3OL8A

Poliovirus polymerase elongation complex with ctp-mn
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymerase
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
total genus 140
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3ol8A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ol8A02
5I3UB 3BGRA 2VG5B 1LW0B 1C1CB 4ECVA 4I2PA 3CJ3A 5KFHA 5KFLA 1TKXB 2E9TA 2XI3A 3I5CA 4ZPAA 5HLFB 3C6TA 4R8UA 3DMJB 5CYQB 4JUZA 2W7OA 1C0UA 1JLFA 1S1WA 2O5DA 4K4WA 1KHWA 4LSLA 5K14B 4YQWA 3CIZA 3DOKB 4Y2AA 3QZ7A 4TYBA 4ECSA 1RYSA 4ID5B 4ICLB 3KLIB 4KV8A 5J2NA 3SFGA 4R5PA 1RT1A 3LAMA 4XO0A 3GIJA 2HNDA 2AGOA 3GIMA 4PWDB 3LP2A 3QGIA 5KFKA 5KFCA 2IA6A 3ITHB 5HP1A 3FFIB 2OPPA 1TKZB 4DL5A 2BR0A 5C25A 4LSNB 2W9CB 4IH6A 1SUQB 1MMLA 1JLGB 3MEDA 5KFZA 2VG6B 3QLHB 4IRCA 2R8IA 4WE1B 1HYSB 3DOLB 1TVRA 1VRTA 5J2QB 4RW4B 2AU0A 2ALZA 3CO9A 5KT7A 3RB0A 1HARA 4WYLA 1S9GB 2FLPA 3E51A 2E9ZA 3V4IA 4IQXA 3DI6A 1S1UA 4IH7A 1TL1B 2R8GA 3OLBA 3KJVB 4FBUA 5JXSA 4DG1B 2FJVA 4XPEA 4TLRA 2WOMB 3I0SB 4NCGA 2C2RA 3H5YA 3KNAA 3G86A 4Q8EA 3KK1B 4HYKA 3GILA 3SFUA 4RNHA 4GC7A 4ED0A 4ZPCA 4G1QB 4ECRA 1ZTWA 3H59A 3RAQA 1T03B 1S1VB 4PUOA 4Q0BA 2AWZA 1S1TA 5I42A 5F8IA 3OL6A 1S0OA 2IAJA 4OL8A 2UVWA 5KG6A 1RTHB 4K4TA 2YKNB 3OL7A 1DTTA 3IGVA 3KLHA 3PJWA 4O3QA 2D3ZA 3LP0A 1MU2A 1TKTA 4KFBA 1JKHB 1GX5A 3OHBA 1GX6A 5KFUA 3KLFA 4F4YA 1FKOA 2R8KA 4IG0B 3MFHA 2JEJA 2QV6A 5C24B 1HPZA 2B5JB 1LWEA 3DRRB 4YR2A 4IDKB 4Y3CA 4QWDA 1KLMA 4QPXA 4FS1A 2AGPA 2OPRA 2D41A 3QO9B 4G3IA 3PW7A 4MK7A 1JXLA 3H5XA 4WZQA 3OLAA 3KMSA 3OSNA 1RT6B 1JLEA 4KO0B 4IFYA 3M8PB 3KHRA 2OPQA 4KKOB 1R0AB 3KK3B 3NAIA 3M8QA 4NLUA 4KHRA 2JEGA 3EZUA 4DL4A 2YNIA 3KLGA 1XR6A 4RW7B 2AQ4A 4Y34A 3M9OB 3TVKA 2QE5A 4O4GA 3RBEA 1S6QB 1S1XB 4EBDA 1IKYB 3HVTA 1RT4B 1IKWA 3PW2A 3ISNC 1C1BA 4RNNA 3I0RA 4J9RA 2OPSA 4RW9A 4O44A 4IR9A 3V6JA 2DPIA 4EYHB 1RTIA 3H98A 1EETB 5JUMA 5J1EB 5FDLA 4B3OA 1SV5A 1SH0A 3DLKA 3MEEA 3LP1B 4ED7A 2WB4A 2CJQA 4ECWA 3G6VA 2E9RX 5KFDA 4EO8A 3CJ2A 4Q44A 4R0EA 2GC8A 5KG2A 4IH5A 4RUAA 2J6UA 2D3UA 3DDKA 5KT4A 4K4SA 3KHHA 1HQEB 2VG7A 4MIAA 2IM2A 3OHAA 2IM3A 3H40A 2R8HA 4MFBB 4TY8B 4F4XA 1N48A 1RDRA 1RTJB 1JLBB 3CJ4A 3NBPA 3CJ5A 5HBMB 5J2MA 2YNGB 1HNIA 2UVVA 4RU9A 3M9NB 1LWFB 2R2SA 3BQ2A 3GIKA 3Q8SB 3NKYA 3PR5B 4O3RA 3N6MA 4ED1A 2YNHA 1FK9B 1RT2A 2IC3B 4MH8A 4F4ZA 1C0TA 4KB7A 4ED6A 4JV2A 3RAXA 4K4XA 1RA6A 5F9LA 3Q8RB 3BREA 3TQ1A 4ZVGA 1RTDB 2VA3A 5CYMB 2WRMA 1LW0A 3IG1B 1C1CA 1TP7A 5DQGA 1LW2A 2W7PA 4NLVA 3BSNA 4EO6A 2I5JB 3OL8A 5F8JA 1RT5A 1HMVB 3E01A 4NLDA 5CYQA 5KFEA 1EP4B 5K14A 3KLEA 4JV1A 3OL9A 5J2PA 3DRPB 3JYTB 3MFIA 4PQUB 4IG3B 2AX0A 3BSAA 2HNZB 2FVQA 3FRZA 3PJXA 3KLIA 3N6LA 4TYAA 1FKPB 1HNVB 4WFXA 2V4RA 4ZPDA 3DLGA 2HWIA 4PWDA 3RB6A 1BQNA 5KT6A 3CVKA 4FBTA 5DGAA 4WZMA 2V0NA 3T5JA 2HMIA 1REVA 3FFIA 2AGQA 1J5OB 3V81B 1TKZA 3V6HA 3MEGA 2W9CA 4NLQA 2RKIB 2YKMB 5KFWA 5KFJA 1JLGA 3G6YA 4KHMA 4MIBA 3BSCA 4WE1A 1DLOA 3BGRB 4QWCA 4RW4A 2WK4A 2JC0A 2WONA 2FVCA 2EC0A 3FDSA 3BQ1A 5KFBA 4ECQA 3D28A 3IN5A 3DM2B 2RF2A 4DL6A 3PW0A 3LANA 1S0MA 2FLLA 1RA7A 1C0UB 1JLFB 1S1WB 1TL1A 4LSLB 1WNEA 1RT7B 4DEZA 5KT5A 1JX4A 1LWCA 5F9NA 1S9EB 1VRUB 3I0SA 3C6UA 2IM0A 4DL7A 5F8GA 1DTQB 5J2NB 1QAJA 1T05A 4QWAA 4TY9A 4WYWA 3T19A 3LP2B 2ZD1B 5L1KA 1T03A 3H4DA 2ZKUA 4TQSA 4ZP7A 1TL3B 3V6DB 4NLPA 3BJYA 2XGQA 2OPPB 2V9WA 1S0NA 4YMEA 3MEDB 4NRUA 3BSOA 3QIPA 2BE2A 2JC1A 4MKAA 3MECB 3QZ8A 1TVRB 1VRTB 3IS9A 4H4OA 1W25A 4X2BA 3GV7B 4NRTA 2JEFA 3I5BA 1JKHA 3H4BA 3DYAB 2HNYA 4IRKA 5KFYA 3QIDA 1RT3A 2ZE2A 3LAKA 3DLEA 2BANA 5C24A 5EWFA 3KK2A 3DRRA 2R2RA 4NLGA 4J9OA 5KG3A 1N5YA 2AX1A 4M94A 1HQUA 2GIRA 1IM4A 4IFVB 4KAIA 4H4MA 4K4ZA 5DG8A 3MR2A 4ZVHA 1RAJA 5KG0A 5KFIA 4KO0A 3GV5B 3M8PA 2FVPA 3PW5A 2BQUA 2FVSA 4MK9A 1QUVA 1JLAB 5KFMA 4RW7A 4TQRA 3KOAA 4Q0BB 4MKBA 3IRXB 4URQU 3FSIA 1N6QA 4WFYA 3SI8A 2FVRA 3H5UA 3UR0A 4Y2CA 3MR3A 3GIIA 1S9FA 1JLQA 4ZHRB 3KLHB 3MR5A 1YVFA 1MU2B 1TKTB 4KFBB 4HKQA 4K4VA 1EETA 5C42A 3KLFB 1QE1A 1BQMB 5KFPA 4O4RA 1IKXA 2HWHA 1HPZB 1LWEB 3JSMA 4ZVFA 1KLMB 5F8LA 2OPRB 2YNFB 4I7FA 2CKWA 1IKVA 4KBIA 4J9NA 1JIHA 1D1UA 5DQHA 5D3GA 3KHGA 3RBDA 5L1LA 3EPGA 1JLEB 3Q8QB 3QGGA 4IFYB 5L1IA 2OPQB 1XR7A 4O3PA 3M8QB 3EPIA 1JLCA 4F4WA 2YNIB 4LQ9A 3KLGB 2BRLA 4ECZA 3VQSA 5KFNA 4J9KA 2VA2A 5KFXA 3ISND 1HQEA 4O4GB 3HHKA 4TY8A 1RTJA 3PVXA 5KG4A 1JLBA 2UVUA 3QGHA 1IKWB 1C1BB 1CSJA 4FS2A 2OPSB 4RW9B 2W9BB 1S4FA 3BQ0A 1TV6A 5KFFA 2IC3A 4RW8A 2OH2A 3HVAA 5FDLB 4I2QA 3TAMA 4J9PA 1RTDA 5KG1A 4B3OB 3T1AA 5CYMA 2B6AA 2ILZA 4ED8A 2D7SA 2B43A 5I3UA 2C28A 2WCXA 1S6PB 1C2PA 2VG5A 3G6XA 1HMVA 1TKXA 4YR0A 1EP4A 5KFVA 2IMWP 3DRPA 3JYTA 5HLFA 3DMJA 4WXOA 2XC9A 1SH3A 2ASLA 2J6TA 2JEIA 5F8HA 1QAIA 2I1RA 3ICLA 3DOKA 1ZTTA 2WTFA 3N6NA 3DRSB 4ID5A 4ZVEA 4QW9A 2VG7B 4J9SA 4M95A 1NNDA 4ICLA 4RW6B 5KFOA 4ECUA 1D0EA 1SH2A 3MF5A 3RB3A 1HNIB 5KFTA 5HROB 5EWEA 5L9XA 3V81A 4ZP8A 5DG7A 3HKWA 3ITHA 1RT2B 4DL2A 1UWBB 2YKMA 4IKAA 5DQIA 4YP3A 4K4UA 4NLYA 4LSNA 5DG9A 4ECTA 1SUQA 2RDJA 3KMQA 2VG6A 3QLHA 4ECXA 1HYSA 4NLWA 1LW2B 3DOLA 5KT2A 5J2QA 