3OLAA

Poliovirus polymerase elongation complex with 2'-deoxy-ctp
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords Polymerase
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 140
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3olaA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3olaA02
3GIIA 2B6AB 4IKAA 4NYZA 3TQ1A 3CWJA 3QGIA 3HVTB 1ZTTA 1KLMA 3D5MA 3G6XA 4MH8A 3QIPB 2YKNB 1HPZB 3IG1B 4MFBB 3BGRA 5I42B 3OSNA 2OH2A 2IM0A 3MECA 5KFJA 2R2RA 3DRPB 3E01B 4F4XA 2UVVA 2AGOA 2IJNA 4EYHB 2IA6A 1S10A 5F8GA 3V6DB 1N48A 2VA2A 2YNGA 3M8QB 1RT2B 3MF5A 3M9OB 5KT5A 4RW6A 4QWCA 5L1IA 5F8MA 2FVRA 4HYKA 1KHVA 3N6LA 3PHEA 2BRLA 1BQNB 3DLGA 4LQ3A 2RDJA 4TYAA 1IKYB 4J9OA 4H4OB 5L1JA 5KFUA 3DRRA 2FJVA 1VRTA 2E9RX 3T5KA 4M94A 4IFYA 4RW7A 5DG8A 4NLUA 2YNGB 2DPIA 3IGVA 2AGPA 4RW6B 1SUQA 3NGDA 4ECQA 3ISNC 4EO8A 2ZD1B 2JLEA 1XR6A 5KFVA 3OHAA 4MKBA 1C1BB 4ED6A 2WHOA 2IMWP 4O4GA 5KFAA 4JV1A 4XPEA 3KK1A 4ECRA 2C28A 4QWDA 4IDKA 3SFUA 3NAIA 3UPFA 3QZ7A 4IR9A 5C25B 1RTJA 1S9EA 3RAXA 3BSCA 1RT4A 5D3GB 3Q8RB 1XR5A 1MU2A 3MTKA 4TQRA 2I5JA 3MEEA 1S1UA 2OPSA 3PW4A 4O3QA 3RB6A 3TVKA 4IFVB 4IH5A 4ID5B 4ZVGA 3GQCA 4IOBA 5KT6A 1JLBA 3GIMA 4FS1A 2IBKA 1RAJA 1DTTB 3ITHB 4O4GB 2HAIA 3NMAA 2WK4A 2J6TA 4LSLB 1VRUA 1RTJB 1K1QA 5DLGA 5KFLA 3UDLA 3KLGB 2XGQA 3OLBA 2UVWA 1RT1B 5HROB 3FFIB 4EYIB 3Q8PB 4IRKA 1REVB 1JLBB 2HNYB 2VG7A 4TN2A 4YQWA 4IH6A 3KK3B 5KG5A 1C0TA 3PW2A 1C0UB 1HMVB 3C6UA 1S1TA 4RW9A 2AU0A 3N6MA 2QE5A 4LSNA 2J6SA 4NLQA 2BQRA 4ECYA 1T03A 1HQEA 1EETA 3QZ8A 3C6TA 3H40A 3MFIA 1EP4A 3I0RA 2CKWA 4RW8B 4J9LA 4ECVA 1JLAA 5KG2A 3G6YA 5CYMA 3KMSA 1S49A 2HWIA 4KFBB 3Q8QB 4MK9A 1JLEA 1I6JA 4R5PB 4O4RA 1JLQA 3LAMA 4LSNB 4O44B 5DQGA 4I2PB 4WFZA 1TL3A 3MR5A 1S6PA 5C42A 2FVPA 4IRCA 1N4LA 4PUOA 2ALZA 3LP1A 4DEZA 4WYWA 3OHBA 3MR2A 3BQ1A 5HBMA 2BANB 4ZMMA 1JLAB 2AWZA 1SH2A 2YNFA 3H98A 5CYMB 4Q45A 2ZE2A 2JC1A 3KJVB 1R0AA 4B3OB 3KNAA 2W9CB 2GIQA 4ECSA 2YNHA 1FKPA 1S6QA 1RTDA 1BQMA 1T05A 2XCPA 2AX1A 3DI6A 5KFBA 3RB3A 1U09A 4Y2CA 2I1RA 4WFYA 3BSAA 3V81B 3LANA 5C42B 1MMLA 4URQU 1RYSA 1N5YB 1S48A 3KLFB 2UVUA 2YNFB 1T03B 1N56A 2ASLA 2YKMB 2ZE2B 5KFIA 3CDWA 2DPJA 3IS9B 3MEGB 4ZVHA 2WTFA 1FKPB 1S6QB 2R2SA 3LP0A 5KFYA 1IKWA 3NAHA 3KLHA 2FJXA 2FLLA 1NHVA 1DTQA 3UQSA 4Y34A 4ZP9A 3DI6B 3DRSB 4R8UB 3I5BA 2FLPA 3LP2B 2GC8A 3GIKA 4I2QA 3H5XA 1RT5B 4ECWA 2OPRB 1TL1A 4K4XA 3SFGA 2JC0A 4JUZA 3KHLA 3N6NA 4F4WA 4KBIA 3DMJA 5EWFA 5T14A 3QIPA 1D1UA 3IG1A 4F4ZA 4NLYA 5I42A 3BSNA 5F9LA 3RBDA 3MEDB 1TKZB 4I2QB 2WB4A 3M8QA 3T1AA 1RT2A 1CSJA 5KFFA 1JKHA 1TL1B 3RBEA 4ICLB 1TV6A 4H54A 1BQNA 2IAJB 4DL5A 3DMJB 2W7PA 1S9GA 3T5HA 3V4IB 3DM2B 4NZ0A 1IKYA 4H4OA 4O3RA 2D3ZA 5KFKA 4K4TA 3H5UA 3M8PA 3PJWA 5KG6A 3QLHB 3EPIA 3NL0A 3M9NB 2IM1A 1JKHB 3I0SB 4RW4B 2ZD1A 1GX5A 1TV6B 3CJ5A 3DOKB 4EO6A 2VG6B 2R2UA 1S9GB 1JLCB 2R8HA 4MK7A 3OLAA 4IR1A 3H4DA 1C1BA 4K4YA 4RNFA 3KLVA 1TKXB 5KFPA 4EBDA 3ISND 3HKWA 5KFGA 4URGA 4ED3A 2ATLA 1UWBA 3M8PB 4EBEA 3GV8B 4K50A 4RNNA 5F9NA 5C25A 1JXLA 5D3GA 1IKVA 4ZPAA 3PR5B 3GIJA 1S4FA 3CO9A 5J1EB 4URSA 1JLFA 2FJWA 4IFVA 4ID5A 3OL6A 3DLKA 3DYAA 3ITHA 1DTTA 5KFZA 1N6QB 4LSLA 3G6VA 4J9PA 1UWBB 1C1CB 2C22A 5KFHA 1LWCB 1IKVB 2ILZA 1QUVA 3KLIB 3KLGA 4O3SA 3BQ2A 1JLFB 1RT3B 3H59A 3VQSA 1RT1A 3FFIA 5KFQA 3DYAB 1REVA 3DLKB 2HNYA 4Y2AA 3HVWA 3IGNA 3EPGA 3EZUA 3JSMA 1S0NA 3KK3A 4U7CA 4ED1A 1C0UA 1HMVA 2WONB 1TKTA 2ZKUA 5K14B 4R0EA 2BE2B 5JUMA 4Q0BA 4IG0B 4DG1B 4RW8A 1HARA 1HQUB 2FVCA 4ZP8A 4XO0A 4KFBA 3JSMB 1RTHB 2IM2A 4R5PA 5CYQA 4WYLA 4K4ZA 2XCAA 4NLPA 3LAKA 1TKTB 4O44A 5DQHA 5KG7A 2R8JA 5F8HA 3DOLA 4DL3A 4Q8EA 4I2PA 2WCXA 2J6UA 4Q0BB 4MIBA 1JIHA 1LW0B 2WRMA 4KV8B 2BANA 5DG9A 4M95A 3KJVA 3M9MB 4ED0A 2BR0A 1T3NA 4B3OA 3CJ0A 5KT4A 2W9CA 2R8KA 1HYSB 5CYQB 1QE1B 4K4VA 4GC7A 4WE1B 1RT7A 4RUCA 2C2RA 2V0NA 3DOLB 4WXWA 4Q8FA 4DL7A 1FK9A 3V81A 3V6KA 1N5YA 4FBUA 3T5JA 1RDRA 5L9XA 3KLFA 3H4BA 4NLWA 3ICLA 4ECXA 4ED8A 1S0OA 4KKOB 3KHHA 1D0EA 2UVRA 4O3NA 5KT2A 2YKMA 5C24A 2C2EA 3IS9A 3MEGA 3CDUA 5J2NB 1SV5B 1RT7B 4G1QB 4ZPDA 4U6PA 1IM4A 3DRSA 4R8UA 5C5JA 3OL8A 1XR7A 1FK9B 3LP2A 4IG3B 3GYNA 1Z4UA 5DLFA 1RTIA 1RT5A 1S1WB 3KK2A 4RNHA 2JEIA 2B5JA 5KFEA 2OPRA 2F8EX 2HNDB 5EWGA 2D7SA 4K4SA 2D3UA 5C24B 3HHKA 4Y3CA 4O3PA 3PR4A 4YR0A 3OSPA 4NLRA 4KHMA 2HNZB 4QW8A 1RA7A 3MEDA 1TKZA 2BRKA 3QO9A 4J9RA 3KMQA 1RTIB 3KK2B 2YNIA 1IKXB 2B5JB 3BREA 3KLEA 4J9MA 4ICLA 3V6HA 3H2LA 5KG4A 2VG5A 4NLTA 4ED2A 3RB0A 2W8KA 2IAJA 3PW0A 1DLOB 5HLFB 4IRDA 3V4IA 2WOMB 3DM2A 4QWAA 3PJXA 4ECUA 1ZTWA 3G86A 4RUAA 2OPPB 2XGPA 3QO9B 4J9NA 3UR0A 2HMIB 3QLHA 2YNIB 3GV5B 3H5YA 2RKIB 4KHRA 3KLEB 1NNDA 3DLEA 3I0SA 4RW4A 4QW9A 2ASDA 2ILYA 2VG5B 2FVQA 4PWDB 3H5SA 5KFRA 5KFXA 3DOKA 4NLSA 2VG6A 3FSIA 1JLCA 2OPQB 3FQLA 5FDLB 2RF2B 5DGBA 1TKXA 1LWFA 1QAIA 2C2DA 4J9SA 3MFHA 3I5AA 1S97A 4LQ9A 1C2PA 1HNVA 3NBPB 4WXOA 1SH3A 2IM3A 1J5OB 4TY9A 5EUHA 3CJ2A 4ZPCA 3GV7B 3RAQA 2BQ3A 3LALA 3KHRA 4H4MA 3DLEB 3IRXA 4YR2A 5J1EA 4EEYA 3TAMB 5KFDA 4KE5A 2AX0A 5EWEA 1RT6B 5F8NA 1LWFB 3KHGA 2W7OA 1N6QA 1HNVB 1S1VA 1C1CA 3FDSA 