3OLAA

Poliovirus polymerase elongation complex with 2'-deoxy-ctp
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
461
Chain Sequence
b'GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymerase
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
total genus 140
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3olaA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3olaA02
4NLQA 3QIDA 1RT7A 3ITHA 5J2PB 3RAQA 1FK9B 4ZPBA 1N6QA 1J5OA 2OH2A 2D41A 3LAKA 4O3QA 1KHVA 1REVA 5EDWA 1SV5A 4U6PA 1T3NA 5KFCA 1LWCB 3CDWA 3OHBA 2QE5A 4H4OB 1RTIB 3SI8A 1RTDB 1MU2A 4MH8A 2XGQA 3IGVA 1S9GA 1IKXB 3I0SA 3T19A 4F50A 1OS5A 5F9LA 4IDKA 5DGAA 3GV5B 1JLQB 3DLGB 4RW7A 5JXSA 1C1CA 3MEEA 5KFZA 3BR9A 1BQNA 2DPJA 3OLBA 1S4FA 2BE2A 5KFMA 1KHWA 5J2MA 1LWEB 4GC7A 1S1WA 2VG6A 3KMQA 3DYAA 4RW6A 2HAIA 3IS9B 4IR9A 4Q0BA 5KFIA 1C0TA 4U7CA 3IRXA 4JV2A 3NMAA 2R8GA 1RYRA 4RNNA 5EUHA 1JLAA 5KG5A 2UVRA 1GX6A 4IH6A 2RF2B 1EP4A 3DOLB 4ZHRB 4K4ZA 3OL9A 5DGBA 4R8UA 4ICLB 2W9AA 3QZ7A 2R8HA 1TP7A 3CJ2A 3H4BA 1T05A 4WXWA 2FLNA 4K4SA 2B5JA 3MTKA 4EYIB 2E9ZA 2IAJA 4IOBA 5KFVA 2FLPA 3DI6B 1RT5B 2YNIA 4FS2A 4ECYA 2VA3A 1VRUA 3I0RA 4NLWA 2XI2A 3G86A 4RNMA 3H5UA 2WOMB 3PJWA 2RDJA 2C2EA 1DTTB 2WONB 4DL4A 4ED7A 1HARA 3ISNC 5I42A 3KLFB 2W7OA 4J9NA 4PUOA 4ZMMA 3LP2B 3UR0A 5KFOA 1R0AA 1TKZA 1HYSB 3QO9A 4KE5A 2CKWA 3BJYA 3KK3A 4LSNB 2JEGA 1TKXA 3QGHA 5KFUA 4ZVGA 3GYNA 3HVAA 4NCGB 2XCPA 3DOKA 4MKBA 3NAIA 3HVTB 4NLOA 3M8PB 3OLAA 2QV6A 4RW9B 3KMSA 4ID5B 1RT4A 4KB7A 4ZP7A 4QW9A 3T5LA 5DG7A 2R8KA 1HMVA 2E9TA 4EBCA 4WE1B 5F8MA 4O3PA 5T14A 1S1UB 3HHKA 2IA6A 2HWIA 4YR2A 3KK2B 4QPXA 4IG3B 3FFIA 3H5SA 2B6AA 4IRDA 3RAXA 3G6YA 3KLEB 1ZTWA 2WK4A 2ZE2A 4YP3A 4EBDA 4QWAA 3GILA 2ZKUA 1DLOA 1FKOB 5K14B 3DLKB 5L9XA 1NHVA 3Q8SB 4DL6A 2ASLA 1FKPB 4G1QA 2WB4A 4KAIA 2B43A 4O4GB 3N6LA 4TY9A 2UUTA 3OHAA 1VRTB 3KHLA 1RT3A 2WCXA 3KLIA 2D7SA 4RU9A 4RW8A 4J9MA 4EO6A 5DG9A 5KFXA 2VG7A 1IKYA 3H2LA 1FK9A 1TKTB 3ISND 3NKYA 2GIRA 4MK9A 3TVKA 1LWCA 4ZP6A 4F4YA 1RT1A 1RTIA 1TV6B 3MEDA 2ASJA 3HKWA 5KG7A 4WYLA 4I2QA 4B3OB 3H4DA 1IKXA 2AQ4A 1IKWB 1HQUB 3KLHA 2W9BB 4IG0B 2OPRB 3QIPB 4ED3A 1JLQA 3G6XA 3DLGA 4ECZA 4IRCA 3OL8A 5KFEA 3Q8QB 1XR6A 2J6UA 4MIBA 2RKIB 5F8NA 3IN5A 4K4VA 3CJ4A 4HKQA 5C24A 3IS9A 4J9OA 4XPEA 4ZP9A 5DQGA 3LP1A 3Q8RB 1S6QB 3PVXA 2FVPA 2W8KA 4PWDA 2YNGA 3G6VA 2OPSB 3OSNA 3V6JA 1U09A 2RF2A 3DOLA 4ZHRA 2W9CB 1TL1B 3HVWA 5KFBA 4DG1B 2V4RA 4ECVA 4J9SA 1RT2B 4KHMA 1JKHB 3N6MA 1IM4A 2JLEA 2YNHB 5DLGA 4ED8A 3V4IB 5KG3A 3JSMB 1QAIA 3DI6A 4K4UA 1UWBB 3CJ5A 4F4WA 1S9FA 2FLLA 4IFYA 5HBMB 3V81A 2JEFA 1JLEA 3FDSA 1JLFB 1HNVB 4YR0A 4I7FB 1MMLA 3MFHA 4XPCA 4DL2A 1QAJA 2WOMA 3PR5B 5L1JA 2WONA 4I2PB 2VA2A 1JLCB 4J9LA 2W7PA 1JLGB 4NZ0A 2YNFB 3KLVA 5EWFA 3KLFA 2UVWA 3GV8B 3LP2A 3LANA 4TYBA 3OL6A 5CYMA 4J9QA 1T03B 3OSPA 4MFBB 3KOAA 4KKOB 4NCGA 5JUMA 1S1VA 5C25B 2YKNB 3CVKA 3M8PA 4RW9A 3ICLA 3C6UB 4ID5A 4Y2AA 1SH2A 1HPZB 2AWZA 2FVSA 4WYWA 1LW0B 2BQUA 1LW2B 2HMIB 4NLSA 3NBPB 4WE1A 4ZP8A 1HNIB 3M8QA 5C5JA 2C22A 3KK2A 2R2TA 3DM2B 1S6PB 4IG3A 1S1XB 2R8JA 1BQMB 1HYSA 3MECB 4TY8B 1DTQA 5DG8A 2J6SA 5J1EB 3KLEA 1JIHA 1D1UA 3H40A 2ZD1A 5KFNA 4O3OA 2BR0A 4O3SA 1FKOA 4QWDA 3DLKA 1RA7A 1KLMB 2ATLA 4NLGA 4X2BA 3FQLA 4O4GA 5KFQA 3KHGA 4ZPCA 1K1SA 3KLGB 1VRTA 3MR6A 4F4ZA 2FJXA 1EETA 2C2DA 4LQ3A 1SUQB 5KT6A 1IKVA 3DDKA 4QWCA 4EYHB 3DRRB 4IFVA 4H4MB 4YR3A 3QGIA 3KK1A 4ECXA 1TV6A 1S0MA 1C2PA 2HNZB 4YQWA 4KO0B 3MR5A 3CDUA 5I3UB 4KSEB 2R2RA 5HLFA 4B3OA 2FVCA 4K4WA 1RT7B 1S9EA 3N6NA 4IG0A 4NLYA 3QIPA 2W9BA 3MR2A 2R2SA 4DL5A 4ED2A 1N6QB 1REVB 3CIZA 5KG4A 1SV5B 1TVRA 2IC3A 4TQSA 2V4QA 4O3RA 3LP0B 4FBTA 1S9GB 5HROB 1N5YB 3PW4A 2OPQB 2UVUA 3DLEB 3I5BA 5DLFA 4IDKB 4ZPAA 5HP1B 1S6QA 2IBKA 4IRKA 5EWEA 4JV1A 4PQUB 2OPSA 4NLVA 1JXLA 1BQNB 3JYTB 2C2RA 2W9CA 1S1TB 2BANB 4IH7A 4DG1A 1S1WB 4ECSA 3DRPB 3QLHB 2ALZA 5KT3A 1RT2A 1JKHA 1C0TB 5KFSA 2JEJA 1JX4A 2IJFA 4Q8FA 3V4IA 4JV0A 3GIJA 5KT4A 3JSMA 3RB0A 1JLAB 2R2UA 4Y3CA 4LSLB 1UWBA 5FDLB 5KT5A 3PW5A 3M9OB 5KFJA 3NGDA 5J2PA 4FBUA 1HNVA 5F8GA 1JLFA 4I7FA 2AGPA 2W8LA 4NRTA 4OL8A 2OPPB 4H4OA 3SFGA 4I2PA 1RTDA 1JLGA 1N48A 2YNIB 1N56A 4DL7A 3KHRA 4HYKA 4M95A 1XR5A 1WNEA 2IJNA 3DRSB 3TAMB 3BQ0A 1T03A 4R0EA 3C6TB 2E9RX 2I1RA 2WTFA 4KKOA 5CYQB 3BSOA 1D0EA 1RTJB 1SH3A 1LWEA 4RNHA 5I42B 3LAMA 5KFHA 2ASDA 4Q44A 3H5XA 1T94A 3C6UA 4O3NA 1TKZB 1HPZA 3H5YA 3CJ0A 3QYYA 5KFTA 3PW0A 4KFBB 3NL0A 2HMIA 4QWBA 3NBPA 1S10A 5EWGA 3DM2A 4ZPDA 1S6PA 1S1XA 3BREA 2WRMA 3MECA 4ICLA 1S97A 1W25A 3LALA 4H54A 3BSCA 4YMEA 5J1EA 3RB6A 3RBDA 5KFGA 3V6KA 1RT5A 5L1KA 3DMJB 3GQCA 3M9MB 3EPIA 2VG5B 3MEGB 2WHOA 3GIMA 1KLMA 1RT6B 2GIQA 4MKAA 2HWHA 5C42B 4K50A 1QE1B 1N4LA 3SFUA 1SH0A 1DTTA 3KLGA 4RW4B 5KFKA 1ZTTA 2V9WA 1RYSA 2AGQA 3T5HA 4ECRA 1DLOB 1C0UB 1SUQA 4ZVHA 4WFYA 5KFLA 2XCAA 4G1QB 4LSNA 4Q43A 3DRRA 4H4MA 3UPFA 3QZ8A 3KHHA 2HNZA 4KO0A 3HVTA 5I3UA 5KFAA 3VQSA 1QUVA 1GX5A 4WXOA 4ZVFA 2VG7B 1IKYB 3PJXA 2FJVA 2YKMB 3H59A 4LQ9A 4O44B 5F8JA 4R5PB 3V6DB 1C1BB 2ILYA 2HNYB 1RT1B 1HQEB 1S1UA 3MEDB 3LP0A 3KNAA 5J2QB 3CJ3A 2JC0A 