3OL8A

Poliovirus polymerase elongation complex with ctp-mn
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords Polymerase
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 140
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3ol8A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ol8A02
4RW6A 3PR5B 4J9MA 3CDUA 5F8LA 5F8HA 4WZMA 2EC0A 1DTTB 3LP1A 4IOBA 4NCGA 5KT7A 2E9ZA 3I5AA 4ZP9A 3EZUA 4RUAA 2XC9A 4WFZA 1UWBA 1C0UB 4EBDA 3PJXA 3MEDB 3KLEA 2XGPA 3QGIA 3GIKA 3DI6A 3H5XA 4R5PB 3E01B 5I42A 2HMIA 3RAQA 2D7SA 3H5YA 2QE5A 3DM2B 3LP1B 3TAMB 3KLFB 1FK9A 3GIJA 1LW2A 4KBIA 1TL3A 3V6JA 5F8GA 4RW7B 4GC6A 3KLEB 1LWEB 2R8IA 2FVQA 3DYAB 1HNVB 1RTJB 1OS5A 2BANB 4IH5A 5HBMA 3QGGA 4ZVFA 3FDSA 3T19A 3OHAA 1RT1B 3EPGA 1SUQA 1FKPA 1JLAA 3IS9A 4H4OA 2IM0A 3DOLA 1IKXA 4EO6A 3CWJA 3SFGA 5KFYA 1RA6A 3G6XA 1N5YB 1TKTA 3NAHA 4ED8A 1NHVA 2JC0A 2YNIB 4MIBA 3BSOA 1QE1B 2CJQA 5J2NA 4QWCA 4MIAA 3MFHA 1S1XB 1JLCA 2HNZA 4DEZA 4K50A 1FKPB 4QWDA 5KFVA 4Q44A 2AQ4A 3Q8PB 1C1BA 5KG3A 3N6NA 3SFUA 3QZ8A 2WHOA 3H4BA 2VA3A 2HNDA 2OPSA 3V4IA 1JIHA 4YMEA 2IC3B 5DQHA 3PW0A 2ASDA 4LSNA 2AX1A 3KHHA 4DL4A 4WFXA 4IRCA 1RTHB 4J9KA 3CVKA 4TXSA 3M9NB 4DL2A 5JXSA 1HYSB 4ZHRA 5K14A 3QO9A 3I0RA 1EETA 4RUCA 1T05A 1VRUA 4ZMMA 4F4WA 3RB0A 2AGQA 3KK1B 4Q0BA 4I2QB 2W9CA 4DL7A 1RT3A 4JV1A 2IJFA 4NLUA 4IFVA 3IG1A 4G3IA 4TYBA 3DOKA 5I3UB 3MR5A 3MECA 1S1WA 3GYNA 4ICLA 3FFIB 1DTQB 4YR3A 4QW9A 1RYSA 4ECUA 3KLIA 4QWEA 4LSLA 2BQ3A 3D28A 4KO0A 3OLAA 4DL5A 3ITHB 2I1RA 4O3SA 1K1QA 2YNGB 3CDEA 4JUZA 4ECVA 5KFKA 3T5HA 4RW4B 2JEJA 2OPPA 3TQ1A 2IM3A 1N6QB 4KB7A 1KHVA 4O3QA 2XWYA 3NL0A 3KLVA 1VRTB 4H4MA 2UVUA 3GV7B 3OLBA 3ICLA 2RKIA 3Q8RB 2B6AA 4F4YA 1REVA 3MEEA 3UQSA 5L1LA 1DLOA 3KMQA 2WOMB 5DG7A 3FQLA 4B3OA 5EWFA 1TKXA 5CYMA 4NLTA 4U6PA 5KFCA 3HKWA 1NNDA 2W7PA 1J5OA 3DLGA 4F50A 1RT4A 3V6DA 3QIPA 5D3GA 3N6MA 2W8KA 2YNFA 4QW8A 1KLMB 1TKZB 3OSPA 1TP7A 2IJNA 4EEYA 4IG3B 4XO0A 5CYMB 5KFBA 1RTDA 2BE2B 5J2MA 4JV2A 2FVCA 1IKWA 3M8PB 1RT7A 2V4RA 1RT2A 2ZD1A 2V0NA 4IH7A 4OL8A 4TY8B 4URGA 3LP0A 3T5JA 3KK2A 3I5CA 5KT3A 4J9PA 4M95A 3RAXA 1JKHA 4IRKA 3QLHA 5DQIA 2YKMB 4NLRA 4KHRA 1RT2B 4J9LA 2R8KA 1RT6A 1HQUB 4KE5A 4FBTA 4PWDB 3KJVA 2VG5A 4QWBA 4RNHA 2E9RX 1JLEB 4DL6A 2RF2B 4IFYB 2C28A 3RB3A 4NLSA 4WYLA 3RBDA 2IM1A 3KLGA 4IG0A 1S10A 5EUHA 2WTFA 2FJWA 1EP4A 1LW0B 2E9TA 1HNIB 1RT5B 2VG5B 5KFHA 1C1CA 4WZQA 4J9RA 3NKYA 3OSNA 3DRSB 4Y2AA 2XI2A 3IRXB 2FVSA 2VG6B 3KK3B 4KSEB 4H54A 5F8MA 1JLQB 1JLGB 3BQ1A 4TYAA 1S0NA 5J2PA 2IAJB 4KV8B 1JLBA 4ZVEA 4O3OA 3BGRA 4MK8A 1S1VA 4RW6B 4I2PA 4EYIB 4O44A 3CJ0A 4YR2A 1S9FA 3T5KA 2FLLA 3NBPA 4NCGB 4M94A 5DLFA 2WB4A 4I7FA 2BRKA 1UWBB 3DLEA 4ECZA 1T94A 5C24A 3DI6B 1HMVA 5I42B 2HMIB 5KG4A 3OL6A 1S1TA 5KG6A 2YKNA 2IBKA 1FK9B 3BQ0A 4RNOA 1LW2B 4TN2A 4U7CA 3SI8A 1TL3B 