2IJFA

Crystal structure of the poliovirus rna-dependent rna polymerase fidelity mutant 3dpol g64s
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVSNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of poliovirus 3CD: virally-encoded protease and precursor to the RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
molecule keywords RNA-directed RNA polymerase
total genus 145
structure length 461
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 2ijfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ijfA02
1XR5A 2VG7B 4IH5A 5F9LA 3NKYA 4Q44A 4EBCA 2E9TA 4ZP7A 2YNIA 2GIRA 3QLHA 5EDWA 4WE1A 3T5HA 4KO0A 1IKYB 1HNVB 3LALA 4I2PA 5FDLB 1S6PB 4TLRA 5KG3A 4LSNA 2YKMB 3I0SB 4ECXA 1RTHA 4R0EA 1FK9A 1S1XA 4EO8A 4J9RA 1RT3A 1REVB 4NLWA 3DMJA 4QWCA 4KBIA 1UWBA 4GC7A 4I2QB 4O3RA 5I3UA 2E9ZA 4K4VA 1IKVA 5F9NA 4EEYA 5J2QA 2QE5A 3C6TA 3KOAA 1HNIB 2RF2A 4IG3A 2RKIB 2R8JA 4IKAA 4O4GA 4QW9A 4YR3A 1LW2A 4TN2A 4NLPA 3QGGA 4IR9A 3MEGA 2C22A 4RW9A 4ZPAA 3OL7A 1GX6A 3OSNA 5KFQA 3OHBA 3QIPA 1Z4UA 5J1EB 4LQ9A 2XI3A 3M9MB 5KFYA 4LSLA 5C5JA 5KT5A 1S6QA 1SH0A 2XCAA 2YNHA 2IM0A 4WZQA 3KMQA 4Q43A 2HMIA 4LQ3A 2WHOA 3PR4A 2YNHB 3H98A 3NGDA 1HPZA 3EPIA 1D1UA 2UUWA 4IG0B 5EUHA 5C42A 4Q8EA 2CJQA 3DRRB 4RU9A 2VG5B 5L1JA 2FLLA 4K4SA 5J2PA 4ED0A 3KNAA 4MKBA 1LWCB 4IOBA 1C1CB 1LWFA 3IS9B 4WYLA 4G1QA 1MU2B 4RNNA 1C0UA 3MFIA 3GIJA 1TL1A 2ILYA 5L1IA 1TL3B 4ZVFA 5EWGA 2JEJA 4PUOB 1S4FA 2ALZA 5KFGA 4R8UB 4TYAA 2D3ZA 5DQGA 4J9OA 5DG7A 3C6TB 1RA7A 4IG3B 4K50A 3PVXA 3SI8A 3KLFB 1VRUA 4RUAA 4QW8A 4NLGA 2WRMA 2AGOA 5KG1A 1TKXB 3MR6A 3LP1A 4MIAA 3CVKA 4QPXA 3KHLA 3JYTB 3DLEA 4ECTA 2YKMA 3KLIB 1IM4A 5CYMB 3DLEB 3CIZA 5DQIA 1FK9B 1HNVA 1S1XB 2W7OA 3Q8RB 2R2RA 2IJFA 3HHKA 3GQCA 3UPFA 4RNMA 1JLFB 3DRSA 1C0TA 3D5MA 5L1LA 4IRCA 2R8GA 4RUCA 4NLYA 3IRXA 4O3SA 3RBDA 3CJ0A 5F8HA 3IRXB 4MK9A 2B5JB 2JC0A 3KLHB 3GIKA 1RTDA 4NLOA 5F8IA 4IDKA 2ASDA 3DYAA 3NAHA 4QWDA 4WFYA 1RTIA 2VG5A 1BQNA 3G86A 2ZE2B 3MEDA 4DL5A 1JX4A 1ZTWA 3V4IB 4ZVHA 2IM1A 2J6TA 1S1WB 3LAMA 5HROB 3KK3B 5KFOA 1NHVA 4FS1A 2B6AA 3C6UB 1TV6B 5DQHA 1FKOB 4ECSA 3RBEA 2FJVA 5HLFB 1MMLA 2FVRA 3FSIA 3PJWA 3KLEB 1S6QB 5C25A 3DM2A 3DLKA 2HMIB 3V6KA 3SFUA 2O5DA 4H4MB 4RNFA 2ZKUA 4YMEA 3HVTA 4JUZA 5HBMB 2V4RA 5KFTA 4TY8B 3RAXA 3H5YA 1IKXA 1KLMB 2XI2A 5KFCA 5KFHA 2D7SA 3BSNA 2DPJA 1RT2A 2W9BB 3PR5B 3EPGA 2IAJA 3H40A 3GV8B 1DLOA 3DI6A 1N6QA 4ZPBA 3CDWA 3RB3A 4K4ZA 2IAJB 1IKWA 3ISNC 3OLBA 1C1BA 2AX0A 3DOLA 5KG0A 3KK3A 4PQUA 2HNYB 2IM3A 3NBPA 4ZP8A 1UWBB 4IFYB 1JLQA 3DLGB 4ED8A 4ZHRB 1S9EB 3CJ3A 3M8PA 5KFEA 4NCGA 4O4RA 3CO9A 4TQRA 4ZP6A 3IG1B 3I0RA 5HP1A 5F8JA 2VA2A 3H4BA 2HNZB 4QWEA 4RW9B 4MFBA 1RTIB 1S10A 4JV2A 4TY8A 1LW2B 3PW4A 1XR6A 5KFZA 1J5OA 1FKPA 2I5JA 3MF5A 5KG6A 5KG5A 5I42A 3OSPA 4ECUA 1T05A 2UVRA 4URSA 3TQ1A 1S1TA 2WONA 1IKWB 2WOMB 2W9CA 3FQKA 1U09A 4Q8FA 1IKVB 3FQLA 2ZD1A 3KJVB 3KMSA 5J2NA 3MFHA 4WE1B 4O44B 5KFSA 2W9AA 5D3GA 4NRTA 4ZPDA 3I5CA 4O44A 3KLFA 4ED3A 4I7FB 4O3PA 2IJNA 3BQ2A 3V6DA 5F8GA 3KK1B 1ZTTA 2W8LA 4F4YA 1EETB 3KK1A 2XWYA 3M9OB 2J6UA 3C6UA 5KT4A 5KFVA 2AX1A 2RDIA 3DOKB 1S1UB 4Q45A 3UQSA 1C0TB 3LP0A 4DL6A 1JLBA 5KG4A 1CSJA 3BGRB 1RT6A 3PHEA 3CJ4A 2OPQB 3DDKA 4DL2A 3EZUA 4RNOA 2IC3A 2WK4A 4ZPCA 3N6NA 3MEEB 1S9GB 3RAQA 3UR0A 3HVAA 5DGAA 1I6JA 4F4XA 3MEEA 4DEZA 5DG9A 3OHAA 2R2UA 2C2RA 4KO0B 2CKWA 2ASJA 2UUTA 3BSAA 2R8IA 4KKOA 3M8QA 1TKZA 1JLGA 4RW7A 5I42B 4PWDB 1TL1B 4ICLA 4MIBA 1LWEB 3DRSB 1N4LA 1S1TB 1MU2A 2JEFA 5KFMA 4NLDA 1TVRA 3KLGA 1TL3A 4O3OA 3LANA 3GILA 4ECRA 1DTTB 4H4OA 1EP4B 3QZ7A 2AGPA 2IA6A 3OL8A 2I1RA 2HNDA 3NBPB 5J2NB 2XGQA 4J9NA 3KK2B 1KHVA 4IFYA 4ED6A 3T5LA 1QE1A 4H4MA 4NCGB 2HWIA 5KG7A 4F4ZA 1S9FA 3DRRA 1RT5A 1JKHA 4G3IA 4B3OB 4Y2AA 5F8NA 5EWFA 4KFBA 3H5UA 3QO9A 1C2PA 1RA6A 1QAIA 2IBKA 2YKNB 1JLGB 4RW7B 5CYQB 1BQMA 3QO9B 3HVWA 2B6AB 3ISND 3CJ5A 1TKTB 4G1QB 1BQMB 5HROA 3E01A 2HAIA 3IGNA 2HNYA 1HQUB 3DOLB 4PQUB 3DM2B 3M9NB 4EO6A 4FBTA 1EP4A 1JLAB 4WZMA 2BE2A 4KB7A 4R5PA 4RZRA 1JLQB 3G6VA 2BRLA 3DYAB 1ZETA 3KK2A 1JLCB 4I2PB 5FDLA 3IG1A 4GC6A 2VG6B 4J9LA 4EYIB 2QV6A 3V81B 2BR0A 5C24A 3MR2A 4EYHB 3V4IA 2R2TA 4B3OA 2W8KA 4QWAA 3G6YA 5T14A 1D0EA 1DLOB 1N6QB 2FJXA 3KLVA 1C1BB 3LAKA 3BQ0A 2FJWA 3D28A 3JSMA 4JV0A 2ILZA 5KFAA 1REVA 2IMWP 3OL9A 4URQU 2OPPA 1HYSB 4IH7A 1R0AB 4K4UA 4Y34A 2J6SA 2B5JA 4NLUA 2R8HA 1RT6B 3GV7B 3HVTB 1XR7A 5HBMA 4H54A 4DG1B 2IC3B 4ED7A 2GIQA 2RDJA 4KV8A 1HQEB 3V6HA 3HKWA 2IM2A 4KHMA 4FS2A 1K1SA 4KKOB 1KHWA 3KLIA 3ITHB 3NAIA 3T5KA 4PWDA 1EETA 2BRKA 4KSEB 3PZPA 3E51A 3V6DB 1C0UB 3BREA 2BQ3A 1JLEB 2YNFB 3BSCA 5KFFA 4EBEA 2XCPA 1TQLA 3KHRA 1S0NA 1JIHA 2V9WA 5KFIA 3LP0B 3PW0A 1S9EA 3M8PB 3QIDA 5HLFA 4WFXA 4YR0A 3KJVA 4F50A 1TKXA 3OLAA 3QLHB 5D3GB 3FRZA 4ED2A 1S1VA 3FFIB 2JEGA 3NMAA 5KG2A 1NHUA 4NZ0A 1RT4B 4MK8A 1SH2A 1RT7A 5F8MA 5C24B 3G6XA 2V0NA 2ASLA 2BQRA 3IS9A 5J2PB 5KFNA 4DL4A 3H59A 4EBDA 4RW4A 2UVWA 2WOMA 2W9CB 2JC1A 3VQSA 1SV5B 1JLFA 3CDEA 3RB6A 1N56A 2C2DA 4J9KA 4MH8A 3N6LA 4ID5B 3LP2B 2FLPA 4ZHRA 2C28A 2F8EX 1K1QA 1TKTA 5HP1B 4R5PB 5KFPA 3Q8SB 2XGPA 1VRTB 2OPSA 3LP1B 