3I5AA 4I2QB 3T1AA 5HROA 1Z4UA 1N5YA 2OPQA 3BGRB 3DLEA 2XGPA 3KLHB 3MFIA 1XR7A 5HP1A 4ECQA 1S0NA 1RA6A 1RTHB 2XC9A 5D3GB 4NLDA 4PQUA 5KFFA 2GC8A 3JYTA 4K4XA 5K14A 2IM2A 2R8IA 2J6TA 4ECUA 1S1TA 2BANA 5KG0A 3M9NB 1JLBB 1TL3B 5KT2A 2HNDB 3DRPA 3QLHA 1LWFB 5C24B 1FKPA 2I5JB 3E01B 3IG1B 3LP1B 4J9RA 4PWDB 4KV8B 2YNGB 1RAJA 4G3IA 2C28A 3NAHA 3RB3A 3E51A 4LSLA 5FDLA 4NLRA 1S0OA 4ED1A 4IR1A 2CJQA 3BQ2A 4QWEA 4DL3A 2BRKA 1NNDA 1TKTA 3PHEA 5L1IA 4TN2A 5J2NB 3BQ1A 2IMWP 2IM0A 2RDIA 2OPPA 3KJVB 4WFZA 2F8EX 4NLXA 4Y34A 4KBIA 4URGA 4J9PA 4URQU 2JEIA 2IM1A 4K4YA 4WZQA 2XI3A 3D28A 1IKWA 1HQUA 3ITHB 4IFYB 5KFWA 4RNOA 4ECWA 3V81B 2OPRA 1JLEB 1J5OB 3Q8PB 3DRSA 3TAMA 3UQSA 5F8LA 3C6TA 3CDEA 5KG6A 2AX0A 3QGGA 1S48A 1ZETA 1MU2B 2AX1A 2RKIA 5CYQA 4JUZA 1RTJA 4TXSA 3I0SB 3CWJA 4TLRA 4TQRA 5CYMB 3PR4A 3MF5A 4KFBA 4RW7B 3V6HA 1C1CB 4F4XA 3MEEB 5KFYA 4IH5A 4NRUA 4WFXA 1RDRA 5F8IA 1S1VB 3T5KA 2BE2B 1TL1A 4KHRA 5J2MB 5F8HA 2VG6B 4RW6B 3DYAB 4Q0BB 5KFDA 1TQLA 3IRXB 5DQIA 2YNHA 5KG2A 3MR3A 3GIIA 4FS1A 1CSJA 1YVFA 3PW7A 3M8QB 2FVRA 2AGOA 2EC0A 1EP4B 1NHUA 3GV7B 3DMJA 5HBMA 2VG5A 3MEGA 3FRZA 3FQKA 4R8UB 3RB4A 1RT6A 5C42A 2JC1A 3UDLA 2AU0A 1T05B 4XO0A 4Q8EA 4ECTA 1QE1A 1DTQB 2B5JB 4MK7A 4M94A 2IAJB 2V0NA 4RW4A 1JLCA 1S49A 4IQXA 5DQHA 2BQ3A 2YNFA 2ZD1B 1VRUB 3OL7A 4K4TA 3I0RB 1C0UA 2FVQA 3CO9A 2XWYA 4O4RA 2BRLA 3H98A 4RNFA 4RUAA 4MK8A 4MIAA 2O5DA 3RBEA 4MFBA 3T5JA 4J9KA 4RUCA 4EO8A 2D3ZA 5C25A 2YKNA 1EETB 2ILZA 4PUOB 5L1LA 4EBEA 2IM3A 1R0AB 1IKVB 3QO9B 3FSIA 3KK3B 2YKMA 4O44A 1LW0A 3V6DA 5KG1A 1LW2A 1C1BA 1TKXB 4R5PA 4IFVB 2HNYA 3GIKA 1HQEA 5KT7A 1HNIA 3KK1B 4ED0A 3DOKB 5J2QA 4GC6A 5HLFB 1BQMA 3BSNA 2D3UA 3BGRA 1RT4B 4DEZA 4Q45A 1S9EB 5F9NA 2UVVA 5KFPA 4TY8A 2UUWA 1I6JA 4WZMA 1HMVB 1RTHA 1TVRB 2IC3B 5D3GA 3D5MA 4NYZA 4URSA 4NLUA 3PW2A 4Y2CA 1JLBA 1TL3A 3EZUA 2HNDA 3FFIB 4EEYA 1LWFA 1K1QA 2I5JA 4QW8A 2DPIA 2B6AB 3E01A 4IKAA 3IG1A 2FJWA 4KV8A 4ED6A 4NLTA 2ZE2B 3IGNA 3EPGA 4ZVEA 4RZRA 5KFRA 3TQ1A 3I5CA 2BQRA 5J2NA 3KJVA 1RT3B 3KLIB 3PZPA 4TYAA 4RW8B 3BSAA 4NLPA
chains in the Genus database with same CATH superfamily
3RGIA 2E1CA 2E5LF 3UDEA 1PAUB 3SI8A 1Q5YA 1S9GA 4N8NA 2BUNA 4B9LA 1IN0A 3UN2A 3OXFA 3U27A 3KFWX 2HFUA 5J2MA 1JXVA 3FSXA 4Q0BA 1GH8A 3UR3C 3MOJB 2MKIA 3IRXA 1SJRA 2CQDA 5EUHA 3GIRA 5IV4A 4DQQA 2IA0A 2VPXB 2K7JA 1KFDA 3HFZB 3WHIA 3MTKA 1FJEB 2CQBA 4DF4A 1VCTA 2FZGB 3MMCB 4XTTA 4DR7J 3EMTA 1W26A 2Y1IA 4LSNB 1N33F 3M8PB 3D1HA 4KB7A 4ID5B 3ZZTA 2CQ2A 3PM9A 1HMVA 1S1UB 2NXNA 2PN6A 3FFIA 1S76D 4ELUA 2ZE2A 3EVOA 4DL6A 2DR9A 2YWWA 3TEGA 2AT1B 3KHLA 2F1FA 2Z8QA 1IKYA 1YBUA 1TKTB 2VU5A 2OHDA 1LWCA 4C3LA 5KG7A 2V8GA 3J7Z5 1HBMA 3EGVA 3QWUA 4ECZA 4L3NA 3R5JB 4LF2A 3I32A 1ZYQA 4ZP9A 3MM9B 1U09A 2SXLA 4DFPA 5H9EK 1RWNB 5HBMB 1VQ7S 1JLEA 4YR0A 3R5CA 3PIPQ 3PR5B 4PG6A 3HK2A 5EN1A 2WONA 2GJFA 2YNFB 3GE9A 5GAEI 3CVKA 4QYRA 1LKZA 3F56A 3M8QA 2PFFB 3HCXA 5DZ6A 1FTCA 1RE1B 3GLJA 2M7SA 4F04B 2RQCA 1EAYC 4OYPA 1IKVA 4QIVA 3ZZPA 2G2YA 4C8ZA 3FC9A 3HLUA 5I3UB 2W4PA 2CQIA 2D3OR 2H5IB 4F2SA 1F5BA 4DL5A 1O6XA 2V4QA 2XS7A 2EPIA 2VFUA 2FHJD 3JQJA 2FGOA 3M32B 3LGHA 3JYTB 3P4UB 3D1QA 4DG1A 5B0DA 5KT3A 1U8WA 1RT2A 2B4VA 3QSIA 4OHZA 4OL8A 2I8EA 2YBVA 1KN6A 3R2DJ 3FRYA 1N56A 4ZVPB 3SEOA 2V4JA 4MAKA 1XR5A 4M8LA 4R0EA 3SYZA 2V8DA 5JVGQ 2DH9A 3UNGC 4Q44A 4E8UA 5HI7A 3UD5A 1UTAA 3F44A 2HMIA 4WCEQ 3RBZA 4ZPDA 2QLWA 1FXRA 2VFTA 3RW7A 4ZLJA 4F2RA 3EPIA 1VLYA 3MEGB 3LGMA 2XULA 4DV6J 3MMBA 2DXEA 2VF3A 1UUJA 1NO8A 1GX5A 2RDDA 1N0VC 5CAAA 3UDCA 1FJGF 2HRUA 1SKUB 1N5YA 4L3KA 1XR7A 1RA6A 2GAHC 1VISA 3GSDA 2WBMA 1ZPWX 2IM2A 5KG0A 1UPMB 1U1PA 5HANA 5KOWA 3UCZP 3K5PA 4FNHA 3VGSA 4PG4A 4P2MA 5KAKA 1MWZA 3IR7B 3IBWA 4PKDB 4A8MP 2XZDB 1SIZA 3TWZA 5BXIA 5CYMB 5K20B 3AX5A 2VPWB 3MURP 2YNHA 3D67A 4DPYA 2J76E 3A8IA 3FQKA 4NI2A 1X4FA 1PBUA 2FHJA 1VQYA 3DNCA 4BWMA 2OMLA 2YKAA 4M5DB 4Y65A 5EX3A 1N8RT 1U1RA 4RUCA 3G87A 5C25A 4ZLNA 2AEMA 1FD8A 1LW2A 4BC7A 3FBBA 4F0MA 3NNHA 4QQBA 2C2KB 5GMEA 4OFZA 2FJAB 4QBUA 3GR0A 2HIYA 5B09A 4FVMA 4ED6A 4NLTA 3OR2B 3DKDA 4WTOB 2P8IA 2KYXA 2HQDA 4AL5A 2AYGA 2DT9A 2NS1B 1HNWJ 2HQGA 3TUIC 1N6QA 1RTIB 3BB5A 3WQPA 1ZAVA 4F50A 5F9LA 3GV5B 4P52A 2HG4A 4TU7A 3EZ5A 2V67A 4NCBA 4ZHRB 1U1QA 1V6HA 4AE5A 2YWHA 4F02A 3DHWC 2KVIA 1ZM3A 2E44A 5A0YB 5LMUJ 1NH7A 3A8EA 3IXQA 2C2OB 2C2EA 1H6KX 3D54A 2DGSA 2IY5B 3CJ8A 5ETRA 1SL0A 1H3DA 1SPBP 4NX9A 2QMUB 2LQJA 3J80U 3T1YJ 3RTVA 1FNXH 5DZ7A 3KK2B 2GQ2A 1YJTA 2M0GB 3FJ2A 4QIWD 3ADAC 2CQ1A 4P72A 2CPZA 1RWWB 4QWAA 5JVHQ 4DMZA 2R7SA 5IT0A 2BOPA 1AROP 2RB7A 3CB4A 2ASLA 1L3TA 1R8CA 1VRTB 1YITS 4J9MA 4EO6A 2ZDPA 4ZIVA 2HW3A 1RT1A 3GP9A 2XMWA 1RBLA 4IRCA 2VB6A 2HBRB 4OHYA 4PWDA 5LSOA 2ZNZA 3DFEA 3DRXA 3M8WA 2RF2A 2V4RA 3BYRA 4L6V3 1RAEB 3CJSA 5M2UA 3ENWA 1JLFB 1RK8A 2HGNA 4NZ0A 3KLFA 3GPAA 3BBBA 1UZDA 4KKOB 1S1VA 4IOCQ 2J0SD 1R43A 3NBPB 4C8MA 4ZP8A 2R2TA 1BQMB 4DR1J 2DEIA 3KLEA 1VLOA 2ATLA 3FQLA 3KHGA 1K1SA 1A9NB 2WSFC 4XK8C 2VICA 2F4VJ 3DDKA 4QWCA 3PRDA 4H4MB 1TV6A 1B3TA 5CZVA 4FYDA 1CULA 2HVDA 2PMHA 4DDFA 2CJKA 4KH0B 2O67A 1P9QC 4ZJOA 2F8HA 