3OLAA

Poliovirus polymerase elongation complex with 2'-deoxy-ctp
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
molecule keywords Polymerase
total genus 140
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3olaA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3olaA02
2UUTA 4WYLA 3NL0A 4U6PA 5DLFA 1N5YA 1JKHA 1K1SA 4ZVGA 3CVKA 2R2SA 1BQNA 1RT2A 4ECWA 4WXWA 4KV8B 4TYAA 3M8QA 5J2NA 3MR3A 3SFGA 2OPSA 2F8EX 3IGVA 3ISND 3PJWA 4ZP7A 1RTIB 1S10A 2JC0A 1RA6A 1FK9A 5DG9A 3IG1B 3KHLA 3PVXA 1SH2A 1RT5B 5F8LA 1RT6B 4K4VA 1KHVA 1RTJA 4ZVHA 5EUHA 3FSIA 5KT7A 1LWCB 1S6QA 3C6TA 3DI6B 2W9AA 5KFGA 1RT3B 1TKTA 3OHAA 2W7OA 2E9ZA 5K14A 2ZE2B 5C5JA 4TY8B 3MTKA 4KBIA 2C22A 4IR9A 3MR5A 2FJXA 1LWFB 5F8NA 4FS1A 3CO9A 3SFUA 4O3PA 1DTTA 4ZPAA 3KLFA 3G6VA 4PUOA 4NRUA 3TAMA 4QWDA 1U09A 3DRSB 2IM1A 2AGOA 2RF2A 4O44A 3V4IB 1S6PA 3MEGA 4EO8A 1JIHA 2VG5A 3CJ2A 3BSCA 2HWHA 4O3QA 4ED0A 4LSNB 1RTJB 2JEJA 4IQXA 4NCGB 4ED2A 1TKZB 5CYQA 3DI6A 4URGA 1I6JA 3Q8PB 2ILYA 3M8QB 1T05A 4ED6A 3QGGA 1REVB 1RT1A 4X2BA 1S1XA 4LSNA 3IRXA 3IS9A 5I3UB 3OLBA 4DL6A 3GV7B 1VRUB 4IR1A 1RT6A 5KT5A 3GQCA 1IKVB 3DRSA 4QW9A 3V6KA 4QWEA 2W7PA 3V6JA 1S1TB 4IOBA 4ZHRA 4TQSA 3PW7A 2IM0A 1JLEB 4RW9B 1MU2A 5KG4A 1QUVA 1LWEA 5KFMA 4Q43A 1QAJA 4ECXA 5EWEA 3LP2B 1WNEA 4K50A 2IMWP 2ASLA 1SH3A 4RW8B 1JLAB 4RNMA 5KFBA 2WTFA 1DTTB 3KLFB 2V4RA 5L1JA 4EBDA 4ECQA 1LW0B 1TV6B 2HNYA 4DL7A 2ALZA 2JEFA 4NLGA 2ZD1A 3RBDA 3D5MA 3D28A 3BJYA 2HAIA 3MEEA 3QO9B 3HVTB 4TXSA 1OS5A 4DEZA 1N6QB 4Q8FA 2I5JA 4YMEA 1DTQB 4QWAA 1N56A 2XCAA 3H5SA 4MKBA 3PW0A 3CDUA 1T94A 5DQGA 2YNHA 3PR4A 4O3SA 4Y2CA 1TL3A 3I0SB 3E01B 1S1XB 1QE1A 2B5JB 4IG3A 2D3ZA 2XCPA 4K4WA 2WOMA 4O3OA 1S9GA 5KFKA 2YKNB 5DG8A 4GC7A 3DDKA 4NLUA 4ED3A 3V6DA 5KFOA 2FVPA 2R8KA 4F4ZA 2R2RA 3GIIA 1FKOB 4J9PA 4PQUA 3JSMB 4ECTA 2QV6A 3UPFA 3KLIA 2C2RA 2HNDB 2VA2A 4RNFA 3DRPB 1T03B 2OPRA 3H2LA 3DOKB 4NLWA 2AX0A 1GX5A 2OPPB 4K4SA 1C2PA 1JLBA 1RT7A 2FVSA 3N6NA 3Q8QB 2IA6A 2RKIB 2HMIA 3JYTA 4J9QA 2R8JA 3NMAA 1RT3A 3BR9A 4J9SA 3FFIA 5J1EB 3KLGA 4TY9A 4WE1B 3BGRB 4MKAA 3DRPA 1T03A 3M9NB 5C42B 2UVVA 3N6MA 2R2UA 3DOLA 1HNVA 2B43A 2ZD1B 1S6QB 3C6TB 3CJ4A 3DMJA 5HROB 3M9OB 2HWIA 1N48A 3MEDA 5KFNA 3H4DA 3DLKA 2XWYA 2BQ3A 4JV1A 4Q0BA 5F8JA 3GV8B 4H4MA 1QE1B 2B5JA 5KT6A 2R8GA 1N5YB 2IJFA 4ZP6A 1RT4A 2GIQA 3C6UB 3LP1B 5KFUA 3OSPA 4NLRA 2YKNA 5CYQB 4Y3CA 3KMSA 2IC3B 4KV8A 2FLPA 4ZP8A 1D1UA 3IGNA 4Q8EA 1RTIA 3HVAA 2JC1A 1DLOB 1TL1A 1S1VB 1FKPA 3OLAA 3QGIA 4H4OB 3H5XA 1RT1B 5F8IA 4H4MB 1S9GB 4RW6B 2FVQA 1RT2B 3RAXA 4IKAA 4R5PA 3BREA 4G1QA 4HYKA 2WCXA 5KFJA 4IFYA 3KLEA 4F4YA 2BRLA 3MR6A 5J2QA 4KO0B 4DL2A 1RTHB 4RW4A 1EETB 1C0TB 3DRRA 4K4XA 3BSNA 3CIZA 2DPIA 1JLBB 4IH6A 4ECRA 4RUCA 4IFVB 3MF5A 4O4GA 2FJWA 3IN5A 4Q44A 4PQUB 1LWEB 2VG6B 3DLGB 2O5DA 2YKMB 4IH7A 5KFLA 4YR2A 4R8UB 3KJVA 1LW2A 5JXSA 2XI3A 4F4XA 3PW4A 1NHVA 2IM3A 1LWCA 3DYAB 2FLLA 3SI8A 2JEGA 1TVRA 3LAKA 2VG7A 3QIPB 3BQ2A 4XO0A 1S1WB 2JLEA 3KLIB 5KFIA 4Q0BB 1REVA 4RU9A 4J9KA 2B6AB 3PZPA 2UVWA 2IJNA 1TKXB 4R8UA 5DQHA 2IAJB 5EWGA 1S48A 1BQMA 5KT4A 4EEYA 4MK9A 1ZTTA 4IRKA 4ZP9A 3KK3A 4KHRA 5KFXA 1IKWA 1HPZA 2IBKA 4B3OB 1EETA 4PWDB 2VG5B 4MIBA 4LQ9A 1J5OA 3T5JA 4O3RA 2OPRB 1JLAA 1EP4A 2FVCA 3LALA 3M9MB 1RAJA 3KK2B 3ITHA 5KG2A 2EC0A 1RTHA 2ATLA 1S0OA 4O44B 1RA7A 1FKOA 1MU2B 1T3NA 2FLNA 5D3GA 2DPJA 1IKWB 1HPZB 4YR3A 3LAMA 3Q8RB 3G86A 1KHWA 1RT5A 3BGRA 4WFYA 3QLHA 5C24A 3EPGA 1TV6A 4NLOA 2HNYB 3KHHA 3RB4A 5C25A 1W25A 4QW8A 3JYTB 1QAIA 3MFHA 1C1BA 3OL7A 4DG1A 2AWZA 3RB0A 5L9XA 3MR2A 4LSLB 4YQWA 5HLFA 1HYSB 3E51A 5FDLA 3OL8A 1TKXA 1YVFA 5C24B 4NZ0A 1IKVA 3NGDA 4RNHA 2BQRA 1TL3B 3FQLA 2BANA 1ZTWA 3V81B 1VRTA 5KFPA 2WOMB 3DRRB 3CJ0A 4WZQA 5F9LA 4K4YA 3BSAA 5J2MA 4ED8A 1N4LA 2WRMA 1KLMA 4IFVA 2ZKUA 5L1LA 1RT7B 2YNGB 5KG6A 3NBPB 1UWBA 2YNFA 4KB7A 5KFEA 2E9TA 4IFYB 4URSA 3KLEB 2UVUA 1RYRA 4WFXA 1S1TA 3QO9A 2ZE2A 1JLQB 3QYYA 1C1CA 4RZRA 1IKXA 1K1QA 4ECUA 1CSJA 1VRTB 1S6PB 2R8HA 4NYZA 3OHBA 2D41A 1LWFA 1Z4UA 1VRUA 4ED7A 3UDLA 2IAJA 3KK2A 4R5PB 4RW8A 1RDRA 5L1IA 2AQ4A 2HMIB 3H4BA 4NLYA 4O4RA 4GC6A 2CJQA 1HMVB 3LP0A 1TP7A 3LANA 2WHOA 4IG0B 1RTDB 3RB3A 3QGHA 5EWFA 3CWJA 4RW7A 1JLFA 4PWDA 3HVWA 2HNDA 3LP2A 2D7SA 3CJ3A 4YR0A 4NCGA 4TQRA 4FS2A 3KJVB 5KFVA 2QE5A 1DTQA 3CDEA 5C25B 4ZMMA 1HMVA 2GIRA 2W9CA 3H59A 3PW5A 4DG1B 3HHKA 4WZMA 1FK9B 3QZ8A 2VA3A 1S1WA 4QPXA 3I0SA 5KT2A 4F50A 3H5YA 1S9EA 5KG7A 3CDWA 3QLHB 4NLTA 1HNVB 4QWBA 3GIJA 1SH0A 1IKYB 1SV5A 3I0RA 3ISNC 2V4QA 5I42B 5KFFA 3V4IA 2R2TA 1S49A 4ECZA 4B3OA 3BQ0A 4ZPBA 4KHMA 5DG7A 4EO6A 3H98A 2AX1A 2FJVA 2OPPA 2YNFB 2IM2A 4NLSA 5J2PA 5KFSA 1JXLA 3I0RB 3RBEA 1JLQA 4G3IA 3KK3B 5K14B 1S1UB 3IG1A 2HNZA 3EPIA 4JUZA 4RUAA 3KLHA 2WK4A 2D3UA 3FQKA 5KFWA 1HYSA 3KLVA 3E01A 2OH2A 3C6UA 2J6TA 5KG3A 3UQSA 5KFYA 2OPQA 5KFZA 2UVRA 2JEIA 1T05B 1HQEA 2W9CB 3Q8SB 4M94A 1DLOA 3NAIA 1TL1B 2VG6A 3CJ5A 3DLGA 3IS9B 3IRXB 4K4ZA 3MEGB 4I2QA 5CYMB 1XR5A 5KFRA 2B6AA 4RNNA 4QWCA 2XGPA 3T5LA 1JX4A 4PUOB 4NRTA 5F9NA 5HP1A 3RAQA 4TN2A 4O4GB 3KHRA 2ASDA 3DLEB 4I2PB 3LP0B 4WFZA 