1NNDA 4ECWA 1RT1B 5K14B 3I0RB 5C42B 1VRUB 3QZ8A 1OS5A 5DLGA 1DTQA 2E9RX 1JLCA 3MR5A 3GYNA 1DTQB 1JKHB 2W7PA 2D3UA 2YKNA 4URGA 3T1AA 1T05B 4KFBB 1RT3B 2BQUA 2UVVA 3FDSA 3QGIA 5J2MA 1JXLA 4K4YA 3H5XA 4Y2CA 1W25A 2YNGB 3H2LA 2V4QA 1RTJA 3E01B 5I3UB 4NRUA 1RTJB 2OPRA 4RW6B 5KFXA 5L1KA 1S0OA 2OH2A 3TVKA 3PJXA 3MR3A 1T3NA 4IQXA 2HWHA 3MEGB 1RT5B 4NLTA 2D41A 4FBUA 1TKZB 4M94A 1RT7B 4LSNB 1SUQB 1YVFA 3V6JA 1SH3A 1S6PA 3IGVA 5CYQA 5KFKA 1RTHB 1TV6A 2WB4A 3QIPB 3I5BA 4O3QA 1DTTA 4H4OB 4DL3A 4JV1A 3DMJB 1HMVB 3LP2A 4IFVA 4M95A 3DOKA 2YNGA 4DL7A 4TYBA 4J9QA 2YNFA 3BSOA 1S9GA 1JLBB 1S48A 2VA3A 3KLEA 4HYKA 4NLVA 3OL6A 3MECB 2HNDB 2RF2B 2OPQA 1N5YA 4K4WA 3GV5B 4U7CA 4ZP9A 1WNEA 1IKYA 5DGBA 4KV8B 3KHHA 4DG1A 4IR1A 4U6PA 1LWEA 4NLXA 3NL0A 1LWFB 2WCXA 2JEIA 4YP3A 1S1WA 2EC0A 2R8KA 1JLEA 3CDUA 5F8LA 4TQSA 4J9PA 1LW0B 3H5SA 2FVCA 1QAJA 1HYSA 2AWZA 4NYZA 3BGRA 5L9XA 3KHGA 2JLEA 1RDRA 2YNIB 4WYWA 3Q8PB 4Y3CA 3MECA 2FLNA 5DG8A 3N6MA 4R8UA 4F4WA 4RW8B 5KT3A 3PW5A 4XPEA 2C2EA 3V81A 3BJYA 1FKPB 2HNZA 1S1VB 3ITHA 5DLFA 5CYMA 3BQ1A 5JUMA 3JYTA 1C1CA 2FVSA 4OL8A 5J1EA 3RB4A 4MK7A 5KFJA 1J5OB 1T03B 5J2MB 5JXSA 3TAMB 4Q0BB 1HMVA 4IFVB 1JLAA 2BE2B 4KE5A 1R0AA 5KFRA 1HPZB 2OPPB 2RKIA 3GIIA 4PUOA 4MKAA 4RW6A 5KFUA 2XC9A 3PW2A 3DLGA 4X2BA 3H4DA 4IRDA 2ZD1B 1RT1A 3DRPB 5K14A 4RNHA 4O3NA 2OPSB 2BANA 4TXSA 2OPRB 1IKXB 1KLMA 1HQEA 4K4XA 2GC8A 2VG6A 4MFBB 4XPCA 1SUQA 4ED1A 3RB0A 1QUVA 1RYSA 3DI6B 1S97A 3QYYA 2I5JB 1LWCA 1N48A 3MTKA 4XO0A 1T03A 1SV5A 2ATLA 3I5AA 4QWBA 4WXOA 1HQUA 5KFDA 2WTFA 5C25B 2UVUA 2R2SA 4O4GB 4I2QA 4IG0A 1VRTA 2AU0A 2FVQA 5J2QB 3UDLA 4KAIA 1HARA 1QE1B 4RW8A 4YR2A 3GIMA 3QGHA 1RT4A 1GX5A 2DPIA 3PW7A 3Q8QB 1BQNB 3BR9A 2BANB 3M8QB 4J9MA 5KFBA 4LSLB 3T5JA 5KT6A 4IRKA 3CJ2A 4RW4B 4ZVGA 4HKQA 1RT2B 2W9BA 2AQ4A 3TAMA 4NLQA 1T94A 3ICLA 4TY9A 1S0MA 4ICLB 4Q0BA 4ID5A 4NLRA 4IH6A 1FKOA 4ECVA 4IDKB 4J9SA 4ECQA 4K4TA 1HNIA 5KFLA 5KT2A 1RTDB 3DLKB 3DRPA 1RAJA 4WFZA 3SFGA 3CWJA 1N5YB 2ZE2A 3MEDB 4I7FA 4KHRA 3FFIA 4WXWA 3I0SA 2B43A 5KT7A 4ECZA 1RYRA 3JSMB 2FVPA 4ZVEA 1S49A 4ECYA 5EWEA 1LW0A 3T19A 1S1UA 1TP7A 1TVRB 4ZMMA 3KLGB 4NLSA 2VG7A 2WONB 3KLHA 5KFWA 3IN5A 2AGQA 4YQWA
chains in the Genus database with same CATH superfamily
3BKFA 2PT0A 3QPIA 1FVQA 3QATA 1U26A 1Y10A 2IA0A 5FLXY 4EBCA 1I51B 4ZP7A 2W4DA 2YNIA 4C4WA 2X7IA 3QLHA 3RW6A 1OO0B 1RAEB 5EDWA 4GVLA 4M5LA 1R43A 4ENOA 3R9LA 2UUBF 1HNVB 3GLJA 3MM6A 3NCRA 1TMMA 5KG3A 2NQPA 2CPJA 1FFGB 2YKMB 3I0SB 5M2RA 3TYTA 2V5HG 2B0GA 1RTHA 5DDOC 4R0EA 1FK9A 4B3SJ 3GTYX 2CPZA 3P8BB 1RT3A 2BA9A 2FZGB 3OJSA 2WZ1A 4NLWA 1CJVB 4OLPA 4OX8A 3QJPA 4O3RA 4DV1J 2V6AA 3QRRA 3CJRA 2ASLA 1IKVA 1T9YA 5F9NA 5J2QA 2E1RA 2F7VA 3KOAA 1RWVB 2QE5A 1PGZA 2LXIA 1TTHB 4IKAA 3R5DA 2G1HA 4O4GA 1N36F 5CH7B 1U1LA 1S79A 2XY6A 1IJEB 4TN2A 4LF8F 5FJ4A 2C22A 3CW2C 4UOCA 4ZPAA 1PILA 3VAJA 5M2PA 4JI4F 4NI2B 2ZITA 2HS4A 1VLYA 3ZTSA 1YJTA 2AJ4A 2XMJA 2LA6A 3HHEA 1RKIA 2XI3A 2N82B 4QJVA 4LSLA 2X3DA 5GAGI 3TZZA 1S6QA 4FZVA 2ZNYA 3MM9A 3KMQA 4Q43A 4LQ3A 4JI8J 3HFKA 1WD6A 1ELOA 2CPIA 1HPZA 3QRPA 2BJ1A 1UPMB 2YPZA 3W60A 4LIRA 3M6UA 4DPUA 1QAIA 1HFEL 2HFSA 2UUWA 4IG0B 5EUHA 1YX2A 4B3MJ 1URNA 1G2EA 4M5NA 1RBAA 4B3TJ 4RU9A 2VG5B 2Z57B 3MGJA 5D6GA 5HMZA 1R6VA 1BGXT 4N7TA 3AD9C 2XMVA 1NJZA 3MM5A 2HQFA 1S7IA 2O3DA 4DFJA 2C2KB 2MSSA 4HT7A 1NB7A 4WYLA 2BE7D 3H20A 3GIJA 5DRKA 4O0NA 2VBXA 4X4PA 2CPDA 3CT9A 5B0DA 3VAIA 1M5VC 3HZEA 3ILJA 6FDRA 1S4FA 3Q89A 2EK6A 5CQGA 4DU7A 4DV3J 2D3ZA 2QSFA 3FZ2A 1YK9A 5J1PA 4IG3B 1RA7A 4HDHA 3SI8A 4NLGA 4RUAA 4QW8A 3OXGA 3AD8C 1OQ6A 1YJ7A 2CQHA 4PG4A 2DH9A 1XJWB 4LFAJ 2YKQA 3KLIB 4WKYA 4C2MA 4DV7F 2HZVA 2DTJA 3VAKA 1HNVA 3T1HF 2IJFA 2XSJB 3HHKA 3GQCA 4AQYF 2FHJD 3FK4A 1B3TA 1JLFB 5L1LA 1C0TA 4IRCA 1FVSA 4NCAA 1ZYQA 3N9UC 4PR6A 2FHJA 4NLYA 4CO1A 2W25A 1NCLA 1WEZA 1R8HA 2WVCA 3PRBA 3VAFA 1RHUB 2DNHA 2YWEA 4XIUA 3GFHA 3M8ZA 3TUIC 4AT1B 5A2QU 4JYAF 1LNQA 3O2IA 1Q1KA 2RIJA 2YPYA 4OZLA 4WFYA 1FESA 3NS5A 3WX8A 4DL5A 1JWWA 1GAOA 2IM1A 2J6TA 3MUVP 1AT1B 3LAMA 4FDFA 3FBFA 3MI7X 4LF9J 1YWXA 3KK3B 4DF8A 4ED4A 4FS1A 2B6AA 2UUCF 5DQHA 1FKOB 4ECSA 1RAOA 1A7GE 2E7VA 3IR5B 5LMNJ 4UY85 2FVRA 1FEHA 3FSIA 2WVBA 1S6QB 2HGLA 3PHTA 3MUMP 1N34J 3JTPA 3M8SA 1L3VA 3D67A 2OUGA 5EGYA 3V6KA 3U7JA 2BYCA 4J9UE 2ZKUA 4C0OC 2UUBJ 4W4MA 1BHNA 3BPDA 3HVTA 3PIPQ 1Y3KA 2CQ4A 3BM7A 4K0KJ 1FXRA 3M2VA 4TLQA 3PX4A 1IKXA 4FNHA 4UF4A 1I94F 1TR0A 2D7SA 3BSNA 2K3IA 4U8VA 1ZZNA 1HNZJ 2DPJA 2ZOMA 1RT2A 2MLYA 1JXEA 1LFWA 3CCZA 2YKOA 4BLGA 1DLOA 3DI6A 3GV8B 3M30A 2RILA 4B08A 3CDWA 2DEIA 4X4OA 2AX0A 4PCQA 1AZSA 3DOLA 1LFPA 2NPIA 2IM3A 2GCFA 1K44A 4MMOA 1OWXA 3O44A 4ELVA 2HBZB 5DDPC 3CDBA 4AFFA 2VD3A 3CJ3A 5KFEA 4ED8A 4O4RA 2V8HA 4USUA 3I0RA 5HP1A 1HQ2A 2VA2A 2AZ3A 2HNZB 3IRWP 1S10A 3OT9A 1X9SA 1LW2B 3IP0A 4CO4A 5KFZA 1RP5A 2QYCA 3K57A 1J5OA 3G9CA 1VQ5S 2AEJA 5KG6A 4ZLLA 4FF4A 2CG8A 2IYGA 2RHQB 3A4TA 3M8WA 5KOWA 4ECUA 4DSLA 2FZKB 1QTMA 5B0BA 1IKWB 2CPHA 2WOMB 5D4NA 1RI7A 3MM7A 3W65A 4NEZA 5LXRA 2JRSA 5IXUA 4F8RA 3GYGA 3CCTA 3FQLA 1Y00A 4HH0A 2LEAA 3UE2A 3DLHA 2WAQD 3N28A 3KMSA 1X4DA 2EG1A 