4DL2A 4JV0A 1QAJA 4PQUB 5JXSA 4NCGA 5DG7A 1LWCA 5F8LA 4H4MB 4MK8A 5I3UB 1S1XB 3IRXB 3KLIA 3SI8A 2FLNA 2R8GA 1S9FA 1TVRB 4WFXA 4RNOA 4F50A 1RT3A 3PVXA 5KFSA 3T5LA 5HP1A 5KFNA 3GILA 1KLMB 5KFMA 3QGGA 2WONA 2GIRA 1FKOA 1S1VB 4JV2A 5K14A 4NCGB 2BE2A 3BGRB 4NRTA 2W9AA 3MECB 3PW5A 3CIZA 2R8IA 3OL9A 4IG0A 1JLGA 4DG1A 4X2BA 4I7FA 1HQUA 3FRZA 3FQKA 5HP1B 1RYRA 2EC0A 2CJQA 4FBTA 1JX4A 1RTHA 2E9ZA 4J9KA 5J2MA 1GX6A 2W8LA 1FKOB 3DLGB 4TLRA 3V6JA 2FVSA 3I5CA 4O3OA 3DRRB 1VRTB 1JLGB 2D41A 1LW0A 4I7FB 4IFYB 4MIAA 4KV8A 4RW7B 3KOAA 5KFOA 3NKYA 4QPXA 4J9QA 1WNEA 5DQIA 4HKQA 4ZP7A 1SUQB 4F4YA 2V4RA 5J2MB 1HYSA 1QE1A 4WE1A 4OL8A 2AGQA 2QV6A 4ZVEA 5EDWA 1KHWA 4K4WA 4NLVA 2UUWA 4RZRA 4EBCA 3QGHA 3KK1B 4ZP6A 4IDKB 2O5DA 3QYYA 4KKOA 3MR6A 4Q44A 1S9EB 2BQUA 1RT4B 3IN5A 1MU2B 1W25A 2I5JB 3MEEB 1S1UB 2OPSB 5J2NA 1SV5A 4G1QA 1S0MA 2RDIA 1HNIA 1ZETA 5J2QA 3BR9A 4IG3A 5KFCA 2V4QA 4DL6A 3MR3A 1S1WA 2HWHA 4NLDA 3BQ0A 5KFTA 1VRUB 4TY8A 2HNDA 4QWBA 1TQLA 1LW2A 2ASJA 4G3IA 4TQSA 5F8JA 5L1KA 1LWEA 3JYTA 1HNIB 4TYBA 4IQXA 2HNZA 3Q8SB 5J2QB 2VG7B 2W9BA 1T94A 4KO0A 1OS5A 5J2PA 2JEJA 3QIDA 1IKXA 1C0TB 3C6UB 5F8IA 1S1TB 4RW9B 4Q43A 4TY8B 4NRUA 3CDEA 2IJFA 1HQEB 1EETB 1LW2B 4ZVFA 1DLOA 3C6TB 5KG1A 4RU9A 5HLFA 2WOMA 5KFWA 1TP7A 1EP4B 4ZPBA 1LWEB 2UUTA 2E9TA 3I0RB 4YR3A 3JYTB 3DDKA 2OPPA 4MKAA 4ZHRA 3RB4A 5DGAA 5J2PB 2XI3A 4KO0B 2W9BB 2HMIA 2XC9A 1JLEB 1JLQB 3E51A 2RKIA 2B43A 2IC3A 4YMEA 2XWYA 2R2TA 4PWDA 4NLOA 4WZMA 3CJ3A 5L1LA 1TL3B 2OPQA 1S6PB 5FDLA 2RF2A 4FS2A 4RNMA 2JEFA 4PUOB 3LP1B 3CJ4A 5HBMB 2VA3A 3HVAA 4ZHRB 1K1SA 3NBPA 3T19A 3BSOA 4DL4A 1R0AB 1J5OA 1SH0A 4K4UA 4NLXA 2YNHB 3PW7A 5KG0A 1RTDB 1BQMB 2IC3B 4XPCA 3D28A 1T05B 2V9WA 4KB7A 4KSEB 4YP3A 3TAMA 5KT7A 4ED7A 4KAIA 2B6AA 1RT6A 4ECTA 3CVKA 1RA6A 3PZPA 3HVTA 5KG3A 4GC6A 1NHUA 4ECZA 4IH7A 5KT3A 4WZQA 2XI2A 2YKNA 1HPZA 4MFBA 4TXSA 4PQUA 3LP0B 3OL7A 1IKWB 3KLHB 5I3UA 2JEGA 1S1XA 2AQ4A 4QWEA 1DTQB 1YVFA 3DRPA 3E01A 1TVRA 4NLGA 3BJYA 3V6DA 5HROA
chains in the Genus database with same CATH superfamily
2GFFA 2F5GA 1XIQA 3P4UB 3W3SA 1T11A 4C3KA 3IG1B 3MECA 2ZJPQ 2ACMA 3C2PA 2IJNA 2DR7A 2XLJA 2IA6A 2JNJA 1RADB 4HHHA 1VBKA 1YSJA 1QSYA 3POTA 2OIHA 5L1JA 5KFUA 2E9RX 4JI7F 2Z0GA 1XR6A 2GJFA 3AOAA 4NA3A 4ECRA 4DPWA 1RTJA 3ZC4A 2G4BA 3NNHA 2LDYA 4IFVB 2DY1A 4BS2A 3ENVA 2BJEA 1K1QA 3ET6A 4DR3F 5B0EA 2G9OA 3KK3B 3B8HA 3M2UA 4N56A 3N6MA 4YFUA 4RWXA 5A6PA 1FNMA 2HSEB 4HDHA 3I0RA 4B9UA 5AT1B 1QTMA 2CNOB 3G6ES 1EX8A 3LAMA 3LWMA 3R5GA 4LR9A 2MB0B 1F9HA 2ZE2A 1XMBA 4ANCA 1Q5VA 2E5JA 1RUSA 3RB3A 2PGCA 2ZC3A 3OTBA 1G4CA 1MMLA 1O5JA 3CMQA 4URQU 7FDRA 3VAGA 3S6EA 4ZVHA 3TA1A 1PSDA 3UQSA 4Y34A 3TX0A 1CJTB 4I2QA 4PYAA 2OPRB 2CZ9A 2HG4A 1V6HA 1WHWA 3IR6B 1LQ9A 4PZVA 3K8WA 4ZPTR 1KFDA 4MKVA 3MPVA 3QLHB 4JI6F 4M63A 3GSDA 2DHSA 4C3LA 2ZD1A 2MGZB 3TAQA 4MK7A 3PYEA 4EBDA 4EI2A 5IV4A 3R1HA 3QMQA 2Z4PA 4ZPAA 2FJWA 1GMUA 1ZM3A 5THWA 3ITHA 4M5HA 1NJYA 2C22A 4WKRA 2KJWA 3IXQA 2J9DE 4YEAA 3THPA 2ZFHA 3FCWA 2MEWA 1TKTA 1X8DA 3TUPA 3OJUA 3HM9A 4JI1J 4F0KA 1RHUB 2UUCF 3AOCA 5DM7Q 4DQQA 5KG7A 3G96A 1JK9B 2WCXA 1WDTA 3JQMA 2BANA 4K59A 3PJ9A 2E7WA 2WSEC 4Y0FA 1FK9A 4CT9A 2A10A 3ICLA 4ED8A 3TOQA 5C24A 4ERDA 5DDOC 4PCQA 1NDPA 4C11B 4D3HA 4WF9Q 4YDDB 2Z2YB 2F8EX 4GKKJ 2D7SA 2XTCA 3ZO7A 2RHSB 4O3PA 2H4WB 1R8CA 2FHJA 1VQNS 1ICEB 1SJ1A 1FJ7A 4U95A 4JYAF 4LREA 1F9FA 2RKIB 3HHLB 3QT8A 3VVTA 2ADCA 3BM7A 4X4VA 5AXMA 4UUWA 3I5AA 3VTIA 2MY8A 4WP8A 2BQ3A 3KHRA 1GK8A 5J1EA 5EWEA 2GVDA 1QAJA 1PJ7A 4PQUB 4H4MB 5KFSA 5HL7Q 3TZZA 2GO8A 3P3DA 1ZPWX 3W9JA 1RE1B 2XO7A 1XMQJ 2N3LA 4IG0A 1HQUA 2ZITA 3J7AN 4X4NA 4J9KA 3U27A 1WWHA 3D0IE 3X3UA 2RU9A 4F4AA 4I7FB 2CZVC 1P9YA 4YOEA 2JSXA 5DQIA 2EI5A 1N0UA 4JP8A 1FWLA 4B9SA 4NLVA 3R97A 3QGHA 3KK1B 3QAEA 5M2RA 2BJ3A 5G0RB 4A8YA 2I5JB 2ZH3A 2N3OA 1RK8A 4DR6J 3LGHA 4F8RA 4G3IA 1TK5A 4AYBD 2CPZA 4JI1F 1T9UA 3BO2A 1IR0A 3C6UB 2OD6A 1NHKL 1HQEB 1SL1A 2OJ3A 2YWGA 2VD3A 2OPPA 1HD0A 3UDEA 4NEZA 2IMOA 1NXIA 1UETA 1HWUA 3SMZA 4ZN3A 2IVMA 1T05B 4KSEB 2R3VA 2AJ0A 1S77D 4ECTA 1AA1B 1RA6A 1J2VA 4YUDA 3GMGA 4GC6A 3FCVA 1M5SA 4GKKF 5K9FA 2AQ4A 1F3VA 2NCKL 3QIPB 2RUGA 1VQPS 4ZCMA 2UVVA 1FE0A 5KT5A 3KG4A 3RYLA 1NLKL 3QWUA 4FXVA 3NGTA 1VRTA 3M2VB 1CJKB 4ZJLA 2L9WA 4LJMA 3HHDA 5KFVA 2XHCA 3UVJB 2ZDOA 3LPYA 3K8VA 3CF5Q 2B9WA 5D3GB 3M4XA 4CCHA 5B09A 1FNOA 3TVKA 2K1RB 4KT0C 5ETMA 1WSRA 4I4BA 3W60A 3PV8A 1RT1B 1XMQF 1REVB 5JVGQ 1VJWA 4MYUA 1X0PA 3IM8A 1X7VA 4DV4J 3O44A 4ED4A 1YJNS 1JLEA 4F67A 1IN0A 1F9EB 4WFZA 2MQPA 2RU3A 3AB2B 2JC1A 4OX8A 2W9CB 2AX1A 3BS9A 3LTOA 1VC5A 3R7SB 2FLLA 2CZ4A 2FLPA 1IJFB 4J7CA 4JI5F 2OEJA 1Y7PA 2J8AA 4KBIA 2ZJQQ 2W4DA 4B3SJ 3TJ8A 1YKWA 1WUUA 3QBCA 3IWNC 1TV6A 3Q22A 3WC0A 2ZM6J 2VKZG 4JI8J 3UWTA 2V2VA 3WDOA 2HHPA 3SDEB 3M9NB 3I0SB 2VQEJ 1HWIA 1GX5A 4P52A 2HHVA 1XN9A 2QSWA 1H72C 2GS8A 4OHXA 1P9QC 4EBEA 4RNNA 1VOMA 4FVMA 3GIJA 3IBCB 3VHQA 1EKRA 3FEXB 2ILZA 1QUVA 1SIWB 3S1TA 4ZPVR 4WTYA 3QNWB 1QLNA 1SJRA 4G1IA 4LF7J 5D4PA 4LIWA 1WC3A 3JQJA 3JSMB 5CYQA 3CCLS 2PFDA 4FXWA 4NLPA 5DQHA 4Q8EA 1LW0B 5DG9A 4LFBJ 4PG4A 