1IM4A 4IG0A 4O3NA 2RDJA 3MEDB 3MEEB 3TVKA 3KMQA 2R8IA 4TY8A 1N6QA 3RB6A 3GIMA 3MFIA 1J5OB 1S9EB 3G6XA 2AU0A 3PHEA 4FBUA 3UR0A 5HBMB 1KLMB 5JUMA 2ILZA 1IKYA 3DOLB 3ICLA 3ITHB 4G1QB 5KFCA 4XPCA 4JV2A 1TKTB 3GILA 4RW4B 4RW9A 4ICLA 1NHUA 1HNIA 3I5BA 5KFTA 4DL3A 1EP4B 2XGQA 1NNDA 5F8GA 2V0NA 4EBCA 4ID5B 1R0AB 2W8LA 1BQNB 1S0NA 1XR7A 3DM2A 4OL8A 3DLEA 4TLRA 3GV5B 2FVRA 4IH5A 4NLDA 5J2NB 1MMLA 4U7CA 4NLVA 3JSMA 3DLKB 3V6HA 1GX6A 5CYMA 5F8HA 2UUWA 4MK8A 1BQMB 3LP1A 3T1AA 3MECB 4K4TA 3FRZA 3T19A 2RDIA 1C1BB 3QIDA 3TAMB 4YP3A 5I3UA 1JLCA 4Y2AA 2VG7B 3QIPA 4I7FB 4KFBA 1HNIB 5DLGA 3QZ7A 2W8KA 3TQ1A 5J1EA 2WONA 4DL5A 2AGPA 3GYNA 2W9BA 4J9OA 3KLHB 4J9NA 1S9FA 4HKQA 4LQ3A 3N6LA 4IRCA 3M8PB 3PJXA 4URQU 1SUQB 4ECSA 4I2PA 3DMJB 4KAIA 2BQUA 2E9RX 4KO0A 1XR6A 4ZPCA 2BANB 3H5UA 1JLEA 4MFBB 4ZVEA 1C1CB 2XI2A 2YNIB 4Q45A 4IRDA 5FDLB 2YNGA 2J6SA 5F8MA 1RYSA 5KT3A 4H54A 4Y34A 2J6UA 2WONB 4IDKA 4ED1A 4WYWA 1JLFB 5KFQA 1S1VA 4ECYA 5HLFB 2YKMA 2AGQA 4MIAA 1JLGB 3EZUA 2C2EA 4JV0A 2I1RA 4RW6A 1TQLA 2IC3A 3OSNA 4KE5A 5J2PB 1TVRB 2BE2B 2YNHB 1HQEB 3KK1A 5L1KA 5KG1A 2HNZB 3HVTA 4IG3B 1C0TA 1JLGA 1HQUB 4J9LA 3FDSA 1LW0A 1SV5B 4ECVA 4ZPDA 1C0UB 1S4FA 5KG5A 3KHGA 4EBEA 4ICLB 3KK1B 5D3GB 2W9BB 3GIKA 3V81A 1S0MA 3KNAA 3FFIB 3KLGB 1FKPB 4H4OA 3DOKA 2XC9A 4F4WA 3M8PA 5C42A 5DGAA 2ASJA 4J9MA 2WB4A 5HBMA 5EDWA 3MECA 4MFBA 3PR5B 1UWBB 2BE2A 4NLQA 5I42A 5J2QB 4MK7A 4KKOB 2OPSB 1D0EA 1JLCB 4KFBB 3T5HA 4IDKB 3I5CA 4ZVFA 3I5AA 5J2MB 1S97A 3T5KA 3G6YA 4M95A 3BSOA 4NLXA 5DGBA 4R0EA 1RT4B 3VQSA 4DL4A 3DYAA 2C2DA 4FBTA 3DM2B 5KFDA 2BRKA 3HKWA 2BR0A 4EYHB 4K4UA 1S1UA 4MH8A 1ZETA 3H40A 4I2QB 5HROA 2C28A 4RW7B 2CKWA 4LSLA 4WE1A 4XPEA 2I5JB 2YNIA 1TKZA 4ID5A 1R0AA 2OPQB 5DQIA 1LW2B 1JKHB 4RNOA 2RKIA 4KKOA 1RTDA 3BQ1A 3NKYA 4NLPA 2RF2B 5T14A 3OL9A 4I7FA 4TYBA 1IKXB 1HQUA 5KFAA 3PW2A 3OL6A 5HP1B 4KSEB 2GC8A 3NBPA 2V9WA 3V6DB 1SUQA 4ZHRB 4J9RA 1C0UA 3KOAA 3NAHA 4WXOA 5KG0A 5KFHA 4EYIB 1HARA
chains in the Genus database with same CATH superfamily
2UUTA 4P73A 3AJ2A 4X4PA 2E1PA 2ZH8A 2GQ2A 4KPCA 2HAFA 2VQFJ 2H9ZA 1GK8A 4I6YA 3D6FB 4L72B 4X4VA 4TYAA 3IAM9 3M8QA 5SUHA 1RADB 1OYEA 2AYEA 3BS9A 3PJWA 3J7Z5 1S10A 1RTIB 1DURA 3MZIA 4K7QA 4BHQA 3KHLA 5HQLA 1SH2A 1RT5B 1ULRA 2EFOA 3CC4S 3EM1A 4ZS6A 1UZDA 5EUHA 1VC6A 2CJYB 3FSIA 1LWCB 2OEMA 3EDRB 3KJQB 1X5SA 2DK2A 2VC0A 5KFGA 2ZH6A 4ANCA 1J5EF 2W7OA 2CNKB 5H9EK 2ZE2B 3CNQP 4DSEA 4KBIA 3CJRA 2XO7A 3EYZA 1JWWA 2XZWA 5EGYA 1UEKA 1RLCL 3ISZA 3CO9A 3SFUA 1S79A 2MHEA 5G4DA 3KLFA 1VQ8S 4JI6F 1VQLS 2QLBB 2GGPB 1WEZA 4P9SA 3PYDA 3TAMA 2KHCA 3QFWA 3DOMB 3VGSA 4LFCJ 3DRSB 4DWIA 1D09B 1Q82T 2MHNA 2OJ3A 4O44A 3PTWA 4AFFA 1NH7A 1S6PA 3LOUA 4M5NA 2QFIA 1Y9OA 2VG5A 5KAKA 3BSCA 3UCUP 4ZKAA 2DH7A 1P1TA 1RTJB 3MCSA 4OJHA 4NCGB 4A8QA 4ED2A 1TR0A 3HLUA 4M1KA 2VC1A 4URGA 4CLWA 4YS2A 2ILYA 3DHXA 3JSBA 3NS7B 4DN0A 1T05A 1K44A 3QGGA 2VJUA 2EK6A 3BZQA 4B9SA 1REVB 4ETZA 4WIQA 2W2PP 1HBUA 4LSNA 2VOPA 1DBDA 2DGUA 3AQPA 2AZ1A 2RU9A 2LQJA 1IKVB 4PXBA 4IQMA 3EE3A 1YJ7A 3WX8A 4QW9A 3RU0A 3X3UA 1VISA 3M6UA 3ZNUA 2WAQD 4UUXA 1MU2A 1HWLA 5KG4A 4JYAF 2QLFB 4NASA 1QAJA 4ZCIA 5LXYA 1SH3A 5BXIA 3KLFB 2C3YA 5L1JA 5IS2A 1OY8A 1LW0B 1TV6B 2DCLA 5CQGA 5D0HA 2ALZA 2JEFA 3W2VA 1H7XA 3W2WA 5E0OA 1N33J 4DV0J 3D28A 3BJYA 4LFAF 4QBUA 3MEEA 4A8OA 4RR5A 2IY5B 4NL5A 2GCFA 1FRIA 2CIMA 3T1HJ 3K89A 2NUUG 1DTQB 2OD6A 1Q0NA 3TZZA 2YKQA 3I87A 2Z2LA 2XCAA 1IUJA 3M2RB 1SJQA 3THPA 1T94A 3PR4A 1RAGB 3AOCA 5BJRA 4ELTA 4C9DA 1TL3A 4F25A 2PMWA 4P2SA 3A3OB 4IG3A 2XCPA 2B56A 2WOMA 3PFEA 4LJMA 5E3CA 1S12A 3SIPB 4DR7J 1HW9A 4C2MA 4GC7A 3DDKA 2YPZA 4C4WA 2XSFA 1EKRA 1WELA 2CNOB 1B70B 2R2RA 4QYZK 1FKOB 1SC6A 2ASYA 1Y5IB 3TUJC 3U02A 4ECTA 2C2RA 4UW2A 3PO4A 4X4UA 2C42A 4RNFA 4TU7A 5EX3A 2G0IA 4RWXA 4AT1B 1FRXA 1NJYA 3LTOA 2OPPB 2DO0A 2A0FB 2FHJD 1D9FA 3A8KA 3N28A 4LF1A 2RKIB 1NB7A 4YDDB 1SC3B 1CJVB 3M1VA 4JI4J 3TJ8A 2N7YA 4TY9A 2HWTA 3K58A 3BGRB 3HSDA 1IWAA 2MJUA 1B7FA 2KU7A 3AHPA 3M9NB 4QYZJ 2DY1A 2R2UA 4KGZB 1UVNA 5JVGQ 4L73A 1WSVA 2AHOB 2PT0A 7FDRA 4WFNQ 3OJSA 3QJLA 4J9UE 2GO9A 4C8KA 2MKKA 2HS3A 1J2VA 4BC7A 3K5LA 3H4DA 2R7SA 3HHLD 3NGRA 1NDCA 2MKHA 4YFUA 4JV1A 5F8JA 1HBNA 3QT7A 2R8GA 1H73A 3C6UB 4B02A 4LRDA 3MD1A 5I3PA 4Y3CA 2IC3B 2VBXA 4KV8A 3UDVA 1GMUA 3EVOA 3MMCA 4WU2A 1ZPVA 3SEOA 1XNRJ 5IT4A 4LVNP 4DPTA 4F4AA 1WC0A 3OLAA 1S9GB 2B4UA 1H72C 3RAXA 4LIRA 4WP8A 3N4WA 1LXJA 2BRLA 3VR1A 1U1MA 4WK1A 4F3OA 2CA9A 5IZHA 2MQPA 3FEXB 2VQFF 2G4BA 2CQIA 4F67A 4CTAA 5B0GA 4K4XA 3CIZA 2XNRA 1NEEA 2M5YA 1JLBB 2GZOA 1UUJA 3D54A 3EGNA 4IH6A 4AD6A 5BYSA 1WF2A 1RWXB 3MF5A 4IFVB 4JOUA 1T11A 5BYQA 1S77D 3HKZD 3I96A 2RSQA 4GKKJ 2KHDA 3CCSS 4ZVSB 3GB0A 4A46A 1L5UA 4PQUB 1CQNA 1WDTA 1GFWB 3P6YC 4JV5F 4J90A 1MWYA 2DEIA 1YSJA 2O5DA 1WSRA 4A8MP 4R8UB 1G7CB 2V2KA 3HD1A 1MWQA 4DV5J 1QM9A 1WKKA 5A8KA 3PW4A 3MPWA 1X9MA 1N34F 3DYAB 3CT9A 4E98A 4HACB 1FF2A 4XO0A 3DN9A 1S1WB 3QMQA 2JLEA 1WC5A 5B7WA 1KN6A 1REVA 1PILA 2E66A 1H38A 3PCOB 4QJVA 2SXLA 1BUXA 3PZPA 2WVBA 2UVWA 1NK5A 4LF8F 1BQMA 4EEYA 3P5BP 4MK9A 3DLBA 1O6XA 2AIRB 