3AJ2A 3TJ9A 1S99A 4JBCA 3ZC4A 2RF2B 4WP3A 2E9RX 1NNDA 1S6QB 1NPPA 1MMLA 3IC1A 1TL3A 4TYAA 4IQXA 4DL3A 1M5VC 3K7RA 2DGUA 2XGQA 3K2YA 4X4PA 4B9VA 1XBWA 1V5VA 2DNOA 2RNEA 4DG1B 2RHSB 2GMJA 2UUAJ 4QYRA 4ERDA 4ECRA 3GIRA 3T6BA 4B3SJ 1RHRB 5M2UA 3P4UB 5J1EA 2VKZG 1X4GA 4LRFA 1JLBA 1U1LA 3I31A 3Q89A 1FTCA 2R7WA 3HJVA 4TY8A 3CDUA 5D4LA 2LU1A 3M8QA 4WIQA 2XMUA 3I9ZA 3PJXA 2ZVIA 3HHLC 2J0WA 3KK2B 4NWBA 1GTEA 1KQFB 2IVMA 5GAHU 2HLTA 3I4PA 1VQLS 2ZZMA 2C28A 2OMLA 1X4FA 5KFTA 5DZ7A 4KO0A 1RTDB 5FDLA 2HFVA 2OH2A 2W9CA 3AQOA 1LXNA 4B3MJ 2OPRA 3ONQA 4GMKA 1L3KA 2QV6A 1IXKA 1N5VA 4LF2A 4LIWA 2IM0A 3E01B 3VWSA 3GIMA 3QLHA 4DN0A 4RZRA 4PUOB 3MM9A 3C8YA 5EDWA 3J7Z5 4ES3A 3I4HX 3D1QA 3PYDA 4N8OA 2RSQA 3D6MB 4Y2KA 1NRKA 1K44A 3NNAA 1ZS6A 2XWXA 1FVSA 1U2FA 4ILLA 4EZ9A 1F5AA 4A8OA 3P6YC 1RT5A 5DDRC 1Z1ZA 3CJKA 4FNHA 3M8SA 3OPKA 2W1BA 2V2KA 1XR6A 3CEDA 1N54B 1RGVA 2MQLA 1V3ZA 1REGX 2XZ2A 2JLGA 1SJQA 3L09A 1HR0J 3I5BA 3H8YA 4JI2F 3CIMA 2VASA 2QLFB 3ELHA 5FD1A 1O0PA 4KQZA 1GT8A 3U02A 4OZ5A 2V4JA 8ATCB 1EAYC 4P2MA 5A6WA 4FF3A 1IKXA 2J6TA 5JMNA 5AXKA 3IM9A 4U9RA 1URRA 3W8GA 3GFYA 4KFBA 2MZJA 3C15B 3CMES 3GP9A 4EBEA 3OR2A 1WHWA 4DV5J 3B4DA 5CCLA 4LSZB 4OX9F 4FYXB 4B9MA 1YJVA 1TL7A 2HURA 2CNOB 4E2FB 4TQSA 2EKNA 1S5ZA 2LEBA 1PJ6A 1S97A 2J9CA 1JJCB 3PDNA 4QIVA 5IT4A 1YITS 3I0RB 3HHEA 1C1CA 2QL9B 1LNQA 4OYBA 1O51A 2B6AB 3WQPA 2Y3YA 4ICLA 1F5CA 4PKDB 4RNOA 3PIOQ 4J9KA 2IA0A 3A3PB 3M8QB 5F8MA 4IRCA 1IJEB 1PIEA 2YH1A 3EGWB 2GX8A 3AXKA 4OV1A 4B9UA 1BQNA 2FYXA 3RBZA 2CA9A 3QSIA 3R8YA 1U7LA 2E1PA 2UUWA 1S0VA 4I2QA 4K2JA 4UF4A 4LFBJ 5JVGQ 1I3OB 4TN2A 5HMWA 2JOQA 1AYEA 1K1QA 3QPIA 2AWZA 5D0RA 3CNQP 1RXOB 4M5HA 4YS2A 1LXJA 1IQZA 5HMXA 4NCGB 3PIPQ 1FRHA 2D41A 3EDRB 5KFAA 4Y2MA 3FJ2A 4RBTA 2F4VJ 2LXFA 3VAIA 1VC5A 3I0SA 2GJFA 2C3PA 2D9OA 5K20B 1HI1A 2H5EA 3ET6A 3J81Y 3PJWA 2HVZA 2QA4G 1M5PC 1WF0A 2EFOA 2RQCA 1FFGB 2LYVA 6FD1A 2W8LA 1RJJA 1IKWB 2FY1A 5HI7A 1TAQA 4CLSA 5KG5A 2RILA 2HRTA 3ETOA 4CO0A 2Y1IA 3F41A 2JEGA 1U02A 1UCNA 5L8RC 1VBYA 4PPZA 1HWIA 