3KJVB 5DETA 3NGRA 4DSEA 5KFSA 4O44B 3LGNA 4OI3A 2VKRA 3AJDA 2RDDA 3I5CA 4P71A 3C16B 2CJ9A 3AX2A 1O6XA 2Z0GA 3JSBA 3KUEA 3MMCB 4OYAA 4PPZA 4O3PA 3TUZC 2AJ0A 3SSRA 2BACA 2H5IB 5HANA 3KK1B 3UD4P 4LVOP 4RWWA 3MMBA 5L9NA 2M52A 2PA8D 3GONA 4F4YA 2HW3A 2XTJP 2BW2A 1FDDA 2XWYA 1VBYA 5KFVA 4A46A 4ZVSB 2PEHA 2QMWA 3UQSA 1C0TB 2IPOB 4F2SA 1JLBA 2OI2A 3P96A 1CSJA 2ZBPA 3AY0A 1HBNB 1P27B 3EZUA 2UUCJ 1F3VA 1XERA 2RS8A 3N6NA 3EX7B 2CQGA 3RAQA 4P52A 2LDYA 3HVAA 4I6YA 2P2CB 3NLCA 1RACB 3MEEA 4DEZA 4DF4A 2YBVA 4HI2A 5DDQC 3MMAB 2ZM6F 4B3SF 2XLJA 3T6JA 4KKOA 1TKZA 4NCBA 1JLGA 2LU1A 4RW7A 4DX8H 5K8MA 5I42B 3TA0A 2YQ3A 2KU7A 1XNRJ 4ICLA 2HQIA 1Q5YA 1MU2A 3EZOA 3MCMA 2AYMA 3M32B 1TL3A 1NO8A 2JDJA 3H2VE 3ZNJ1 4H4OA 1UMJA 3D3CJ 4LRBA 3O3LA 3U27A 4EFAC 4KGZB 2LYVA 3QZ7A 1TAUA 5H9EJ 4YDXA 4NZ7A 4E8UA 5J2NB 2E5LF 1WC4A 5ETRA 4UTGA 4ED6A 4JV5F 1DAXA 1FRMA 4L76A 2ZKTA 3T1YF 1FNOA 3W9JA 2BJ9A 1RT5A 1JKHA 4U96A 1NDCA 4F0MA 4C98A 2J76E 1C2PA 3N4WA 2DD8S 3CJKA 1ZA2B 1PAEX 3ISND 3M6WA 3QO9B 4HLBA 3EDQB 4BC9A 1IBKF 3CJ5A 4N5SA 1BQMB 2G2ZA 1H98A 2VFUA 2HNYA 3EVOA 1SC6A 5IQ6A 4DPWA 1AZSB 2EG2A 3DOLB 2UV8G 2EFGA 2KG1A 2BKNA 3US5A 2UXCF 2ZJRQ 2X1AA 3IWXA 2Y8YA 4DI6A 2M2BA 4B3TF 2BRLA 1TUWA 2XULA 1JLCB 3M2UB 1NEEA 4I2PB 1OY8A 1KOHA 4AXJA 2UXBJ 1WHVA 7AT1B 2AJQA 3R3TA 2XLIA 3MR2A 4TKTA 1WHYA 2AD9A 2W8KA 1RSCA 2HWTA 3TI0A 1RU2A 2AT1B 3W2VA 1N6QB 5EHHA 3B82A 2VH7A 2KFNA 4M63A 2FJWA 3HULA 4F67A 3JSMA 3VGUA 1VK3A 3FSYA 4M5DA 3CCVS 2ILZA 4UZBA 4DFKA 4ZLPA 4DOZA 1URRA 3OL9A 2G9OA 1V5VA 2OPPA 1REGX 3CO0P 1OM2A 3BYPA 3BGUA 3J81j 4IH7A 5GADU 2KL8A 4DQQA 3NWGA 2EI5A 1HI1A 2HGMA 2XYGB 2YKPA 3Q86A 3LGMA 4S0MA 2C3UA 3HO1A 1NBEB 1GFWB 4OV6A 1V3ZA 4DG1B 3L3CA 5AXNA 2GIQA 2X3GA 3PKMA 1HQEB 3HKWA 2FTRA 2IM2A 4FS2A 1K1SA 2APOA 3MM6B 3ITHB 4M5JA 3NAIA 4AQYJ 1YJRA 3HHLA 1EETA 2OJ3A 4KSEB 1C0UB 4J37A 3KJFB 4NE9C 2BQ3A 1JLEB 2YNFB 5ETKA 2KI2A 3DU5A 2QFIA 5IZHA 3RTVA 1SJQA 2CPEA 1S0NA 1ZAVA 4QIWD 3LPYA 2A2DA 4JI2F 4OYZA 3PW0A 3R5CA 3M8PB 3QIDA 4WFXA 1AYEA 4DUYJ 2NXEA 4CT9A 4F50A 3OLAA 4YB5A 1PYTA 2NPFA 3NWRA 3QLHB 4MKYA 2KVQE 4RL1A 2JEGA 1Q7LB 1RT4B 4MK8A 3PFEA 4ETXA 5BYSA 5F8MA 5C24B 1L3UA 2PEBA 2V0NA 1HNWF 2BQRA 3IS9A 3D0IE 3DDIA 1U6FA 3H59A 3KG4A 1PYSB 1HWUA 2MKKA 3T1YJ 3KTQA 1MSWD 2E44A 2HBRB 2C2DA 3GJTB 4DUTA 4PXCA 4JI3F 4MH8A 2M70A 1Z2ZA 3HHLC 4P2FA 4KGMA 2L9WA 3TZXA 2PMWA 4HVZA 2F8EX 4XAKA 2A0FB 5A6PA 5DM7Q 1ZH5A 3AOAA 4R5PB 1GQEA 2N3LA 4GVBB 3G2XA 4XDDA 4I2PA 4PYAA 2HFVA 2LU2A 2VONA 1KKHA 1KN6A 2FJDB 1N88A 2IIHA 2GFFA 2KT3A 3I0RB 4DV3F 3ZTOA 2Z30B 1TUGB 1BLUA 3AOBA 5GMEA 4CLZA 5DLGA 1S59A 2XMWA 1JLCA 3AJ2A 3CIMA 2PMZD 3MR5A 1DTQB 1JKHB 2YKNA 1PAUB 1FEEA 3O6QA 1M1GA 3M05A 2F65A 4C9DA 3R2DJ 2UVVA 3KG1A 4F0HA 2WBMA 1T9WA 2DXFA 3ENWA 4K4YA 3H5XA 2Z2LA 3H2LA 5H9FJ 1VQMS 3KNGA 3AB4B 3TZYA 1RTJA 3O5TB 3OXFA 3Q8VA 2V4QA 1VQLS 2YVSA 5A8WB 3W2WA 1WEXA 4CCHA 1Q79A 3ISZA 4C0BA 2CDQA 2XMUA 1F5CA 2OPRA 4YDDB 3R27A 1VMBA 4XDCA 2YH1A 3I55S 1F6TA 1NB2A 4IQXA 3NNCA 3ZNUA 4DV2F 4NLTA 4GO5X 4F36A 1RT7B 3T9ZA 2JSXA 1SUQB 1YVFA 3CE8A 3V6JA 4XTTA 1RTHB 2F4VJ 3FCVA 3R1LA 1TV6A 3ZZOA 1GTHA 2MZQA 4G6VB 4JV1A 1N5QA 4Q8FA 3LP2A 1P1TA 3V5RA 4ZCKA 2YNGA 4WWSA 4TYBA 3HPOA 1Q78A 2YNFA 4DL7A 1AXQA 2VOPA 2O01C 1JLBB 1S48A 3N0VA 3MPVA 4KQZA 3KLEA 1GH8A 3MECB 2HNDB 1QSSA 3GSIA 3K5LA 1N5YA 4K4WA 3GV5B 1WNEA 3GR0A 3MUTP 1YBUA 3OR1A 1JQGA 2LCWA 4KV8B 4TU9A 4WBFA 4DG1A 1RWXB 3JTNA 1WKJA 3MMAA 1CC8A 4J9VA 3NL0A 1LWFB 4ZLNA 2DH8A 5HI7A 4I6AA 1KEKA 2JEIA 3U1LA 3CCLS 1KS2A 2FDNA 2ZH6A 2R8KA 2BE9B 4V1Ak 3RRHA 1LW0B 2F3JA 2JHEA 4FVMA 1X31C 1R8AA 2RSQA 2QL7B 3GP9A 1HYSA 3VCDA 2FPHX 3QWUA 2DNPA 2YY3A 3QFWA 3Q8PB 2GQCA 4Z7CA 2FLNA 2VC0A 4XPEA 3MURP 2J0XA 1U1MA 5ETVA 2NUUG 3TWZA 3M4XA 3CEDA 3BJYA 1TL4A 1FKPB 5E3AA 2AYBA 3VR1A 3T9NA 2OMLA 1EARA 3GWCA 5CZVA 2G1DA 1LWXA 4P75A 2FC9A 3DHWC 2RJZA 5E33A 4HH1A 4GKKF 1HWLA 1ZOTA 2MZJA 3QJLA 1FDAA 4NL5A 5A0YA 1XK8A 1HMVA 4IFVB 1JLAA 4Q0BB 2ZNZA 1W2BR 3N79A 1HPZB 4OYBA 2ZH2A 3T1HJ 1TELA 2QC3A 4PUOA 1Q8IA 1WEYA 3PW2A 1X9WA 4X2BA 1AUSL 1RT1A 2V68A 3MPWA 4JBCA 1GXUA 2FJBB 2OPRB 1IKXB 4XPCA 4GO7X 4OZ3A 4ED1A 1N8RT 1ZAXA 2W2MP 2XG8A 4NEYA 1EKRA 1RYSA 2NYIA 1OPIA 1K9MT 1F9FA 1HI8A 3DI6B 2N4DA 3QYYA 4EUVA 3Q0AA 1PG5B 4LIWA 3EUNA 5B0GA 3I96A 2D3O1 1T03A 1D8ZA 2ATLA 2FQQB 3Q8UA 2GIFA 4LJMA 4ZVRB 3VZIA 4M5DB 3RAMA 2HRUA 1T9TA 3DXSX 2R2SA 2CAJA 1RBLA 3BBFA 1Q5VA 2MLXA 3M2RB 2D69A 5F3ZA 3HDSA 5IC4B 2FVQA 1KQFB 3R6LB 1XTZA 5A8KB 1QE1B 4RLEA 2DGOA 4CT8A 2DPIA 1UVIA 3BO3A 3PW7A 3JS9A 3BR9A 1SKUB 2BANB 3POTB 2POKA 2MY8A 4CTAB 5K8PA 2DK2A 2W2QP 2D9OA 5KFBA 1XMQJ 4K59A 3NRBA 2EFOA 5HQ8A 1W26A 1F9EB 3CJ2A 4JI8F 1HA1A 4DR6J 2UU9J 3W3SA 4F3MA 3KYLA 1JNZB 3TAMA 3HVRA 1B99A 3ICLA 4ZA1A 3IO1A 5B08A 2E7XA 2EPIA 3V2UC 2YWGA 2HS3A 3I32A 3I87A 4ILRA 4KYZA 5HMXA 3NMRA 3KKFA 3UN3A 1TFWA 4WFAQ 2NR0A 1X7VA 3PTWA 1HNIA 1ULRA 1R6YA 3AAWB 1FXDA 1YQHA 4LT6A 3SCLE 2CJAA 3B6BA 2VKZG 2XTCA 3DRPA 2Y0SD 5FIIA 4CLSA 4DN9A 5L46A 1N5YB 3KJNB 4DX6A 1QY7A 4CNYA 1QLNA 1X60A 1D3WA 1WSVA 4MYUA 1SCJB 2CFXA 3I0SA 3NEKA 4TVAB 3DLBA 4TU7A 4Y2IA 