2BQRA 3DM2A 3T5KA 4NLTA 4I2PB 1RT5B 3E01B 3KHLA 1S9GA 1KHVA 4IOBA 3KLEB 3FQKA 2FJXA 1RT7A 3Q8PB 2W9AA 5J2PB 3C6TB 3H2LA 4R8UB 4MK8A 2ATLA 1S9EA 1VRUA 1ZETA 4RNFA 1S49A 3KJVA 1DTQA 4DG1A 4QWBA 3GYNA 3RB4A 4K4YA 3M9MB 3DLGB 2WOMA 4K50A 2V4QA 2UUTA 2ZD1A 4KV8B 1N56A 3I5AA 1BQNB 1RT1B 4R5PB 3KK1A 3T5LA 2HNDB 2FLNA 2HMIB 1TL3A 4G1QA 3V6DA 1REVB 3MR6A 4O3OA 1S1VA 3KLVA 3MEGB 3UPFA 1K1QA 1XR5A 5KG5A 5HP1B 4O3NA 2WHOA 1NHVA 5C25B 2UUWA 1DLOB 3MECA 3V6KA 1RTHA 4J9MA 2YKNA 2WONB 3DYAA 5KFAA 4URGA 4J9QA 4Q8FA 2XGPA 3UQSA 2RF2B 1S97A 4RUCA 2R8JA 4IG0A 2RDIA 2ASJA 3V4IB 4IFVA 4EEYA 3DI6B 2B5JA 1LWCB 4YR3A 2ASDA 3PHEA 4IDKA 4RNOA 1S1UB 4TXSA 4ZPBA 3QYYA 3C6UB 3QO9A 1T05B 3D5MA 4WXWA 2R2TA 4IRDA 4NCGB 1T94A 2W8KA 1S10A 2JLEA 1JLAA 1RT6A 4ZP9A 2IJFA 5T14A 3UDLA 5C5JA 3IRXA 4KKOA 3KK3A 1S48A 3GQCA 1R0AA 4PUOB 4TN2A 3FQLA 3CDUA 4ECYA 1S1TB 5KG7A 1T3NA 5I42B 2IAJB 3BR9A 4H54A 4RNMA 4F50A 3QIPB 2BE2B 1S6QA 4ZP6A 1S1XA 4KSEB 4NLXA 3IS9B 5F8NA 1IKYA 4H4OB 4ZHRA 4Q45A 1RT4A 4Q43A 2J6SA 1DTTB 2HNYB 1K1SA 1BQMA 3LP0B 5EUHA 1RT3B 2ZE2B 2R2UA 3DLEB 2BANB 3KK2B 1N5YB 1FKOB 5J1EA 1HQUB 2YNFA 4NLSA 2C22A 3LALA 4ZMMA 4NYZA 4H4MB 2XCAA 2IBKA 4EBEA 3IGNA 5DLGA 3PZPA 3CDWA 2C2DA 2BQ3A 3LP1A 2XI2A 2BRKA 3PR4A 2IM1A 1OS5A 4KE5A 4URSA 5KFGA 2HAIA 4WFZA 2W8LA 4EBCA 4NZ0A 1N6QB 2F8EX 1N4LA 1I6JA 4QWEA 3NGDA 3T5HA 5L1JA 3H5SA 4MFBA 5EDWA 1JLQB 5KT3A 3HVTB 5HBMA 3NAHA 3NMAA 2W9BA 4J9LA 2YNGA 3CJ0A 5KFSA 4ED2A 2DPJA 1LWFA 3I0RB 5C42B 1QE1B 4O44B 5KFQA 2XCPA 1Z4UA 1IKXB 1FK9A 1RTIB 3HVWA 3JSMB 2FJWA 4O3SA 4RZRA 5EWGA 4DL3A 4I7FB 1IKVB 1SV5B 1S6PA 3DLKB 3IG1A 3MEEB 2UVRA 1TQLA 4U7CA 5D3GB 3CWJA 4NLOA 2ILYA 5F8MA 4EYIB 4GC6A 3PW4A 2I5JA 1U09A 4NLRA 1JLCB 2IJNA 4QW8A 4PQUA 3NL0A 2C2EA 4IG3A 5DGBA 3DRSA 3CDEA 2GIQA 2HNZA 4RW6A 4IR1A 1FKPA 1HNVA 4U6PA 5DLFA 3OSPA 5HROA 3GV8B 3MTKA 3NBPB 5KFRA 1TV6B 5J2MB 2XWYA 4XPCA 1UWBA 4JV0A 1J5OA 4RW8B 4ED3A 4I2QB 4LQ3A 2YNHB 3TAMB 2RKIA 1RYRA 1C0TB 2B6AB 1NHUA
chains in the Genus database with same CATH superfamily
4DFJA 2QRRA 2FGCA 4CH7A 5ETQA 1OSCA 2QT7A 3CDAA 3BGLA 3IM8A 3RW6A 2G13A 4XO0A 2CYYA 2FZGB 5IS2A 5KFKA 1NDKA 1XN9A 1JLGB 3QLHB 4IRCA 3GG0A 5D6GA 1I94J 4ZOSA 2HFOA 2CQHA 2HHSA 3D7SB 2HURA 2WOMB 1WC6A 3VR1A 4GO7X 2NR0A 3W60A 1XQIA 2HG4A 3OT9A 2IAJA 1FHTA 3CCZA 3KG1A 2NCKL 2V1TA 1NBEB 2LXFA 4YR2A 4DDFA 4G3IA 2KRRA 4QIFA 4KO0B 3KUHA 4RW7B 1YLXA 1RUSA 3CW2C 4HI2A 1RHJB 5LL6d 3FJ2A 3I0RA 3OXLA 4USKA 4EYHB 2E1AA 2HVEA 1IBCB 4WWSA 1Y9OA 3QPIA 1D8ZA 2AJ4A 1M5OC 2C2NA 2QIFA 5AE2A 2DGQA 2N7CA 1Y10A 2R7OA 4DR2F 1CBKA 2X1GA 4MFBB 3GE9A 4OMFG 2WVBA 3M9NB 4JB8B 1FK9B 2F65A 2IC3B 4JV2A 3MMJA 3TZYA 1NK8A 1HLWA 5BYQA 1WSVA 4BDPA 1YQHA 1MN7A 2MYFA 1F3FA 1VIXA 1WUUA 2MQMA 4PWDA 2RVJA 2JOQA 3CVKA 5DGAA 1WJ9A 2E1RA 3SZ2A 2W2OP 3Q89A 5D0HA 5FD1A 1B70B 4P52A 2FVCA 3FDSA 1YBUA 3G4SS 1F5BA 2VV5A 1UETA 1LQ9A 1T05A 1OY6A 3LF0A 2HW3A 3BB5A 4HACB 3BJYA 5LXYA 2JC1A 2KXFA 3UCZP 1ZAWA 2BANA 5EWFA 2VB6A 2E1CA 3NOGA 4L73A 1B3TA 3DHWC 3M8PA 1YIJS 1QUVA 4C8MA 2OLWA 4M1KA 1N33J 3U1NA 3J7Z5 2Y1LB 2ZJQQ 3CF5Q 5E5NA 2G0CA 1BQMB 2ZBQA 4LMZA 3HT0A 2DIVA 3DLBA 4I7FA 1IKVA 1NPPA 3R6LB 2VPYB 1VIOA 3M8QB 2BRLA 2VA2A 2RDDA 1YWXA 4N41A 2BUNA 5K5MA 4ZLLA 4GKKJ 2HAFA 4U96A 4ED8A 1FDBA 4IOAQ 1U1PA 4YR0A 4DV5J 3G8TA 3UDEA 5A8WA 1RAFB 4ED5A 2V63A 2DNGA 4ECUA 1KVJA 4TU8A 2VD3A 4K5SA 2HZAA 4J9UE 3L7OA 1RU2A 3DU6A 3F44A 2BABA 1X4HA 3QLHA 4PWWA 2KI2A 4Q5VA 4PXBA 2MQNA 2G0JA 3J81j 4PEOA 4K4YA 2WOMA 4OJ3A 1IQZA 4GVBB 1U45A 4NMXA 2QZ8A 2DY1A 2PEHA 1HD1A 2K3IA 2RF2B 3EX7B 1Y3KA 1NZ8A 5HJXA 1WG1A 1S1UB 2HHHJ 4ZP9A 2KZMA 4HI1A 4TN2A 2NSBA 3IWNC 4QIGA 2CJKA 4Q43A 4EFAC 2R2UA 3UI3A 3LALA 4B08A 2IBKA 5DLGA 1QJHA 2NS1B 1U25A 2BRKA 4KE5A 4URSA 3D1HA 5I3PA 2H4YB 1N6QB 2F8EX 3SCKE 1TZ0A 3T5HA 2C3PA 4LF1A 4MFBA 3NAHA 1SKRA 1SIWB 5ETKA 4K0KF 2LU2A 1SJ3P 1FK9A 2QL7B 1RWVB 3HVWA 2V4JB 1S77D 3ZTQA 5ETRA 2E44A 5H9EJ 2KT5A 3KDOA 4RW6A 4IR1A 4USMA 4QPTA 4UOFA 1L3SA 1N52B 2Y9HA 4Q7AA 1XNQF 2BZ2A 2LQ8A 2H48B 1ZM2A 3CJ3A 5E3RA 4A8XA 4LSZB 1VQLS 4OI6A 1N36J 4HACA 4J5OA 3UNYA 2XSJA 2NREA 1MMLA 4PWUA 4AL5A 3DOLB 3P4UB 5KT7A 4K5RA 5HVFA 3Q0AA 4YY3F 2EW9A 4ECRA 3H59A 2OKQA 2AWZA 3D6FB 1TTHB 2G2YA 5E3AA 3PX6A 4ERDA 4A46A 3IR7B 3M8YA 1FJ7A 2MY8A 4QIEA 2FZKB 2EBGA 4MK7A 3H5XA 1FWLA 3RRHA 2GV1A 3M8QA 2NYHA 4LF8F 4C8ZA 2MJUA 3TUJC 3RBEA 2H54B 1VMBA 4UF4A 2FHKA 4KQZA 3W2WA 1DY3A 2WB4A 2V2ZA 5KFDA 2HQDA 1X9WA 4A8OA 1RDRA 2XWXA 2FUG9 4F4ZA 1C0TA 1DBDA 1LW0A 5DQGA 4OYXA 1S12A 2PN6A 4LREA 1U0HB 1EP4B 4ANEA 2CZ4A 1L3KA 3BSAA 3P3DA 4PABA 1LNQA 1HQ2A 1TKZA 3I96A 1B0TA 4GVBA 3QATA 4WP8A 2RF2A 1S5ZA 1M1HA 2K3KA 2ZEJA 2FB0A 1MWQA 4DPUA 4YHHF 5AXKA 3ILLA 3FCVA 3H42A 2XGQA 2OPPB 3PG9A 2B4UA 2FHJD 1NO8A 3QZ8A 1R8BA 3GV7B 4OYWA 2VQEF 3D1QA 1RAJA 2YX1A 3CC2S 1N6QA 4R25A 3VAFA 4LRAA 1J2VA 4DCOB 3GJTB 3A8IA 2IYGA 4ZHRB 4LUBA 4FDFA 1X4GA 4X4TA 2V4JA 2OTLS 1MWZA 2DEJA 4J90A 1CG2A 2YY3A 1VHFA 2IDEA 2LKZA 3HHKA 2WSEC 1RTJA 3PVXA 3GJSB 3RYLA 1KOHA 4B9UA 2M8DB 4V19J 1XWLA 5LMNF 4I64A 4WTOB 3HHLD 3I9V9 3VQTA 5B0GA 