3OLAA

Poliovirus polymerase elongation complex with 2'-deoxy-ctp
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
molecule keywords Polymerase
total genus 140
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3olaA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3olaA02
4RW4A 3FSIA 1S9EA 3IG1A 4TY9A 3T5KA 2XCAA 2JEFA 2BQUA 4Y2CA 1C1CA 4Q44A 5K14B 2W9AA 3QGIA 1RT3B 3NMAA 1DTQB 3NBPB 5T14A 2BQRA 4EBCA 2HAIA 1K1QA 3GIIA 1RTDB 1IKYB 1SV5A 2IJFA 3NKYA 2YKNB 2AGPA 4O4GA 5DQIA 3LAKA 1S1UA 4FBUA 1JLBB 1RTIA 4IH5A 3PR5B 3HVWA 2FVPA 2IM3A 1MU2B 3N6NA 5KG1A 2ASJA 2HWIA 5DLGA 4J9NA 2R2TA 4ED3A 2AU0A 4H4OA 3SI8A 5KG6A 5C25A 1J5OB 2R2RA 1JLAA 1OS5A 5CYQB 2YKNA 3NGDA 2IM2A 2WRMA 5EWFA 3H5UA 5I3UB 5KFAA 4K4VA 5KFYA 1HYSB 3RB4A 5DLFA 1KHWA 1QE1B 1S1VA 3G6VA 3KHLA 3DLEA 1HQEA 4WXWA 1XR5A 1LW2B 1RT1B 4H4MA 5F8NA 3CVKA 2XGQA 5DG7A 3RB6A 1TKTA 1TL3B 4H4OB 3VQSA 1GX5A 2AX0A 3MTKA 4LSNB 3Q8RB 2QV6A 3T5JA 4NLYA 2RF2A 3QIPB 1QAJA 4EO8A 4PWDA 3I0RA 3G86A 1RYSA 1WNEA 3DLEB 3H4DA 4Q43A 5KFZA 3KLIA 5C5JA 3CDWA 3MEDA 3GQCA 3KLEB 1S6QB 4IOBA 4IRDA 1JLBA 2ZD1A 2BE2A 3IGVA 4IKAA 4J9RA 2FLLA 4F4XA 3E01B 1BQMA 5KT7A 2W9CB 2XI2A 3M8PA 3QYYA 3PW4A 1S1WA 2CKWA 4KB7A 1IKXA 3OL6A 1S9GB 1VRUA 4URGA 3M9NB 4B3OB 4KFBA 5KT4A 2R8IA 2WOMB 3LP1A 1NHUA 5KFFA 1SUQB 3SFGA 4I2PB 1N5YB 3GILA 2I5JA 4G1QA 4JV0A 4TXSA 3OL9A 4MFBB 1C0TB 3KK2A 2FLPA 2XC9A 4WE1B 3IG1B 1RAJA 4XPEA 1MMLA 5F8LA 2D3ZA 5L1LA 3H5XA 4NLVA 3HHKA 3QZ7A 1DTQA 4KFBB 1T05B 4ED6A 3KLHA 1DTTB 4I2QB 2YNIA 5CYMA 4G3IA 1BQNA 3H98A 5KG2A 3OHAA 2I1RA 1FKPB 4R8UA 4TQSA 5KFMA 4O4RA 1EETB 4O3NA 5J2MB 4TN2A 2UUWA 5KFUA 2VA3A 3LP2A 2FJXA 2OPPA 4DL7A 3KLGA 2V4QA 1HMVA 2HNYA 3NAIA 3TAMB 1QUVA 4O44B 1C1CB 1RT5B 4LQ9A 4IFYA 4R8UB 4ZPBA 4K4UA 4URQU 1TQLA 5HP1A 4WXOA 1ZETA 2J6SA 2C22A 3CIZA 5D3GA 3H40A 2JC0A 1SH2A 2WOMA 1LW2A 4RW9B 2FVRA 4QWDA 4K50A 4I2PA 4KAIA 2W9BA 4IG0A 1LWFB 4QW8A 4KKOB 4RW7B 4NLRA 5DGBA 3BR9A 4JV1A 2E9ZA 3C6UB 1TP7A 3IS9B 4F4YA 4IFYB 4NLWA 5HP1B 5HROA 3UPFA 5DGAA 3HVTB 4KSEB 4K4XA 3KK1A 3PW0A 5JUMA 4KBIA 3DDKA 2J6UA 1RT7B 4ZP9A 2V4RA 4M94A 3GIJA 2V0NA 4ICLA 1W25A 3OSPA 3E01A 5C24B 3MFIA 3H5YA 3IS9A 4ECSA 4J9OA 1C2PA 3GIMA 1IKVA 1HNVA 4K4WA 1TKTB 5KFHA 3NBPA 4RUAA 4EO6A 3KOAA 4ZMMA 1HMVB 2HNYB 3G6YA 4O44A 2R8KA 1SUQA 3BSAA 3DRSA 4U6PA 2IC3A 4YQWA 1S0MA 2V9WA 2RF2B 2YKMA 3I0RB 3KNAA 5KFGA 5C42A 2XGPA 5L1JA 2UVVA 2OPQA 1JIHA 2BQ3A 1SH0A 2W7PA 4RW6B 3CJ3A 4ZP8A 1KLMB 2VG6B 3DOKA 4J9MA 4DL3A 1C1BA 1HPZA 3DMJA 3MEDB 4IG0B 4MKBA 2QE5A 4R0EA 2D7SA 2B6AB 1N56A 3IRXA 2VA2A 1RA6A 3BGRA 1RDRA 1NNDA 3OHBA 4ED0A 2ASDA 1FKPA 4RNNA 5KG0A 3CJ4A 3E51A 3QZ8A 1EETA 3DRPA 4KV8A 4GC7A 4TYBA 3DI6B 4ECXA 1IKYA 1SV5B 3RBDA 4M95A 3ITHA 3KLGB 4IR9A 4G1QB 1ZTWA 1RTJA 2JLEA 4EBEA 3H5SA 3BSNA 2YNFA 3ISND 4ZVEA 1MU2A 4K4TA 4Q45A 4NLPA 3FFIA 3V6DA 5KFWA 1R0AB 3EZUA 3D5MA 2B43A 2GIQA 1JLCA 3CWJA 4XPCA 1IKWB 4O3PA 1S0NA 3RBEA 5HBMA 3BREA 3KLIB 2IC3B 4TYAA 2W9BB 3ITHB 1BQNB 3D28A 1REVA 3V81B 3BSCA 3M8QA 2C2DA 2OPQB 4YP3A 2RKIA 4YR3A 5J2PA 1BQMB 2W9CA 4KO0B 2UUTA 2WTFA 3V6DB 4RW6A 3MFHA 4EBDA 4ECZA 2YNGB 4MKAA 3PW2A 3I5CA 3C6TB 3KHHA 2ALZA 2XI3A 3KJVB 2JEIA 1RT2B 4IFVB 4RW8A 4ZP6A 2AWZA 1JLQA 4LSNA 1XR7A 4NLSA 3KMSA 3LP1B 4J9LA 3MECA 4J9SA 1RT7A 3ICLA 4IRCA 3DYAB 2BRKA 1DLOB 1RTIB 2D41A 3KK3A 2B5JB 5KFPA 1LW0A 4KO0A 5F8JA 4NLQA 4DL5A 3RB3A 4RNHA 4Q8EA 4LQ3A 2OPSB 1S0OA 4NZ0A 1K1SA 4Q0BA 2BANA 1TKZB 1N6QB 4Q0BB 3KLEA 4QWCA 4MH8A 2R8JA 2FJWA 1RTJB 3PJWA 2ZD1B 5DQHA 2ZE2A 3DRSB 2HMIB 1D0EA 2FVCA 3DYAA 4MIAA 5KFXA 3V4IB 4IDKA 3RAXA 5I3UA 1HYSA 1VRTA 5KFEA 5F8HA 2XWYA 3HVTA 3KK1B 2ATLA 3EPIA 4KHRA 5DQGA 1N5YA 4ECVA 4FS1A 4GC6A 3TAMA 2B6AA 4WZQA 1LWCB 3M8QB 2F8EX 3MEGB 2IA6A 3QGHA 5C24A 3OLBA 4WFYA 2WONA 2FVQA 4MK7A 4PWDB 4ZPCA 3GYNA 3H59A 3QLHA 5KFRA 1EP4B 2VG5A 3DLGA 3LP0A 5KFIA 5KG3A 1S6PB 3HKWA 3KLVA 4MIBA 5KG5A 5C25B 4R5PA 5J2QA 3KHRA 1YVFA 2OPRA 4NRTA 3H4BA 2YNIB 2BR0A 4PUOA 5CYQA 3JYTB 2E9RX 4K4ZA 4ZVGA 5J2NB 2R8GA 2UVWA 4Q8FA 3CJ5A 2IAJB 1TVRB 3DRRA 1RA7A 2WHOA 4NLUA 1HQEB 3Q8PB 5F8IA 1T94A 4DL6A 3RAQA 1JXLA 5KFSA 1IKXB 1R0AA 3BQ2A 4X2BA 3CJ2A 1FK9A 2IBKA 3LP0B 4JV2A 3CDEA 5F8MA 1JLFB 1JLEA 4RZRA 1XR6A 2BRLA 4ECWA 5KFTA 3V81A 5KFQA 5FDLB 5D3GB 3BJYA 4WE1A 4ED2A 2UVUA 2XCPA 4WFZA 3Q8QB 2YNGA 3KJVA 4IH6A 1RT6B 3SFUA 1S6QA 2WCXA 3PZPA 4WYWA 2WB4A 1T05A 1NHVA 3MECB 1RYRA 1DTTA 4I2QA 3TVKA 3M8PB 3M9MB 2HNDA 3CO9A 4TY8B 4ZVHA 4ED1A 3N6MA 5F9LA 5KFNA 1HNIA 3HVAA 3NL0A 5HLFA 1S6PA 2FJVA 3GV8B 1TV6B 4WZMA 1TL3A 1S4FA 3IN5A 2AX1A 3PVXA 2ILZA 5J2NA 4O3RA 3JSMA 3QO9B 3QGGA 2IM0A 4ECRA 1IKVB 1RT2A 4RW8B 3DRPB 1FK9B 1HNIB 3OL7A 5L9XA 3Q8SB 3NAHA 1J5OA 1C0UA 1S48A 2HNZA 3T1AA 4QPXA 2VG7B 4RNOA 1GX6A 2RDIA 1LWCA 5C42B 5F9NA 2RDJA 3QO9A 5J2MA 4YMEA 1KLMA 1S1WB 2VG6A 1RT1A 4H4MB 4QWEA 1C1BB 2BANB 4WFXA 3DMJB 5KFLA 3V6KA 1EP4A 2VG5B 1S49A 1UWBA 1JLCB 3DLGB 1JLGB 3H2LA 3MR3A 2AQ4A 4F4WA 4ECTA 1T03A 1SH3A 1RTDA 3BGRB 5I42B 2HMIA 4Y34A 2VG7A 3V4IA 3IGNA 5F8GA 1S1TB 4K4SA 1S1XA 2D3UA 3DM2A 2IAJA 4NCGB 4IG3A 5KT5A 1JX4A 