2QV6A 1S9GA 3OL8A 4KFBA 5EDWA 1QAJA 2JC1A 2W7OA 4PQUA 5KG0A 4IDKA 5HBMB 4WXOA 4IQXA 1S0OA 3HVAA 4IR9A 3LP2A 5KFAA 3CJ5A 3UDLA 1SUQB 1JLAB 4ZVHA 3IS9B 4H4OB 3DOLB 1IKXB 4KHMA 1TKTB 3GIMA 1MMLA 3PW4A 1C0TA 1S6PA 3KOAA 1XR5A 4ZPAA 2HWHA 5J2NB 3UPFA 2UUWA 3GILA 1JLCB 2HNZB 5JUMA 5DGBA 3RB6A 4ZP7A 2FJVA 2J6TA 1IKVA 3M9OB 4WYWA 3PW7A 1C1BB 1BQMA 3IN5A 4DG1A 3M8QA 2FLPA 2HNDB 2OPSB 3LAMA 3CDWA 3LALA 3LAKA 3V4IB 3JYTA 4LSNB 3V81A 3ISNC 2BRLA 2B43A 4PUOA 2J6UA 3Q8QB 2UVWA 4ZHRB 3D5MA 3QO9B 5K14B 5J1EA 3I0RB 1EETB 1I6JA 4Q8EA 1T05B 1WNEA 1VRUB 5KFUA 1QUVA 4NLYA 4FS1A 4YQWA 2WONA 2ASLA 3M9MB 3DDKA 4WE1A 2C22A 2DPJA 3MEGA 2I5JA 4Q0BB 4J9QA 1SV5A 4RNFA 1YVFA 1RT3B 3DMJA 5F8NA 2W9CB 3CO9A 4IFVB 2DPIA 3IG1B 1RDRA 2VG7A 2R8GA 3H40A 1BQNA 3DOKB 4ED2A 3MECB 3PW5A 1S1WB 2UUTA 1K1SA 3DLKA 4ICLB 3H2LA 2W9AA 3CJ2A 3I0SA 4ZVGA 4K4WA 3KLIB 3PR4A 3BSNA 4G1QA 4LSLB 4KO0B 3T5LA 4FBUA 3MF5A 4TQRA 4R8UA 5DG8A 4NRUA 1HPZA 1LWCA 4DL3A 5KFWA 1N4LA 5KFDA 3JSMA 5L1KA 3KMSA 1TV6A 2OPPB 1CSJA 1LWFA 5C25A 5CYQA 3DRPA 3QZ7A 3KHRA 1S49A 2OPRA 4O4RA 4RZRA 4ECSA 1D1UA 4NLQA 5J2QA 1T03A 4ZP8A 2XGQA 4H4MB 3NGDA 4IRDA 4HKQA 5KFLA 3MFIA 5DG9A 2XI3A 3BR9A 3C6UA 4J9NA 2RKIB 3HVTA 2B6AB 4O4GA 1REVB 3MEEB 3MR2A 3DRRA 1DLOB 3G6YA 2W8LA 4B3OB 4Y2CA 2ZE2A 1S1UA 1TKXB 5F9NA 2OPQA 1T3NA 2IM2A 3HVWA 1J5OB 4NRTA 4TQSA 3DLGB 3OL9A 1RT4B 3IGVA 4X2BA 3QIPB 4RW9A 3V6DB 5D3GB 3CJ4A 2IMWP 2YNFB 1HQEA 1TVRA 4JV0A 3C6TA 3GQCA 1JLFA 2AGOA 1S1UB 1RTDB 1MU2A 5J2MB 1FKOA 1IKWB 1RT7B 5L1JA 2ZD1B 3LP0B 3KK2B 4EBCA 1U09A 4MH8A 4XPEA 4RNMA 4NLVA 4NZ0A 2R8JA 4KKOA 1TL1A 4ECWA 1JKHB 3QGHA 3QLHB 4MKBA 4MFBA 1S4FA 5DQGA 5HP1A 3BQ2A 1JX4A 4O3RA 4J9SA 1RT6B 2C2DA 4ID5A 2W9BA 4QPXA 3KJVB 3FSIA 5C42A 5KG2A 1D0EA 2JLEA 1R0AA 5HROA 2V9WA 1W25A 2HNYA 3PVXA 4RW8A 4NLOA 4K4XA 3MR3A 2F8EX 3KLGB 5KFMA 2B5JA 5KFIA 5HLFA 4IG0B 1EP4B 5FDLA 3HHKA 1S6QA 1S9EA 1C1CB 3BSAA 1IKYA 4URSA 4WFYA 1DTTA 5KFXA 4RW8B 4TY9A 2JEIA 4NLPA 4ECQA 5KFNA 1XR7A 5KT4A 3UR0A 3RBEA 1C0UA 5J2PB 4URQU 1JLBB 5F8JA 3H59A 3BGRB 3MEDA 5KFPA 1SH3A 4KAIA 1S1VB 3E01A 5T14A 4I2PB 4R5PA 4O44B 4F4XA 3DM2A 3NBPB 3TAMA 3KLFA 2AWZA 4I7FB 5KFRA 1S0MA 1SH0A 3DLEB 5KT6A 4RW7A 5C24B 4Q8FA 1LWEA 1HMVB 3DYAA 1HNVA 2HAIA 1RTJA 3LANA 2UVRA 2WK4A 1S1TB 2BANA 2RDIA 4EYHB 2YKNB 3I5BA 2OH2A 1N48A 5F9LA 2C2EA 4RU9A 3BJYA 5EWGA 1RT1A 2AU0A 2R8HA 2ZKUA 2FJXA 1S9GB 4KFBB 3N6LA 1ZTWA 1N5YA 2R2SA 5KG7A 1NHUA 2J6SA 1HARA 4XPCA 4PQUB 4IDKB 2YNIA 1ZTTA 1QE1A 3MTKA 4MK7A 3OHBA 3LP2B 4QWAA 1S1XA 4K4YA 2ALZA 2JEGA 5KFTA 1RAJA 1KHWA 4R0EA 2GIQA 4K4TA 2XCPA 3RB4A 5KT5A 4O3PA 3PZPA 5KFZA 3PJWA 3PHEA 5KFFA 1C0TB 1S6PB 4ECTA 2IC3A 1TQLA 3V6KA 3FRZA 1RTHA 4LQ9A 4HYKA 1HYSA 4Q45A 2BQUA 5KG5A 2C2RA 1IKVB 2IA6A 3VQSA 1BQMB 4ZP6A 2GIRA 3M8QB 4DG1B 1N56A 2AGPA 3EPIA 2BQRA 4EBEA 3JYTB 3KK1A 