3HHEA 3PYEA 2OFGX 1T9UA 2Y0BB 4KHRA 4LT6A 3WQPA 1XIQA 2FIUA 2MQMA 2F1FA 1N0UA 2VG5B 4MIBA 4P2FA 2XQCA 4DPYA 1QSSA 1KRPA 3T5JA 1K8AT 2OPRB 2CJAA 3JAMY 4O3RA 3NNAA 2W4PA 3L4BC 4PCQA 3KK2B 2ZWPA 3BPDA 2GO8A 1NK8A 1S0OA 2EBGA 4CP5A 5D3GA 4W92B 1X5PA 4DQSA 4YR3A 2MY7A 1MMNA 4OX7A 2A6MA 1HWIA 2KJVA 2AP6A 1RT5A 1OIAA 3QLHA 4JI0J 2HBQB 2AZ3A 4J7CA 5G0RB 1TV6A 3EPGA 4JI3J 1ZH5A 3BPSP 4UOGA 2OTLS 2K2PA 3N79A 1P1LA 4QW8A 1PBUA 1B0TA 4DF8A 1QAIA 1VYAA 3JTPA 3D9BA 4WU3A 4NCBA 2DITA 2NR0A 1RHQB 1RJJA 2MZQA 1U1QA 1KD1T 2Y8WA 2Z4PA 5L9XA 1X0FA 3MR2A 3HSJA 1HBOB 4C8YA 1HYSB 1IBLJ 3AA9A 4PYAA 2BJ7A 4ZA1A 1IKVA 3QRRA 4B9TA 4DUYF 3NGDA 2FQQB 3MOJB 4OMFG 2DCUB 1GMVA 1VJQA 5CYJA 4O0IA 3THVA 4XK8C 2LFVA 4RNHA 2YX1A 3TVYA 2B9YA 4A8KA 3UVJA 4X64J 2HS0A 2G9OA 2DKOB 3K2YA 4LIWA 2BX6A 3BSAA 4JI0F 3LGNA 3C15B 2GAGC 3AB2B 2FUG9 3ILJA 1KLMA 2W2NP 4ED8A 1N4LA 4IFVA 2ZKUA 4R0JA 2XMKA 2YNGB 3KJFB 3NBPB 3ET6A 2J0QD 4JI5J 4KB7A 2GA7A 2J5AA 3C14B 2E9TA 4WP9A 2R7OA 4KRWA 1S1TA 4RZRA 4B9VA 1JLQB 4MTPA 4ECUA 4KH0B 1S6PB 1BWVA 4USWA 2D41A 4CO2A 1Q7LB 1NU4A 1N5TA 3FBCA 4KGXB 2IAJA 4C7QA 3H4BA 4A48A 2HMIB 2YH1A 1IBKJ 2XYGB 3UD4P 5K8MA 1PAUB 4FYXB 2LDIA 4IYQA 3RB3A 1UA0A 5DDOC 4DXLA 1VBZA 5H1SV 3D7SB 4KR0B 4C8ZA 4PWDA 3NY0A 1IBLF 3DNCA 2KVQE 2OO4A 2ZEJA 3FRYA 2D7SA 1MROA 2XMTA 1F3FA 3CJ3A 4GO5X 5BR8F 6FD1A 2V50A 4N56A 1MSWD 4FS2A 3RR8A 3KJVB 3NLCA 4FF3A 1DTQA 2BJ8A 2GX8A 2GS8A 2J7WA 3UDCA 3NCPA 3W9HA 4V19J 2VFTA 3GG0A 2GIRA 1RCOB 3GFHA 3H59A 5ETSA 2KKHA 2PMHA 2FYXA 2J9EA 3HHKA 3L7PA 3WZ0A 2ZJPQ 4C8MA 3QZ8A 3VAGA 1WWHA 5KT2A 4L6V3 2M70A 1S9EA 3OR1B 1V5IB 5KG7A 4HTJA 5CD4H 3Q8VA 3CJTA 3GIJA 4C48A 1SV5A 2RVJA 3W63A 3B6BA 2V4QA 5KFFA 2QSWA 1MWZA 3OQ2A 5GMKa 3HJFA 4KHMA 2DT9A 3J81j 5DG7A 1RWOB 3QRPA 5B0BA 2OPPA 4NEZA 1XN9A 5IWAJ 4FXWA 4NLSA 1AB8A 5LT5A 5J2PA 4OZ5A 3FKBA 2OI2A 2N82B 3JSRA 4P2MA 4DL0C 4RUAA 2WK4A 3VAHA 2I8EA 1HYSA 3MM5A 3E01A 2ALYB 1R6VA 1FFGB 4LBIA 4LRBA 4YOEA 4A4JA 2K8GA 1NBEB 1RXOB 5KFYA 5GADU 1GQEA 1TK0A 2JEIA 4ID8A 4ZJQA 4HEA9 3SCJE 2W9CB 5DO2A 3Q8SB 1PGZA 1FHTA 2UUAJ 1DLOA 3NAIA 3VGUA 2VG6A 3DLGA 2YX4A 5KFRA 4DJBA 4F50A 3T5LA 2KZZA 2B6AA 3ZXWA 5KOXA 3EVMA 2CZ9A 1AXQA 1DQ9A 3MCMA 3G96A 4NRTA 4RUHA 5HP1A 3RAQA 2UXDJ 2K1RB 4PPZA 2VUGA 3UW1A 2ASDA 1YGYA 3FEYB 1VIOA 1FRLA 4I2PB 2JOQA 2ZDPA 3MEDB 3MEEB 3AD7C 5A0YA 4I6WA 4Z2XA 2KRBA 4PG5A 4M5IA 2AU0A 1U25A 2VKRA 4ZPWR 1AT1B 1SJFA 4FBUA 4F3MA 1NSKL 4BCAA 2HKEA 1UFWA 5JUMA 3ICLA 2M8HA 4G1QB 1YJ9S 4HVZA 2AJQA 3W65A 3H25A 2E7WA 2X1GA 4RW4B 1M5HA 4L74A 5KTQA 2EBEA 2OSRA 1MN9A 2X3DA 3I4HX 1LK7A 1RABB 4USIA 5KFTA 4AL7A 4DL3A 1VK8A 2NZ4A 1PIEA 4TLRA 2JHEA 3GV5B 4HACA 1S0VA 2ATCB 4IH5A 5E33A 4PKDB 4DPWA 1MMLA 3MCOA 2ZHBA 4JI7J 3J81U 2QTWA 1FD2A 1SBRA 3SQOP 2V94A 3MM8A 3V6HA 2V8DA 2ZDOA 4C0OC 4ZN3A 3RUBL 1U0SA 3V2UC 2G2OA 3OTOF 3MECB 4K4TA 1UJ5A 5ETTA 2MZ1A 2RDIA 1CLFA 1NDLA 3SSSA 1FEHA 2NPFA 1HNIB 5J1EA 2WONA 1RYRA 1S9FA 2CUYA 2PIIA 4J9OA 1ZZNA 4KT0C 2HRTA 2V6AA 3BDPA 4FXDA 2KO1A 4LQ3A 1QSLA 3O5TB 4DV5F 4WBFA 2QIFA 5D8HB 3BBFA 3DMJB 2BQUA 2XS7A 4A8WA 4ZPCA 1R8AA 3H5UA 3LGMA 2XTJP 3W66A 1C1CB 4P6QA 2RRAA 1U1KA 3CMES 3K5MA 3F41A 2XI2A 4DPUA 1JQGA 2YNIB 2D3O1 5FDLB 1IR1A 1FJGF 3CCLS 2HK3A 4QPTA 4CRJA 3PX0A 2DGQA 4PRFA 3CJKB 1K0VA 2D1CA 2YKMA 3CDAA 2F9DA 1OQ3A 4RUBA 1N54B 2RH3A 4MKVA 2H4YB 3T3FA 4XDDA 3U1LA 2GQQA 3EDQB 3FNNA 2IC3A 1EX8A 2H1YA 1G3OA 2E5GA 2XMJA 2W01A 1X4EA 4Y2MA 4ECYA 1YITS 2BE2B 1R31A 1QUPA 2O3DA 2YNHB 2M4MA 1FWLA 2DYAA 4OHVA 3IBCB 1OSCA 2HNZB 3B8HA 3WHIA 4ZCLA 3HVTA 1D8ZA 1C0TA 3MMJA 2QLJB 3QPIA 1HQUB 1QDUB 3R5GA 3FDSA 3Q23A 4J9LA 3HZEA 2HGLA 4DX6A 1QVFR 4N77A 3VF0B 3HPOA 3HHNB 2FJDB 3Q89A 1URRA 1ZZFA 2YH0A 4ECVA 2YWGA 4FVMA 2KG0A 1C0UB 4JI8F 5KG5A 3IRWP 3KUHA 4EBEA 3ETOA 2QFJA 2MEWA 1NK6A 3GIKA 1U2CA 2M0GB 1TAUA 3P8BB 2NYIA 4JI6J 2XC9A 4ED5A 1SQEA 3KWMA 4K0KJ 5C42A 4TNOA 2EWHA 2HS4A 2ADCA 2J0WA 2BE2A 1LQ9A 2J9CA 1L3KA 4QIWD 2HBZB 1OO0B 1ZOTA 4MK7A 1WOOA 2ZM6F 2OPSB 4DUYJ 4WCEQ 1JLCB 4KFBB 4RJVA 1XBWA 2BOPA 2J9DE 3LPYA 3I5AA 3PM9A 2CPEA 2KN4A 2FPHX 2IRXA 4FDFA 4DS5A 4M95A 1T9XA 5DGBA 2RU3A 3O3LA 3TWZA 3SV4A 4DL4A 3FBFA 4OYBA 3DM2B 4USHA 4G6VB 5DM6Q 4NA3A 3EX7B 4EYHB 4CLZA 1X31C 4MH8A 1R3NA 3R5AA 2C28A 1YRTA 4RW7B 3CF5Q 3D66A 3DLHA 2DNNA 1F9EB 5L38A 2YNIA 2QMWA 2A10A 4OZNA 3R3TA 2OPQB 3BO4A 2YX7A 1WHYA 1JKHB 3DXBA 4RNOA 4K0KF 2CQ0A 2DR8A 2H51B 1WUUA 2L08A 1FX2A 1KTQA 4I7FA 1IKXB 1X4CA 2VPXB 4J9VA 1F6TA 4CI0B 4CWBA 5HP1B 5U47A 1AZSB 1FRKA 5HMYA 2GVDA 2YVSA 4M5DA 3RBXA 1R8PA 2ZWOA 2E1AA 2LMIA 1RWMB 3V6DB 2AJ2A 2V9WA 3ZZOA 1CVJA 3UDEA 3NAHA 4NMXA 3U7JA 1TK8A 3IWXA 5D0GA 3VAIA 1PCAA 3EGZA 3CB4A 1SQFA 1YBUA 4OHYA 2ZFHA 2ACMA 2RIJA 5LM7E 1X4BA 2ZH9A 5DLFA 1N5YA 2OAUA 1T9TA 1BQNA 1RT2A 1RBAA 2A2CA 3CVKA 4WXWA 1BMQB 3RRHA 3SCIE 5J1PA 5GAHU 1Q7YT 1DZ5A 4A8XA 1JMTA 3MR3A 4DUZF 3IGVA 2F8EX 3CC7S 3C46A 2R7TA 3TOQA 1CJUA 4FP9A 5ETQA 2HFSA 4DV1J 5DG9A 2ZH4A 3AFGA 1KR4A 1WI6A 2HGNA 2Y1RI 5F8LA 1RT6B 4K4VA 1KHVA 1RTJA 2BYCA 5HVFA 4ZVHA 1ZS6A 2EKYA 3C6TA 3BH7B 2W9AA 1WC1A 4OX9F 2H54B 1N5SA 