3M9OB 4YR0A 1CSJA 3GIKA 3DI6A 3ISNC 4ZHRB 3DLKB 4NRUA 1JLQB 3I0SA 1RT4A 1IM4A 1JLGA 2ZKUA 4KKOA 4RW7A 5KFJA 4K4YA 4YR2A 2ILYA 3KLFB 2C28A 3JSMB 5CYMB 2W8KA 3PR4A 4ZPAA 4MK9A 2WONB 2AGOA 1D1UA 1S1XB 1S1TA 5FDLA 4ID5A 4B3OA 1S9FA 4ZVFA 3LP2B 2R8HA 4ECYA 5J2QB 5HBMB 2GC8A 1TL1A 2HNZB 4ZHRA 1N4LA 4O3SA 4F50A 1RT4B 1S1UB 3IRXB 3TQ1A 5J2PB 3FDSA 5DG8A 4ZPDA 2HNDB 1HNVB 2AGQA 4DL2A 4LSLB 3DOLB 4HKQA 3CJ0A 5I42A 3UDLA 1TL1B 5KT6A 1ZTTA 5EWGA 1LWFA 4RW4B 2UVRA 4RU9A 5KG7A 3DM2B 1S97A 2B5JA 2YNFB 3MEGA 2EC0A 4KE5A 3CDUA 3LANA 4OL8A 5K14A 2YNHB 3FRZA 1JKHB 4ECQA 4EEYA 1HPZB 1S9GA 1VRUB 1N48A 1N6QA 3OLAA 1Z4UA 4R5PB 4LSLA 2E9TA 3KLFA 5EDWA 4PQUA 1LWEA 4FS2A 3QIPA 3GV7B 2IM1A 4IDKB 1REVB 4Y3CA 4EYIB 3KK2B 4KHMA 3N6LA 1VRTB 4O3OA 4ID5B 3MF5A 2W8LA 3BQ1A 1RTHB 3DRRB 1TKXA 5EUHA 5KFBA 5KFKA 3C6TA 2FVSA 3EPGA 1TV6A 3UR0A 3BSOA 4IFVA 4ED7A 5EWEA 4RUCA 2OH2A 4TLRA 3V6JA 5KT3A 3KLHB 1JLAB 1I6JA 5KT2A 2C2RA 3FFIB 2YKMB 4F4ZA 4NCGA 3QLHB 4NLXA 3KK3B 1QAIA 4IRKA 3UQSA 3LALA 1QE1A 1S1VB 2R2UA 1TKXB 3I5AA 1S10A 3OL8A 5HLFB 2OPSA 2OPPB 5KFCA 3DLKA 2JEJA 4QW9A 4NLGA 4XO0A 3MR5A 5KG4A 1C0TA 4O3QA 2JC1A 2ZE2B 4H54A 2RKIB 5L1KA 1TVRA 2CJQA 4IQXA 3MR6A 4RNFA 1FKOB 3MEEB 1JKHA 2ASLA 4JUZA 4Y2AA 2GIRA 1JLFA 1T03B 1HARA 1JLEB 3BQ0A 5DG9A 4J9PA 1LWEB 3FQLA 4WYLA 3MR2A 3PHEA 2R2SA 4HYKA 4DL4A 2O5DA 4NYZA 4J9KA 1S9EB 4IH7A 1LW0B 3I5BA 4MK8A 5KFVA 5J1EB 5KFDA 2IMWP 5L1IA 1FKOA 4ECUA 4U7CA 4RNMA 5HROB 4ZP7A 1U09A 1RT3A 3LAMA 2IJNA 1KHVA 3KMQA 1IKWA 4TQRA 3DOLA 4IR1A 2OPRB 3PJXA 4I7FA 2FLNA 3GV5B 3OSNA 2I5JB 2C2EA 1RT5A 2DPJA 4MFBA 4ICLB 4ED8A 4J9QA 4TY8A 2J6TA 4DG1B 5J1EA 4URSA 5JXSA 3KHGA 1HQUA 5KFOA 4RW9A 4KV8B 2YNHA 3PW5A 3PW7A 3FQKA 2DPIA 4FBTA 4NLOA 1UWBB 4NLDA 2JEGA 2BE2B 3RB0A 4PQUB 4I7FB 3C6UA 2W7OA 3T5HA 4QWBA 1DLOA 2HWHA 3MEEA 3T19A 3T5LA 4QWAA 3G6XA 4IG3B 1RTHA 4DEZA 4DG1A 1T3NA 1HQUB 3DOKB 1C0UB 4EYHB 2WK4A 3QIDA 4NLTA 1TKZA 3V6HA 4PUOB 1RT6A 3I0SB 3JYTA 4O4GB
chains in the Genus database with same CATH superfamily
1FWPA 1AROP 2BJ1A 1FFSB 1RAIB 2XYHB 4LIWA 4L76A 1GXTA 3GG1A 5EX0A 2XCAA 1O0PA 4RL1A 5D78A 2AJ2A 2BE7D 2KDOA 3ULHA 5K14B 2AZ1A 3UNGC 3ZO7A 5A0YB 5BJRA 3QGIA 2B9WA 2I2YA 3NMAA 2G0CA 2OLWA 3ONQA 6FD1A 2A1BA 1FRJA 2E1RA 3OR1B 3ZTQA 4YDXA 4FYWB 5A8KA 4P10A 3ZNUA 3ENVA 3R8YA 1RTIA 5D77A 3PRDA 3PR5B 1HNWJ 3SDEB 4OYWA 2FVPA 2IM3A 1MU2B 2LVWA 2Q1LA 4ZPVR 1XMOF 2ALYB 5LXRA 1RBAA 5DLGA 4G65A 1HL6A 2CADA 1KDNA 1YZ6A 1WI6A 2B4VA 1IBMF 2R2RA 1OS5A 2CNKB 2EG2A 4OYXA 5CYQB 2B56A 2WRMA 2CQGA 2PE8A 5KFYA 4K4VA 4LF6F 1HYSB 4LF5F 2XG8A 1URNA 1KHWA 3K8VA 3HJFA 1S1VA 4ZLPA 2EFPA 1B7YB 2XEXA 3AD8C 5HI7A 4X66F 2YWHA 4OYIA 4WK1A 3G6VA 4ID8A 4H4MA 4AQYF 2PA3A 2XGQA 5DG7A 1ZZNA 3BBFA 3DDIA 4H4OB 2NYIA 4GVBA 3SBMA 1YTYA 2QFIA 1FDAA 3T5JA 5D4OA 2MKCA 2RF2A 2VC0A 4J5OA 1KQSR 4J37A 4PWDA 2HQFA 3G86A 4DUZJ 5IC6B 1RP5A 3H8YA 2ZBQA 3MM8A 3D0IE 3OBIA 4K5RA 2CPZA 3DLEB 4PWUA 4Y2IA 3RGIA 4QCLA 2F1FA 5KFZA 4DPTA 2J9EA 1R27B 2L3MA 2XSFA 5C5JA 3GQCA 3O6QA 4FVMA 4UOCA 5L39A 2HHQA 3IGVA 4IKAA 1JJHA 1H7WA 3SCIE 4DR2J 2VQEJ 3CCUS 3OFGA 3DLLQ 5LMUJ 2XI2A 3MR7A 2D68A 3MCMA 2N3OA 2H1YA 3QATA 4HHHA 3GTYX 1J2VA 4QBUA 2R8IA 2RVJA 3PYDA 4G1IA 5G0RA 1NHUA 4B9SA 1N5YB 1NK4A 3SFGA 4DN0A 1NDCA 4DCOB 4Y2KA 3GILA 1SKRA 2M8DB 3MOZA 4JV0A 3I6PA 2Y8WA 1LFWA 1N5TA 1C0TB 4LSZB 1KFSA 2C3YA 4QU7A 3UD4P 2FLPA 1HWJA 1MMLA 1VQSA 2APOA 3H5XA 3JSRA 4D3GA 1WDDA 3HHKA 5K8OA 2MSSA 3C16A 1FEEA 1DTQA 2H5IB 2AJQA 1RBOB 4JI6J 2IY5B 2DT9A 4DR7F 2K8GA 4ED6A 4OI2A 4KH0B 3TP2A 4I2QB 4WU3A 2XY5A 5HATA 2BV3A 4EZ9A 1BQNA 1QJHA 3R6LB 3H98A 3QT7A 5L9NA 2DNOA 4R25A 5A2QU 4CNZA 1SI9A 3QPIA 2ZBRA 4NMXA 4HT7A 2V1SA 2UUWA 4P7VA 3LP2A 1VQ4S 2YX4A 2FJXA 2CPIA 2ZVIA 2MJUA 3NS5A 2GO8A 1XMOJ 2IDEA 4F36A 2OEJA 3N4WA 4LF4F 2G9OA 1QUVA 1PO6A 2H5JB 1NPPA 3PNIA 3ILOA 2YKAA 1FKAF 4R8UB 1RUSA 4X4QA 5D3GA 1PYSB 2C22A 1H72C 1JQGA 1Q8IA 4Y2MA 1LW2A 1B3TA 4K50A 1WSRA 3BKUA 4I2PA 4KAIA 1FWKA 2GQCA 2CNLB 4IG0A 1IBLF 4KKOB 2B0GA 4JV1A 5DGBA 5AE1A 4DR1F 1UP1A 2JJ4D 3E8OA 5ETOA 3EZ5A 2MXYA 3C6UB 1X5PA 2HPUA 2GAGC 1ROFA 1KTQA 3R5AA 4F4YA 5HP1B 2CJXB 5HJXA 1TR0A 3AXMA 4C3LA 3KJQB 1J5EJ 2KXHA 1VQ6S 2L08A 2QA2A 2HG4A 2KL8A 1FD2A 1ZA2B 3B4MA 3T9ZA 4F02A 4N7TA 1H2VZ 2HW3A 3NGSA 1UFLA 3QSIA 2FQQB 1P1TA 4IOCQ 3D2WA 3QJPA 5HK4A 3MFIA 3PCOB 3FSXA 2MQ8A 2HQ3A 2L48A 3IO1A 1IKVA 2DNKA 4K4WA 1TKTB 3OPKA 2VQFJ 4W4MA 3R6GB 4QZVB 3CE8A 2DRBA 2MQPA 1S79A 4HLBA 1SUQA 2R8KA 1YBAA 2V2KA 2IIHA 4RUBA 1M1GA 2YX1A 2YKMA 5IM0B 5SZTA 1VI7A 5C42A 2UVVA 1F60B 2IRXA 4LUBA 3J80U 1VLOA 2ABYA 4RWWA 2VBYA 1RAGB 4P7TA 2UUBF 2BABA 2R7SA 1KLMB 2M2BA 2MQLA 2MYFA 2W4PA 2J5AA 2KFNA 3DMJA 4OHWA 2EFVA 3ISZA 1SJ4P 1IR0A 1F1BB 2DEIA 4R0EA 2D7SA 2A10A 2VPYB 3C14B 2BBEA 1RA6A 3IRXA 2EFOA 4Z7YA 3CCJS 1SL0A 1NNDA 3Q2SC 4ED0A 2ASDA 2CZ9A 4GRSA 5KG0A 3ILLA 3JTNA 2KT2A 1N34F 4LFAF 4GC7A 2RRAA 2Q79A 1DURA 2X51A 2YQ0A 2RD5C 2OEMA 1Q16B 1U8SA 3ITHA 4IR9A 4JYAF 1ZTWA 2ZH4A 2HQDA 4ZVEA 1FVSA 1HBUB 2HHHF 4K2JA 3FFIA 1S6OA 1N8RT 1U1RA 2GCFA 2WB1D 4USIA 4WIIA 1UETA 3PEHA 1VK8A 1IKWB 