4NLXA 2R2UA 3V81B 4I2QA 2GC8A 4ZPBA 5DLGA 5KFQA 4ECRA 4PUOB 5KFEA 4NYZA 3KLHA 4K4VA 5J1EB 3KHLA 4MK9A 5I3UA 2R2TA 4ED3A 2FVRA 3FFIA 1DTQA 2WONB 3GV8B 3H5SA 1RA7A 4WE1B 3MEGB 2I5JB 3BREA 3OL7A 1SV5B 3QYYA 5KFGA 2R2RA 4Y34A 3DMJB 2RDJA 3H4DA 4NLWA 3ITHA 3KLHB 2VG7B 2CKWA 2YNGA 1BQNB 2FLNA 3DLKB 4RW4A 3NMAA 3I0SB 2XCAA 2BR0A 1N6QA 4K4SA 1GX6A 4TLRA 4IR1A 4G1QB 3FQKA 1VRTA 5KFOA 2UVVA 4R8UB 3BSCA 4Q43A 3KNAA 1HPZB 1LWCB 2ATLA 1IM4A 4GC7A 3JSMB 2O5DA 1TV6B 3H5UA 5F8IA 1LWFB 2WOMA 4NLDA 3DRPB 5CYQB 5C25B 2OPRB 3Q8SB 4ED1A 2VA2A 1ZETA 4LQ3A 1GX5A 1Z4UA 4Y3CA 3G6VA 4O3NA 5J2QB 5DGAA 1T03B 2D3ZA 4IH6A 3C6UB 5KFSA 4YP3A 2HWIA 3HVTB 4O4GB 4ED7A 3T1AA 1QAIA 3DRRB 1KLMA 1TKZA 5EWEA 5KFJA 2ZE2B 1RYRA 4IG3A 1C2PA 3IGNA 1RTIA 2BE2A 2OPQB 3QIDA 4IKAA 5KT2A 3M8PA 4MKAA 3TVKA 2AX0A 4RW9B 4TY8A 1HQEB 1TVRB 2WCXA 2ILYA 3GIIA 2WRMA 3C6TB 1JLFB 3MR6A 1MU2B 1RTIB 3ISND 1FKOB 3NAIA 3H98A 5L9XA 3E51A 2YKMA 5KG1A 3KHGA 2ASJA 1XR6A 4WXWA 4YR0A 1HQUA 2V4QA 4PWDA 3CIZA 1S48A 1JLEA 2D41A 4KKOB 4FS2A 1TL1B 2RF2A 2YNHA 4IFYA 1SH2A 4F4ZA 2JEFA 4MFBB 4ZPDA 3PW2A 5HP1B 2FVPA 1JXLA 4ECXA 3GV5B 3G86A 4ID5B 2W9BB 4K4ZA 1LW0A 5C42B 4RNNA 4J9OA 4K4UA 1HNIA 1RT5A 1R0AB 5HROB 2YNHB 2D3UA 2HNYB 3DRSA 3IRXA 4ECYA 4ZPCA 4NLGA 1S97A 2VG6A 3CJ3A 3KK3A 4ED6A 5C5JA 2B5JB 5HLFB 2ILZA 1JLGA 1JLQA 4ED0A 3V6HA 2IAJA 4KV8A 4EO8A 5FDLB 1S6QB 1S9EB 5L1IA 1IKYB
chains in the Genus database with same CATH superfamily
2BKNA 1DTTB 2UXDF 4QCLA 3CCQS 3NCQA 5K8OA 4PG6A 3OTOF 1M5VC 1FXDA 3RAQA 4CH7A 4DUZF 2QGFB 2V6AA 1RWMB 1ZAVA 1KLNA 2AJQA 5DDRC 2RSQA 3G2XA 1RT1B 3TWZA 1JLAA 2XZ2A 3DOLA 2QMWA 2AEJA 4ZDNA 3U1MA 4AYBD 3A3NB 4Z2XA 2VA3A 2ERRA 1ICEB 1Y5IB 3P5TL 4J9KA 1N33J 2LU1A 3QJPA 2COLA 3IM8A 1N5QA 2VBXA 4Y2KA 2OEMA 4AE5A 2QN6B 4OJ3A 4CTAB 4YR3A 2CZ9A 5ETMA 1QTNB 3KLVA 4DQIA 1HR0F 3WX4A 3TNVA 5K8NA 4WTYA 2L48A 3GFYA 4ZVOB 3N6MA 2JHEA 4L74A 4EEYA 3KK2A 3CUNA 4CLYA 3E8OA 3NP5A 4W98A 3J7YI 1RBLA 1CJVA 2AV5A 2RF2B 1N0UA 4NLSA 3TARA 4C8KA 2HQGA 2YWEA 1NJYA 2FJWA 2VG5B 2NSBA 1GMVA 3OSNA 4JI8J 3NCRA 2M7SA 3EGVA 2DR5A 2R7WA 4LF5J 1WKJA 1B0PA 4LRDA 2KHDA 3H2VE 3ZC4A 4YR2A 4KQZA 3NBPA 1UWBB 4F8RA 3GB0A 3DI6B 2V9KA 5ETSA 1TKDA 5EDWA 1IBKF 2EKYA 3M2VA 2FY8A 5KAKA 4IDKA 1H3DA 3B6BA 1OM2A 1NSQA 4FPIA 2AJ1A 4CWBA 1PIEA 4ZIWA 5ETNA 4CNZA 4EK2A 1WHWA 3A8JA 2FLPA 3OTEA 4JBCA 3PKYA 3DRYA 5J1EA 1EETB 3HLUA 2CDQA 4LF8J 1YG0A 3MEGA 2KHCA 1R8HA 1CULA 1FRKA 3RYLA 5DG8A 3BBCA 2ZFHA 3TZWA 1N54B 1N34J 4EZ6A 4OHYA 4YS2A 3C6UA 3SIPB 4U9RA 2W8LA 4C11A 3P49B 3WHIA 1RT4B 4X2BA 1X4GA 2HHWA 2YVSA 3O3LA 2WSFC 3L95X 4B9SA 3NGSA 1FFWB 2MKCA 4KKOA 4NA1A 4M5NA 3QLHB 2RRBA 3GFZA 1R0AA 1OYEA 5C7PA 2VUGA 3EGZA 2FJBB 3NLCA 1S9EA 2H1YA 4WFYA 3BGRB 5BR8F 4K2XA 3KFWX 3O6QA 1OY6A 1M90T 1HI0P 4C0HA 4Q8FA 1HWIA 1S1TB 2MMYA 4EYHB 3ET6A 