1HMVA 2CNLB 2DHXA 1ROFA 2A6OA 3R5AA 3UW1A 1SH3A 1MW7A 2I6WA 3GR1A 2VG7B 2DNNA 3MD3A 4KGXB 5EWEA 1VQYA 3NGSA 3G8SA 1KONA 2LA6A 3HDSA 2EG1A 3DOLA 3DM2A 4WFNQ 1SJ4P 3R5JB 4L6V3 1KHVA 1T95A 3B8HA 1HNXF 1T7PA 4LT6A 1S49A 2QJ3A 1J27A 1RT1B 2LU1A 1RWMB 2KM8C 2A6MA 1FNXH 3TWZA 4F0MA 1HR0F 1S79A 3UQSA 4DPOA 2VQFF 3G96A 3DC2A 3CCMS 1IBKJ 3PHTA 2ASDA 4RNOA 2RU9A 3MTJA 5G4DA 4DUZJ 1Q1KA 3CDUA 3QJPA 1IBMJ 2AF6A 5AT1B 3JSBA 1SQEA 1KTVA 2JJ4D 2IVYA 1F9HA 1LFWA 4FBTA 4JI6J 3CDWA 3H2VE 9ATCB 2IM1A 2NYIA 2CWKA 1VI7A 1U49A 1UFLA 2W1BA 1HWIA 1RCOB 4HVZA 3ISZA 4USUA 2FJWA 3R5GA 3DLKB 1HW8A 3MEEB 2HFSA 2MQQA 5MAOA 1CQNA 3TOQA 1U0HA 2XYGB 4DUYF 5DGBA 4DN9A 2C3UA 3BGOP 2QLFB 2ZUAA 5DLFA 4MMOA 3ZTSA 1YBTA 5IQQA 4LQ3A 4DLGA 2ACYA 1HBMB 3GONA 1KD1T 3JQJA 3QWUA 4FF4A 2BX6A 1FNOA 4R5PA 1U47A 2PFFB 4M63A 3FCHA 4YS2A 2I8EA 3IWLA 2OPPA 1FX2A 3J7YI 2LP4A 2Y0BB 1RAIB 2R8IA 1IBLF 4KC5A 1SQGA 5J2QB 3L7UA 1MLAA 1S9GB 2HRUA 5E41A 4DR6F 2GIFA 1W2IA 3HJVA 3FEZA 4ED0A 1TAQA 4DV1F 4FYXB 1S1TA 1S0OA 1P8GA 2A10A 4L3KA 4CM0A 4FYWB 3CMES 3IGVA 2HQ3A 5KFUA 5B0AA 2EPIA 2ZHAA 4X65F 1RHMB 2Y8YA 3ZNUA 3UE2A 2R7VA 2MZQA 1KVKA 2CVIA 2OEMA 1H7WA 2UU9F 4V19X 2DH8A 4OZ2A 1XMQJ 3BGUA 1S1XB 4EBDA 1NH8A 3PW2A 1RWKB 2DR9A 3VGUA 4JV5F 2CJQA 2RQMA 4H4KA 3P5BP 3KG4A 1NJWA 3U1MA 4CO2A 2VG7A 3OHAA 1FDAA 2CJYB 3MGJA 4RX6A 2R2SA 3VALA 3BQ2A 2JVOA 3BDPA 5F9LA 1RTDB 2XY7A 2YKPA 4FVMA 1S99A 2B51A 2I5JB 2PC6A 1VQSA 4ZPDA 4LVOP 1H72C 2CPXA 4JI4J 1H3DA 2GHWA 4DHVA 3V6HA 2BM0A 3VZIA 3M8RA 4QWCA 2VZ9A 4O0IA 5A6PA 4IUFA 3LANA 1JX4A 3AT1B 4Y00A 1RHUB 2UXBJ 2CNOB 1OPZA 4C11B 3A3PB 4N47A 3HFZB 1TL3B 2EFNA 3HFKA 4BCAA 4YMEA 3KKFA 5G0RB 1NB2A 5L38A 2F7VA 3QIDA 1SC3B 4YUDA 4P2SA 2J9CA 4ZVHA 2GMHA 4P73A 2FVPA 4MK9A 4JYAJ 2D9PA 4TQRA 5DZ7A 2LDYA 1A6LA 1HKAA 4WJBA 2DGTA 3GIIA 4NWBA 2FLOA 2F4VF 4N77A 3U27A 2OUGA 2ALYB 3G82B 1EQMA 4YB6A 2QC3A 5IXUA 2V2VA 3RU0A 3TR5A 4ELUA 1X0PA 3BQ0A 3QJLA 3P49B 3AX2A 1JNRB 3CO0P 1X7VA 5HQMA 2IVMA 2BW7A 4DF8A 2GS8A 2VICA 5F8HA 1K8AT 2MKYA 4ZA1A 2WTFA 5CZVA 1YTYA 2MKIA 2ZITA 4ZCLA 3PX0A 2VPWB 3QWPA 3NWRA 3HXMA 3CSKA 1WEYA 3GPAA 2QLBB 5HMZA 3T1YJ 5J2QA 4OQJA 1S9GA 3AY0A 3M30B 2GCFA 2MZTA 4QWBA 3M9MB 3DLGB 3O5TB 3QT5A 2L41A 4NCAA 1G2EA 1XR5A 2QX0A 2LVWA 4LFAF 3JSRA 2R3VA 4DXLA 1IN0A 2C2ZB 1IM6A 1R31A 1ZPVA 3MR7A 4B3SJ 3L7PA 3K17A 1LKZA 5GMEA 3GQCA 4JI1F 3S7RA 2ZM6F 2WBMA 2RUSA 2OELA 4QU6A 5KG7A 1ZM4A 3PIOQ 4C0BA 2BE2B 1S1XA 4KSEB 2Z2ZA 1FT8A 1K1SA 1QVGR 5DDPC 3E3XA 2GJ2A 3POTB 4MKVA 1BLUA 2XYHB 1N4LA 2RMLA 1RISA 3FC9A 4PKDB 1TR0A 3PY8A 3OFGA 1Z4UA 5ETOA 1PYSB 1YBAA 1RAHB 5D3GB 2I5JA 3C3LA 1RWWB 5CXTA 5RUBA 4C4WA 1DHMA 1BQXA 2UP1A 4OFZA 4XPCA 5DM7Q 7AT1B 3KXDA 1RYRA 4AQYJ 2ACMA 2CPEA 2E29A 3BH7B 2QEXS 5CYQB 1FRXA 5HO4A 4C11A 4OZJA 1TMMA 1VLOA 3OR1B 5HL7Q 2MKCA 5G0RA 4ZVPB 3HD2A 3PXGa 3W64A 3PV8A 2R8GA 5CD4H 1FCAA 3G86A 4LFCF 2NZCA 1X5OA 4RNHA 1CEZA 2R42A 4YY3J 1N5QA 5F8IA 2UVWA 2ZNYA 1ZPWX 5CCLA 3MFHA 4DUTA 1T8EA 3KMSA 1YKWA 3M32A 1NPKA 3K7RA 1M5HA 3NAIA 4KHRA 3G82A 4KHPF 4N56A 4J9RA 4DSKA 4ITSA 1IR2A 2DHHA 1SH0A 2YWEA 3SBMA 5K8NA 4CO5A 4R0EA 3LPEA 2GC8A 3H40A 2BM1A 2IM3A 4DSJA 1N48A 1WG5A 3CJ8A 2BYCA 2CZVC 1NAQA 2OI2A 2M88A 2XZDB 4K4XA 2DGUA 3W9JA 1C1CA 5HVHA 2NPIA 3GB0A 5KFEA 1FVQA 3M30A 4B9TA 2J7UA 2VH7A 4TYAA 3DLGA 3IWXA 2GO9A 1IWAA 2V0NA 3DRXA 5IM0B 1AZSB 2OIHA 4A8WA 4WE1A 1F5CA 3ILJA 2VDHA 3D28A 4ELTA 3AA8A 1RE1B 3S6EA 2C1EB 3NS6A 1C0UB 4KGMA 5EN1A 2DH9A 4QWAA 3AA9A 2ZD1B 3TARA 5L1KA 1XTZA 2V2QA 1ZAVA 2ZH8A 5LSRA 2BE2A 1VQMS 5IZHA 4CIOA 2DK2A 3FMWA 3UO0A 1K73T 1WF0A 4J9OA 3K8WA 2FJAB 4IFVB 2VQEJ 3POTA 4GKJF 2LEPA 3PW5A 3K2YA 3NGTA 5LSOA 4DCPB 4PXEA 2HHTA 3H5UA 1OY9A 2Z58B 4QR1A 1G1XA 3NNCA 1UUJA 2Q66A 1HPZB 2DR8A 1X4CA 5D3GA 1MROB 1NH7A 4DR5J 3DNCA 1HQEA 3VAJA 5KOXA 1IKWB 3VGTA 2OPSB 4NPOA 2H65B 1Q8KA 1WKKA 1L3VA 1D9DA 1YZ6A 3JTNA 1YITS 1S6PB 4JI0F 1MMDA 2KHDA 2C3YA 2WB1D 4FYYB 3SCJE 1KKHA 4ZPTR 5KFOA 5HI7A 1D0EA 2J7WA 2RHSB 2VASA 3N4WA 2YWFA 3OR1A 2KVIA 1KP6A 1SL0A 4CO3A 2G1HA 2XMMA 2JLGA 3E01B 2FJXA 3R7BB 2OEKA 2B7CB 2E7WA 2E5LJ 2MGZB 2AD9A 4URGA 2R8JA 4KPCA 3DRYA 3V4IB 1KNZA 2BVZA 1VOMA 2MLZA 3EGZA 4DPYA 2FQQB 2G9OA 1JLAA 3QGPA 2B4PA 1H2VZ 2J6SA 4QU7A 3K5PA 3KK2B 1UEUA 3A8JA 3CC4S 4ZMMA 2HIYA 3LGMA 2HAIA 5GAHU 3PO4A 4P71A 1R0CB 2U1AA 2XS5A 2HHUA 2IYIA 3HSGA 3K5MA 4OLPA 3CWJA 4GC6A 4NLRA 2V94A 2PGCA 4C2MA 1HWKA 2MDAA 2GIQA 4U6PA 4DUYJ 3OSPA 1VK8A 4B3TJ 2RD5C 2KXHA 2D74B 3NBPB 5J2MB 4JV0A 3M6XA 4USTA 5IM0A 1AZSA 3PYFA 3EVWA 3K5OA 2AT1B 2RT3A 4HT7A 1C0UA 2YBVA 3HCXA 3A1YG 4CLYA 1Q8IA 3PDNA 3D0HE 1WEZA 2BR0A 3QRRA 4JI5J 3H25A 4HR2A 3P8BB 1IBLJ 3KJVB 5JXSA 3QAUA 5D78A 3KK1B 2L9WA 2PEBA 5DJBA 4ZPCA 3BKUA 3PIPQ 4CLPA 4FVCA 2D3ZA 1Z1ZA 2R8KA 4KGKA 2QV6A 1HPZA 2AGPA 4FPIA 4NZ6A 1S59A 1VYAA 2DGVA 3W7BA 2DY9A 5SZTA 3CCVS 4KKOB 5HVGA 1Y5LB 4CT8A 2Q43A 3IR5B 1IKWA 4RR5A 2BJ3A 4RNNA 4RU2A 2OPSA 2UU9J 1FFWB 3H8YA 4DV6J 4LF5J 4LF7F 4DV7F 4RWXA 5AE3A 2OGUA 2D3UA 3P6YC 5C7PA 4OX9J 4OLOA 2J9DE 2HBYB 4WKYA 1MWYA 4DCJB 5HQ8A 2YXLA 4EO6A 3JB9k 3E01A 5D0EA 1VQ4S 1GXTA 