1S6UA 2LU2A 3VZHA 1AYEA 4QR2A 4K4VA 3HZEA 1FFSB 3DOLB 2M8HA 4DPXA 4FBUA 3NCRA 3KLFA 4HR2A 1XNQF 1HW9A 2HQCA 1RT7B 5LSLA 1SL0A 3JB9k 1UKUA 2O1PA 2I6WA 4DQRA 1RT5A 1S1WB 1YRXA 5KFEA 2ZHOA 2L3MA 5IWAF 5EWGA 2D3UA 2HHHJ 4KQZA 3QO9A 4KYZA 1BLUA 1UVMA 3RB0A 2BJ1A 1NBEB 1ZTWA 1NK0A 2HMIB 2YNIB 2BABA 3KLEB 3G71S 4TU7A 3ILJA 3ENWA 1H0HB 4HACB 8ATCB 5CYJA 1UTAA 1RHMB 5B7WA 2AJQA 4AE5A 3ZZTA 1FRKA 2ZUGA 3VZIA 5DG7A 2R9LA 3EDQB 3KLIA 3DRYA 3M2RB 2HHXA 1A6LA 2WONA 3VGTA 4F0HA 3BGUA 2CNLB 1FXDA 3FQKA 3RRGA 4RR5A 4FBTA 1SI9A 4OZ0A 4DN9A 2BVZA 4CLTA 3N01A 3TUJC 2VQEF 2DY9A 3OVBA 1TU0B 2NYIA 4U8VA 3CW2C 2BUNA 1GTEA 5KFOA 4OJHA 1SUQB 2KYXA 2AGQA 5LOQA 2CJAA 1K0TA 3MR6A 4DV5F 3DFEA 1S1UB 1UEUA 2CPJA 4WWSA 1B64A 1HNIA 2V8PA 4DR1F 1U49A 1R8HA 1U25A 3VGVA 4NLDA 3J81Y 1LW2A 1GTHA 1IR2A 3JYTA 2B9EA 1RAOA 2DCLA 2JVOA 4TYBA 1NUEA 1IBLF 3BZQA 4LF7F 4RW9B 3HPOA 2V34A 4LRAA 2VV5A 1R0CB 1TKDA 5J2PB 4QR0A 3MMBB 4RL1A 5LMUJ 5D77A 2F8HA 4C0OC 4RNMA 1UAWA 5HAOA 1TL4A 1ZAVA 3PRVA 2AKWB 1TL7A 4WJBA 4K5SA 4C8MA 2ZH2A 4Y65A 1DTQB 3E01A 1ZH5A 2HHHF 1G6BA 2LQ5A 4NCBA 2UXBJ 1HPZB 2OH2A 3ZFVA 3BGRA 5KFJA 3I31A 1FRIA 4EYHB 3M8QB 4ANEA 3N6LA 3NGKA 3QJLA 1WD6A 1X4AA 4EO8A 2RJZA 2J0XA 1C1BB 2JLGA 2L41A 1L3UA 1X4GA 3QSIA 3I82A 4IDKA 5C7PA 4UF4A 3TUZC 1GMVA 1WOPA 1JJCB 4LF5J 3PW4A 2KFNA 4FS1A 1RJJA 1WTBA 2XZ2A 3RRKA 1RAJA 4TVAB 2VFVA 1RQ0A 3PX0A 3AJ2A 4IYQA 4UZBA 2XGQA 4EYIB 4FDFA 1YJVA 3OXLA 3VAKA 5EHHA 4NA1A 2HRUA 1EETA 1FJGJ 3MFIA 3BPSP 5KG2A 2ZHAA 1KD1T 4YDXA 2ALZA 3BQ1A 4U9RA 1T03A 5CYMB 2PMZD 4RKUC 5C42B 2G2YA 1HR0J 3KLHA 2Q79A 2GO9A 4Q5VA 3GIKA 3J7YI 4K4XA 2HIQA 3IG1A 3EWGA 3MCMA 2QO3A 3BR8A 2AYGA 1TKZB 1WC1A 2VOPA 2XMMA 3W61A 3CCUS 5LMUF 3GSIA 4DHVA 3LOUA 1RHQB 1IBMJ 1RWKB 2EEYA 4RNFA 1WF2A 1TKXB 5KFPA 1QAYA 1R89A 5MAOA 4K50A 5DS7A 2FJBB 4DX6A 3C15A 1X4CA 1HI1A 1JLFA 1U2RA 4IFVA 3DLKA 4PWWA 5GAEI 1UWBB 2MQNA 2RT3A 3NS7B 3HT3A 1YTYA 2UXBF 3ZTQA 3G8QA 3HVWA 1X5PA 3TRGA 3KK3A 3CO0P 3JTNA 3VCDA 3AQOA 2K8GA 2VFTA 3W8PA 5IT0A 2XTDA 1AB8A 3J81U 3UE2A 2ZZNA 2BMBA 1HBMB 3I9ZA 1U02A 3HDSA 3Q23A 1NB2A 4DV7F 2XMJA 1HIYA 4LF5F 3G9CA 5L9XA 3ZTRA 4L3NA 3CDUA 2GHWA 4C2MA 2DD8S 5DLFA 5F41A 2OPRA 4LRDA 1PAUB 2LA6A 2DGVA 1FJGF 4QW8A 3GFZA 2BRKA 3KMQA 1N5SA 3L7UA 2VJVA 1XEZA 1L3KA 2W2QP 3QLHA 1WC4A 3CDBA 1UA0A 2MGZA 8RUCA 1WC5A 4ZA1A 2KN4A 1QAIA 2AP6A 1J5OB 3CJ2A 1HKAA 2PIIA 1HR0F 1TUGB 4EEYA 4KE5A 2LEBA 4X66J 1RT6B 4DUTA 3DLBA 3R27A 2KDOA 2KTQA 3IAS9 2HQ3A 1D8ZA 1JJ2R 2XSFA 5LXYA 3VWSA 4HEA9 4MAKA 3K89A 4V1Ak 4J90A 3N28A 1SVDA 3QJPA 2QMUB 5GAHI 5FD1A 1NCLA 4FNHA 1ZZFA 4DSKA 3I5CA 4OJ1A 1IBMF 2VFUA 4Z2XA 4MIAA 3NKYA 4ZP7A 2BJ9A 2CQ3A 1Y3KA 2KXHA 2FHOB 4K4WA 1NPKA 1X5TA 3MGJA 4PEOA 2BQUA 1RT4B 4C11A 2VICA 4ZOSA 5KFCA 5KFTA 5K8PA 4QU7A 1TFWA 3C3LA 3CTRA 1MWZA 2W9BA 3EVWA 2OP5A 1EIYB 4HL9A 5E2QA 3OUYB 5KG1A 4MTPA 1N54B 3P96A 2M8DB 4USMA 2RKIA 3HHLA 3TARA 3W9IA 3CT9A 1S6PB 4U96A 1PYOB 1XQIA 3KDOA 1BQMB 4XPCA 3D6HB 4KB7A 5ETNA 2VBYA 5LJ5Y 4NASA 2YQ3A 3PZPA 2YVSA 2BE7D 4IH7A 2D3OR 4PQUA 2YKNA 3LP0B 3DRPA 4E0DA 5GAGI 4AL6A 2GMHA 2AF6A 4A8SA 2CPXA 4USTA 3CD5A 3WX4A 1JB0C 3DKDA 1RT2B 1HHSA 2FVRA 2FC9A 2C3MA 3JTOA 3M1VB 4LT6A 1R8PA 3MMCB 5AE2A 3NP5A 4ED6A 5B0CA 1TAQA 2DR9A 4ZIWA 3CJKB 3KK1A 2FJEB 4X66F 1M90T 2I5JA 4P72A 4O3QA 3BGLA 5A76A 3GQCA 5KT6A 1WI8A 4TKTA 4W98A 1SJQA 5F0UA 3MM6B 2OELA 4DCPB 1N5TA 5B0GA 5LL6d 4F36A 3EVMA 4A8QA 1PBUA 3C6UA 5DZ7A 1HQEA 2E44A 2HBRB 1NB7A 1UL3A 4P74A 9ATCB 2XY6A 4QYZJ 3D1HA 3MR5A 2W1BA 3NY0A 2YXLA 1JLAB 2YNFA 3MMJA 1FKPA 1FERA 5GADI 5HMXA 1T05A 1L3VA 3IS9B 1S6QB 4FF3A 2VB6A 2N7CA 3J7YU 1U6FA 2NXEA 3KXDA 3FEYB 1PILA 1IR1A 3QIPA 3F73A 4NLYA 1OJ4A 4IOCQ 4IO1A 3U1LA 3V4IB 2G2OA 2XY7A 2MHNA 1UFKA 3CC4S 4DSJA 1HFEL 3EXCX 2DEIA 3KLVA 3R2CJ 1JNRB 1VMBA 5D3GA 1WEXA 4QJVA 3F44A 4Z7YA 4LR8A 2VASA 2RS2A 2E5GA 1RT1A 5IXUA 2QN6B 3DYAB 1REVA 4DOZA 1R6VA 1HBOA 3DLHA 4ED5A 3L3CA 1UJ5A 3GU0A 5FJ4A 4DFPA 1VRQC 4WIIA 3KNGA 4O23A 1T02A 5T41A 1FJCA 1H98A 2D69A 1JIHA 1CBKA 3W2WB 1FDNA 2W9CA 3CJQA 3FCHA 4OZ3A 2P6SA 3A8EA 2VHGA 3QQCD 3H4BA 5KT2A 4CLKA 3Q8VA 1SV5B 2GNKA 3SQOP 3ADAC 3GYNA 3D1OA 1K73T 1F2HA 4FZVA 2XM3A 4UW2A 5ETPA 4NXNJ 1VQLS 3H2LA 1CQNA 4JI3F 1MWQA 4ECUA 4RUAA 1CC7A 2ALYB 3UR0A 2EFNA 3J7ZT 3SDEA 3FKBA 3I0SA 3X1LB 3FSIA 3FQLA 1EHWA 1S97A 1HNVA 4WXOA 2DNOA 2RE1A 3CUNA 4OI0A 5B0AA 1O8BA 2Z57B 3HI9A 3G82B 4RUBA 4DL2A 3OJSA 4MKYA 5F8LA 8AT1B 4LR7A 2L9NA 2P6TA 3GILA 5CXTA 1PIEA 4DF8A 2P9GA 1WF1A 4X64J 2H5JB 1WC6A 2J0QD 1RAHB 1DHMA 1Q86T 4CLUA 3OR2B 1JXVA 3M6VA 1KS2A 3DRRB 4FN5A 1LW0A 2ASYA 1NZ8A 4BC7A 5KTQA 2CQCA 2V4RA 5J2MB 5E3AA 4ZITA 3GPAA 1IVZA 3D4JA 3N0VA 2HW3A 1N36J 2L48A 1I51B 1Q95G 1M5VC 5I4MA 1QSSA 2HURA 3F41A 1S1WA 2KM8B 2A18A 1X0FA 2CPIA 2KKHA 3UO0A 5ETLA 3BKTA 4IQXA 1Q53A 2QEXS 3QIDA 3NWGA 2IJFA 4RU9A 1NPRA 2N7YA 1RWMB 1CULA 2HMIA 3K59A 4GRSA 1WHYA 3AXMA 3AWRA 2HFNA 4HACA 3CJ4A 5HBMB 2HVEA 1HA1A 3NCPA 1R0AB 3M32B 4GO5X 3BV8A 2MKYA 4OHVA 1PYSB 1NK6A 1X9WA 2B6AA 2ZZMA 1H2UX 2B4VA 2ZJRQ 2IBOA 2C2NA 2W4PA 2XI2A 4Y00A 2ZBQA 3M2RA 3A1YG 4Q2LA 