2Z58B 1X5SA 1UW4A 4ZVPB 2ZWOA 4DCPB 4ECZA 2FVPA 2KM8C 1DQAA 1YZ7A 1BWEA 3QAUA 4OHWA 1KSPA 1PYOB 3T19A 2CQ3A 2DGSA 1UPPA 2AJ1A 4NLSA 2WW4A 4IOCQ 1VBXA 2RUGA 2HRYA 2AGQA 4RUHA 1XR5A 1BQXA 4IH5A 4USMA 3NKYA 1CJTB 2ZJPQ 2E9TA 3AXKA 5T41A 2QJ3A 2MTLA 4KGXB 5B0EA 1IBCB 1GTEA 2ZBIA 2BJ3A 2A6OA 1FRXA 4WE1A 1UEKA 2PI4A 2HLTA 1UFWA 4ELTA 5FDLB 5GMDA 1S6PB 3IBWA 4TLRA 1VISA 1I1GA 2X1BA 4LSNA 5K9FA 1FRJA 1HIYA 1NMEB 1ZZFA 2DY9A 2ZDPA 2IDLA 4CI0B 1T3OA 5LOQA 3PY8A 2A2CA 4J9RA 1TL7A 1FWLA 1RLDA 3D1OA 4DL0C 2GV1A 3J7YI 1Y5NB 3V4MA 2VQFJ 2VHGA 4X84A 1FWPA 2KVIA 3DMJA 4QWCA 1V5IB 3UVJA 3CNQP 2DHSA 1Y11A 3AHPA 4A8XA 1DJ0A 3FEYB 3CPWR 2E9ZA 3RRGA 4B3RF 4M5MA 4DV6F 2YX4A 4FF1A 3E2EA 1MLAA 2R8JA 1NK6A 3BBCA 3TOQA 2W4CA 2AHOB 2G2OA 3WDOA 5IWAJ 2KJWA 1LW2A 2WVFA 2KYXA 5RUBA 3CC4S 4IR9A 5J1NA 4RW9A 3GR1A 3OL7A 1X4AA 2ZUGA 4P10A 1WORA 3QIPA 1XNQF 3AA8A 5J1EB 1E6VB 4LQ9A 4YUDA 1NPKA 4L73A 4OI4A 4USTA 5C5JA 4OIXA 4H4KC 2IM0A 4WZQA 3OJUA 2WHOA 2YNHB 3H98A 5D4PA 4Y0FA 3PDNA 1D9FA 5D15A 1UEUA 2DCUB 1SJ3P 4MYTA 2Q6CA 1P9YA 3P5BP 4Q8EA 4KPYA 2V4JA 1U2RA 2CJQA 2JWNA 2Q79A 3K8VA 2FLLA 4K4SA 5J2PA 5A8RA 3Q2TC 1K0VA 4ED0A 1CBKA 2DR8A 2HBQB 1MW7A 2A10A 2MKJA 3PRDA 1LWCB 5E7OB 1C1CB 1LWFA 1CULB 1ICEB 2NSBA 1X5PA 1MU2B 4RNNA 1C0UA 4ZCLA 4Z37A 2HHHF 1ZPWX 4I0WA 1DY3A 1TL3B 3D1QA 3R97A 4DX5A 2JEJA 1RWNB 4J5OA 1KNZA 4V19X 4UOHA 2HFUA 3CJ8A 4FF3A 1EQ0A 4ITSA 5DG7A 4DV0J 4U7UD 3C6TB 1S4EA 4K50A 1VFJA 2KXHA 2QX0A 3KLFB 2RQCA 4I67A 1MN9A 1QD1A 2FLOA 4MIAA 3CVKA 3UNGC 1ZM2A 1WUUA 3KHLA 3K59A 4ECTA 1VBKA 4RUBA 5DQIA 4UY8T 1S1XB 4ANEA 2DCLA 1BWVA 2R2RA 4JI4J 3FSXA 1GK8A 1VJWA 1VJQA 3N5BA 3HM9A 4AL6A 3K5OA 2HSEB 3D5MA 4JI0J 2JL9A 4RUCA 4K7QA 4JYAJ 1QTNB 1QUPA 3MOZA 3OTOF 3WHIA 3RBDA 2IYIA 3D66A 4OI2A 2R7TA 3CJ0A 3D0HE 4MK9A 4DZDA 2EK1A 5LSOA 1R8CA 2JOQA 2MKIA 2HVZA 3BH6B 2ZHAA 1XMOJ 1FXLA 5A2QY 2P9GA 3DN9A 3ENQA 1RZMA 2Z2YB 2E66A 1U45A 4UOGA 2HBYB 1TUVA 1BQNA 3QJJA 1WOSA 1RE1B 3BDEA 2BOAA 2M4MA 1W7WA 3SSQA 5CHCB 2BXJA 1FJEB 1NXIA 3B54A 3TUJC 3C14B 5KFOA 2VU5A 4F02A 1SJ1A 1N0UA 3RBEA 1CJUB 1MMLA 1TAQA 4PPDA 5D8HB 3PJWA 4KJIA 3ZC4A 3CCUS 2HHVA 3BGLA 2EEYA 3DM2A 4NXNF 5IFMA 1FRKA 2CUYA 1SKRA 3D0GE 3SFUA 3ZO7A 4YMEA 4JUZA 3SEOA 2KO1A 2B4VA 5IT0A 2B9EA 1CS4B 1IBMJ 4JI5F 4C8YA 4DR5J 1YIJS 2ZFHA 4QIGA 4A8KA 1H3DA 1A0OB 2W9BB 5A76A 3PR5B 3H40A 2V8VA 2J9DA 1N6QA 2VBWA 3CJKB 4DV7J 3EGNA 3W64A 1IKWA 2VIHA 1ZBTA 2QL9B 2MKHA 2HNYB 4PG5A 3NOGA 4DV6J 1UA0A 3NBPA 3HSJA 4QYZJ 4ZP8A 3RGIA 2HHWA 4IFYB 1JLQA 2DNOA 3C15A 3OFFA 3ADAC 3M8PA 4FP9A 2DITA 4ZHRB 2UUAF 5C2GA 1SKSA 4LF5J 3R7SB 3HT3A 3H4BA 3G4SS 3W8GA 1MG7A 1RTIB 2LDIA 2E7WA 5CCMA 3PW4A 2HHXA 4PWWA 3RR8A 2E1MC 2I5JA 2ZBRA 3MF5A 1RGVA 4YS2A 1T05A 2LXFA 4X4TA 1HWJA 4AL5A 5K5MA 4I6WA 3THTA 5D0EA 4CLWA 3K0JA 2WONA 5IC6B 4KHPJ 2W9CA 3OXLA 3FQKA 2CDRB 1T11A 2GMJA 2ZD1A 5GAHU 4B9NA 1X8DA 4ZLJA 2DH7A 1T8EA 4WP3A 1R89A 3CF5Q 5THWA 3QT5A 1T9XA 1XBWA 2NYHA 3QMQA 3KLFA 2W2OP 2LEBA 2RH3A 2DO0A 3OTDA 2FGOA 2CVIA 1I94J 1UFLA 5F8GA 2DKOB 4U67Q 4JI3J 1EETB 2P6SA 4AYBD 3C6UA 1HNWJ 3F44A 4X66F 2AX1A 2RDIA 1MNEA 1MWZA 1S1UB 2MMYA 1N32F 4Q45A 2YWWA 5ETPA 1SJFA 5KG4A 2BKPA 1Y3JA 2NCKL 5I4MA 3CJ4A 4CQ1A 1NSPA 2OPQB 4DL2A 1VCTA 1SC1B 2JFKA 2IC3A 2A6MA 3ET6B 3GYXB 3IBCB 3MEEB 4WK3A 1S9GB 4KTQA 3UR0A 3AQPA 1X0PA 3SV4A 3MCNA 2ASYA 4LBPA 4HEA9 3OHAA 2Y1JA 2ASJA 2MKSA 4B02A 1OMSA 3GCXP 1RCXB 2R8IA 3M1VA 1YLXA 3M8QA 3I82A 1WSRA 4P2MA 4EWTA 3BH7B 4PWDB 4JI0F 1TL1B 4MIBA 1LWEB 3DRSB 1KDNA 1S1TB 4OX7A 1N4LA 3BDPA 4OZ2A 1TVRA 2EKYA 2BMBA 3O1LA 3LANA 3J7Z5 2XS2A 1A9NB 2M9KA 3W2WB 3D9BA 1UEVA 1EKSA 1UKUA 2IJRA 3CB4A 3QQCD 4Q2LA 3G6ES 4DU8A 3KDNA 2IA6A 4DMZA 2JVOA 1VIOA 1OJ4A 2HNDA 3NBPB 4NMLA 3R7NB 2VASA 1TL5A 4IFYA 3SYZA 1QE1A 5H1SV 4F4ZA 3QT6A 4U7UK 4QYZK 4G3IA 3UCZP 5F8NA 2W24A 2HIYA 3NY0A 3VWSA 1WDDA 3BN4A 3H5UA 3QO9A 3W62A 5A8RB 2QL5B 2YKNB 4QIEA 5CYQB 4F3QA 1BQMA 1UP1A 2X1FA 4Y65A 3LF0A 5IT4A 3AQOA 5HROA 1TKTB 2MQOA 2HAIA 1H7WA 3HCXA 2C2MB 3TAQA 2B9XA 4YEAA 1HHTP 2HVDA 4B9LA 4DBQA 5A8WA 2BE2A 4WZMA 1Q16B 2V2ZA 4PQAA 2HK2A 1WHWA 4QIVA 1FE4A 1GEHA 2F63A 2HS0A 1JLQB 1VGYA 1GT8A 2MQLA 3C15B 3DYAB 4RBVA 4YY3J 3KK2A 3G6VA 1VQOS 1U1KA 1DFDA 2VG6B 1RWKB 3CTRA 3POTA 1WG1A 2K06A 2QV6A 3V81B 1KD1T 3V4IA 1B0PA 4B3OA 4IO1A 5B0CA 3JQKA 2C2OB 3HFZB 5K20B 5T14A 1IBLF 4LFCJ 1VQSA 3EGZA 2V1SA 3LQVA 3W9IA 1C1BB 3GFYA 4LRAA 2EFVA 3BQ0A 1XNRF 1VQ8S 1LQ9A 3GB0A 5LMUJ 2CWXA 4HT5A 4Y6IA 5E3CA 4DQPA 4OZ0A 2OEJA 2WSFC 1OQ3A 4LRFA 1WELA 4UZCA 3FC9A 4DV2J 1CJVA 2ABYA 2CZVC 4K4UA 4WCEQ 3DDNA 2R7XA 4Y34A 2PA3A 4M5HA 2J6SA 1Q0NA 1RHQB 3H0PA 2ACMA 1RAIB 4CM2A 5HBMA 1XR7A 4HI1A 5BR8J 2F1FA 2IC3B 1EB0A 4KV8A 1X4GA 1L5UA 4KHMA 1MROB 1FCAA 1KHWA 1WOOA 4P73A 3PKYA 2J0WA 4P74A 5IWAF 2BRKA 3GJSB 4N8NA 2KHCA 2CQBA 2Y1RI 3D6MB 4I4BA 4OYXA 3PZPA 1LK7A 2Q6BA 2VC1A 1JXLA 3C14A 1RQ0A 3J80U 2KHDA 2CXEA 2CZ9A 1RWUA 3AWRA 3EVWA 2GJFA 3L7PA 1TQLA 3Q2SC 4Y28C 3KHRA 3C46A 4DR6F 4DFPA 2I0XA 1EAYC 3WQPA 3VGTA 4G1PA 1S9EA 2J8AA 3SDEB 2W01A 1KVIA 4WF9Q 2DBBA 3HI9A 3UR3C 3NCQA 4ED2A 3PYGA 3FFIB 4MKVA 4RR5A 1WI6A 4NZ0A 2DHXA 