1O0PA 3MM7A 1SL1A 4CLLA 3G2XA 3Q22A 3JSYA 2MPUA 5KFSA 2PI5A 3LWMA 1E6YA 4ZVQB 1UWBA 3G8SA 4I7FA 3KJNB 1PGZA 1N48A 1EKRA 1NZAA 2YNIB 3OTDA 3RR7A 5H1SV 1T94A 4O3NA 3MDFA 3AQPA 2KFZA 2WW4A 1VQ4S 3W2VA 3LALA 2CUYA 4Y00A 3BSCA 5KFGA 2PEBA 3C3LA 1RT6B 4WK1A 1R8PA 1OY8A 2XNQA 1U02A 1I94F 2J9DE 4UW2A 3RUBL 3EGNA 1WTFA 1YBAA 1LQ9A 2VG7B 3W60A 2MMYA 2K1RA 5F8JA 1VIXA 2OPQA 2EFVA 4I6AA 4HHJA 2F3JA 4I0WA 4QYZK 2HYIB 2FJDB 5AXLA 1ZZFA 1JLBB 3QLHA 2I5JB 4OI2A 2NZCA 3ELHA 2B9YA 1WG1A 3BQ2A 5GADU 3C16B 1X4DA 4LF9F 4TN2A 4WFNQ 2RDIA 1T3OA 1WKKA 4P71A 4URQU 2V2KA 3EZOA 3HZGA 2VQFJ 3DLHA 1IBKJ 4DCJB 1TMJA 3PR4A 4C97A 2BE2B 3I4HX 1Q0NA 5ETNA 2VG6B 1YVFA 4N47A 5BYSA 5I4MA 2GVZB 2QO3A 1U7LA 3SBMA 2CPEA 2VBZA 4LIRA 3C14B 1SC3B 3OL7A 1RI7A 2I38A 1PYSB 2X51A 1CVJA 2RUSA 2P6TA 2Y1RI 1FX2A 5CCMA 5E41A 1B0PA 1QM9A 5ETVA 3KK1B 3BGRA 1SIWB 1WWHA 5D3GA 1RTHA 2DGVA 2UXDJ 3MOZA 1DURA 3K5LA 1CBKA 4P2XA 4ETZA 1IJEB 2VL1A 1P1TA 4DS4A 5ETOA 3VTIA 4L76A 5IM0A 1RT7A 5D0GA 4DZ6A 3OFGA 2ZOMA 2AF6A 5THWA 2E1AA 2XMVA 1BQNA 3B54A 1VQPS 4C4WA 1UVLA 2EBGA 4JV2A 2J0WA 4M63A 4C8KA 3CCMS 1NPRA 1M5OC 1TP7A 1T05A 2HHQA 2OAUA 1KOOA 4FYXB 2VA3A 1VRUA 1RU2A 3MMAA 5HQMA 2WOMB 3JQKA 2MZRA 1X4BA 2W7OA 3QFHA 2HQ3A 4LFBJ 2QGFB 3BDPA 3T5LA 2B4UA 1HLWA 4WE1B 2UUBJ 3A1YG 1QLNA 2EEYA 3ENVA 4ITSA 2ZKUA 1FKOB 3CGIA 5L9XA 3DLKB 1X4HA 4N8OA 2R42A 2WB4A 2RD5C 4DJBA 4FXWA 2PFDA 1KLNA 5K8PA 3UI3A 4MK9A 4GVBB 2LQBA 2WVCA 2M8HA 4IG0B 4M1KA 4K4VA 4DR4F 3FCVA 3X3UA 2OPSB 2VASA 4CLUA 3HVWA 4ZJLA 1EIYB 1AZSA 1X9MA 4LRCA 1L3SA 5BJRA 2C2MB 2JEFA 3CCLS 2B8PA 1YK9A 4LMZA 1E6VB 3SXLA 2VA2A 2QMXA 4QIFA 4NXNF 1Y9OA 4J9QA 4YN3B 2QLJB 4RW9A 2YX4A 5CABA 3J80Y 1HNIB 4J7CA 1FT8A 4IG3A 3CXCR 3SQGB 4NCAA 3NGUA 3AOAA 4O3SA 4QWDA 1B70B 3P49B 4O4GA 1UMJA 1K0VA 4LF5F 2CFXA 3UCGA 5AXNA 2R2RA 4K4WA 2M52A 3W2WA 2HRYA 3M1VB 4FXDA 3CPWR 3PW4A 3N79A 3JSRA 5F0WA 4RUBA 4IRKA 3TR5A 4JI7J 3OVBA 1QSYA 1S1WB 3BGFA 3VAMA 3D66A 2B9XA 4H4OA 4BDPA 1G7CB 1FX4A 2IJNA 2NUUG 4AUKA 3MUTP 5KFHA 1QAXA 2ASDA 3C6UA 3V5RA 4DV2J 1VK3A 1CJTB 4CLKA 1S6PA 1CS4B 2DGXA 1S7HA 1WUUA 3RBDA 2CWXA 3M6WA 3M9MB 1TUWA 3S01A 1HBOA 4OYAA 4JI8F 1LEOA 4GKJF 3IFEA 4DLEA 3HVTA 2XY7A 2NPFA 2H5JB 2J8SA 3B82A 3I5AA 5E3PA 2DGQA 3G6ES 3KLHB 2XGPA 2MSTA 3MM5A 4ECUA 4KR0B 3DRPA 5HMXA 1FKPA 4DV4F 2AV5A 2NCKL 4K0KJ 3GWCA 4DN0A 4IR1A 5ETQA 3EUNA 2Y3YA 2GGPB 1X0FA 1XQIA 1HQUA 1OQ6A 3J7YU 3R5GA 2Q3PA 1IXKA 3ENAA 1S48A 1TK5A 3ZO7A 4JV5F 4TQRA 1ULRA 3V6HA 4F4XA 2MLYA 4HR2A 3BBCA 1FRLA 3WX8A 1H2VZ 5DQIA 2PA3A 4DX7A 3FMWA 5SUHA 1I5OB 3PCOB 3RB4A 4ECTA 1JQGA 2B5JB 4IQXA 2XYGB 2XWYA 2HZVA 2O5DA 2YPYA 4EO8A 5D4PA 2BJEA 3MPVA 1FNMA 4P6QA 3KK3B 3V6DA 4R5PA 3EGWB 4ED0A 3DOKB 5J2QA 1NK9A 4LF6J 2CADA 2UVVA 4CWBA 1W7WA 4RLEA 3RZAA 2E1RA 3HXMA 3HD1A 1N52B 3SDEA 4EI2A 2ADCA 3BO2A 4WJBA 5CZXA 4ES2A 5J2NA 3NGKA 4C9DA 4CO5A 1H2TZ 2VIHA 1REVA 1UFWA 3CD6S 1HBNB 2XYHB 5DGAA 1T95A 5JXSA 1AXQA 3OLBA 1KHWA 4RWWA 2EFOA 4U7CA 3M2UA 3NMAA 4USUA 2AW0A 1GX6A 3BN7A 5H9FJ 3W1YC 3ZTOA 2FLNA 4ECYA 3MPYA 3G86A 1IBLJ 1GEHA 3PX6A 5CD4H 2ZH5A 2GVDB 1R0AA 3BJYA 2NXCA 4CLWA 4HTJA 3D6FB 2FGCA 1EKSA 3K7RA 4QPXA 5A2QU 1TK0A 3RAXA 2MYFA 3T41A 5K14B 4KYZA 4PG5A 4TY9A 1O5JA 3G82A 2D7SA 2H3EB 2AJ4A 3JAMU 2W4CA 4QJVA 1Y0HA 2QFJA 1EQMA 5E5NA 2ZOGA 4ED3A 1SKSA 1XR6A 1TZ0A 1NCLA 2EFGA 4HKQA 4A4JA 3DN9A 1BC6A 3M6UA 1CJKB 1BWEA 2LKZA 3ZNJ1 5KFBA 4JI0J 2D74B 4CRJA 5CD4A 4ED8A 5GMKa 3VZIA 1MMLA 3LGNA 3MMCA 4C8LA 1PCAA 2CQ0A 2VC0A 3OL6A 1R27B 3M8PA 4ID5A 2BJ1A 4QOTA 4YFUA 1F5AA 4YOEA 1UZHA 1Q16B 3UCUP 3TZZA 4A8FA 2EG1A 1RISA 4NWBA 1WF1A 2VFSA 3KLGB 2HIQA 4LQ3A 4YS2A 1SJ1A 2B8QA 2E5HA 4KO0B 5K9FA 5AJ3J 4B9VA 4DFMA 4LF1A 1P27B 5ETTA 1S9GB 5GAGI 1TUVA 4RU2A 4ZPAA 3GFXA 3MM9A 2EI5A 4OZNA 4PQUB 2DCUB 4FPRA 1M5HA 3JTPA 3PW5A 3S6EA 3NGDA 4X65F 3SCLE 3TP2A 1SQEA 1KQFB 5IWAF 4JI4F 3HFKA 2UU9J 4ILMA 2G0JA 4WKYA 4KFBB 1S57A 4JI6F 4O0NA 3RU0A 4A8WA 4USMA 2WRMA 3I9V9 3TNVA 2ZH2A 5DDRC 1OQ3A 4DUZJ 2FB0A 1FJ7A 3UD4P 4KQZA 4ECRA 2DR8A 2LQ5A 1XNRJ 2U2FA 4ED4A 3ETMA 5I3UA 2F9JA 1T7PA 3EXCX 2XMAA 1FO1A 2HVIA 1IKYB 2BKNA 2FJVA 2YKMB 2A10A 2VJVA 1C1BB 1AUDA 1AB8A 2C3OA 3QJLA 3AJDA 4MMOA 3PKMA 1U1OA 4QPTA 1S0NA 4DX8H 2XC9A 2GCFA 4NLDA 3BGUA 1T0TV 3M32A 2XNRA 5DM7Q 3JYTA 4UUWA 1NKCA 4ZPTR 5LSLA 4LF7F 3ZC4A 3J7AN 4KV8B 3BN4A 3OTOF 1IUJA 5BYQA 2IM0A 2YWGA 4IYQA 4JI1F 1YJVA 5I3PA 4E2FB 4URGA 1JLEB 1J5OB 4LF4J 3DLBA 2NLWA 4DUYJ 2AX1A 1UA0A 1SC4B 1UJ4A 3GR1A 3UWTA 4TLRA 3P5TL 5AE2A 2V68A 1NZ8A 2LCWA 1VC0A 3GJRB 3NCQA 4ZVTB 4KGMA 1DZ5A 3QT6A 3M8QB 1NAQA 3MEGA 1OMSA 2JWNA 2BQ3A 2DK2A 2QG9B 1QUPA 1FFSB 3BF4A 2BEFA 2N4CA 1N34J 2ILZA 5GAHI 1S72S 1MW7A 1HI0P 1IKVB 3GIKA 3MXHP 2VH7A 2BW7A 4L74A 3R7SB 2UUWA 1I6JA 5DJBA 4C98A 2LA4A 1B64A 2W2QP 2FJWA 1M1GA 3IGNA 4WU2A 3NS6A 1M5VC 1UFKA 3A8JA 3I5CA 1SVDA 1XMOJ 3IRWP 1VRQC 5G0RA 1NPKA 3G71S 4ZPBA 4DV5J 2LQ8A 1SV5A 4U6PA 5AE1A 1IKXB 3T19A 1U1KA 3NWGA 1ZS6A 2V4JB 3CT9A 4DQPA 3GMGA 3KMQA 2CG8A 5HVFA 5KFIA 5LL6d 2R8GA 4RNNA 1R3NA 5D0HA 3LF0A 1SKWA 3HM9A 3PIOQ 2ZBCA 4ED7A 4GRSA 3MMBB 2E5LJ 8AT1B 4HDHA 1TKZA 