4OI6A 4IKAA 3QGIA 3T1HJ 3W8GA 4NXNF 4MFBB 3OSNA 1YITS 3V6DB 1OPZA 3RZAA 1Y0HA 1WG1A 1KHVA 4XDDA 2IRYA 4H4OB 2YKQA 1RAGB 4ENOA 4W92B 1SUQA 4HT5A 4M5JA 3UW1A 4ER8A 2G0JA 2PMWA 1NJXA 3I96A 1PC5A 1P27B 5C25B 2YWHA 3QJJA 1S1UA 3M8WA 4NZ7A 4IH5A 2QJ3A 5HVGA 4WU3A 2ZOFA 3HCXA 5HVHA 1CJUB 4CLPA 4USUA 3OLBA 2MLZA 2W7AA 5HROB 4DFKA 2DGWA 4RW9A 4LSNA 5E41A 3BEGB 2GCFA 3P45B 3MMBA 3A8KA 1HNXF 2ABYA 1AT1B 4GVBB 5IM0B 1N4LA 3RW7A 4DEZA 3OHBA 4OX9J 4DV0J 1S0VA 1U1QA 3C14B 2H9ZA 3MD3A 4P2SA 2I1RA 4C8LA 1N36F 1HW8A 1N5YB 2V50A 5KFIA 3CDWA 2DPJA 4KIAA 3MEGB 3BF4A 2GAGC 1DTQA 2JC0A 2M70A 4A48A 3FJ2A 1SC3B 4DX8H 3G4SS 1UA1A 2RSQA 2AJ2A 3M8QA 3FVYA 1S9GA 3UFCX 4YHHJ 1OMSA 3TZXA 3PJWA 5IC4B 4IR1A 1JLCB 2MKCA 1C1BA 4K4YA 1VLYA 5DDQC 4C8ZA 3KDNA 2VPYB 2CJXB 3CO9A 2A2CA 4DR5J 3HXMA 1WELA 3PFEA 4LF9F 2ZH4A 2HLUA 3T1HF 3TJ9A 4DR2J 3PACA 1U48A 3NNAA 4X62J 4PKDB 4Q2MA 5JUMA 4CWBA 4OYBA 1K9MT 3AHPA 4DG1B 2DIUA 2IJRA 3W5ZA 2BOAA 2LQ9A 2IM2A 1SPBP 1PJ5A 3IA0A 1FCAA 4MIBA 4M95A 5KT4A 1N33F 2U1AA 2JOQA 2HHUA 2DGXA 5E3RA 4Q8FA 1YJRA 1D0EA 3CIMA 3W66A 1HWKA 2CAJA 3P49B 2WVBA 1Z4UA 1T95A 1H7XA 3HHKA 1NK9A 4JI4J 1E6VB 4NLRA 3H0PA 1CS4A 1TKZA 5JMNA 1KR4A 2IHR1 5HQLA 4NLTA 2RMLA 4LF1A 2CPHA 4OX9F 3DLEA 5KFRA 3BBFA 4B3TJ 1TKXA 1RCOB 2IM3A 4NPOA 4TU9A 1KP6A 5F8NA 2M4MA 3D3CJ 2R8GA 4F50A 1CG2A 2V4JB 1VBXA 5EX3A 1HNWF 1NSKL 1R0BG 3A3OB 2PA8D 4USKA 1EKSA 3U02A 2W8LA 1FKOB 1BXNA 1WNEA 2UU9J 3PM9A 1KHWA 2AV5A 4AL7A 4H4KA 2JRSA 1ZM2A 3TAPA 4DR5F 4F2SA 5ETTA 3SSRA 3GE9A 1WKLA 2HWHA 2RQCA 1FA0A 2UV8A 1VK8A 3UD4P 1T94A 1OS5A 2Z8QA 3GIRA 2NREA 3CDEA 3EGWB 2HVHA 1LWEB 2FC8A 3JSRA 2Q6CA 3VV2B 4J37A 3L95X 2V67A 2LA4A 2B9YA 3IRWP 3LP1B 3QT7A 4LUBA 4I6AA 1J5OA 1YG0A 3FRYA 3D28A 4M5MA 4K0KF 2V1SA 1RT6A 3D3BJ 4ECZA 2FY8A 2CPDA 1UJ6A 2G1DA 4F26A 4NLGA 4LSZB 4JI4F 2VL1A 1LNQA 2G0IA 4M1KA 1KVKA 1NDLA 1B0VA 3D5MA 4HDGA 4ILRA 2R2RA 3C8YA 2CQ4A 1IM6A 5KOXA 4F02A 2A6MA 2HBYB 3PHEA 4LQ3A 5G4DA 4C8KA 4TYAA 1UUJA 3I9V9 4G6VB 1VQMS 4OI4A 4E98A 2HVDA 3KFWX 2GVZA 4RW6B 2F3JA 2QGFB 1H38A 3PHTA 4MKBA 3C16A 2C28A 3K0JA 2CIMA 2GHVC 1TMMA 1RT4A 2Z2LA 2R42A 3K58A 3WBZA 4CNYA 4QIFA 4C7QA 5IS2A 3NMAA 2ZBRA 2HFZA 2XSJB 2DXFA 3UDLA 3LQVA 3B82A 4TN2A 4LF4J 1HMVB 2E5LF 3OUYA 2CQ1A 1ULRA 3JXOA 2HWIA 2CQIA 1I6JA 1FFGB 4GO7X 4I2PB 3ETOA 1VIOA 1JJ4A 1S6PA 4PWUA 2H65B 4WK1A 3AB4B 3MI7X 2LYVA 1BQMA 2XCPA 5KFBA 1IWGA 4ALZA 1U09A 1JWWA 1RYSA 1LFWA 4U67Q 2HBZB 1KQFB 4JI0J 3CULA 3LP0A 3NAHA 1I3OB 4CTAB 4B3RJ 1NHVA 1F2GA 4X4QA 2WSFC 4FYWB 5DZ6A 1T7PA 2FHKA 4F4WA 1EQ0A 4DLEA 2DRDA 4CNZA 2P8IA 1YZ6A 1RT2A 1JKHA 3DM2B 1BC6A 4K4TA 4WTOB 3NL0A 3M1VA 4LBIA 2A1BA 3MMCA 1RTZA 1SKSA 3HKWA 3CJKA 3RR8A 3ZZ0A 2M5YA 1IKVA 3GG0A 2HBQB 2BM0A 4X4SA 4B3MF 3MM6A 2DT9A 3I6PA 2GHPA 2WBMA 3OTDA 3HKZD 3EPGA 2RNEA 3L4BC 5I3PA 2QA2A 5F3TA 3LAKA 2GMJA 4ETXA 1D9FA 3DDIA 2PA3A 5IOLA 3LW5C 3KJFB 3IR7B 1REGX 4ILMA 4DL7A 1UWAA 4QZVB 3KHHA 3IS9A 3U7JA 4CO4A 4C0BA 2GMLA 1IM4A 3WZ0A 1BUXA 4WKYA 3KK2A 1H2VZ 2B5JA 4K4SA 1UPPA 5K8NA 3N4WA 4LF4F 2YPYA 5F0WA 1RA7A 3NS5A 1RTIB 4OZ5A 3ZTPA 5KG4A 4G65A 4IRDA 3PW0A 3V4IA 2WOMB 3AD9C 5CABA 1Y5LB 3QRPA 3SCKE 3NXZA 3EICA 1RHRB 2VG5B 1HWJA 4XTTA 1FD8A 3BO3A 4LVNP 3RAQA 4A8FA 2ZH5A 2GQCA 4BHQA 1LWFB 4OZJA 1RWOB 4DCJB 4B9VA 4DR7F 1RZMA 3CPWR 2XNRA 4NCGB 4NYPA 2N4CA 1JLGA 4ZCIA 2YPZA 4O3OA 2HFUA 3T6BA 3ILOA 5AXLA 2DR5A 4OLPA 2NZCA 2MDAA 4EMDA 2PE8A 4HTJA 3QFHA 3SXLA 2VOOA 1HBNB 4OYAA 1SV5A 5HQMA 5B0BA 3BQ0A 2GX8A 3NGSA 5E5NA 2CPEA 2ASJA 2IPOB 5F8JA 3AFGA 1DJ0A 3IMQJ 4I0WA 1D3WA 2W2MP 1CJVB 3AJ1A 3CD0A 5D0EA 2FUG9 3J7A1 5H1SV 2NR0A 1XJWB 4FS2A 4DS4A 1YJWS 3CMES 2M7SA 2H51B 3PYDA 5D4OA 2LECA 2VH7A 3HVTA 2ZUAA 4OZNA 2QRRA 3HP6A 2QYGA 1MN7A 2J5AA 1ACMB 3J80U 1NJZA 4B08A 5ETQA 4M5LA 5RUBA 1N32J 1VISA 2RH3A 1IUJA 2NXUA 3TR5A 3BBCA 2CQPA 2RDJA 3OFHA 1R3NA 3DRRA 1SJFA 2DRAA 1U6ZA 1SL2A 2KHCA 4NEYA 3QRQA 4O4GA 2DNNA 2A3JA 2KI2A 4QWDA 3J7Z5 3EUNA 3FBCA 2VJUA 3RAXA 3CNQP 1KBRA 2J6TA 4KGZB 3MAHA 4B9TA 2C2MB 4DSEA 1FRJA 1JLBB 2AEMA 1C0UB 2H3EB 1LK5A 2BQRA 4ECYA 1TELA 3MHYA 4HT7A 2CYYA 4U8YA 4ECVA 1FI4A 1F5AA 4V19X 4HLBA 1WOOA 4GKJJ 5HBMA 3T9NA 1R0AA 1WEZA 1Q4RA 2LU1A 4DJBA 1S48A 2ASLA 1N8RT 3PIOQ 5BJRA 1M1HA 3I5BA 3LP2B 5MLCV 4PYDA 4ECWA 1FRHA 1TL1A 3BPDA 1S99A 1GQEA 3DMJA 4F4ZA 3GB0A 5T7LB 3K5PA 4ETZA 3T5HA 3VGUA 3P5TL 4H4OA 3MTJA 2HGMA 3AA8A 4MJKA 2M9KA 1FE4A 1U1MA 3GV8B 1M0SA 5C25A 5BR8J 1K0VA 2J7WA 2NPFA 5KFZA 3U1NA 1D09B 2KVQE 3CCTA 1FRXA 5K20B 1VBZA 3TZYA 2HZVA 4F3QA 1APSA 1N32F 3VGSA 2BE2B 2R7SA 2FB0A 2DJWA 1VQ7S 2Y8YA 1FO1A 2BZ2A 2RQMA 2EBGA 3HULA 1BWVA 4V19J 2J7KA 4K4ZA 4AUKA 5IM0A 3LWLA 3OW2R 1WSVA 3C14A 3TVZA 2YQ0A 3L7OA 1O6XA 3SQGA 2XQCA 2ROPA 2UXCJ 1N5YA 1RDRA 4KKOB 2D1CA 2C2EA 3MEGA 3DC2A 1LWXA 1VYAA 2WVCA 2MHEA 5IT9Y 1KN6A 2OFHX 2B7BB 2XULA 4K2XA 2J9CA 3CCVS 3SZ2A 2XZTB 3BREA 2W8KA 3MM9B 3TANA 2FLOA 1Q0NA 5E7OB 3CCQS 4C98A 5J1PA 3H5YA 2FVQA 5L38A 1ZM9A 5EX0A 1JLCA 2XZWA 1X4FA 4LQ9A 2DNHA 1N5QA 4OI2A 1GMWD 3IRXA 4UOFA 5KFDA 4X4RA 1U8WA 3RBXA 4JV0A 2FGOA 2OLWA 1U1PA 3NOGA 3AOBA 4WBFA 3M8YA 5KFNA 