2CNOB 3RR8A 4JV5F 1AW0A 3HVRA 1U7LA 1Y7PA 1NPRA 3HFKA 2IC3B 4M5GA 4WPAA 2W9BB 2XS2A 2J7UA 2VOOA 2V6AA 2VFVA 4U95A 1REVA 3CCLS 3MMCA 4AD6A 4C98A 2RKIA 5ETQA 1ZZFA 4KO0B 3V6DB 2DRAA 3VGUA 3EMTA 3KG0A 4ECZA 2BOAA 5DZ6A 1AB8A 2HRTA 5DDRC 3KJVB 2C3PA 4RW8A 3KYLA 4ZP6A 2DVIA 1SPBP 4YY3F 1SIWB 3H2UB 4X62F 1XR7A 4J9LA 1UEUA 4OJHA 4DV5J 1R8HA 2B51A 3W9IA 1RT7A 5ETLA 4YFUA 3CCSS 1NBEB 1KOHA 1FNOA 2ZH2A 4LVNP 4HH0A 1G4CA 2DGQA 4CO4A 5ITHA 2D41A 4B9VA 1RAFB 2B5JB 5KFPA 1AFJA 1EJ7L 4RNHA 2IPOB 4J9VA 3HSGA 2BANA 4WTYA 4MH8A 2BM0A 2VZ9A 3MEKA 3RTVA 3W66A 4KHPJ 2OP5A 1HLWA 3PJWA 1VISA 1Z2ZA 4DUYF 3DRSB 1WOPA 1FHTA 4X4OA 3M7VA 1T9TA 4MIAA 2WSCC 2O1PA 3POTB 2PFDA 4IDKA 5A0YA 4Q5VA 3RAXA 4C0OC 4U96A 5BYRA 4DR3F 2W4DA 3LGMA 4P2FA 2ATLA 3EPIA 4KHRA 4B3RF 1VBXA 2XWXA 3R9LA 2VKRA 3PKMA 1PIEA 1UA0A 1RISA 3Q8YA 4RR5A 2FY8A 2G2YA 2F8EX 1NHKL 2MLZA 3DNCA 3KDOA 2RUGA 2VB6A 3R2CJ 4MK7A 5J1PA 3DKDA 3OTOJ 4L75A 1EP4B 2VG5A 4CQ1A 4DR3J 5KG3A 3THPA 3HKWA 5C2CA 2LEPA 5IV3A 5C25B 3PACA 1Q78A 3W5YA 1YVFA 2JSXA 4ES2A 3H4BA 5CYQA 2WW8A 3JYTB 1KSPA 2VHGA 1HR0J 1Q82T 2UVWA 2QLJB 2ZC4A 3ADAC 2RU3A 2HQGA 2XULA 1U45A 4KHPF 4JI0J 4EK2A 2KXFA 2HHSA 3W9HA 2ZH9A 3R7SB 4RBTA 3BPDA 2B7BB 2H51B 2Z2LA 3R7BB 5K20B 2IBKA 3CC7S 4PG5A 2UXDF 3TI0A 4V19X 2M70A 3QT8A 4P75A 2D69A 1OQ6A 1KQGB 2WVEA 3UO0A 3A3OB 4ECWA 2OEKA 2RS8A 5FDLB 4WE1A 4PYAA 1SC4B 4YB5A 3GP9A 4FNIA 4YY3J 4DV5F 4ED2A 3PIOQ 3QJLA 4F4KA 3PKYA 1YSJA 1QLNA 1DQAA 2W2QP 4WP3A 3OVSA 3PZPA 2WB4A 2V34A 1T05A 4HDGA 3MECB 3M6WA 3PG9A 4OJ1A 5DRKA 4F3MA 4P2MA 1EQMA 5AE2A 4ELVA 1X4HA 2HNDA 4ZVHA 2KG1A 5F9LA 2YVSA 3QAUA 1HNIA 3HVAA 2KRBA 3A8JA 5KFNA 3GJTB 3D6MB 1W2IA 1TV6B 3MUVP 2XZTB 1S4FA 3HSDA 4WFNQ 2AX1A 4NA1A 2V8VA 3AX3A 3B8HA 4DV1F 4DFMA 4QU6A 4JYAJ 2HS4A 3ELHA 3O2IA 2RIJA 4DU7A 2M0GB 3M6VA 1IKVB 1RT2A 5CHCB 1FK9B 2C2OB 2KVIA 2N4CA 3NAHA 1VOMA 3AODA 3M4XA 3SCKE 4C97A 1J5OA 4C2MA 3GYGA 3ILJA 1MMNA 2W2NP 2ZHOA 1CBKA 3CDAA 5F3TA 5F9NA 1PC4A 2MLXA 1T95A 3H2VE 2DH8A 3QO9A 4LF7F 2VD3A 2FTRA 1KLMA 2LMIA 4FXWA 2WSEC 3CMQA 1C1BB 4H4KA 4DPUA 5KFLA 1SJQA 1WF2A 2JWNA 3G87A 1S49A 4PPDA 4EI2A 4ZJQA 1JLGB 1MN9A 2XS7A 2C3MA 1SH3A 1GMWA 4OZLA 3EX7B 5D0EA 1DZ5A 1NH7A 3PYGA 3IAM9 2KTQA 1U6FA 2QSWA 4HTJA 2GO9A 3V4IA 3MCOA 5F8GA 1S1XA 4RPFA 1PBUA 1SBRA 3DM2A 2HQCA 4WF9Q 5D8HB 4CYUB 4E98A 2IFXA 2WVBA 4YHHF 2J8AA 3GIKA 3CCWA 2MZQA 4QIGA 1TMJA 2H5EA 2FC9A 3Q8VA 3PFEA 4ZHRB 1IBKJ 1ZAWA 4CWBA 5MAOA 2RUSA 1CJVA 2ILYA 1MROA 2C3UA 1HBUA 2Q6CA 5CYMB 1PSDA 4CT8A 3PR4A 2W8KA 3HDSA 3KUGA 2GQ2A 2AGOA 1D1UA 2HFVA 4OHXA 3WX4A 5GAEI 1K0VA 4DFPA 4DMZA 1FJEB 1HNZJ 1AZSB 2AYBA 4W92B 1RT4B 2VUGA 4ANEA 3K7RA 2FZKB 3TQ1A 2JNJA 3F41A 3GWCA 3TA2A 3ZFVA 5DG8A 3BDPA 2CYYA 3D1HA 1SCJB 1CC7A 1Q79A 1HI0P 1M1KT 1Y11A 1YX2A 3H0PA 5LSLA 3MXHP 4LBHA 2OFGX 1FFWB 1FO1A 3M30A 2CQBA 4YHHJ 3UWTA 1T9WA 2GNKA 4DL0C 1TL1B 1ULRA 1NZ8A 3AOBA 1V3ZA 3EYZA 2E7XA 5EWGA 1FERA 1LWFA 5K8MA 1L3KA 2IRYA 2LLZA 3A13A 4RW4B 2UVRA 3DM2B 2DR7A 3N01A 2B5JA 4O23A 4JI3F 5ETNA 4ZCLA 3RG6A 1O51A 3LANA 1OSCA 3NCQA 5HL7Q 2MMYA 3NG8A 4CLPA 5IT0A 4DV4J 3ZTPA 1YI2S 3DCAA 3VHQA 3NOCA 2NREA 4FF2A 4GVLA 1XNQJ 2IVMA 2F9DA 2CAJA 4LSLA 4PQUA 4DPYA 1WEXA 4FS2A 3MAQA 1FRLA 4B9TA 1FI4A 3GV7B 3UDCA 1NJIT 2IM1A 3POTA 1BD6A 4IDKB 4EYIB 4KHMA 1VRTB 4O3OA 3D9BA 3BR8A 3MF5A 2QFJA 1RTHB 1P6TA 3AX2A 4QJVA 5KFBA 3OUYA 3LPEA 2ACMA 3NGTA 4PCQA 5CCLA 1NK9A 1WACA 2DYAA 3GFZA 2ZITA 1V6HA 4IFVA 1C4CA 1H0HB 1FJ7A 4OZ0A 2HHXA 1P1LA 4WFAQ 2OH2A 1EAYC 1JLAB 2B4OA 3DHWC 2WBMA 4OZ5A 1I6JA 3FFIB 1JK9B 2VA2A 1CJTB 1G3OA 1R31A 4IRKA 2VH7A 3ZZTA 4JI4J 1QE1A 1P8GA 1TKXB 3I5AA 1CJUA 2HIQA 2V69A 3OL8A 5ETKA 5IXUA 4LF4J 2OPSA 1TELA 2M5YA 2GX8A 2V94A 4A8MP 3SCJE 1VR6A 3HD2A 4YOEA 4ZVOB 3ET6A 2RKIB 2Y0BB 1FKOB 3MZIA 3PV8A 3MEEB 2D9OA 1RK8A 1D8ZA 2AYMA 3GJRB 1M5HA 3QT5A 3TR5A 2CRLA 3ZTOA 4BLGA 2BJ3A 2DH7A 2GGPA 1HARA 1PJ5A 1JLEB 3MM7B 5L8RC 3GZ7A 3BQ0A 4J9PA 2OJ3A 1NJWA 3L7PA 1S12A 1R6YA 2GVZB 4NYZA 2OHDA 1S9EB 1RKIA 2O5DA 3FSYA 4UZCA 2ZZTA 3WC0A 5E41A 5H9FK 5U47A 3I5BA 2VL1A 5KFVA 4AUKA 2EI5A 5L1IA 2UUCJ 2DO4A 4ZP7A 3JSBA 1RT3A 2A2CA 3TEGA 3JS9A 2IJNA 2AKWB 1X9WA 2M52A 2VF3A 5G4DA 4TQRA 2ZEJA 3DOLA 5HQLA 3PJXA 3DGVA 3IMQJ 4NXNJ 2WVFA 2I5JB 3DRYA 1OSDA 3OSNA 3UD3P 4MFBA 3AB2B 4ICLB 2JLGA 4ED8A 5LT5A 4J9QA 2PMZD 9RUBA 2GQQA 4TVAB 5JXSA 4DPWA 1FA0A 1RAAB 4UOFA 1Q7YT 4A48A 5I3PA 1Q8BA 4FBTA 4NLDA 4ETZA 4ZITA 1WOSA 2CQHA 4AXIA 1U1OA 2BE2B 3VAKA 1NK5A 3MPDA 2M88A 4I7FB 2QC3A 3H20A 4WJBA 3T5HA 1LK5A 2HWHA 4IG3B 2QLWA 4J91A 4DG1A 1LWXA 2Y9HA 1NSAA 1N5VA 1HQUB 2QGFB 4OJ3A 5G0RB 5IOLA 5DDOC 2QZ8A 3QIDA 1L3TA 1FVQA 4FPIA 1RT6A 4K59A 3JYTA 1ZYQA 4JI8J 3I82A 2UXDJ 2DGTA 5GAEU 3OVAA 4KY3A 1KNZA 4C8YA 3IG1A 4TY9A 2XLKA 4ED5A 4Y2CA 4Q44A 1VHFA 2BYCA 2HBRB 1DAXA 5HQ8A 4WIQA 1IBMJ 1U02A 2BQRA 3W1YC 4IOAQ 3QWUA 1YJRA 1K1QA 1NDPA 2A3JA 3BO3A 5CD4H 1XMQF 1LV5A 1RTDB 2AJFE 1NK0A 2IJFA 3QRRA 2YH0A 1Q95G 3LAKA 1VQ5S 3VF0B 1GQEA 3D66A 4OZ3A 5E0OA 2MY8A 4IH5A 4Y0FA 1XC9A 3GR0A 2ASJA 5KG1A 3GSIA 4YR2A 5GAGU 5ETMA 2HGMA 1WC5A 3KJFB 5BR8F 2MZ1A 