2IJFA

Crystal structure of the poliovirus rna-dependent rna polymerase fidelity mutant 3dpol g64s
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVSNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of poliovirus 3CD: virally-encoded protease and precursor to the RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
molecule keywords RNA-directed RNA polymerase
total genus 145
structure length 461
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 2ijfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2ijfA02
2YNFB 5C25A 4J9MA 1TKXA 1ZTWA 3V6JA 4NZ0A 3CDEA 4YQWA 4TY8B 1SV5A 4WE1B 2BQRA 4PUOA 4ICLA 3H5XA 2OPPA 2OPQA 2JLEA 3I0SB 3ICLA 3MEDA 4TYBA 3Q8QB 2HNYA 2CJQA 3MECB 1BQMA 3HVTA 1D0EA 1RT2B 3KMQA 1TP7A 2VG6B 3FQKA 3LP0B 3MF5A 4O3OA 5CYQA 5C42A 4Q45A 4ECZA 5J2MA 3V81A 1ZTTA 2CKWA 1NHUA 1QE1A 2YKMB 2FVRA 1S0NA 1HPZB 5KFSA 1HNVA 2AU0A 4MFBB 5J2QA 4ECWA 1HNVB 3FFIA 3DLKA 4KKOA 3DM2B 1C1CA 1IKYA 3H98A 4ZVEA 2ZE2B 5HP1B 2FLLA 2BANA 5KG1A 2V4RA 4NLPA 4RNFA 4YR2A 5L1KA 3KOAA 3V6HA 1VRUA 1OS5A 4RW4A 4WZQA 1DLOB 3IRXB 5HBMB 2ASDA 3MEGA 3JYTB 1S9EA 3KK2A 5F8JA 4ID5A 4NCGA 2IC3B 2AGPA 1N4LA 1JLGB 4NLYA 2AWZA 2C2DA 4I7FB 4TY9A 3I5CA 4LSLB 3LP2B 5K14B 1EP4B 3DRSB 4F4YA 4QWCA 4DL2A 4RW7A 4KFBB 3DRSA 4IQXA 2WHOA 5HROB 4ECRA 1JLEA 1JXLA 1S10A 4EYHB 1RTJA 4KB7A 1NNDA 3TVKA 1S1XA 2HNZB 4IFYA 5F9LA 4ZVGA 1N5YB 1RTHB 3CJ3A 5KFQA 4FBUA 1HMVB 4JV0A 1C0TA 3RB0A 1RT1A 1Z4UA 3GIJA 1LW0B 3DYAB 3DLEA 4K4VA 4O4GB 4J9RA 1RA7A 3IGNA 2BRLA 3DLGA 4ED2A 3DI6A 1HARA 3QO9A 4TQSA 1JLQA 2HWHA 3DMJB 2OPSB 2OH2A 2UUWA 3KLFB 4IR1A 2UVRA 4ED0A 3KLFA 3BSNA 3RBDA 4TYAA 5KFZA 3T19A 3QGHA 3MEDB 2D7SA 3DOKA 1TQLA 1FK9B 3OSPA 5C5JA 2VG5B 4RW9B 5KFRA 4G3IA 5KFCA 3G86A 2JEIA 2IJFA 1REVB 2W8KA 2FVSA 4KBIA 1WNEA 2YKNA 4Q0BB 2WOMA 1JLFA 2R8HA 1T3NA 3DM2A 1S1UB 4KV8A 3KHLA 5I3UB 2EC0A 1VRTB 3M8PA 4DG1B 1C2PA 2XI2A 2J6TA 5CYMB 2BANB 2JEJA 3CDWA 4MK9A 5KFNA 3T1AA 2FLNA 4NLVA 3D5MA 3QLHB 2BE2B 5KFMA 3GIMA 5KFXA 3EZUA 3N6LA 5KFGA 3EPIA 1J5OB 2R8IA 4NLGA 5J2PB 1TV6B 1RT5A 2OPPB 3C6UA 5KG0A 1BQNB 4QWAA 3M9OB 4ICLB 4F4WA 5J2PA 1BQNA 4ECTA 4O3SA 3RB6A 2WTFA 1EETA 5KFJA 3QYYA 4R5PA 5CYQB 4LQ3A 1XR7A 3Q8SB 3PZPA 2BR0A 2VG6A 3FQLA 3LP0A 3CVKA 5C42B 3CIZA 5J2MB 3H40A 4GC6A 3V81B 3QIPB 5EWEA 3PW2A 3H5YA 1DTTA 3LP1B 2HNDB 5KFVA 4MFBA 2QV6A 1HPZA 1S9FA 1C0TB 5J1EA 3BQ1A 3FDSA 3SFUA 2IMWP 4JV2A 3LALA 4URQU 1RT3B 4R8UB 4ECYA 3MEEA 1TKZA 5KFTA 2QE5A 3DDKA 3GV8B 1VRUB 4RW4B 4MKAA 4U6PA 4Y3CA 3GYNA 1JLBA 2R2UA 4ID5B 5EWGA 3GIIA 3OL7A 3RB3A 3M8QB 2IM3A 4I2PB 1S0MA 4NCGB 4TN2A 2IA6A 2FLPA 4O4RA 1KHWA 2JC0A 1UWBA 4ZPCA 4RUCA 2R8JA 3QGGA 1LWCB 3KNAA 4O3QA 5L1IA 3CJ5A 1S9GB 3KLIA 4LSNA 3KLEB 1RA6A 1RT1B 5I3UA 3KLGA 3M8PB 5KG4A 4RUAA 2GC8A 2WB4A 2B5JA 4K4ZA 4G1QA 5DGBA 1S6QB 1TVRA 1QUVA 5JXSA 1TL1A 1JKHA 3MR2A 2D41A 5C25B 3Q8PB 2HAIA 4RNNA 2XC9A 3KHRA 4Q8EA 4RW6A 1SV5B 4WE1A 4ECVA 4IDKB 1KLMA 5KFYA 4NLUA 2C2EA 3PW4A 4K4UA 2FVCA 3DOKB 5KFLA 5KFIA 1FK9A 3N6NA 3CWJA 3JSMA 2DPIA 1HNIA 3LP1A 2VG7B 1IKWA 2VA2A 5DQIA 3BQ2A 1QE1B 2YKMA 3M9MB 4ECSA 2W7PA 3FFIB 1LW2A 5J2QB 1S48A 5KT2A 4NLQA 1VRTA 3DLKB 4KKOB 4NLRA 3NL0A 4H4OB 1QAJA 4H4OA 2BQ3A 4DG1A 4WFYA 2WONA 1IKXB 4FBTA 5KFOA 5DQGA 5KFPA 1J5OA 1HQUA 2BE2A 3BJYA 2RDJA 4RW8B 3NGDA 3V6DB 2JC1A 4RW8A 1RTIB 1JLAB 1YVFA 4O3PA 4PUOB 2IC3A 1JLGA 3LP2A 3BQ0A 3N6MA 3ITHA 2RKIA 2AGOA 2FVQA 2O5DA 2HNDA 3T5HA 4H4MB 4Y2AA 3QIPA 1DTTB 1QAIA 1NHVA 1RT6B 3EPGA 1DTQB 3DOLB 3V4IA 2AGQA 1ZETA 4ZP7A 4NLDA 5KT3A 1C1CB 4ECQA 4ZVHA 1LW0A 3DYAA 3FRZA 3H5UA 5KFDA 4Q44A 4HYKA 3RAXA 3TQ1A 5HP1A 3DLGB 3OHBA 3G6VA 3PR4A 3QO9B 1SH3A 4O3NA 2W9BA 4ZMMA 4DEZA 4HKQA 2B6AA 2RF2A 3H4BA 4J9QA 2YNGA 5FDLB 1IKVB 3HVAA 3OL9A 4WYWA 1IKVA 2IM2A 3DRRB 3ISNC 4YR3A 1JLEB 4O44A 2YKNB 4IR9A 4Q0BA 1RTJB 3KLIB 4J9OA 4LQ9A 5EDWA 3MR5A 1S1TB 4LSNB 3GV7B 1RTDB 1S6PB 5KT5A 3GQCA 2OPRB 1RT7A 4EBCA 2BRKA 3CO9A 5KFFA 5KG7A 2YNFA 3IG1B 1MU2B 3C6TA 4MIAA 5KFEA 4B3OB 3T5LA 4NRTA 1JLQB 5KG2A 2V0NA 4IFVA 4NLXA 4QPXA 4IFVB 4KE5A 3I0RA 3Q8RB 2ILZA 4EBDA 2ALZA 4M95A 1LWFA 3PW5A 4K50A 1XR6A 2OPQB 1GX5A 3I0SA 3JSMB 2W9AA 1RAJA 4ZP6A 4K4YA 1MMLA 2HNYB 2RKIB 5KT4A 4DL5A 4WXWA 4IG3B 4ZPAA 1C1BB 3DRPA 3T5KA 2VG7A 3IGVA 5KT7A 2WOMB 4PQUA 2ZKUA 4PQUB 2HWIA 4I2QA 1S1VA 4DL4A 4IH7A 5DLFA 4Y2CA 2XCAA 2ILYA 3TAMB 3D28A 4IG0B 3E01B 4KAIA 3KJVA 3QZ8A 1DLOA 1KHVA 2FJWA 3QIDA 1HQUB 1SH2A 4WYLA 4J9LA 5HLFB 3KK1B 3I5BA 5KFUA 4NLTA 3PW7A 3MFIA 1FKOB 5KFKA 5DLGA 3SFGA 2WRMA 3H2LA 3KMSA 3V6KA 3OLAA 2W9CA 5KG3A 4WFZA 5J2NA 5D3GA 4M94A 4R0EA 4IFYB 4MKBA 2W7OA 1DTQA 4K4XA 3DOLA 4J9PA 1RTDA 4JV1A 3DLEB 2IBKA 4ZP8A 4ED3A 2FJXA 3IS9B 3IG1A 1S6QA 2E9TA 1TVRB 2R2TA 3KLHB 3NKYA 1TL1B 3E51A 3MTKA 3NMAA 2AQ4A 4IOBA 3PJWA 4KHMA 4WXOA 3OSNA 4F50A 4YR0A 4QWDA 1T94A 2W9BB 2C28A 3MFHA 5KFWA 5F8MA 3MR6A 5F8HA 2VG5A 4RW9A 1S1WB 1C0UB 2ZD1A 2D3UA 2IJNA 4WFXA 2YNGB 3GV5B 2FVPA 2C22A 5F8NA 4TXSA 3FSIA 5FDLA 4QWEA 1RYSA 4J9NA 1HQEA 3OLBA 4ZPBA 3BR9A 5I42B 3RB4A 1HQEB 1N6QB 4IRDA 3NAHA 1LWCA 4FS2A 4ED6A 2JEGA 1S9GA 1S1UA 2J6SA 4XO0A 4I2QB 2C2RA 3H4DA 3QGIA 