5IT9U 2K7KA 2QYCA 5GAGI 3RAMA 3HZEA 2W4DA 2UZAA 2HVHA 1NM2A 4UOHA 1R8CA 2OAUA 1BMQB 2UUBF 4Y65A 4WU2A 3JAMY 3M2VB 2DNRA 1CJKB 1S0MA 2IRXA 4DZDA 2IM0A 4Z2XA 1QAJA 3AQOA 1CVJA 3R1LA 3T1HF 2DEIA 3CB4A 1BUXA 3IAS9 2KO1A 3BDEA 4X4NA 2E1PA 1TVRB 1W25A 2JFKA 3H4BA 2DR5A 4FYVB 3TA0A 3KK2A 2R2RA 3SDEB 2BDPA 2I0XA 3M6WA 1HIYA 1BD6A 3MPVA 4CH0S 2BQUA 2CQIA 1UWAA 1YGYA 4EZ9A 5CABA 4WFYA 3BV8A 3L09A 2BMBA 4CCHA 1TKTB 4EWTA 4ZJQA 5HN0A 3DXSX 1SVDA 2OFGX 2HS3A 2JFDA 3ZZTA 3H20A 5F8LA 5E33A 1Q86T 1JJ2R 4BBYA 2IIHA 4AT1B 3ZO7A 5J1NA 3BO3A 2O3DA 2OPQB 3EGVA 5BXIA 3D1OA 4ELVA 3QGHA 3MM6B 1OQ6A 1SKUB 2OH2A 2H4WB 4F4AA 3IFEA 4CO1A 1BHNA 2JEIA 2PMZD 3MUMP 4ZVEA 3PACA 2POKA 1HNIB 3LGHA 5KFTA 5GADU 2YKMA 2AJFE 3AB2B 3R97A 5LT5A 1W2BR 5AXNA 2BQRA 4ED4A 4BWJA 1BE4A 1VK3A 2CQDA 3KJVA 1S0VA 1SJRA 4V1Ak 3KK1A 1WC3A 1RJJA 3V6DA 3TUIC 3MEGB 1WC0A 1FRHA 3MECA 3O6QA 4ES3A 1XBWA 3Q8VA 2OSQA 4J9QA 1BWEA 2K06A 2BOAA 4KKOA 1YG0A 5HANA 3TZWA 1NK9A 5DDRC 1UMJA 2WBRA 3EE3A 4NXMJ 4DSLA 4CLSA 4WIIA 3Q2TC 1FKOB 1HQUB 1U2CA 4C9DA 3UD4P 2XI2A 5E3QA 2K2PA 2ATCB 4EBCA 5H9FK 3IXQA 3AFGA 3LWMA 1ZBTA 3W62A 4P2XA 4F36A 2HGNA 3SSRA 3JSMB 4OX7A 4O3SA 2VUGA 2K1RB 1R8AA 4C3MA 4HTIA 5F8MA 1U09A 1EX8A 4LRFA 2C2EA 4DQPA 3NY0A 1BGXT 1KBRA 1JJCB 1AUDA 3CJKB 3T9NA 3MTKA 1S7HA 3HFVA 2YVSA 1EZZB 3TAMB 5E3PA 3CJQA 4BC9A 3M2VA 1CJKA 4R8UA 5IT4A 2UXCJ 3UN5A 1T11A 4TYBA 3THTA 5IOLA 2FY1A 2RH3A 3LAMA 5C2GA 1NK5A 1Q8LA 1FVSA 2NXJA 3C2PA 2COLA 1TVRA 1EAYC 3V4MA 3E51A 4IQXA 3NNHA 3SDEA 3PTWA 2HVIA 5D4LA 4ATNA 1T03B 1FWPA 3R1HA 2DT9A 3CD6S 3K5LA 2ZH9A 1T9WA 2XTDA 1TUWA 5D0RA 1LXNA 1TKTA 1MN9A 2LQJA 4IDKB 1RT6B 5BYRA 2OPQA 2CDQA 3CJSA 4F04B 2VKZG 5T41A 3EWGA 3QSIA 5IC4B 2DGOA 3ISNC 3MM6A 4IR9A 4KHPJ 3W5ZA 1FE4A 2IHR1 4NEZA 2CRLA 3DLJA 4WK3A 5DS7A 1PKUA 2HKEA 1PO6A 2ZFHA 2QFIA 4EO8A 3GLJA 5B0BA 4Q44A 1A9NB 4RUAA 2NXNA 4K4SA 2HQFA 2R8HA 1N32F 4F4XA 1JLBB 3UD5A 1HNIA 1X9MA 3PR5B 3W66A 4OZ5A 1ZM3A 1CULA 4FKYA 1X4BA 2DVIA 1PJ5A 2RS2A 1F1BB 2LXUA 4U7UK 2HHVA 3Q83A 3PJ9A 2PO4A 5K14A 2V50A 2AX0A 3MOJB 1V3RA 2KB2A 4BLGA 4DPTA 1TL5A 5AE1A 1FKAF 1HI8A 4U67Q 1J5OB 3FFIA 2BJEA 3MEGA 2W9CA 2CQBA 3G6YA 5KFJA 2DRBA 5LJ5Y 1NDPA 2XG8A 4RW4A 2FIUA 3TYTA 1XMBA 3D4JA 1RT7B 4LIWA 2VDIA 2GFFA 4B3MF 3VVTA 2CQPA 3MM7B 5BR8J 2RIJA 2CJXB 1V9OA 2QFJA 5L39A 1UTAA 2YPZA 4IRKA 5GMDA 1F9EB 4NLGA 1UZDA 1HQUA 2YH0A 3GV5B 1BXNA 4URQU 1TKDA 4GKJJ 2LECA 1N34F 2Y3YA 3IC1A 1UPMB 3B4DA 1CJUB 1UVLA 4QBUA 3JSMA 1UEKA 3ULHA 4WCEQ 2K1RA 4ETXA 4KBIA 1Q81T 5L1IA 4CDIA 4DR1J 3VAGA 3OW2R 1CSJA 3CJKA 3B4MA 1XEZA 3AD7C 4NL5A 3UWTA 1W7WA 3MM9B 3TAMA 4PG7A 4X62F 2ZOMA 1UAWA 5CYMA 2EKYA 2P9CA 2B43A 2C28A 5KFVA 3ETMA 1U1RA 1YRTA 1ZTTA 2WVEA 3N01A 3T3FA 2P5VA 1U1LA 3RB3A 1WC5A 1ZZNA 4K4UA 4A8YA 1Q78A 3KMQA 2QMUB 3MURP 1Q82T 3AJ1A 4X4SA 3Q8PB 1X5TA 3MM5A 3DDNA 2MHNA 3WC2A 1N54B 5LSLA 1BQNB 4ZPVR 3KLVA 3UPFA 1AT1B 4MT1A 5A8RB 4QYRA 2V8GA 2YKQA 4RUCA 2B9EA 1GMUA 4IDKA 2F3JA 2MJNA 2XTJP 4DV4J 2JLEA 1RT6A 1FTRA 3UDLA 3R2CJ 4PUOB 4G1IA 4DX7A 4H54A 4NXNF 2PIIA 5F8NA 1YJVA 3LP0B 2W2PP 1UEVA 1VQ8S 4NYZA 1OS5A 1RADB 2DKOB 1QVFR 4DR7J 4CLFA 1PILA 3NGDA 5EDWA 2ZVSA 2R7WA 3SSQA 3NMAA 4GVLA 2F8MA 5C42B 5KFQA 2XCPA 4DV0J 1TQLA 4B9NA 1NKBA 3PW4A 2RJZA 2XY5A 4QW8A 2E5IA 4UOCA 3IM9A 3CD0A 4DQIA 3W8PA 1HBNB 3GV8B 1J5OA 1SJ1A 2P8IA 2MZ1A 3CCRS 2UUCF 2JL9A 4LF6F 4IYQA 2ZH3A 3TVZA 4JI7J 3C6TA 1UJ4A 1HW9A 3I56S 5KFCA 2QO3A 2IA0A 3MM7A 1M90T 1RHQB 2RRNA 2ALZA 4FKXA 2F4FA 1U48A 3GYXB 1TL1B 2FJVA 4FXWA 2H9ZA 3I0SB 2GHPA 4HYKA 4GC7A 3FGVA 2HEKA 3QFWA 3LQVA 5KG6A 3SCIE 3OL7A 3OVBA 3OFHA 1YJTA 2RHQB 4O3QA 1F9FA 3QNWB 4HHHA 1CJUA 2BKPA 1MNEA 4Y3CA 1GEHA 4C97A 4X4VA 2CXEA 1URNA 4NYPA 2HBZB 3BGFA 3D0IE 2NUHA 1SC6A 1XMOF 3BR8A 2ZDOA 5GAHI 3HVTA 3MZIA 1LFPA 4HTJA 4O44A 3PEJA 2XHWA 3MM9A 1JQGA 2BE9B 3LP1B 5CAAA 1WHWA 3EDQB 2X3DA 4LF9J 2Y1RI 5KG2A 2VPZB 1F2GA 4OYPA 4MIAA 4TY8B 2A18A 4O0NA 4DR4F 3CD7A 3Q8SB 3O2IA 5E2QA 3BREA 2Q6CA 1YHQS 3HHLB 3GMGA 3DRPB 3MFIA 1G3OA 4USVA 1TK8A 2ABYA 1BQNA 4XIUA 3V81B 2YQ0A 2D3O1 5HJYA 2E5JA 5KFWA 4KGZB 5K8OA 4L76A 3VZHA 1WHVA 2JC0A 1XJWB 4CRJA 1S1WB 5A8KA 1FA0A 4RJVA 3GJQB 5SUHA 2V8DA 1X4FA 1JXEA 2AJQA 3ZC4A 5JMNA 2C2MB 3T1HJ 3BSOA 3MD1A 4MKAA 3BKTA 4X2BA 1OPIA 4J7CA 3J7A1 4P2MA 5CD4A 4X66J 4K4ZA 2O1PA 1RWXB 4JI2F 1Z2LA 2GA7A 4M5GA 3SI8A 2FVRA 3UR0A 4Y2CA 2EWHA 3D68A 1YVFA 4KFBB 1RABB 5C42A 1CJTB 1O51A 2HWHA 4QOTA 2M7SA 4ZVFA 4M5DB 2KJWA 5DQHA 3KJNB 1K0TA 1VC0A 5L1LA 3EPGA 3QGGA 3D54A 2RUGA 3PFEA 5B7WA 1JNZB 2Z2YB 1QD1A 2CIMA 1NLKL 3BBCA 4B3OB 5KG1A 1M1KT 3J7ZT 3RRKA 3JYTA 4EZ6A 4ANCA 2WW4A 1X0FA 3N6NA 4ZVTB 3CULA 4A8FA 3VVUA 1RWUA 3FRYA 4WBFA 4CLUA 3D67A 1KN6A 3HKWA 1UWBB 4M5IA 1IR1A 1H2UX 3JS9A 4ECXA 4M8LA 3TANA 4I2PB 3UD3P 4IOBA 4C6AA 2EK6A 1T9TA 3I4HX 4OI3A 3GYNA 3CCSS 3EXCX 3AHPA 3C16B 3C19A 1DQ9A 4O3OA 3WC0A 1VLYA 2XM3A 4FXVA 2FHJA 2WHOA 2QSFA 2HQGA 1S97A 2DXEA 1HNWJ 3DI6B 4TXSA 3RG6A 3T6BA 1NJIT 1KLNA 2IJFA 2XMAA 2AJ1A 2QN6B 2ZBPA 5LMUF 1FDNA 4ZCMA 5I42B 4LR9A 3IS9B 4ZN3A 1DTTB 1PCAA 3N79A 2YX7A 2YNFA 3LP1A 3NCPA 5KFGA 