5EWGA 1EAYC 2BE7D 3BO4A 3LP2B 2GVDA 1FRMA 2H54B 2B9XA 3OXFA 3UCUP 3FK4A 1T95A 1N33F 3D68A 4QZVB 4F02A 4QIVA 1M5KC 1LEOA 3RAMA 5JVGQ 2WONB 2BZ2A 3HJVA 6FD1A 1NPKA 2DHGA 3ITHA 2UV8A 2M88A 2WVCA 1BQNB 5H9FJ 3W2VA 2EFPA 3NMAA 2AZ1A 4IR1A 2CWXA 2HQ3A 5CZXA 2OD6A 2FIUA 3P45B 2CQPA 5THWA 3MAHA 4HI2A 1VIOA 2D3ZA 1KDNA 1XMQF 2E1MC 3VVUA 3HPOA 5B0FA 3T6JA 1EQMA 4RJVA 1B0VA 2BJ3A 2HVZA 3KHGA 4PWDA 1RAIB 1IBCB 2XLKA 3TP2A 3UR3C 4RNNA 4PG4A 2HNYB 1TAQA 4A8XA 5HLFB 3VGSA 1BY9A 1LFWA 4JI8F 4N8OA 5F8LA 1ZM4A 4IOBA 4DR1J 1BLUA 4LF5F 3BYPA 4NXMJ 1Q86T 1WC3A 3QGIA 1PGZA 1XN9A 1FK9A 1FFGB 2CXEA 3GIJA 2CNOB 2Z8QA 4DX6A 3W5XA 2XTJP 2UUAJ 1XK8A 2BJEA 2HVEA 4R25A 3OR1B 1QY7A 1K0VA 2AD9A 4QWCA 1QTMA 1R31A 4MIAA 4FN5A 5HJYA 2OPSA 3TZYA 2RUSA 1RHUB 3UVJB 4ZHRA 2W4CA 2KFZA 4Q0BA 4FF1A 2IJFA 4LF8F 2A2DA 4X64J 2DNOA 4HHHA 1HBNB 3OLAA 3GJQB 1HWUA 1M5PC 2DD8S 4B08A 1LNQA 4A8SA 4LFCJ 2V2ZA 2XYHB 1N34F 3Q8RB 5FD1A 2E1AA 5B0EA 5HVGA 3HKWA 4P74A 1Q5VA 3U7JA 1MROB 2RB7A 2EFVA 1HBMB 2DEIA 2BE2B 1CBKA 4J9PA 3MOJB 3DCAA 4ZVPB 1RT2B 4J9LA 3KJQB 2GVZB 2EG2A 2VFVA 4LRFA 1SKSA 1QM9A 1HNIB 3C15A 4D3GA 3BQ1A 1KFSA 4EYIB 1Q1KA 3P4UB 3DLEA 3F44A 4ECZA 1T94A 5CZVA 1VGYA 2YY3A 3UO0A 1WI8A 2YKNA 1RWVB 5D0HA 3DHWC 4CO0A 1S0OA 1X0PA 1DQAA 2X1FA 5ETTA 1PCAA 1JLCB 1TMMA 1AYEA 3M9OB 1UVIA 4WYWA 1QSLA 3M8QA 4FVMA 2ZZTA 4PXEA 4NLYA 4OHXA 3HM9A 4DJBA 4OHVA 2W9CB 2DISA 1F6TA 2UUTA 1SQEA 4ZVGA 4KO0B 4J5OA 3R1HA 1N4LA 5L1KA 1D1UA 2MEWA 3M4XA 4DCJB 2MKYA 4USIA 2LQ9A 1HQ2A 1CJUB 1ZA2B 2GAGC 2N3LA 4NRTA 3IGVA 1TELA 1Q7LB 1DARA 4USJC 2DR7A 3WC2A 1HQEA 4KH1B 2XLJA 4FDFA 4XPEA 4RNMA 1Z1ZA 1VS3A 3PX4A 2HFNA 1UPMB 1A0OB 1YWXA 3LGMA 3THPA 4IG0B 3MUTP 1EP4B 1MNEA 3W2WB 4OI1A 2CADA 3KDNA 3PTWA 1C0UA 4DR1F 3H59A 3Q83A 1SH3A 1YBAA 3MM8A 2N82B 2AWZA 4C8OA 2IVFB 3LWLA 5A0YA 2J9DA 2C2EA 2V34A 2UUAF 3N6LA 2A6OA 2I0XA 3FSYA 1RAOA 3R6LB 5KFTA 1KHWA 3AD9C 1LWXA 4QR2A 4CT8A 2F9DA 2C42A 3LA0A 3VQSA 2KJVA 2AGPA 4NLXA 2ZJRQ 3W9IA 4QYZK 2HVHA 3J7ZT 1YRXA 3THTA 1RA7A 2R2RA 3QYYA 3DMJB 4X64F 1FKAF 1KTVA 3GG0A 2FLNA 5F0WA 2BR0A 3U1NA 4TLRA 2UVVA 4WFAQ 4Q43A 4GVBA 2M0GB 2ZJQQ 2EK6A 4LFCF 4YB5A 3PV8A 4NCAA 2GZOA 4UZBA 3QT6A 5KFSA 3M2UB 3HD2A 5M2PA 2K3KA 3DRXA 2XO6A 3IGNA 4F0HA 1GMWA 2ZDOA 2A3JA 3B54A 2H4YB 1VBYA 2V8DA 2YKMA 2DNNA 1HQUA 3FBEA 3A8IA 3MM7B 3LO3A 2ZBIA 2E7XA 3AD7C 4HACB 2W9BB 4J9OA 5HVFA 3D4JA 2ILZA 1S6QB 3PHTA 3J7Z5 3MWBA 3LP1A 3MM9A 4F0MA 1V5IB 2DHXA 2H51B 2AT1B 1KTQA 3E01B 3H5YA 4CP5A 4ES3A 3HHLA 1UFLA 5IWAJ 2N4DA 4IH5A 3T19A 3OHAA 1SJ4P 2BJ8A 2PMWA 1VC6A 3EPGA 2JVRA 1JJHA 4ED8A 4RUHA 5T41A 4Q44A 4UOHA 3N6NA 1B3TA 4NOHA 1X4AA 1FCAA 4ILLA 4DL2A 5JXSA 1HYSB 4OX7A 4ZJQA 2MY7A 4RO0A 3OTDA 1T11A 4BWMA 3GE9A 2R7UA 2V63A 3T5HA 4CIOA 4MAKA 2KRRA 1PKUA 3ZZTA 2IMOA 4ZVSB 3TA2A 3M2RB 3SV3A 3FRYA 5DG7A 5LOQA 