2YQ1A 4J9NA 4ED3A 3NCRA 3RRGA 3SI8A 1AT1B 1EKRA 1CJVB 4CLTA 5MLCV 4PR6A 4UY85 2RQ4A 3W2VB 4A8SA 4YB6A 1FX2A 2GHVC 2YKNA 2F65A 3NGDA 2IM2A 3J81U 3G96A 1Y0HA 3MMCB 5DLFA 1X60A 4ZVUB 2LDYA 2LQBA 2W4CA 3D1QA 1HQEA 3R3TA 3KHLA 1XR5A 4Y00A 1LW2B 5AT1B 3RB6A 2MPUA 1TL3B 3K5OA 4LFBJ 3VQSA 3M8YA 2EK6A 4E2FB 2QV6A 2UV8G 3LPYA 2KU7A 2QLBB 1WHVA 3TARA 4C8OA 1IWGA 3OVBA 4EO8A 2V68A 3I0RA 1YLXA 2EK1A 1HWKA 1ZM9A 3P5BP 4A8KA 3N79A 1SJFA 5IT9Y 1FESA 2ZNZA 4D3HA 2BMBA 2NCKL 4Q43A 3M8WA 3KLIA 4DFKA 3MEDA 2RQKA 1X31C 4IRDA 4IOBA 1Q5YA 4C7QA 2FB0A 2E5GA 4J9RA 4F25A 5CCMA 1BQMA 4N5SA 2OELA 3EM1A 2QL9B 3TX8A 1IM6A 3C46A 5T7LB 1IKXA 2PD1A 4B3OB 3M9NB 5KAKA 4KFBA 2DHSA 5KT4A 1UEVA 1CJUB 1RADB 2ZZNA 1QSLA 2WVCA 1S4EA 4I56A 5KFFA 2V2ZA 5CXTA 2DK2A 4DQRA 3OR2B 4RO0A 1RBLA 1V3RA 1J27A 4TXSA 2KM8B 2UU9F 3CCRS 1HWLA 2ZWPA 3A8KA 3TVZA 3VZHA 2D3OR 1RAJA 2JZ5A 3PJ9A 5CQGA 4XPEA 2BOPA 5L1LA 1OY9A 4Y65A 5M2RA 2XM3A 1U1QA 4NLVA 2YPYA 2UXCJ 1K0TA 3QZ7A 3H25A 2CVEA 3GJQB 4DXLA 4ZKAA 3CPWR 1QSSA 2RU9A 3L95X 2DIVA 5LL6d 2KO1A 4JI7J 1APSA 1GK8A 3KLHA 5CYMA 2HLUA 5JVGQ 1VQMS 5LSOA 4TU9A 3X1LB 1SC1B 3LTOA 1FKPB 4TKTA 3OHAA 3CXCR 3CMAS 4ZIVA 1R8BA 3SXLA 4MYTA 1LOUA 4KGXB 1UAWA 2ZBPA 3EXYA 4O3NA 5KFUA 3TVYA 4CLYA 5KOWA 2VA3A 3OQ2A 1QTMA 4CM0A 4MKYA 5FLXY 2MQMA 2OPPA 1FFGB 4MIWA 2HSEB 4LF7J 3NAIA 3O1LA 3T3FA 2IA0A 1EZZB 1G2EA 3VGVA 3F56A 3ZZZA 2QMUB 2HVDA 5HVHA 2YWEA 1HQ2A 2CQ3A 4LQ9A 3ENAA 2F8MA 4ZPBA 4K4UA 4IFYA 3CCVS 2J6SA 1ZETA 5I4MA 3CIZA 2AEFA 4HHJA 3H40A 4BS2A 4EUVA 4NASA 4PXDA 4QWDA 3P8BB 3R1HA 5CZXA 4DQPA 4O0IA 3TJ9A 1N36F 4USJC 1IQTA 1VJQA 4NLRA 4K8RA 2M3DA 3AXKA 3SDEA 1FT8A 2YTCA 1RQ0A 1YJUA 2HFOA 3TZXA 1WJ9A 2VFUA 1TP7A 1X5OA 3IS9B 4GKKJ 4CO0A 8AT1B 4JBCA 4A8XA 3TRGA 3IRWP 3KK1A 2Z56B 4KSEB 4OYOA 2J0QD 1N88A 2RB7A 1O6XA 1JXVA 1RT7B 1VQNS 3W8PA 3K2YA 2PT0A 3GIJA 2V0NA 4ICLA 1D9DA 3IWNC 1TUVA 2C1EB 5M2PA 3HKZD 4B08A 2B9XA 3ZZUA 3H5YA 2V2VA 4CLFA 1WSVA 2PA8D 1C2PA 2ZWOA 4JI6F 4CH1A 3GIMA 1YHQS 1HNVA 3VQTA 4ITSA 4RUAA 3NBPA 1GFWB 4ZMMA 4GVBB 3H90A 2BEFA 2CQ0A 2E1AA 4C0HA 1M5KC 2XTEA 3A8IA 4KYZA 4OZ2A 4U6PA 1F9HA 1W7WA 2DGXA 1RAOA 2LA4A 2QLFB 3A1YG 3HI9A 2HFUA 2Y1LB 3L3CA 2BA9A 2WAQD 3SQOP 5KFGA 3CD0A 3J7A1 2OPQA 1JIHA 1H6KX 1T3OA 1Y00A 3FVYA 3K5LA 2KKHA 1Y3KA 3M2RA 5DJBA 4ZP8A 4NMLA 3DOKA 1U49A 1G6BA 4YB1P 4DQQA 1C1BA 2XNRA 4DCJB 4IG0B 4MKBA 4ALZA 2B6AB 2GHPA 3GJSB 1FJCA 2N4DA 3RZAA 1RDRA 1FCAA 4MTPA 3HF5A 4GMKA 1RSCA 4USWA 2X1GA 4C8MA 3M8ZA 5LJ3Y 1EETA 1T9XA 3DRPA 1FRXA 4MKVA 3KUEA 1CJKA 1SQFA 2DR6A 3M8RA 1XMBA 4TYBA 4WP9A 3RBDA 4OZJA 1RGVA 2VASA 1SC3B 2V67A 3KLGB 3VV2B 4DL5A 1RTJA 1TFWA 1GMWD 1FNMA 2JLEA 4P2SA 2YNFA 2AIRB 5HMYA 3RRHA 4F0KA 2UUCF 4NLPA 1R0AB 3ENWA 4DR6F 3VZIA 3IR7B 3I96A 4YN3B 3UD5A 3J7YI 3D5MA 4NWBA 3D3CJ 4FVCA 2HBQB 3GFYA 4M5JA 4O3PA 1S0NA 3RBEA 3WC2A 3KLIB 4LF1A 3ITHB 2OO4A 1WF1A 2L9WA 3IWLA 2FJAB 2ZM6J 4UUXA 2GW8A 5IV4A 3BSCA 1VHIA 3AT1B 3M8QA 2OPQB 3K5NA 1U2CA 2C2DA 1BQMB 4ED4A 1U6ZA 3TANA 3MFHA 1KVKA 2YNGB 3FBBA 3I5CA 3C6TB 2CQCA 2G1DA 4ELTA 2JEIA 2AWZA 3R5DA 1VC0A 3MM9B 1VMBA 3N0VA 3O8WA 4P9SA 3LP1B 5H9EK 5T41A 3MCSA 2P6TA 1F3FA 2BRKA 1DLOB 3SSSA 3UDEA 1RTIB 2VBZA 2Z0GA 5GVQA 4WFBQ 2MGZB 3KK3A 2CG4A 5C2GA 2CJ9A 3OT9A 3BF4A 1CS4A 4Q8EA 3WDOA 4LQ3A 3OXLA 3S7RA 4ZLNA 3Q0AA 1TFYA 1UCNA 4M5DA 5HO4A 1W26A 3KLEA 4HT5A 3QFHA 3SIPB 1N0UA 2FJWA 1RTJB 3EZOA 2AP6A 5DQHA 2B9EA 2AHOB 4DV0F 3DYAA 2UV8A 4DSEA 2LKZA 3MCNA 4RNOA 5I3UA 1TU0B 1VRTA 1NKCA 1K73T 2H54B 1U6BA 2V9KA 1BWEA 1LK7A 4LR9A 3HVTA 4PWWA 1BC6A 2XTCA 2YKOA 4FZVA 5DQGA 5GAHU 2YKPA 3LUYA 3W61A 4FS1A 1UVJA 4GC6A 1Z1ZA 3TAMA 3M8QB 2ZOGA 3MEGB 2XLIA 5EN1A 3T1YF 1VK3A 1XEZA 4X84A 4E8UA 1N34J 4PWDB 3H59A 1XTZA 3WBZA 3W8GA 1RHKB 2NZCA 2DJWA 2CDRB 3LP0A 5KFIA 3Q23A 3KLVA 2J76E 4MIBA 4DL4A 5J2QA 2V8HA 2OPRA 2NPIA 3PO5A 2OUGA 3PRVA 3SQGB 2XZ2A 2LQ9A 4K4ZA 4UOHA 4ZVGA 1XWLA 3CJ5A 4ENOA 3TO8A 1NAQA 1TVRB 2E66A 3Q8PB 1HQEB 1T94A 3RAQA 1VQ8S 2XMWA 3PY8A 2ZFHA 3FCWA 3TA0A 2V4JA 5F8MA 3SMZA 1MWYA 3DXSX 1JLEA 2OKQA 1TL4A 1KFDA 3FCHA 2WSFC 3GB0A 4RZRA 2BRLA 4E0DA 1U2FA 1G7CB 4NZ6A 5D0GA 2KM8C 1WTFA 2VDIA 3V81A 1FTRA 2VJVA 4P52A 3MMBA 2QO3A 2MLYA 1NKEA 4AFFA 3EUNA 3LO3A 3ZC4A 3AJDA 2CQDA 2KI2A 1OQ3A 2ZH1A 2MHEA 1NJXA 5A8WA 1WC1A 2O66A 2FGOA 2WCXA 2ZHBA 3Q89A 5A6WA 1WORA 3TUZC 1DTTA 3TVKA 3D0GE 4JP8A 2MQOA 2JX2A 1L5UA 1XMQJ 1YGYA 2BW2A 1GTEA 3KNGA 1UJ4A 1R0BG 1T9UA 2GJIA 3M2UA 3MPWA 4QYRA 4NCBA 2CWXA 1YJVA 3MUMP 1IBCB 3QBCA 5B0AA 1S76D 1YRTA 1JXEA 3M2RB 1RWOB 1UVIA 2HVEA 3GV8B 3BGLA 2VPXB 1TL7B 1AUDA 3FGVA 2DRDA 3CULA 2B8QA 1IBLJ 3PX6A 2MB0B 3JSMA 1KEKA 1H2TZ 2XYGB 3HHEA 4RJVA 2HRYA 1X9SA 3FZBA 2RQCA 4DLGA 3MUTP 1YITS 3IR5B 4Y28C 3BYPA 1CC8A 1ZOTA 4RW8B 1KTVA 2ASYA 3DRPB 2E1MC 1HNIB 3NWRA 2DNPA 4HEA9 3OL7A 2BKPA 3W60A 5AXLA 3Q8SB 1FXLA 3M2VA 2HNZA 3RAMA 3T1AA 2KZZA 2IVYA 4U8YA 1VS3A 4PXEA 2HVIA 3PRBA 1GX6A 2RDIA 1LWCA 2W2PP 2XMMA 3C66A 3MM5B 1HHSA 2EXUA 3VALA 5IT9U 1JB0C 3S1TA 4JI2J 5IT4A 2W01A 4PQAA 1S1WB 1GMVA 1RT1A 1OY8A 5A8WB 3DLGB 1WHYA 2FJEB 1HBMA 3H2LA 4P72A 4DN9A 2AQ4A 2DGVA 