2E9ZA 5K14A 4P74A 4TY8B 2AMCB 2HQDA 2DNPA 4C97A 2W4DA 4IR9A 1NK0A 3VQTA 4FS1A 5F8NA 2FHOB 4H4KC 4Q7AA 5E41A 1Q8KA 4NRUA 3BF4A 3I6PA 3U1MA 2F4VJ 4LR7A 1CJKA 1KWMA 4P7TA 4X66J 2IM1A 5M2RA 4P7VA 4EO8A 3MEGA 4O0NA 4X4SA 2KT5A 4O3QA 1WHVA 1HNZJ 4TVAB 4IQXA 1TUWA 2VFSA 4S0MA 3WIVA 3GZ7A 1SL0A 3I31A 4R25A 3G8TA 2OTJS 1Q95G 2I9SA 2V8VA 5HO4A 2BMBA 3R7NB 1I6JA 3Q8PB 1V6HA 2X1FA 1SQGA 3A1YG 3M8QB 2EFNA 3TVZA 2QZ8A 3DGVA 3ENVA 1SC4B 2HQCA 4LRAA 2DIVA 1S1XA 1SPBP 2PFDA 4HH1A 1RT6A 4KPYA 1O51A 4L76A 5KT5A 3GQCA 5HATA 4HHHA 1N52B 1RE1B 3BBBA 2W7PA 3V6JA 4DR6J 1S1TB 4IOBA 4TQSA 3TYTA 2IM0A 1H2VZ 1XQIA 4RW9B 5THWA 2ERRA 4UY8T 4DV3J 1GMWD 1Q53A 2B7CB 2C2KB 2F7VA 2NLWA 3BN7A 3FSXA 4RW8B 4RNMA 4BBYA 5IV4A 1DTTB 5KFBA 2V4RA 1NRKA 2PA3A 5F41A 2HNYA 4ENOA 4DL7A 2V68A 2ZD1A 3F73A 3P4UB 2CDQA 3GTYX 5D78A 2HAIA 3QO9B 3HVTB 3MCNA 3OR2A 4KHPF 2XYPB 3FBBA 3NGSA 5IC6B 4B9UA 1I3OB 1S7HA 2XZTB 4HH0A 3FK4A 2D9OA 1NCLA 4OZ3A 1HBOA 4Y2IA 2JVOA 4YMEA 2ZH3A 2OSQA 4QWAA 3OW2R 1QVGR 1TFWA 1D3WA 4L75A 1BWEA 2VZ9A 3P45B 5KOWA 3PW0A 3CDUA 1RQ0A 5DQGA 2YNHA 2BKNA 2LXIA 2E5LJ 2V67A 4NXMJ 1B7YB 1KP6A 2CPXA 4RO0A 3K17A 2QA4S 3J81Y 1MROB 2QYGA 1S9GA 2FHJA 3TJAA 4D3GA 2DVIA 4NLUA 1LFPA 5KFOA 4GVLA 3BYRA 2Z57B 1CS4B 4OJ3A 4P52A 2FVPA 3GIIA 4LF5F 1N32J 1SCJB 1WKLA 2P8IA 3CO0P 4HI2A 4J9PA 2OIHA 1U6BA 2QV6A 3NOGA 5E3QA 2ZC4A 3BB5A 1JB0C 4A47A 2OPRA 4FF1A 3DOKB 1GNKA 4B3MF 5ETMA 1GX5A 5FIIA 4K4SA 1C2PA 2RHQB 3N6NA 3KUEA 1XMBA 3EJMA 2HMIA 3EGVA 1H98A 1XWLA 3IP0A 3M32A 3W9IA 3NMAA 5HAOA 2V8HA 3BR9A 3CCZA 1H2TZ 2U1AA 3MGJA 2PDAA 5J1EB 4WE1B 2V8GA 4J9SA 1T03A 1U4BA 3V4IB 3QJJA 2N3LA 2AKWB 3W5YA 3AD8C 1B0VA 3RG6A 2GHWA 1HNVA 3DOLA 5HANA 4B9LA 4DQIA 1B4SA 1UVIA 2ZD1B 1S6QB 3CJ4A 2NSCA 3N0VA 3PYFA 4DSIA 2HWIA 2HHUA 3PX6A 1SKWA 4LRCA 4DSKA 2XWYA 4PG7A 2BQ3A 5CXTA 2R7VA 4DFMA 2MTLA 3GV8B 4H4MA 1QE1B 2HLTA 2HQFA 2Y8YA 2KFNA 1Y11A 5LJ3Y 1N5YB 4ZP6A 1SC1B 4ALZA 2GIQA 4WKYA 4RBVA 1N32F 4NLRA 1EB0A 2GHVC 2QSFA 2YKNA 4DZDA 5HN0A 5HMZA 2FLPA 2EFQA 2NXJA 3Q22A 1D1UA 4DCOB 2EK1A 5F3TA 3MXHP 3I9ZA 4WIIA 2W7AA 1EQ0A 1S1VB 1FKPA 4U8YA 1WOSA 5F3ZA 3H5XA 5F8IA 3Q0AA 3JTOA 4IKAA 3AX2A 3UCZP 3QBCA 4G1QA 3KLEA 1TUGB 3BM7A 4M5JA 5GAHI 1RZMA 3UI3A 3MR6A 4DL2A 1OY6A 2CQ1A 1WG1A 4RW4A 2ZH5A 4F26A 1T0TV 2CJKA 3W5ZA 1T95A 2HRUA 3CMAS 2MKSA 4OHZA 3DRRA 3ZZYA 4E8UA 2C2OB 4ECRA 3T1YF 3ZTRA 1IWGA 3IN5A 1JJCB 4FKXA 1PC4A 4EK2A 5RUBA 1U6FA 2HEKA 2KZMA 2OMOA 1LWEB 1H74A 4OJ1A 2VG6B 3DLGB 2RUGA 3BR8A 3G87A 4IH7A 5D77A 4P2XA 4EZ6A 4KY3A 4JYAJ 2CAJA 1T9YA 1NSQA 5C2CA 4DQPA 3PXGa 5HK4A 1M5PC 4GO7X 2IM3A 2KFYA 2HVEA 4EUVA 3VV2B 3LAKA 5HQMA 4X4QA 3BGOP 4CLFA 3Q83A 3OJUA 3BQ2A 3MM6A 5KFIA 4BC9A 1FTRA 3R7SB 4ZCKA 1SKRA 4RU9A 3RBZA 5DQHA 4R8UA 5EWGA 4N7TA 3LW5C 1NKCA 2FHKA 4B3RF 2VIHA 4IRKA 5E3RA 2FZKB 4IO9Q 4ZP9A 2ZOFA 4X62J 3M8WA 5AXKA 2AW0A 1RWWB 5KFXA 2IBKA 2BZ2A 3GMGA 1U1NA 1EETA 1RKIA 4ZN1A 2H5JB 1Q78A 2MSTA 2NPIA 2IPOB 2Y3YA 3D0HE 3VVTA 5LSOA 3OUYA 3T1YJ 1AUDA 1JLAA 2FVCA 5D4PA 1REGX 1YZ7A 2E1MC 1JJ2R 1KS2A 3ITHA 3ULHA 2EC0A 2ATLA 4O44B 1FKOA 3D6HB 5EX0A 1F5AA 1HPZB 4Y2KA 1FEEA 3SBMA 3LAMA 4CTAB 5B08A 2H5EA 1ZAXA 4I56A 2VOOA 2GJ2A 3MMBA 4WFYA 3N9UC 3S7RA 5C24A 1G4CA 4C8OA 3KHHA 3AX5A 3F56A 1NHKL 1NXIA 2Q6BA 1RHMB 1Q81T 4QU7A 1F0XA 1YRXA 3GJQB 4KYZA 4F04B 5HMWA 3JYTB 3TEHB 4DR5F 3CD6S 1C1BA 3OL7A 2MY8A 1U45A 1LOUA 2AWZA 1F60B 5DDRC 1KC8T 3THTA 1YDLA 2ZJRQ 4K2XA 4RX6A 4OZ1A 3FCHA 3DXSX 5FDLA 1HBNB 1LK5A 1WTFA 1YVFA 5C24B 2LDYA 2P9EA 4NE9C 1KONA 2BV3A 5ADZA 2YWFA 4ANEA 4CM0A 2V2ZA 1OM2A 2BQRA 1O5JA 3M6WA 5D0EA 2WW8A 1ZTWA 2JFDA 5T7LB 5KFPA 5FJ4A 1NSAA 3OR2B 2L41A 1NPPA 5CHCB 2XTEA 4K4YA 1FFSB 2NS1B 4KH1B 4CLPA 4Z7CA 4CZCA 5L1LA 2MXYA 4LFBF 1M1GA 1RT7B 5KG6A 2C2MB 4JI1F 1ZA1B 1RHRB 3M05A 2XLIA 4IFYB 2C2NA 3C16A 4HLBA 4AXIA 3TZXA 3HT3A 3QO9A 1S5ZA 2K7JA 2VBZA 1TL4A 2QC3A 4NYZA 4DV7F 4JV5J 2HHVA 2L9DA 1LWFA 2CPYA 3RJMB 3W60A 2R9LA 2UUCJ 4DDFA 3GG1A 2OEKA 4RW8A 5HVGA 2V2VA 1KVJA 2H48B 3UD5A 2QA2A 4NLYA 4X64F 4CDIA 3LP0A 3BGUA 3POTB 1TP7A 4IG0B 2FDNA 3BH6B 2DNYA 2DEJA 4DSFA 3CWJA 5HJXA 3O8WA 4I69A 4WFAQ 5A6PA 2KFZA 3LP2A 3EICA 4NZ7A 1PYOB 1PSDA 1VI7A 3EXYA 4NCGA 4E2FB 4TQRA 1FVSA 1EHWA 3RGIA 4DV3F 2MLXA 3CDEA 3DRYA 3RRGA 3JSYA 4DV6J 2FC9A 3J7ZT 1HMVA 1IBCB 1DY3A 2NCKL 4OI6A 1LNQA 1FNOA 2HHHF 4WZMA 1FK9B 1TMJA 4PWUA 5B0CA 1S72S 2KJWA 1NSPA 4DU7A 4OYXA 1HI8A 3NS6A 1EJ7L 2KG1A 3HK2A 3QLHB 2FJEB 3QAUA 1R7IA 1UEVA 1K0TA 1SH0A 2KM8B 2KT3A 3ISNC 2CQ2A 4X65J 2LLZA 4LFAJ 4DCPB 1Q5VA 2I0XA 1QAXA 3MMBB 4WJBA 3BQ0A 2IIHA 2B8PA 3N5BA 3NCQA 2ZBQA 2FJVA 4UY85 2QLWA 4DV6F 2YQ0A 4ES2A 1JXLA 3I0RB 4G3IA 1JLQA 2VU5A 4M5GA 4GKJF 2V1SA 5K14B 4CO1A 2AJ4A 3TP2A 1X7VA 3CXCR 3EPIA 4JUZA 4A8SA 3DLJA 2D3UA 5KFWA 1TK5A 1CEZA 1PJ5A 4I67A 1XNQF 1FTCA 4RLEA 3IO1A 2AF6A 2J6TA 5KG3A 2OH2A 4JI7F 1HNWJ 1F5CA 1V5VA 4L3KA 1FXRA 3D68A 2K06A 1Q5YA 1T05B 4GKKF 1HQEA 1H0HB 5K8OA 5LXRA 3UVJB 1XMOJ 3K5NA 1ZM2A 1TL1B 1X60A 2PE8A 4OI2A 4IUFA 3Q8QB 4OL8A 3EVWA 3O6QA 3IR7B 4ZLJA 1OSDA 3GYXB 2XGPA 4BWMA 3KYLA 5A8KB 4DR3J 1W26A 2C1EB 3LF0A 1U6ZA 