3CC2S 1SH2A 3PYDA 1U02A 4X4RA 2A1BA 4DCOB 2IVFB 1U49A 1BC6A 2FGCA 4DL4A 4PG8A 2OFGX 3CC7S 3AJ1A 2MHNA 3TJ9A 2ADBA 2DHGA 4OFZA 4QYRA 3TANA 3NG8A 3RB6A 3TQEA 4PABA 1SKWA 2LQ8A 3OVSA 3QT7A 1FJGF 2BUNA 4DLEA 1B7YB 3EXCX 3FEZA 2DNNA 2J5AA 1TKTA 1WDTA 2U2FA 1CJKB 4YB7A 3DKDA 4R0JA 3CXCR 4A8YA 1Q8BA 3KJQB 4K2XA 5DJBA 5HP1B 4L72B 3RRKA 3HD1A 3RW7A 2OFHX 3ULHA 1VRTB 3Q8SB 3LP1B 3CCES 1NJYA 1NNDA 2EBEA 1RT1B 2VDIA 4ANCA 3THVA 1U24A 1ZPVA 4ZJLA 2D1CA 3TX0A 4M1KA 3E3XA 4NZ6A 1DTQA 3W7BA 5JMNA 2VBYA 2NREA 2MLZA 2RMLA 1DBDA 2VUGA 3RJMB 4URGA 2G2YA 3T1AA 3L4BC 1T05B 3U1NA 4FYVB 4LF4F 2BQUA 4O23A 2Z2MA 1YKWA 5J2MA 4JI1J 2BJ7A 1W25A 1U0SA 4Y2CA 2YNGB 3PG9A 3PNIA 3WIUA 4D3GA 2F8MA 4FPRA 1X5OA 3FGVA 4F3OA 1PCAA 4USHA 5D0HA 1CQMA 2OTLS 4RW6B 5L1KA 2K8GA 3MD1A 3OTOJ 3TX8A 3MR3A 3A8JA 2MYFA 2BZ2A 3QSIA 4WP9A 4OI1A 2HWHA 2DR6A 3I9ZA 1IN0A 3MEGB 2V50A 1VR6A 4FXWA 4FBUA 4EZ6A 4K2JA 1R0CB 3OR2B 3AFGA 4LSNB 4WIIA 1YJNS 1NK7A 1Q81T 5AE3A 4KHPF 2OP5A 2WB4A 2I2YA 1FFSB 2X51A 4KIAA 1DTTA 1QDUB 4DL3A 3DMJB 4P2XA 3WBZA 3MHYA 2HYIB 4B9TA 4A8FA 1AUDA 4PG7A 2GGPA 1NM2A 5LSLA 1Y5LB 4RBUA 3VZHA 2UXDJ 4NLVA 1WOPA 3WIVA 2OPQA 4DR5F 2DNKA 5IV4A 4QCLA 4U7CA 2VPZB 5MAOA 4X65J 1FO1A 4OI0A 3HJFA 2VPYB 1AB8A 3UDVA 1DARA 1TK8A 2LQ5A 4NLXA 2DGWA 2RU9A 2BM0A 3BGOP 2PIIA 3OBIA 2ZBCA 4AXIA 3SIPB 4N41A 2KH9A 2DGXA 3SCIE 1FJCA 3CCSS 3CDUA 5F8LA 4HACB 1KTQA 1WC1A 2H5EA 1FJ7A 4ZITA 2AV5A 1CVJA 3H5SA 4OYPA 4F7VA 2D3OR 2KTQA 1YJVA 1V3RA 1LXJA 3BGRA 1FTCA 3LO3A 1NAQA 4KH1B 4WYWA 3G8QA 2XSFA 1ZM4A 2GAHC 3N6MA 2GVDB 2NXUA 4R8UA 3J81U 1G1XA 2GJIA 4I64A 1N33F 2HVHA 1HBMB 2HNZA 3UDEA 5CYMA 3GJRB 5LSRA 4B17A 3BQ1A 5JUMA 3JYTA 1C1CA 2FVSA 3RB4A 5KFJA 3MM5B 1J5OB 1T03B 4C8MA 5JXSA 3DGPB 2R9LA 4LFAF 1XMBA 4BS2A 1P6TA 5E3RA 5I3QA 2GMHA 3K7RA 1R0AA 1MMDA 2P6TA 3PXGa 2JFDA 2RKIA 1QVGR 5E3PA 3GJQB 4WK1A 1KC8T 2CRLA 4KH0B 2HIQA 3ILIA 5K14A 4O3NA 3LTOA 2BANA 4CTAA 1RAGB 3FZBA 1CS4A 4LREA 2QMUB 2VG6A 1RHJB 5SUHA 3UCGA 1KLNA 2EVZA 4X66J 3TARA 3P3DA 1E6VA 1H72C 2I5JB 3DLJA 4FF2A 2RVJA 2BABA 1E6YB 2SXLA 3MTKA 1N48A 2RE1A 1N5VA 3B4MA 3ENAA 3QBCA 4I69A 5CYJA 1PO6A 4QWBA 4L6V3 1HQUA 3X3UA 3Q83A 2UXCJ 2VPXB 1KR4A 5C25B 2UVUA 4OHVA 3IWLA 2XS7A 4I1TA 4CDIA 2HURA 5A8KA 4G65A 2HHQA 3H2UB 1Y5IB 4DX7A 5J2QB 4FN5A 2C2ZB 3UDLA 4KAIA 3VV2B 4RW8A 1FX2A 1WI8A 4A4JA 3QGHA 4YR2A 3GIMA 1AA1B 1GX5A 3T3FA 3Q8QB 2AZ1A 1KTVA 1BQNB 5AXKA 1HBUB 2RU3A 2GQQA 1L3SA 4LBHA 5G0RB 3T5JA 1G3OA 2BJDA 1S5ZA 3K8WA 1B4SA 4IRKA 1M5PC 4CLYA 2QLWA 3VTIA 4PG6A 3HHLD 2PC6A 1S0MA 4ICLB 4DV5J 1GMVA 4ID5A 1NSAA 3PO5A 3FKBA 3M32A 1FKOA 3PEJA 3ZTRA 1F60B 1K73T 1F5BA 2ZH1A 5BXIA 3FMWA 3ZZRA 3JAMY 4J9SA 4K4TA 4ECQA 5BR8F 4Q2MA 5JJBA 5KT2A 3X1LB 2CQDA 1UJ5A 4ZVQB 4HHUA 2DIVA 2QMXA 4FXDA 3JSRA 5CZXA 1U1NA 1UWAA 1HNXF 2WVEA 4KHRA 3FFIA 1AROP 3ZZYA 5ETOA 2VJVA 1ZM9A 3UD3P 2WBRA 2CQ0A 1N54B 3D3BJ 3U02A 4OJ3A 4A8SA 2B43A 1NUEA 1VRQC 5HSPA 2B3TB 4FKYA 2LQ9A 5GAEI 5HVGA 1VLOA 8ATCB 1S49A 1N5SA 2HQGA 3BB5A 3EGWB 5EWEA 3G82A 3JQMA 2L41A 1S1UA 1TVRB 3KLHA 1I5OB 1PJ7A 3AB2B 2DNLA 2VG7B 5F9LA 1SJ4P 4Q44A 4PXDA 3CJSA 2ZH4A 2BJEA 1S0VA 2L3MA 2GVDA 2OAUA 1S7HA 1X4EA 3A8IA 1YZ6A 3GFZA 1B70B 2B7CB 2OD4A 2G13A 1RAAB 3L7UA 3LALA 2DJWA 3M2UA 4FYYB 4KT0C 2C2NA 2DR7A 1NPPA 2OLWA 4F25A 1VC6A 2EBGA 4EK2A 4EO8A 2HZAA 1MN7A 2W4PA 1GXLA 2DB1A 2JVRA 1REVB 1QSYA 1S76D 2HQ3A 4KBIA 2K2PA 3A13A 4ZCIA 5EX0A 2PO4A 4I2QB 1M90T 1L3KA 4K4VA 4DQRA 4CWBA 4IG3A 1YHQS 2LKZA 2IVMA 2RKIB 1N32J 1VS3A 5GVQA 4QW9A 1IWGA 1SQFA 4NLPA 3AT1B 1V6HA 3MEGA 3QGGA 3UNYA 3OSNA 1GX6A 3KLHB 5KFQA 3OHBA 3PV8A 2VV5A 4DR4F 3D7SB 3EJMA 1CULA 4A8MP 2R3VA 3TO8A 1YBTA 2V1TA 2XWXA 4CO2A 3M9MB 5KFYA 4DV4F 5KT5A 1OYEA 2QRRA 1P9QC 4E2FB 1SH0A 1WKKA 2B51A 2YNHA 3I31A 3BKTA 3LOUA 4F04B 3KDOA 3MM7B 2M0GB 2RRAA 5KTQA 3NGDA 2DR5A 2KZZA 3F73A 1PBUA 3EPIA 3PX6A 2COLA 2CVEA 2L9NA 2U1AA 1D1UA 2M8DB 4PKDB 3KUGA 4FNIA 2DR9A 4A8WA 2CIMA 3SCKE 2KG0A 3DRRB 3HKZD 4JI6F 4C3KA 3M6XA 4OI6A 5L1JA 1H2VZ 3GFXA 3M2VB 2E1AA 3MEKA 3OFHA 4OYIA 2VODA 4GRSA 3W61A 2HHHJ 5DO2A 2ZBQA 3C19A 4IOBA 2QT7A 1UVLA 2BKOA 2LXUA 3IS9B 3EPGA 4RPFA 5IM0A 4G1QA 3MAQA 1CC7A 1S12A 2HZCA 2ILYA 4LF1A 5L1IA 4UQGA 4ZVFA 6AT1B 3K58A 3DFEA 1KQKA 1T7PA 1IR1A 2OD6A 4U8YA 2B9WA 3MOJB 4LRDA 2DHHA 5HMYA 4J9OA 3HXMA 2DGUA 4JP8A 3IM8A 3PVXA 1SIZA 2DGVA 1VRUA 3HFVA 5IV3A 3TNVA 2IY5B 4NWBA 2MZRA 5CAAA 2Q3PA 4MIWA 1O8BA 1Q4RA 2YKMA 2GQ2A 3UO0A 2MZ1A 1BE4A 3DLEB 5CYMB 3DRYA 5HL7Q 1FK9B 1UTAA 5HQLA 1KFSA 2GA7A 2ZUAA 2R7WA 3AD7C 1R31A 3NS6A 2R7OA 4C6AA 3J7AN 1VI7A 2XNQA 3D1HA 2R8GA 4M5KA 2E5LJ 3MCSA 3HMJG 3SQOP 2DO4A 5F8HA 3IRXB 3ZZUA 2B5JB 2AEMA 1HWKA 2JC0A 4RBTA 2YX1A 4IDKA 1RTDA 4IQMA 4HDGA 2ASDA 4DSJA 2R7VA 3DYAA 2JLFA 4PYDA 2CPYA 3VVUA 3NAHA 2OELA 2OO4A 2HHUA 1LK5A 2VG5A 2Y9HA 2ZE2B 3MEDA 1FNMA 3PEHA 4OLOA 1ZTWA 3R7BB 3V4IB 3AXMA 1NK4A 4ZVHA 4WJBA 1VQ4S 4EGLA 3J7YU 1OIAA 2OMOA 4FPIA 1RHRB 5HROB 1NHVA 1M5SA 2DNGA 3GE9A 3OFGA 4NA3A 1HD0A 2EC2A 1TV6B 1RK8A 4FVCA 3RBXA 2FJVA 1J5EJ 1RWPB 4LR9A 1WF1A 4R25A 5K8OA 1PBAA 2NXNA 5C25A 4QR0A 3DLKA 2HVIA 4K8RA 3QNWB 1OSCA 4RNFA 4YOEA 2XY5A 