3QGPA 3QGHA 2XCPA 4MKBA 4ZP7A 5AE3A 2LU2A 3GG1A 2Y8YA 2QL7B 4J91A 5D4OA 2HHHF 3V2UC 4DSEA 1X5TA 1PJ7A 2Q6CA 3KG4A 3HHNB 4A8XA 4G1QA 3OHAA 2XHWA 1RAGB 5BR8F 3W8GA 4TU8A 3FCWA 2J5AA 1FERA 4LRDA 5L46A 4ZP6A 1RTIA 3MEDA 3HKWA 1QY7A 2MQLA 2W9BB 2V50A 1FFWB 4UQTA 3G6XA 3PRBA 3B4DA 2MY7A 2DHAA 4B3MF 2J8AA 1FWPA 2HS3A 3AD8C 4DPUA 5MLCV 3AD9C 2GQCA 3B78A 4ZHRA 4EMDA 3KYLA 3DXSX 2RUGA 3CDAA 3N6MA 2JLEA 2YNHB 2MQPA 3ILIA 5A0YA 2RNEA 2DY9A 2KXHA 1DY3A 1RBOB 3PXGa 1R8HA 1AUSL 1Q4RA 3OSPA 3LO3A 5C25B 4HT7A 3PYDA 2HEKA 1LW2B 2RRBA 5GMDA 2MQOA 3KK2A 3AA8A 2KM8C 5A2QY 2IRXA 2QRRA 3H40A 1Q95G 2PC6A 4CO4A 4X2BA 1YRXA 1H74A 4JI5F 4ZPCA 1VRTA 5F41A 4F4ZA 2FD2A 1M90T 2CDRB 2JVRA 1VC5A 1SCJB 4EYHB 5LSRA 2E66A 2HNZB 3N5BA 1S9EA 1N6QB 3NNCA 1NXIA 1UEKA 4HT5A 3D68A 3BYPA 4NLVA 2IFXA 2BMBA 3W9JA 4FPIA 5ETPA 4CP5A 3RB0A 2ZEJA 1JK9B 2AJ1A 4DXLA 1JLFA 4ZS6A 4KRWA 2QA4G 1A6LA 1HFEL 3T6JA 4ZCIA 3C6TB 2I1RA 2HPUA 4KKOA 5CYQB 1LWEA 4Q2MA 5LJ5Y 1ICEB 3ZTQA 4PAAA 3H5YA 3D6MB 3PW0A 4C8NA 4ZCMA 3NBPA 4UOCA 5EWGA 4DR5F 2GS8A 4ICLA 2F7VA 3C15A 3L95X 4H54A 1L3VA 2G1HA 3RB6A 2XZ2A 2VG5B 4MKAA 4K50A 4B08A 1KQKA 2D9OA 3UE2A 1CC7A 2AGQA 2OLWA 2B56A 4G6VB 3NY0A 4H4MA 1CC8A 3VQSA 2GMLA 2W24A 1U8SA 2QN6B 1RT1B 2Z4PA 4F67A 4F25A 2CXEA 1K73T 3VCDA 4QR2A 1TL3B 4ER8A 2LLZA 4ILLA 3IG1B 4PWDB 1UJ5A 3EWGA 3T9ZA 1F0XA 3BQ1A 4KY3A 3OJUA 2HRTA 2RAQA 3ITHB 2O3DA 2Z2LA 3KJQB 2DBBA 4TXSA 1FJGJ 1NSKL 3MEEB 4NRUA 2ZJQQ 2P9CA 5F8IA 1S1VB 3BZQA 2NUHA 1XN9A 4PWUA 3LA0A 1R8BA 2E5IA 3FRZA 1RT6A 2RMLA 1RZMA 4XDCA 2A6OA 4B3RF 2KL8A 2CJBA 4RUAA 4MFBA 2AYMA 2FC9A 2YKNA 4PUOB 3QO9B 5KG1A 2XHCA 4JOUA 4DFKA 1RT4B 5F9NA 4EUVA 1J5EJ 4NYOA 3RYLA 3TX8A 1JLBA 4EEYA 2I5JA 3LWLA 4ZVEA 4RZRA 3S7RA 3C16A 2CG4A 2ROGA 4KC5A 2V34A 4M5HA 4NLQA 1W2IA 4O3QA 3AXKA 3OHBA 4ELVA 3UD3P 2HVHA 1JLQB 2AMCB 2KZZA 2BE2A 2VG6A 2GZOA 2M2BA 3FZ2A 2EG2A 1RYRA 2MZ1A 2ZZMA 2GVZA 1X8DA 1EARA 1RWMB 2FLPA 3DI6B 3C14A 1KOHA 1IJFB 1TELA 2Y0SD 4DOZA 4B02A 2W4DA 5DG7A 4O3PA 2IA6A 1K44A 2ZVIA 4IRDA 1B0TA 1HNXJ 1WORA 2MTLA 2WK4A 3FK4A 3W3SA 4OYIA 1NHVA 3DC2A 1BMQB 2AJQA 3D3BJ 4X66J 1U48A 3P6YC 2D68A 2YY3A 4J90A 3ISND 1BXNA 4WWSA 2GIRA 1GXTA 4F4YA 2JRSA 5LMNJ 2MZQA 1OY9A 2RU9A 1JJ4A 2B3TB 4J9OA 3OSNA 3KUHA 1LFPA 4F0KA 1WEYA 4N76A 1JKHB 4PXBA 3CNQP 1H38A 3F73A 2FLLA 3PO4A 1HNVB 2K7KA 2WOMA 5L1JA 4DR7F 3PY8A 3OT9A 1KQGB 1HKAA 1FEHA 2CA9A 3ICLA 3L7OA 4PWWA 4WE1A 1WC6A 1H7WA 4V19J 3PNIA 2A2DA 3DM2B 3MECB 2J6SA 1YKWA 2YWEA 1KEKA 1FKOA 2CPFA 3DLKA 3QFWA 4NLGA 4F4KA 1XNQF 4ZVUB 2WVFA 3R7NB 4DSLA 4GVBA 4IFVA 1S0MA 1C2PA 2VHGA 1RT7B 4IG0A 4USJC 3IP0A 2HFVA 3LP0B 4CLFA 5HROB 4LRBA 3DLEB 2MDAA 3X1LB 4OZ5A 5HP1B 2OPSA 1BQNB 4GO7X 4Q8FA 3CJKB 4Y3CA 3M9OB 1FRJA 2RIJA 1H98A 3SFGA 1E6VA 1RTDA 3PYFA 4DWIA 1XIQA 1BHNA 2R9LA 3DRSB 2B9WA 3BQ0A 2UXBJ 5K8MA 2ZC3A 1X7VA 2RVJA 2BXJA 1HD0A 1UFLA 1VS3A 3SQGA 1S97A 5K8OA 2R4FA 2R7VA 1WHXA 1RT5A 1GTHA 3M2VB 1NK8A 2COLA 4K59A 3SFUA 1ZTTA 2R7XA 1VDHA 4ES3A 2AZ3A 1Y7PA 2MKCA 2ZH7A 2HK2A 2XCAA 2NYHA 3UPFA 4LIWA 1QSLA 3CD5A 4Z7YA 2ACYA 1VHIA 1RADB 2XS5A 2Z2MA 4LQ9A 3QT8A 2HNYB 2UXCJ 4KJIA 1MG7A 3I82A 3FUYA 2F4FA 4OJ1A 3GFHA 5IFMA 2J6TA 2UUAJ 1LWFB 3NOCA 4QIGA 4NA1A 1L3KA 3PHEA 1I94J 2JEIA 3D28A 3CD0A 1GQEA 4ZLPA 4JB8B 2QC3A 2OPRA 2LEPA 1Y3KA 1ZAXA 1FHTA 3UQSA 3R6LB 9RUBA 4F26A 3TAQA 3I0SB 3LH2S 1ZOTA 3CMES 3W5YA 4RW7B 1H0HB 1CJTA 4RPFA 4U8YA 4CI0B 1CS4A 2ASYA 2CYYA 1CSJA 2QL5B 4NE9C 3GV7B 3WX4A 1Y00A 2AU0A 2KT2A 1DFDA 5B0EA 4M94A 2PIIA 4LF9J 3VVUA 3KDOA 5L38A 1OPZA 3FBFA 2RH3A 3H25A 2XMMA 2IM3A 1PIEA 5K8NA 2YPZA 2D3UA 4WFAQ 4OMFG 3TJ8A 5DO2A 1RACB 4Y2CA 5B08A 1RAHB 2OI2A 1CJVB 1RWUA 3OFFA 4OX7A 4AL6A 2BACA 4CO0A 2YX1A 3NG8A 2FHOB 3ZZOA 1ROFA 2D41A 2OJ3A 4LVNP 4H4OB 3AB4B 1OS5A 2D69A 1VQSA 2Y9HA 1URNA 3S1TA 4HVZA 1WELA 1KNZA 3Q8VA 3AXMA 3OL9A 1R31A 5DGBA 2B5JA 1YRTA 1MSWD 2G4BA 1N0UA 4M5JA 3TO8A 2NXUA 1NDKA 2R3VA 2M3DA 3KK3A 4DZDA 3D0IE 1IQZA 3DOKA 3HVTB 2DIVA 4QW9A 3CMQA 1YJ7A 3R27A 2V2ZA 5F8MA 4CLTA 4OHXA 4GKKF 2N4DA 2PDAA 3HFVA 3GB0A 1TL7A 3DDNA 5CH7B 1OY6A 1Q1KA 4YP3A 3UO0A 3MM5B 3BGOP 1FKPB 1HNWF 4KAIA 2UUTA 1RWKB 4KPCA 4MYTA 4CM2A 3BH6B 4B3OB 1HBNA 3H4DA 1HQUB 4WP3A 4OI3A 3TANA 1WSRA 2J6UA 1GAOA 4MIBA 3EDQB 4BLGA 1HWKA 3P3DA 3G6VA 2XTDA 1UKUA 1NDPA 2MGZB 4J9SA 5LMUF 2KHCA 3JSMB 4K4UA 3CJ5A 5KOXA 1S9FA 4B9SA 3TX0A 2CJAA 2EK6A 2KM8B 2W7PA 5EWFA 2GVDA 2ZWPA 3RBXA 3DOMA 1SJQA 3T1YF 1D09B 1HPZB 3VGUA 1N32J 1DRZA 2IDLA 5CHCB 3SIPB 4ZVSB 1Y3JA 4U7UD 2ABYA 4TKTA 4O3OA 1J2VA 3V4MA 3I56S 4UTGA 5ADZA 3SDEB 1IWAA 4QR0A 2C2DA 1VQMS 1URRA 4Y2MA 5KT6A 2OMOA 4ZCKA 1HWLA 4DR2J 3QSYB 4CLYA 1REVB 3WIUA 3Q8UA 4B3TJ 3CC7S 3HX9A 1KFSA 2NREA 1KDNA 3K8VA 2XZTB 3TARA 1CJKA 4DV3F 1VBXA 1S1TB 1NBEB 4IO9Q 2FHMA 3Q86A 2MEWA 2L9WA 5J2PA 4FBUA 2YH0A 3E2EA 2OPPB 1LWXA 1OPIA 1M5KC 5A8RB 4GMKA 4ERDA 4HYKA 1WDTA 1ZM9A 5FD1A 1T9VA 4W92B 2A2CA 1RTJB 3HT0A 2H4YB 1U6FA 1PBAA 1CEZA 3D7SB 1W25A 3JXOA 4RUHA 1FKAF 3V6KA 3BKUA 5L1KA 3DMJB 3GIMA 3KLGA 4RW4B 2F4VF 1S6UA 4ENOA 2B7BB 3MAAB 2E1MC 3G82B 4BBYA 4KO0A 3ZTPA 2DY1A 2O66A 2QA2A 2F5GA 4DV7J 