3BBFA 4AD6A 3R7NB 5FLXU 4N5SA 4PZVA 5L1JA 5EX3A 3OV7A 1U26A 3NGUA 2DPJA 2UXDF 4I1TA 4Q2MA 1RTIB 1CS4B 3PM9A 1SV5B 5B0FA 1H74A 3HHLA 5K8PA 3DRSA 2NLWA 2WZ1A 3JXOA 5M2RA 3TVYA 4DWIA 5GADI 4X4QA 2GW8A 2Z4PA 4B9LA 2XI3A 1R6VA 2G1DA 2FHMA 1S1WA 3L9ZA 4K4WA 5I3QA 4YQWA 1DZ5A 4ECSA 3HT3A 3KLIB 1PBUA 1OQ3A 2HNDA 4LVNP 4OYBA 2XLKA 4ID8A 1VR6A 5HP1A 3IRWP 2CJBA 3G6ES 5KFZA 4MJKA 5H9EK 3OTOJ 1QSLA 1WOPA 2FLPA 2DR6A 4K2JA 4PG8A 1RWOB 3BZQA 4C3LA 1RWPB 2VOPA 4NCGA 4Q8EA 2UUAF 5IWAJ 4P7VA 3X3UA 1RTHB 4XTTA 3C15B 3JTOA 3NG8A 4KFBA 4LFBF 4NX9A 3OHBA 1CJTA 4FZVA 3DRRB 5HMXA 4DR3J 4FS1A 3FEXB 5D15A 4M5DA 2NSCA 4J91A 1JJHA 3OQ2A 4MAKA 2CQ1A 3AAWB 2JEGA 1FJGF 1UL3A 1RT4B 4F7VA 1RQ0A 2XULA 4TU9A 1EETB 3TJ9A 4P9SA 4ZLJA 4B3OA 4ZIVA 1KTQA 4ED7A 3QRQA 3CCES 2KFNA 4Y28C 1AUSL 1HNZF 1VCTA 3MMBB 4FPRA 2NQPA 4XK8C 2CPYA 1BWVA 2HRTA 3GTYX 2YNHA 4ED6A 3RAXA 1CLFA 1U1MA 4A8QA 2VBWA 2XMKA 4NLDA 4UUXA 2NXCA 3MPUB 5FJ4A 4J9VA 3PJXA 1WELA 2WAQD 1S6OA 4DL0C 2CG4A 2Z8QA 4WP3A 1JLGA 2YQ1A 2ZOGA 3W2VB 1JJ4A 1I94F 1ELOA 3O8WA 5CCMA 2LQ9A 1PC4A 4QYZJ 1TMJA 1NJYA 4I4BA 3GYGA 1S9EB 4OHWA 5F8GA 4IO9Q 2M9KA 1FERA 1FD2A 2ZKUA 1VC5A 1XNRJ 3MMCB 4FYDA 3I32A 3IS9A 1AFJA 3HSDA 4YDDB 4PPDA 4DV2J 3F41A 4M94A 4DZ6A 2FC9A 3VTIA 1M0SA 3CC7S 4KO0A 2LEBA 2MEWA 4RW7A 2D1CA 1FTCA 1I1GA 1TK0A 3KFWX 2BV3A 2Z0GA 4RBVA 1MU2B 1KWMA 3KLFB 3UVJB 4HDGA 1N34J 1KLMB 1RAOA 1CS4A 5M2UA 1WDTA 1VDHA 4JI8J 5KFNA 3KJFB 2QA4G 4ZJOA 3CUNA 1RGVA 2DRDA 5KG4A 1R8HA 4N8OA 3W65A 2KH9A 2J7KA 4FS2A 2RRBA 2W9BB 1ZA1B 2IC3A 2JWNA 5H1SV 3B82A 3J80U 4C98A 2LXIA 4K59A 1H0HB 3AODA 1S6UA 2XC9A 4IO1A 1WTBA 3ICLA 1NNDA 2MMYA 2FHOB 3MF5A 1WOSA 4BC7A 5HROB 2FJEB 3NP5A 3VHQA 3ILIA 4Z7YA 1LW2B 3KG0A 1KQKA 4NLTA 3R8YA 1FRKA 5J2PB 2L48A 2Y1IA 4MK8A 1ZETA 1M5VC 2A0FB 1NKEA 4X64J 4KV8B 2B9WA 3T5LA 2J0QD 4F2RA 4KPYA 5ETTA 2DNZA 5KG5A 1F3VA 4UZCA 5C25B 2UUWA 1RTHA 3C15A 2R7TA 4Q8FA 1J5EJ 2MLYA 4N7TA 4I6WA 4PPZA 1ZYQA 2GJFA 2RDIA 2ASJA 4YR3A 4ETZA 4ZJLA 3AH6A 1TL7B 4NI2B 2J8SA 1QUPA 5T14A 4UOGA 4KTQA 2ZH1A 1FF2A 2ROEA 4F50A 3UCGA 1RT4A 2QSWA 1BQMA 2WVCA 4NXNJ 1PG5B 1U4BA 4H4MB 3QFHA 3PRVA 3LOUA 1K9MT 3EMTA 1UVNA 2I2YA 2V9KA 1I6JA 2B0GA 3JQMA 4GKKF 2OD6A 2CPHA 1W26A 3OBIA 3OD2A 1H98A 4DV5F 5JJBA 3TA2A 1WSRA 3ETOA 1S7IA 2KHCA 3EDRB 1PAUB 3PO5A 1QY7A 3CE8A 4LBIA 1TK5A 1JK9B 3W2VA 3T9ZA 1EKSA 2OSRA 2Z2MA 3GWCA 2W2QP 4YB1P 4JI3J 5FLXY 2CWXA 1I3OB 3NCQA 1YJ7A 3K59A 1HI0P 2RQCA 2F1FA 1I51B 3MMCA 3I6PA 1AROP 2HHHF 4KGVB 1IVZA 1S1UA 2GGPB 2YWKA 4IH7A 5LM7E 4EMDA 3TW0A 4DG1B 2XS7A 3H5YA 3KNAA 1MSWD 2XZWA 1S1VB 1LOUA 4I0WA 2IDLA 3N5FA 2DR7A 2XMWA 4F4KA 1MU2A 1JKHB 2HQIA 3KLFA 4OHYA 5C24B 3UVJA 1KLMA 4LRCA 3QO9B 4YB7A 2XBPA 4E0DA 3HSZA 3NCRA 2GX8A 4AL7A 1FXDA 2W01A 4D3HA 3RJMB 1IKYB 1WKJA 1F5AA 4OHVA 3V6JA 1R27B 2VONA 2LMIA 2BKNA 4DLEA 5C2CA 3PEHA 5KT4A 3W9IA 2J0XA 3KHHA 3BF4A 4C7QA 1Q79A 2UVVA 4RU9A 1WI6A 1H7XA 4C48A 2F9DA 2M2BA 2CVEA 1LW2A 1HBUB 4KH0B 4K7QA 3MUTP 5CZXA 5A6WA 2CPDA 1PC5A 4RWWA 3ET6B 2GQQA 3O3LA 5J2PA 4IG3B 1MG7A 5E0OA 3DDIA 1HNVB 1N36F 2OD4A 1VGYA 4NA3A 2LFVA 3IBCB 4MTPA 2AGQA 2YKAA 4KHMA 3AX5A 1IXKA 5A0YB 2DNKA 2WK4A 2J9DA 3WQPA 3HF5A 4LRBA 1WNEA 3CCLS 1VRUB 1DTQB 2AEJA 1RHRB 1TL7A 4NI2A 2XTCA 3H4DA 3TI0A 2P6TA 2PMWA 3P45B 1VRTB 3DYAB 1TFYA 1PGZA 1HHSA 2AX1A 3MPWA 4H4MA 1ICEB 2DGSA 3BBBA 4OYOA 1GK8A 2LDIA 4FP9A 4PG6A 1Q53A 4MKBA 3IRXB 4X4UA 4JI2J 2XO7A 2IPOB 1A7GE 1A0OB 3MR5A 5ETMA 3US5A 2EFQA 1RZMA 1X4AA 1LWEB 2HLTA 3IO1A 2OPRB 2AZ1A 2CKWA 1U02A 5B0DA 1U2FA 2GQ2A 2QA1A 2HFVA 4M5HA 3LA0A 3MPYA 4F4WA 2Y8WA 1X5PA 3PFOA 3X1LB 2XYPB 5KFFA 1GMVA 3T1AA 2D7SA 1LEOA 1EP4A 3JQKA 2GJIA 2G2ZA 2I1RA 2BE7D 4WTYA 1H38A 3I55S 1XK8A 1TU0B 1FO1A 3OPKA 4ZP8A 1DFDA 1P1LA 5HATA 2E5HA 4ECTA 3HI9A 2RDJA 2VU5A 4G6VB 5GAGU 1Y11A 3KLEB 2W9AA 3PYDA 2VC0A 2MKSA 4DG1A 3RB4A 1X4DA 2HQCA 2FLNA 3MR6A 1S1VA 3AB4B 3GIRA 5AXMA 3J80Y 2ZBCA 4X84A 4QIVA 4DFMA 3KUEA 1YJUA 1B0PA 3QO9A 2R2TA 3KTQA 3CCTA 4GO5X 3DN9A 3FMBA 1KQFB 3A13A 1D9FA 2PSZA 2IAJB 3QIPB 4ZHRA 1IKYA 2NPFA 3FVYA 3ZXWA 4ZCKA 5K9FA 2KYZA 1X9SA 3D3BJ 4PG5A 2B9XA 3H5SA 2FC8A 5KT3A 1ZA2B 4ED2A 3I0RB 3CNQP 3W5XA 2KG0A 1HBUA 2ZH6A 2ZNZA 1YJWS 1UW4A 4RL1A 4NZ7A 4IG3A 1HNVA 5F3TA 1AW0A 1ITPA 2BJ9A 3AOAA 2KT2A 3QRPA 4DR2J 2F63A 5D4PA 2JSXA 1R43A 2RAQA 5D4OA 5AJ3F 5KFLA 1TKXB 1ZS6A 2HSEB 3G8QA 3CJTA 4JUZA 4OV6A 1X4EA 4F67A 1YDLA 1RHKB 4ICLB 3PKYA 1RT1A 4PWDB 1U8WA 1Q95G 3WHIA 4DL5A 4LSNB 3MAHA 2PI5A 2DD8S 2VFVA 2CAJA 1VRTA 1IBKF 2GAGC 3TJAA 1ZM9A 4RLEA 1WF1A 2CNKB 1QDUB 1IBMF 3M8ZA 3OL6A 1YRXA 2B9YA 1NK6A 4K4TA 2YKNB 1GX5A 4JI6F 1URRA 2EFVA 1LWEA 2OPRA 2L3MA 1KEKA 2LQBA 2YPYA 5HK4A 4CO0A 3M8PB 3VAMA 4DU7A 1Y00A 4NLUA 2F40A 4DL4A 2JVRA 1WTFA 2IMOA 3FBFA 1REGX 1Y5NB 3MWBA 3THPA 3DLKA 3MEEA 4X4PA 4PRFA 1RSCA 3O1LA 1QTNB 3ZZRA 4WF9Q 3S8SA 4B3RF 5D4NA 3CTRA 1SPBP 4CLLA 1HWJA 1G7CB 2FJBB 3CJ5A 3GIKA 2BW2A 4MH8A 1M5PC 3EVMA 4OHXA 1RAEB 3Q8RB 1RA6A 1HBMA 1ULRA 3I82A 1TL4A 4NASA 4NLVA 4QQBA 3VAKA 3OL8A 2GZOA 5EHHA 3KLEA 3BO2A 5A8WB 1NK0A 3SQOP 3NXZA 3RR8A 8AT1B 2Z56B 3QSYB 2X1BA 1VBKA 