4RU9A 1IKYB 4URSA 3BSCA 5KFHA 3TAMA 1GX6A 1MU2A 3E01A 3SI8A 4ZPDA 2E9ZA 1S49A 4KSEB 3PR5B 3PVXA 1RYRA 4Q43A 3LAMA 4TY8A 1JLAA 1RTIA 1XR5A 5K14A 5L9XA 3MECA 2YNIB 4IRCA 3ITHB 4KHRA 4ZHRA 5L1JA 1T03A 1D1UA 2F8EX 4IKAA 1TKTB 1EETB 4H54A 4IG3A 1C1BA 5J2NB 4XPCA 1R0AA 4DL3A 1JLCB 5T14A 2XGQA 2HMIB 4NRUA 4MIBA 4QWBA 5DG9A 4K4WA 1LW2B 3CJ2A 1W25A 4MK7A 4K4TA 3LAKA 1TKZB 2XGPA 2FJVA 2D3ZA 4IG0A 2OPSA 5F8GA 3KJVB 1JLBB 2IM0A 5HLFA 2WK4A 3PW0A 3MR3A 1S9EB 3KK2B 3IN5A 3KK1A 1S0OA 2RF2B 5KT6A 4ZP9A 5KFBA 3ISND 4I7FA 4KFBA 4J9SA 4F4XA 4LSLA 5JUMA 5HROA 1EP4A 4YP3A 4KO0A 4KO0B 3NBPB 5C24B 5D3GB 3NBPA 5C24A 4ED8A 2E9RX 5F8LA 1S1TA 2YNHA 3KLEA 1RT4A 3OL6A 4OL8A 4JUZA 3UR0A 2XCPA 4TQRA 4MH8A 4NLSA 3KK3B 1CSJA 1SUQA 3M9NB 1T05B 3KK3A 3GILA 1HYSB 2B5JB 1JKHB 4G1QB 2R2SA 4XPEA 2J6UA 3QLHA 5EUHA 3H59A 4ZVFA 2V4QA 1K1SA 3DMJA 4TLRA 4F4ZA 2XWYA 4IH5A 4X2BA 4IDKA 2GIQA 4EEYA 1LWFB 5DGAA 4RW6B 2UUTA 3I0RB 1KLMB 1JIHA 4RNHA 4WZMA 1BQMB 1FKPA 4PWDB 1RT2A 1S1WA 2ZD1B 4U7CA 1I6JA 3NAIA 2UVWA 3HVTB 1HNIB 1IM4A 3I5AA 1REVA 4URGA 3G6YA 5EWFA 4RNMA 3DRRA 4QW8A 3BGRB 4NLOA 3HKWA 4MK8A 4O44B 2XI3A 3BGRA 3DRPB 5L1LA 2I1RA 4DL6A 5J1EB 3QZ7A 1JLFB 3KHGA 2IAJA 2VA3A 2BQUA 4QW9A 4O3RA 3VQSA 1RT3A 4R8UA 4EO6A 2ATLA 1N48A 4FS1A 2DPJA 2R8GA 3UQSA 4ECUA 4EO8A 4J9KA 2ZE2A 2WONB 2RDIA 3HVWA 1IKXA 3BSAA 4IRKA 2ASJA 3IRXA 1TKXB 2W8LA 4B3OA 1SH0A 3MEGB 4K4SA 4Y34A 3JYTA 4ECXA 1TV6A 3V6DA 4DL7A 1S97A 3RBEA 3H5SA 1RT5B 3C6UB 3T5JA 3UPFA 2YNIA 1TKTA 3LANA 4ZHRB 1K1QA 5DQHA 2W9CB 4R5PB 4RW7B 1T03B 4H4MA 2HMIA 1JX4A 1R0AB 3RAQA 2UVVA 1JLCA 4RZRA 2B43A 1RT4B 3G6XA 2HNZA 1S1XB 3V4IB 1N5YA 1RTHA 1RT6A 4ED7A 3PJXA 3KLGB 1RDRA 2AX1A 4EBEA 2GIRA 3CJ4A 1S1VB 3IS9A 1LWEA 1TL3A 3MEEB 3CDUA 1LWEB 1TL3B 2WCXA 4PWDA 2AX0A 3OL8A 3KLHA 3DI6B 5F8IA 3UDLA 4ED1A 4NYZA 3CJ0A 5HBMA 5DG7A 2JEFA 3M8QA 4I2PA 1FKPB 2B6AB 2R2RA 5F9NA 5KFAA 4Q8FA 1C0UA 4YMEA 1FKOA 3PHEA 4EYIB 1UWBB 4IH6A 4NLWA 1U09A 2I5JB 3KHHA 2ASLA 2R8KA 2I5JA 5KG5A 1IKWB 1N6QA 5I42A 3OHAA 3BREA 1S4FA 5DG8A 2IM1A 2IAJB 2YNHB 4RNOA 4GC7A 2OPRA 1HMVA 5KG6A 3KLVA 4KV8B 3HHKA 3GIKA 1S6PA 3BSOA 2UVUA 1HYSA 1RT7B 1N56A 1SUQB 1T05A 5CYMA 3C6TB 4O4GA 2V9WA
chains in the Genus database with same CATH superfamily
2UP1A 4PR6A 3HX9A 1R3NA 3I9ZA 1WOSA 1ZTWA 4CLPA 7FDRA 1XEZA 1T9VA 4YQWA 4NXNF 3AX3A 1SV5A 4AT1B 5IT9Y 1DQAA 2KO1A 4ICLA 2JLEA 3MEDA 3W1YC 3ZTSA 2MZRA 1KLNA 1BQMA 5B0EA 1KQSR 5C42A 3GSDA 4DQPA 2E1PA 3V81A 3OJSA 2HHVA 3TW0A 2VC1A 3M32B 3W5ZA 2CKWA 3OFEA 4O0IA 1FXRA 5LL6d 2FVRA 4JI7F 8RUCA 2RS2A 4DSJA 1HNVB 5ETOA 3FFIA 2HHTA 4CQ1A 3PEJA 4RPFA 1L3VA 2ZH3A 3J7YI 2AJFE 5B08A 2DIVA 2ZE2B 3HJVA 3MPDA 4ZVEA 2V4RA 1KKHA 3AB4B 4OMFG 5D0RA 3V6HA 3FNNA 4RW4A 1HL6A 3W63A 5IFMA 2DPJA 4UZCA 1N4LA 2IC3B 3J7ZT 2AWZA 3TA2A 3IC1A 3DGPA 1B64A 1FESA 2DJWA 2GGPB 4I7FB 2ZH7A 4QQBA 4E2FB 4DL2A 3DRSB 4LSZB 4RW7A 4Q7AA 3DRSA 4IQXA 2X7IA 2DGUA 2WHOA 3LGNA 4FF4A 2IRYA 4DWIA 3GJQB 4WTOB 4KY3A 3IRWP 1RWMB 4K59A 4LFBF 3HT0A 5F9LA 1NSQA 3I82A 3Q22A 4FVMA 5L46A 3TWZA 4JV0A 1P9YA 2YVSA 1NK7A 1SL1A 1LW0B 2H51B 2DO4A 3T1HF 1H6KX 2V50A 5LMNJ 4J9RA 2EFGA 4Y65A 1RU1A 1S4EA 3UCZP 2F7VA 3T1HJ 5H9EJ 3QO9A 1JLQA 2AYMA 2E5JA 2HWHA 3AXMA 3DMJB 2GQ2A 1YSJA 5G0RB 2RIJA 4U96A 1NMEB 3UN5A 3QSYB 1FJEB 1TQLA 3K2YA 4X65J 4B9MA 3OPKA 3CPWR 4JYAJ 2DNZA 1WC5A 4FNIA 3O44A 4Y2IA 5K5MA 3NLCA 4DU8A 4G3IA 5KFCA 3G86A 1B0VA 4PWDB 2JEIA 5HMWA 3U27A 4KBIA 3HZEA 1YG0A 2KG1A 1TELA 2GW8A 2HQDA 2YKNA 5A76A 3OFGA 2HIQA 2WOMA 1RAOA 4KTQA 3CCES 1N36J 2LFVA 1LFWA 1T3NA 3DM2A 3IR7B 3L7UA 5MLCV 1KC8T 4A47A 1DAXA 3HCXA 1IUJA 3KG0A 4MYUA 4LFCJ 2BANB 1MWZA 5KFNA 5F3TA 2UXBJ 2QLXA 1YGYA 5BYQA 1T95A 3MUVP 2FDNA 3EZUA 2RMLA 4JI4F 2R8IA 2F40A 2PN6A 3HFZB 2HK3A 5J2PB 1QVGR 3C6UA 4QWAA 3PACA 1QY7A 3OJUA 9RUBA 4ZDNA 2KT3A 1U45A 4O3SA 1HNWJ 1QTNB 4X4NA 3FVYA 3RB6A 5GVQA 2C42A 3QYYA 4OX7A 4LQ3A 4QPTA 2BR0A 3D7SB 2VG6A 3CVKA 3MMAB 2H54B 2CQ4A 2QG9B 3LGHA 5DRKA 1KVIA 1X4DA 2YY3A 5A8KB 4HLBA 5HK4A 3Q8SB 3B54A 2QV6A 1HPZA 1S9FA 2H9ZA 4DL0C 2F65A 3BQ1A 1TUGB 2KT2A 2ACYA 3AHPA 2G13A 3EICA 3O1LA 1UJ6A 3QQCD 4R8UB 3OTOJ 1RB0A 3BGFA 1TKZA 2LEAA 3ZZZA 1RZMA 4MIWA 1SJ4P 1I51B 2CPHA 1KD1T 2E5IA 3GJRB 4U6PA 1WUUA 1RHQB 1RP5A 2BJ8A 2XO6A 5ETRA 4OI3A 2AW0A 2MLYA 1TL4A 4Y6IA 2IM3A 3OTBA 3RB3A 5CA5A 3R27A 1S0MA 4TN2A 4LT6A 4O4RA 1Q1KA 1TUVA 2E29A 2Y0SD 5D0HA 4DSFA 3THVA 4B9SA 2VJVA 3UFCX 2JX2A 2W2OP 4ZPCA 2H4WB 2DNQA 2HHPA 1Z2LA 5K20B 1JJ2R 2R8JA 1CS4A 3QGGA 1Q8BA 2UUBJ 3EGVA 3KUGA 2K2PA 4DDFA 1LQ9A 4F4KA 4ILMA 1WC3A 1FCAA 4HHJA 3KLEB 4USJC 3RW6A 3VVTA 1Q53A 4YEAA 3ZZ0A 3T6JA 4C11B 5AXMA 4G1QA 4K4ZA 3K8WA 1GTEA 2Z2ZA 1RE1B 4KR0B 4LR8A 1JKHA 2AMCB 4F0HA 4RKUC 1A7GE 2DNNA 3CSKA 5C25B 2B56A 3P45B 1KQKA 3VGVA 2R7SA 3PM9A 1D9AA 3I56S 4MMOA 3G9CA 1SV5B 4NXMJ 1VC6A 2C2EA 1OQ3A 3CE8A 4LBHA 2FVCA 1CQNA 3FEXB 1X0FA 3TUJC 3DXBA 4ZLJA 2DNYA 2N4DA 2MYFA 2OP5A 2YXLA 2Z2LA 3M30B 2FHOB 2X51A 2YBVA 3NCRA 3QMQA 4DR1J 4OHXA 3NMRA 2XBPA 5FD1A 3IFEA 2YWEA 3MM5B 4V19J 1QSSA 2XWXA 5J2QB 1H2UX 1UZDA 1VRTA 1ZZFA 1QAJA 4NLRA 3NL0A 4CO1A 1RUSA 2XB2D 4NA3A 3QJLA 