2RQ4A 2ILYA 5D0RA 1RLDA 3KNAA 3FBCA 3OV7A 3HULA 3R5BA 2IYIA 2HHVA 4PQUA 3ZZYA 3M7VA 2V1SA 3IR6B 3CDBA 4QZVB 4OI4A 1NRKA 3ET6B 4GKJJ 2ZH6A 4DF8A 5MAOA 2MSSA 1WKLA 3Q8PB 2OO4A 1MMNA 3Q8YA 2RKIA 4JUZA 2L08A 1BY9A 5B0GA 4NOHA 1WI8A 4KFBA 4OX9J 3FGVA 5KFDA 1GNKA 4Q8EA 1WF0A 3OR1B 4AD6A 3DLJA 3R1HA 4YY3F 2QMWA 1C4AA 2DNLA 4RR5A 4J9KA 3GTYX 4AQYJ 2D3ZA 3HDSA 1OSCA 2O1PA 5L1LA 3W9HA 2YKMA 1C1BA 3AH6A 5A8KA 1PILA 5KFPA 2G0IA 1X4EA 1F9FA 2F8MA 2DPIA 2B6AB 3NGTA 1YGYA 4ANCA 4DS5A 4KV8A 1Y11A 4L75A 4NYPA 1Q79A 2BW2A 2CQGA 2ZHOA 3KLIB 3QIDA 3HHLD 1J5OA 2VQFF 3A4TA 3LAKA 1A7GE 1IBKF 3IWNC 1F60B 1IBCB 1KQSR 1LV5A 1NMEB 1SQGA 3NS7B 2DB1A 2CPXA 5M2PA 3HP6A 3DLGB 3BR9A 2DPJA 1XERA 3HZEA 2EKNA 1HBUB 4HTIA 3IS9B 1WJ9A 1O51A 3VGTA 2UVRA 4IH6A 1XMQF 3QZ7A 2R8HA 3H4BA 2MB0B 1RHQB 1V5VA 2XI2A 2ZBRA 3BH7B 3OD2A 4FF2A 4B9TA 3JB9k 1PO6A 2ZHBA 1TTHB 1G2EA 1RHKB 3ISNC 3J81j 2ROEA 4CO2A 2CWKA 2Z58B 4P75A 2UXDF 4RBTA 4EBCA 3GJTB 5T14A 2GX8A 4P9SA 3CW2C 3NRBA 2DXDA 1NUEA 4ZPVR 4ZITA 4OX6A 5D8HB 8ATCB 4IOAQ 4PZVA 2KB2A 3MTJA 5DG9A 1NK7A 4OQJA 4MKVA 1IKXA 1GMWD 4NEZA 3QIPB 2BV3A 1TKDA 2DNMA 5KFEA 3HMJG 2Z56B 3I9ZA 2H65B 4X4SA 2VBYA 4RJVA 2Z30B 5HAOA 3V4IB 4OIXA 1T9UA 4QCLA 3MCNA 4XPCA 5CYJA 4WIIA 1WKJA 4I2PB 3PEHA 1MN9A 3CCVS 3EICA 3CULA 3GV8B 3H2UB 4LFBF 2N3OA 3FVYA 3IM8A 4JI2J 1KONA 4J5OA 1RQ0A 1T11A 3HHLA 2FVSA 2JLGA 3VF0B 5HO4A 2XWXA 1GTEA 3AHPA 1HYSA 1NK5A 1DTQA 5ETKA 2OD4A 3BGLA 4Y28C 2AHOB 1HR0F 3JS9A 4MJKA 4PXCA 2Y1LB 1Z2LA 1SUQB 3VGVA 4ECXA 2GNKA 3WBZA 4UOFA 3D0HE 5G0RB 4Z37A 2W9BA 4KGZB 2DXFA 1SV5B 1FWLA 1GK8A 4JYAJ 5HQ8A 1FRXA 4TLQA 3N28A 5EWEA 1V3RA 4JV1A 2DRDA 3BBFA 1JXLA 2ZZTA 3C66A 2KZMA 4ED5A 3M8RA 1IR0A 2IVMA 2IJFA 1JX4A 2ZFHA 4JV0A 5FDLB 1GXUA 4UOHA 3NGRA 1FDNA 4PEOA 2UV8A 3MPWA 4C3KA 1TKZB 3BR8A 3K5NA 2VC1A 2EBEA 5LM7E 2E7XA 5D77A 4B9MA 3B8HA 3NGSA 2QA1A 1ZZNA 2UUCF 1LK7A 3VWSA 3NNAA 3C8YA 3ONQA 2RQKA 2V9WA 1UVNA 3WC0A 3RRKA 4G1QB 3R3TA 2M88A 2HNZA 4I6WA 4WTYA 2C42A 1SJ3P 1TAQA 4FKYA 4AFFA 1HQEB 3MEDB 3N0VA 4JI7F 2VUGA 3P96A 3HSJA 3I6PA 1S0VA 3E01B 1M0SA 3O5TB 2XLJA 3L7UA 1OYDA 1T9XA 2CZ4A 1DJ0A 2MZJA 4C0HA 4NLXA 4KBIA 4DX6A 3C6TA 2HBQB 4RL1A 5CYQA 3G8TA 4U96A 1X4AA 2BBEA 2J7KA 1HNZJ 4C8OA 4RW6B 4EWTA 2DRAA 1Q8BA 4FS1A 2DR5A 4OHWA 4LF7J 2FVRA 2VD3A 2VG5A 3MCOA 2JC1A 4MK7A 4K4TA 2YKOA 1YLXA 2WSCC 1SL2A 1KVKA 5GAEU 1YX2A 4LFAJ 1NB7A 2N7CA 2XTCA 4EBEA 1LW0A 2FJBB 1TKXB 2QSWA 4RBUA 4DR3J 3VZHA 4H4KA 2OP5A 1ZBTA 1S9EB 1Q81T 4OJHA 4URSA 4K0KF 1TL3A 4X62J 2B9EA 3IG1A 4UOGA 4O23A 2JNJA 3ITHA 1FE0A 2FC8A 5K5MA 5KFCA 2X1GA 3D9BA 1IM6A 4P2FA 4MH8A 3TA2A 4LT6A 4HI1A 2XGQA 3CCZA 3AX3A 3I87A 4IDKA 1AFJA 3MEEA 2PGCA 3RG6A 1LWEB 3LPYA 1FRMA 4DLGA 4G1IA 3A3OB 4HH1A 1GMVA 4K4ZA 2V8VA 4A48A 4ICLB 4OX8A 3C15B 2IHR1 4ZA1A 5KFVA 2VZ9A 1WSVA 1UEUA 2HAFA 2RRNA 1HARA 1JXEA 2VKRA 2MXYA 3HVRA 4PUOA 1PYTA 3QO9A 2CKWA 1P1LA 2HZAA 5KFUA 2V94A 3MCSA 2JVOA 2QV6A 4LREA 1ITPA 2LXUA 1RT4A 4ZKAA 4LSZB 4PPZA 2R8KA 1S77D 1WOOA 3PRVA 1QD1A 2HFZA 3IAS9 2E5GA 4ZVOB 2G2ZA 3HD2A 2RHQB 3BEGB 3W5ZA 5LJ3Y 2HK3A 5U47A 2WBRA 2B43A 2X1AA 1IBMJ 2WCXA 5C2CA 4I64A 4IQMA 2F9DA 5H9EJ 4J37A 1JLQA 3J81Y 3HT3A 3C46A 3QMQA 2V8HA 4R0JA 1N88A 1EZZB 5ETMA 1S6QB 4CH1A 4K2XA 1U2RA 2K8GA 2FIUA 5SZTA 3DI6A 4FF3A 2Q79A 5BR8J 1LNQA 3KLVA 4ETXA 2CDQA 4MFBB 3MPUB 5JUMA 2YKNB 2ZBIA 1IR2A 4FKXA 1H7XA 1WDDA 3HHDA 2HFOA 2C22A 2VPYB 3DGVA 1S1XB 2OELA 1KRPA 2AJ2A 5J1EB 1SC6A 4OZ2A 3QAUA 1KLMB 2BJDA 3Q89A 2H54B 1KS2A 3G96A 3S8SA 1FNOA 3DRRB 1RAAB 1M1KT 3CCJS 4PXDA 4WIQA 1OIAA 2KYZA 4IO1A 4I4BA 4O3RA 1F5CA 4FBTA 4MIWA 1U4BA 3FBEA 2HHXA 2V9KA 1XBWA 1HHQA 4ZCLA 1VK8A 1PC5A 1RJJA 2BANB 3MUVP 4K2JA 1Q8LA 1RBAA 1JKHA 4F3OA 4UZBA 1L3UA 5DDOC 3GIJA 4LF8F 2HVZA 1DARA 1YZ7A 1WHYA 3MD3A 1HNVA 4B3SJ 2AGPA 2FUG9 2CZVC 3ZZRA 4CO3A 2BM1A 3IBCB 4DV1F 3UVJB 5IC4B 4OLPA 4M95A 1N5QA 3TAMB 1HI1A 2DEJA 3TVZA 4DQIA 4CNYA 1VQOS 2BE9B 2CVIA 3DM2A 1R89A 2AZ1A 3MECA 1FDAA 1IR1A 3SQOP 2GIQA 4MTPA 1Z2ZA 2QYCA 2ZKTA 2G2OA 2DH8A 2QSFA 3OBIA 5KFLA 3KDNA 5IS2A 1FVSA 2K3IA 1XWLA 5IZHA 3QWPA 1SXLA 2GHPA 2FHKA 1NHKL 3LP0A 1NDCA 2G9OA 3BV8A 3T1AA 5HROA 3MAQA 2JFDA 3DLEA 5FIIA 2R7RA 5HP1A 4QR1A 2GC8A 2XO6A 2A6MA 4PABA 1N5VA 4EU0A 3CJKA 3RB3A 3QRPA 3TA0A 2CJQA 2UZAA 4X4PA 2IMWP 5E33A 2IM1A 2UU9F 1IKWA 2EKYA 3QPIA 4LBHA 3Q2TC 2RJZA 1N36J 3DRSA 1FRKA 1KTVA 4A46A 1U26A 1TL1A 3A8KA 2RRAA 2XMUA 4F8RA 1TQLA 1CLFA 5EGYA 2K2PA 4X4NA 2AGOA 1NHUA 4R8UB 3M2VA 3UDLA 3HJFA 3FZBA 1JLCA 1XNRF 7FD1A 5A6PA 4MK8A 4X64J 1X60A 3HHLC 3IMQJ 4IFVB 2HNYA 2K3KA 2W01A 3BSNA 4CH0S 2RHSB 1X31C 2V2VA 3AA9A 4NYZA 2XSFA 3L9ZA 1LWFA 2YXLA 4CM0A 1WEZA 4ZDNA 3TQ1A 2L3MA 2LU1A 1QDUB 4LF4F 4B3RJ 1FDBA 4RW8B 1Y5NB 3R7BB 4KH1B 1RKIA 1RTDB 3I0SA 5CQGA 4RW7A 2QX0A 1WI6A 3U7JA 2DNOA 1Q86T 1U6ZA 3T1HF 1J27A 3VAGA 3MCMA 5FLXY 5DETA 1TAUA 3NS5A 4K4SA 4U95A 2E9ZA 2NYIA 1RT5B 4NXMF 1B7YB 4RNMA 4DL4A 3US5A 1FA0A 2RE1A 3FMBA 1NSAA 8RUCA 3I55S 3LP2B 3UR0A 3A12A 3NAIA 2R7WA 2HGMA 3AODA 3KMSA 5HMZA 2V2QA 2L9NA 1ZA2B 2BABA 1W2BR 3E8OA 4ZJQA 1CJVA 2AEFA 1XMOF 2ZM6F 3GILA 5D4NA 4ZLLA 2OTLS 