2V4RA 4N77A 4USVA 1F3FA 5HBMB 1UL3A 1NH8A 4DSKA 3H5YA 1KLMB 4B9SA 1VC5A 1IWAA 3EE3A 3LWMA 2FY1A 3OR2A 5JVGQ 3K5NA 4ZPBA 5D4OA 3RB3A 2IAJB 3ISNC 1IR2A 1RB0A 3CMQA 3IR6B 3SBMA 3VF0B 1NKBA 2HQCA 1JB0C 2V69A 3H25A 5IOLA 4V19J 1H2TZ 1UWBB 2QSWA 2K7JA 3ENVA 1R8PA 2XLKA 1NHKL 2CPXA 3DLGB 1S9EB 3KWMA 3LH2S 2XBPA 4NCGA 3CO9A 5A6WA 4TQRA 4ZP6A 3R1HA 3VAGA 4DQIA 1S77D 5F8JA 2JZ5A 1X4FA 3PFOA 4KGVB 4MFBA 4IYQA 4JV2A 3JSYA 3H90A 3LUYA 4TY8A 1UZHA 3WX4A 1Q8LA 1DQ9A 1SPBP 1RU1A 1XR6A 2C1EB 3B78A 3EICA 4NI2A 4QPTA 1N36J 3O8WA 1FKPA 5IT9Y 3CD5A 5KG5A 2NSCA 5I42A 2QEXS 2Y8WA 4L74A 2PN6A 4N76A 3OPKA 2CPFA 1NDPA 5BYQA 2E5HA 1RKJA 4CRJA 1U09A 3VHQA 1NSQA 4C48A 1IKVB 2EW9A 2J7WA 5B7WA 1KQSR 1VYAA 1FE0A 1Q8KA 1HHSA 2ZH5A 2NLWA 4WE1B 5J2NA 1FERA 1VC0A 3DGVA 1IBLJ 4ZPDA 3OTEA 2JX2A 5LXYA 3WC2A 3P4UB 1SL0A 1RAFB 2PFDA 1IBMF 1FRHA 1Y9OA 2CQIA 1UETA 3V6DA 1ZTTA 2W8LA 4C97A 1U0HA 1X4BA 1KOOA 3J7ZT 1UAWA 3UCUP 1ZM3A 3UD5A 3M9OB 4BWJA 2AKWB 2IRXA 3MXHP 4B9VA 2JLGA 1JJHA 1RHKB 2CJYB 3W8PA 2BM1A 3ETOA 1U8SA 1S57A 4HR2A 4DL6A 1U4BA 2MJNA 3BGRB 1X9MA 1RT6A 3D54A 1QJHA 3IR7B 1VHFA 3B8HA 1QSLA 3DDKA 1KONA 2CA9A 2WK4A 4ZPCA 2M3DA 1VQYA 4DQSA 3IBFB 1SXLA 3HHNB 4DZ6A 2E5IA 2CWKA 4WTYA 4F4XA 5DG9A 2R2UA 4ZN3A 1FRIA 2BBEA 4KO0B 1X4HA 5SZTA 3P49B 3LW5C 4NYPA 4CH1A 1PKUA 1MWYA 4ES1A 2FJEB 1HHQA 2DIUA 3HHLB 3M6VA 1MWQA 1QAYA 5KFMA 4NLDA 5E3QA 4ETZA 5CD4H 3GILA 3W5YA 2AYGA 3RR7A 4JV5J 2M5YA 2LMIA 2MKCA 2AGPA 1QM9A 2MJUA 4G1IA 4Q5VA 2I1RA 1JXVA 4DV5F 5D0RA 3VQTA 4J9NA 3KK2B 1KHVA 3T5LA 1Q82T 2P5VA 4NCGB 2HWIA 3HD2A 1VQNS 4QQBA 3DRRA 3HHDA 4A47A 2LQJA 5HK4A 4B3OB 4Y2AA 2V8PA 3MMJA 2VB6A 2ZHBA 4LFBJ 2GMLA 3CCQS 3OV7A 2ZH9A 3MPUB 3HVWA 2AMCB 2B6AB 3MZIA 1D9AA 5D0GA 5CABA 4G1QB 2RB7A 2DNYA 1FTRA 3E01A 2OEMA 2JNJA 2LECA 1JJ4A 1HQUB 3VAMA 2CJXB 2N3OA 1DQ8A 1KVKA 2PE8A 5G4DA 4EO6A 2FYXA 3M9NB 5AE2A 1EP4A 4F2RA 4FBTA 4GKKJ 4RX6A 2E5GA 1HBNA 2ALYB 3PCOB 4KB7A 4TNOA 4R5PA 3CJTA 4KY3A 4DN0A 1SIWB 3SCJE 1N34F 1ZETA 2PMHA 1TK5A 4EZ9A 4GC6A 1YTYA 4LF4J 4CO5A 1L3TA 1VDHA 4NOHA 2HFNA 2I8EA 1NK8A 1ROFA 2VFVA 3EWGA 3OFEA 2NZCA 4GMKA 1LXNA 5C24A 2BR0A 2R2TA 2L08A 3D2WA 2H3EB 4QWAA 3G6YA 5HMWA 1T02A 3LAKA 3BKUA 2B56A 2AEFA 4UT4A 2PGCA 3TP2A 1TL7B 2YX7A 1BUXA 3G82B 2ZZMA 5KFAA 2IMWP 5HAOA 4NPOA 2J9CA 1IQTA 1HYSB 3UVJB 4DDFA 4PRFA 3SDEA 3IAS9 4DJBA 2VQEF 2GS8A 1RTZA 1WJ9A 2B5JA 2RRNA 2R8HA 1RT6B 2G0JA 4PEOA 4CIOA 2RDJA 1W2IA 2RT3A 3HZGA 4KKOB 4CLUA 2B4UA 2GHPA 4Y2MA 2F9DA 3T5KA 2AIRB 1IVZA 2KFYA 2WSEC 3E51A 3V6DB 4E0DA 2QO3A 4ILMA 3ELHA 3S6EA 4OX9J 4JI2J 1H2UX 1GMWD 1NDLA 4OYOA 3BSCA 4EBEA 5IS2A 5A0YB 4CZCA 7FDRA 1VOMA 2KJVA 1JIHA 3M8RA 3IMQJ 3S1TA 1KVJA 2IHR1 1K0TA 4JI6J 5HLFA 3OUYB 3NGSA 4YR0A 1C4AA 1HNZF 1TKXA 2CNOB 3TUPA 4FYDA 5D3GB 2D68A 2ALZA 3VGVA 2J8SA 3MPYA 5KG2A 1IM6A 2AF6A 3OR1B 1O0PA 1OPZA 1SB6A 1SJRA 1BMQB 1RT7A 2CG4A 3S01A 4A8OA 3G6XA 3HT0A 1U2FA 3BZQA 5J2PB 2WW8A 1Q86T 4EBDA 3GCWP 3RU0A 2UVWA 3A8EA 2WOMA 3IWNC 2JC1A 1LKZA 4WP8A 3VQSA 1N56A 2JH3A 3ZZ0A 3A3OB 4J9KA 1BY9A 4ID5B 2V2QA 3LP2B 2XO6A 4LVNP 4ZHRA 2FLPA 2Z4PA 2XHCA 1K1QA 2RRBA 3ZFVA 2C28A 2DNMA 4FYXB 4LUBA 2G4BA 3F56A 4OZJA 2MPUA 4ECWA 2XB2D 5K14B 1FT8A 1XIQA 1U1PA 3AODA 1UA1A 1NJXA 3QZ8A 2KT2A 1HBUA 2XNRA 4Y00A 2E9RX 5G0RA 3DXBA 2QA4S 3SZ2A 4DPXA 2AP6A 2ATCB 3GPAA 2QA1A 2W7PA 5JVHQ 3EMTA 5DZ6A 2IVYA 1SQEA 1S99A 2J0QD 1U47A 1U7LA 3R5JB 3FDSA 5IM0B 1VHIA 2CNKB 3H8YA 3MR7A 4RJVA 4F0KA 1F9HA 3DU6A 1BXNA 1G6BA 1OSDA 1J2VA 2HHPA 3E01B 4UUWA 5I3UB 3J7A1 4LMZA 2V8GA 1ACMB 4NRUA 2PFFB 3NGKA 4DFMA 2OSQA 5ITHA 4N56A 1EX8A 1R0BG 2RNEA 3I4PA 2CZ4A 3PJXA 5HATA 2V34A 2OH2A 3UN2A 3IA0A 3CJQA 5GADI 1RT5B 2KN4A 1TKZB 1D09B 1ZAWA 2GX8A 2R7QA 2W1BA 4M94A 1KRPA 3UDCA 2Z56B 1HNXJ 1S6PA 3D6TB 1IUJA 2VJUA 3FCHA 5HN0A 4HACA 1GMUA 3I5BA 4O3QA 4FKXA 3RBZA 2IBKA 4H4OB 2VPWB 4M95A 1HMVB 4IFVA 3KFWX 4IOAQ 1EQMA 4J9QA 2MB0B 2FIUA 3BSOA 1S9GA 4OHZA 1WTFA 1GMWA 2VF3A 2IRUA 4HYKA 2OKQA 1NU4A 1J5EF 4ZVOB 3W9HA 3A12A 2QA4G 3C8YA 1WTBA 1T9UA 7FD1A 2IBOA 1F2HA 2MHEA 3SV3A 3ZTQA 2EKNA 1NH7A 2W2NP 5ETSA 4IR1A 1LWEA 1Y4ZB 4RKUC 2ZH7A 1FDBA 1H0HB 2YWKA 4DXLA 1T0TV 4LRCA 4YP3A 3I4HX 4BC7A 2D74B 2XO7A 2DRDA 1N5TA 2XMKA 2PSZA 4DPYA 4K5SA 4C3MA 2F8HA 2FVCA 2QG9B 1QAJA 5L9XA 1VK8A 2CJBA 2Q66A 1CEZA 4TU8A 1M0SA 4WU3A 1KWMA 3FUYA 4ZJOA 2E29A 4DHVA 4GKJJ 3WC0A 5KT3A 2C2EA 1TZ0A 4D3HA 3E8OA 3DOMB 1M5OC 4RU2A 3C3LA 2ROPA 5DLFA 3ITHA 2AJFE 3W5ZA 3NS7B 4DV4J 2KYZA 4LF6J 1NKCA 1G4CA 4ZPWR 5E0OA 1YJUA 4J7CA 3W5XA 2GHVC 5J1EA 4X4VA 4DR4J 3TAMB 1JNRB 3HK2A 2XYPB 2J9EA 3KUHA 3OVAA 4IUFA 2BE2B 3UFCX 3CMAS 4KE5A 1B64A 1ITPA 4L3KA 3GIIA 3MTJA 3C2PA 3DLGA 2VOOA 3H4DA 2ZD1B 2DNRA 2HVEA 2UXDF 1WWHA 3DRPB 3HSDA 3PRVA 4DCJB 4TXSA 1PIEA 1KLMA 4OZ1A 3TJ8A 4MFBB 1SUQA 3BO4A 3RB0A 1UCNA 2O66A 3QRQA 4MTPA 8AT1B 1S72S 3HP6A 2ADCA 1LWCA 1R27B 1SC3B 1SBRA 2V8DA 4HHHA 2ZVSA 4LF7F 1SV5A 1FDNA 2ZH8A 3I5AA 4OHYA 4WXOA 3TRGA 5HJXA 1HBOB 2BEFA 1U48A 4P2SA 3H42A 1CJTA 2AU0A 4OX6A 4C8KA 4QZVB 2ROEA 1F2GA 3G71S 5FLXU 1RT4A 1YRUA 2MQNA 3TEGA 1NZAA 1V3SA 3PJ9A 3SQGA 3ZZZA 2M88A 4J9MA 2J9DE 4QOTA 1RWWB 1UFKA 