3TZYA 4FZVA 1XMOF 1UVLA 1NPRA 3LWMA 1WC6A 3TVKA 2R8IA 3OTEA 4YB1P 3EXCX 2J7UA 1J5OB 2G1HA 1S9EB 3OR1A 3I32A 3PHEA 5K9FA 1DRZA 1HR0J 3NGTA 3H42A 4EMDA 3VGTA 4ZLNA 3H7HB 4XPCA 3CUNA 2CVEA 3S1TA 4JV2A 2R42A 4ANDA 3MURP 3K57A 2P6SA 3W8PA 2QMXA 1R0AA 1VC0A 1Y5LB 1AUSL 2H5IB 1NHUA 3SCKE 4OX9J 1UP1A 4OI1A 3I5BA 2ZH7A 1DJ0A 4WTYA 2XGQA 1S76D 3CCVS 5AT1B 4DV0F 4ER8A 4OYZA 4QYRA 2WSEC 1XR7A 3DM2A 2Z0GA 5B0FA 2W8LA 1S0NA 2KT2A 2ZM6J 3BO3A 4NLDA 4OYIA 1E6VB 3D1QA 4MIWA 1N0VC 3NXZA 2L9NA 3OT9A 3M8ZA 4BLGA 3JSMA 2RS2A 1DQAA 1KFSA 1YHQS 2NXCA 5F8HA 2UUWA 4LR9A 1BQMB 4MYTA 4MK8A 3PNIA 4NX9A 3T1AA 3AWRA 3KG4A 2VPYB 3KG1A 3FRZA 3V4MA 2HHSA 3T19A 1TZ0A 4X4NA 2DR9A 4N41A 4FVCA 4KGVB 1JLCA 4KFBA 3QZ7A 5DLGA 3WC0A 2W8KA 5LMNF 4J9MA 1D9DA 1HD1A 3MPYA 2MJNA 2GJFA 2W24A 2F3JA 2VPZB 1H6KX 2UUBJ 4HKQA 4WK3A 3FVYA 2IRUA 1YWXA 1SJ1A 2KXNB 2YKPA 4IRCA 1SUQB 4JI4F 2RT3A 4HR2A 4ECSA 2BOAA 2B0GA 3EGWB 3M7VA 1DARA 4KO0A 4MFBB 1NDKA 3D3BJ 3G8SA 1KQGB 1UPPA 4J5OA 2BEFA 1U0HA 2KYXA 2WB1D 4LFBJ 1S99A 4NMLA 1Y3JA 4ZIWA 1L3VA 2E5HA 4IRDA 4F4KA 5M2UA 3L3CA 4KC5A 2DHSA 4ZLLA 3WDOA 4C0BA 2ZC3A 4HT7A 2XB2D 5F8MA 3D3CJ 1X4HA 4H54A 5D4OA 2VONA 2QJ3A 4NYPA 4IDKA 1SB6A 1JLFB 4DR1F 5KFQA 2HVDA 3DGPA 2Z2ZA 2UV8G 1OJ4A 4OYPA 1JLGB 3EZUA 4ZOSA 8RUCA 1ELOA 4JV0A 2G2YA 3NGUA 2VL1A 2WVDA 3E3XA 2FLOA 3HHLC 1RWVB 1WHXA 5D4NA 4NCAA 1HHSA 1G1XA 2DHGA 1TVRB 2IDLA 1NK9A 4DS4A 1WDDA 2DISA 4LFCF 1AROP 2JWNA 5LL6d 2DNQA 2IDEA 3KK1A 2GMHA 1V9OA 1JLGA 3W62A 5L39A 3UN5A 2V63A 2VD3A 5CCLA 1LW0A 2RJZA 2J0SD 2ZBCA 2XHCA 5DDPC 2ZBPA 1U49A 1NK7A 1W7WA 3QFHA 3KFWX 3PRDA 2HRYA 4ICLB 4KIAA 4ES3A 1S0MA 3KNAA 1GEHA 3DU5A 1FKPB 2LXFA 3FFIB 2FGOA 3KLGB 4OI0A 2RRBA 1QLNA 1AFJA 2R7WA 4U95A 3OFFA 9ATCB 1FJCA 2ASJA 4U7UD 4I64A 4JI2J 5HBMA 1ZAVA 3MECA 2V1TA 4MFBA 3ET6B 4P72A 5E5NA 1M1KT 4U8VA 5L8RC 5J2QB 2LQ5A 4CLKA 2DTJA 1RSCA 2K3IA 1XJWB 1Q4RA 3M2VA 3MPVA 2XEXA 4KKOB 3FMBA 1D0EA 1HI1A 5EN1A 1TELA 3I5CA 3H2VE 1UVKA 1C4AA 1X4FA 2AJFE 3MPUB 4CCHA 5ITHA 3LWLA 4NLXA 3SYZA 4F7VA 1RT4B 2MGZA 2BABA 3D2WA 3B78A 4FBTA 5DDQC 2XLJA 2BRKA 4K59A 1FA0A 4CNYA 4DSLA 4KQZA 1WEYA 1ZETA 4I2QB 5HROA 2C2ZB 2GFFA 4WE1A 2I5JB 4TLQA 1AZSA 4GKJJ 3NS5A 3JQMA 3G82B 1ZBTA 2GGPA 4CH1A 1EIYB 2WVFA 5IQQA 2NXEA 2LEBA 3CJQA 2XSJA 6AT1B 3BQ1A 1UA1A 1IR0A 3TANA 1T3OA 2WW4A 4NLPA 1RTDA 1PG5B 2CVIA 2CPFA 3CJ8A 4KGMA 5A0YB 3PW2A 2HVZA 2Z30B 3OL6A 4PWWA 1ZAWA 4KSEB 3A13A 4OZJA 3D6MB 2MDAA 2OHDA 3GSIA 1ACMB 1P9YA 4OIXA 2UUAF 4ZHRB 4J9RA 4ZITA 3VZHA 5A8WA 3KOAA 5KFHA 4WXOA 2M52A 2ZNZA 3MMAA 4RKUC 4DLGA 3M8YA 3EZ5A 1HR0F 2PFFB 4WYLA 1RAEB 4U6PA 1ICEB 1FRMA 3MM7A 4GRSA 5J1NA 1VLOA 1YKWA 2R2SA 1NJXA 1M1HA 2VKZG 3NWGA 3E8OA 4OX8A 1C4CA 3SFGA 2OPSA 3ISND 2JDJA 3MAAA 3CCUS 3QGPA 2UU9F 1MW7A 1RA6A 2B51A 2JC0A 3TRGA 1S57A 1YJVA 2MGZB 1RBOB 1RU2A 1S6QA 1UFLA 3DI6B 4F4WA 1TKTA 4CLLA 3CCTA 3OHAA 5H9FK 1VQ7S 1P6TA 4LF6J 3MTKA 4DI6A 3M2VB 4M8LA 2C22A 1VQ6S 2F8HA 2H65B 3TA2A 1LWFB 4OZ2A 3MR5A 2HG4A 2OKQA 3L7OA 4PUOA 4ZPAA 2OFHX 1VHFA 4C11B 3OVAA 4QWDA 4ERDA 3HSZA 2FB0A 3CSKA 4F0HA 2AGOA 4F0MA 1B3TA 1HQ2A 2Y9HA 3CJ2A 4ED0A 2HWHA 4U9RA 2AEFA 2CPDA 2VFRA 4QIEA 2Z2YB 3ZFVA 4ZLPA 2JEJA 3CTRA 5DM7Q 1IJFB 3BGFA 2M8DB 5JJBA 1NJWA 4PABA 4LF4F 2E44A 2KYZA 2NSBA 2W1BA 3A8EA 5GVQA 1R6YA 2HVIA 3ETMA 5E3PA 1LWXA 1IQZA 1PJ7A 2Q3PA 3CJKA 4F0KA 1X8DA 3HFZB 3QSIA 5HL7Q 4X2BA 1RLDA 4LF9J 4F02A 3R2CJ 2BKPA 2XS5A 2ZH1A 3R1LA 4QZVB 3GV7B 1VRUB 1WC4A 3PY8A 2X3GA 3RW6A 1Y3KA 2RDDA 2GJIA 7FD1A 3V6KA 3AH6A 3PW7A 1W2IA 2YWKA 3ENWA 2ADBA 4HHUA 5KFMA 4X4TA 2BXJA 5EWEA 4OYMA 4ZVPB 2CRLA 3LP2B 4FKYA 2D9PA 2IMWP 2ASLA 1U1OA 1JLAB 1WF0A 2CQPA 4EBDA 4PUOB 2CWXA 4NLGA 1EZZB 4M5HA 1VHIA 3W8GA 3D5MA 4YY3F 3HX9A 2JLGA 2CPIA 2ZZMA 1GH8A 2OELA 3K0JA 1N6QB 2HPUA 4DEZA 4TXSA 1OS5A 3ZC4A 5CD4A 3G71S 2JL9A 5GAEI 1R89A 4FYVB 3AXKA 5E3AA 2HZVA 1T8EA 3H2UB 3Q8YA 3PYGA 4OZLA 1MG7A 3GJRB 3PEJA 5HVHA 1N56A 2D3OR 2PI4A 1A9NB 2E1RA 2BKOA 2GQCA 3HHDA 4O3SA 4AYBD 2UZAA 2DGWA 2DXDA 2BJDA 2G2ZA 1S1XB 1CG2A 2B5JB 2XMUA 3OD2A 2D3ZA 4K4WA 1O8BA 4O3OA 2I38A 2RRNA 3OTBA 2AYBA 5KFKA 1RACB 3MM7B 3A8JA 1NH8A 2XMWA 3V6DA 2R8KA 2APOA 2DRDA 3FCWA 3KDOA 4DX5A 2QL9B 4NPOA 3ZO7A 3ZZTA 1RTZA 2R7UA 2VQEF 3JSMB 3UPFA 3EMTA 3KLIA 1LFWA 2HNDB 2IRYA 4OQJA 2XZDB 5DJBA 1HIYA 3DRPB 2DJWA 2VA2A 2DXEA 4NLWA 2AX0A 2B4PA 5G0RA 4TKTA 3A4TA 1SJRA 2HQ3A 3FUYA 4ZVQB 3M2RA 1CJKB 2FVSA 4EU0A 4YY3J 3JYTA 3Q24A 2R8JA 3CCRS 3W61A 6FDRA 4TU8A 1VBKA 2V4JA 1NM2A 2X7IA 4FNIA 5ETRA 1VQ9S 1NDPA 2KB2A 4MKAA 4QIVA 3DRPA 1P9QC 2RUSA 2DR5A 2V9KA 1FDDA 5LSLA 4OI3A 1FRJA 2E5JA 2B43A 3W2VB 3C6TB 2R7RA 3DMJA 4CLTA 2DXFA 2YQ1A 3M6XA 5GAGI 1XEZA 3UNYA 1FVQA 3FSYA 1N34J 5KFNA 5BYRA 2MQLA 3MEKA 2B5JA 1VBXA 3IWNC 1Q8IA 3ZTPA 2DR7A 1RT4A 2MZJA 2HGMA 2FY8A 3LP1B 4C8LA 1Q86T 3OSPA 1KFDA 1U8SA 2JH3A 5CYQB 3HM9A 5AXLA 5IT0A 3AB4B 4ZP8A 2PSZA 2D74B 2GMLA 3IGNA 4M5KA 5M2PA 4NXNF 4Q8EA 3HVAA 2R4FA 2JC1A 1TL1A 2RQCA 4OJGA 2QN6B 3JS9A 3QGIA 2AJ0A 5LMUJ 2DHHA 4H4MB 3M8SA 4BS2A 1HBMA 1RT2B 5A6WA 4IOCQ 4R5PA 3BREA 1X5TA 2C3MA 2WCXA 3PACA 1VQNS 4IFYA 4F4YA 