4AQYJ 1KLMB 3MAAB 3DHXA 2X3GA 4JV2A 3IM9A 4HVZA 3M6WA 4DG1A 4K7QA 5HP1B 1FDAA 2X51A 3ENAA 1GX6A 1YGYA 2PSZA 4FYXB 1U0HB 2D41A 1SCJB 4IFYB 4RW7B 2E66A 4M5DB 4AL5A 5BR8F 4ZVEA 2JZ5A 2DHAA 3EGVA 1V9OA 1N0VC 2EXUA 3CJSA 4ELTA 1U2CA 4Q44A 2BA9A 1F1BB 1YQHA 1Z2ZA 1LFPA 2HK3A 2JEJA 3KG1A 1Y9OA 2FHJD 5IFMA 3C6TB 3CJRA 2XLKA 5KFWA 3WIUA 2VPWB 2GA7A 2XC9A 1WG5A 3NLCA 2OMOA 1TL3B 4PUOB 2DNGA 2V8VA 2VIHA 4OZ1A 4ZHRB 2WZ1A 1EARA 1URRA 2AJ4A 2HQIA 2IC3B 3OFGA 4X4OA 2OUGA 1N34J 4DPUA 5F3ZA 5KG3A 5H9EK 4QIEA 4I69A 2AYBA 3MM8B 1JMTA 3JS9A 1UVLA 1VQKS 1RWVB 2EW9A 2V4JA 3TQ1A 3PYGA 2BOPA 4UZCA 3US5A 4FNIA 2JHEA 5F8MA 4HYKA 1S7HA 1M1KT 2V6AA 1P6TA 4M94A 3EGZA 1GMWA 2ZBPA 4D3GA 3TEHB 2EKNA 4DUZJ 3D9BA 5A0YB 3QZ7A 2E1CA 1H73A 1DTTB 4LSLB 3IC1A 3LUYA 3MD1A 1RTJB 4AQYF 3PEHA 2UVWA 1U7LA 2RVJA 2HNYB 2RD5C 4IH6A 2YQ1A 3H25A 2BYCA 1DZ5A 1RU2A 1FTCA 2WBRA 4J9LA 1S6OA 1WKKA 4UY8T 3G6YA 2YWEA 4MK9A 1VFJA 4O44B 3RUBL 2FVPA 2DH9A 3LP1A 3H98A 2DHGA 4ECSA 4OYPA 2ADBA 2R7QA 2QSFA 1DARA 4PXEA 1P1LA 2ZE2B 1J27A 4OJGA 3DRSB 2ZOGA 2QMXA 5DO2A 3MEDB 4I2QB 3T1AA 5KFFA 1UVNA 2CUYA 2AW0A 4XIUA 2E1RA 3LA0A 2IAJB 1WACA 4NZ0A 3FBBA 3K57A 3M8PA 2GJ2A 2QIFA 5HANA 3AA9A 4J5OA 1UFWA 4AD6A 1X5OA 4EGLA 2DISA 5GVQA 1N34F 5F9NA 1XMOJ 3DHWC 3GJTB 4CT8A 2QLJB 4CO1A 1VQ9S 4OHYA 3CB4A 4FPIA 2XSJA 1UPMB 1WC0A 3BQ2A 1GXLA 3QATA 2QMWA 1HMVA 3PEJA 4R0EA 3K5OA 4Q0BA 2FVCA 2R7RA 4NZ6A 1C4AA 2VDIA 4WYLA 4Z7CA 1TKTB 1NH8A 3O3LA 4I2PA 1OQ6A 4KGXB 2WRMA 4KV8B 1T3NA 3QGPA 4DX5A 4DUZF 2PI4A 4P73A 1B0TA 2RHQB 4L76A 1RWWB 4YB1P 5E3QA 2GIFA 1FK9B 2PDAA 1AFIA 2VFRA 3NG8A 1R8AA 5C24B 1NSQA 3OBIA 3NNCA 2HYIB 1S4EA 2QL7B 1TMJA 1PCAA 3MOJB 3DM2A 2CXEA 2JDJA 2B8QA 4J9NA 3H5SA 3K5MA 1TZ0A 2W01A 4ATNA 3ELHA 2GGPB 4C0HA 4DR4J 3TAMB 2Y1RI 2W7OA 3L09A 5D6GA 1BY9A 3SI8A 3CD6S 4WFXA 1RXOB 1SKUB 2XS2A 4YB7A 2GVDB 2CDRB 2DBBA 4DU8A 3L7PA 4L72B 4P75A 2DYAA 3CEDA 2R7UA 1GEHA 3F0NA 3TYTA 4NE9C 3DLGB 1CPZA 4M8LA 2FVSA 2IFXA 4HI1A 2AEJA 4J9QA 3D66A 4F4YA 2CWXA 3GYGA 4OX7A 4OL8A 1XMOF 2OSRA 2KU7A 1B3TA 3QYYA 3SV4A 3OT9A 3MAQA 2ZVIA 2YTCA 3MWBA 4I64A 5HQ8A 2IY5B 1S0MA 2VQFJ 2RDIA 2V4QA 3I4HX 4F0MA 1VRUB 4TY8A 1PYTA 4QWBA 1MSWD 2AZ3A 3BKFA 2DITA 3OD2A 4KO0A 1TUVA 2DRBA 1UVJA 4NRUA 1TR0A 4HHJA 1BMQB 2WOMA 2D9PA 1EP4B 3O8WA 2VBZA 3HHLC 1KONA 4M5NA 1DY3A 2MQOA 5DGAA 3E8OA 4OJ3A 1N5VA 2C3YA 7AT1B 4J9UE 4F4KA 2MZ1A 4DR6F 4DQPA 3IP0A 3AQPA 5H9FK 3PRDA 2ACYA 4KAIA 5LMNJ 3T6JA 1J5EJ 2OEKA 4QIVA 5KT3A 3BDPA 2NYHA 4QWEA 3BJYA 4JV5J 4DBQA 2M88A 3V4MA 5HVFA 1NPPA 3PRBA 4F4XA 2B9XA 3W2VA 1F60B 2VA2A 2YNGA 5IV3A 4G1PA 2RILA 5L1IA 3WX8A 2BRLA 4B9NA 2H4YB 1IQTA 4BWMA 3GJSB 2BACA 1ZBTA 4ZS6A 2IMWP 4ZVUB 2W2OP 1U1LA 1UZHA 2ZC4A 3W5XA 2EC2A 4OV1A 1HBNA 4TQRA 1N88A 2Y8WA 2U2FA 4Y2KA 2B4OA 3MUTP 1SC1B 2V69A 1RACB 1HBUB 2OI2A 1ROFA 4F25A 3AD8C 2J6SA 1NMEB 4RW8B 3PO4A 2OMLA 1UEVA 3VAFA 2ERRA 1YIJS 4R5PB 5ETSA 3CC7S 3GJRB 1Q79A 1SBRA 2BW7A 3DI6A 2YX7A 2YKMB 2DR6A 4YY3J 2AD9A 3HLUA 5ETOA 4LBPA 4DS5A 1R7IA 4DV4F 3H5XA 2D74B 2HHSA 2FQQB 3AODA 2UXDJ 4P9SA 1C4CA 4CLWA 3BSNA 2HGNA 1SKRA 4NCAA 5FLXY 4DL5A 4RO0A 5KFKA 3H5UA 3D7SB 4P2MA 1TV6B 2BJ7A 1Y10A 3DLJA 2F4VJ 2R8HA 1F5CA 4URGA 4R0JA 4UOHA 4BLGA 1JXLA 5LMNF 2RB7A 2K2PA 1S4FA 4B3SF 3N9UC 4JV5F 2P2CB 3TEGA 3MMAA 2R7OA 4OV6A 2ZM6F 4JI8F 2MPUA 1C0UA 3D1QA 5K14B 2HQFA 5H9FJ 5D0GA 4ES1A 1Q16B 1FD2A 4XO0A 2PO4A 5F8HA 2J6UA 2CNKB 2JL9A 2BR0A 2ZEJA 5CYQB 4ITSA 4RUCA 3N5FA 3V2UC 1KNZA 2Z2ZA 3MM5A 4U6PA 4G1QB 3SSSA 4B02A 1RAIB 3LP2A 4IG3B 4J91A 2OFGX 4NXMJ 4L6V3 5T7LA 3GFHA 4J9RA 5I3QA 1TAUA 2DHXA 1IKXB 4LFBF 4KGMA 4DFJA 1OSDA 3QO9B 2OSQA 2EFQA 1FDBA 3HD1A 3C66A 3MFHA 4A8WA 2LEAA 4JI2J 3H90A 4LRBA 2H5EA 1S1VA 1WDDA 3FDSA 2K7KA 5JXSA 3W5YA 1S1XB 1B7FA 2XMWA 4MYTA 3T5LA 5C2CA 3GTYX 2BE2A 3Q2TC 3PW5A 2JWNA 3PXGa 4YN3B 1DQ9A 1U4BA 1ZYQA 2IYIA 1KOOA 2ZDPA 4ZLPA 3TP2A 5HMYA 1IJEB 3GCXP 1RGVA 2E29A 1B4SA 1FRMA 4KPYA 1Q78A 4ANDA 4EBCA 1PC4A 2LXFA 3A8IA 3JAMY 4KKOA 2CQ0A 3MEEB 4X65J 3HK2A 4PXDA 5CCLA 5J2QA 3ZTOA 1AZSB 1TQLA 3QAUA 4EUVA 3H20A 3PCOB 3P6YC 4RBVA 1HNIB 3O5TB 1C0TB 5ADZA 1LW2B 1HL6A 3KWMA 1Q8IA 3MM9A 3A3PB 3IO1A 3JYTB 1U47A 2MTLA 2QC3A 1YJTA 2OGUA 3CCZA 4HH1A 1T9WA 1ZS6A 3RAMA 1NZAA 2MQQA 3T19A 5FLXU 4U7UD 2YNHB 4DPTA 2DO0A 4TNOA 4FKYA 1YX2A 3D54A 3O1LA 4WZQA 2NPIA 5CZVA 2QLXA 3C46A 3BGFA 4NYZA 1TL7B 4EWTA 2XO6A 1KLMA 1FHTA 3HSDA 4MH8A 2K3KA 2KFYA 3E01B 4LRFA 3DU5A 4U7UK 4DR3J 3AD7C 2AYEA 4IFYA 4RW7A 4NLUA 2KRBA 3M8SA 4M5DA 1ITPA 2G13A 3TZWA 3OHAA 5KFAA 3SFUA 3NGRA 2WW8A 2E1AA 2OEMA 4AT1B 3RB6A 2FZGB 4IOBA 3EX7B 3UR3C 1RWUA 5J1NA 3CJ8A 3OVSA 1RWNB 2AU0A 3C6TA 1NO8A 2XG8A 2CKWA 1BD6A 5E33A 2YWFA 4O4RA 3HHLD 1TL3A 3IBWA 4PUOA 6AT1B 3MR2A 3M30B 2AMCB 1B99A 1M5HA 2MMYA 4Y6IA 3TQEA 3RG6A 1CJTA 1IBCB 3V5RA 2DNYA 4DQSA 1X4HA 4JI6J 3BO4A 1T03B 3GJQB 3MM8A 1RU1A 3SEOA 3B54A 4C97A 1RSCA 2LDIA 4LIRA 2VODA 3KHLA 3N6NA 2WVEA 4RX6A 2FZKB 3SCLE 5KAKA 4IOAQ 3KTQA 2W7PA 3K7RA 1ZAWA 5ETRA 5D4NA 5EGYA 4O3RA 2L9DA 1W2BR 2VZ9A 3EPIA 3R5BA 4YB6A 4CH7A 2UUCJ 1NKBA 4B9LA 4BC9A 2VC0A 5A0YA 3QRRA 2BJDA 