2DGSA 3C16A 2RRNA 4AL7A 4ENOA 3HSJA 5M2RA 2E66A 3PYEA 1PSDA 5GADI 5C2GA 2RDJA 2CPZA 4RW8B 4RW8A 2YPZA 4WU3A 4KHPJ 1B0PA 1JLAB 1YVFA 3EWGA 1VFJA 1YBUA 2IC3A 5KOWA 2H4YB 2OO4A 4DX5A 3BQ0A 4A4JA 4KHPF 3JXOA 2GS8A 1NHKL 4ERDA 2HZVA 3KG4A 2AJ2A 3F41A 2VQEJ 1QD1A 2ZNZA 2FVQA 1VS3A 2OIHA 3CC4S 3BKUA 2O5DA 2EFQA 3CC2S 4DR7J 1CG2A 4USTA 1T11A 4Y28C 1NPKA 5LSRA 2DR7A 4LF8F 4JI1J 3TQEA 4EU0A 1N52B 1VISA 2QYCA 1SC6A 5HO4A 3DOLB 4W4MA 4F2RA 3HJFA 2OD4A 4PXDA 2VKRA 3I31A 3J7Z5 2HURA 2W2MP 3RRKA 5AJ3J 1RHJB 1PO6A 4HTIA 1LW0A 3OTDA 1TUWA 4NZ6A 3FRZA 2ASYA 5KFDA 4Q44A 1LK5A 3VCDA 3NGSA 5IQQA 3RAXA 1WI8A 3OHBA 2JFKA 3AA9A 3G6VA 3QO9B 5AXKA 2RHSB 3ETMA 2XO7A 5E3QA 4K7QA 3CCRS 1G7CB 1UUJA 3HULA 4J5OA 2XTJP 4LR7A 4O3NA 3U7JA 3SQGB 4F0MA 4RO0A 4HKQA 2VONA 3K0JA 3QATA 1U1MA 1UVJA 4M5JA 5CCMA 2FJEB 4DV5F 4LF9J 1Q79A 3ISNC 3H25A 4YR3A 1JLEB 5GAHU 4CT8A 1V9OA 4IO9Q 4Q0BA 3KFWX 1FNMA 3KLIB 4OZ1A 5ETNA 5BR8F 1NKEA 1M1HA 2HYIB 4KRWA 5ETLA 3MR5A 4FF1A 2DY1A 3DHWC 2IRXA 4X62J 4CLSA 5KT5A 3M8RA 3OVBA 1RT7A 3TAPA 3N28A 1WC1A 4QIWD 1CQMA 3CULA 3BBCA 4C7QA 4MIAA 5A8RB 3MWBA 4OI6A 2ERRA 2KI2A 4NRTA 4CLFA 1J27A 4K2XA 2EVZA 4N41A 4NLXA 4PXEA 4EBDA 2ALZA 2DNLA 3S01A 4LF7F 2DCLA 2J8AA 3I0SA 3CJKB 3HPOA 3MAAA 3I96A 4W90B 1EIYB 3ILOA 3QT7A 4I0WA 4KGKA 4NMLA 4ZPAA 3R8YA 1C1BB 1RWUA 3ZFVA 5GAEI 3QJJA 3DRPA 1F2GA 1UTAA 2LDIA 3L7OA 4ZVRB 2NPIA 2WOMB 2RAQA 1VHIA 2AEFA 2KB2A 4TVAB 1VBYA 2XZ2A 5DZ7A 1Q78A 2HWIA 3O2IA 1TK0A 1S1VA 1VQKS 4IH7A 1K73T 2V2VA 3DRYA 2K06A 2UXCJ 2I9SA 1VGYA 3QZ8A 2K1RB 1U1PA 4OI4A 3GB0A 3QIDA 3HD2A 3ZXWA 2ABYA 2UXDF 1GAOA 3SQGA 2RD5C 3AJ2A 1M0SA 3OTEA 3GJTB 1V5IB 3AT1B 5BR8J 2LXFA 1CPZA 3RRGA 1SCJB 5EX0A 5HQ8A 1UA1A 2EFPA 1IN0A 3GSIA 3L4BC 2ZH8A 3IBCB 1RISA 2VZ9A 3M8WA 3PCOB 4NL5A 5E33A 2EKYA 2BJ9A 3H2LA 2XTDA 5KG3A 4CNYA 4IQMA 1QM9A 4R0EA 3KYLA 5K9FA 4LVOP 3BBFA 4J9PA 2BEFA 4DV0F 4QJVA 1MNEA 2D9OA 1K8AT 2V8HA 2B8QA 3VGSA 4ED3A 1MMNA 3R5CA 1QTMA 2ZJQQ 2MJNA 3IG1A 2AJ4A 1X4BA 3WQPA 2R2TA 2DD8S 1ZAWA 1X5SA 2ALYB 1UMJA 3CD7A 3EE3A 1Q5VA 4DPWA 5D6GA 4WXOA 2RRAA 3NP5A 2AYGA 2AP6A 2CQDA 4LFAF 3ONQA 2RU9A 3LTOA 3CMES 1U2CA 3KJQB 3HXMA 1RBAA 2GA7A 2Z2MA 3MFHA 2W9BB 1PIEA 2AV5A 3MR6A 1P1TA 2B9YA 1I3OB 2ZD1A 2D3UA 2IJNA 2FVPA 2QZ8A 5L9NA 2GJIA 3TJAA 1P8GA 2WBRA 2HFUA 4TXSA 2M5YA 4QWEA 3SCJE 1HNXF 3MXHP 3OLBA 4ZPBA 1N34F 1N6QB 2CQ3A 2NZ4A 3CCWA 4RX6A 4CO3A 3RGIA 4F3OA 4TKTA 2P6TA 4E8UA 4WPAA 3IR6B 4BLGA 1H72C 3W9IA 2MGZB 1Q86T 2P6SA 3DLLQ 4ZPWR 1KNZA 3D1OA 1X0PA 4URSA 3BSCA 4CYUB 5KFHA 1GX6A 1N0UA 3KKFA 2X3GA 3E01A 2FHJA 4EWTA 4ZPDA 3EVMA 3BGLA 2ZBCA 5DDQC 4HDGA 2CFXA 3UD5A 3PVXA 4PCQA 1T03B 3HHLC 4Q43A 4C3KA 1FDDA 3FUYA 3NOGA 1VBXA 1UEUA 1A6LA 2K7KA 5AJ3F 1XR5A 1WWHA 5ETMA 5K14A 1FDAA 3MECA 2J9EA 2YNIB 5L9XA 3PFOA 3ITHB 2F5GA 4DR1F 2ADBA 4NCBA 1DQ8A 2B9XA 3R7NB 1VJQA 4IG3A 1BD6A 5IQ6A 4DUYF 5J2NB 2OGUA 3SCIE 4DHVA 5RUBA 3F73A 3GCWP 3RRHA 5HVHA 4XDCA 1AFJA 1YJNS 4YUDA 2HMIB 1SKSA 2VFRA 4LF2A 5K8PA 4USWA 4PYDA 2MSSA 2E7VA 5LXRA 2VDIA 2GX8A 2BA9A 4M5MA 4MK7A 3TZYA 2XSFA 3GWCA 3IO1A 1YRUA 4FKYA 1HI1A 2B8PA 1WKJA 2D3ZA 3GIRA 4IG0A 4EI2A 5LSOA 2A1BA 4KH0B 4QR1A 1FKAF 2VFUA 4NI2A 3CCZA 2BUNA 4LFCF 5HLFA 4GKJJ 3PW0A 3MR3A 3SXLA 2DR8A 2GNKA 4GVLA 4OLPA 2X3DA 3PXGa 5L39A 3ISND 4DFPA 3VAHA 4LSLA 5JUMA 5HROA 3EDRB 3GJSB 3CD5A 4L75A 4X66J 4OHYA 1L3TA 5C24B 2CDRB 2LECA 4TU7A 2MDAA 4ED8A 3O5TB 2CPIA 2E9RX 1X4AA 2QLJB 3KLEA 1RT4A 3UR0A 1IBLJ 1UJ4A 3G4SS 2MKKA 3D1HA 4MH8A 4P2MA 4F02A 4ED5A 2LEBA 5E3AA 3HSDA 2NXUA 1HYSB 1VR6A 2B5JB 2R2SA 4XPEA 2HHHF 1FFSB 1WHYA 3IR5B 2YX1A 3CF5Q 3D4JA 3CUNA 2J6UA 2XS5A 3FSXA 3M2VB 1T8EA 4QIGA 1P1LA 3DU5A 2PC6A 3G2XA 4AYBD 4AUKA 4CH0S 3DMJA 1U6ZA 1YJRA 4IH5A 4C4WA 3PKMA 5CYJA 1LWFB 1N5QA 1U7LA 2ZJPQ 1EARA 2GVDA 1RT2A 1FFGB 3NAIA 5CCLA 4NYPA 2YKQA 4CLLA 1KVJA 2ZH5A 2RQMA 1RAHB 4RNMA 2LXUA 3M8ZA 2QGFB 3MM9A 4NYOA 1XMOF 2OTJS 3MM9B 5CABA 4JI0J 2I1RA 3JB9k 1XNQF 1FD2A 1N5VA 2ZHOA 5IM0B 2X1GA 4RL1A 3KHGA 3MMCA 3IWXA 2BQUA 2OD6A 3VQSA 2VB6A 1RT3A 3K17A 1YDLA 1NDKA 4PWWA 1YJUA 4MT1A 3RBZA 4FS1A 4DQSA 5DETA 3UQSA 2LP4A 2R7TA 3C15B 4IRKA 2WONB 1WOOA 2VQEF 4NI2B 4ELTA 2JSXA 4I6WA 4B3OA 2QL9B 3MEGB 3JYTA 4HACB 3V6DA 4DL7A 1S97A 2RB7A 3E2EA 1AYEA 3WC0A 3AB2B 1RT5B 4ED4A 3T5JA 2AYBA 1XMOJ 4MYTA 3BPSP 3KUHA 1WSVA 1PYTA 2L08A 1S6OA 2ATCB 3N5FA 2W9CB 4YB6A 1S76D 1F5CA 1N32F 2EWHA 3T3FA 3J81Y 3AD9C 1IWGA 3Q89A 4RZRA 3RAQA 1JX4A 1K47A 2WBMA 2HNZA 1ZBTA 3M8YA 1JNZB 2K3IA 4C8YA 1RT6A 1WEYA 2AX1A 5E7OB 4TU8A 1EAYC 1TAQA 1T3OA 2VOPA 1S1VB 4Y0FA 3MEEB 4HH1A 1Y00A 2IHR1 1TL3B 4JI5J 4WP8A 3HMJG 5K8OA 3OL8A 2XYHB 3C2PA 2R7XA 5F8IA 3UDLA 4X4SA 2OELA 2W25A 4Y2MA 3CJ0A 2RSQA 2QC3A 5DG7A 2MZJA 3BH6B 3GR0A 4K8RA 1LV5A 1X4CA 2ZOMA 2YTCA 1XMQJ 1FKPB 2B6AB 1H2VZ 1V3ZA 1U1NA 1BWEA 2CQ1A 4Q8FA 1FKOA 4RU2A 4EYIB 4IH6A 2I5JB 2Z57B 3IM8A 5EHHA 5SUHA 2I5JA 2MHNA 4IOCQ 1FA0A 2VH7A 2DYAA 5HQLA 3R5GA 1R8CA 3JTPA 5I42A 1NDLA 3OHAA 1S4FA 1M5HA 4GRSA 4DU7A 5DG8A 5D4NA 4Z37A 3HHEA 2YNHB 4RNOA 2OPRA 1GT8A 1O51A 2YQ3A 3A12A 3HHKA 2C3PA 4KV8B 3GIKA 3B6BA 2UVUA 1FDBA 1N56A 1TZ0A 1SUQB 4I69A 1RWPB 