4DL2A 2J9CA 2WW8A 4Q2LA 3H7HB 3TVKA 4U67Q 2W25A 2LXIA 1HIYA 4WYLA 4I2QA 2AP6A 2OPRB 1VMBA 1BGXT 2KXFA 2XBPA 2XSJB 3RR8A 1M5SA 2CPYA 2KJVA 3CJ4A 2X1FA 3LP1A 3Q8RB 3PVXA 2FTRA 4WP9A 3OXLA 2HWTA 1B4SA 1X4CA 2VJUA 4LRAA 2W9CB 4XAKA 4RO0A 2Q43A 4F4WA 4USIA 4DQSA 2IIHA 4J9LA 4M5MA 1JLGB 1O8BA 4PYAA 2H51B 1T03B 5A8WB 4F0HA 1GFWB 3B6BA 2OSQA 3W9IA 5JJBA 3H0PA 1YZ6A 2XM3A 4D3HA 6AT1B 5DG8A 1F2GA 3DHXA 2EFQA 3MM6A 2VV5A 1TK8A 1AYEA 1S59A 3MR6A 4DUTA 1RLCL 1FWKA 2YTCA 2WVBA 3AY0A 4H4KC 2GMHA 2FZKB 4R25A 4CLZA 1LFWA 3KUGA 4B3OA 4DN9A 2DO4A 4NLYA 2JSXA 2YH1A 1TVRA 3D3CJ 2IC3A 2HKEA 3NCRA 1REGX 1FE4A 2UVUA 4C8YA 4DR6J 2IBKA 2C2RA 3MGJA 1VJQA 1KKHA 2MGZA 3JSMA 1V9OA 1TUGB 1XNQJ 2BJ7A 3PHTA 5F8GA 2ZH9A 2CJYB 4ZOSA 2VOPA 4CT9A 4USHA 5LT5A 2NZ4A 5AXMA 3KHRA 1HI8A 3FEZA 1VHFA 4DPOA 4LBIA 3MUMP 6FD1A 3H5XA 1KD1T 1HPZA 2RT3A 2XLIA 2GV1A 2WZ1A 4P74A 4DFJA 2PO4A 1NU4A 5C42B 2HWHA 1TL7B 1WOSA 1DTTA 5DS7A 5E3RA 2WB1D 5ITHA 4X4UA 2CNNB 4DSIA 3TJ9A 1U1NA 4QYZJ 1CJUB 1JB0C 2I0XA 1X5PA 2EWHA 1NPPA 3H59A 4O44B 3SCJE 3CC2S 2VFVA 3QQCD 4FVCA 2DNRA 1Z4UA 3MFIA 4OYBA 3BPSP 2DNGA 1S1TA 5LXRA 2HNDB 1ACMB 1RAJA 2C28A 3E51A 4YHHJ 1NNDA 1S79A 1FXLA 2WVDA 1VQ8S 2YQ0A 2OPPA 5A8RA 4RNOA 2ALYB 1MU2B 1RTJA 3CWJA 2KFYA 2C3UA 3DOMB 3T5KA 4KHRA 5F8HA 1WHVA 2KKHA 1JMTA 3U02A 4K8RA 2JX2A 1R7IA 3PW7A 1EP4B 3DMJA 3IWXA 2BKOA 1T9WA 3TZYA 2H5EA 4RW4A 1NSQA 3TYTA 2A3JA 3I0RB 4FF1A 3MAAA 4ID8A 1Q8KA 2YWKA 4AXJA 2Q6BA 3U1NA 5D4LA 1FEEA 3K89A 5KT7A 2LMIA 1N5SA 4F36A 1D3WA 4DU7A 1V5IB 2HGLA 4V1Ak 1HD1A 4Q45A 2CQ4A 2FQQB 4C48A 4TY8A 4G1PA 4FYWB 3CD7A 3EZUA 2PSZA 3CJQA 5C7PA 3MAHA 4DSJA 1VFJA 4HEA9 5KFRA 2MLZA 4DCOB 2Z57B 3EJMA 1SJFA 2LDYA 4UT4A 3ET6A 2BJ8A 3W62A 2C3PA 5J2PB 3AFGA 1FK9B 1SBRA 2ZOFA 3M2RA 2HHUA 3HI9A 2QE5A 4HHUA 4HI2A 3IGVA 2MHNA 3AAWB 3I31A 1D9DA 4OZJA 1C0TA 4CTAA 3SSRA 1KTQA 3ULHA 2C2ZB 3OJSA 3M4XA 3OR1A 2LECA 4OV1A 3AJ1A 2D3O1 5HMYA 1LXJA 2DCLA 2HSEB 3HVAA 4DV0J 4LFCJ 1J5EF 3OTEA 1S5ZA 1OWXA 3OLAA 2AKWB 4RKUC 3CIMA 4JP8A 2U1AA 3NP5A 2HWIA 4QU7A 2B6AA 3FNNA 2P9EA 3EDRB 3Q8SB 1F9EB 4NA2A 3KLIA 3PJ9A 4FP9A 2LXFA 2DHGA 2V5HG 4A8SA 5GADI 9ATCB 5T7LB 4K5RA 3M8YA 5LXYA 3CJTA 4AXIA 4NEYA 2XMJA 2Y1JA 2P6SA 2IVFB 3D1OA 3DLGA 3OL8A 2RKIB 1HBUA 3CE8A 3IS9A 2DRBA 4XPEA 2EK1A 2QT7A 1VI7A 3ZTSA 4GKKJ 1MWYA 3V6JA 4WFBQ 3R2CJ 4KIAA 2BVZA 4F7VA 1QAIA 3D4JA 3K0JA 3V81A 3WC2A 2QTWA 3FDSA 3JSBA 4HDGA 1KVIA 2DO0A 5IC6B 2UVWA 3WIVA 2GO9A 4JI3J 2OEKA 2KO1A 4Y2AA 5A8KB 1HNXF 3ILLA 1RABB 2A18A 3CCWA 4USTA 4J9VA 4X66F 2BR0A 1WG4A 1DQAA 1RA7A 2F63A 5ETSA 5LMNF 2GFFA 3KUEA 4M5LA 4YR3A 4UY8T 1QTNB 1OO0B 3QIPA 3D2WA 5KG4A 2W2MP 3GONA 3P8BB 2MY8A 1R6VA 1JWWA 5DLFA 4EGLA 2DHHA 1D8ZA 2PMWA 4X4QA 4LUBA 4DHVA 3V4IA 4KT0C 2OEMA 3F41A 4NRTA 2LEAA 4I2PA 3THVA 1VQKS 3C2PA 3OXGA 2X3DA 2WTFA 3TUPA 3BSOA 4KHPJ 1MROB 2G1DA 4RNHA 2MQQA 1UA1A 2OIHA 1UEVA 5D0EA 2LFVA 3BREA 1UP1A 3EX7B 4DV3J 4YMEA 4PCQA 3GQCA 1RWPB 2WHOA 3NEKA 4FYYB 4NA3A 1U2FA 5DDQC 1SUQA 3OFEA 3ZNUA 2YKQA 1SC1B 5GVQA 3QZ8A 5B0AA 4PQAA 3M6VA 2MQMA 4WBFA 2XTJP 6FDRA 2FDNA 3SZ2A 2N3LA 5FDLA 1DBDA 2J7UA 3D6TB 1OSDA 1TU0B 2XI3A 2BDPA 2UXBF 4U7UK 3QNWB 1NK4A 3K2YA 1UCNA 3K58A 4WPAA 1C1CB 3SMZA 1U2CA 4C0BA 4E0DA 1XJWB 2B4PA 1NKBA 2M9KA 2ZHAA 3HHLB 2XMTA 1C4CA 2H48B 1JJCB 3GIIA 3N9UC 1HYSB 5L39A 2HQCA 1VQ9S 1DTQB 2EFPA 2V0NA 2DKOB 1VQLS 4O4RA 3H98A 1X5OA 3K59A 4MIAA 3T3FA 3T5JA 1HW9A 2UXCF 4PRFA 3FSIA 1HQEA 1IVZA 1MMDA 3B4MA 1N33J 1D9AA 3EXYA 4OYWA 2UUAF 4CIOA 1RAOA 3VAJA 4I56A 3TEHB 4NLUA 2HHPA 2VQEF 3E01A 4IKAA 4RX6A 3FCHA 3RAMA 2BQRA 4YY3J 2DHSA 2VPZB 3EM1A 5GAGU 2MHEA 2ATCB 2Z2YB 3EE3A 1XEZA 1RU1A 3TZWA 4WKRA 2A1BA 3G4SS 5KFMA 2XTEA 5IT9U 3PG9A 4PG8A 4RW6A 4OV6A 3VV2B 2EVZA 5T41A 2DISA 3DOLB 3GSIA 2BE7D 1UJ6A 3HPOA 4FYVB 1S99A 2GJIA 4IOBA 4EK2A 5HK4A 1CG2A 3WZ0A 3PFOA 3NLCA 1NJXA 3ZZ0A 2CNLB 2MKJA 4OI0A 2JEGA 3SV4A 1TKXA 4ZVGA 3GYNA 5H9FK 1X9WA 1FFGB 5E0OA 1F3FA 3P45B 3DGPB 2ZH3A 2XO7A 2G0CA 4DPXA 1UVMA 5L8RC 1Q8IA 2ZUAA 1XMQJ 1Q7LB 1GMUA 2YWFA 2XS2A 2JL9A 1VC6A 1TMMA 3NKYA 3MHYA 3VR1A 3N5FA 4HACA 4U9RA 2GMJA 1UPPA 3J7YI 5F8NA 2OFGX 4B9NA 2FVPA 2YNGA 4WK3A 4DSFA 3ZZZA 2RS8A 1BE4A 1P8GA 1JNRB 4C2MA 2BJ3A 5DLGA 4IFYA 2QLXA 2FJEB 3MFHA 1Q82T 4X4OA 2ZH8A 3QJJA 3LANA 4PR6A 2OKQA 3M30B 2WAQD 1F9HA 1L5UA 2UP1A 2R7UA 1LW0B 1YG0A 1RHRB 4UY85 2HFSA 3FEXB 4KGXB 3UW1A 5KFNA 3GCWP 4UF4A 1I51B 1EJ7L 2HQFA 1U0HB 5GAHU 2V8PA 2K06A 2FYXA 3W64A 3O6QA 3MR5A 2C3YA 2HLUA 1Z1ZA 4ED2A 1Y5IB 4USKA 3I5BA 2J7WA 4IDKB 1S6QA 4M5KA 1R0BG 4D3GA 4P73A 4C3MA 2PMZD 4Y0FA 4Z2XA 1HWUA 5FJ4A 2MKKA 1HR0J 2R2UA 5KT5A 5F3TA 3A3NB 1VQNS 2VDIA 1B7FA 2ZC4A 2DIUA 1U47A 4ATNA 1LXNA 2JZ5A 3VAKA 5D15A 5E3AA 3KXDA 1N32F 2RQMA 1SH3A 2KH9A 4UUXA 2ADBA 3PO5A 3GU0A 3NL0A 4QWBA 1N54B 2CQ3A 1S1XA 1NJIT 1JJ2R 5CCLA 2LP4A 2MQ8A 5J1EA 3GG0A 2CIMA 1VBKA 1KLMA 2N82B 1QJHA 1FI4A 1QE1B 1C0UB 2DNZA 4WFYA 4OZLA 4DR2F 2FZCB 3DRRA 1K8AT 3KHHA 1R8AA 2CZ9A 1RWVB 3VAIA 4B3TF 2L41A 2W2PP 4WXOA 4Z7CA 4PG7A 4XIUA 3FSYA 4ANEA 2EW9A 3A3PB 3AOBA 3KJFB 4K4XA 2BANA 3M9NB 2KU7A 3IO1A 2HVEA 2V63A 2UUCJ 1UL3A 