1G4CA 2KN4A 4RKUC 2EC0A 5KFBA 4F3MA 3UFCX 4ES1A 4DEZA 1VFJA 3SV3A 3DKDA 3HO1A 5F9NA 1WHYA 2H3EB 2B4VA 5J2NB 4UY85 2ADBA 3LP2B 1VQ7S 2VF3A 2V9WA 2EVZA 2B7BB 2KFZA 3QIPA 3VAIA 2W7AA 2FD2A 2FPHX 2C42A 2BBEA 5KFYA 1PAEX 2MKKA 5JVHQ 1FFSB 4NE9C 1DAXA 2RS8A 3SMZA 3CDBA 2KDOA 1XMQF 3OXGA 4Q0BB 3OFEA 4R0JA 2MLXA 4Y2KA 1S9FA 1FEEA 1Q4RA 1YJRA 4HKQA 2DJWA 2B3TB 2VKRA 4HH1A 2YX4A 2AMCB 2OP5A 3M6UA 3Q8QB 2FYXA 2YNIB 3KLGB 3EZOA 3DOMB 2W2MP 3DGPB 4EGLA 3DHXA 2XSFA 2ZWPA 4CWBA 4J9PA 2DHSA 1RTDA 5ETVA 3OTDA 3U02A 4K0KJ 2MQOA 1TKXA 3ZZPA 2DNPA 2IMWP 4OYZA 2Q6BA 1FRLA 4I6AA 2VHGA 4QW9A 4M95A 4ICLA 2QGFB 4RW6B 4JI4F 2D68A 3T41A 4DX6A 4IKAA 4LSNA 1OM2A 3MDFA 2EI5A 3AQPA 2QLJB 1XNQJ 3T5KA 2UXBF 1U2RA 1KFDA 4OZLA 3AXKA 4NMLA 2XNRA 4L3NA 3AX3A 1TL3A 2XMVA 1OSDA 2F5GA 1KSPA 2XSJB 3Q8UA 2YKNA 4ZLPA 4DX8H 5DO2A 4C3KA 3AJ2A 2CPFA 1LWCB 2ZVIA 3DCAA 4ZPBA 4JYAF 3GCXP 1NU4A 2VFUA 1U6ZA 4WXWA 1K47A 2MHEA 2W8KA 4M5JA 2ZDPA 1IUJA 4A8MP 3UNGC 2UV8G 3FQLA 3QQCD 2GMJA 3BN4A 1GMWD 4HHUA 3WX4A 2L08A 4RPFA 4ANDA 1V5IB 1RT3B 4CI0B 3DLEB 4NLSA 3WX8A 2IRYA 2ROGA 1HWUA 2Q3PA 1U1KA 2KKHA 2H51B 2XY6A 3F73A 2E5GA 4CNZA 4LF8J 2HHQA 3ENQA 4PR6A 1R3NA 5LOQA 5E7OB 3JAMU 3W2WB 3OTEA 2H5IB 5B0CA 1PYTA 2M4MA 4P74A 3F56A 1JLCB 1TFWA 3W5YA 2QL9B 3OR2B 4A4JA 1AXQA 2ZBIA 1OMSA 2HHXA 3DLLQ 1PYOB 3T1YF 1C0TB 2ZH2A 2VA3A 5I3UB 1LW0B 3IMQJ 5KFHA 2HYIB 6AT1B 2IJRA 1SL2A 3CIZA 4DOZA 3WBZA 5J2NA 3SFGA 3GFHA 1VQOS 3D6TB 3LP2A 1FRMA 2BJDA 1TKZB 1EKRA 2VG6B 1EHWA 1FWKA 2RQ4A 3CEDA 1N5VA 3EZ5A 2CDRB 2VFRA 4B3SF 1DJ0A 1UPPA 4XPEA 1UA0A 5IT0A 3N5BA 5DETA 1RAAB 2GAHC 4Q0BA 5EGYA 2QA4S 4DPXA 4W98A 2CQ4A 4YHHJ 4CH1A 2CFXA 3FCWA 3NWGA 1BC6A 4QR2A 1AA1B 1SXLA 1N5SA 4IG0B 9RUBA 4YFUA 1NXIA 2WVDA 1RKIA 5IV4A 2BKOA 4WU3A 1FJEB 2G4BA 5F0WA 1P27B 2AYEA 2YNIA 3KLGA 5L9NA 3DOMA 3SCLE 4CLWA 3DGPA 4DN0A 1DQAA 1NKCA 2V5HG 2DPIA 2YQ3A 4OV1A 2KTQA 5J1EB 3K58A 3GJRB 3AD9C 1KQSR 4FF1A 3HHLC 4IH5A 3VF0B 1KS2A 5DDQC 2FJDB 4LBPA 2DNLA 1I5OB 4HDHA 1RTJB 4LR8A 4AQYF 4ED1A 3TJ8A 1GQEA 3I9ZA 3UDVA 3DFEA 5LMNJ 1VS3A 4E8UA 5CYQA 1HMVB 3TX0A 2VFTA 4FN5A 3ZZ0A 3TUPA 1NJZA 3EM1A 3BYPA 5KT6A 4B02A 2QTWA 3BSCA 3L3CA 4ZIWA 4KRWA 3DM2B 2DNMA 1JLFB 1H73A 3AOCA 1LWCA 2DBBA 1HNXJ 4TY9A 3H0PA 2HVDA 1RT3A 3DLEA 5BJRA 3EVOA 1HR0J 2VQFJ 3OFFA 2XNQA 5KG0A 3IA0A 4C8KA 4RUHA 4F25A 3TEGA 4CQ1A 4G65A 5KFPA 1PSDA 1T3OA 4ILLA 1SJFA 2MZSA 2MY7A 4KH1B 4IFYB 4O3PA 1JLCA 3RW7A 4ECZA 3VQSA 2BXJA 5ITHA 3OR2A 2LEAA 5B08A 1GXUA 3FEYB 3R5BA 5ETLA 3EJMA 5I3UA 3BPDA 1V3ZA 2FTRA 4ENOA 2K7JA 1VBYA 2J6TA 1UW9A 3K0JA 3KUGA 2VL1A 3MOZA 4M5LA 1P9QC 2EFPA 3QBCA 3ZTOA 3D6MB 1SKWA 3HK2A 3K89A 4K8RA 2HK2A 1OY8A 2HFUA 2CG8A 2VG6A 2GNKA 2KRBA 3LO3A 1RT5B 1PBAA 5KOWA 3H2LA 5GMKa 1X31C 2JHEA 1AB8A 4AFFA 2ZD1A 3UDCA 4PAAA 4R5PB 1N56A 4ZITA 1HBOB 4FNHA 3V6KA 4KJIA 1HHTP 4HL9A 1V5VA 3ZZZA 1VBXA 4OYAA 1D09B 2OMOA 4IG0A 4IFVA 2OTJS 1JB0C 4DR6J 3FKBA 2M3DA 2N3LA 2V67A 4FNIA 1S1TB 1VQ9S 3BR9A 4RNMA 4DV1J 2FVSA 5A2QU 1QAYA 2HVZA 1RI7A 1Q8BA 4PG4A 5J1EA 2C22A 1F60B 2XCAA 2HZCA 3OVSA 4EBEA 2R7XA 4ZVRB 2DO4A 1MROA 4DR5F 1VRQC 4X65J 2I38A 4P72A 4WFZA 4KYZA 4J9LA 4L75A 1QE1B 1IKXB 4DS5A 3M2UB 2C2KB 2CQGA 3D3CJ 5EWGA 1S6PA 3O44A 2PFDA 2R7RA 4JV5J 1D3WA 2IJNA 3CCUS 2B56A 1Y4ZB 4USIA 2XMTA 2RRAA 4F26A 4JBCA 2M70A 2DNOA 3HP6A 2GO8A 4CTAB 3ENWA 4DSFA 4Z7CA 3DMJB 1JLFA 5CA5A 5AJ3J 8ATCB 1RBOB 2AEMA 4TLQA 3GIJA 2E5LF 1E6VB 4Z37A 1GT8A 1UA1A 2ZH4A 3MAQA 3B6BA 2MGZA 2ROPA 1HYSB 1L3TA 3ADAC 3RB0A 2B4OA 4WYLA 2W24A 2E9ZA 3V4IA 3UCUP 3OLBA 4TLRA 4ZDNA 1VQ6S 3RAQA 3HM9A 1UFKA 2CADA 4ZVOB 1IR0A 2R7QA 4NCBA 3HSJA 1Q16B 2DO0A 3NOCA 4OI2A 1JXLA 4WZQA 3RUBL 4F0KA 5GAEU 3PKMA 1H2TZ 4IFYA 1GFWB 5CYJA 1UJ6A 6FDRA 3KK3B 2FZCB 1UJ5A 2CQ2A 3TEHB 2RILA 3C46A 3IBWA 3VCDA 3FK4A 5ADZA 3ENAA 1QSYA 1NDLA 2EEYA 1NK4A 2G0IA 1KR4A 2F4VJ 4Y2IA 4B3TF 2D9OA 2IM2A 1U6FA 1QM9A 3NBPA 5J2MA 2YNGB 4B3RJ 4D3GA 5J1PA 3G71S 3PYEA 4W92B 5FIIA 3IG1B 3M4XA 1SC4B 3R6GB 5F8JA 1RT5A 2ZJRQ 2ZC3A 2NUUG 3PCOB 4WFXA 2X7IA 2HBQB 4JI5F 2JX2A 3CJRA 4NLQA 2O66A 1HBOA 3FZBA 4PCQA 2LLZA 3PW0A 1RA7A 3TUZC 2XLJA 2HHPA 4CYUB 2YWGA 2V34A 3KJQB 4W4MA 2SXLA 1NZAA 4L72B 2C3MA 4Y6IA 1IWGA 2X1AA 1NHKL 4DSEA 4TKTA 4WFBQ 3LW5C 1N0UA 4LIRA 4UQGA 2W4CA 3K8VA 4B17A 4LFAJ 1B99A 3MCMA 2GIRA 2R4FA 1IM4A 1RXOB 2HWTA 2DYAA 5DG8A 4ZS6A 2HHWA 2IRUA 1LXJA 3EGNA 4PQAA 3IAM9 5F3ZA 5KFMA 1NRKA 4WPAA 4JOUA 4JI1J 2ZM6J 3KLHB 3AWRA 4AXJA 4DV6F 3CXCR 2W4PA 1QE1A 4LF5F 4O4RA 1IKXA 3M2UA 2H5EA 5F0UA 1NCLA 2QMXA 4J9NA 4Q2LA 4DBQA 2FY8A 3KHGA 1YJ9S 2CQ0A 1JLEB 4OX9F 1U6BA 2CNNB 1Q7LB 3A3OB 5DM6Q 4O4GB 5K20B 2HPUA 1NPRA 4RW9B 3FSXA 1FE0A 3EGWB 3FSYA 3R27A 3HVAA 5FDLB 3SEOA 3MI7X 2PE8A 3CCWA 3S01A 4CTAA 4UQTA 2EC2A 3DMJA 3G9CA 4J9SA 2YTCA 1D9AA 1S4EA 1OYDA 2MSTA 1LK5A 1E6VA 4F2SA 4C8LA 4WKRA 2P6SA 2XMUA 5DG9A 4TU7A 3BEGB 3H90A 1HYSA 3RRGA 3R7SB 3L4BC 4DS4A 2X1FA 3IP0A 2ZC4A 1Q0NA 5L8RC 1RLDA 3NEKA 5GVQA 1NUEA 2DB1A 3R5DA 5B0EA 2P9GA 3J81U 5A76A 4OIXA 2JNJA 2VBZA 5ETNA 1SQFA 1O8BA 3C6UB 2KZZA 1SL1A 3U7JA 3HMJG 3KK3A 4LFCJ 4ZP6A 2PA8D 1LWXA 4HT5A 3GSIA 