5CYMA 3C6TB 2CG8A 4LFAJ 1NXIA 4CH1A 4NZ0A 1PBUA 3M6UA 2KVIA 2LYVA 2Y8WA 2M8DB 4WE1B 2BQRA 4PUOA 3KXDA 3W61A 4WKRA 3PX0A 3H5XA 3NGUA 1GQEA 3I0SB 4C97A 4TYBA 3LOUA 4ALZA 5AT1B 3TARA 3HVTA 1LNQA 3J81U 1CJUA 4IO1A 2VG6B 8ATCB 4O3OA 2F3JA 1N33F 2LKZA 4ECZA 1KWMA 4ES1A 5L8RC 1HLWA 1MG7A 1QE1A 1WTFA 2RH3A 1EHWA 1HPZB 1SJQA 3OFHA 4GO5X 1T0TV 4MFBB 2N82B 4ECWA 3TR5A 2KM8C 1B7FA 3DLKA 2AKWB 2NZCA 4NA2A 4KC5A 1S79A 2RUSA 2HZCA 2QL7B 3R9LA 1F9FA 2LEPA 2YH0A 4FPIA 5HP1B 3BS9A 3EGNA 5IOLA 4DSIA 3L9ZA 4NLPA 4RNFA 4V19X 5L1KA 2QT7A 3V4MA 1AROP 5B09A 4WZQA 1DLOB 3IRXB 4OZ2A 2GO9A 3WDOA 4ID5A 2B4UA 1X4HA 3U1MA 2CUYA 2BJ3A 3MPYA 2PMWA 3I5CA 4TY9A 1IR0A 3LWLA 1EP4B 1TFWA 2HHUA 2H5IB 3PNIA 3GYGA 1MMDA 1ROFA 2BM0A 3PYDA 1JXLA 1KTQA 1S10A 2AIRB 1FRHA 3R1HA 1NNDA 1PCAA 3TVKA 1HWLA 1S1XA 3L09A 4IFYA 1Y11A 3GFYA 2HEKA 3P96A 1RTHB 4ZVGA 1N5YB 5KFQA 3AQPA 4J37A 5IV3A 3QWPA 2CQGA 1C0TA 4K5RA 4U9RA 1R7IA 3GIJA 3DYAB 3HF5A 4K4VA 4OYXA 1Y5LB 4DV1F 1RA7A 3A1YG 2DR9A 3DLGA 4ED2A 4NXNJ 2R9LA 1HARA 1X60A 2OH2A 4KGMA 1CJVB 2ZWOA 2UUWA 2AJ0A 3EZOA 2EFVA 3KLFB 2UVRA 3CMAS 3CCSS 4USKA 3BSNA 2PD1A 2AEJA 3MPUB 5IT4A 2VPXB 3P5TL 5LSLA 3MEDB 2D7SA 3DOKA 2KYXA 2CWXA 2ZM6J 4DV7F 3OSPA 3NWGA 4DV2J 2P5VA 2VG5B 5KOXA 2QL5B 1WSRA 3F44A 1Q7LB 2IRUA 2JOQA 3BN7A 1U1KA 2Y1RI 2IJFA 1REVB 3UDVA 5HSPA 3D2WA 2FVSA 3N4WA 5J1NA 2G0JA 4Q0BB 4DR6F 3C8YA 1VDHA 3HD1A 3POTA 2ZZMA 4A8MP 1S1UB 3P3DA 3DU6A 5I3UB 4CYUA 2EC0A 3M8PA 3TNVA 2CQ2A 2HIYA 2XI2A 2VD3A 5BJRA 3PIOQ 5HI7A 3VZIA 2JEJA 1H74A 2MKSA 4MK9A 2FLNA 2YKOA 3QLHB 2V68A 3PDNA 1MWYA 3N6LA 2PSZA 3EPIA 2VDHA 4P73A 3EMTA 1L3KA 1TV6B 4LJMA 4OJ1A 4F36A 1BQNB 1RI7A 3M9OB 4F4WA 5J2PA 2IY5B 1BQNA 1HW8A 4KIAA 3ZTPA 4CIOA 5LXYA 1DY3A 2Y0BB 3BB5A 3MHYA 5BYRA 3M32A 3ILIA 3LP0A 4HI2A 4ZJLA 5A0YB 4C6AA 4GC6A 2L41A 2FJXA 1F60B 4UY85 1HBOB 1TMJA 1YZ7A 4AQYF 1ZOTA 2HNDB 2UUAJ 3HKZD 4DPYA 3CTRA 3M6VA 3MM8A 2VOOA 5IM0A 1N34J 3SFUA 1L3UA 4CI0B 2IMWP 1NO8A 2B51A 4CM0A 2W01A 7FD1A 3LALA 4B17A 4ECYA 2JNJA 4WF9Q 2K7JA 1FDNA 3MEEA 1FXLA 3ZZPA 4WK3A 1S12A 4RW4B 3JSBA 2BBEA 1H0HB 1UJ5A 3CJ8A 1X4FA 4ZJOA 3M6WA 3R6GB 3MM7A 2A6OA 4I2PB 4G6VB 1Q81T 3HHNB 4UZBA 2OSQA 3GCXP 2APOA 3H0PA 1EQ0A 1AT1B 2GVZB 1XNQJ 1BWVA 1YJ9S 5HAOA 1NZAA 5K8NA 3S8SA 1UWBA 4LF1A 4OHZA 4U7UD 1HHTP 4GKKF 4MKYA 1LWCB 2LXIA 5L1IA 4C48A 2A10A 2BACA 3A4TA 1S9GB 3CJ5A 1OPIA 3G87A 5HMXA 5MAOA 1X9WA 4BDPA 3W9HA 4DZ6A 2IVMA 2PA3A 1TL5A 1I94F 3C14A 1RT1B 2AZ3A 3SYZA 4DFMA 5KG4A 3PRBA 5I3UA 3TANA 1FJCA 3NCPA 2WB4A 2LCWA 3R5AA 4B9TA 1S6QB 3D6FB 1QUVA 2VQFF 2JLFA 4QZVB 1BHNA 1Y0HA 4OYAA 4MAKA 1WTBA 2UUCJ 1QVFR 1UL3A 2C2KB 3DNCA 5I3PA 3OVAA 5G0RA 3LPYA 1KR4A 2XC9A 2WW4A 4YDXA 2DGOA 4WE1A 4OZ3A 1WDDA 5KFYA 4PWDA 2DISA 4K4UA 2KHCA 3MDFA 5KFLA 3G71S 1Y4ZB 1VQOS 1W7WA 4HEA9 4FBUA 4UTGA 2DXDA 2E7XA 3R7SB 2DNPA 4N7TA 5AE3A 3M4XA 1QE1B 4U8YA 4CZCA 2XLJA 4ECSA 3PKYA 3VAKA 1Q8IA 4YY3F 4CCHA 4LRCA 2ZVIA 3DLKB 2J7KA 3PX4A 2DK2A 1HWJA 2JDJA 2YWKA 1UFLA 4DG1A 1Y10A 3OR2B 4ZLNA 2PIIA 3MOJB 3UWTA 5AE1A 2QA4G 1OYDA 2QYGA 1J5OA 4DR5J 8AT1B 1HQUA 2BE2A 2G0IA 1M90T 3M9NB 3ILLA 1R8PA 2RQ4A 1N36F 1WDTA 1HBNA 1ICEB 2CZVC 4O3PA 1KOOA 1ZM4A 3LP2A 2CNLB 4NMXA 2KXFA 5JMNA 2QFIA 1IVZA 2ZNYA 4D3GA 1LK7A 1MN7A 4OX6A 5JVGQ 2UXBF 4EFAC 5A8WA 5A8KA 3T5HA 4H4MB 3QIPA 4HT5A 2QN6B 1DTTB 3G82A 4DV4J 3W65A 1UW4A 3CCVS 1RT6B 1DTQB 4NCAA 2F9JA 2AGQA 2FGCA 2DNRA 4ZP7A 3GYXB 5KT3A 5CXTA 3W3SA 1SIZA 4ZVHA 1K44A 1X7VA 4JI0F 3DYAA 3SBMA 1HNZF 3H5UA 2FY8A 4DCJB 3DLHA 1NH7A 2N4CA 3BDEA 4N8OA 4N56A 3TQ1A 5HP1A 4XTTA 1K0VA 3PR4A 4M5GA 3VF0B 3AOBA 4JI8J 2LU2A 1SC4B 2PFFB 1S72S 2OKQA 3JQMA 1KN6A 2B6AA 4ZA1A 4NXMF 4FPRA 1NPPA 2PMHA 2DEJA 2GJ2A 1N88A 2QMXA 3DGPB 4M63A 4P9SA 1DBDA 2YNGA 5LM7E 3HT3A 3OL9A 1H2TZ 2D1CA 4WYWA 2HBQB 4FYVB 4DV2F 4AL6A 1CEZA 2A3JA 1BC6A 1S0VA 1HA1A 4Y2KA 1FFWB 4J9OA 2C2NA 4LQ9A 3TYTA 1PYSB 2DHSA 2XLIA 1TTHB 2B0GA 2BM1A 3MURP 2XMJA 3BKTA 2P9EA 4A8OA 3GQCA 4DR3F 3C16B 2UV8A 2BRKA 3OR2A 2OEMA 2LA4A 1VIOA 1NSKL 3QT6A 5D77A 4DSLA 1MU2B 2K3KA 1R31A 2R7OA 1U1RA 2EBGA 1WKKA 2HVIA 3T5LA 4B3RJ 1JLQB 3EJMA 4DSEA 2V0NA 2X1BA 3EXCX 4FYYB 3I0RA 3Q8RB 3A3OB 4PG4A 3W2WB 2MQLA 2BE7D 4OQJA 2OPQB 1GX5A 1JMTA 3C19A 5D15A 1VQSA 1RAJA 2HNYB 4YN3B 3WIUA 4X4UA 4DL5A 1RK8A 2MB0B 1H98A 2VFSA 1V5VA 2AEMA 1IR1A 1E6VA 3OBIA 4P2XA 4DCOB 5IWAJ 2BVZA 3G82B 2VG7A 4WWSA 3AX5A 1HHQA 4WKYA 4EUVA 2ZKUA 2MKJA 4ZJQA 1IBMF 2ZH4A 2GJFA 2MKHA 1SC3B 3JTOA 4NZ7A 2W4DA 5AXLA 4ZCIA 3GLJA 1TAUA 5DLFA 4F26A 2KKHA 4IG0B 4DZDA 4A8QA 1CJTA 3GFXA 3KJVA 2QIFA 2ZH2A 3ET6B 3HLUA 1PC5A 4BS2A 1ELOA 2ZWPA 4P75A 1PJ6A 1SH2A 4UOCA 3SSRA 4N5SA 4J9LA 1WELA 3KK1B 3I5BA 3R5BA 5KFUA 2XNQA 4ILRA 4ZVQB 5THWA 2QSFA 2N7CA 2E7WA 2IDLA 3SFGA 2CJ9A 2DNGA 2VBWA 1LOUA 2J9DA 2KFYA 2IDEA 3CW2C 3OLAA 5BXIA 2W9CA 5D3GA 4U95A 2UV8G 4M94A 2FC8A 1CS4B 2RRBA 4A8KA 3TX0A 2DRBA 1YBAA 2CXEA 4QYRA 1NK8A 2E5LF 3HDSA 1OQ6A 2XMTA 3G8TA 3LGMA 2EBEA 4OJ3A 1OSDA 1PG5B 4NA1A 3VV2B 2NSCA 5HVFA 4ZP8A 1FX4A 3SMZA 2HHSA 2B9EA 1S6QA 4PWUA 1QAXA 1DFDA 3NKYA 3E51A 2AQ4A 3NMAA 3D0IE 3H20A 3PJWA 3CO0P 4QWDA 3UE2A 1RKIA 5M2PA 4QOTA 