3GCWP 3MR3A 4ECTA 4N77A 1T03A 1RTDA 2DCLA 2FZCB 4BC9A 2DNNA 2HMIA 4KH1B 2VG7A 4PRFA 3M2UB 2XTJP 3B6BA 1CJTA 4L3KA 3DLHA 3UR3C 2IAJA 3A8EA 2FVSA 4IG3A 4M5MA 4F4AA 2FYXA 5CAAA 3W7BA 4YS2A 2GFFA 1H38A 2GVDA 4DZDA 3SZ2A 4PABA 3JTOA 4YR0A 1A7GE 1CSJA 3G4SS 2KJWA 4DDFA 3L7UA 1FXDA 3ISNC 2CA9A 3DLKB 4DV3J 3FSIA 4EZ6A 2ZKUA 4KKOA 4K0KF 4CT9A 2P5VA 1WG4A 3JSMB 3BZQA 4ZVPB 3EVMA 1BXNA 1XBWA 2WONB 1NU4A 1R7IA 2CDQA 1TAQA 2XYPB 1S1TA 2CJAA 2Z57B 3GU0A 1BUXA 4ID5A 2VICA 1TK5A 1NKBA 1WELA 5ETRA 1S9FA 3L09A 2R8HA 3HHLD 5HBMB 3MR6A 1CG2A 1XIQA 2GC8A 2EWHA 2HNZB 3FNNA 3HJVA 1YJ9S 1U47A 1N4LA 1M5OC 1HKAA 3QWPA 4LBIA 2DEJA 1TTHB 2NXJA 3IRXB 5J2PB 3BH7B 3TUIC 3TNVA 1RLDA 1YBUA 4EFAC 2VDHA 2B4PA 3BGOP 1X4CA 3FMWA 4HI2A 1NSQA 2MQQA 2AGQA 4DUZF 4NXNF 1Y3JA 4V1Ak 1HR0F 3DOLB 4HKQA 4DU8A 5KT6A 3JB9k 1IWAA 3BPSP 4ZCIA 1P27B 1ZM2A 2DXEA 3FEZA 3N5BA 3TWZA 2JEFA 2DR8A 2MGZA 3MEGA 1FRKA 1RHUB 1F6TA 3WIVA 2QT7A 2MJNA 2R7WA 1N33J 3DLJA 4DSKA 4CP5A 1JKHB 4KGZB 4ECQA 3PX4A 1OO0B 1N48A 2LXFA 3OLAA 4LF6J 3HD1A 1HBOA 1GAOA 3BB5A 2RS2A 3P49B 1KN6A 2E9TA 4RBVA 3BO2A 4P71A 3M6UA 4OFZA 1VQ7S 1RCXB 1G1XA 2CPHA 1REVB 3WQPA 3HHLB 4U67Q 3W3SA 4ID5B 1F5CA 1RJJA 2VBXA 3DGPB 2W8LA 1O8BA 2G2OA 3BQ1A 5EUHA 1U24A 3RYLA 5KFKA 1NB2A 1DRZA 3V2UC 2HRUA 1HNXF 3EPGA 4M5NA 1LQ9A 3BSOA 2MKKA 3LA0A 3QFWA 1NK8A 2DHAA 1NDLA 5KT3A 3KLHB 3NNCA 4JI7F 3KFWX 3OFHA 4LFCF 3TZYA 3CJ8A 2BUNA 3CD7A 5D15A 1UVKA 3UVJA 1N5SA 1RWUA 3CC4S 4X4UA 2OIHA 4NLXA 1QAXA 4ZVRB 3DU5A 3UDVA 1S1VB 1IR2A 3HCXA 3HK2A 1IJFB 2OPPB 1F2HA 5D0RA 5C7PA 2XY6A 4QW9A 4NLGA 2OTJS 3MR5A 4J9UE 2U1AA 3UW1A 3LOUA 2ZE2B 4H54A 5HQMA 2N7CA 1FDNA 1TVRA 2XO7A 3VAJA 1RWVB 1ZPVA 2GA7A 2DY9A 2BKNA 2MQNA 5CH7B 4F67A 1LKZA 1JKHA 2CQ4A 1U48A 1Q81T 3GCXP 4Z2XA 2GIRA 2E1CA 3D67A 3PM9A 3F73A 2F3JA 3I4PA 5DG9A 2UUBJ 1QVFR 2OMLA 2ZBIA 4IO9Q 2K7JA 1S77D 3PEJA 4NL5A 2JOQA 4RLEA 4IUFA 4N56A 4IH7A 3AWRA 2A2DA 5J1EB 5KFDA 4X4TA 2BJEA 2UP1A 2Q3PA 2FUG9 4XAKA 1FKOA 1HWIA 4UUWA 4F0MA 1OYEA 3CJTA 2BM1A 4RNMA 1HI8A 3LAMA 2AEJA 1E6VB 2E29A 3C19A 4Q2LA 2YWKA 4USVA 3EGZA 1NUEA 2JHEA 1T9VA 1H2UX 4L72B 4KPCA 2AEMA 1DARA 1U0HB 4QR0A 4CM2A 3C3LA 2ADBA 2C2EA 5IFMA 4UY8T 3KG4A 4NEYA 4UZBA 4ILLA 2VJUA 4OI3A 3I4HX 4OIXA 1Q7LB 4DPOA 5KFOA 4CNYA 4RW9A 4KV8B 2YNHA 3R5JB 1R43A 2QG9B 3FQKA 3PW7A 5LOQA 1AZSA 2ZVSA 1HBMB 5ETTA 1R6VA 4ZPWR 2ACYA 2DNHA 1E6YA 2HK2A 3DXBA 3GSDA 1TAUA 1R0CB 4TU8A 1PGZA 4BWMA 3ZZ0A 2POKA 4ZCKA 3G8TA 2CPFA 3I9ZA 2D74B 3T5LA 3MEEA 1MWQA 3T19A 3WX8A 3JQJA 3QJJA 2VBWA 3BKFA 4KTQA 3MPVA 2X7IA 2QEXS 5LJ5Y 1QAIA 3DOKB 4EYHB 3HHNB 1TKZA 1N52B 3I0SB 4O4GB 5GADU 4RW4A 5ETSA 3FRYA 3CCQS 1S9EA 2UXBF 2QA4G 2DCUB 3D54A 1NSPA 2ZJPQ 3FUYA 2J0XA 1UVLA 1BQXA 1C1CA 2Z58B 3EE3A 1RHRB 2QX0A 2K06A 2MDAA 4FPRA 4NYPA 1PCAA 3KKFA 2W9AA 1RT3B 1DTQB 3B82A 3NBPB 5T14A 3DOMA 3NY0A 2HBYB 4X4PA 1VQPS 1RHQB 2ZNYA 4M1KA 2DNRA 1WHWA 5CABA 3GIIA 2A0FB 1NB7A 1IQZA 1VIXA 3CJQA 2AGPA 5DQIA 5J1NA 4JI8F 4FBUA 1JLBB 1JJCB 2KFZA 3LGHA 4ZVTB 3HVWA 1FDDA 2ZHAA 3K57A 1QY7A 2YH1A 2IMOA 2HWIA 5HJYA 2KG0A 1XQIA 2LXIA 1MW7A 2N7YA 4Y6IA 2R2TA 4FF1A 1T7PA 4H4OA 2FDNA 4F0HA 3HMJG 3EWGA 2HBZB 4RU2A 4X4NA 3NP5A 4I6WA 2QN6B 1J5OB 1KLNA 4KJIA 5EWFA 2A6MA 1Y9OA 3H5UA 3IP0A 2VONA 1R8AA 4EGLA 4CH7A 2F7VA 4HACB 4WXWA 2I6WA 2Z2MA 4KGVB 5LXYA 4TU7A 2Q6BA 5F8NA 1OM2A 3CVKA 1BHNA 5E3PA 2MY7A 1TKTA 2AJ1A 5A76A 2KT5A 1GX5A 2AX0A 1RWPB 4LSNB 4CO5A 2JDJA 3TAPA 3NGUA 2PO4A 3Q8RB 1CLFA 5D4NA 1R89A 3TJAA 2H3EB 1B0TA 3RB3A 2XHCA 2L41A 4C8KA 4KRWA 1NK6A 3LF0A 1SQGA 1KD1T 1ITPA 4DSJA 4PXCA 1XNRF 4C3MA 3T1HJ 2HZAA 3L9ZA 1IUJA 2R4FA 2UUAF 3CDWA 2EVZA 3CJSA 4OX8A 1S6QB 9ATCB 3KLEB 2F63A 5ADZA 2DGOA 1Y5IB 4TLQA 1S72S 3E3XA 4IYQA 3UNYA 2I8EA 2H65B 5KT7A 3W2WA 3M8PA 3PW4A 3NXZA 3QYYA 2HHVA 2CKWA 4C8NA 2P9GA 2YKQA 3OJSA 1VRUA 4M63A 4BWJA 4URGA 3BBBA 1RWXB 2WOMB 3LP1A 4IO1A 3VR1A 1VQKS 1SUQB 3HX9A 4DF4A 4G1QA 1AXQA 5B0DA 3R1LA 2D9PA 5BYSA 4MFBB 1VIOA 1SL1A 2FPHX 2KHDA 3IM8A 4Z37A 4NPOA 4WE1B 3PXGa 4DF8A 2DO0A 4A46A 5F8LA 2D3ZA 5F3ZA 5LMNF 1NXIA 3K59A 4B3TJ 5ETVA 2P9CA 3VAHA 4DR2F 3CNQP 1VFJA 4KFBB 1FX4A 3BGFA 1Y4ZB 1F9FA 3MHYA 3P4UB 4USMA 2DHXA 2OD6A 2OTLS 4ILMA 3IA0A 4YB7A 2Y8YA 4WKRA 1YG0A 4ES3A 5KG2A 1V3SA 1H98A 1YJTA 4PG7A 4W98A 1L3SA 4TQSA 1ZH5A 5HVGA 1I51B 1EETB 5KFMA 2NXCA 2ZBCA 5D0HA 5CZVA 5J2MB 2QYCA 3AY0A 3EXCX 3OXGA 2IBOA 4P2XA 4DL7A 3KLGA 3AOCA 1E6VA 2W1BA 2V4QA 4I6AA 1U1MA 2HNYA 3TAMB 3HPOA 4O44B 4B3RJ 4NI2B 4DLEA 1M5PC 2JRSA 5HP1A 4OHYA 2PSZA 5T7LA 1TQLA 1DY3A 1WC0A 4WXOA 3NGKA 4DV6F 1FWLA 4CH0S 2H4WB 2JC0A 5A8RB 3K58A 3BO4A 4DUYJ 1SH2A 2WOMA 3IWXA 4RW9B 2FVRA 2EFNA 3OFEA 4UOGA 4USTA 2W9BA 1LWFB 2DGWA 3OFFA 4RW7B 5DZ7A 3NMRA 3BR9A 1HD0A 3DU6A 3IBCB 2I9SA 5E5NA 1WI8A 3H7HB 3CC2S 2E9ZA 5JMNA 2PIIA 3GONA 5AJ3F 4NLWA 2DHHA 3TEHB 3TJ8A 4CTAB 1IVZA 4AL6A 5DGAA 4YUDA 4USUA 3PW0A 4K4XA 3Q86A 4BC7A 4KBIA 2LDIA 3DDKA 4HL9A 2J6UA 2M8HA 2J7WA 3B78A 4ZP9A 3MPUB 2H9ZA 3I31A 3TA1A 3KDNA 3V6KA 4ATNA 4X64J 2A6OA 4DHVA 3ET6B 4K5SA 2WBRA 1L3VA 4N41A 1W25A 1RKJA 3OSPA 5GMEA 3E01A 1HIYA 2HZVA 4I68A 5C24B 