2W7PA 5D78A 5E0OA 2YWKA 2Y1IA 4JV2A 3M8PB 4ER8A 3LP0A 2CJ9A 3M1VB 4Q2LA 1W2BR 2YH1A 1YK9A 2E1RA 3RUBL 1VOMA 3NKYA 1LQ9A 3ETMA 1WF0A 1BQXA 2XMUA 3ZTSA 2FZKB 3KG0A 3QT8A 2GAHC 1VQ4S 4I4BA 2RAQA 3W62A 3MMCA 3I32A 3MM5B 1RLCL 4KR0B 1SC1B 2U1AA 5HBMB 3LTOA 2KU7A 1IKXB 2K7KA 1S6PA 2K3IA 5JUMA 1FNMA 2FJVA 2HNDB 4LSNB 3ISNC 1M5OC 1QUPA 1U1QA 2OIHA 3ULHA 1AUDA 3IG1B 5HVHA 4B9TA 2IIHA 3T5LA 2ACYA 4UOCA 1LWCA 2DGWA 4FYYB 3R9LA 4A46A 3MFIA 5DG9A 2M3DA 3N4WA 5F9NA 4C0BA 5LM7E 1RKJA 3Q86A 4O0NA 5IC4B 2RNEA 1RTDB 1MU2A 5GMKa 4TVAB 1UFWA 3PRDA 3BH7B 1WOPA 2AJ0A 1FFSB 3O5TB 3ZZRA 4C8ZA 4KRWA 2XO7A 2F5GA 1XBWA 3AXMA 3N79A 1PJ7A 1IKYA 2LDYA 4OMFG 1E6YA 3R5BA 1PYSB 1VQ5S 4LF9J 4DR7J 1HKAA 1RWNB 3IBWA 5KFPA 4OI4A 1KVJA 2AYBA 2BDPA 5IWAF 2ZOFA 1HARA 4W4MA 1YI2S 1MSWD 1RCOB 2E7VA 4PG7A 4O3PA 4U8VA 4X65J 2WSEC 2E5JA 4HLBA 2DHSA 4ETZA 4CO1A 1RK8A 3DGVA 4X4VA 4I2QA 3SQGA 1MN9A 3DOMB 3TX0A 5GVQA 1U45A 3GV8B 4WE1B 1S57A 3H4DA 2JLFA 1CC7A 5CXTA 2RDDA 5B0BA 2J0WA 2HYIB 4K4SA 2CQCA 5D4LA 4G1QB 1VRTA 4GRSA 2HFOA 1TV6B 2BX6A 2OPRB 1YDLA 1T3OA 4O4GB 3DRRB 1KLMA 4IG3A 4LJMA 4TY8A 1UVLA 1R6YA 5L9XA 2ASJA 1XR6A 4YR0A 1Q8KA 3PJ9A 2HRYA 1XEZA 2VPZB 2FVPA 3AHPA 4DV2J 1XNQJ 5E2QA 4DZ6A 1HW8A 1LKZA 3OTBA 3CB4A 3IRXA 3HP6A 1S97A 2DCLA 1G7CB 3V2UC 4LF1A 3NG8A 3BYRA 4C8LA 3HDSA 3AAWB 4OYMA 2A2CA 1XWLA 3PJXA 1VRQC 2D3OR 4ZPWR 1VFJA 4L73A 5CH7B 4FKXA 1LWEB 3QGGA 1SUQA 1FKPA 1N5YB 4BWJA 5KFYA 5EN1A 3OUYB 4OFZA 2E1CA 3W9HA 1D8YA 3GWCA 1FJGJ 2AMCB 3HHNB 1RTHB 3GYGA 4RUCA 1VRUA 2J8SA 4WFBQ 5CCMA 2MQPA 3CD5A 1CJKB 4TYBA 3FFIB 1HA1A 3UN5A 5CHCB 4NMXA 5LMNJ 1RHKB 4DR4J 5A76A 1EZZB 2XYGB 2XWYA 2VV5A 2GQ2A 3OLBA 1AXQA 3NCPA 3VCDA 5L1LA 2WOMB 2EPIA 1VYAA 3C8YA 3R3TA 3DLLQ 4DV7J 2ZKTA 1K0TA 2LEPA 3CCUS 2V4RA 4QIEA 2UXBJ 1RACB 1O6XA 5KT3A 3VR1A 2QL7B 1JKHA 5B08A 2FJAB 1X31C 2V69A 1Q5YA 2HRUA 4DL6A 4OJGA 3RB3A 4WYLA 4A8QA 5CD4H 2C2MB 2U2FA 4Q5VA 1RAGB 4H54A 5F8MA 4HL9A 4M5HA 5J2PA 3AA8A 4LF9F 4DR7F 2J0QD 1YKWA 2FLLA 3D6FB 2BKOA 2FHKA 2OJ3A 2HZVA 3MTJA 2E44A 3NS5A 3ENQA 4JI2J 2VONA 1S59A 2MLYA 3RRHA 3D0IE 3VAIA 1E6VA 1A7GE 4X65F 1X7VA 4CCHA 2ZH3A 3VAJA 1IKVA 5GMDA 5HN0A 1T9TA 3V81A 2I6WA 3LW5C 1R8PA 2KL8A 5IOLA 5K14B 4DX5A 1T05B 1FJCA 2J7KA 2XZWA 4C9DA 2ZWOA 3EX7B 1TL5A 4J9QA 4DSKA 3VF0B 4ED2A 4ICLB 3MCSA 1F3FA 2PI4A 1RLDA 2VJUA 3VAGA 4FBUA 4DL3A 2OPPB 3H20A 2C2OB 3NGDA 2LVWA 4DPXA 1FVSA 3HSJA 4B9UA 2QT7A 2ZE2A 3HVWA 2DT9A 3DLGB 5E3PA 3FUYA 2AP6A 4EBCA 2V67A 4ECWA 1B7FA 2B8PA 5DQGA 2V50A 2ADBA 4ZPVR 4DV2F 2B4OA 4RW8A 1D9AA 4JI6J 2F8EX 4P6QA 5K20B 2AJ4A 2B5JA 2R7TA 5FDLA 2MGZB 1X5PA 2VBZA 3I9ZA 4P71A 4M5KA 2ABYA 2BV3A 2VC0A 2XB2D 1V6HA 2L3MA 1NK4A 4LREA 1RAFB 2B4PA 4FXVA 1R89A 1OPIA 2PFFB 1U6BA 3DYAA 2KRBA 3TZXA 2OI2A 1FX2A 1HI1A 3A4TA 2DHAA 3OHBA 4M5LA 5DM6Q 5H9FK 1H2TZ 1K44A 4ECTA 