4F25A 5FLXY 2G0CA 1UFWA 1JQGA 1JJHA 9ATCB 1YTYA 1FEHA 2WVEA 2AD9A 3KDOA 1SC1B 2VG5A 5E3RA 1S1WB 1C0UB 2RVJA 1RWKB 4WFXA 3GV5B 1JK9B 3W2VB 2C22A 2HVZA 3PO5A 2B3TB 2GVZA 2MQMA 4FDFA 5D4PA 1GEHA 2NXJA 4ER8A 4J9NA 3AA8A 1HQEA 1Y9OA 3ADAC 4XIUA 1T9TA 1HQEB 4EZ6A 1LWCA 2VBXA 2F1FA 2FPHX 1ZAVA 3PYGA 1S1UA 5B0CA 2V8GA 4XO0A 1GMUA 3H4DA 4RU9A 5IXUA 1IKYB 2J9DE 3CCQS 3A3PB 2V94A 2UXCF 3QPIA 1WC0A 2VBYA 4OHVA 1HR0J 2XHCA 2J0SD 4A8WA 2WVBA 3WC2A 4X4VA 3GG1A 3DOMB 5CQGA 2Y1IA 2PGCA 4FYDA 5CZXA 3Q8YA 2XYGB 3BO2A 1WHXA 4ZIVA 3DHXA 1Q0NA 2Q6CA 1XNRJ 3FMBA 2I0XA 2KZMA 1IJEB 4KHRA 3N0VA 4AXIA 1TKTB 1EETB 3BPDA 1C1BA 4XPCA 4DBQA 4ID8A 3PEHA 2G2OA 4ZOSA 2CQPA 2R7RA 4DL3A 1NPRA 1IWAA 3EGWB 2CPDA 3N01A 2UZAA 4MIBA 1NSAA 5DG9A 1V3RA 1QJHA 2DO0A 2FTRA 2IPOB 2B7BB 2O1PA 3MPWA 3OD2A 1OY6A 2XULA 4HL9A 4OJHA 3LAKA 5ETPA 1TKZB 1S99A 5B0FA 5J1PA 4HHUA 2FJVA 1U25A 2BW2A 4KH1B 3CCUS 2FHKA 3BKFA 2WZ1A 2XG8A 4LR9A 3Q83A 3BGUA 1RHUB 1E6YB 4A8SA 2HFOA 4Y00A 2SXLA 4M5DA 1UVLA 4F4XA 3TA0A 1WKLA 2GGPA 4I7FA 1ZAXA 1GXUA 4KFBA 4ANDA 1EP4A 2E1AA 4YP3A 4DFKA 1YRXA 4UY8T 2R7UA 4WFAQ 5ETKA 5C24A 3ZZOA 1S1TA 5F8LA 4ZVSB 1LXJA 1NDCA 4OL8A 3RU0A 2M7SA 3FCHA 2J7WA 3TEHB 4TQRA 3QRQA 3TJ8A 4IUFA 2OI2A 4OV1A 3UCUP 1JKHB 1S6UA 5EUHA 4OYOA 3PG9A 4ZVFA 2V4QA 1WF1A 4UQTA 1UWAA 4OYZA 4C3MA 4LF4F 4KJIA 4TLRA 3K5LA 2QA4S 4F4ZA 1VQ7S 1UW9A 3A8IA 3K5OA 3GP9A 1JXVA 4JBCA 4ELVA 1UFKA 2UUTA 3AWRA 2DGXA 3G8QA 3I0RB 4RW6B 1KLMB 1JIHA 3HFVA 1BQMB 3WX8A 5B0BA 2HZAA 4ZPTR 3W60A 2QA2A 3MM6A 4U7CA 1ZM3A 3D66A 3VQTA 4WFBQ 2UVWA 1IM4A 1KP6A 4XDDA 3G6YA 5EWFA 2QTWA 4NLOA 3BGRB 3HM9A 1KFSA 3DRPB 3BGRA 5L1LA 1HNZJ 2HGMA 1CVJA 2GQQA 2NYHA 4DL6A 4EGLA 5J1EB 2IAJA 1YI2S 2C2OB 3HSZA 5H9FK 2MKCA 3OXGA 4A48A 3UN2A 2R8GA 2CZ4A 3R7BB 2XEXA 2ZE2A 2F8MA 2RDIA 2BW7A 3HVWA 3JTNA 4DX6A 4DS5A 2ASJA 4OHWA 2Z8QA 3IRXA 2W8LA 2R7QA 4N8NA 1SH0A 4DN0A 2KZZA 4ECXA 3B82A 2Q6BA 2WVDA 3KJNB 3LUYA 4J91A 1RKJA 4LUBA 3C6UB 1T9UA 5F3ZA 2GCFA 3IBWA 2YKAA 1YBTA 5E2QA 3RG6A 2RDDA 3FBFA 4R0JA 4M5KA 4RW7B 4ZHRB 1I1GA 2FGOA 3IA0A 5A8WB 2V2QA 1SJRA 2DTJA 4H4MA 4ZS6A 4ZVOB 1QSYA 1U26A 2HMIA 3TZXA 2UVVA 4ANEA 4K5SA 3X1LB 1RT4B 1J5EF 1TMMA 2E44A 2V8VA 3A3NB 3NRBA 3PJXA 3KLGB 1KFDA 1X4GA 2YX4A 3AD8C 5LJ3Y 1VQ9S 2NLWA 4L72B 4RUHA 2QA1A 1KTVA 3EXYA 4JOUA 4LRFA 5GMEA 4C98A 1M1KT 5CAAA 2HBRB 4LF6F 1Q95G 3AD7C 1LFPA 1SJFA 1KDNA 3SDEB 2OEKA 3TZZA 5HL7Q 4ED1A 3M7VA 3GFHA 5T7LA 2DHXA 2DNMA 5GAGU 1KSPA 4P52A 1BMQB 4I2PA 1Y5IB 1KS2A 2R2RA 3MM6B 3PTWA 2KRBA 1R43A 1NK0A 3PHEA 1WACA 2XY5A 3W2VA 1EJ7L 1ZPWX 1YJTA 3ZZTA 2ASLA 2AF6A 2E5GA 2N3LA 1IKWB 2NUUG 4CO4A 5KG5A 4X4TA 4DV3J 2YWFA 4J9UE 1A0OB 3AODA 1O6XA 3VWSA 4GKJF 3ZTQA 3MMCB 4RBTA 4DR2F 4GC7A 2DXFA 3U1LA 4P6QA 2VODA 3RZAA 2ZJRQ 1AW0A 5HMZA 1S6PA 1HKAA 3WBZA 2A2DA 1SI9A 1T05A 1U0SA 4QU7A 4FYWB 3UO0A 2YNFB 4N76A 1U02A 2CJXB 3FBCA 3V6JA 3UVJB 2HKEA 4DR4F 3CDEA 5DDPC 1J5EJ 1DRZA 3CCLS 2HHXA 5CHCB 4HVZA 5AE2A 4JI7J 2OPPA 2OPQA 2HVEA 4AQYJ 2C3UA 1RADB 5E0OA 3Q8QB 3MECB 3SSSA 3KMQA 3LP0B 2ZH1A 1HHSA 4CTAB 4Q45A 4FF2A 5CYQA 2NPFA 2F9DA 3QGPA 3OUYA 1FVQA 1LKZA 1YQHA 2ZUAA 2R4FA 2HFVA 3TOQA 1VK3A 3JAMY 1YX2A 5LOQA 2AU0A 2W4PA 4PEOA 2NS1B 2OFHX 4KKOA 1C1CA 2DXEA 2JL9A 2Y3YA 4YFUA 4XAKA 4C3LA 2ZHAA 1TFYA 5FJ4A 5CH7B 4I6AA 4C2MA 2RHQB 5KG1A 3TEGA 2DVIA 2LLZA 1L3SA 1FRKA 2DGVA 1VRUA 1OS5A 3MGJA 3L7PA 5C2CA 2Z56B 2MY7A 2HQCA 2ZOGA 4OJGA 4TNOA 4ZIWA 1S9EA 3KK2A 5F8JA 2ASDA 1XNRF 1VC5A 2ZDOA 2C2DA 4K0KJ 2NQPA 2JHEA 2NXEA 5K14B 1NJYA 3LP2B 3S1TA 4F4YA 2VPYB 3VGTA 1SQGA 4QWCA 1NJWA 1ZH5A 1SXLA 1RAFB 5HROB 4ECRA 1IQTA 2GO8A 4UF4A 4EYHB 1RTJA 4M5HA 4AFFA 1VRQC 2M2BA 2EPIA 3UI3A 4DPXA 2VICA 2V8DA 1P6TA 2QO3A 3CNQP 3CJ3A 3C14B 3ENQA 4RBUA 5EX3A 5D0GA 2MEWA 5B0DA 1YJWS 5ETQA 4CRJA 4CLUA 3QFWA 2DH9A 2CPEA 2OFGX 3KUEA 4L73A 2V6AA 4OFZA 2BRLA 4P10A 3DI6A 5HANA 3G8SA 1PJ5A 4TQSA 3PV8A 4J9VA 1Z1ZA 3DLJA 4IR1A 4DLEA 4ED0A 3KLFA 4DS4A 3RBDA 2HLTA 3H90A 3T19A 3FCVA 4X62F 2XY6A 1P9QC 3D3BJ 3AOAA 2KDOA 4CTAA 5GAHI 1VBKA 1FRJA 2G2ZA 3IBFB 4X84A 5KFRA 3EZ5A 1NJIT 2ROGA 3CDAA 4NE9C 2W8KA 4LBPA 3MD3A 3PFEA 1JB0C 1FX2A 4C8OA 2MQOA 1JLFA 1VMBA 4I4BA 3PHTA 4PG5A 1RWVB 4N77A 4QR0A 4KV8A 1XMQF 2HHWA 2B4OA 1M5VC 2CQIA 1FRXA 2J6TA 3EYZA 3VR1A 5JVHQ 4ELUA 3AY0A 4FXWA 3CDWA 4W98A 2F4VF 1FXDA 4NLVA 1HBUA 3D5MA 4RR5A 2NXNA 3NOCA 5KFXA 5KFMA 3U1NA 2K8GA 2BOAA 2XS7A 4NLGA 2OHDA 4IRCA 5KG0A 2WSFC 2IBOA 1H38A 1D9FA 4WIIA 3W2WA 4ECTA 5HJXA 5IV4A 3MAQA 2VL1A 3GU0A 2DHGA 2AYEA 3E3XA 4R5PA 1XR7A 4C0OC 2H1YA 3PZPA 1W2BR 1NSPA 1S0OA 4B3SF 5J2MB 2A6MA 1VOMA 3W8PA 4LF7J 1DTTA 3LP1B 1YITS 1WORA 3MAHA 4MFBA 3AJ1A 1NCLA 4ZVUB 4B02A 1HNWF 1C0TB 5J1EA 4E98A 2DKOB 2W2PP 2FHMA 4M5IA 2MXYA 1RT3B 2E1CA 2UUAF 4AD6A 1G2EA 3LO3A 4KPYA 5KFTA 1LEOA 2QE5A 3DDKA 3I4HX 2ADCA 3GZ7A 4JI3J 2CPXA 1JLBA 5I3QA 2R2UA 1L5UA 3UR3C 3GIIA 1HR0F 5D8HB 3OL7A 1IBKJ 1Q4RA 2JJ4D 4NCGB 1VQ8S 3PX6A 1SJ1A 2IA6A 1NUEA 2CJAA 2FLPA 3HHLB 5B7WA 2ZOFA 1KHWA 2KRRA 5CZVA 2JC0A 5GAEU 4WU2A 1OY9A 2LQ9A 2C3YA 3A13A 3AAWB 2DBBA 3Q86A 5KAKA 2CVIA 2V5HG 3KNAA 4O3QA 4F2SA 3KLIA 4JI2J 2O01C 4B3MJ 2J8SA 4YS2A 4F67A 