1N5YB 4GMKA 4YEAA 3S1TA 2C2DA 2MKHA 4W90B 1ZOTA 3M32B 1OYEA 1WORA 2ZH7A 4OZNA 1KFSA 2ZH5A 4E98A 2YNGA 4E2FB 2AW0A 4RZRA 2DNQA 1P9YA 3IG1A 3TO8A 2UVRA 1RU1A 4N76A 1F6TA 2IBOA 2AEFA 5A2QY 1TV6B 1NDCA 2XWYA 4RW8B 4Y2MA 1C4CA 4UZBA 1GNKA 2KG1A 4I68A 1M1GA 3B78A 1FRIA 5DZ6A 1C1CB 2CPIA 1XC9A 1GTHA 2O5DA 4TVAB 3DOKB 1RYSA 1IJEB 1YK9A 4ID5B 4CYUA 2VJVA 4A47A 2AGOA 3GIMA 4DV3F 4M5KA 1G6BA 2HLUA 2IA6A 2BJ1A 3CCJS 4LRDA 2N7YA 1SUQB 2GQCA 4WE1B 3CO9A 1YI2S 1WEXA 2XZ2A 3NLCA 1WACA 2HGMA 3MMAB 2KVQE 3GILA 4G1QB 2A2DA 4UW2A 4F3QA 3ONQA 2ZZNA 4OL8A 4NXMF 2MZJA 4HEA9 3KLHA 1RBAA 4TNOA 2KFYA 1Q7YT 1FKOA 4QPXA 3NGRA 3FNNA 3TNVA 2CJ9A 4AE5A 1QTMA 3FZ2A 1JLEA 2CJAA 2D69A 1R0AB 4WP9A 3EZUA 2AQ4A 4O4GA 1DRZA 5ETSA 2OHDA 1GH8A 2MPUA 3W8GA 2KXNB 2WVFA 4OJGA 2Y1JA 4RW9A 5BYSA 3BPSP 2OFHX 5FDLA 1LK7A 3ZTRA 3EICA 2MKJA 1VQKS 5T7LB 3TRGA 3DDKA 4GRSA 1HFEL 1HQEB 1SIZA 2DHGA 3CJ4A 1U8SA 2GHVC 2N4CA 4F8RA 3FBBA 4KB7A 4A8KA 3M7VA 2UXCF 1UP1A 4KY3A 2N82B 2B8PA 2C3OA 4JI0J 1FKPB 5DRKA 2O67A 4WZMA 2RKIB 3JSYA 3CPWR 4ECQA 3IN5A 4LSLB 3C6UA 1T03A 4TQSA 3MEDB 4NRUA 5F41A 4F0HA 4DQQA 4NRTA 2JH3A 2FGOA 2EXUA 1N5YA 5KG3A 2XTEA 3TZZA 2NZ4A 3MCOA 1JLAB 3FSIA 5IC6B 2JZ5A 1EARA 2AKWB 3MR3A 1YJNS 1C4AA 2M0GB 1JIHA 4EI2A 1XERA 4ZN1A 1XR7A 4U8VA 1X5SA 3ISND 5KFXA 1JLBA 2UVUA 4J37A 3FBCA 2KYXA 1TV6A 4RW8A 2ILZA 1NSQA 1F0XA 4OI1A 4BHQA 1X60A 3WIVA 5HAOA 2IVFB 3FUYA 2V6AA 3DOKA 4ID5A 3MEKA 3JTPA 3UR3C 1PJ7A 5L9XA 3C66A 1T9UA 5DQIA 4ZVQB 1ZAXA 3R3TA 1SUQA 3PNIA 1QSSA 1VBZA 4PYAA 4NLWA 3NS5A 4ZVSB 4A48A 1DQ8A 2P2CB 1WG4A 1RT7A 5EX0A 2ATLA 2BJ8A 2AJ0A 4X4OA 2HGLA 1VISA 3MMAA 4G1PA 2UUTA 5BR8F 3B54A 2DXFA 4G1QA 1DLOB 1DURA 2ZHOA 4J9MA 4PXCA 1EQ0A 2MQPA 2Q79A 2LA4A 2V2KA 4OZ0A 3MAAB 5IFMA 5C5JA 1R0AA 2OMLA 4U95A 3KDNA 1JMTA 4H4OB 4KR0B 1WOOA 1M5KC 2HNYB 2ZE2B 2X51A 3I4PA 1Q5VA 2J0SD 3IGNA 5HQLA 4DFPA 3M8WA 2CQ3A 3AOBA 3E8OA 5CH7B 2AYMA 4DR1F 5T7LA 4QWEA 5THWA 3J81Y 1OO0B 2N4DA 1JLQB 1O6XA 1WHXA 3PX4A 5KFSA 2VODA 1WI8A 3CIMA 3AJDA 4U7CA 1WKLA 3E2EA 4NLOA 2MTLA 1RBLA 4CLKA 4LF7J 3Q24A 1FKPA 4DV7J 1FEHA 1R6YA 3HHNB 3C14B 5CQGA 4I2QB 2RKIA 1HWLA 3D66A 5LJ3Y 1HI1A 2E9TA 1RTZA 2A2CA 1ZZFA 1T9XA 4ZPAA 5HLFB 3VGSA 4LSLA 1R7IA 4Y2AA 1RAGB 2Q1LA 2AYBA 4I69A 3CCQS 2I9SA 2VBXA 4OX8A 2OO4A 3ITHB 3RR7A 3BS9A 1UKUA 3WDOA 2W2NP 2U2FA 3R9LA 1F2HA 3MEDA 2AU0A 5A8RA 1RP5A 2DGWA 3DXBA 1AYEA 2UUBJ 4UTGA 4DV4F 1HA1A 4DQRA 1GAOA 1ZTWA 4PUOA 2WSFC 2BOPA 2DITA 5I4MA 3HJFA 1X8DA 1T9YA 4UUWA 2X3GA 2CQCA 3LP0A 4ZVUB 1XIQA 4F4YA 1TUGB 1VJWA 2FDNA 4QWDA 4DR7F 3D9BA 4CLTA 6FD1A 2EBEA 4NOHA 2PI4A 4ALZA 3M9OB 3TX8A 3TVKA 3BN7A 2PD1A 3IBFB 2XS2A 4DV0F 3MUVP 2Z2LA 5JUMA 4RBTA 1SCJB 3A8EA 3CJ2A 2J6UA 2NXUA 4WK1A 1B0VA 1HBNA 2BEFA 3HD1A 3NGKA 1U1NA 4USWA 1LWFB 1WD6A 3NKYA 3H7HB 2RNEA 2QYGA 3VV2B 4CP5A 3TQ1A 3LUYA 4YB5A 4JI7F 2DCLA 2QL5B 3G87A 4DMZA 3BSNA 2G2OA 4LJMA 2HBRB 1YSJA 1U7LA 1NSAA 2F8HA 3U1LA 4B9MA 2HNZB 3QT6A 4PYDA 2HWIA 3D2WA 2RU3A 3A8KA 4C0HA 1UVIA 1NSKL 3T5JA 2XLIA 3DGVA 1L3UA 2BJ7A 3GP9A 4CO4A 2YKMB 4MIBA 1DLOA 1Y0HA 4DQSA 2PDAA 4M5NA 2FLLA 1TL1A 2V1SA 5KT5A 3HLUA 1B7FA 4PXDA 1AFIA 3I0SA 2J9EA 3MAAA 4ZP7A 3V6DB 4EK2A 4AYBD 3GU0A 3PRBA 3MECB 4H4OA 4S0MA 4X4RA 2HNYA 3BH6B 2J76E 4F3OA 2ZE2A 2CZ9A 3MR2A 2HS0A 2HIQA 3ENVA 1OJ4A 1SKSA 1TUVA 4UT4A 2ZWOA 5GAEI 2Z30B 3MXHP 2L9DA 1O5JA 4CM2A 4RBUA 2PMHA 1JLQA 4QYZK 2VPXB 3V5RA 4K4VA 1UVKA 3SIPB 3BKFA 4LF9F 3VWSA 3GCWP 4C0OC 3EPIA 2GVZB 4LQ9A 3OJUA 4J9KA 4C8YA 2VC1A 4TY8A 3R5CA 3M1VB 1C1BB 7FDRA 3TAPA 1V3SA 1FDDA 1Y7PA 3C14A 4I2QA 4DU8A 2KU7A 2AIRB 2WCXA 3DRPA 5HLFA 4WXOA 4LR7A 3W1YC 1QAIA 1VHIA 2E7XA 1SH2A 2NXEA 2W25A 3V81A 3SXLA 5DG7A 3ITHA 1RT2B 3W61A 1Z2ZA 1SC1B 5KT2A 3GFYA 4R8UB 1S76D 3J7AN 4K50A 1DARA 2V4QA 4CZCA 4ER8A 3W9HA 2GVDB 1REVB 1K1QA 3HHDA 4BS2A 2WONB 3K57A 4X66F 3M8SA 4I67A 2AHOB 4MIWA 2DNYA 2BQ3A 1NEEA 4JP8A 5IV3A 4IRDA 1T94A 1S48A 2KM8B 4Y0FA 4ECYA 1PIEA 3CMQA 3I87A 1FX4A 4IQMA 2BA9A 2DISA 1O0PA 3H2UB 4AUKA 4U8YA 1P6TA 1M5SA 2RQKA 2M5YA 4ZKAA 3HX9A 3PR4A 2P9EA 4HH0A 2W8LA 3A4TA 1NMEB 3D6HB 2YKOA 5D77A 4ZCIA 1LWFA 1WC4A 3ELHA 1WC1A 4NA1A 3RBZA 1VQ5S 3BM7A 4XDDA 3KYLA 1KC8T 4EYIB 3ZNJ1 2GMLA 1WDDA 2HNZA 3M6VA 4HLBA 3NS7B 4LF4F 2J8AA 1Q5YA 1UWBA 1N32J 1WWHA 3I31A 3AD8C 1KQGB 1HHQA 1CULB 2R9LA 1NHUA 3G2XA 4ECVA 4I2PA 4QR0A 3I5CA 2W7OA 5K14B 1KHWA 3CMAS 1FJCA 3TA1A 1N5TA 3C16A 2ZBRA 2D3OR 3FFIB 2W9CB 4OI0A 4NA2A 2LYVA 4DV3J 1HNWF 4RW4B 1D8YA 3TZXA 3DI6A 1UVJA 4MKYA 2A1BA 4RUBA 2DNHA 2A3JA 4O23A 3OVAA 4QJVA 3Q23A 2C2RA 1RWNB 3SFUA 4LBHA 1OIAA 2EK1A 4B3MJ 5I42A 1DTTA 4F02A 1CJVB 4P10A 2ZZMA 2VFSA 1GX6A 4XAKA 2JEJA 2B5JB 2CUYA 2D41A 3OSNA 1IJFB 4P2FA 3MHYA 3OTBA 3Q22A 1HL6A 4HHJA 2GVZA 1N0VC 4KT0C 4Y34A 2QE5A 4P6QA 1S6QB 5AXLA 3M1VA 1C1BA 5LXRA 1RTIA 1GXLA 1SV5A 3A3NB 3OJSA 3W63A 2XB2D 1P1TA 1KRPA 2YWHA 1EJ7L 1FRJA 3MCSA 5HBMB 4O3RA 1LV5A 1RT2A 3GZ7A 3Q86A 1BY9A 2JRSA 5CYMB 1TP7A 1UCNA 1SJQA 4OYMA 4C8OA 4X62J 4OYIA 2VOOA 4DFKA 4JV1A 3OL9A 2DIUA 3P5TL 3N28A 3KLIA 3N6LA 3RB6A 4BWMA 2J5AA 2GVDA 3THVA 1REVA 3ZTPA 1FESA 2V8PA 1K0VA 