1WKJA 4O0NA 3M6UA 4CO0A 1XBWA 3ZZPA 1DTTA 1N6QB 1VQSA 4LSLA 2AZ1A 3G6VA 2JVRA 1Q1KA 4NX9A 3C15B 1JLFB 1ZZNA 1JXEA 3DLKB 3JAMU 2HNYA 2I0XA 5B0DA 2HZCA 3LH2S 3O6QA 4O44A 3UNGC 1FX2A 1OIAA 2HVZA 4ED0A 2Q66A 2V8GA 1HYSB 1KC8T 4JYAJ 3A8JA 2O66A 3FEZA 2C42A 1VBYA 4ZPDA 3DRSA 2Y3YA 1FDDA 4CLFA 2V68A 3MXHP 2F7VA 4QQBA 3T3FA 3MEDA 4ED2A 2IAJA 2XMVA 2XGPA 1RI7A 5CA5A 3E2EA 2PN6A 1PG5B 2F1FA 4QIWD 4DX7A 4QW9A 2IVYA 2MQ8A 2OPQB 2RF2B 4PG6A 4J9SA 4UY85 4DV6J 2HPUA 2HZAA 4H4MA 2CQHA 2QA4S 1S79A 4DQIA 1KQSR 1YRUA 4CLYA 2PD1A 4DF4A 2MY7A 4ILLA 4DSFA 1FRLA 5I3UB 2FLNA 1TVRB 3MURP 3KKFA 2DNQA 3ONQA 4I68A 3D6FB 1Q5YA 2YY3A 4OYIA 2EFVA 4I7FA 2EC0A 1H74A 1NK5A 4CH0S 2E9ZA 1NH7A 4CM0A 2VBWA 3V6JA 2XB2D 1AFJA 2HS4A 4KV8A 5G0RA 4HKQA 5IQ6A 4H4KC 5D78A 2QV6A 5EDWA 1O51A 3LF0A 3R3TA 2I8EA 2YX4A 3FBEA 2QG9B 1GAOA 6FDRA 1FX4A 1R43A 2E5HA 3FMWA 3F56A 2W2PP 2W25A 4A8XA 3KJNB 2E1MC 2CVEA 1K44A 3NEKA 4RJVA 4DV3J 4CDIA 4LRCA 3KUEA 5E3CA 3H2VE 2GW8A 1RABB 4MKAA 3OXFA 2W9BB 2L08A 2OO4A 3RR7A 1ELOA 1YWXA 3R1LA 1IXKA 4F3OA 5SUHA 3BSOA 4DL4A 1NK8A 1HNZJ 1VQ6S 4LFAJ 2GGPA 2EG1A 3ILIA 3MCNA 5HO4A 3TAMA 5KT7A 2NXNA 3FC9A 1NHUA 4LBHA 5CH7B 1FVSA 2KHDA 2UUBJ 2NXJA 2W4CA 3MPDA 3G6XA 2YKNB 5DRKA 5I42B 4QCLA 1UCNA 3DRPB 3M2VA 1S10A 1N48A 1CJKA 2V5HG 4QWCA 4FYDA 1RBOB 3DLGA 1IKYB 4J9OA 3UVJA 4NYOA 4A47A 2GV1A 2C3PA 1NKCA 2Y0SD 4DV6F 2F8MA 1HI8A 2K1RA 4DDFA 3TA2A 5HATA 1NDCA 2LXUA 1WHXA 3Q8RB 3MTKA 1KDNA 4L75A 2FJAB 1FXRA 2HWTA 2PT0A 1VRUA 4RLEA 2AHOB 2YWWA 3NOCA 4C3MA 3KLGB 3PO5A 4IRKA 4N76A 2A6OA 2ZBIA 1LXJA 1M5PC 1DFDA 2HFOA 3H40A 1EP4A 2YBVA 4JI5J 2HAFA 4N47A 1RHKB 2CADA 4P10A 1KVIA 3GYXB 1FKAF 4ZVPB 3M7VA 2MKSA 4Q45A 3THTA 2XYPB 4OX6A 3BH7B 2PI5A 3QT5A 2WAQD 2ZNZA 5AE1A 3R6LB 2HHQA 2YNFB 1N56A 1FKPB 2XYHB 2EPIA 1S57A 3W1YC 3W62A 3IBFB 2WB1D 4DV1J 4DV3F 3SFGA 2B8PA 4UOCA 3ILLA 1VK3A 1XK8A 5B0FA 4ICLB 4BWJA 3T41A 3RU0A 2BDPA 1XNRJ 5KG6A 1GXTA 4JOUA 4C8YA 4FKXA 2KB2A 3ZZYA 1HNZF 4EO6A 2BJ8A 1DQAA 4LFAF 4WFAQ 4ED3A 2P9CA 2ROGA 5D8HB 4LMZA 4ZJOA 2YKOA 2CRLA 3W64A 4J9PA 2RRBA 2UUBF 2M52A 4O3SA 1UVKA 1B70B 3VQSA 3HX9A 1HBUA 1RAAB 1U1RA 2CG8A 2HS0A 3JSMA 4EFAC 1UW9A 1RAEB 4ED1A 1XNQJ 1CQMA 1U24A 4X84A 2ZKUA 1FWPA 3CE8A 4RW8A 3PTWA 5IWAJ 2RS8A 4R5PA 1HBOB 3AXKA 4PXCA 3DOLA 1U1NA 2ZHBA 1YBTA 1T9XA 3CJ0A 4ES3A 4WE1B 1RT7A 3R2DJ 4CLSA 2VDHA 3GCWP 2R7XA 2YKMA 1S59A 1U1KA 1RAFB 4I56A 1QY7A 2ZWPA 1FWKA 3KYLA 1PBAA 1EB0A 1P1TA 1X9SA 3CCWA 4Y3CA 4YR0A 2UZAA 1YI2S 1CLFA 2HNZB 2K06A 2YNIA 3KLEA 1JQGA 4J9MA 4QWAA 3PJXA 4F2RA 4OYZA 4PPZA 2OHDA 4ZDNA 5KFXA 2XTJP 2C2DA 2D3O1 1PAEX 2VBXA 3HSZA 1HQ2A 1M5KC 1HNVB 2X1FA 1Y11A 4DV1F 2ZH8A 4RNOA 4DPOA 4OHWA 4DV5J 5A8WB 2FJDB 5KFMA 3EDRB 5K14A 4DR1J 3UCUP 2R8IA 2A2DA 4X2BA 1UW4A 2V2ZA 2CJQA 1XNRF 1JX4A 4OYWA 1SC4B 3HHEA 2Q3PA 2HRTA 1IBLJ 2ZH6A 1VJQA 4N77A 3KOAA 2P5VA 4C9DA 1AW0A 4CO5A 1M5OC 1WF0A 2X3DA 3BGOP 5HJXA 3JSBA 5AJ3J 1A9NB 4KY3A 4X64F 3DLLQ 2OPSB 4CLZA 4G1QA 3LGMA 4IG3A 1VC0A 1ZA1B 3HHNB 2CVIA 4CZCA 1FESA 4EK2A 3Q8SB 2AJ1A 5J2PA 2HKEA 1IKXA 2NS1B 1S1TB 4WIQA 4FF2A 4ZVTB 3DDKA 1Z2LA 5K8OA 3DNCA 1JLQB 2XWYA 3EVOA 4NA2A 1QSLA 3D6MB 3K2YA 2LMIA 1CULB 2VA3A 4LF6J 1RTDB 3LPEA 4RU2A 4DFMA 4OYOA 1HPZA 1IKWB 1S1XA 2YH0A 1MMNA 2J9EA 2QZ8A 2XNQA 2B6AB 3CWJA 5DM6Q 3FSXA 4MMOA 4I67A 2ZBCA 1H3DA 2GZOA 2GAHC 4DWIA 3MF5A 3H42A 1BQNB 3TVYA 1MW7A 2PMHA 5DG8A 3R7BB 2F4FA 2KXNB 1UEKA 3ISNC 4USIA 4FYVB 2RAQA 2V8HA 2WHOA 2DNZA 1KQGB 3M8ZA 3NAIA 4C48A 3BSCA 3PKMA 3MEEA 2CDQA 3AJDA 4CIOA 2KM8C 4ZVGA 4ZVQB 1IBKJ 3N79A 1AZSA 1X4BA 3HT0A 1JJHA 3UCZP 2E7XA 4BCAA 2VKRA 1BHNA 2HLTA 1C0TA 3PW2A 4E8UA 3HJFA 2VONA 4NLQA 3QZ8A 2VC1A 4QYRA 5CYMA 3KMSA 1RWPB 4KFBB 2H54B 4WK3A 1RISA 4LSNB 2GJIA 3R5DA 5C42A 4AXJA 1XWLA 1LK7A 3ISZA 1SH2A 4B3OB 4LF8J 1U26A 2SXLA 2YNHA 2RIJA 5AJ3F 4Y2CA 3GONA 3O2IA 4UQTA 5LM7E 2CNNB 4RBUA 1SJ3P 2BX6A 3MDFA 1Y5NB 2FJXA 4ZP9A 3QPIA 2GC8A 2OKQA 2JLFA 4JUZA 5T14A 1NAQA 3R5AA 2MKJA 1RHJB 3MM7B 5F9LA 1KKHA 4DV2J 4DV0F 4H54A 2MZRA 2XBPA 2D3ZA 3PY8A 2H48B 3HZGA 1RLDA 1T3OA 4A46A 2ZWOA 1YLXA 2G1HA 4LF6F 1RKIA 4ZVRB 1VI7A 2VG6B 1S9GB 5SZTA 4TU8A 1UWBA 3MCSA 3GFYA 4CLLA 3PR5B 3ZZRA 3G8TA 2VF3A 2XY5A 4ZLLA 4DV7J 4QBUA 3HSJA 1LWCB 2V8DA 2QLBB 1RT3B 4YHHF 2C2OB 5KFQA 3SIPB 2B51A 2LXIA 3OTEA 1AROP 5K8MA 1HBMA 4P7TA 4ZP8A 2HFVA 2EFPA 1NSAA 1S5ZA 4ZK7M 2ZZTA 4RPFA 3M30A 1WORA 3ZTSA 2R7TA 3UN3A 3GFXA 3GR0A 4UOGA 3PG9A 1FFWB 3OPKA 3G8SA 4DR2F 3PKYA 1T9VA 4X62F 1E6YB 1IBKF 2C3OA 1LKZA 2MLYA 5J2NB 3EZOA 5C5JA 3HVRA 4UTGA 2XTEA 1HLWA 2FD2A 3OSPA 4PAAA 4QIGA 1F6TA 2FPHX 4WFBQ 4I6WA 4P71A 3BH6B 4DXLA 3T9ZA 1WHVA 2BM1A 1VR6A 3G86A 2CPFA 1CS4B 1PKUA 2EFOA 1RBAA 3GV5B 4ECXA 2ASDA 3BN4A 2ILYA 4LF8F 2QL9B 1U6BA 1SH3A 1ZOTA 4TY9A 4NI2B 3DLEB 3RTVA 1FXLA 2OTJS 5D15A 3ZNUA 4XDCA 1N6QA 3TWZA 2EK6A 1K47A 2IRUA 3NCQA 3Q83A 4DV2F 2W9AA 2QA4G 3VAHA 4B3TF 4A8MP 2EFGA 2MZSA 2JFKA 3B4DA 2KO1A 1F0XA 1HYSA 3H8YA 2Q1LA 3P8BB 4USJC 2XMTA 1MMDA 4CI0B 2PEHA 5HJYA 2JX2A 3DU6A 3KJQB 2N82B 3CCRS 4WP9A 3IFEA 2CPYA 1KFSA 4TQSA 5L1KA 1UFLA 2J7UA 2LCWA 2XS7A 2VG7B 3K5LA 