3HO1A 3M8PB 4RUAA 2GC8A 3QNWB 1YIJS 3BR8A 2B5JA 4L3NA 5DGBA 1TVRA 2QMUB 2XSJB 5JXSA 1TL1A 1HBUB 2L48A 2CA9A 3THPA 2ROEA 7AT1B 4I6YA 3J81j 2Q43A 3MR2A 1BY9A 4UOFA 2QSWA 3IM9A 2HAIA 4RNNA 2D74B 3ZTRA 4G65A 1RLDA 2LQ8A 4JB8B 1Y3KA 4RW6A 1U6BA 3P49B 4A46A 4IDKB 3BO4A 4ZCKA 3T6BA 1Q16B 3KNGA 1FK9A 1M5KC 3CWJA 1O8BA 3JSMA 3H42A 5GADU 1JNRB 3MAAB 3QT5A 3LP1A 2VG7B 2VA2A 5DQIA 3FCWA 4R25A 1HQ2A 5C7PA 3M9MB 3SV3A 3AFGA 3MUMP 4V1Ak 1KOHA 1LW2A 3L95X 5KT2A 4KKOB 1T02A 3HVRA 4YHHF 1IBKF 3WZ0A 2MZTA 3MCNA 2BQ3A 2D68A 4WFYA 5B0AA 3OXFA 3NNHA 2WONA 4FBTA 1UPPA 2GAHC 2CRLA 5KFOA 4DR7F 1FNOA 1MLAA 1Q8KA 4CP5A 2H48B 3NGDA 1YKWA 4HACA 3V6DB 4DOZA 1RTIB 5HATA 1SKWA 2M8HA 4PUOB 1FE4A 4ES2A 2XS2A 1FWKA 2MY8A 2M88A 3ITHA 1FJGJ 4PZVA 2MLZA 3CC7S 3IAM9 2I38A 3MMAA 4Y2AA 1U4BA 1EKSA 1NHVA 4QIVA 1REGX 3MCOA 1SPBP 3V4IA 4IOAQ 4O23A 1RU2A 1ZA2B 4PABA 2EFOA 1U1LA 2M9KA 4X66F 2XQCA 1U0HB 2R7VA 2BJ7A 4HH0A 1RCOB 1D8ZA 4D3HA 2KXNB 4DR4J 1XJWB 2AT1B 3VALA 3DLGB 4H4KC 3M1VA 5IS2A 1IBLF 2V34A 1SH3A 4DFJA 2KL8A 2W9BA 1O5JA 4ZMMA 1HD1A 4DEZA 2MQQA 2CQ0A 4QCLA 1FT8A 2RJZA 2RF2A 4RWXA 3OVSA 3LWMA 3K8VA 4FVCA 1SBRA 3S6EA 2YX7A 4PG8A 5LJ5Y 4P7VA 4J9QA 1IKVB 1HIYA 2J5AA 1NRKA 2J0QD 1A9NB 4ZVPB 2OMLA 3DRRB 4C0BA 1Q82T 4O44A 2YKNB 3B8HA 5LMNF 1RTJB 3M8SA 4OI2A 3TZWA 3N9UC 3T1YJ 1XIQA 5EDWA 4LSNB 1AA1B 1RTDB 4X65F 4USVA 2EI5A 2HVHA 3DFEA 4JI3F 3CDBA 2V2ZA 4ILLA 1UEVA 2L9WA 1HWKA 2L9DA 2YNFA 3FBBA 2WVCA 2BV3A 2C2MB 1HW9A 4WJBA 3TAQA 2U2FA 3RUBL 5KFEA 3UDEA 2ZBIA 3I6PA 3CCJS 2BABA 3QRRA 3I87A 5KG2A 4P7TA 3CXCR 2BXJA 3ZTOA 4QPXA 1HFEL 1VLOA 2D9PA 2DGQA 2ILZA 2GMLA 2IJRA 2YKPA 1HWIA 1LWFA 4OYPA 1OPZA 1PAUB 4K50A 1XK8A 1XR6A 3I9V9 4RJVA 3PW5A 2DR5A 3EGZA 2W9AA 4K4YA 4ZP6A 1RHKB 2B9WA 3M30A 4WXWA 4DV4F 3R5JB 2Z2YB 4IG3B 1CULA 3AOCA 5SZTA 3T5KA 2HGNA 4C8LA 5E5NA 3IGVA 1F0XA 4PQUA 3QBCA 3FRYA 1WC6A 3GONA 4GVBB 1G3OA 3NCQA 5A6PA 3MR7A 4C8MA 4QU6A 3R6LB 4Y2CA 1RCXB 4WTYA 2XCAA 3H2UB 3TAMB 3D28A 2CPYA 3BGOP 2LU1A 2A2CA 3M2UB 3OXLA 4PYAA 5DO2A 1RAIB 1DLOA 3UNYA 2FJWA 2MSTA 3F0NA 2QLWA 3MPVA 3PW7A 1YZ6A 2POKA 4ZCLA 5KFKA 3A8EA 5DLGA 2WRMA 1O0PA 3KMSA 4UW2A 4LF9F 2KJWA 5HJYA 4WFZA 4OV6A 2D69A 3OR1B 4ZCMA 6FD1A 3GPAA 1WG5A 2HFNA 3BM7A 4HTJA 4IFYB 2W7OA 2CZ9A 3DOLA 1YJVA 4QYZK 1XTZA 4WCEQ 2KTQA 1PBAA 2DIUA 5IC4B 5HQMA 4DV6J 2W24A 3QT8A 1OY8A 2CVEA 3NGKA 3DCAA 3VAGA 5E3CA 4ES3A 2KG0A 1TVRB 2XSJA 2NCKL 3PRVA 1F5AA 2EK1A 2KM8B 4NEYA 1DQ9A 4DV3F 4LF4J 4ZLLA 1UKUA 4IOBA 1F2HA 4KHMA 4YB1P 4F50A 4YR0A 3RYLA 2X1AA 1FI4A 2VQFJ 1CLFA 2FYXA 3CT9A 4F4AA 4ANCA 5F8MA 1G4CA 3NS7B 3ZZRA 2BOPA 5F8HA 4DPUA 4KPCA 3V2UC 4C9DA 2J7UA 4CLYA 5FDLA 2HBYB 3F56A 4LIWA 1RYSA 2QMWA 1D9DA 3DN9A 3J7YU 3RB4A 2V4JB 5H9FJ 4K0KF 5ETVA 2JEGA 1FRLA 1HWUA 1W26A 3DC2A 1S9GA 2CDQA 4DF4A 3TI0A 2J6SA 2Q66A 1D3WA 3EVOA 1MROB 5D4OA 3QGIA 1VCTA 3N5BA 4P2FA 1X9MA 4ZK7M 4QIFA 3CMQA 3BEGB 3PRDA 4PPZA 3TAMA 2BKPA 3M2UA 5F41A 5A8RA 3S7RA 3G96A 3SI8A 1VQ6S 2P9GA 3C15A 3ENAA 2E9ZA 4KSEB 1URNA 1RYRA 1QDUB 3LAMA 1FD8A 3K57A 2IVFB 1F9HA 3ELHA 4I68A 3K59A 1RTIA 3GR1A 1N5TA 2PI4A 3RJMB 2MQPA 1HBNB 3N79A 1NZ8A 2YWHA 2YQ1A 3ISZA 4CLKA 5T41A 5L1JA 1V3SA 3MOZA 1UVNA 3UD3P 1NAQA 5A0YA 3W64A 3VAJA 1E6VB 3QSIA 2DB1A 4J90A 3OR1A 4DPOA 2XTEA 4U7UK 1XQIA 2KH9A 1S77D 2NSBA 2E5HA 4BWJA 1GH8A 2GIFA 4DQRA 5EGYA 1WOPA 2MTLA 4NRUA 4YHHJ 2KVQE 4K4WA 3CJ2A 1PILA 4Z7YA 1W25A 2BJEA 2FZKB 3KJFB 2CNKB 4MKVA 5D4LA 3FKBA 4K4TA 3KWMA 2RU3A 3K89A 2M4MA 2W2QP 2BKNA 2GHVC 3D6HB 2HPUA 3ILJA 5LT5A 4E0DA 3DRXA 4DX8H 3FC9A 5IWAF 2K1RA 2XGPA 3OV7A 3QJPA 2PEHA 2OPSA 2EW9A 5T7LB 4DR3J 1QLNA 3VZHA 3EX7B 3D1QA 2IM0A 1ZYQA 2F4VJ 4DCPB 4LRBA 3W66A 2KN4A 2MLXA 1FNXH 4L3KA 1S9EB 3KK2B 2RS8A 1G1XA 5KTQA 4S0MA 2ZHBA 3J7AN 5F0WA 2FC9A 2VV5A 5KFBA 1NK4A 2CQCA 3QAUA 3W62A 1F1BB 1Y7PA 2U1AA 4KO0A 4Q2MA 4QR2A 3ZZUA 4HHHA 5E41A 4KO0B 3NBPB 5FIIA 2KU7A 1KRPA 2HHHJ 2A0FB 2MMYA 3MI7X 3CCMS 2YNHA 4I64A 1UVMA 1LXNA 3OL6A 3FK4A 4OZLA 4DF8A 2R42A 4DV7J 3FZBA 4NLSA 3KK3B 4EZ9A 1SUQA 1IM6A 2CPJA 3GILA 2BKOA 3OW2R 4G1QB 3T1YF 3HSGA 1IR2A 3BV8A 2Y1LB 3MZIA 4OYWA 4JI5F 3PJ9A 2AHOB 1VBZA 1RTZA 1Y3JA 4B9UA 2JVOA 3R1LA 2XWYA 1VQMS 4X2BA 4QYZJ 2GIQA 1MWQA 3P4UB 4B9LA 2JZ5A 1U1QA 4RNHA 2IYIA 4CO5A 1HBMA 1M5OC 1CJUB 2HFZA 2ZD1B 3ZZYA 3VAIA 4HT7A 1RBLA 1WF2A 2I8EA 4A8XA 3DRRA 4QW8A 3BZQA 4MK8A 4O44B 1D8YA 3SCLE 2HFSA 2XI3A 3GE9A 3SEOA 3K5MA 1YJ7A 3KDNA 1N5SA 4OI1A 4DJBA 1JLFB 3QZ7A 1BGXT 2VA3A 1FVSA 3E8OA 1SJ3P 3IWLA 1AUSL 1FRMA 4QW9A 4R8UA 1SKRA 2XM3A 2XMMA 1XN9A 1OO0B 5ETSA 3TVZA 1R8AA 1B3TA 2FJAB 2E1RA 1IKXA 4BC9A 4BWMA 4C0HA 4FZVA 1TKXB 5GMKa 1F6TA 4K4SA 4Y34A 1FTCA 1NLKL 2PA8D 4LREA 2ZEJA 2CYYA 2YWGA 3BYPA 3RBEA 1YRTA 1NB2A 3NG8A 3O8WA 4ZLPA 1WF0A 2RUGA 2NR0A 2R3VA 1CBKA 2LVWA 2ZBRA 3C46A 1B0TA 1PAEX 4X64F 3Q8VA 1ITPA 5LMUJ 2YPYA 1R0AB 3FBEA 1JLCA 5K8MA 4PAAA 1S1XB 2HRTA 5DM7Q 1H3DA 1N5YA 1OIAA 1U2RA 4PRFA 1APSA 2IFXA 3MM8B 1EX8A 2P8IA 1MW7A 1M5SA 4GVBA 2GIRA 3IS9A 3TUZC 4EBEA 1LWEA 1UP1A 3A8JA 3CDUA 3H2VE 1SL2A 2YH1A 1TR0A 2AX0A 4DQQA 3M1VB 1EB0A 4DV6F 4DQIA 1S7IA 3CIMA 4LIRA 5HBMA 3K7RA 2FQQB 5A2QY 1MN9A 