3TR5A 3L9ZA 3HMJG 5J2QA 3SQGA 3AODA 1RTHB 3P3DA 3SV3A 3M32B 2HQGA 4PXEA 4ETXA 1SIZA 4P75A 2PD1A 1U1LA 1C0TB 2AT1B 1IBMJ 3BSNA 1EAYC 5GAGU 4V1Ak 2EG1A 4YDXA 3DCAA 2QA4G 3R5JB 1CC8A 1FRHA 2IFXA 3L7UA 4K2JA 3HF5A 5ETNA 2KRRA 4YN3B 2FJWA 3UFCX 1XNRF 4Q44A 2JZ5A 4OLPA 4MMOA 4ILLA 1K9MT 1S4EA 2VB6A 1VS3A 1OPZA 2YKMB 3DKDA 2NREA 3QT5A 5CAAA 2Y1JA 3BGLA 3LO3A 3KJVA 1TU0B 3GYGA 5JXSA 2XI3A 1R0CB 4F4XA 2MYFA 1NHVA 1NB2A 1LWCA 5D15A 4MJKA 3GCWP 2FLLA 1TVRA 2JEGA 2VG7A 3QIPB 2ZITA 3GJTB 1WEXA 2YBVA 2MQNA 3KLIB 3M8RA 3HVRA 4DR5J 5F9LA 4J9KA 4NXMF 2B6AB 3R2DJ 2K3KA 2HQIA 1TKXB 4ED4A 2IAJB 2DIUA 1S48A 1Y7PA 3FJ2A 5KT4A 1ZTTA 1RWNB 2ZUAA 4OYOA 4CM2A 2DNHA 1I51B 1NZAA 2CG8A 3T6BA 2OLWA 2HHQA 1TAQA 1JJHA 3KK3A 1VDHA 1HHQA 1IKWA 1TKDA 3QJPA 2XM3A 1W2BR 4JBCA 2DH8A 4QU6A 4WF9Q 1NZ8A 4AQYJ 4B3SJ 4LQ9A 3TA1A 4DPXA 2JRSA 1FERA 3GR1A 3GWCA 1EP4A 4AUKA 3LALA 3IC1A 4NA1A 3M9MB 1YTYA 2HBYB 5KG2A 4ZJOA 2QLXA 5A76A 1U1PA 3US5A 1SL1A 1T3NA 4YHHF 2CFXA 1KQSR 4USKA 2VASA 2DPJA 2FLNA 1IKWB 2AD9A 2MKYA 4PG6A 1KHWA 3O2IA 1FD8A 3D67A 2PO4A 3KG0A 3GFYA 4I0WA 1WI8A 1Q8BA 3IBWA 1RAOA 5C25A 3CCWA 2HFZA 3RB0A 3TW0A 2CQCA 1X4DA 3PFOA 4EGLA 1HW8A 1DQ8A 4C0HA 1JXEA 1HFEL 1FWKA 1PBAA 4LSLB 4QR2A 1VJWA 2CJBA 3E51A 3OL8A 1TKXA 1U47A 1KBRA 2BJEA 2CNNB 1IN0A 1N88A 3M30A 4QQBA 1TL3B 3FQLA 2J0XA 3T41A 3FZ2A 5ETKA 2AEMA 3V81B 1U2RA 1R43A 1SL2A 2QX0A 3F44A 3TZWA 3OVSA 2MZSA 1RU1A 3DRRB 3TEGA 3DDNA 1WHWA 1XC9A 4QIGA 1BHNA 1FESA 3HZGA 2RB7A 4HI1A 2O1PA 2YNFA 3ZTOA 2OGUA 1YLXA 5CCMA 4URSA 2DGXA 5KFEA 4HDGA 4YHHJ 3KLEB 4WFXA 2UVUA 2QRRA 2VFVA 1IJEB 1C1CA 2LEAA 1K1QA 2HSEB 5A8RA 3T9ZA 1CSJA 1VRTB 3T1HF 1S6OA 3OHBA 2ZHOA 2B3TB 3ILLA 1U7LA 4ED7A 1I1GA 1V3ZA 2M7SA 3UDLA 2AQ4A 3J80U 4R5PB 1NPKA 1RDRA 1RB0A 2MLZA 4C11A 3B82A 3CW2C 4YUDA 5L1IA 1YBAA 3LUYA 2Y1IA 4LF2A 4GC6A 2CJQA 1JXVA 1AYEA 5AE2A 1UVJA 2WHOA 2DHXA 4DLEA 2HK2A 3QGHA 4P71A 3LGHA 1URNA 1R27B 2CNLB 2L48A 3HVWA 3HP6A 5C7PA 2LQ9A 3HHLA 2N3OA 2R7XA 3K5OA 1SJ4P 4DUZJ 1WF1A 5KFVA 2QE5A 5K8PA 1FJEB 2X1AA 2R7QA 3PW5A 1XK8A 1X9WA 3HI9A 4LRFA 3O1LA 4DG1B 1RHUB 2EPIA 1NJZA 4CNZA 3MWBA 4CLYA 2QEXS 4U96A 4DPOA 2Y1LB 3QT6A 5B0AA 3I0SA 3HULA 4CO0A 2VFUA 3H5YA 2PMZD 2DR6A 4FNHA 1YJRA 2DY9A 2IMOA 4OI4A 4XIUA 4ES1A 1UTAA 2QL7B 3TARA 2XTCA 1VFJA 2IA0A 3I0RA 3TI0A 1CULA 3L95X 3MAHA 5I42B 2O67A 1FWPA 4XDCA 4Q5VA 2FZCB 2O01C 3V4IA 4LR8A 1S49A 4OV1A 2F63A 1YRUA 2N4DA 2UUBF 4B3OA 1YBTA 4UQTA 1D8YA 4EO6A 2QG9B 1BE4A 3NOCA 3H98A 7AT1B 3MR7A 5I3QA 2AX1A 4RPFA 1VQ4S 2YNFB 4NEYA 1NKEA 2E7XA 2WVEA 3EWGA 5D4LA 2XTDA 5KFSA 5CABA 2GHPA 3MMCB 1R8CA 2BM1A 2XULA 3OXLA 4Y0FA 4USVA 3PO5A 3KLHA 3FQKA 1F3VA 1FNMA 3KLVA 3NRBA 4X84A 1IR2A 3C6UA 4WP3A 3CPWR 5H9EJ 4F8RA 3R27A 3CMQA 1RP5A 2UVRA 3UN3A 1IQTA 4RBTA 2J7KA 3AXMA 3E2EA 2ROGA 3K7RA 3Q2SC 2WBMA 4OYAA 3CJ5A 4I2QA 5MAOA 3IS9B 3IRXB 4K4ZA 4M5MA 5CYMB 3RW7A 1XR5A 4CQ1A 5I3UA 4QWCA 2FJAB 1JX4A 3CEDA 1HHTP 1UVMA 2A18A 5F9NA 5D0RA 1N36F 4TN2A 1VOMA 5SZTA 4O4GB 5DZ6A 4ZPVR 3KHRA 3CC2S 2AYGA 1XTZA 2BJ3A 3DHWC 1TFYA 3LP0B 2EXUA 2IYIA 4IG0A 4O3NA 3OXFA 2LU1A 1N6QA 3QATA 3RB6A 3PV8A 2G1DA 1F1BB 1HNWF 2DNZA 4C6AA 3MFIA 2VHGA 3G6XA 3W64A 3RR7A 5HBMB 3VAMA 1RHJB 1KQFB 2RS8A 1RKJA 2ILZA 3DOLB 1RWKB 4ZCMA 2KM8C 5KFCA 4PYDA 4N76A 4G1IA 4FF4A 1FNXH 3G4SS 2OP5A 3WX4A 3RZAA 4ICLA 3MAAB 2LQBA 5AE1A 2GVZA 4USUA 2A1BA 5LMUF 1VQ5S 3J7A1 1NNDA 2POKA 5F8GA 4UZBA 4F36A 4LMZA 3O44A 5ETOA 5L46A 3DLEA 2HFNA 1M5VC 5JVHQ 2BVZA 1BD6A 3IA0A 5J2NB 4U7CA 2HHHJ 2A3JA 3BN4A 2KDOA 3DLKB 1AA1B 2UV8A 5HMXA 2UU9J 4CH0S 1VRQC 2Q43A 2J9DA 4L3NA 1O0PA 1Y4ZB 2KTQA 1B64A 2QGFB 1HNZF 3C3LA 3J7AN 1C1BB 2Q6CA 3QIDA 1RK8A 3Q2TC 1TTHB 4QR1A 1VQSA 5GMEA 2NYHA 4X66F 2D68A 3TQ1A 1I5OB 1I94J 2VF3A 2W9BA 4FYDA 4C3MA 4DN9A 4OX6A 3PX4A 1JJ4A 4B08A 1U26A 3GFXA 3GFZA 1SVDA 1U02A 4CH7A 2ZH2A 3CCJS 2E9RX 3SQGB 2BANB 4XAKA 4Y6IA 3HO1A 4OHXA 3AD9C 1GXTA 2RD5C 2UUCF 3R6LB 3W1YC 2XHWA 1JK9B 4Q45A 4B9MA 3A12A 3GONA 3OUYB 2LYVA 1HLWA 2P6TA 2YNGA 4Z37A 2J6SA 2WZ1A 4IOAQ 3OTDA 4OHWA 1CBKA 1XNQJ 3Q8UA 1UW4A 1RYSA 5KT3A 1BY9A 3MDFA 4DMZA 2FC8A 2GV1A 3ONQA 4G1PA 3JB9k 1ROFA 2AJ1A 3SXLA 3D4JA 2HIYA 2C3PA 1OYDA 2WBRA 4LBHA 2RE1A 4QIFA 4QR0A 4RW6A 3SSQA 1FDBA 1TQLA 3PKYA 1KDNA 3DLLQ 2FJBB 3NNHA 5GAEU 4KE5A 1HKAA 1OMSA 3VGVA 3PIOQ 1M5KC 2CYYA 1OQ6A 1UFKA 4CT9A 3UE2A 5KG1A 3GJSB 5A8RB 4GVBA 2DNKA 2HHPA 4IG3B 4FXVA 5DS7A 2LKZA 2HFVA 4N47A 2HHTA 3ZZRA 1HL6A 1OWXA 3G8QA 2N7CA 4DV4F 1MN7A 3R5CA 4PZVA 3R9LA 4ZPDA 3BKTA 2KL8A 1E6YA 3KHGA 3KDNA 2G13A 3GP9A 5LOQA 3KK1B 2ZJQQ 3V81A 5D3GB 2QL5B 2V4JB 1NKBA 3WIUA 1Q16B 2MKJA 5ETPA 1F2HA 2P9CA 1G6BA 1TL5A 2BUNA 3IM8A 1GTHA 2HBRB 1X5OA 2ZNYA 3GU0A 3M8PA 3NG8A 3P5TL 2ROPA 2WB4A 3PEHA 5EDWA 3MD3A 1D9AA 4LF6F 1UWBB 2BW2A 4NLQA 2X51A 5I42A 1MMDA 3WBZA 4DU8A 4IDKB 3T5HA 4UZCA 4ZVFA 3ZNJ1 5J2MB 2DBBA 1S97A 2E1CA 3I55S 1PJ6A 5FLXY 1GMWA 3NNCA 3W7BA 2BBEA 2GVZB 3BSOA 3TAPA 1UCNA 1PYSB 3KTQA 1RAFB 4AE5A 3DYAA 2QYCA 2U2FA 2C2DA 2GMJA 4PG4A 2EI5A 4CO4A 4HL9A 3MAQA 4K4UA 1N5QA 5AJ3F 4USJC 4O23A 2CQGA 3M2UB 3MTJA 3CGIA 2CKWA 4CO5A 