1WEYA 3PYFA 5F8IA 4Q43A 3CD7A 3MOZA 2UU9F 1SB6A 1X31C 2J0WA 2VPZB 3BB5A 3RB4A 3EE3A 4NLOA 5A8KB 1VC6A 2OPQA 2RF2A 3HVAA 2VFSA 4QOTA 4DLGA 2K7JA 2KYZA 3TA0A 1W26A 1VHFA 5DETA 4CRJA 4ED7A 3OTOJ 1V5VA 4KTQA 2DCUB 2JEGA 3OL7A 5I3UA 1VQ5S 3M6XA 1TVRA 3NS6A 2KXFA 3P5BP 3UN5A 1KRPA 2NSBA 3AY0A 4QYZK 4FF1A 1Y4ZB 2M2BA 1QJHA 2FYXA 5A8RB 3CCES 5AXKA 3GP9A 2MKHA 1SIZA 1Y3JA 3KG0A 2FJVA 3UD5A 4RUHA 2DPIA 4TLQA 4DL0C 1U45A 2P9EA 4Q7AA 2DR8A 2XYGB 2JLEA 1WJ9A 4CM2A 1U1OA 2B7CB 3DOMB 3FMBA 2GVZB 3UPFA 3HD2A 4OI3A 4FXDA 3B4MA 4ID5B 2IBKA 3C16B 3CSKA 1T0TV 2HAIA 1QD1A 3VQTA 2VUGA 3FFIB 3KUHA 2C2ZB 5GMKa 2QL5B 1KTVA 2IRXA 3AX5A 2COLA 2KH9A 1JLAA 3M8RA 3HSGA 1FF2A 4PRFA 2AT1B 3ZNJ1 2FGCA 2MZJA 2BKNA 2ZNYA 3KJVB 3KNAA 3AT1B 2GIQA 2MZQA 1S6QA 4KH1B 2F9JA 1FEEA 3SSQA 4HH0A 4C8NA 3FZBA 3Q0AA 3V81B 2DB1A 4FYYB 2WTFA 2KRRA 1V3ZA 2APOA 5ETKA 5GMDA 3OFFA 4P6QA 3D67A 1VCTA 5EWFA 5I42A 3D68A 4K5RA 3CC2S 3BKUA 2DGQA 1IKYA 3DDNA 1RLCL 2E7VA 1JKHB 1YJ7A 4RW4B 4JI0F 1R31A 3CJ5A 2R2UA 3OLAA 1QM9A 3H4DA 4OZLA 4B3RF 3ISND 2QLWA 2X1AA 3H7HB 2M0GB 3OTOF 4WPAA 3HFKA 4URSA 3HFZB 3DYAA 1BQXA 1C1CB 2HK2A 5KFHA 1FVQA 1V5IB 1IKVB 3KLGA 4K8RA 3WIVA 2LEPA 4DSIA 4U7CA 2OD4A 5LXRA 3I56S 2R7WA 4W4MA 3W2WA 1PJ6A 3VR1A 2R8JA 3OTCA 1FT8A 4DL3A 4C8OA 1OY8A 3WC2A 5CQGA 1TK8A 2HRYA 1MN9A 4JI3J 3MPWA 1Q82T 3D2WA 3FBFA 3U1MA 2YWKA 1X9MA 5CCMA 5AE3A 1XR7A 2FHMA 2DK2A 1YZ7A 4RNHA 2JEIA 3S7RA 1DRZA 1SQFA 2NUUG 5C2GA 2XMUA 3KK2B 2B5JB 2B0GA 4ICLA 5HLFB 2EKYA 1DLOB 3MPUB 1WOSA 2IDLA 1W2IA 2DXDA 2V63A 4NL5A 4PWDB 3SCIE 1XTZA 2F40A 3MEKA 5FDLB 3PDNA 1QVGR 3W9HA 2W24A 4JBCA 3G82A 1RP5A 2KG0A 5IQQA 2MKKA 2Z2MA 3CCJS 4WCEQ 3TI0A 4KPCA 2LP4A 4CO2A 2AX0A 1X4DA 3KHGA 1YRTA 1OY6A 5ITHA 2BKPA 2E1PA 4L73A 3TO8A 2BW2A 3OR2A 3TJAA 5GAEU 4NMXA 3DXSX 5IZHA 1AUDA 1IQZA 2DXEA 3PX6A 4NRTA 3FRZA 2J8SA 4IO9Q 2LLZA 4ES2A 5J2MA 1NEEA 2MJNA 1LV5A 4GVLA 1JLGB 2C2KB 2JH3A 4WE1A 3VAMA 1S12A 5CZXA 2R7VA 4M5GA 4ZP6A 1AUSL 4ZLNA 2CJKA 2NZ4A 1S9EB 1MU2B 1W25A 2JFDA 2LQJA 2X1GA 4NWBA 4DPYA 4Y2IA 2CQGA 2HHWA 4ZCLA 2RQKA 1YBAA 3R5JB 2HNZA 3MUVP 2FZCB 2UV8G 2MXYA 4YS2A 2RRAA 4ZKAA 2KG1A 4ZVFA 1T9YA 4ZPBA 4QR1A 2LFVA 3M32A 2DIVA 2R2TA 3PIPQ 2CJ9A 4WZMA 3E3XA 4USHA 3EGNA 2CG4A 2F63A 3DCAA 3TUIC 2D68A 4NLXA 2ROEA 1Y00A 4PR6A 1HWLA 1GH8A 2GQQA 4MFBA 1GXUA 2PC6A 1NK7A 5LJ3Y 3V6DA 2F9DA 2LKZA 1MG7A 2Y1LB 3ZZUA 1X4EA 3HVTB 2KT2A 5A8WA 1ZTTA 4J9VA 4ID8A 4XAKA 1URNA 4ZN1A 4DZ6A 2AGOA 2EVZA 1XERA 3M9OB 1ZA2B 2XMAA 4FPRA 2HQGA 4DZDA 5GAHU 2Y1IA 1DAXA 1L3TA 2Z58B 3HFVA 3IGVA 4CYUB 2AGPA 3NGDA 4ECQA 5BXIA 3FUYA 4BDPA 2X7IA 3UCGA 1VQYA 1KVJA 3MZIA 1HNXJ 1CJUA 1GFWB 1XR5A 2OPSA 1VQ4S 5HROA 4EU0A 4O4GB 3LGNA 1I94J 3AX3A 2IVFB 1L3SA 1RBLA 2DKOB 2Z30B 3ETMA 1S1TA 3TW0A 5BYSA 1MWYA 2MSTA 2NUHA 2QFJA 4GVBA 5LT5A 1KLNA 2DGTA 3QT6A 1JLQA 2V2QA 4C4WA 1FJEB 2VU5A 1LEOA 4WYWA 1OO0B 4DUYJ 2DNKA 2DVIA 1RTDA 4ZVOB 1V3RA 1R27B 4WFYA 3UI3A 3RBZA 1TK0A 5L9NA 1MROB 4IQMA 3R8YA 4A8KA 3JQKA 1YHQS 5KFYA 1IKWA 2KT5A 2DNMA 4R8UB 3W63A 1I1GA 5HSPA 3D0GE 2BBEA 5GAGU 5HMZA 5A6WA 1VQOS 1ZM4A 3OR1B 3THVA 4GKJF 1CSJA 1TL1B 3MPYA 3W7BA 4LF9J 1BQNA 2YX1A 1KTQA 3DMJB 2HFSA 3MCOA 5DJBA 1Q8LA 4OLOA 4L3KA 3BYRA 2IM1A 3DOKB 3G87A 1Y5IB 3C19A 1UVIA 4KC5A 2CWKA 4CP5A 5CD4H 3OL6A 2LQ8A 1NJIT 1Q8KA 1N33J 4ZCKA 4KRWA 3B6BA 6FD1A 3H59A 2Q43A 3K5NA 3FSYA 2EG2A 3HJVA 5ETVA 1DBDA 3IR5B 4PG8A 1ZAXA 5HN0A 4ELUA 1SQEA 4KFBA 3JSYA 1RTHB 1YJ9S 2DH7A 2QTWA 2CFXA 2V1TA 1KWMA 4B3OA 1QE1B 4GC7A 2C2RA 2DHHA 2V0NA 4OMFG 2ZH1A 7FD1A 3DGVA 2KJVA 4NLWA 3GG1A 2RUSA 5GADU 3JTPA 4O3NA 3VALA 1I94F 2Y0BB 3SQGB 2ZKTA 1E6VA 4UUXA 4OYXA 1GT8A 4DU7A 2EBEA 2HNDB 5A2QY 3DGPB 1EZZB 4KHPJ 4RWWA 4HTIA 3PR4A 3FNNA 3R6GB 2B4PA 4PQAA 3S8SA 3MM7A 1U8SA 1NJWA 1OY9A 1RWXB 1BWEA 3UN2A 2UXCF 1OQ3A 1G2EA 4DUYF 1HNWJ 4N41A 4IR9A 2FIUA 4NLSA 2VG6A 3ZZZA 3VVUA 3UNYA 1C2PA 1JNZB 3NBPB 5BYQA 1SQGA 1WG4A 4YR2A 4C6AA 2POKA 3CJTA 1LWCA 4M5IA 3IRXB 3VF0B 5AXNA 1S9FA 2ZVSA 1RT3A 5D4LA 3DRXA 2I38A 3UD3P 3QGGA 1FKOA 1OYEA 1Q7LB 3MECB 3OL9A 2I2YA 3IWXA 1MNEA 1YK9A 4MIWA 2BXJA 1FTRA 2RRNA 3POTB 1NKEA 3OVAA 9RUBA 3NMRA 4CH1A 3MUMP 1S76D 2UUWA 2MJUA 1E6YA 2BV3A 2HGLA 5J2NA 3K17A 3BR9A 4BBYA 2J9DA 4NOHA 3MR3A 1YDLA 4M5KA 2B3TB 4K0KJ 3ET6B 1IWAA 2EK1A 5JVHQ 1LWEA 5IT9U 5EN1A 1KQKA 1UMJA 4WFNQ 3Q89A 2Q6BA 3M2UB 5CHCB 3I0RB 3J81j 4DI6A 4E2FB 2MLXA 2XI3A 1QAXA 4KGVB 4N8NA 2B4UA 3CJ3A 4FP9A 2DGOA 2NXCA 3EM1A 5D0RA 1SH0A 4NI2A 1CC8A 2V9WA 3Q8UA 2IA0A 1G3OA 2HIYA 4JB8B 4YP3A 4F7VA 2O3DA 1B7YB 3SYZA 1V3SA 4IUFA 4PXBA 2FTRA 1HHQA 3Q2SC 4KHPF 1QTNB 1N52B 3GIIA 2XMKA 3Q8YA 5B08A 4RW6A 2IDEA 3T5KA 3PFOA 2E5LJ 2V94A 3EXYA 3GWCA 2ZD1B 4JV1A 1Q8BA 1HI0P 4RBTA 2C1EB 3SCJE 4A4JA 1KEKA 4R25A 3TX8A 2HVIA 1R6YA 3AX2A 3ITHB 1NSPA 2WK4A 2KZMA 2DNLA 2DGUA 5H9EJ 3Q8PB 1QDUB 2VG7A 1P8GA 5KG5A 3CDAA 3KUGA 3S01A 5U47A 1FEHA 5A2QU 3EJMA 4FVCA 5DQGA 5A8KA 4IRCA 1CVJA 2F65A 2BANB 2AWZA 2ZH9A 2DEJA 4CTAA 4XK8C 2WVFA 2N4DA 2UVUA 3W65A 2C3UA 2WVDA 3G2XA 3QFWA 3VAJA 2R2SA 4Y2MA 4HHUA 2V9KA 2RQ4A 2DNRA 1TFYA 1Q7YT 4OFZA 1R8BA 1SXLA 3CCMS 