3MTJA 1FE0A 1PJ7A 1S5ZA 1C0UA 2DH8A 1X4EA 4TLQA 3KHHA 4NLWA 1VI7A 1GMVA 2R8KA 4C8KA 2RNEA 3NEKA 3O3LA 2UUCF 5DJBA 1YK9A 2KFZA 3T41A 1XBWA 2QFJA 2PFDA 4NASA 1GNKA 3NGTA 2J76E 2IAJB 2HRUA 1DHMA 1RWNB 1SQFA 2KYZA 2DGTA 1TU0B 1HMVA 1QUPA 1G6BA 2VPZB 3W8GA 4X4OA 1UCNA 2VBZA 2JLGA 4AL5A 1RT7B 3LA0A 2KT5A 1HYSA 2H65B 1KBRA 4O4GA 3M05A 1R27B 3Q2TC 3WIVA 5C25A 2VJUA 4FXDA 4J9MA 1TKXA 2Y1JA 1GFWB 3MD1A 1FTRA 4TY8B 1FWPA 2I2YA 1IJFB 1I5OB 3DOMA 1MSWD 4KT0C 2DT9A 2O67A 2GZOA 4DPTA 3ICLA 2HG4A 2CADA 4CO0A 2L9NA 1D0EA 1H73A 2HNYA 2CJQA 2OLWA 2CNNB 2YWWA 3SSQA 3OTCA 1RT2B 1UETA 1TP7A 3FQKA 3MF5A 4U67Q 4TU9A 2V9KA 2M3DA 5J2MA 3TVYA 3BN4A 1ZTTA 1KEKA 3IMQJ 3V5RA 1NHUA 1N32J 3HK2A 2YKMB 4LBIA 2Y8YA 5F0UA 2V4JA 1WC4A 1S0NA 3GG0A 2G1HA 5KFSA 1HNVA 2ZC3A 2NREA 4JI6J 1NDPA 4M5LA 4USHA 1NBEB 3MCMA 5J2QA 4USIA 2CQBA 3DM2B 1IXKA 2CJYB 4I56A 3MMBA 1VK8A 4CO2A 1IKYA 4F0KA 2YQ0A 3H98A 4FF3A 2FLLA 2G4BA 4WBFA 2BANA 1HI0P 2WSCC 3J80Y 4YR2A 2HBZB 3KOAA 1DJ0A 5BYSA 3NY0A 1YLXA 2HLUA 2ZUGA 4EMDA 5ADZA 5HBMB 3TJ9A 2RQCA 3MM7B 1GXTA 3MEGA 3JYTB 1ACMB 3B4MA 3CD6S 4NCGA 2F8HA 2AGPA 1TKDA 1JLGB 4NLYA 1B70B 1X5OA 1ZPVA 2A18A 2UU9J 4LSLB 2ZITA 4CM2A 2BYCA 4KFBB 3NS6A 3HFKA 3R2CJ 1JLEA 2CJKA 5D78A 4N47A 1VYAA 4KB7A 1WI6A 4X4RA 4B3TJ 2HNZB 4UUXA 4B3MF 3VVUA 3D3CJ 1ZM2A 4DV0J 3HHLD 1HMVB 2CAJA 1R8HA 1RAEB 3OFFA 4B3TF 4L6V3 1UVKA 3Q23A 1RT1A 1Z4UA 3ETOA 3RB0A 3C66A 4M8LA 4RLEA 3Q24A 3DLEA 2ATLA 1PGZA 4X4PA 4O4GB 1K0TA 3WHIA 1NJZA 2PE8A 1U24A 3IGNA 1AZSA 4DX7A 4M5NA 2OPSB 4OZ5A 3MEKA 2Z4PA 2QEXS 1UAWA 3RR7A 3TP2A 4TYAA 3I55S 5KFZA 2EKNA 3QGHA 4BC7A 4JI1F 4RUBA 1FK9B 2VIHA 1CC7A 5C5JA 4RW9B 4JI8F 1OYEA 1RXOB 2MZQA 3MCSA 1FJGF 1OSCA 3FSYA 4HI1A 2KJVA 1FEEA 1WNEA 4DN9A 4OZJA 3G6ES 2WB1D 1NK9A 2R8HA 3KHLA 3HHDA 3MMBB 2MZ1A 3B78A 4ATNA 1VRTB 3LPEA 3SCKE 1C2PA 4Q2LA 3UW1A 1XMBA 3NS5A 5CYMB 4DG1B 4DMZA 3TUPA 1KONA 2MKIA 3T1AA 2GFFA 2BE2B 2HK2A 2JWNA 3W5XA 1J5OB 5IT0A 2IYGA 3GIMA 5KFGA 1IBMJ 5HN0A 3SZ2A 2AZ1A 1RT5A 2BE9B 1R0BG 2DGWA 2OPPB 4ICLB 3UCGA 2W2NP 1PC4A 1WEZA 2P2CB 3W7BA 1EETA 3FZ2A 3QWUA 4L74A 5CYQB 5KFJA 3OUYB 2WTFA 1T7PA 1ULRA 5C42B 3FQLA 3H7HB 2F4FA 3V81B 3CIZA 2DY9A 2QRRA 4OIXA 3QIPB 3A8KA 5EWEA 3H5YA 5KFVA 3H40A 3PW2A 3RR8A 3CB4A 3D6TB 1OWXA 1H7WA 1RLCL 1DARA 1SKUB 1URRA 1WJ9A 2VF3A 3FDSA 4DUTA 4CDIA 6AT1B 1N8RT 4ITSA 3DLBA 4JV2A 2QLBB 4KGXB 2ZZTA 4URQU 4I67A 4DV5J 5DDRC 1VQ5S 3SIPB 3U02A 4JYAF 2BJDA 3GV8B 2RILA 1VRUB 3NXZA 3TX8A 1X31C 2LMIA 2LA6A 4MKAA 4Y3CA 1BQXA 2XZWA 3GYNA 4LF5J 4FYXB 1E6YA 4ID5B 1I94J 5EWGA 3M8QB 4AXJA 4GO7X 4J7CA 2HQGA 2HS3A 2MZSA 3ZC4A 3IWNC 4PG7A 2XTCA 3M2RA 2ZH6A 1U2FA 2D3O1 3RAMA 3CJQA 4RUCA 2P9CA 3VHQA 3UN3A 1U1OA 4DUZJ 3QAEA 4PKDB 4LSNA 1ZS6A 5CD4A 2XMKA 1WHVA 4MJKA 2HWTA 1RA6A 2BX6A 3CJSA 3KLGA 2VU5A 1EKRA 2JVRA 4KYZA 3US5A 4BCAA 1H7XA 1CJKA 4CNZA 1FERA 1GMWD 4UUWA 5U47A 4WP9A 3MUTP 5GMDA 3JS9A 3R5DA 2C2ZB 2D41A 4NWBA 3FEZA 2V1TA 2HSEB 3Q8PB 2C3OA 3RBXA 3TA1A 4CH7A 3KHRA 4Q8EA 1RWXB 1EZZB 1XERA 2DH7A 2DNOA 4XK8C 4ECVA 1KLMA 2HRYA 4NLUA 1DURA 2GQCA 5KFIA 3DOKB 3PW4A 2VPWB 2PI5A 2HS4A 4X64J 3N6NA 1WD6A 3CJKA 2DPIA 1KQFB 1HNIA 1D09B 3ENWA 3AJDA 3NWRA 2RQKA 1IKWA 2ACMA 3MM5A 1WHWA 3BQ2A 2C3MA 3IP0A 2YKMA 3TRGA 1UVIA 3JQJA 1NH8A 2FHJD 2W7PA 3FFIB 1U49A 2XY7A 2VKZG 2ROPA 2UU9F 1S48A 3D6MB 4NLQA 1R8BA 3DDNA 4F04B 4H4OB 4USUA 4U8VA 2FUG9 3JAMU 4H4OA 4DI6A 4F3MA 2GV1A 4DXLA 1IKXB 1BLUA 2AJ1A 3OQ2A 3TO8A 5KFPA 4B08A 4YB5A 2HQFA 1HD0A 5DQGA 5IT9U 3JSYA 3BJYA 2CJBA 2DHAA 3PYFA 1RBOB 2JC1A 1S59A 2OEJA 4ZPVR 1VHFA 1X8DA 3DGVA 3AQOA 2FD2A 1JLGA 2QX0A 5FLXU 4ZKAA 2BDPA 4P72A 2CWKA 3N6MA 1X5TA 2BZ2A 1K9MT 4WP3A 2J9CA 2VUGA 5EN1A 1U8WA 2RKIA 4QBUA 2J0WA 3RTVA 2AGOA 1TK8A 2DITA 2HNDA 1QSLA 1PKUA 1HBOA 3UD4P 1QAIA 3EPGA 3DKDA 2PDAA 4PG6A 3Q8UA 1SQEA 1ZETA 4NLDA 1C1CB 4Z2XA 4NEZA 3K58A 4ECQA 3BH7B 3NNCA 1U0HA 3RW7A 2IIHA 4HYKA 1NB7A 3M2VA 2BJ1A 3SDEA 3UNGC 3PIPQ 1HNXJ 5DM6Q 2CQHA 2F63A 2VHGA 1S7HA 3JSRA 1J2VA 1NK6A 2XHWA 2V2KA 2XZDB 3FEYB 1S57A 3EM1A 3M6XA 3H4BA 5H9EK 2WSEC 2M70A 3CJRA 4NPOA 5FDLB 4USMA 4DR6J 3HVAA 1Y5NB 3J7A1 2Z0GA 1IKVA 2IM2A 2XMUA 1B7YB 2H3EB 4IR9A 4JP8A 4DV1J 1VLYA 3BYRA 4YB7A 3PY8A 1S1TB 1FJ7A 1MROA 3JQKA 2XLKA 4EK2A 2HQ3A 2IMOA 3GV7B 4Z7CA 2ZM6F 1S6PB 5LMUF 1WG4A 2OPRB 1NKBA 2GHPA 4EBCA 3HZGA 3CO9A 4B3SJ 2HGLA 4AE5A 3R3TA 5KG7A 2FLOA 5KFFA 3OTOF 2H5JB 3IG1B 1IBCB 3C6TA 2ZBQA 3TUIC 1RJJA 2BMBA 4ZITA 1VIXA 1JJCB 1VJWA 2G9OA 4OX9F 1AZSB 1LWXA 1AUDA 4B3OB 2VFVA 2FY1A 4IFVA 3EVWA 4M1KA 3HP6A 2LDYA 2V1SA 2NUHA 3FJ2A 4IFVB 4KGZB 4KE5A 4JI6F 1M5PC 4DSKA 2PMZD 4M95A 4O0NA 3K5NA 1T9XA 1NEEA 3JSMB 4NX9A 2RKIB 2OTLS 1GK8A 1MMLA 5KT4A 4Q5VA 4FXVA 4KGVB 2PT0A 2XMAA 2FZGB 3FMWA 1DZ5A 1B4SA 4FKXA 3C3LA 2V63A 3P8BB 2W4CA 2CPFA 5A6WA 1XC9A 1WG1A 3ULHA 1QAYA 5KT7A 1RAGB 1RWOB 4PQAA 5G4DA 4JV5J 2FZCB 2HW3A 2JRSA 4FNHA 1X9SA 1FO1A 4H4KA 4JI4J 4I2QA 4RWWA 4PQUB 3D67A 2OUGA 4OX9J 2DNKA 3J80U 4DL4A 1VQYA 5B0GA 4OYIA 2ILYA 2HAFA 1F5BA 3E01B 4KAIA 1D1UA 1KHVA 1AB8A 3D9BA 3OT9A 1HQUB 3B4DA 2EC2A 3AXKA 4WYLA 5HLFB 3ZO7A 4C8ZA 4NLTA 3MFIA 2MHEA 2HHQA 1FKOB 3DXSX 