1RAAB 1HBUB 3NP5A 4XPEA 2IVMA 3CULA 1TKZA 5EHHA 4ID5A 2W2MP 4DR2F 3I4PA 5DQIA 3CCMS 2C3OA 5CH7B 1RISA 5E7OB 5K8NA 2I6WA 2RKIA 4USTA 4KKOA 1R8HA 3N5FA 1U1RA 2C3UA 2RF2B 2PC6A 1T02A 1X9SA 2XMVA 1HQUA 1Q8LA 1FKAF 1IVZA 5AXMA 2XY7A 2GC8A 2LQ8A 2JVRA 2ZVIA 2J8AA 2Z58B 5K5MA 3BO2A 2NQPA 3J80Y 3KNGA 2I2YA 1BGXT 3JTNA 2B8QA 4YB5A 3FCVA 5GMDA 1QJHA 3N01A 2M88A 4FN5A 3CIMA 8AT1B 1ITPA 1TUVA 1BLUA 1HARA 2Q1LA 3OTCA 3NL0A 1U8WA 4DUTA 3MUMP 1KEKA 4WFBQ 1JKHA 1K1SA 4ZVGA 3OFHA 4ECWA 4KV8B 3W9JA 2HW3A 3A3NB 3C19A 5J2NA 3WC2A 4ZP7A 4DV2F 2LCWA 2NUHA 1FK9A 2B7BB 1Z1ZA 2KI2A 3IG1B 2UXDF 3UWTA 1VLYA 2VV5A 3BV8A 4AXJA 3PVXA 3BKFA 1VCTA 2RILA 3NCRA 1EARA 2A2DA 5KT7A 2Q66A 1RT3B 5C2GA 2OUGA 3UO0A 4CYUB 5C5JA 5ETLA 4X62F 1VBYA 4LSZB 1FXLA 3MM5B 2FJXA 2ZOGA 2LA4A 4ZVUB 1UPMB 4O3PA 4MKYA 3ZZPA 4DR4F 1DTTA 3IR5B 4QOTA 2EFPA 4JP8A 3G6VA 1QSYA 3ENQA 3TQEA 3VWSA 2MQ8A 3KXDA 3R5BA 1U09A 1VQPS 3D1OA 3C8YA 1SI9A 2RF2A 2IJRA 1CJVA 1JIHA 3M1VB 5LJ5Y 3M2UA 4LSNB 3UD3P 2HFOA 3ELHA 3MM8B 4C3LA 2CZ4A 2EEYA 1B0PA 2ROEA 3HFVA 1TKZB 2CXEA 2YQ3A 5CYQA 3DI6A 1YJNS 2UP1A 1PO6A 3QRQA 4NXNJ 1MNEA 3P96A 2UXBF 4CYUA 3FMWA 3LQVA 4ED6A 2V8PA 4JI2F 5ETVA 4UOHA 3FEZA 1U24A 1RT1A 3I82A 2DD8S 2KH9A 4CLUA 1RWUA 3IRXA 3IS9A 2QMUB 3OLBA 5I3UB 1JNZB 4C3KA 4ZIVA 4DL6A 2VPWB 4IR1A 3NEKA 1GTEA 1BQXA 1S6UA 2PN6A 3GLJA 3JQJA 4N5SA 3DRSA 3HJVA 3CDBA 4ILRA 4OFZA 1IM6A 1KKHA 2DO4A 2DH9A 2M2BA 4QWEA 4ZHRA 4LF5J 2DGSA 4NOHA 1TMMA 1JLEB 2CQHA 3K8WA 1QUVA 1LWEA 4Q43A 4W90B 2YWHA 3MMAB 3HD2A 4ECXA 1YIJS 1WNEA 4K50A 4W98A 4B3TJ 2WTFA 4ECQA 4RU2A 5IT9U 2EFGA 2ACYA 4Q2LA 3SMZA 2M9KA 3B4DA 4BWJA 4DSJA 1UJ4A 4M63A 3GE9A 1CULB 3RBDA 3IR6B 2DHAA 1E6YB 1VC5A 3ZTSA 4I68A 3BDEA 2R3VA 2CJXB 1IBMF 1SXLA 2I5JA 1FFWB 3SI8A 1WTBA 2B9WA 2ZBIA 1SIWB 3G82A 5C42B 2DRBA 2YXLA 3H5SA 4LUBA 1SJ3P 1KVIA 2EG2A 4MKBA 3OBIA 2LECA 4JI5F 4LF8J 1CJUB 2HVHA 3Q86A 4NI2B 4Y2CA 3OFEA 4NZ6A 3I0SB 4OV6A 3X1LB 3E01B 1QAYA 1QTNB 1QE1A 1QD1A 3MI7X 2VBYA 3MM9B 3AX3A 2GAHC 3S6EA 3HHLB 3VAKA 1FE0A 3HXMA 4DQQA 2YKNB 5DG8A 2BJ1A 1RI7A 4ED3A 5A2QY 5K20B 1YI2S 4F4ZA 4DZ6A 3MUVP 4PQUA 3L09A 4DR3F 1Z2LA 2MZTA 3MM6B 2IVYA 1XMQF 1T03B 2K7KA 3H2LA 4FYYB 3TJ9A 1JLBA 1YJUA 1RT7A 3U1NA 3PIPQ 1I94F 3RRKA 2H4WB 2IA6A 4DHVA 4Q8FA 3AQOA 2LEPA 4J9QA 1IXKA 1QY7A 3VVUA 2CQBA 2B4OA 1RT3A 4K8RA 2CQ4A 1RAHB 2O66A 2NXNA 3FFIA 3KLGA 1FX4A 2F4VF 1CC7A 4JI3F 1LV5A 3R7BB 1L3TA 4W4MA 2IBOA 3RYLA 2UVVA 3N6MA 1NAQA 3GSDA 4JB8B 4WWSA 3M9OB 4N8OA 2OEJA 2F8MA 5L9NA 5IM0B 5HROB 2UXCJ 1FE4A 3M30B 3G9CA 1M0SA 1N48A 2E5LF 1J5EJ 1HD0A 3MEDA 3IM9A 1PC5A 3DLKA 4RWWA 1XMQJ 4PR6A 4Q0BA 2YWWA 2AYMA 3AJ1A 1GXUA 2L3MA 5KT6A 4X65F 2CPHA 2IJFA 5KFUA 2MZRA 4AL6A 5HQ8A 3CD5A 2KXFA 2V2QA 3IBFB 2MPUA 2ZHAA 3KMSA 2DNRA 2DNOA 4ILMA 3PG9A 1UWAA 3AY0A 2E29A 1VIXA 1BC6A 5CA5A 2P2CB 3FGVA 1RTIA 3K5PA 1F2GA 1DLOB 4DBQA 3DGPB 4UUWA 5HJYA 4FPIA 4H4OB 1RT1B 2CJ9A 1XERA 2DNLA 1F5BA 4KJIA 4RW6B 3SSRA 2FVQA 4HYKA 3I56S 3QWUA 2UXCF 1CQMA 5KFJA 4B17A 2ZUGA 4DV1F 3PDNA 2VICA 2IHR1 4KO0B 3AA8A 3QSYB 1EETB 1OY9A 3K8VA 2XS2A 2WSFC 1U0HB 2MLYA 4ZJLA 2RMLA 3TX8A 2M3DA 3GPAA 1B99A 2ZVSA 4K5RA 3LH2S 2DPIA 1N33F 4H4KA 1DFDA 4ZVRB 4RUCA 1FXDA 4O4GA 1R8BA 5LSRA 3KJNB 4C98A 4CT8A 2PA8D 2CQ3A 3UN2A 4ZDNA 3C16B 5IOLA 3V5RA 1APSA 3SCLE 3HDSA 5GADI 3OXGA 4KTQA 2XO6A 4YR2A 5KFLA 3EZOA 2HFUA 4B9NA 2RQKA 1A0OB 1H3DA 1NMEB 2XG8A 3BBCA 1LW2A 3QT8A 5F0UA 1X0PA 5FLXU 2LU2A 5IC4B 4PG8A 1SKUB 4BDPA 2F5GA 2J76E 2JFKA 3FC9A 3CD0A 1H7WA 3GR0A 3M6VA 4MT1A 4OZ0A 4UOFA 3VAFA 9RUBA 4Q0BB 2IJNA 1FCAA 1ZA2B 2VJVA 1Z2ZA 1LXNA 4NA2A 2UXBJ 1PKUA 4DCJB 5JMNA 2D69A 1ZM3A 3H20A 2JJ4D 1TL7A 4PWDB 1HPZA 4B3OB 3B54A 4X4OA 4YEAA 2GW8A 1R0BG 3DFEA 1VR6A 3IWLA 4UF4A 1KQKA 1J5OA 1T7PA 3T9NA 1RAJA 1RUSA 3W3SA 2YWEA 3SDEA 2X1BA 2YPYA 1YK9A 1RTHA 1YJTA 1YG0A 3W2WB 1RA7A 4X4RA 1MU2B 2VDHA 1UL3A 3OTOJ 2MQOA 2YKAA 4I1TA 3G86A 3Q8RB 2EW9A 4EI2A 3PRBA 3BGRA 1ZM9A 4U67Q 4F2SA 2HNYB 4NLOA 1FT8A 1V3SA 3RB4A 2Z2MA 4LF7J 2IYGA 2F9JA 1W25A 4I6AA 4I4BA 3S01A 1HNXF 2H3EB 4F2RA 1YZ6A 3DRXA 3MFHA 4QCLA 2EVZA 1KLNA 2PEHA 2Q79A 4ZVTB 5HI7A 4DG1A 2F40A 2KVIA 1VQKS 1Q1KA 4UT4A 4YQWA 2LP4A 5HLFA 5IQ6A 4NZ0A 2ZZNA 1UZHA 2DGOA 4WTOB 3R6GB 1G2EA 4V19X 3NMRA 2DNGA 1FI4A 4JI1J 2ZBRA 2BANA 4M5LA 2XBPA 4TU9A 1VRTA 1NK4A 2RQ4A 1HI0P 2WOMB 3CJ0A 4WZQA 3OPKA 5J2MA 1CPZA 1RCXB 1VGYA 2WRMA 2XYHB 1FDNA 4UTGA 4DV7J 1SKSA 4PQAA 1UWBA 2G0JA 4WPAA 3CE8A 3OFGA 1UAWA 3ZZ0A 1L3SA 2CADA 4DR4J 3ADAC 1TL7B 3DOMA 3QYYA 4CO3A 2ZE2A 5A8WB 3D1HA 3OVBA 4A8YA 1IKXA 3D0IE 1AW0A 2MMYA 3M4XA 1Y0HA 3CJSA 4ZK7M 2R8HA 3QAEA 1VRUA 1Z4UA 4LVOP 1P27B 2VODA 2K1RA 2GIFA 3KK2A 4O4RA 1YJWS 1HMVB 2Y0SD 3UNGC 3LANA 2MKIA 2XSJB 1RTDB 2N4CA 3HT0A 4RL1A 5EWFA 3LPEA 1JLFA 4RW7A 4IO1A 5HSPA 1H2UX 2FHMA 4WKRA 2HNDA 3TAQA 2ZZTA 4GVBB 3R8YA 4YR0A 3ILIA 2V5HG 5C25B 1BXNA 2BE9B 3W5XA 5B0DA 1M5SA 4NYOA 3PKMA 2OD4A 4ZMMA 3POTA 2W9CA 2VBWA 1Y00A 2HURA 4ELVA 1N8RT 4JI8J 2VA3A 4DOZA 1S1WA 3R97A 3RTVA 4QPXA 3FBEA 2XZ2A 4UQGA 3G2XA 4B3SF 1HWJA 5E2QA 2PI5A 3CDWA 1A7GE 4NLTA 1HWUA 1HNVB 4QWBA 4EFAC 1IKYB 