1YQHA 3NAHA 4N56A 5IXUA 4ED1A 5A6WA 4NMXA 4OJGA 3KJVB 3P5BP 4J9PA 1FESA 3UVJA 1HA1A 2FLOA 4DI6A 2Z2ZA 3TAMA 3MWBA 5KG6A 3CF5Q 1ZETA 3O1LA 2JDJA 3TUZC 2C2NA 3M8ZA 1H2UX 3MF5A 5I3QA 3RJMB 4WFXA 1RDRA 3DYAB 2DNNA 2KG0A 2BOAA 2P2CB 1BD6A 3UDVA 2EC0A 2B0GA 1BUXA 3WDOA 2IAJB 4CH7A 4EZ6A 2AJFE 5A76A 4DV7F 3BDEA 1T9YA 2I6WA 3SV3A 3GJQB 2JOQA 4GO5X 1BQXA 3KG0A 3BS9A 4C0OC 1YJUA 1SQFA 1KP6A 2Y8WA 3JTOA 5M2RA 2GIFA 2Q66A 4BC9A 4C11B 1Y10A 1YRUA 1FVQA 1RT3B 3O44A 3TZXA 4YDDB 1RWOB 2OH2A 2NXEA 4TVAB 5AXKA 3FEYB 3NOGA 4OX9F 3GYGA 1XK8A 5B0FA 1M1HA 1FTRA 5DM6Q 1ZM2A 4IR9A 1F2HA 1B0VA 1JLAA 2CJXB 3UN3A 4I69A 4R8UA 2W9AA 4WXWA 2DJWA 5J1PA 4OI6A 2XG8A 4AQYF 4CYUB 4CDIA 5I42A 3HO1A 4A47A 4J9NA 4KE5A 4TNOA 2KI2A 3IR5B 4W4MA 4NCGB 1F6TA 4NLOA 4NASA 2E29A 3HHKA 1K47A 4YR2A 3MEKA 3QBCA 3LPEA 1ZTWA 1DLOA 2Y0BB 1UW9A 4LR7A 4I6YA 1R6YA 4RW8A 4F3QA 3RW6A 2CQHA 3JQMA 1IKWB 3POTB 3VAHA 2H1YA 1JJHA 4NZ7A 3BO4A 1B99A 1EX8A 1G4CA 5C24A 5IT9Y 3IBFB 2BKPA 5DQGA 3Q2SC 4XDDA 5IOLA 2J9DA 5HJXA 1TL1B 4KHMA 1ZAWA 2I9SA 3AOCA 2IBOA 1UETA 1G6BA 2KT5A 1VGYA 1G1XA 1JLCB 3LP2A 3PV8A 2B51A 5E2QA 4N5SA 1WEXA 2AWZA 1Y4ZB 4NLSA 5C5JA 2J9EA 2LYVA 5J1NA 1SJ4P 2KFNA 2ZD1A 1RGVA 1EB0A 3SSSA 3U1LA 1TR0A 1RUSA 3MR7A 4YEAA 2FJXA 1EETA 3L4BC 1DQ9A 3THPA 2AYBA 2VDHA 2VBWA 2N7YA 3PYEA 3OTCA 4KSEB 5HLFA 2R2SA 1OJ4A 3Q83A 3CIZA 4HL9A 4KGKA 1PC4A 1WC3A 2XSJA 4TQSA 2CQCA 3O8WA 2XY6A 2VODA 4AL7A 2W9CA 4ECSA 2JEJA 5KTQA 4I67A 2E7WA 5E3CA 4LSLB 5JMNA 5KFJA 4DV6F 4NMLA 2GHWA 1EHWA 1JLGA 2R7OA 3K8WA 3G9CA 4JI2F 4KTQA 3MM8B 1S7IA 1WNEA 1T03A 5A8WA 2E9RX 2ZUGA 3LAMA 3GJSB 3OUYB 3QT5A 1S10A 1HWIA 4HH0A 2QEXS 1KWMA 1BWVA 1V3SA 4WP8A 1P9YA 2ACMA 1JNZB 4LF8J 4N77A 1SH0A 2C3MA 3T5HA 4A8OA 2HQIA 1VYAA 4LSNA 4Q43A 4C6AA 4DV1J 1MNEA 4ZVFA 4JYAF 3AJ2A 1S1UA 1RHJB 2JC0A 4I2QB 3AB2B 2A0FB 2GJ2A 5KT2A 2PT0A 3LP1B 4Y2IA 5F3ZA 3K57A 2IJRA 1TKTA 3GFYA 1WG5A 3L09A 4Y34A 3KTQA 4WZQA 4K4YA 5KFWA 4W98A 1XTZA 3CDEA 5DDPC 1H73A 3TW0A 7AT1B 2VKZG 3ETOA 3UN5A 4DPTA 1VJWA 2O01C 5KFYA 1AA1B 4AT1B 3DU6A 5J2MB 4FF4A 4Q0BB 3IRXB 1NJWA 2ZDOA 3W7BA 5HBMA 3QATA 5C42A 2J0QD 2YNFA 3CTRA 1CQMA 2M4MA 2KDOA 3MM6B 3MI7X 2CAJA 3RBEA 4FDFA 1WF2A 1CJUA 3BKFA 2HZCA 1TFYA 1SI9A 4O44A 3N4WA 1APSA 2PEHA 4GC6A 3HSGA 2MZTA 3ILOA 1F1BB 1HMVB 1TVRB 2IC3B 2HNDA 3FFIB 1ZM4A 3IA0A 5HJYA 4M5NA 2ZE2B 3SCKE 3EPGA 1RCOB 1WC4A 4X4RA 1RB0A 4TYAA 1KHVA 1LWCB 3FKBA 5EHHA 2DNHA 1MU2A 1HNZF 2L9DA 1HBMB 1GXLA 1S12A 2XYPB 5KFZA 4M5GA 1S4FA 4GC7A 2QA4S 1QAYA 1PKUA 5KG5A 2QJ3A 1EP4A 4LVOP 4DR4J 3CJ2A 1RWXB 4I1TA 1G3OA 3TVYA 4EYIB 3I0RA 4LFAF 3H5UA 2ZBQA 1DTTB 2WONB 3K5MA 2PI4A 1FDDA 4DR3F 4OZ0A 5KFOA 1QTMA 2VONA 4CLSA 2CPIA 1YI2S 1YWXA 3PX4A 4NXNJ 3OW2R 4OHVA 1RKJA 2PD1A 2QLBB 4X62F 2XEXA 3T1HJ 1RAIB 3CCES 2V1TA 5C2GA 1SB6A 1ELOA 2DYAA 3NMRA 3BPDA 3ENQA 4ANDA 2ZITA 2OGUA 4NXMJ 4V19X 4RU9A 1Q5VA 5KFXA 3H2LA 1FK9A 2BZ2A 2APOA 4LF5J 3N01A 3PDNA 4F3MA 1FRHA 1NKEA 1MLAA 1ZH5A 1FRIA 3JTNA 4K7QA 3IN5A 1IWGA 3PACA 4OZ3A 2LQ9A 2W8KA 4NPOA 2V69A 4DR1F 5LOQA 4DG1B 4ECVA 2PE8A 1RT2B 1IM4A 2ZM6J 1DHMA 5KG3A 1S6OA 3GCXP 3DDIA 4AYBD 2KRBA 3OFHA 3J7A1 1FXDA 3PX0A 4DSKA 2CPJA 4TYBA 2ZJRQ 5IQ6A 5CYMA 4DBQA 1U24A 3SSQA 4QU6A 4WYWA 2YKPA 3HF5A 2HMIB 3C19A 1GT8A 4OYOA 2H4WB 4TY8B 3R5AA 4WF9Q 4M5DA 3RRHA 1IBMF 1HQ2A 3QRQA 5KFQA 2QL9B 3CEDA 1NDLA 4C7QA 3QGIA 2ZNYA 5T7LA 4JI8J 3TUJC 3CDUA 1UVKA 1Q7YT 3LOUA 4P7TA 3M2RB 2RU3A 4KPYA 4DL0C 2JJ4D 2YX7A 2NSCA 3R1LA 3H8YA 1N5YB 4N41A 2R7TA 2X3GA 3OR2A 5IT4A 2DITA 1YJWS 3EYZA 2ALZA 1C0TB 4CTAB 2PA8D 1RAFB 4MKYA 4FNIA 1EQ0A 1M5PC 4Q7AA 4DV4J 3GFZA 3HHEA 4OZ1A 4ES1A 4ZIWA 1VQ5S 2CQPA 2KJWA 4IUFA 1T8EA 3NCPA 3SCIE 4BWJA 1S4EA 1UAWA 1QVGR 4Y6IA 1RTZA 2E5JA 1D0EA 2RILA 2OD6A 2QIFA 5KFTA 3CJ0A 1NEEA 2BJ9A 2DNKA 1KC8T 4JV5J 5D6GA 5E3QA 3PFEA 1U0SA 3CUNA 4NI2B 1NM2A 1N4LA 2MJNA 4P2SA 2HBZB 1HW8A 4OJ3A 3PKYA 3HSZA 1ZA1B 2GA7A 3TI0A 5KFAA 1QUVA 3R6GB 1AT1B 4JBCA 2IYGA 1WD6A 3CJ3A 1DAXA 3J81U 5KFFA 2R8IA 1FJCA 1A0OB 4B3SF 1HL6A 2KVQE 1RP5A 1S0OA 3DLLQ 3JAMY 4DPWA 4E98A 2KRRA 2LDIA 1YJNS 3GZ7A 4A8QA 3V81B 2UV8G 3L3CA 1MROA 2DTJA 1U49A 1I1GA 2JLFA 1U45A 2W2NP 2ZH1A 3IAM9 3BKTA 1NK6A 3ZFVA 4XO0A 2NPIA 1WC1A 5DQHA 3MPDA 3CCQS 2EFNA 4HHHA 2FVQA 3HKZD 5HN0A 1T9TA 2ZVSA 3OPKA 4YB5A 1BQMA 3H90A 4WZMA 3CJRA 2JHEA 3ZZUA 1NSPA 3UFCX 2X7IA 4L72B 4YB6A 2JFKA 4J9UE 1XC9A 4FZVA 1N36F 4YUDA 1TFWA 4NLPA 4CT8A 3RAQA 3BM7A 1PJ6A 2VOOA 2HFNA 1AW0A 3LUYA 2M5YA 2FY1A 1C1CA 2B7CB 3K17A 1WTBA 1N5TA 2MJUA 2KN4A 3CCSS 2UUBF 2HAIA 5B7WA 2HS4A 5CXTA 3K5OA 3OQ2A 2CPHA 2RF2B 3CCTA 2QFIA 4OLOA 1LK5A 4X64F 2YNIA 4FS2A 2XY5A 3THTA 3MMJA 5BYRA 3KLFB 2DNQA 3TOQA 2DGTA 3AQOA 2M8DB 1YTYA 2XLKA 3MZIA 5IQQA 4FN5A 4B9UA 1VOMA 2J0XA 1NJZA 2DNYA 3H5SA 3KLEB 4EBDA 3W8PA 4CQ1A 3VVTA 5AT1B 2XMKA 3W5XA 2VG7A 3CCUS 3PTWA 1WC5A 1TV6B 3R8YA 1CULB 3Q8QB 4L73A 2AIRB 4EFAC 2E7VA 1MN7A 3MM7B 4NZ6A 2LEBA 2H9ZA 3DOLA 1GMWA 4BHQA 5B0BA 1WACA 1E6YB 1UWBB 4I7FB 1YDLA 3PYGA 3QT7A 1TL4A 4X65J 3KOAA 2MKYA 2V6AA 5CA5A 5IWAJ 4CCHA 2FPHX 3G8QA 1NJYA 4JI4J 1MWQA 3TRGA 3I4PA 1SH2A 2JH3A 2BQUA 3DGPA 