2WSCC 4NA1A 4YB6A 4ZCMA 4P72A 5KT6A 2M7SA 1EIYB 3CGIA 4RW4B 2HKEA 2CQCA 2MKYA 4ZVGA 1RT2B 9RUBA 4NLQA 1T94A 2HRTA 2HEKA 5ETNA 4LR7A 1VQ9S 3R5GA 2XZDB 4Q0BA 1RCOB 4IH6A 4DSFA 4OV1A 3JTOA 2B9YA 4HHJA 4IDKB 1D9DA 3HF5A 2GJ2A 1H6KX 2QTWA 3WZ0A 4LF8J 3MDFA 4BCAA 1U2CA 4C11A 2DEJA 4ES2A 2ZE2A 3MEDB 5ETTA 4ZDNA 2C3YA 4WXWA 3R5BA 1UJ4A 2B8QA 2GO8A 2E5JA 4BWMA 2FB0A 2XEXA 1U25A 3DHXA 1NRKA 1P1LA 4OZ5A 3ZTPA 4X64F 3FBCA 1A6LA 2BX6A 3Q8YA 4UUXA 5AXMA 4ECYA 3W63A 2MQPA 2H54B 1TP7A 3F0NA 4ZMMA 2VG7A 3PYFA 3DLLQ 5KFWA 3M8YA 4YQWA 3BO2A 3G8SA 2H4WB 2ZOGA 5AT1B 3CMES 4MT1A 2GIRA 1WG4A 2P9CA 3P45B 3MAAA 2GVZB 2ZHOA 1LOUA 3L7OA 3BBBA 4OHXA 4A8QA 3T5HA 1HR0F 4KO0A 1IKYB 3B4DA 2LFVA 1PJ5A 3L09A 3J81Y 2NXCA 4PAAA 2Q43A 5D4LA 2GO9A 4CLTA 1FA0A 1OY9A 2V67A 3MMCA 2ZM6J 4ECXA 1S1XA 2J0SD 1JK9B 1D8YA 3IFEA 4IO9Q 5DZ7A 4B3RJ 4W98A 1UJ6A 1LEOA 4MJKA 1UWBA 5CD4A 4GC7A 3BPSP 2HQDA 5I3UA 1F0XA 3MCOA 2XZ2A 1OYDA 2VQFF 1HBOA 2FJAB 3C6TA 1HNIB 2RF2A 2B4PA 4EEYA 4JI7F 3TVZA 2MY7A 1Z1ZA 2NXJA 4YR3A 1H38A 1PC5A 3G87A 3LWLA 3FBEA 3VALA 2FHMA 3HSZA 2DGTA 2DXEA 4YHHJ 3HX9A 1H74A 1Z4UA 2H65B 5LT5A 5LJ5Y 4ES3A 3SQGB 3T41A 1Q95G 3I9V9 4ANDA 4NYOA 1R3NA 1Z2LA 2QA2A 3MM8A 3Q22A 4ZS6A 2XCAA 1RHMB 2VL1A 1RLCL 4DLGA 3QAEA 2DISA 1JJ2R 1VQKS 2HMIA 3PR4A 5GAEU 2ZVIA 1WC5A 2CYYA 3HLUA 3ONQA 4WU2A 5ETQA 2K1RA 2PD1A 4M5IA 4N8OA 4P7TA 5C42A 3PYEA 4CH0S 2CQ2A 3SXLA 4EI2A 4USKA 1FI4A 2XMTA 3TZWA 2MQQA 2DRBA 1YRTA 2UXBF 2I6WA 4ATNA 2VFSA 3KNAA 2WVDA 5F0WA 4ZK7M 4MKBA 2A18A 4BHQA 4H4KA 3N01A 3RYLA 2DT9A 5DM6Q 4HTIA 4P6QA 4L75A 3U1MA 4E98A 3MFIA 5AXLA 2ZDOA 4UOFA 1R7IA 1TL1A 3G8TA 2I38A 4LBIA 2RAQA 3K17A 3S7RA 5EWGA 2LEPA 1SL1A 4NXNJ 3P6YC 5D77A 2JJ4D 4C3LA 4ZIVA 5AE1A 4PUOB 4AE5A 5KFGA 4R8UB 4TYAA 5DQGA 1RJJA 1WKLA 2UP1A 4A48A 4CNZA 2AJ2A 1UZDA 4Z2XA 5DDRC 4ER8A 2WRMA 2AGOA 5KG1A 4ED5A 1TKXB 4DR7J 5U47A 3MR6A 3LP1A 1SQGA 4DV0F 1KFDA 1GXTA 4QPXA 4DR2F 4PZVA 2KDOA 3OTBA 3DLEA 3JYTB 4C11B 2XY7A 4X4SA 1U1QA 2GVZA 5H9FK 2FY8A 1IM4A 1Q53A 2A3JA 3AH6A 3CIZA 2KZMA 2W7OA 4K5RA 3Q8RB 1U0HB 5GAGU 2J7KA 4DUZJ 3UPFA 4DPOA 2VDHA 4RNMA 2FC8A 3DRSA 1RABB 5E2QA 3TA2A 5ETMA 3W2VB 2K7KA 1X0FA 1XMOF 3OVBA 3K5MA 3CCJS 3IRXA 4HTJA 4ZOSA 4O3SA 2UUAJ 1HD1A 1V9OA 4X4UA 1WG5A 5T7LA 3GIKA 1VBZA 4NLOA 5F8IA 2F9JA 3D6HB 4ZPTR 1QAXA 3VAHA 1U1OA 2R7RA 2QLFB 4QWDA 1RTIA 3QWPA 2IRYA 3G86A 3UN5A 1JX4A 1XN9A 1HL6A 3A3PB 2VFTA 1RXOB 2C3MA 1FNXH 1S1WB 2UZAA 1K8AT 1B7FA 2FHOB 3T6BA 4X4QA 3NP5A 1B0TA 1F5AA 3QSYB 4ZKAA 3C6UB 2MXYA 5AJ3J 4DPTA 1APSA 1FD8A 1AFIA 3D4JA 3KLEB 3MM8B 4I56A 3L9ZA 4YY3F 4U9RA 2QLJB 2GGPB 2HMIB 1G7CB 2MDAA 2O5DA 2QN6B 4H4MB 1EHWA 2HFOA 5KFTA 1YSJA 1FRLA 2D9PA 3FJ2A 2LLZA 2XI2A 4TY8B 5KFCA 5KFHA 1NDKA 3CCMS 2LQBA 4FYWB 4CYUA 2IAJA 1YITS 4W90B 4K4ZA 1C4CA 5BYRA 3JB9k 3GMGA 4B9UA 3OLBA 1C1BA 3FVYA 5KG0A 3KK3A 2AW0A 4PQUA 2HFZA 3MM9B 1M5HA 4CLLA 3PX0A 3BF4A 3Q23A 4ALZA 4XK8C 2AYEA 2H48B 5EX3A 2XTDA 3VGSA 4I68A 2DHAA 5HLFB 3GZ7A 3IG1B 4AL7A 2KT5A 2C3PA 1FJGJ 2OTJS 2ZC3A 4YHHF 4F4AA 4YFUA 4QWEA 2RD5C 2E1PA 2ACYA 2LA4A 1FD2A 1IXKA 4RW9B 1N52B 3A3NB 1WC6A 2DYAA 4ZPVR 3GU0A 1YG0A 3K5PA 2OGUA 3M1VB 4QIFA 1HBMA 2V63A 2UVRA 3OSPA 2FD2A 4ZVUB 3CUNA 4OYMA 4URSA 3TQ1A 1S1TA 4LSZB 1CLFA 3ZXWA 1JJCB 1CQNA 1CJUA 2XZTB 4C0HA 2DXDA 1PSDA 3TR5A 5KOXA 4DUZF 3QFHA 1VQ6S 2MSTA 5F3TA 1IQZA 4ELUA 1VIXA 1UVKA 2EWHA 2ZZTA 2YQ1A 3MFHA 2YTCA 4KGKA 2W9AA 5D3GA 4C8ZA 2IFXA 3LGHA 4NRTA 1EJ7L 3N5FA 2KFZA 4ED3A 4O44A 3TJAA 5HVFA 4I7FB 1NSKL 2ZOFA 2WB1D 2IJNA 3BQ2A 3RUBL 1NK5A 3NCPA 5HJYA 2DY1A 2FHKA 4EU0A 5L38A 4DR1F 4JI5J 2BV3A 3KK1A 2J6UA 2EXUA 5KT4A 2RQKA 5HQMA 4LR8A 1RBOB 3DOKB 4M5GA 3EYZA 1YI2S 2XMMA 1DRZA 2X1GA 5ADZA 2Y0BB 3LP0A 4UW2A 2C42A 1CPZA 2R42A 2NZ4A 2H5JB 3PHEA 1M1HA 4KRWA 4RNOA 3OUYA 4QU7A 4DR2J 2RQ4A 2V4JB 4NXMF 1K47A 5DGAA 1AFJA 1NPRA 2BVZA 1I6JA 2Z2ZA 2QLBB 2H1YA 5F0UA 2RHSB 2MEWA 4C7QA 2KXNB 2CKWA 3A8KA 3C16A 2YKAA 2C2RA 2UUTA 3BSAA 4LFCF 4Q7AA 1WF2A 2R4FA 1M1KT 1O5JA 1MROA 3EZ5A 4DR3J 4QU6A 1X4CA 5H9EK 3UWTA 2J7UA 5MLCV 1CG2A 2JEFA 2QYGA 2VICA 3KLGA 1WC0A 1FWKA 3DC2A 3QGPA 4O3OA 4ECRA 2HLUA 1DTTB 1FHTA 1EP4B 4EMDA 2DRAA 2FUG9 3OL8A 4MAKA 3CULA 2XGQA 4LF2A 2LP4A 1Q7YT 4H4MA 1HW9A 2B8PA 3D6FB 5KG7A 1S9FA 2L48A 3ILOA 1U6BA 1SI9A 4WIQA 4LF9F 4CLKA 1UW9A 3OD2A 2KKHA 2DNZA 3K2YA 4KFBA 5F41A 5EWFA 1RA6A 3KG0A 4J90A 1VQPS 1S6OA 3M30B 1JLGB 4RW7B 5B0FA 5AJ3F 4OJHA 4CYUB 1NKEA 4CO0A 1Y7PA 5E5NA 1NK0A 1H7XA 5M2UA 3IGNA 4F26A 2LVWA 5L39A 2MZSA 2YH0A 4PQUB 2MQMA 3EXYA 3DM2B 1KP6A 2B7BB 4PXEA 2MZTA 1JLAB 3ET6A 3NGUA 4WFNQ 1NZ8A 4RZRA 1S6UA 4KC5A 1RWOB 2H9ZA 5FDLA 3IG1A 4DWIA 2V94A 4J9LA 4OJ1A 4EYIB 4ERDA 2Y1IA 1SC4B 2YWFA 1FFWB 3FEXB 2BDPA 4EYHB 4RWXA 5BJRA 3W66A 2EFPA 1DHMA 1D0EA 1XMQF 1PC4A 1DLOB 2YWHA 2FJXA 3KLVA 2K3KA 3D28A 3AA9A 4JV0A 2N7YA 1REVA 4OJGA 4M8LA 4URQU 3IXQA 4DSIA 1CJKA 1HLWA 2PI5A 5HO4A 1FF2A 1YRXA 1R0AB 5LMUF 4CLPA 1T9VA 4NLUA 4AUKA 1SL2A 2F4FA 3GV7B 3HVTB 4LF6F 2F40A 4H54A 8RUCA 4ED7A 1F1BB 1WHXA 3V6HA 2QGFB 3GG0A 4C8LA 4JI7J 3TEHB 2HHTA 2ZC4A 2CNNB 2YXLA 4OX9F 3UI3A 3KLIA 1M5KC 3EGVA 4WFBQ 4B9MA 1QVFR 2HHSA 