3GONA 2QL5B 3FRZA 3CMQA 2ZM6F 4BC7A 2BQUA 3MMJA 2JNJA 2R2UA 4JYAF 1VK8A 4ZPBA 2H48B 4NX9A 4F2SA 4QU6A 5I3UA 4NA2A 3IR7B 4ED3A 1DTQA 4DR2F 3BREA 3QSYB 1PYOB 1WC0A 2YNGA 1XERA 3UDVA 3OTCA 4DR4F 4OI3A 1PAEX 2WVBA 3ILLA 4DU7A 4QOTA 3JSMB 2O5DA 3JSYA 3Q8SB 1RKIA 5B09A 5LXRA 3L4BC 4LR7A 1DHMA 4IH6A 3C16B 4A8KA 1K8AT 3HVTB 4UQGA 4OZ5A 3CTRA 3QBCA 3C6TB 1EIYB 1RJJA 2HK2A 2Q6CA 2OLWA 4IQMA 1NPRA 2DGTA 5SZTA 2LECA 3K5MA 4K4ZA 5C42B 3CC4S 3DRSA 2JSXA 3BZQA 4XTTA 2DO0A 1WWHA 4UY85 4DPWA 4RW6A 3HT3A 3NEKA 3PYEA 2HAFA 3GIKA 3LP1B 3KLFB 1O5JA 4KBIA 4K7QA 1GQEA 2L9WA 1WC4A 4ZVFA 1KQFB 2YWWA 2RD5C 3HHLC 1T9UA 1P1TA 4U67Q 2JFDA 2PFDA 1TKTA 3VAFA 1HD0A 1TU0B 1S12A 2W24A 3IRWP 4YMEA 4DR6J 5DQHA 4J9VA 4CLLA 3I0RA 1YJRA 3S6EA 3MM6B 3CMES 1GFWB 3DHXA 4X4NA 2KH9A 2GO9A 1GAOA 4ECUA 5C2GA 2YKOA 5A6WA 2CQHA 3M6UA 3D0GE 1IUJA 4USTA 4KB7A 1NZAA 1OSCA 1FEEA 3NL0A 2FYXA 3SCJE 2RKIA 3C14B 4JI7J 3W1YC 4U6PA 2BEFA 3CC7S 1HBOA 2WBMA 3OSPA 4QW8A 1R43A 1VQOS 1VQKS 1IKWA 4ZITA 2V0NA 2ZOGA 2FC8A 5G0RB 3FEYB 3KJVA 1WG1A 2E9RX 4O23A 2MY8A 2C28A 4IFYB 4KYZA 2AEMA 5I4MA 4PWUA 2JX2A 1MWYA 4KHPF 3KDOA 2IPOB 3VGTA 2VG6B 3GJTB 1Y11A 4O3OA 4PCQA 2XEXA 1YTYA 3AQPA 2HHVA 1HMVA 3N9UC 2JL9A 3PYDA 2RH3A 4OYIA 5ETRA 2LA4A 4KFBA 2AYGA 2R42A 4IQXA 1FX4A 1SXLA 2CQ4A 2EVZA 3CJ5A 1ZPVA 1NKCA 2KXFA 3PW4A 1C0TA 4ZPAA 3QT7A 3N0VA 5F3ZA 1BQMA 1PBUA 4DG1A 2DRAA 2J9CA 4Z37A 2QLJB 4ZPTR 2CJAA 2C22A 3CO9A 2OMOA 2A0FB 3PW5A 1K1SA 2AJ2A 3KUGA 2QFIA 3MD3A 4LSLB 3IFEA 4MIWA 5CABA 1AFIA 2JZ5A 2ZH8A 4EZ9A 5C25A 5EX3A 3CXCR 4OYXA 1R6VA 1HNWJ 1SIZA 2KXHA 1FTRA 1X4HA 1WF2A 1UAWA 2HFVA 2MLXA 5IV4A 3WQPA 4TQSA 3GYXB 4X62J 3CD6S 4HT7A 4YY3J 1UVMA 1UZHA 1FKOA 4F3OA 3C2PA 3R2CJ 2YWFA 4NZ0A 4DSLA 3UCGA 3BQ2A 2NXUA 4ID5A 5BJRA 2KZZA 3CT9A 4N77A 3S01A 2XG8A 2V9WA 3HSGA 4KGZB 5KFMA 3NWGA 1YGYA 1DTTA 2V2QA 3Q2TC 2P9EA 1I1GA 3ZFVA 1KWMA 1S0MA 2Q6BA 3RRGA 4F7VA 2BM0A 4DR3F 1JNRB 4JI5F 4I64A 1RT1A 1G2EA 3OFEA 3EMTA 2VFUA 2KZMA 1M1HA 4LR9A 2Y1JA 4A8MP 3DLHA 2P9GA 1M0SA 4DR6F 2XM3A 5A8KB 5KG5A 1AB8A 2C3UA 1N56A 2XMTA 3NWRA 2QYCA 4RR5A 4KGXB 2H5IB 2B9EA 1P8GA 2FVRA 2D9OA 3EVMA 4CTAA 2RDJA 4X4OA 3GFHA 4YB7A 3FQKA 3KUHA 1IM4A 2BMBA 1LWFB 1MG7A 5CYQB 2Y8WA 1T03B 4CLPA 4JI7F 4WWSA 2AZ3A 1IQZA 1FRHA 2IVMA 2RMLA 3TOQA 2VFRA 3UI3A 2L9DA 2RS2A 3CDBA 3JTOA 2RF2A 3OFHA 2VL1A 4YHHJ 2IYIA 3MAAB 3AWRA 4F3MA 1U49A 1YHQS 4WP8A 3FMWA 5L1IA 4CQ1A 4ZS6A 1T0TV 2E9ZA 3I5AA 3EZUA 4X4SA 1NDKA 1UWBA 4JP8A 2QL9B 1EB0A 4DN9A 3DI6A 4R5PB 4ANDA 3TJ9A 2D7SA 3L09A 2G0JA 1RHQB 2UU9J 3TUPA 2BANB 2HZCA 2ZUAA 1PBAA 5AJ3J 2Z4PA 1UPPA 1NHVA 4DEZA 1FKPB 2NXCA 1K73T 4D3HA 4OYZA 4WFXA 2EFNA 1EETA 5FLXU 2KM8B 3KXDA 4KTQA 2AGQA 3I56S 4DR5F 3OXGA 2HHHF 2XSJB 2LMIA 4UUWA 5D6GA 4KC5A 2HS4A 5AE2A 4OZ2A 2NZ4A 2LYVA 2WVDA 2FTRA 3MOZA 3W64A 5IXUA 5SUHA 5KFCA 1RT4A 