3KUGA 5IT9Y 1JNRB 4PXDA 4Q2MA 2R2TA 3UR3C 2LXUA 4ECZA 4DFJA 2VDIA 4HTIA 3DDIA 4PAAA 4F3QA 5IV3A 1UMJA 4ZPBA 2JSXA 3JXOA 2XMAA 1LKZA 4AQYF 1RWPB 2COLA 3IMQJ 4B3TF 2IM2A 3D6TB 2FTRA 4DR2J 3SDEB 3RBEA 2CG4A 2LVWA 2FGCA 1OPIA 3CD7A 4RBUA 3KK3B 5BR8J 3QWPA 1S1UB 3ZZZA 2EKNA 4USMA 2RNEA 1N5VA 2HNZA 3IG1A 2QA1A 2YY3A 5CZVA 5T7LA 2XLKA 3H90A 3D0GE 4DQRA 1ZPWX 5H9FJ 1FJGJ 4DR7F 3UQSA 3J7YI 4NWBA 2OPQA 5KFZA 8ATCB 1QTMA 2HIQA 3A3PB 3H0PA 2DGTA 2E7VA 3DC2A 2DGVA 2AEJA 1WD6A 1CS4A 4LF9F 4M94A 2G0CA 4GMKA 5A2QU 3F0NA 3MEGB 4HDHA 3HCXA 4LBPA 4Z7YA 5IFMA 1UJ6A 4RNNA 3G6ES 3C2PA 4LF4J 4J37A 1GT8A 5CZXA 3ILOA 5L1KA 3IFEA 5B09A 2P5VA 1UETA 2V34A 3AOBA 3DLEB 4ZPTR 1F9HA 4WFZA 1IM4A 2XY6A 2RDJA 2HHXA 4MYUA 3KMQA 4LREA 4TY8A 2WSCC 3GIMA 1NUEA 1WJ9A 3RAMA 2RQMA 3DU6A 3ZZUA 2IVFB 3UR0A 2MKCA 4DFKA 1KLMB 2AV5A 1IKYA 1YQHA 3ITHB 4Y65A 5AJ3J 3MUTP 3CCQS 2XY5A 1TKTB 3GILA 2QO3A 1FJ7A 3C14A 1EKSA 3AOAA 5DRKA 3VZIA 1AFIA 2F65A 4RW9A 4ELUA 3J7YU 3UCGA 4XTTA 1HNIA 4ATNA 1WKJA 1VMBA 3VCDA 3C15A 1EP4B 2HZAA 4FYWB 1K47A 2V0NA 5LMNJ 4EBCA 4ID5B 1R0AB 1BQNB 2B9XA 3KKFA 4U7UK 3VAJA 3QQCD 1T9VA 2DNMA 2XMMA 5B0EA 2FVRA 2J8SA 4J91A 1GAOA 4NI2A 3P49B 2GNKA 4NLVA 2V69A 5T41A 4DFPA 1P8GA 5AXNA 1NO8A 2JLFA 4YB6A 4EZ9A 1GX6A 5CYMA 1MLAA 3JQKA 3VHQA 4B3RJ 1VQOS 1M5OC 4N8NA 3AAWB 3LP1A 2HZCA 4MAKA 1ZYQA 2GVDB 4M5DB 3MHYA 2E5IA 3ENAA 3IAS9 3IXQA 3MPDA 2BW7A 2DB1A 2PEBA 3AT1B 3FZBA 2EFVA 3TAMB 5F0WA 4YP3A 1E6VA 5IWAF 4Y2AA 2VG7B 3MOZA 3QIPA 2RHSB 4I7FB 1IBKF 2HHWA 2AGPA 4DL5A 3GYNA 4J9NA 3KLHB 4B3MJ 3B4MA 1NLKL 2BM0A 2EC2A 1WG5A 3HSGA 3N6LA 3M8PB 3PJXA 4URQU 5D6GA 3OV7A 2VQEJ 4I2PA 4KAIA 3R5DA 2FY1A 1XR6A 2W2QP 3NGKA 1JLEA 1WC3A 2BA9A 2L9WA 3PHTA 4ZVEA 2W2OP 1V3RA 1U2FA 1F9FA 4HHJA 3ZTQA 1UKUA 2BDPA 1UW9A 2RAQA 3TX0A 4UOCA 1M90T 2A6OA 4OLOA 2OMLA 5I4MA 1N36J 3VALA 4DV2J 4DV4J 4FF2A 4Y34A 2J6UA 1KNZA 4DR6F 2WONB 3A8IA 4ED1A 5FD1A 4WYWA 1WORA 3TO8A 1S1VA 5DETA 5HLFB 2AGQA 2C2EA 4MIAA 1UEUA 2I1RA 2P9GA 2W4CA 4KHPJ 2FZGB 2MSSA 3OSNA 2W25A 4YB7A 3HFKA 5IXUA 2NXUA 5J2PB 3TUPA 1HQEB 1HNXJ 4C8NA 2CZVC 2Z56B 3MM9A 1RGVA 3I9V9 2Z8QA 1DAXA 2NZCA 1RBLA 2BJ9A 1KSPA 4PXCA 4HT5A 4CLSA 1NJIT 3AJDA 1Q79A 3BKUA 1ZM4A 2CPZA 1SV5B 2MB0B 3PJ9A 1S4FA 2HYIB 2ZKTA 3QNWB 4PEOA 3R1HA 4LF7F 2VH7A 2W9BB 1RAIB 1KOOA 2LA6A 4K5SA 4P10A 4H4OA 4Y28C 3DOKA 1DHMA 3GCXP 2XNQA 4AL5A 3LA0A 5DGAA 2B9EA 4G65A 1GXLA 4KGKA 3PR5B 3K59A 4CIOA 1EQMA 3TNVA 4OYWA 1FO1A 2YTCA 1YX2A 4PPDA 1Y10A 3BYPA 3T5KA 3G6YA 2CWKA 4R0EA 3VQSA 1S59A 4A8FA 3BEGB 3U27A 3GIRA 4ZVOB 5IM0A 5KFDA 1X4AA 3HKWA 2BR0A 1WOPA 4DR1J 1S1UA 3PRVA 2HLUA 3TA0A 3T6JA 4D3HA 4DX7A 2YKOA 2CPJA 2MQQA 3H40A 1PYTA 4LSLA 3TUZC 1FDAA 4ITSA 5AE3A 1K73T 4E0DA 2WVCA 2DRAA 2BE7D 2CDRB 3VTIA 1J27A 1LW2B 1A6LA 2F4FA 5MLCV 2BACA 2B4VA 2ZOMA 1S7IA 1KTVA 4Y00A 2QT7A 1WACA 3NKYA 1HA1A 1LEOA 1WG4A 3EUNA 1CJTA 2PGCA 5T14A 3OL9A 3JAMU 1T9WA 4TYBA 5DZ7A 5KFAA 1L3UA 1VQMS 4DX8H 1HBMB 1Y5NB 2JX2A 3SZ2A 3H8YA 1KOHA 3NWRA 3S8SA 1HWKA 3NBPA 4DF4A 2XWXA 2FD2A 1RHKB 1SUQA 4FPRA 1C0UA 1VK3A 3C66A 2JNJA 3TUIC 1KVKA 2CQDA 1VQYA 1PAEX 2KXHA 5KG0A 1U48A 1CJTB 3CCES 1X4GA 4EWTA 4EYIB 2ABYA
chains in the Genus database with same CATH topology
2UUTA 3AJ2A 4X4PA 2ZH8A 2GQ2A 2H9ZA 4I6YA 4L72B 4X4VA 4TYAA 3IAM9 3M8QA 5SUHA 2AYEA 3BS9A 1S10A 3PJWA 3J7Z5 1RTIB 1DURA 3MZIA 4BHQA 3KHLA 1SH2A 1RT5B 1ULRA 2EFOA 3CC4S 4ZS6A 5EUHA 1VC6A 3FSIA 1LWCB 1J5EF 1X5SA 2DK2A 2VC0A 5KFGA 2W7OA 2ZE2B 4DSEA 4KBIA 2XO7A 3EYZA 1JWWA 2XZWA 5EGYA 3ISZA 1VQLS 3CO9A 3SFUA 1S79A 2MHEA 5G4DA 3KLFA 1VQ8S 4JI6F 2GGPB 1WEZA 3TAMA 2KHCA 3DRSB 4DWIA 1Q82T 2MHNA 2OJ3A 4O44A 4AFFA 5KAKA 1NH7A 1S6PA 3LOUA 3V4IB 3UCUP 1Y9OA 2VG5A 3BSCA 4ZKAA 2DH7A 1P1TA 1RTJB 3MCSA 4OJHA 4NCGB 4A8QA 4ED2A 1TR0A 3HLUA 4M1KA 2VC1A 4URGA 2ILYA 3DHXA 3JSBA 4DN0A 1T05A 3QGGA 2EK6A 3BZQA 4B9SA 1REVB 4ETZA 1HBUA 4LSNA 2VOPA 1DBDA 2DGUA 3AQPA 2RU9A 2LQJA 1IKVB 4PXBA 4IQMA 4QW9A 3RU0A 3X3UA 3M6UA 2WAQD 4UUXA 1MU2A 1HWLA 5KG4A 4JYAF 1QAJA 4ZCIA 5LXYA 1SH3A 3KLFB 2C3YA 5L1JA 5IS2A 2DCLA 1LW0B 1TV6B 5CQGA 2ALZA 2JEFA 3W2VA 1H7XA 3W2WA 5E0OA 3D28A 3BJYA 4LFAF 4QBUA 3MEEA 4A8OA 4NL5A 2GCFA 1FRIA 2CIMA 2NUUG 1DTQB 2OD6A 2YKQA 3I87A 2Z2LA 2XCAA 1IUJA 3M2RB 1SJQA 3THPA 1T94A 3PR4A 5BJRA 4C9DA 4ELTA 1TL3A 4F25A 4P2SA 4IG3A 2XCPA 2B56A 2WOMA 3PFEA 4LJMA 5E3CA 1HW9A 4C2MA 4GC7A 3DDKA 4C4WA 2XSFA 1WELA 2R2RA 1FKOB 1SC6A 2ASYA 1Y5IB 3TUJC 3U02A 4ECTA 2C2RA 4UW2A 3PO4A 4X4UA 2C42A 4RNFA 4TU7A 5EX3A 4RWXA 1FRXA 1NJYA 2OPPB 2DO0A 2FHJD 1D9FA 3N28A 2RKIB 1NB7A 4YDDB 3M1VA 2N7YA 4TY9A 2HWTA 3K58A 3BGRB 2MJUA 1B7FA 2KU7A 3AHPA 3M9NB 4QYZJ 2R2UA 1UVNA 5JVGQ 3OJSA 2PT0A 4WFNQ 7FDRA 3QJLA 4C8KA 2GO9A 2MKKA 2HS3A 1J2VA 4BC7A 3K5LA 3H4DA 2R7SA 3HHLD 4YFUA 2MKHA 4JV1A 5F8JA 1HBNA 2R8GA 3C6UB 4B02A 3MD1A 5I3PA 4Y3CA 2IC3B 2VBXA 4KV8A 3MMCA 4WU2A 1ZPVA 3SEOA 5IT4A 4LVNP 3OLAA 1S9GB 2B4UA 3RAXA 4LIRA 3N4WA 1LXJA 2BRLA 3VR1A 1U1MA 4WK1A 4F3OA 5IZHA 2MQPA 3FEXB 2VQFF 2G4BA 2CQIA 4F67A 4CTAA 5B0GA 4K4XA 3CIZA 2XNRA 1NEEA 2M5YA 1JLBB 3D54A 1UUJA 3EGNA 4IH6A