3LGNA 3Q8UA 3BQ0A 3DI6A 3IRXB 4ANCA 1JWWA 2ZBCA 3TAQA 1CJUA 2WVDA 3V2UC 1ZPVA 3M4XA 2EG2A 3DOLA 3UE2A 3MPYA 4OHZA 1W25A 3OL7A 1PC5A 5HVFA 4CO2A 3CCJS 1Q5YA 1TZ0A 4P72A 3GZ7A 4C97A 3ZNUA 1FT8A 1FCAA 4JI4J 1IKXB 1FJEB 3PYEA 3Q23A 2VG6A 4FNIA 2UXDJ 5ETMA 3LP0A 3MCMA 3TRGA 4R25A 4U6PA 1FXRA 3FSXA 4B9SA 3H40A 1WF1A 3DOKA 2BJDA 5EWFA 2UVUA 3I96A 4ZVEA 5I3UA 1NK7A 1MU2A 5L46A 2B0GA 3MUVP 3D2WA 1NK4A 4LR7A 3MEGA 2XULA 3GCWP 3FCHA 4ICLB 2KYXA 2N4CA 2BQ3A 4V19J 1Y11A 4H4MA 2VC1A 3NLCA 9RUBA 5HN0A 2DRBA 3GTYX 1GX6A 2VPYB 1H7WA 3V6HA 4CLTA 5F8NA 1NK0A 4C3LA 5KG0A 2ZITA 5E3CA 3AD7C 1S1TB 3JSBA 4MK8A 1NJXA 2P6SA 3TYTA 1NM2A 1BQNB 2GQQA 3ZTRA 2BXJA 1UJ6A 3IRWP 2F3JA 5LL6d 3SFUA 3MM6B 4N41A 1T02A 1RAAB 1C0UA 2PGCA 1H2UX 2I5JA 3PW7A 2XSJB 4Y00A 3MHYA 2VV5A 3UI3A 3H2LA 2JRSA 3SCIE 2E7WA 3DFEA 2MTLA 3UW1A 3WDOA 3NGUA 1SH2A 2AP6A 3UDEA 5J2QB 2RKIA 1UZDA 3I55S 3QWUA 4MKYA 4K59A 4F25A 3R97A 1RAEB 4NLSA 3ZXWA 3IBCB 4QWEA 3E8OA 4OJHA 4F26A 3DRSA 1J5OB 5CZXA 3GLJA 3W5XA 2EWHA 3N0VA 2CVEA 2YWFA 4ENOA 5KG4A 4ZVTB 4DQQA 1VQSA 2CUYA 4DMZA 1S7HA 2ATCB 3E3XA 4PG6A 2W7AA 3LANA 2R7OA 1Y0HA 3DRPA 3LALA 3VGUA 3A1YG 4NX9A 3C14B 2AHOB 2MLYA 1Q5VA 1NHKL 3KFWX 2DR6A 4DX6A 2F9DA 3HD1A 2R4FA 1RU1A 1RWMB 1OQ6A 1O6XA 2KJVA 1V3RA 4AL7A 4I2PA 4DV4J 1F9HA 1N8RT 1YWXA 3ISNC 4MKAA 1TKTB 1HBMA 4ZVPB 4B3TF 1UA0A 3U27A 4ILRA 5ETLA 4ZPCA 1R43A 4HI2A 5KFKA 3T5LA 1BC6A 1JKHA 3C6UB 5H9EJ 1VHFA 2W7OA 1HW9A 4X65J 4J9MA 3NMAA 1U6FA 1X31C 4TNOA 3L95X 1SL0A 3OQ2A 2CKWA 4FZVA 4J5OA 2DXDA 2CRLA 2OEKA 2XM3A 2D7SA 2ZH4A 4B9LA 1QDUB 2ZH8A 3OT9A 1MROA 1T9TA 3NNHA 4YY3F 2VQEF 1J5EF 3C6TB 2GMLA 1LFWA 4WFZA 1HI0P 2M7SA 4LT6A 5CZVA 1S1UB 1G1XA 2EC2A 4U8VA 4OMFG 2VBXA 2OPQA 1SKUB 2P5VA 5DGAA 3OUYA 2XO7A 4GKKF 4MIAA 3BYRA 3GYXB 1WD6A 4OX8A 1KC8T 3TAPA 1EQMA 3BDPA 2Z2YB 2XMVA 3NXZA 4BWJA 1X4BA 1FKAF 3DHXA 1XK8A 2ZHBA 2HS3A 4EFAC 4M94A 3OL6A 3DKDA 2VHGA 2KJWA 1Y3JA 3TQEA 1RADB 3RU0A 3QJPA 3EICA 4PABA 2KXHA 2OSRA 2MQQA 3EZUA 1U09A 3TZXA 4Y2AA 1X4AA 3NGSA 2OKQA 3DRSB 3UO0A 3M6XA 2X3DA 4TLQA 1Y5IB 5GMDA 2PA8D 1FE0A 2RQ4A 4XDDA 2AMCB 1WHXA 4W98A 2KTQA 2M8HA 2AT1B 1N4LA 3TEHB 5BYQA 1RLDA 3TX8A 1PG5B 3O8WA 1CJTA 4A48A 4KHPJ