4PWDA 3H7HB 3MMBB 1PJ6A 4ZIWA 4JB8B 3BREA 3I56S 1J27A 3J80Y 1TFYA 3G96A 5KFFA 1T95A 3M7VA 2HGNA 4PXBA 2XCPA 3AX3A 1ZA1B 2I9SA 2DVIA 3DCAA 4ID8A 4ZJQA 2V9WA 5KFIA 3LP0B 3TVYA 2N7CA 1YJWS 3FCWA 3TAPA 1TK0A 3NNHA 3KJVA 1OY6A 1U6ZA 2XYHB 3RG6A 1XEZA 3OQ2A 3FRZA 1S1VA 2DNQA 3CDAA 5CA5A 3NMAA 1NHUA 2V9KA 1I3OB 4F4KA 2O1PA 3W1YC 4OZNA 1DZ5A 3HJVA 2HAFA 5KFNA 4CO3A 4O0IA 1B0VA 4RW4A 5CCLA 2W9CB 4B3MF 1SVDA 1SV5B 1JLFA 2IMOA 2GAGC 2O67A 1RWMB 3CDEA 1E6YA 3EM1A 3GG1A 3PIOQ 2XM3A 3N6LA 3PACA 4X62J 4LF5F 4USWA 3BV8A 4C8OA 4X64J 4GKJF 3IC1A 3R8YA 4LF7J 2VFRA 1H73A 4USIA 4YN3B 4WTOB 3QT8A 1RISA 2W7AA 3FMBA 5KFPA 2HPUA 2KB2A 2XGPA 5C7PA 1U8WA 2OPSA 2ZH3A 4DV1F 4DS4A 1VQ7S 2BW7A 2P8IA 4N47A 1UUJA 1HKAA 5C42B 1KQGB 1VRUB 3NOCA 5D78A 4RO0A 5ETLA 1OS5A 4WPAA 4Y2KA 3GYNA 2Y1LB 2ZWPA 1YJ9S 3EVMA 4DR7F 2D3UA 4U95A 3LPEA 1R8BA 4KFBB 1RT3B 1XNQJ 3QGIA 4X4NA 1TU0B 2V2KA 1MMNA 2ZEJA 3TW0A 2ERRA 4BDPA 1RTJB 4OYWA 5CXTA 1S0OA 5KFXA 5FD1A 3TVKA 2YQ0A 3CCRS 1T3NA 3JAMU 1HR0J 3F41A 3MD3A 2MGZB 2D41A 1NJWA 1DURA 3L95X 4BBYA 5I3PA 3D68A 2V2VA 5GAHI 1SH3A 5KFKA 3IGVA 5CYQA 2Y3YA 5LMNF 3CSKA 1LV5A 3P5TL 2L9DA 2QIFA 3PM9A 3KXDA 3QIPB 3DGPA 5E41A 2KM8B 4QR1A 4Z7YA 1XQIA 5EN1A 1U1RA 2G0IA 3DOKA 3NXZA 3BYRA 3JQJA 1NK9A 3ZZPA 2VA3A 4K0KF 3OL6A 4X65F 4WKRA 2RF2B 5T7LB 3PO4A 3MAAB 2QLXA 2EFQA 3FRYA 4ZP9A 2VZ9A 4CH7A 1IKYA 3DOMA 4NASA 5DGBA 2GHWA 2P9EA 3SMZA 3KHHA 1UVJA 5LJ3Y 3THPA 1O51A 4CM0A 4U6PA 5B0AA 3BN7A 1UVNA 2WCXA 2N4CA 4USJC 3VVTA 1S1WA 2EC0A 5C2CA 2Q1LA 3MWBA 5KAKA 2XQCA 2KRBA 1RADB 2XZWA 1JLEA 2C3OA 1NJIT 5IQQA 4TQSA 2F5GA 3A1YG 4JOUA 3IM9A 4CLFA 2NS1B 4J9PA 1HW8A 3I6PA 1KBRA 2AWZA 4NYZA 1TMJA 3MAHA 1TKDA 3KHGA 2JLEA 1RDRA 2YNIB 2IDEA 4Y3CA 2K1RB 2KXFA 3MECA 3ETMA 5DG8A 4F4WA 4RW8B 3PW5A 2CADA 5LM7E 3V81A 2OEKA 3CCWA 4PWUA 3CD0A 4UQTA 1S1VB 2BOPA 2GW8A 3Q24A 1HI0P 4ILLA 2CJKA 3OW2R 4KR0B 1N33J 2UU9F 2XSJA 4ZVTB 4QBUA 1Y0HA 3TA1A 1XC9A 4OL8A 3K89A 2OSRA 4MK7A 1YGYA 5J2MB 2VBZA 2RQMA 2EFNA 3IAM9 2RS2A 3NNAA 1N0VC 2PDAA 2HK3A 3CD7A 3R5AA 3R6GB 3GIRA 1RUSA 2Z8QA 1BD6A 3CD6S 2H51B 5KFRA 2B4OA 4DUYF 1IJFB 2OPPB 2XS5A 2W2PP 4MKAA 1WACA 4RW6A 5KFUA 5DS7A 2XC9A 4IRDA 4ZN1A 2BJ8A 5B09A 4RNHA 2OPSB 2H4YB 2R7SA 2XMAA 1HQEA 2GC8A 4K4XA 2RUSA 3ILLA 1HWIA 4KPCA 4NX9A 2DGQA 4LFBF 1QUVA 3NGTA 5LL6d 2MGZA 1S97A 4X62F 3BEGB 1UVMA 1JMTA 4XO0A 1ZS6A 5GMKa 4DR1J 4W92B 1FX4A 5KFDA 4P9SA 2WTFA 3FBBA 2OIHA 2ZJQQ 1NLKL 4HL9A 2XHWA 3C66A 2E1CA 4O4GB 4I2QA 1FKAF 1EZZB 4IG0A 2ZZNA 1VRTA 2ROGA 3BR8A 2UV8A 5K8NA 4GVBA 4DS5A 3M2RA 1HARA 3ZZTA 4CP5A 3SSSA 6FD1A 3S8SA 2R7UA 4NMXA 3RZAA 2QZ8A 3MPDA 3R2CJ 2GNKA 3M8QB 4NXMJ 2OHDA 3RAXA 2MQ8A 3BGFA 2CNLB 4LSLB 4OMFG 3BS9A 9ATCB 2QFJA 2NUHA 4HKQA 2W9BA 2AQ4A 4TY9A 3DNCA 2XTEA 3AOCA 4NLRA 2CQ1A 1WF0A 2GZOA 4DR3F 3GSDA 1P8GA 1YDLA 4AD6A 4JI1F 2VQEJ 3DRXA 4ECVA 3FNNA 4NA2A 5KFLA 1RTDB 4OQJA 3DLKB 1WC3A 1XWLA 2KRRA 1RAHB 1X5TA 1RAJA 3AX5A 4WFZA 3SFGA 3CWJA 3JXOA 4C8NA 5IT9U 4I7FA 3EDRB 1IBKJ 1GNKA 5L8RC 2G0CA 4P7VA 5KT7A 4J91A 1RYRA 3JSMB 2M8HA 3UW1A 4ZVEA 5HVHA 4L3NA 2F4VF 2FZCB 3HSGA 1LW0A 3OTCA 4FXVA 1YBAA 3KLGB 2HG4A 3LA0A 2CQPA 2WONB 4QR2A 1AW0A 1IR0A 3IN5A 4YB1P
chains in the Genus database with same CATH topology
2PT0A 3QPIA 1FVQA 1U26A 2IA0A 5FLXY 4EBCA 4ZP7A 2W4DA 2YNIA 4C4WA 3RW6A 3QLHA 1OO0B 5EDWA 1R43A 2UUBF 1HNVB 3MM6A 3NCRA 5KG3A 2NQPA 2CPJA 2YKMB 3I0SB 5M2RA 3TYTA 2V5HG 2B0GA 1RTHA 5DDOC 4R0EA 1FK9A 2CPZA 1RT3A 2BA9A 3OJSA 4NLWA 4OLPA 4OX8A 3QJPA 4O3RA 2ASLA 1IKVA 5F9NA 5J2QA 1PGZA 2E1RA 2F7VA 3KOAA 2QE5A 2LXIA 3R5DA 4IKAA 4O4GA 1N36F 5CH7B 1U1LA 1S79A 2XY6A 1IJEB 4TN2A 4LF8F 5FJ4A 2C22A 4UOCA 4ZPAA 1PILA 3VAJA 5M2PA 4JI4F 2ZITA 2HS4A 1VLYA 4F2SA 1YJTA 2AJ4A 2XMJA 2LA6A 3HHEA 1RKIA 2XI3A 2N82B 4QJVA 4LSLA 5GAGI 1S6QA 4FZVA 2ZNYA 3MM9A 3KMQA 4Q43A 4LQ3A 3HFKA 1WD6A 1ELOA 2CPIA 1HPZA 4LIRA 3M6UA 1HFEL 1G2EA 2UUWA 4IG0B 5EUHA 1URNA 4RU9A 2VG5B 3MGJA 5D6GA 5HMZA 1BGXT 2XMVA 1NJZA 3MM5A 2O3DA 4DFJA 4HT7A 2MSSA 1NB7A 4WYLA 3H20A 3GIJA 5DRKA 2VBXA 4X4PA 2CPDA 3CT9A 5B0DA 3VAIA 1M5VC 3HZEA 6FDRA 1S4FA 5CQGA 2EK6A 2ALZA 2D3ZA 2QSFA 3FZ2A 5J1PA 4IG3B 1RA7A 4HDHA 3SI8A 4NLGA 4RUAA 4QW8A 3OXGA 1OQ6A 2CQHA 4PG4A 2DH9A 4WKYA 4C2MA 2YKQA 3KLIB 4DV7F 2DTJA 3VAKA 1HNVA 3T1HF 2IJFA 2XSJB 3HHKA 3GQCA 4AQYF 2FHJD 1JLFB 5L1LA 1C0TA 4IRCA 1FVSA 4NCAA 1ZYQA 3N9UC 4PR6A 2FHJA 4NLYA 4CO1A 2W25A 1WEZA 1R8HA 3PRBA 3VAFA 2DNHA 2YWEA 4XIUA 3GFHA 3TUIC 4JYAF 3O2IA 1Q1KA 2RIJA 4OZLA 4WFYA 1FESA 3NS5A 4DL5A 1JWWA 1GAOA 2IM1A 2J6TA 3MUVP 3LAMA 3MI7X 1YWXA 3KK3B 4DF8A 4FS1A 2B6AA 2UUCF 5DQHA 1FKOB 4ECSA 4UY85 1A7GE 3IR5B 2FVRA 1FEHA 3FSIA 1S6QB 2HGLA 3MUMP 3JTPA 3M8SA 1L3VA 3V6KA 5EGYA 3U7JA 2BYCA 2ZKUA 4C0OC 3HVTA 3PIPQ 1Y3KA 2CQ4A 3BM7A 1FXRA 3M2VA 4TLQA 1I94F 1IKXA 4FNHA 1TR0A 2D7SA 3BSNA 2K3IA 1ZZNA 2DPJA 2ZOMA 1RT2A 1JXEA 1LFWA 3CCZA 2YKOA 3GV8B 1DLOA 3DI6A 3EPGA 3M30A 2RILA 4B08A 3CDWA 4X4OA 2AX0A 4PCQA 3DOLA 1LFPA 2NPIA 2IM3A 2GCFA 4MMOA 1OWXA 3O44A 4ELVA 5DDPC 3CDBA 4AFFA 2VD3A 3CJ3A 5KFEA 4ED8A 4O4RA 2V8HA 3I0RA 5HP1A 2VA2A 2HNZB 3IRWP 1S10A 1X9SA 1LW2B 4CO4A