3IS9A 2F8HA 1KVIA 2QL7B 1S57A 1K47A 2FLOA 3OTCA 2DXDA 4LF2A 4CLSA 5KFHA 3KOAA 1LFPA 3OV7A 2HNYB 2ZC3A 2XS5A 3Q8UA 2AT1B 2EG1A 3DRSA 4WU2A 4JI3J 2V9WA 2RF2B 3GYXB 2FHJA 1RLCL 3I0RB 4QR1A 2XGPA 1VQ9S 2CFXA 5KTQA 4B9UA 4BBYA 1SH0A 2HHHJ 2W7PA 4DV7F 2VPWB 4RW6B 3NNAA 2VG6B 4J9MA 3K5PA 4DWIA 3H42A 1HPZA 4L3NA 2MZRA 3MEDB 4F26A 2KH9A 1FRMA 1R3NA 2L9NA 2QE5A 4OHVA 4R0JA 1X5SA 5CD4A 1BE4A 3T1YJ 4B9LA 2XO6A 1NO8A 4CRJA 4MMOA 1UL3A 3OHBA 1PKUA 2EW9A 3CJ4A 1PC5A 3E51A 5SUHA 4EU0A 3VAMA 2EKYA 1BY9A 4WTOB 1MMDA 4NE9C 4DOZA 4A8WA 3SV3A 4M8LA 1IKYA 1SV5B 2ZM6F 3MM6B 1RTZA 2XMUA 4LT6A 4HDHA 3H5SA 5FD1A 3BSNA 1L3UA 4K4TA 2R7XA 1UVNA 2CQIA 3M8SA 5KFWA 4DV2J 1UMJA 2C3OA 3BH6B 3D6FB 5B0FA 4B3MJ 2XMVA 2GIQA 2B43A 1JLCA 1ZBTA 3MAAB 3AFGA 3NWGA 3S01A 3HZGA 5HBMA 1ICEB 3BREA 3J7Z5 2CZVC 1BQNB 1KS2A 2YX7A 5GMKa 2ZH5A 2ZUGA 1SJRA 5E33A 4A4JA 3V81B 4YR3A 4YP3A 3PYEA 5J2PA 1NZAA 1GTHA 3BM7A 1V9OA 4QIEA 3ZZYA 1R0AA 3PW2A 4ZPTR 3KHHA 5FIIA 2XI3A 4IFVB 5JJBA 2HHWA 2F5GA 4LSNA 3KMSA 4NLSA 1I5OB 4OV1A 5LSRA 2XTDA 3MECA 4MAKA 4J9SA 3BYRA 3ICLA 3F0NA 4DR7J 3AJ1A 4C9DA 4KQZA 2E5LF 3C2PA 4NX9A 1TK8A 2E7WA 1LW0A 4KO0A 4QPTA 4NLQA 1GXLA 1NCLA 1YK9A 2CG8A 3FJ2A 2OPSB 3MMJA 4NZ0A 1K1SA 1X4DA 3NS7B 1S0OA 3S8SA 4KPYA 1N33F 4QWCA 1U1LA 3CTRA 4NXMJ 3D6HB 2NS1B 5DM7Q 1DQ9A 2ZDOA 4ILRA 1D0EA 1U1KA 1SJ1A 2XNQA 2R7QA 3IXQA 4I0WA 1HYSA 1HW9A 3TOQA 1TZ0A 2O67A 2O01C 1X4AA 4ELUA 2R7VA 1YJ7A 1HNXJ 2ATCB 2YXLA 2Z2YB 2Z2ZA 4WBFA 3C14A 3FBEA 5IZHA 4OYZA 3CCES 2JFDA 3V6HA 4LREA 2B4UA 2IA6A 1XJWB 3K89A 2FVQA 3OLBA 4WFYA 4DX5A 1GNKA 3MWBA 4ZPCA 3QLHA 5GADI 3D6TB 4ZDNA 5KFRA 1QVGR 5EX3A 4GKKF 3ZZPA 3DLGA 7FDRA 3NNHA 1S0MA 4IRCA 3R5GA 1S6PB 1R8PA 2LCWA 3U1MA 1B0VA 5KG5A 1A9NB 1MSWD 4NRTA 1OPIA 2YNIB 4N47A 4PUOA 1TK0A 2RRNA 4FP9A 2R8GA 1IR1A 3AA8A 4UTGA 3DRRA 2C28A 1RA7A 2WHOA 4NLUA 1QTNB 3FC9A 4J7CA 2VIHA 4DL6A 4B9NA 3IAS9 4OX9J 5KFSA 1IKXB 3CCZA 1PYOB 4X2BA 4ZCMA 4OV6A 3G6ES 4NXMF 2Q66A 2CVIA 2CPJA 3CDEA 2K3KA 1JLFB 3NLCA 3R2DJ 3MTJA 4OQJA 3SQGA 2CQPA 2MKIA 2E7VA 3Q83A 2V2QA 3CJKA 3LW5C 5KFQA 4JI5F 1P9QC 3BJYA 2CNNB 3FEYB 2XCPA 2ROPA 2VQEF 3PX0A 3Q8QB 1VYAA 4LRCA 2E44A 3TUPA 1X0PA 2C2KB 3OTOF 2WW4A 2CPYA 2ROGA 1RT6B 3SFUA 1S6QA 1X5TA 1KR4A 2HGNA 2XBPA 3CO0P 4IH6A 1VDHA 2B3TB 2V8DA 4XTTA 1UA1A 2RH3A 1RYRA 1HBNA 3U1LA 4I2QA 4DS5A 4JI4F 2CZ4A 2MKSA 2RE1A 2V8PA 2F4FA 3M8PB 4A8QA 1RU2A 4YDDB 4CTAA 4AQYJ 3CO9A 5E3QA 1X0FA 3N6MA 1FRHA 1TMMA 2B7CB 1N0VC 3NL0A 3CMES 1S6PA 4LRDA 3MD1A 2AZ3A 4DV2F 2V1TA 1VC5A 2MZSA 4WZMA 3AOAA 1QD1A 2BW7A 1ZAXA 1HA1A 2FJBB 2ILZA 1E6YB 2NXEA 2XZWA 3AQPA 2YWFA 2CPDA 3CDBA 1JNRB 3NRBA 1S6UA 3QO9B 4X66J 3FEXB 5HANA 4JV5J 2IRUA 2ZJRQ 2IM0A 2QL5B 4XDDA 2OFHX 2MHNA 2JH3A 5HSPA 4LF8J 1SIZA 3IBWA 5A6PA 1B99A 1B0PA 2LQJA 1RHMB 1HFEL 1SB6A 1S48A 3FBCA 3BN7A 1UFKA 3BV8A 3RW7A 3W2VA 1U0HA 3NOGA 3CF5Q 4QPXA 2QSFA 4DV4F 1XN9A 2LEBA 2Y0SD 3OTDA 1NLKL 4FYVB 4F8RA 4ZA1A 5J2MA 4C8LA 2HAFA 4X62J 4YMEA 4CCHA 2VG6A 2GMLA 4H4MB 4QWEA 2YWWA 4B9MA 2BANB 1FEHA 3SYZA 1UWBA 1JLCB 4L6V3 2XQCA 3CCMS 1SXLA 1RWNB 1UJ6A 1UPMB 2GGPB 5E7OB 5I42B 2BJDA 2M7SA 2XSJB 3RU0A 2DH9A 5K5MA 3UCZP 4CLUA 1VBZA 4Y34A 1BLUA 4F3OA 2IDLA 4K4SA 3TW0A 4A8OA 3MM8B 3LQVA 4EWTA 1GT8A 4FYDA 3DC2A 1JX4A 3EJMA 2DXFA 3KG1A 4B17A 1WC6A 4LBPA 2OSQA 1TL7A 3N9UC 2PI4A 1BGXT 3I0SA 1JLQB 5KFJA 1Q86T 1IM4A 1JLGA 2DB1A 2YQ3A 4ZJLA 4OHZA 1EX8A 3ILIA 4KC5A 1F5BA 1Y5LB 1WC4A 1KC8T 1EKSA 4MK9A 4X64F 4LMZA 4ERDA 2W7AA 1S1XB 3W62A 2X1AA 1N54B 4JI1F 3SCLE 5IWAF 2LECA 4B3OA 4OZNA 2DNGA 1D09B 2ZOFA 2EFGA 2RILA 3LP2B 4ZVFA 3T41A 4CI0B 5BXIA 2MZTA 1Q0NA 2RT3A 2K7KA 4ZHRA 4ZVQB 3RUBL 4DX7A 5D6GA 4F50A 2KXNB 1S59A 3CD6S 1SVDA 2WZ1A 3VGTA 5IQ6A 2NSCA 2VKZG 2HEKA 2AJ4A 2BXJA 4X4VA 3CJRA 3HFZB 2FD2A 1R8CA 2HNDB 1HW8A 1GEHA 1CVJA 5F41A 3QGPA 1HNVB 3EDRB 4CLZA 3CGIA 3R5CA 3VVTA 4DV6J 1KRPA 2HHUA 4DL2A 2MSTA 2J8SA 2EPIA 4LSLB 1YKWA 3EDQB 3UDLA 4NEZA 4FF3A 1ZTTA 2C2MB 2RMLA 4U8VA 1UEKA 2RAQA 1CULB 2ZDPA 3IC1A 5JVHQ 4MYUA 4KR0B 2YNFB 3GFHA 4MT1A 2NQPA 1KP6A 2QRRA 4KE5A 4OL8A 5E2QA 4I4BA 5K14A 2YNHB 3FRZA 2MZJA 5F0UA 4EEYA 1HPZB 1VRUB 4DJBA 2DISA 1RAHB 3I9V9 4CO1A 3VAGA 2K2PA 2R7OA 4QIVA 1FTCA 1MWZA 1Z4UA 4ZN3A 2QJ3A 4R5PB 2MEWA 5EHHA 5EDWA 2ZJQQ 5A8KB 1DBDA 3R97A 3OTBA 4OZ1A 4NCAA 4Y3CA 1XK8A 4PAAA 3KK2B 3CT9A 4F2SA 2G0IA 2NR0A 1HI1A 3DRRB 3I56S 1TKXA 2ERRA 3UE2A 3C6TA 1J5EF 1TV6A 3UR0A 2OD4A 1S5ZA 3RJMB 2CUYA 4TLRA 5D4PA 3V6JA 2PC6A 2OSRA 2FY1A 1U8WA 3EVOA 2R7RA 3X3UA 2C2RA 4HHUA 2GJFA 4HTIA 3CJKB 4NCGA 3QLHB 4F4ZA 2CQ1A 1T9YA 4CLKA 3KK3B 4RKUC 2HKEA 1OJ4A 2BJ7A 3DGPA 4GO5X 2R2UA 1URRA 4WKYA 3CW2C 5B0EA 1V5IB 5HLFB 3E2EA 2DR5A 2BDPA 4OI1A 2JEJA 5D4LA 4F7VA 4O3QA 1WEZA 2Z30B 1VC6A 1TL5A 2CJQA 3BKTA 3GFXA 1S7HA 3BBCA 4PZVA 4IQXA 3BGUA 4C3KA 4RNFA 4P73A 2DNYA 5ETPA 1YJNS 1B64A 2J9DE 3EICA 3GLJA 4NZ7A 2ASLA 4Y2AA 2FJDB 2MTLA 2EBEA 1HWUA 3K17A 1JLFA 1RHJB 1S99A 3M32A 4KT0C 4LRAA 3FQLA 4HYKA 3MR2A 3PHEA 3UFCX 1A6LA 2FC8A 3HULA 1WC3A 2HYIB 2WVDA 2PGCA 2DBBA 4N8OA 3W64A 3K0JA 1LW0B 4MK8A 2GVDB 2NUUG 3WHIA 4NA3A 4LF9J 4U7CA 