2VFSA 1HD1A 3KYLA 2P2CB 1TKZB 4X62F 4YY3F 1U1OA 5I3QA 2R3VA 3BGOP 3TZZA 3QLHA 2QIFA 1NUEA 1PC4A 4RX6A 2DK2A 4J91A 4K8RA 2B4UA 2CAJA 4I6AA 3RBDA 4ED5A 4DXLA 3VWSA 2VIHA 2ZBRA 4C8YA 2XY5A 3R27A 1GMUA 4G1PA 1DRZA 2V8PA 1O51A 5A8RB 3BGRA 3EWGA 2HBRB 5DLFA 2MKIA 1S5ZA 1PYTA 2G0IA 2KTQA 1S1TA 1TL3B 3OL8A 1I5OB 3N01A 3Q0AA 2MZJA 3H42A 1F2HA 4IR9A 3LP2A 1U8SA 4UTGA 4MTPA 1RAEB 1Y3KA 1NJWA 2V8VA 3BH6B 4P9SA 2J9EA 2J6TA 1FERA 3CDWA 1ZM3A 1FI4A 2UUCJ 1KVKA 4CYUB 4DFJA 1HNXF 2WONA 1RT3B 1BQNA 3MECB 3EGNA 1RP5A 2V2VA 2ZEJA 2VBYA 1MWZA 4ZKAA 3BEGB 3DDNA 1U47A 3KHRA 2QJ3A 2ZNZA 1NKBA 5KFLA 8AT1B 3K5OA 3NOGA 3ILIA 2FD2A 1TKXB 3VV2B 3A1YG 2IMWP 3X3UA 3WX8A 4NA3A 2C1EB 1Y5LB 2XYPB 1LK7A 2KKHA 1PJ5A 1DZ5A 2DNPA 4J9SA 4YHHF 4QPXA 1D0EA 5HMYA 2ADCA 2HNYA 3PVXA 3FJ2A 3KLGB 4ALZA 5HLFA 1FXLA 3SCIE 4RW8B 2YX4A 2MJNA 3JAMY 4I2PB 2KVIA 2IRYA 5KT6A 2UU9F 2Z2ZA 4RU9A 4F04B 3BJYA 5DM7Q 1RHMB 3JTNA 5T7LB 2E5LJ 3NNCA 1WACA 4DF8A 3SBMA 5AJ3F 3OR1A 5CAAA 4C0OC 2KYZA 1RAJA 2IRUA 5KT5A 3PZPA 1YSJA 4OYAA 4TU7A 4DV4J 2CNNB 2GO8A 3UVJA 4TNOA 3NOCA 3JYTB 1NHKL 1CEZA 2I2YA 4HHJA 4PUOB 5MAOA 1VHIA 2I9SA 4K5SA 1G1XA 2BA9A 3CF5Q 2I5JB 1XTZA 3UDEA 5BYSA 4WIIA 1F60B 3OV7A 1B7YB 1EHWA 1ZZNA 1DQ9A 5KFOA 3SDEB 2G0CA 2J76E 5F8IA 2PD1A 2BJ7A 2CQIA 1QSYA 4ZCIA 3C66A 1X4DA 1MROA 3OFGA 1X9WA 1HBMA 2BE2A 4PYAA 1TL7B 5LSRA 1RE1B 1LXJA 3J81U 3NAIA 5D8HB 1M5HA 2MKHA 4N76A 3BGUA 4MFBB 3N28A 3L7OA 2GMLA 4K4UA 1HNIA 3T6BA 1BHNA 3RR7A 4ZPCA 2PSZA 5D77A 1KC8T 4A8WA 3DLJA 1D9DA 5E5NA 3LF0A 4ZCLA 2NS1B 3R8YA 3MEDB 2FLOA 1VQLS 2HHTA 1BWVA 1RAHB 3M30B 2MXYA 4ZLJA 4FYWB 4RBUA 1UW9A 2DGUA 1UJ4A 4B9NA 1CS4B 5A8WB 1GXLA 1JLCA 5KG3A 4C8MA 2RT3A 2WVFA 3A8KA 1K9MT 2B51A 2XY6A 4NL5A 2V2KA 2UUCF 2GQQA 2W9CA 1Q81T 4B3RF 2GJ2A 4G3IA 1VQ8S 4QW9A 1HLWA 4CT9A 3HULA 3QMQA 1S6UA 4KO0A 4ZN3A 1OY9A 1K1QA 2C3MA 2CJXB 5KFKA 4OYBA 1JJ2R 2IM3A 4DLEA 4DFMA 1EKRA 2NCKL 1V9OA 3HFZB 3ICLA 3T1YJ 3EXYA 1CJUA 1P9YA 4WU3A 2PDAA 1HR0J 2D68A 1UEKA 4KGVB 3GCXP 3GP9A 2FVCA 2N7YA 4ZJLA 1Y5NB 1XMOJ 2Q79A 2HIYA 1U6ZA 1NDCA 2MJUA 4NLRA 4KE5A 3RRKA 4TLQA 3W66A 1NSAA 1H98A 1S77D 4IG0A 1EP4A 5D0RA 3W2WA 2C3OA 4Y2AA 3HI9A 3KK3B 1S0NA 3CJ0A 3BKFA 1VR6A 5HSPA 4LIRA 2WB4A 4JI1J 2VH7A 4PPZA 3CULA 3H7HB 4DX7A 1YJ7A 4ATNA 1T7PA 1ZOTA 2IBKA 4YDDB 2CPZA 3NRBA 1S79A 2B56A 3B78A 2W7AA 1HNZF 1IBKJ 2CZVC 2F65A 3FVYA 1ULRA 4H4OB 1NK0A 1LOUA 3GIMA 5LSOA 5J2NB 3TJ8A 2UUWA 3GILA 2HNZB 1C1BB 3K89A 2L9NA 5M2UA 1OQ3A 2FHOB 3Q8QB 2UVWA 3CCTA 1RHRB 5GAGU 2HHPA 4P72A 3DMJA 1U1PA 3B82A 1CG2A 3PR4A 3BSNA 2DJWA 4YN3B 4NRUA 1NU4A 4J37A 1TTHB 2DEJA 1RUSA 3M2UA 3CO0P 3G82B 1WG5A 1J5OB 5HQLA 2LQBA 2QA4G 3QIPB 1T9WA 5LXYA 4IO9Q 2XZTB 3WZ0A 4MJKA 2HVDA 3MM7A 3BDPA 2HVIA 2VD3A 4HACA 2D69A 1N32J 1NK5A 2W9BA 4ILMA 4I1TA 1AUSL 2VF3A 3D3BJ 5E33A 3BV8A 4K4XA 3CJ8A 