chains in the Genus database with same CATH topology
1FVQA 4PWDB 4RW8A 2GHVC 3DCAA 1ZM3A 5C25A 2EFGA 4NYZA 3KK2A 4KJIA 3S1TA 5EWEA 1LK5A 2Q6CA 5KAKA 5IWAF 1ZTTA 2QA1A 4C11A 4WJBA 5BYRA 2Q6BA 4AE5A 1W2IA 4TY9A 4MIBA 4YUDA 1RT5B 2F8HA 5DETA 2MXYA 3SSSA 1U8SA 1R8HA 1L3VA 2ZE2A 3BGUA 3DGPA 5D4PA 1B0PA 3Q8PB 1ZOTA 2EW9A 1YJUA 3WC0A 2UUTA 3CJKB 2XMTA 3B8HA 5F41A 5DG7A 2DNGA 2Z2MA 3Q8SB 1NHUA 2DGWA 3DDKA 3OSNA 2AJ1A 4QBUA 2KN4A 4F67A 4ED8A 1S10A 3U1NA 3KK3B 3T19A 1KNZA 4YHHF 1R6YA 1HBMB 4NPOA 4OZJA 3ZZYA 3UQSA 2MQNA 4JI5F 4WZMA 4WFBQ 1RYRA 1Y5NB 1WWHA 1BQXA 1RTDA 1RA6A 3HM9A 2O67A 3AA8A 4USJC 3MR3A 1HBNB 3GG1A 5LSOA 3QGGA 2CQ0A 4BBYA 3KLIA 4DSLA 1O8BA 2KHDA 3EZ5A 2FC9A 5GAEU 1K1SA 1TFYA 2ASDA 4HVZA 2IBOA 1C0TA 1S77D 4B3RF 1NB7A 1S1XB 2BUNA 1TV6B 2J6SA 4NLXA 4I7FA 1LK7A 5F8GA 5G0RA 4TU8A 2CPFA 1FNMA 1NH7A 4WE1B 2DCLA 2C2RA 1UVKA 1UKUA 4F02A 1WEXA 3MECB 3PO5A 3AA9A 4QIFA 2C2DA 4MKBA 5A8WB 2QO3A 3OHBA 3DU6A 1W2BR 1JIHA 2W9BA 3TW0A 4WIIA 3PW5A 2BDPA 2FHOB 4PUOA 2NPFA 1HYSA 3LH2S 3CC4S 1X4HA 1S9GB 1D9FA 4B9NA 2VPZB 2DCUB 4R8UB 3HLUA 2B9YA 1FRKA 2V4JB 2OD4A 2C42A 2KT5A 3LW5C 1X5SA 4Q5VA 1FKPA 1GXUA 5B0DA 5F8JA 4CT9A 3WZ0A 5J2MA 2WB1D 3D0IE 2XLKA 1JLFB 2GFFA 4K4VA 4GO7X 4DR1F 4J9LA 4KE5A 3I82A 4UY8T 2WCXA 5A0YA 3SQGB 2QRRA 5GADU 4KFBB 2ROGA 3PKYA 4ZCIA 4YR2A 3IR5B 2CPJA 2DHXA 2FPHX 2N7YA 4KPYA 2VFSA 1KFDA 2P9EA 4ZDNA 3KHRA 2NR0A 3OR2B 3AB2B 4E8UA 2XS5A 1DJ0A 4ZCMA 3D0GE 5KFOA 1YSJA 4DFMA 2DNZA 2P6TA 2FJEB 4X4SA 1J5EF 1YVFA 2JEJA 3OW2R 4CCHA 4JI3F 3CPWR 1S1WA 2B51A 2XMKA 3HHDA 3DNCA 2JH3A 2PDAA 4IFYA 3IS9A 5I3QA 1R7IA 4G6VB 1H3DA 1JLCA 2DGXA 3FFIB 3V4IB 3OTCA 1N0VC 2LQ5A 5B08A 1WTBA 1OS5A 2KO1A 2FJBB 2K7JA 2XEXA 2HPUA 4OLPA 3SSRA 2OPQB 4AXIA 3TA1A 4C0OC 1U48A 4UOCA 3VAMA 1C1CB 3RB3A 3FMWA 4B08A 3M2UB 4URSA 3PHEA 1VK3A 3JB9k 5KFXA 3KLVA 1N33F 3POTA 3OFGA 4DSKA 3K57A 1CQNA 2ZD1B 4IG3A