5G4DA 4CO1A 4ALZA 2L48A 1ZPVA 3W2VB 2R7QA 4JI6J 2AYEA 3L7PA 1D1UA 3F0NA 2D1CA 4F4AA 2QLFB 2ZH4A 2HHTA 1VBZA 2IDEA 4DCPB 4OYMA 3KK1A 3ZTRA 4W90B 3HJVA 4CLPA 3PEJA 2EXUA 3N6NA 3LQVA 3VALA 2K1RB 2M70A 1K9MT 4ILRA 2YQ1A 4DV2F 3R5DA 4CNZA 2ZWOA 3LW5C 2OPQB 3H2VE 2OEJA 5B0CA 1AFIA 5DRKA 2GO8A 1PYOB 2DHXA 4IH7A 2G13A 3QLHB 2GQQA 1U1MA 3H20A 5FLXU 3M05A 5E7OB 4O0IA 3OTOJ 2KXNB 4CZCA 4JI1J 3M30A 2NXJA 4LR8A 1HWJA 2LA6A 4X84A 3QYYA 4DX5A 2ZJPQ 3CCRS 2FY8A 2I2YA 1Q78A 3T9NA 1U0HA 3KNGA 2YVSA 4ZVHA 1VIOA 5HMWA 3BO3A 1X4GA 5HL7Q 3PJXA 1U1LA 1NLKL 4DR6F 2IMOA 4RWXA 3BGRB 4HACB 1SKRA 2XB2D 4ECQA 5D3GB 1RTHB 5F0UA 1DQ8A 4EZ9A 1FCAA 1XMBA 3R97A 2DVIA 1RXOB 2YNGB 3KWMA 2DGOA 4G3IA 1RSCA 4NLRA 1QVFR 3ISZA 4QWEA 5L1IA 3DU5A 2CNKB 2MQNA 4ZN3A 1KR4A 1WOPA 2DGUA 5IM0B 4IFYB 3D6HB 5F8LA 4QIEA 2AX0A 3QGGA 4A8KA 3Q0AA 1KVJA 3VQTA 3OVSA 1X9SA 4LF6F 1Q53A 4ZK7M 3M6XA 5RUBA 5KG2A 1NH8A 5IV3A 1UVJA 4USWA 1T05B 2MLXA 1QE1A 2IRYA 1CQNA 2OFHX 1VRUB 1C0UA 3CO9A 3MMAB 2BRLA 5L9NA 3AT1B 4U8VA 2X1BA 1RHMB 2XZWA 1HNIA 1P6TA 3OVAA 3U1MA 4DEZA 3DCAA 1UW4A 4YHHF 2HHHJ 5HVHA 1OM2A 3W61A 2MKHA 3LTOA 3KJVA 2IVYA 3PZPA 2W1BA 4HLBA 3BSAA 3R9LA 1IBLF 3DXBA 5EDWA 2BA9A 1U25A 3M1VA 1T3NA 3CDWA 1X0PA 4USVA 1VR6A 4P7VA 2P5VA 4WU3A 3GYXB 3O2IA 1S1WA 2HHWA 3DYAA 4P10A 2W2OP 2GHVC 3H42A 4B3MJ 3EVMA 2F65A 3TAPA 2VQEJ 1RHUB 1AZSB 2VBXA 1IQTA 2IAJA 1LOUA 4NLWA 2HS0A 4YDXA 1H72C 3PJWA 2RDJA 4S0MA 3W66A 2KTQA 1K0TA 2POKA 4ZMMA 2KHDA 2CPDA 4YB1P 4K5SA 1VBYA 4RW9B 4LRFA 2DD8S 1YSJA 2E9TA 1RCXB 1KBRA 1D8YA 4IG3B 3VHQA 2BYCA 4JI0F 3CSKA 3G6YA 4C11A 1WC0A 4GVLA 4O4GB 3N6LA 1RT3A 2W7AA 2HLTA 4JI5J 3TJAA 1T02A 4DQRA 3TA1A 1PJ5A 2ASJA 2AQ4A 3KLHA 3KG1A 3W2WB 4TU9A 4RBVA 3O3LA 4MYUA 1FF2A 4X4VA 2AEJA 7FDRA 3KKFA 4G65A 1NK0A 2AD9A 1V3ZA 4UQGA 4X4TA 4Y2KA 2YQ3A 1X5SA 2E1PA 1NB2A 2KT3A 3J7ZT 3ZXWA 2GGPA 3A13A 2GAGC 2DH7A 1VQ6S 2WSEC 2B4OA 4CYUA 1QAJA 2QYGA 1WHWA 3AD7C 2MZSA 3OTBA 4DV0F 4LFCF 5AJ3F 2QZ8A 1PAEX 3MD1A 4NCGA 3C6UB 2P9GA 2MKSA 2AJ0A 2R8JA 1S6PB 4ZN1A 3W63A 1JIHA 1R0CB 1Y5LB 4DR5J 5HSPA 2CJ9A 1HBOB 4PXEA 2BM0A 2F40A 4N7TA 1F3VA 5D78A 2ZBPA 4YQWA 2FVCA 3POTA 2NR0A 3MR2A 4ZPWR 2OSRA 3QJPA 1YBTA 3DRPB 4PYDA 3T6BA 4DUZF 5KT4A 1JLAB 4OYZA 3RRGA 2ROPA 2W8LA 2CVEA 4PPDA 1BLUA 4JI3F 4DL7A 3CMAS 3HSDA 4ELTA 4LJMA 5I42B 4NL5A 1HHTP 3EGZA 1PG5B 2CRLA 2DR6A 2RSQA 2C1EB 3VAFA 3NXZA 2LVWA 3QRRA 5KFKA 1RYSA 1DLOB 4UZCA 3TQEA 5ETLA 2OUGA 2OTJS 3D0GE 5HQLA 4DUYF 2NSBA 3V6DB 4R5PB 3ILJA 5J2QB 1D9FA 1YHQS 3E3XA 2DNPA 3UNYA 2D9PA 5K14A 2HHSA 5C24B 4J9RA 4ZVRB 4LSLA 3NWRA 2DGWA 4KGVB 4DL3A 5EX0A 3Q24A 1KSPA 2BRKA 3QAEA 5J2NB 4M5IA 4WFZA 4LR9A 2F8EX 4Q5VA 2CNOB 4OYXA 3AWRA 4ECWA 4KHPF 1N34F 3MM8A 2IRUA 1YJ9S 2DR7A 1OYEA 2IPOB 1YIJS 5HVGA 3OUYA 2HBYB 4B17A 1UWAA 4IH5A 4LBPA 1HHSA 2GW8A 3IWLA 3M2UB 2Q1LA 3MR3A 1CPZA 2NQPA 4DU8A 1UVIA 4BCAA 1U6BA 3M8SA 3EVWA 1S49A 2HURA 2ZD1B 1FD2A 3AX2A 2VFRA 2XQCA 4RNFA 4DV5F 1PSDA 1EETB 2Z0GA 2RS2A 2EC2A 4OI1A 1R0AB 2KG1A 3DRYA 3I96A 3IC1A 2WVEA 5HLFB 2ZZNA 1QSSA 3IM9A 3CC4S 5HATA 4YB7A 3D5MA 2BX6A 4A8YA 3PW2A 4BS2A 1K1QA 4QW8A 1YJRA 2ERRA 3CO0P 3W65A 1I3OB 4I68A 1TL5A 4MT1A 3Q23A 4FXVA
chains in the Genus database with same CATH topology
2E1CA 3ITHA 1FE0A 3G71S 4ZPBA 2E5LF 2FC8A 2OH2A 5K5MA 1SV5A 5AXKA 4U6PA 5KFCA 2X1GA 3FEYB 3SI8A 4MH8A 4OX9F 4LT6A 4HI1A 3TA2A 5AE1A 3CCZA 1S9GA 2XGQA 1IKXB 4N8NA 2BUNA 3T19A 1U1KA 3I87A 1IN0A 3NWGA 3OXFA 4B9LA 4IDKA 2V4JB 3CT9A 1XK8A 5B0FA 3U27A 1AFJA 4DQPA 3MEEA 3KFWX 3GMGA 1FTRA 5DM6Q 1ZM2A 5J2MA 2PGCA 1LWEB 3LPYA 1FRMA 3KMQA 3FSXA 4Q0BA 1GH8A 4IR9A 3UR3C 3MOJB 5KFIA 2MKIA 4DLGA 4G1IA 3IRXA 1SJRA 2CQDA 4HH1A 5LL6d 2R8GA 4RNNA 1R3NA 5EUHA 1B0VA 1JLAA 4DQQA 4K4ZA 2IA0A 4I69A 2V8VA 2VPXB 4R8UA 4ICLB 4OX8A 4A48A 2W9AA 2K7JA 4WXWA 1KFDA 2IHR1 2DJWA 3LF0A 4ZA1A 5J1PA 3MTKA 1FJEB 2CQBA 1SKWA 5KFVA 4DF4A 2VZ9A 3HM9A 4OI6A 2XG8A 3PIOQ 4AQYF 1UEUA 2ZBCA 2RRNA 3MMCB 4ED7A 1HARA 1JXEA 2VKRA 3MMBB 5I42A 4HDHA 2MXYA 3HO1A 4A47A 3HVRA 4J9NA 4PUOA 1TKZA 3QO9A 4KE5A 2CKWA 4TNOA 2Y1IA 1P1LA 2KI2A 3IR5B 4LSNB 1N33F 3QGPA 3QGHA 5KFUA 2V94A 4NCGB 2XCPA 4MKBA 3MCSA 4NLOA 2JVOA 3M8PB 2QV6A 2LXUA 3D1HA 4ID5B 1RT4A 4KB7A 4ZP7A 2E29A 4ZKAA 5AE3A 2LU2A 3ZZTA 3GG1A 4PPZA 2CQ2A 3PM9A 2R8KA 1HMVA 1S77D 1S1UB 3HHKA 4YR2A 2HFZA 3IAS9 2E5GA 3MEKA 2PN6A 5D4OA 2HHHF 3FFIA 3V2UC 1S76D 3BEGB 4DSEA 1X5TA 1ZTWA 4ELUA 2ZE2A 2Q6CA 5LJ3Y 1DLOA 3KG4A 3HHNB 4DL6A 2DR9A 5U47A 4A8XA 2WBRA 4I6YA 4G1QA 3OHAA 1R6YA 2B43A 2XHWA 2X1AA 3KHLA 2WCXA 5BR8F 4RW8A 2F1FA 4F3QA 4TU8A 2J5AA 1FERA 2Z8QA 4I64A 1IKYA 4IQMA 1TKTB 2F9DA 1LWCA 4C3LA 4ZP6A 3RW6A 2CQHA 1RTIA 5H9EJ 3MEDA 3HKWA 2V8GA 5KG7A 4J37A 1QY7A 1IKWB 2MQLA 3POTB 3J7Z5 2W9BB 1HBMA 3QWUA 4UQTA 3VAHA 1JLQA 3G6XA 3PRBA 4ECZA 1JJHA 3B4DA 4L3NA 3J81Y 2MY7A 4NZ7A 3HT3A 3C46A 3QMQA 2DHAA 2V8HA 4B3MF 2J8AA 4R0JA 2HS3A 1N88A 3BO4A 3I32A 5C24A 1ZYQA 5IT9Y 4ZP9A 5DQGA 3MM9B 1S6QB 3Q2SC 4XDDA 5MLCV 2GQCA 1U09A 3B78A 2J9DA 4CH1A 4ZHRA 1TL1B 2SXLA 3KYLA 4DFPA 3DXSX 2RUGA 3CDAA 4KHMA 3N6MA 1U2RA 4K2XA 2JLEA 2K8GA 2YNHB 2MQPA 1ZAWA