1U09A 1WKKA 4M5DB 2F4VJ 1JNZB 1KHVA 2FHKA 3KMQA 3G82A 4CZCA 1FNXH 1FJGF 4IR1A 1WD6A 2CPXA 2OPRB 4I7FA 6FDRA 3GV5B 3PYFA 4OX6A 1U1PA 1CQNA 1RT5A 2W25A 1IXKA 3LGNA 2PI5A 5HVFA 2VOPA 1PG5B 1NEEA 2HK3A 2JFKA 3HZEA 4DG1B 5J1EA 4URSA 1YBTA 5A8RA 3KHGA 5KOXA 3V4MA 3PW5A 4ZJOA 2DPIA 1YDLA 1OYDA 3QNWB 1UWBB 3KTQA 1F0XA 2V4JB 5LMUF 2OMOA 3RRKA 2C42A 1UKUA 2GAHC 5HMZA 2W7OA 1D9FA 4DSIA 1I1GA 4JOUA 4K2XA 4ZLJA 1Q8KA 1T3NA 2GMJA 2HLTA 3U7JA 5L38A 1VBYA 1HNWF 1FE4A 2WK4A 4NLTA 3BN4A 3EGVA 2KT3A 4AL5A 3G2XA 2UZAA 2VFTA 1RU1A 1FE0A 2MKJA 4HI1A 5CYJA 4UQTA 3T5KA 2Y1JA 4OX9F 2BQUA 5AXNA 2EKNA 2MKYA 1PBAA 4CLLA 3TYTA 4KIAA 1B70B 3D4JA 2NPFA 3R5BA 4FXDA 5HN0A 3JXOA 2KJVA 2BACA 2R9LA 3K5MA 2HAIA 3N5FA 4EBCA 3SSRA 2JVOA 4FNHA 4NYOA 1O5JA 3MMAA 4ZOSA 3OTEA 1IKYB 1SV5A 2XSJA 1TKDA 4LF5J 3NKYA 3FZ2A 2VC1A 2YKNB 4O4GA 3VVUA 3PFOA 1S1UA 1OPZA 2QMWA 3ETMA 3O44A 4UQGA 3N6NA 1DFDA 4OLPA 3VWSA 3AHPA 3S6EA 2AW0A 2HURA 2AU0A 2J7KA 4RX6A 3DOMB 5CA5A 5KG6A 2J0SD 1SC6A 4A8YA 5C25A 3M2VB 3HM9A 2Y1IA 4XK8C 3MM7A 3C15A 1JLAA 1NH8A 3PIPQ 5FLXU 2BJ9A 3J7AN 3UVJB 3T6BA 2J0WA 2FIUA 5DS7A 5I3UB 5KFAA 4O0NA 3LWMA 3RB4A 2HQIA 2RSQA 1QE1B 3DLEA 2P2CB 4GO7X 4LIRA 4B3SJ 1X4GA 1RT1B 1N36J 3THTA 4DUTA 4DS4A 4DPXA 1QSYA 2E5JA 3UN3A 2OI2A 3MTKA 1GH8A 4LFAJ 2BJ8A 2E1PA 4B02A 3W9JA 5B09A 1U2RA 4NLYA 3QIPB 2KVQE 1RYSA 1WNEA 3TX0A 1H7XA 2E5LJ 1UW4A 3PHTA 3GIRA 5H9FJ 4HACA 2P6SA 3M05A 1PAEX 3H4DA 5H9EJ 1WHXA 3MMAB 1N32J 3G9CA 1NJZA 1OIAA 3D0HE 4C11A 2YBVA 8ATCB 2Z8QA 4DR4J 4CIOA 2GVZA 1JLBA 2I38A 2BE2A 2ZD1A 2XMAA 1MROB 2ADCA 4F4XA 2FLLA 3E01B 3MPYA 4PG6A 2SXLA 2W9CB 1I94J 3RR7A 1S1WA 4KB7A 3CEDA 3OL6A 3VAIA 1S9GB 2M9KA 3NCPA 2HHTA 4LR7A 1UZHA 3A3PB 4L73A 2XY7A 5K8PA 3HFVA 1M0SA 4I2PB 2VQFF 1H74A 2I5JA 4OX7A 1FF2A 3OL9A 3CCTA 1D8YA 1VQYA 1ZM4A 1H73A 4I69A 2XC9A 3MMBB 2BKOA 2VV5A 2Y3YA 3IG1B 3T9NA 3QSYB 2DTJA 1AUSL 1WUUA 3NS6A 1WEYA 3O5TB 5DETA 2PDAA 3J81j 4X65J 3JTPA 4G1PA 1T05B 4U7UK 3JQMA 1DTTB 3T6JA 2YNIA 4G3IA 1N32F 1Q53A 2I1RA 1UW9A 3OXFA 4R8UA 4O4RA 1HHQA 2HFNA 2JVRA 3P3DA 3QQCD 4TN2A 1VQLS 4DR1J 3Q22A 2ZKTA 2L9DA 2X1BA 1UVMA 2YY3A 4NOHA 2BZ2A 3MOJB 1HMVA 3P5TL 1QDUB 1AFIA 4BCAA 3L7OA 2VU5A 2KHCA 4I1TA 1UZDA 1C1CB 4G6VB 1C4AA 1RT5B 4URQU 2G13A 4LFCJ 1DQ8A 1FRIA 2X3GA 1MLAA 3U02A 2ROEA 4CYUA 5EGYA 5FJ4A 4LFBF 1RACB 3OUYB 3M6XA 3M32B 2D3O1 2H48B 2GZOA 2IJRA 2ZH6A 1WWHA 5DO2A 5I3QA 4QW8A 4AXJA 3AAWB 4OYAA 1CULA 1AA1B 4DV3F 3MM5A 1EQ0A 1HBNB 7AT1B 1UJ5A 2P9EA 4P6QA 5B08A 5GAHI 2V63A 3BS9A 2DHGA 3VGSA 1QUPA 4IFYB 4EMDA 4OYBA 5HROA 3UPFA 3QT6A 2VFRA 1RXOB 3MD3A 3RBZA 4I67A 2NZ4A 3HVTB 1K9MT 2R42A 2HFZA 5JUMA 5B0GA 4PYDA 5BR8J 4DSLA 2V4RA 4M94A 4GKJF 1Y10A 2F9JA 1EB0A 3KK2A 4DFJA 1DJ0A 4K0KJ 2PFFB 3QRPA 2RJZA 3W5ZA 4UW2A 1SL2A 4ECSA 3FKBA 1FJGJ 4J9OA 3JQKA 2EFQA 2DITA 2G1HA 3RBXA 2VODA 1X4BA 1ZAVA 4FN5A 4JI5J 4EO6A 4H4KC 3I55S 1HMVB 3G6YA 1EIYB 4O44A 4JI0F 3BSAA 2R3VA 3DHXA 4YQWA 2IC3A 2HS0A 4AT1B 5LMNJ 4DX6A 2YWGA 3LH2S 3W65A 4B3TF 2VFSA 3KNAA 4AL7A 5L1JA 3TAQA 4I6YA 1VGYA 1RI7A 3O3LA 5AXMA 1YJWS 1LXNA 4OLOA 2Z4PA 4QIFA 4C48A 2BQ3A 3PDNA 1SJ3P 3CJ3A 4DL3A 3B4DA 2ZH3A 3GMGA 4CO2A 2LQ8A 2CJBA 2GMHA 2AMCB 3SEOA 3KWMA 2FHOB 4J9KA 2NSBA 4J90A 1N56A 4C8ZA 3BGRA 3CB4A 2LEAA 1WDTA 1IJEB 5K9FA 3GG0A 2HVHA 3W2WB 3AD7C 4FYXB 1FKPA 3HT0A 4RNNA 3QZ8A 2AF6A 2NUHA 1DHMA 1VJWA 2JL9A 3ZTRA 1V5VA 2J9CA 2ZUAA 4KV8A 4M95A 3DI6B 4ECXA 5H1SV 3RW6A 4OI6A 4NA2A 2NYHA 4G1QB 2RDDA 4JB8B 4X4RA 2GS8A 1AYEA 4KGMA 2OGUA 4EBEA 3ISND 1MU2A 4ZK7M 4Q45A 1Q1KA 2W24A 3ENQA 3V6DA 2LQ5A 3C8YA 3GE9A 2FHMA 3EZUA 3LWLA 1K8AT 3UN2A 1YQHA 2AD9A 1PAUB 1M1HA 1Z2LA 2D1CA 1REGX 3CWJA 2LA6A 3CSKA 5RUBA 3TZZA 4XPCA 2O3DA 2B9YA 1GMUA 2HGLA 4RBUA 4C11B 4TYAA 2EBGA 2FZGB 3MM6A 3D28A 4CLWA 4XIUA 4M5KA 1YZ7A 2DY1A 2G0JA 4PPZA 3EGNA 4HVZA 3EVWA 5AE3A 1UPPA 1FDBA 4A47A 2UUTA 2WTFA 1TUGB 4RW6A 2W9CA 3AJ2A 4L74A 4MKAA 3HP6A 4EBDA 1RABB 2QIFA 2ALZA 3DN9A 4DX8H 1RT2B 2I0XA 4ANDA 5HMWA 1JLQA 1WG1A 2IHR1 2N3LA 2VPZB 4MJKA 1S0VA 8RUCA 4CDIA 2OAUA 3DYAB 3BEGB 2E5IA 4X65F 4V19J 1VLYA 1FXRA 3D1OA 4S0MA 4F04B 2XB2D 1XNQF 1UUJA 1SKUB 1VBKA 3ETOA 4LRFA 5F8JA 3R7NB 3VCDA 2KFYA 2GJ2A 3P45B 1RCOB 2GIFA 3KXDA 4CO3A 4WK3A 5DDQC 4Q0BA 3IR6B 5GMDA 1TKZB 1N6QB 4DZ6A 1YWXA 1M5VC 4Q0BB 1VRQC 1WKJA 2HVZA 2LP4A 5GAGI 2R8JA 2ZD1B 1Y5NB 2ZE2A 7FD1A 3PO4A 2HMIB 2FVCA 5KFXA 3G71S 3V4IB 2UXBJ 4USHA 5KFEA 4ES1A 5F8HA 1KOOA 2QYGA 2XWYA 4DSFA 4BDPA 3KK1B 1B4SA 4ZVSB 1CS4B 5IS2A 3Q24A 3AA9A 1N5YA 3MDFA 3DDNA 4QIWD 3B54A 2U2FA 2B6AA 4WZQA 1LWCB 1KQKA 3UI3A 2ZZMA 1RWMB 2RHQB 2XMTA 3QGHA 2WONA 3CIMA 5C24A 1HNZF 1EHWA 3GYNA 2DGSA 1MNEA 2HZCA 3J81Y 2ZOMA 4R5PA 5HLFA 4FDFA 4F3QA 3KHRA 2RNEA 1ZPWX 2BR0A 2LYVA 4DV0J 3HHLC 1U1NA 3A12A 1FD8A 2E9RX 4KGKA 1TUWA 5J2NB 5DM6Q 2DIUA 4Q8FA 2IAJB 3TQEA 3JAMU 2DKOB 1F3VA 3JAMY 1JXLA 1IBKF 2X1FA 5F8IA 4DQSA 3BQ2A 1RWWB 3CJ2A 1FK9A 4FF4A 1T0TV 2H4YB 3LP0B 4JV2A 1ACMB 3M30B 3VTIA 3OR1A 3AB4B 3AQOA 3IM9A 2CXEA 2ZH8A 4OI0A 1XR6A 4A8FA 1JJ2R 1N5QA 3D68A 3P96A 5KFTA 4QYZJ 4LVOP 3M1VB 5IWAJ 2XLJA 2V8GA 5D3GB 2CIMA 4OJGA 