3GTYX 1Z2ZA 3HHLA 4JV5F 2DCUB 3V6KA 1OJ4A 2M0GB 1KVKA 4YOEA 5J2NA 2KXHA 2N7YA 2COLA 2HVDA 3BO3A 4MKBA 4RBVA 2WAQD 3UDCA 1DTQA 4K4XA 1RHRB 2Q79A 2ZKTA 1RTDA 1VQLS 3H8YA 5AXNA 3W9JA 1BXNA 1EQMA 2ZH9A 4JV1A 4F7VA 3DLEB 2EEYA 1N54B 2CG4A 1VQ4S 1OM2A 2XNRA 1SIWB 3IS9B 5DS7A 1CJKB 2E9TA 2GMHA 3KLHB 1TL1B 1GXLA 1OMSA 3MTKA 3SQOP 1VC0A 1NKCA 2MQ8A 1Q7YT 3OSNA 2ZDPA 1VQPS 3L3CA 1NU4A 1CJVA 3O6QA 1T94A 2XZTB 4ZN1A 2Q3PA 3LH2S 5KFWA 4MTPA 5IZHA 2C28A 2QLFB 4RW9A 2L3MA 2RT3A 2HQIA 3R97A 1RAAB 2YNGB 3THTA 1FRIA 2B7CB 2DEIA 1YHQS 3NNAA 2KFNA 5F8NA 3FSIA 2EFNA 1NM2A 3ZNJ1 1W2IA 3BR9A 3AX2A 3FGVA 2C1EB 5I42B 4IRDA 4OZ0A 3NAHA 4FS2A 4ED6A 1AFIA 1TK5A 2KHDA 2MGZA 2WVFA 1RACB 2OSRA 2MKYA 3POTB 3ENVA 4I2QB 2C2RA 2UXDJ 4DR5F 5A2QU 3VTIA 1SB6A 2GMJA 1GMWA 1JJ4A 4LFBJ 2PEBA 1MU2A 1JWWA 2G1DA 1V6HA 2RE1A 2EXUA 1C4AA 1GTHA 1S49A 2QJ3A 1HI8A 3D68A 3PR5B 1SL0A 4B3RF 3UVJA 3BBBA 4TY8A 4YY3J 1JLAA 1RABB 2OMOA 4CWBA 3VAFA 3MMJA 1U47A 4ZHRA 1T03A 2GVDB 1F3FA 2F8EX 4IKAA 1YWXA 3D0GE 4H54A 2VC0A 4UOHA 5E3PA 1CULB 3CGIA 4WK1A 2MQNA 2VASA 1R0AA 1JLCB 4HDHA 5T14A 2XGQA 1U6FA 4UQGA 4FP9A 1UEKA 1FWLA 4P74A 3EDQB 4B9NA 4QWBA 4KQZA 2HS0A 1LW2B 3T9ZA 1UA0A 2V69A 2PO4A 4B9VA 3P5BP 3IXQA 4QIEA 3QFHA 3ET6A 3SV4A 1JXEA 5F8GA 1CJTB 2EK6A 3KJVB 1JLBB 3LW5C 4LRDA 2Y9HA 1R6VA 1T05B 2WK4A 2NYIA 4DUZF 5GAGI 3IN5A 5CD4H 3KK1A 1ZZNA 2DHHA 2RF2B 2Z30B 4ZP9A 5IC6B 4YDDB 1KQGB 5KT6A 4J9SA 3VGUA 2ZBPA 1T9YA 4G1IA 5D3GB 2EG2A 2E1MC 3NBPA 3W5YA 1Q5YA 2OJ3A 3KTQA 3DDIA 3VAMA 3CJTA 3BDPA 1XWLA 3PO4A 5H1SV 5DZ6A 4A8FA 4IYQA 2FJDB 5D0EA 4JUZA 2XCPA 2R7WA 3K5PA 3Q0AA 3CCTA 3Q2SC 2GHWA 1CSJA 3KG1A 4OYMA 2DNHA 2M52A 2G2YA 4PXBA 4ZVTB 4ETZA 1RWWB 1P27B 2XYPB 5ITHA 3KK3A 2GAGC 2NXCA 3I32A 3QLHA 2ZZNA 3H59A 3HI9A 4K2JA 1NJXA 1R89A 3CEDA 2XMWA 1K1SA 4PPDA 5M2UA 5L38A 4IDKA 5DGAA 2JH3A 4ETXA 4LVNP 4EEYA 2Q1LA 1FHTA 4CT9A 4P2SA 3BF4A 1SVDA 4WZMA 1FKPA 2V8PA 1RHMB 1S1WA 1ZA1B 4LF5F 1M1GA 1I6JA 1U8SA 1NK5A 1X5PA 2JFDA 1HNIB 3HVTB 4G1PA 3I5AA 1REVA 4OYBA 4URGA 2IA0A 3ZNUA 2CIMA 2N3OA 4DLGA 3AH6A 2IBKA 3HKWA 4A8YA 4CLTA 1BUXA 1R0CB 4WFNQ 3D0HE 2ZVSA 4O3RA 1B99A 4EO6A 1AXQA 1N48A 2WW8A 3NGRA 4ECUA 4EO8A 2EG1A 2I6WA 4J9KA 2OAUA 2IVYA 3BSAA 1UPMB 2VFTA 2B4PA 1PYOB 3IAS9 5HVGA 4UT4A 1TV6A 4W92B 2X1FA 2Z58B 1T9WA 2DRDA 3WX4A 1CC8A 2LQJA 3H5SA 2D3OR 3UPFA 3LQVA 2AJQA 2YNIA 1TKTA 3D54A 4ZN3A 3LANA 1K1QA 2ZFHA 4L76A 4BHQA 4R5PB 5DQHA 4WIQA 2FIUA 3T9NA 4CLZA 4LRAA 4DUYJ 1N33J 2B43A 1R6YA 1BE4A 5I4MA 3G6XA 3V4IB 2J0XA 2DR6A 1RTHA 4ED7A 2LQBA 4NOHA 4P71A 1RDRA 2CNOB 4C11A 2FB0A 1N0VC 1TL7A 2W1BA 3CJ4A 1TL3A 3EUNA 3GMGA 1TL7B 1RQ0A 4OLOA 1LWEB 2O3DA 2WCXA 5HMYA 6FDRA 1U48A 3QRPA 3LF0A 1UZHA 3KLHA 3DI6B 2DRAA 2LQ5A 1C4CA 4NYZA 1RSCA 4OZNA 4F3QA 5DDOC 2E5LJ 2JEFA 2O66A 4JI2F 2XMVA 3M8QA 1HBMB 2UUBF 4M5DB 5F9NA 4GKKJ 1F9EB 4DR2J 1ZM9A 5ETTA 5KFAA 4UOGA 4YMEA 3R2DJ 2H5EA 1UWBB 4LF6J 4I1TA 1U09A 3M2RB 4HR2A 4C8NA 1N6QA 4PXCA 2ZC4A 1IQZA 4OI0A 3X3UA 4BBYA 1FF2A 3CD0A 2B4VA 2FJBB 2MJUA 3BREA 2IM1A 4CLWA 4F8RA 4GMKA 5JJBA 3P6YC 2V67A 4OX8A 4LF8J 1VQNS 1RGVA 2MPUA 4LMZA 5KG6A 4FN5A 3KLVA 4X4QA 3GFZA 3I4PA 1F3VA 3BSOA 1WEXA 1Q8LA 2W7AA 2V9WA
chains in the Genus database with same CATH topology
2UP1A 4PR6A 3HX9A 1R3NA 3I9ZA 1ZTWA 4NXNF 7FDRA 1XEZA 4YQWA 1SV5A 5IT9Y 1DQAA 2KO1A 4ICLA 2JLEA 3MEDA 2MZRA 1KLNA 1BQMA 5B0EA 1KQSR 5C42A 3GSDA 4DQPA 3V81A 3OJSA 2HHVA 3TW0A 2VC1A 3M32B 2CKWA 3OFEA 4O0IA 1FXRA 5LL6d 2FVRA 4JI7F 2RS2A 4DSJA 1HNVB 3FFIA 2HHTA 4CQ1A 3PEJA 1L3VA 2ZH3A 3J7YI 2AJFE 5B08A 2DIVA 2ZE2B 4ZVEA 2V4RA 3AB4B 4OMFG 3V6HA 3FNNA 4RW4A 1HL6A 5IFMA 2DPJA 1N4LA 2IC3B 3J7ZT 2AWZA 3TA2A 3IC1A 3DGPA 1B64A 1FESA 2DJWA 2GGPB 4I7FB 2ZH7A 4QQBA 4DL2A 3DRSB 4RW7A 4Q7AA 3DRSA 4IQXA 3LGNA 2DGUA 2WHOA 4FF4A 2IRYA 4DWIA 3IRWP 4K59A 4LFBF 5F9LA 3I82A 3Q22A 4FVMA 4JV0A 2YVSA 1SL1A 1LW0B 2DO4A 3T1HF 1H6KX 4J9RA 2EFGA 4Y65A 3UCZP 2F7VA 5H9EJ 3QO9A 1JLQA 2AYMA 2E5JA 2HWHA 3DMJB 2GQ2A 1YSJA 5G0RB 2RIJA 1FJEB 1TQLA 3K2YA 4B9MA 3OPKA 3CPWR 2DNZA 4FNIA 3O44A 4Y2IA 5K5MA 3NLCA 4G3IA 5KFCA 3G86A 1B0VA 2JEIA 5HMWA 3U27A 4KBIA 3HZEA 1YG0A 2KG1A 2GW8A 2R7WA 2YKNA 1FJCA 3OFGA 2HIQA 2WOMA 4KTQA 3CCES 1LFWA 1T3NA 3DM2A 3IR7B 5MLCV 4A47A 1DAXA 1IUJA 3KG0A 4MYUA 2BANB 1MWZA 5KFNA 5F3TA 2QLXA 1YGYA 5BYQA 1T95A 3MUVP 2FDNA 3EZUA 2RMLA 4JI4F 2R8IA 2F40A 2PN6A 1QVGR 5J2PB 3C6UA 4QWAA 3PACA 1QY7A 3OJUA 4ZDNA 2KT3A 1U45A 4O3SA 4X4NA 3FVYA 3RB6A 5GVQA 2C42A 3QYYA 4OX7A 4LQ3A 4QPTA 2BR0A 2VG6A 3CVKA 3MMAB 2CQ4A 5DRKA 1KVIA 1X4DA 2YY3A 5A8KB 4HLBA 2QV6A 1HPZA 1S9FA 2H9ZA 4DL0C 3BQ1A 2KT2A 2ACYA 3AHPA 2G13A 3O1LA 4R8UB 1UJ6A 1SJ4P 3BGFA 1TKZA 2LEAA 3ZZZA 1KD1T 4MIWA 4JYAF 2CPHA 2E5IA 4U6PA 1RP5A 4OI3A 2AW0A 1TL4A 4Y6IA 2IM3A 3OTBA 3RB3A 5CA5A 3R27A 1S0MA 4TN2A 4LT6A 4O4RA 1Q1KA 1TUVA 2E29A 2Y0SD 4DSFA 3THVA 4B9SA 3UFCX 2JX2A 4ZPCA 2HHPA 2DNQA 1JJ2R 1Z2LA 2R8JA 3QGGA 1Q8BA 4DDFA 2K2PA 1LQ9A 4F4KA 4ILMA 1FCAA 4HHJA 3KLEB 4USJC 3RW6A 1Q53A 4YEAA 3ZZ0A 3T6JA 4C11B 5AXMA 4G1QA 4K4ZA 3K8WA 1GTEA 4KR0B 1JKHA 4RKUC 1A7GE 2DNNA 3CSKA 5C25B 2B56A 1KQKA 2R7SA 3PM9A 1D9AA