3OTOF 3BGRB 1YRUA 2WONA 3BQ1A 1SI9A 1VJQA 3FBEA 3MM5B 2V68A 4ILRA 4M5MA 2XQCA 2OEJA 5IWAF 4WYWA 3MM8B 3LGNA 3D0GE 2V8HA 2CPJA 4NLPA 1RACB 3L95X 4ILMA 1S0NA 2V8VA 2JEFA 4DR3F 2XHCA 4YOEA 1QLNA 3DRRA 3WZ0A 2EG2A 4KAIA 3TAQA 2EFOA 3RZAA 2C2OB 5KFIA 1N33F 3KOAA 4USJC 4NEYA 1EIYB 1JWWA 1EETA 4FF2A 2PT0A 1WF2A 2HS4A 3LPYA 3SQGB 2B8QA 3MMBA 2JDJA 2DH7A 3HZGA 1N8RT 2AYGA 1FXLA 2DHAA 1FI4A 1GTEA 2XMJA 3K5NA 4B9VA 1PJ6A 2CPZA 1S4FA 1RCXB 1FFGB 3ZZOA 1QAXA 4C8NA 1C2PA 3G6XA 4MYTA 2ASLA 4DPWA 4OZ1A 1U1QA 5K8MA 2IFXA 2DGXA 3SYZA 2LCWA 4DSIA 3CGIA 1B4SA 5JVGQ 3QJJA 4K2XA 3MCNA 3KHLA 3M05A 3EYZA 2UUCJ 3FQKA 3C6TB 3MPDA 4LF6J 1S9EA 4RNFA 2ASYA 3NRBA 3I5AA 2HMIB 1XNRF 3W3SA 2EKNA 1NHVA 4DV2F 2AJ2A 5KFAA 5H9FJ 3HHEA 1CJVA 1TAUA 1RLCL 4EEYA 2B5JA 2R7UA 5IT9Y 4AXIA 2VIHA 4FF3A 1CC8A 1S10A 3LH2S 2EFGA 1ZH5A 2KL8A 3VAHA 1NJXA 5DDOC 1S6QA 4NLXA 3C8YA 4DX5A 2L9NA 1HD0A 4B9SA 1R0BG 4U9RA 2HFZA 4WIQA 2M52A 2H1YA 3PZPA 1R8PA 4JI8F 3GG1A 3PRDA 2J0WA 4NZ0A 4H4KC 1E6YB 3Q8YA 2HK3A 3T6JA 3QAEA 4CNYA 2RB7A 2IY5B 3HVTB 5HBMA 2YWWA 2W9BA 1XMOJ 4U7UD 3CJ0A 2E66A 2ZUGA 4OZ3A 2H5JB 1JXVA 4O44B 2DRAA 3CD5A 3TP2A 2XEXA 2BACA 4N8NA 2ILYA 5D0GA 4FXDA 4YN3B 1NB7A 1KOOA 3CDEA 3SSSA 3TQEA 1RK8A 3F0NA 4WFAQ 5HROA 3GSDA 1UZHA 5KFRA 4AL6A 3DU5A 4ED3A 1RB0A 2Y0SD 4DR4J 2B6AB 1FNMA 1KDNA 3IR6B 3BGRA 2VG5B 3HPOA 1Y3JA 2JLFA 4XDCA 3M2RB 1CC7A 2MQ8A 4X64F 4FBUA 2MSSA 3QZ7A 4I56A 1EB0A 4KV8A 2AP6A 3MM8A 3QGIA 3LWLA 4YDXA 5C25A 1J5EF 4IH6A 1APSA 2KT3A 1HARA 2E7VA 4LF2A 5IQ6A 5A8KB 1TELA 3BYRA 3ZZYA 4KIAA 1CPZA 1NSPA 1GMWA 2KJVA 3RBXA 3PJWA 3HULA 3EUNA 3HKZD 1NK7A 3KWMA 4EUVA 3SQGA 3PW7A 1U24A 2ERRA 3OLAA 8RUCA 2RE1A 3KHRA 2M8HA 1XR6A 5KTQA 3QT8A 3H98A 1U1OA 3LTOA 3OUYB 4ECWA 3G6VA 2E9RX 4OX6A 1V6HA 2RSQA 1R89A 1K44A 3EXYA 3N6MA 4QIWD 4ZVGA 2WRMA 1SBRA 2W7PA 3PYGA 1FXRA 5HSPA 1N88A 4DJBA 2LQ5A 4JI3F 2ZHBA 4PQUB 3JYTB 3Q2SC 2UV8A 2WSCC 2FVQA 3FRZA 2V4RA 1Y5IB 4NYOA 5HMWA 2HMIA 4MYUA 4OI4A 4ES2A 3QMQA 2DTJA 4QZVB 3HVRA 2ZKTA 1YX2A 2APOA 4DL6A 2GGPA 4L74A 4DL7A 3T19A 1U0SA 5L46A 3CT9A 1FD8A 1T02A 2MB0B 1H6KX 3I5BA 1JKHA 2V69A 3ILOA 5D8HB 3UN3A 2QG9B 1YZ7A 3LAKA 5C24A 5CHCB 1B64A 5M2PA 2OJ3A 3NNAA 3UN2A 4DI6A 3RGIA 4ZLNA 1KVIA 2R7SA 1E6YA 4CLZA 5LMUJ 5B09A 4UY8T 2VBYA 3GFXA 7FD1A 3R2DJ 2VJUA 2YNFB 2O01C 1S57A 1D1UA 1IQTA 3RBDA 2DXDA 2WW8A 2PA3A 5E3CA 2XZTB 3BO4A 1L5UA 4DF4A 5HMYA 5ETPA 2QLXA 3WIUA 2UXDJ 2YH1A 2B6AA 1UVMA 2VG5A 4ZK7M 1OWXA 3ET6A 3M2RA 3DRSB 3QT7A 2QMWA 2K8GA 3GFZA 3RTVA 1S72S 4DL2A 1MMNA 4YP3A 4NLYA 3P96A 5A0YA 2MZRA 3A12A 4QCLA 3ZFVA 2ADCA 3VGVA 3OTCA 2CA9A 1VRUA 1DTQA 3ZZUA 3GR0A 3J7YU 2XO6A 2HNDB 2Z57B 3KNGA 3OXFA 5HP1B 4O3NA 2MXYA 4P7TA 4EU0A 3NMRA 2HZVA 3DYAA 2XGPA 3DLHA 1ACMB 4DUZF 4OHZA 3N9UC 2MQLA 3PHEA 3QYYA 1VC6A 1T05B 3D5MA 4NCGB 5U47A 3IRXA 2N3OA 3SV4A 2AZ3A 2UUAJ 1T3NA 4Q45A 2HFNA 4OJ1A 5EUHA 3N0VA 2BANB 4IOCQ 4P75A 1VQNS 2E1MC 3AXMA 4LFBJ 1T9VA 2AV5A 2ZOFA 2ZJPQ 3OUYA 4A8SA 4CT9A 2QLWA 4OJHA 1SB6A 2F9JA 1FJGJ 1B7YB 4ZPWR 4DL3A 4I7FB 1IKVB 1CQMA 5KAKA 3V2UC 5MLCV 2DCUB 4I6YA 4PQUA 3NL0A 4RO0A 1RKJA 4USHA 2QA2A 1T0TV 1HNZJ 1UFWA 1VQPS 2HRYA 4LF4J 2YNHB 2ZZTA
chains in the Genus database with same CATH topology
4DFJA 3T9ZA 2QRRA 3B78A 2FGCA 1FRIA 4CH7A 1C1CB 2OSRA 3K5OA 1OSCA 2QT7A 3CDAA 2CPIA 2RT3A 2Z2MA 1XC9A 4HT7A 3GWCA 1GTHA 1C0UA 3BGLA 2O5DA 3A1YG 3DOKB 1RYSA 4YB1P 1IJEB 4ID5B 3RW6A 2G13A 5FLXY 4A47A 4XO0A 2CYYA 3NCQA 2AGOA 3GIMA 4DV3F 3K59A 5IS2A 5KFKA 1G6BA 1Q8IA 3PDNA 2HLUA 1HI0P 2IA6A 2RQCA 3CCJS 2F1FA 3D0HE 1WEZA 1XN9A 2BR0A 2N7YA 1SUQB 1JLGB 3MMCA 2GQCA 3I6PA 3QLHB 4IRCA 1AROP 4WE1B 3H25A 3CO9A 3GG0A 1YI2S 5D6GA 2HHHF 4ZOSA 2HFOA 1S1UA 2GGPB 2YWKA 4IH7A 2CQHA 3KJVB 2HHSA 3TW0A 1WEXA 5JXSA 3QAUA 2XZ2A 4DG1B 3NLCA 5D78A 1WACA 2WOMB 2HGMA 3MMAB 2XS7A 3H5YA 3KNAA 3KK1B 2L9WA 3VR1A 1MSWD 3GILA 4GO7X 2XZWA 4ZPCA 4G1QB 5DJBA 2A2DA 1S1VB 4UW2A 2NR0A 4F3QA 3ONQA 2HG4A 2ZZNA 2IAJA 1LOUA 4OL8A 4NXMF 4I0WA 3CCZA 3KG1A 1FHTA 2MZJA 3N5FA 2DR7A 3PIPQ 4FVCA 2XMWA 4HEA9 4F4KA 3KLHA 2D3ZA 1MU2A 1Z1ZA 1JKHB 4TNOA 2KFYA 2HQIA 3KLFA 1FKOA 4KGKA 1Q7YT 2LXFA 2R8KA 4OHYA 2QV6A 5C24B 1HPZA 2AGPA 4YR2A 1KLMA 4QPXA 4DDFA 4NZ6A 2KRRA 4G3IA 3QO9B 4QIFA 3FNNA 4YB7A 2XBPA 3TNVA 2DGVA 2CJ9A 4AE5A 1QTMA 3FZ2A 3W7BA 5SZTA 1JLEA 4KO0B 3CCVS 2CJAA 4KKOB 1R0AB 4E0DA 1Y5LB 3EZUA 4RW7B 2AQ4A 4CT8A 2Q43A 3NCRA 4O4GA 2GX8A 4AL7A 1FXDA 4D3HA 1DRZA 1IKYB 4HI2A 3IR5B 1IKWA 2MPUA 1GH8A 5LL6d 2KXNB 4RNNA 3FJ2A 3I0RA 3OXLA 4OJGA 2OPSA 4RW9A 2Y1JA 1F5AA 4OHVA 3V6JA 4RU2A 4EYHB 2E1AA 5BYSA 2OFHX 5FDLA 3H8YA 1LK7A 1Y9OA 3QPIA 1R27B 1D8ZA 2VONA 2MKJA 4LF7F 2AJ4A 1VQKS 1M5OC 2LMIA 2QIFA 5AE2A 4DLEA 4DV7F 5T7LB 4RWXA 5AE3A 2DGQA 2D3UA 3P6YC 3TRGA 3DDKA 2N7CA 3PEHA 5KT4A 2J0XA 3KHHA 1HFEL 1HQEB 2R7OA 4DR2F 4MFBB 2X1GA 1SIZA 2DHGA 3GE9A 4OMFG 3BF4A 4OLOA 3CJ4A 4C7QA 1Q79A 1U8SA 2UVVA 2GHVC 4RU9A 1WI6A 2J9DE 3M9NB 2N4CA 1H7XA 2F9DA 1FK9B 4WKYA 2IC3B 4F8RA 2M2BA 4JV2A 1MWYA 4KB7A 4A8KA 3MMJA 2CVEA 5HQ8A 1NK8A 1LW2A 2UXCF 1HBUB 5BYQA 4EO6A 3MUTP 5CZXA 5A6WA 3JB9k 2CPDA 4BDPA <