3US5A 2UVUA 1IN0A 2GV1A 4WFZA 2KYZA 3KJNB 4I64A 1CJKB 1A0OB 2YNGA 3ZZOA 4UT4A 3KJVA 4AYBD 1RAEB 2KB2A 2QA1A 3FK4A 2KYXA 2F40A 1RE1B 3G82B 1VCTA 4WYWA 4DCPB 4ETXA 1F9EB 1NHVA 1WTBA 4BHQA 1YRXA 3FBFA 2FGCA 2GHWA 3IBFB 3V5RA 3P6YC 4LRBA 2DNMA 2NLWA 2AJ0A 3M9MB 4TY8B 4ED1A 2QTWA 2P8IA 4OYPA 3MAAA 5AJ3J 4OYMA 3WIUA 4DBQA 2FJVA 1QAYA 3D3BJ 5B7WA 2G4BA 3Q2TC 3IFEA 3G8SA 2PMHA 4FKXA 4W90B 1WG5A 1HHTP 4DR6J 1TL3A 2V5HG 2PMWA 3IN5A 4Z7CA 3PVXA 5J2NA 4O3RA 3DLBA 1KKHA 2LU2A 4NI2A 1LNQA 5HAOA 4B3SF 1CEZA 3MAHA 3W63A 1X8DA 2A18A 3N28A 3QGGA 4ECRA 3TZWA 5A2QY 5L46A 5DDPC 1GXUA 1QM9A 2K3IA 5THWA 5L9XA 1EARA 1C0UA 1BWVA 3JSYA 2KRRA 4ZIWA 4DR5J 4M5LA 2AYGA 1RWKB 2VG7B 1W2BR 2RDJA 2Q43A 5C42B 3HHLA 1Q4RA 1RB0A 1JJ4A 5F0WA 1X9MA 4N76A 1X4FA 1KVJA 1ZM3A 4Q2MA 1NPKA 3DMJB 4WFXA 1PJ7A 4USKA 3OW2R 1EP4A 2VG5B 2K1RA 5B0BA 1KBRA 2HWTA 1MG7A 3A3NB 4F4WA 1Q8LA 3BGRB 1SKWA 3OR2A 5AXKA 3SV4A 1LXJA 3IGNA 1S1TB 1D3WA 1H3DA 2D3UA 2BVZA 2LU1A 4NCGB 2E5HA 3TUJC 1T02A 3HLUA 5KT5A 4DV1J 4DQIA 5BYQA 3AH6A 2C2NA 3HHDA 4ZS6A 3M9OB 3PTWA 3DI6A 1D9AA 4RWXA 2V50A 1M90T 1F2GA 4NRUA 1RT4A 4RW7A 1NM2A 4K4YA 1X7VA 5HMXA 3KLFB 1MN7A 2CQ2A 3C15B 4FXVA 4ZN1A 4ZPAA 3QAEA 1ZS6A 1WF0A 2HHPA 1T8EA 1YRUA 1B7FA 5FDLA 2RRBA 4PG4A 3MURP 1K44A 2DNZA 1M5SA 2IVFB 3OJUA 1OWXA 4LR8A 4PG8A 5J2QB 2Y1RI 3FMBA 4U7UD 3ZNJ1 1TL1A 1RZMA 1SKSA 1ZA1B 2MKHA 2DR9A 4O3SA 4GKJJ 1S1UB 2HS3A 4PEOA 3UCGA 2M4MA 2XMKA 2DD8S 4OMFG 3U27A 2XMJA 4ER8A 2UUAJ 3FDSA 3W5XA 1KONA 5E3AA 3T1HF 2LXUA 4ZPDA 1I3OB 1XNRJ 3DFEA 4DI6A 4M5IA 3HXMA 2X3DA 2XZDB 3CJ0A 2BX6A 5I42A 2W2OP 2F4VF 1HD1A 1NMEB 2DNQA 2YPZA 4K7QA 3KUHA 1LEOA 2COLA 3GR1A 5KG7A 2RHSB 1U0SA 4RU9A 3HT3A 4PKDB 1S97A 4LF9F 1UTAA 2EC0A 2N82B 4C0BA 2B8PA 1CPZA 3CD5A 3CDUA 1F5AA 5IQQA 4XDCA 5IC4B 2PN6A 2EC2A 4QR2A 1VQOS 1S9GA 3R27A 4QQBA 3EGWB 2HIYA 3VAFA 4DR5F 1N6QA 1JWWA 3HSZA 4U9RA 1NK7A 1NRKA 1Q5VA 2C2ZB 3D7SB 1WOOA 1CQMA 3KLFA 1LWEA 5E3RA 2AV5A 4JI2F 3QIPA 3N6LA 3I87A 4FYYB 1PJ6A 4QYZK 3MGJA 3NGRA 1NJYA 2G2ZA 1OMSA 4IQMA 2CPEA 2UXCF 2BE9B 4ANCA 4ED7A 1HBOB 2RQMA 5EWEA 4RUCA 4B3MF 3G8QA 3NEKA 1ELOA 3L4BC 2EEYA 4Q7AA 2AYEA 5KT2A 2YKMB 5IM0A 3MI7X 4OI4A 2KZMA 3FCVA 3UQSA 1JMTA 1X4EA 3LALA 4M5HA 3HO1A 1S10A 4C6AA 4RUHA 5M2UA 3K8WA 4HR2A 3ZZRA 4WWSA 5KFCA 3DLKA 3DRXA 1P9YA 4YEAA 3UN5A 5E3CA 4XO0A 2CWKA 5KG4A 1C0TA 2J9DA 1BMQB 1KWMA 2JC1A 3U1NA 4FKYA 1S7IA 3J7YU 2W2MP 3I32A 2ZH7A 5L1KA 2PEHA 3F44A 1OY6A 3AD9C 3QMQA 4N8NA 1U26A 4C4WA 3C16B 5K8NA 4JUZA 5B0CA 1PYTA 1YIJS 1T03B 1XERA 1T11A 2XHWA 4P74A 4DV7J 1LWEB 2IYIA 4WYLA 2R2SA 2JLFA 4ZLLA 4X4SA 4TNOA 2CJKA 3M1VA 1NDKA 4WCEQ 2DNLA 2UU9J 1U25A 4UF4A 3SSQA 2IMWP 3CUNA 4ECUA 5HROB 3OD2A 2QA4S 3ZTSA 2DGUA 1UFWA 4F2RA 1IKWA 2LFVA 1UWAA 2FLNA 2NXNA 2QMXA 2DPJA 2R7TA 2HFSA 6AT1B 3UCUP 3AX5A 1WKLA 3HSJA 4PXBA 3J80Y 4TY8A 2J6TA 1SQEA 2PEBA 1U4BA 1HQUA 4AE5A 1KQFB 4NLOA 2K1RB 3A4TA 3MM9A 2CJYB 1I94F 2JEGA 3RB0A 2KN4A 4WP8A 3THVA 4PQUB 2NXUA 2QLXA 3C6UA 4LJMA 4JI1J 3GPAA 4QWBA 1DLOA 3ZXWA 4DR4F 4QOTA 4QWAA 3G6XA 3QRQA 3BDEA 1RTHA 2IYGA 5LM7E 4HH1A 1PILA 4DEZA 4LF8F 3J7ZT 2R7UA 2FHJD 1C0UB 4PUOB 1QAJA 3WZ0A 4ECYA 4ECVA 1NSKL
chains in the Genus database with same CATH topology
1AROP 4LIWA 5EX0A 2JEFA 2XCAA 1GXTA 3GG1A 2HHSA 1O0PA 5D78A 3ULHA 3UNGC 2KDOA 5A0YB 5K14B 5BJRA 3QGIA 2B9WA 2I2YA 3NMAA 2G0CA 2OLWA 3ONQA 6FD1A 2A1BA 1FRJA 2E1RA 3OR1B 4YDXA 5A8KA 3ENVA 1RTIA 5D77A 3PRDA 3PR5B 3SDEB 2FVPA 2IM3A 1MU2B 2LVWA 2Q1LA 4ZPVR 1XMOF 5LXRA 5DLGA 1HL6A 1WI6A 2B4VA 1IBMF 2R2RA 1OS5A 2EG2A 5CYQB 2B56A 2WRMA 2CQGA 2PE8A 5KFYA 4K4VA 4LF6F 1HYSB 4LF5F 2XG8A 1URNA 1KHWA 3K8VA 3HJFA 1S1VA 4ZLPA 2EFPA 2XEXA 5HI7A 3G6VA 4X66F 4AQYF 2YWHA 4WK1A 2XS2A 4ID8A 4H4MA 2PA3A 2XGQA 5DG7A 1ZZNA 4H4OB 2NYIA 1YTYA 1FDAA 3T5JA 5D4OA 2MKCA 2RF2A 2VC0A 4J5OA 1KQSR 4J37A 4PWDA 3G86A 1RP5A 3H8YA 3MM8A 3D0IE 3OBIA 4K5RA 2CPZA 3DLEB 4PWUA 4Y2IA 4QCLA 2F1FA 5KFZA 5C5JA 2J9EA 1R27B 2L3MA 2XSFA 3GQCA 3O6QA 4FVMA 4UOCA 5L39A 3IGVA 4IKAA 1JJHA 1H7WA 3SCIE 3CCUS 3OFGA 3DLLQ 2XI2A 2D68A 2N3OA 1J2VA 4QBUA 2R8IA 2RVJA 4G1IA 5G0RA 1NHUA 4B9SA 1N5YB 1NK4A 3SFGA 4DN0A 1SKRA 4Y2KA 3GILA 2M8DB 3MOZA 4JV0A 3I6PA 1LFWA 1N5TA 1C0TB 1KFSA 2C3YA 4QU7A 2FLPA 1HWJA 1MMLA 1VQSA 2APOA 3H5XA 3JSRA 4D3GA 5K8OA 3HHKA 2MSSA 1FEEA 1DTQA 2AJQA 2DT9A 4DR7F 2K8GA 4ED6A 4OI2A 2XY5A 3TP2A 4I2QB 4WU3A 4EZ9A 2BV3A 1BQNA 1QJHA 3H98A 5L9NA 2DNOA 4R25A 4CNZA 1SI9A 3QPIA 4HT7A 2UUWA 4P7VA 3LP2A 1VQ4S 2YX4A 2FJXA 2CPIA 2MJUA 3NS5A 2GO8A 4LF4F 3N4WA 2G9OA 1QUVA 1PO6A 3PNIA 2YKAA 1FKAF 4R8UB 4X4QA 5D3GA 2C22A 1Q8IA 4Y2MA 1LW2A 4K50A 4I2PA 4KAIA 2GQCA 4IG0A 1IBLF 4KKOB 2B0GA 4JV1A 5DGBA 5AE1A 4DR1F 1UP1A 2JJ4D 3E8OA 3EZ5A 2MXYA 3C6UB 1X5PA 2HPUA 1ROFA 1KTQA 3R5AA 4F4YA 5HP1B 1TR0A 4C3LA 2KXHA 1VQ6S 2L08A 2QA2A 2HG4A 1FD2A 3T9ZA 3B4MA 4F02A 2HW3A 1H2VZ 1UFLA 1P1TA 4IOCQ 3D2WA 3QJPA 3MFIA 3FSXA 2HQ3A 2L48A 3IO1A 1IKVA 2DNKA 4K4WA 1TKTB 3OPKA 4QZVB 3CE8A 2MQPA 1S79A 4HLBA 1SUQA 2R8KA 1YBAA 2V2KA 2YX1A 2YKMA 5IM0B 5SZTA 1VI7A 5C42A 2UVVA 1F60B 2IRXA 4LUBA 2ABYA 4RWWA 2VBYA