5A8RA 1VDHA 2WB4A 4B3MJ 3I87A 4KR0B 2XHWA 2DTJA 3DXBA 3GLJA 3HF5A 2O01C 2CA9A 5LSRA 3NWRA 1UJ4A 1T8EA 1D9DA 3DOMA 3M8PB 1QUPA 2OAUA 5J1EB 4ID5A 2M3DA 3FGVA 3DN9A 4P7VA 2HQDA 3FFIA 3IGNA 4Y2AA 3EZUA 4ZLJA 2WSCC 1NDKA 5GMEA 2HEKA 3I4PA 4IG0B 1HARA 1HQUB 2YKAA 3CCSS 1HHTP 1ZPVA 4LVOP 4Q0BB 3KJVA 1G1XA 5CD4A 1S7IA 5L39A 2YH1A 2IYGA 3WQPA 3PX4A 2J76E 3RGIA 3A13A 2A0FB 3V81A 1S0OA 1A0OB 5LSOA 4WP3A 3ENQA 1D9AA 1W7WA 3ZXWA 1RTIA 2PFFB 3OQ2A 1L5UA 4KHMA 4F3MA 1HD1A 2W2NP 5JJBA 3V6HA 2VG5A 1YJUA 3B78A 1U2FA 4DR7J 2OPPB 4N5SA 2CQBA 1X5SA 1NNDA 4RW4A 1OYDA 5DGBA 3MR7A 1LWFA 2KL8A 2G2ZA 2V2KA 2UUAJ 4P2FA 4NMLA 1T9TA 1C1CA 1UP1A 4NCGA 3UDCA 4MK8A 3J80Y 4B9MA 3SV3A 2G0CA 2Y9HA 2O67A 3A12A 3GZ7A 3RRHA 4KJIA 1OM2A 2GIRA 1RKJA 3GR1A 1I5OB 2KVIA 4L74A 1OPIA 2B56A 1RYRA 5L8RC 2KZZA 1O0PA 4TLRA 4DR4F 1VIXA 1VRTB 4OI1A 4QPXA 1TTHB 1WI6A 2X1BA 4AXIA 4MT1A 4DMZA 2BKOA 3R5CA 4RZRA 4LF2A 3EYZA 2DGSA 3RJMB 3HMJG 4O0IA 5BYRA 3R7NB 1Q81T 4Y28C 1ZETA 2MSSA 4DL6A 2H1YA 2BEFA 2QT7A 4P2XA 2CQ2A 1CJVA 1VGYA 1Z1ZA 4TY8B 5HLFA 1DLOA 2Y1JA 4PABA 2E9TA 4YR3A 4KO0B 1JLEB 2B43A 4PWDA 4K2JA 4CO3A 5L1LA 2AEFA 5FDLA 3A4TA 2VQFF 1K1SA 4K4UA 1VQ8S 2XLIA 1UZDA 3SBMA 2K3IA 3CVKA 2HS3A 3QWPA 1B0PA 5D0HA 4TXSA 2EWHA 2AJFE 1VS3A 2R4FA 1GNKA 5DDPC 2JJ4D 2IM0A 5F8GA 3EMTA 1LXNA 5DDRC 3RW6A 1X60A 4AFFA 2Z56B 3T1YJ 1AXQA 3W2VB 2QX0A 4WU2A 3ZZOA 2YNGB 4B17A 1DURA 4GMKA 3CXCR 2NQPA 3D0HE 1J5EF 2UUAF 3I55S 2I9SA 1VLOA 5FIIA 4S0MA 4XPEA 4I6YA 5M2UA 2LQBA 1S9EA 1MU2A 2QLFB 3BN7A 4QU6A 1JLBA 3GIMA 2FY1A 2MZTA 4LFCJ 2DO4A 5DLGA 5KFLA 1G7CB 3BYPA 4YQWA 4ZIVA 2QE5A 1SC6A 4CQ1A 1RB0A 4A8OA 3PNIA 1S49A 3Q8QB 1F5BA 3BDEA 5IT4A 5IC6B 4ZPWR 4PG7A 1OWXA 2D9OA 4ZMMA 1QVFR 4X4TA 3H2UB 2XZDB 4USVA 3BSAA 3LANA 4EZ6A 1LOUA 3KLFB 5E3PA 2FDNA 1S72S 3Q24A 2YKPA 3DI6B 4KH0B 1RT5B 2XEXA 1D1UA 3VAIA 1NK4A 3FZ2A 3RBDA 3RBEA 2DNPA 4PG5A 4X4PA 2HHTA 3LO3A 4DN0A 4QPTA 4CYUA 1WTFA 3D6TB 4YY3F 3R9LA 5E0OA 2AYMA 2ZOMA 3IAM9 5KFGA 2WW4A 2ATLA 2E5IA 4FF4A 2UXDF 2AIRB 2RDDA 1U0SA 4OYMA 2PEBA 1H7WA 4I1TA 3TNVA 3KLIB 1S0NA 2WONB 5HI7A 2NLWA 3MMAB 2J0SD 4USWA 2F4VF 3QSYB 4UT4A 3T1YF 2CJBA 1XC9A 2XCAA 4PPDA 2UP1A 3M9MB 2R8KA 3A3NB 4WXWA 1F3FA 2MQLA 5HK4A 3V6KA 2QYCA 3N5BA 3T5JA 1MROA 2UVRA 4LFCF 4ELVA 4R8UA 4OHZA 3OL8A 4ZVSB 4OQJA 4HI2A 1NM2A 1PO6A 4UQGA 3OV7A 3MM5B 5M2PA 3I32A 3OR1A 2VPXB 4N8OA 3NRBA 1OSCA 1VHIA 2OTLS 3EZ5A 4KGKA 4N7TA 4KHRA 3OFEA 1RCXB 1EAYC 5CAAA 3DOKA 1YBUA 1H2TZ 3L9ZA 1H6KX 2NSCA 4JI7J 5EUHA 3GV7B 4ZPCA 3LALA 3FK4A 4NXMF 2IIHA 4YB5A 1BGXT 2CQDA 2QA1A 1DQ8A 4W90B 1TL5A 2GQ2A 3MAAA 3AAWB 2LVWA 3NGUA 1KSPA 3PVXA 5HP1A 1D8YA 2KT3A 5K5MA 5HMWA 1S1VB 2MQMA 3BGRB 1U0HA 3CIZA 3Q86A 4F04B 1RTHA 1MLAA 4JI2F 4X4UA 4DSLA 2MKIA 1BE4A 3AH6A 2XWXA 1QE1A 3CMAS 3HO1A 2MYFA 4OZ2A 4IDKB 1KOHA 1NU4A 2O5DA 2XS5A 3IN5A 1EQMA 1FNXH 4ZJQA 3IWLA 5L46A 5KOWA 1CEZA 2HNDA 3DGPA 2ZH7A 5J2QB 2BE9B 3ULHA 1NRKA 3BBBA 1EETB 2DH8A 1TP7A 3M05A 2UUTA 1SKWA 4ZHRA 2ATCB 3WHIA 3OXGA 1A7GE 3E51A 4YMEA 2IC3A 4DCOB 1PGZA 2JEFA 2H5IB 4X65F 3NBPA 1EJ7L 2CJYB 3UDVA 3PW7A 5KG0A 4Z37A 1TUWA 3CGIA 1M1GA 2KFZA 1K8AT 3KLHB 4EZ9A 1YVFA 2QFIA 1SJ4P 4OIXA
chains in the Genus database with same CATH topology
2GFFA 4DBQA 4IKAA 2M88A 3QGIA 3V4MA 3W3SA 1KRPA 2NSBA 3AY0A 4C3KA 3PRBA 3IG1B 4NXNF 4MFBB 3OSNA 3MECA 1YITS 2ZJPQ 4FF1A 4F4XA 1Y4ZB 2M2BA 1QJHA 5A8RB 2B9XA 3W2VA 1F60B 2IJNA 5AXKA 2XLJA 3CCES 2DR7A 3V6DB 2IA6A 2VA2A 1OPZA 2YNGA 3RZAA 4G1PA 1Y0HA 2RILA 5L1IA 1WG1A 1KHVA 2BRLA 2MKHA 1SIZA 1YSJA 4XDDA 1QSYA 1Y3JA 3KG0A 3POTA 2IRYA 2OIHA 4B9NA 4H4OB 5L1JA 5KFUA 2FJVA 2E9RX 2YKQA 4RUHA 2DPIA 4TLQA 4DL0C 1U45A 2P9EA 4Q7AA 2DR8A 4W92B 1SUQA 4HT5A 1IQTA 4BWMA 2BACA 2JLEA 2Z0GA 1XR6A 4JI7F 3UW1A 1U1OA 1ZBTA 4ZS6A 2IMWP 4NA3A 1NJXA 3I96A 2B7CB 1U1LA 4ECRA 1PC5A 1P27B 3FMBA 2ZC4A 3UPFA 5C25B 1RTJA 2YWHA 4OV1A 3QJJA 3ZC4A 1HBNA 4OI3A 4TQRA 3B4MA 4FXDA 1N88A 1S1UA 2G4BA 3NNHA 2LDYA 4NZ7A 2U2FA 4IFVB 4IH5A 4ID5B 4Q2LA 2IBKA 4Y2KA 4BS2A 3CSKA 2HAIA 4WU3A 2B4OA 3ENVA 2ZOFA 3MUTP 2BJEA 1K1QA 3VQTA 2VUGA 4DR3F 3OLBA 2W7AA 5HROB 3FFIB 5B0EA 4DFKA 2G9OA 1HBUB 1ROFA 2DGWA 3KK3B 3B8HA 4RW9A 3M2UA 4N56A 3N6MA 4LSNA 4F25A 5GMKa 2J6SA 1KTVA 5E41A 4YFUA 2IRXA 4RWXA 5A6PA 1FNMA 4HDHA 3BEGB 3I0RA 4B9UA 4RW8B 2COLA 2KH9A 1JLAA 1QTMA 3PO4A 3M8RA 2OMLA 2GCFA 1UEVA 3VAFA 2ERRA 1FF2A 3G6ES 1YIJS 4R5PB 4PRFA 3MMBA 3LAMA 3CC7S 2FGCA 2MZJA 3LWMA 1HNXF 2ZNYA 2ABYA 1Q79A 5IM0B 1N4LA 3RW7A 4DEZA 3OHBA 1SBRA 3KJVB 2MB0B 2ZE2A 1XMBA 3KNAA 1S0VA 2GIQA 2MZQA 1U1QA 1S6QA 2H9ZA 2E5JA 2F9JA 3MD3A 1FEEA 3SSQA 4HH0A 2PGCA 3DI6A 3FZBA 4P2SA 4C8NA 2ZC3A 2I1RA 3Q0AA 3RB3A 3OTBA 4C8LA 3V81B 1N36F 1HW8A 1MMLA 1O5JA 4URQU 7FDRA 1N5YB 2DB1A 2YX7A 3VAGA 2YKMB 5KFIA 3S6EA 3CDWA 2DPJA 4KIAA 2AD9A 3MEGB 3HLUA 4ZVHA 2WTFA 3BF4A 2KRRA 4DS5A 1V3ZA 3TA1A 2APOA 1PSDA 1DTQA 3UQSA 4Y34A 1R7IA 4DV4F 4I2QA 3H5XA 2D74B 3OFFA 2OPRB 4P6QA 2JC0A 2HG4A 2M70A 2HHSA 1V6HA 5EWFA 4A48A 3FJ2A 1C4CA 5I42A 4DX8H 3G4SS 3BSNA 1UA1A 2RSQA 2HGNA 1SKRA 4K5RA 1WHWA 3CC2S 3M8QA 3IR6B 4NCAA 5FLXY 1LQ9A 3FVY<