1UVKA 2PMHA 5HJXA 2EBGA 1S6QA 3WIVA 1H72C 4C3LA 2UV8G 4ES2A 4ECQA 2ZBPA 2R7OA 2KG1A 4KAIA 1WSRA 3E01A 3QRQA 1FESA 8RUCA 5BR8J 3O2IA 4B02A 1Q8BA 3EE3A 1RABB 3TUJC 2OFGX 2ZUGA 4USHA 5F9LA 2VQFJ 4KJIA 2UXCJ 1TFWA 4LMZA 3GR0A 1NHUA 2JWNA 3D6TB 2M5YA 3LH2S 1AZSB 2DH8A 2OD4A 2G4BA 4LQ9A 4B17A 1HYSA 4Q45A 4CLWA 2HS3A 4ZP6A 5IT9Y 2DGVA 1R0CB 2O3DA 4ZJOA 3OL7A 2VOOA 4KH0B 1UFKA 3OVAA 5AXLA 9ATCB 4NASA 3AH6A 2ATLA 2HFZA 3M2RA 4NPOA 4RWWA 3DRPB 5IC6B 3TANA 2OEJA 1ZETA 3G6VA 3T1YF 1FDAA 4O0IA 1FD8A 4ZIVA 1U2CA 5KFJA 1H2VZ 4N41A 5DETA 3M8PA 2CUYA 1XMQJ 4AXIA 4PYDA 2GW8A 2BXJA 1JLFB 1XMOF 1VLYA 3M1VA 3R5JB 3E51A 1DAXA 3DGPB 2F1FA 4DDFA 3UFCX 1L3TA 1Y00A 3IBCB 3GJSB 2EW9A 4V19X 3TW0A 3OFFA 4NLGA 4FYVB 1V3ZA 4EO8A 1HBUB 3OBIA 3MUMP 5LJ5Y 3TX8A 4ZP9A 2GNKA 4LFAJ 4JI1F 2CPHA 3MM5A 1I94J 3DM2B 5EX0A 1HL6A 2J9DE 3JQKA 1C4AA 1UL3A 4F67A 5HBMA 5KOXA 1LK5A 2A18A 4I6YA 1IKXA 2R7XA 2D1CA 1QE1B 3N5BA 1Y3JA 1RTZA 4QR0A 3QZ8A 2WHOA 2FGCA 2HNDA 4LSNA 4TXSA 1N5SA 3WC0A 3KKFA 3QGPA 4NYPA 3UNGC 2WB1D 1HI8A 1WEYA 3H90A 4LIWA 2ZH5A 3IG1A 4RBVA 4GKJJ 4BBYA 3CW2C 1FNOA 2XS2A 1FWPA 2OEKA 1VQMS 5E3RA 5D4PA 2JEJA 1SL2A 1YJTA 2HLUA 1UVJA 2K2PA 4NLTA 1XJWB 3R7BB 2NREA 1RTDA 4KPYA 3BR8A 2GJIA 1IBMJ 4IRKA 3EDQB 1T9XA 1N32F 1VBKA 4RNHA 1JLEB 5HMWA 4OYOA 1RHJB 2E9TA 4WZQA 3FCWA 4WP9A 4JV5F 2X3DA 1NSPA 1JLQB 5IFMA 2IAJB 3VAHA 3K8VA 1P1LA 2BOAA 3GPAA 4PAAA 4CLTA 5I42B 3OL6A 2WAQD 5KG6A 2EI5A 4LBHA 3UD3P 2RRAA 2F4FA 2VQFF 2HHUA 2UXCF 1NM2A 3JTPA 1F9FA 1D3WA 2W7OA 3KG1A 2EWHA 3AY0A 2EFOA 2GQCA 1F1BB 1GXTA 2GGPB 2HWHA 2DITA 3RB6A 4C98A 2WZ1A 2DHHA 2DXDA 3KTQA 3LAKA 3BF4A 3RJMB 1S99A 4P75A 5DS7A 4DCPB 4DS5A 3DOMA 3SQOP 1UKUA 1QUVA 2RU3A 2OMLA 4WE1A 2CPYA 3BKUA 1S1WB 3H2LA 3AOCA 4G1QA 3QJJA 3TO8A 4DHVA 2FJEB 1R0BG 1TV6A 2K1RB 3QAEA 2OPRA 4WBFA 4LR8A 2O01C 5I3PA 4PR6A 4O4GA 2B6AB 4H4KC 4FP9A 3MR2A 3DRRA 2F4VF 1R7IA 5DDQC 5D3GB 2EFGA 4Y0FA 2ZVSA 4CLZA 1F5BA 3LOUA 2QMUB 4MKBA 3ZTRA 5LSLA 4O3RA 3FSIA 3BGFA 3FZBA 2NUUG 2VZ9A 1U1NA 2QRRA 1C1CB 1RISA 4ETXA 5ETKA 3CDAA 3PM9A 3SEOA 5IV3A 4JI0J 2P6SA 5T14A 4O44B 1L3KA 4LFAF 2C2ZB 2Z2MA 3JQJA 1I94F 5J1PA 1LWEA 2C2KB 1UETA 1GNKA 4UW2A 2E1PA 1N5YA 2J6SA 3OUYA 3E3XA 4USVA 3RB4A 2GIQA 1TQLA 4PPDA 3R5AA 5H9EK 1RTHA 1BWEA 2CJBA 3TYTA 3MEKA 2GIRA 1CJKA 2B7CB 3CCVS 1IVZA 3FFIA 1JQGA 3C46A 4AUKA 4GKJF 5HK4A 2RVJA 2Q3PA 4ILRA 3FCHA 3AJDA 1WDDA 4I67A 1HPZB 1IM6A 3LGNA 4NLDA 2WOMA 5ETPA 1GX5A 1U2FA 2FZCB 1W2IA 3SCKE 5EWEA 3T9ZA 1VQ7S 1TFYA 1ELOA 4HEA9 4RW9B 2IVYA 1KOOA 1IBMF 1U48A 3V4MA 3PFEA 2W2QP 2VU5A 1HW9A 1S48A 2BJDA 1WC5A 3DXBA 3PW2A 4ERDA 4OLPA 2H65B 3PACA 3Q23A 4N7TA 2ZH6A 2FGOA 3CDUA 2EC0A 2QA2A 4YDXA 2W4PA 3H5XA 2PEHA 1S7HA 3TEHB 2I38A 2B3TB 3EICA 1RTJB 4NEZA 1OS5A 3FDSA 1FO1A 1EQ0A 1KFDA 4QIGA 4DUYJ 1QD1A 2DIVA 2XNQA 2YNIB 4AFFA 5HMXA 2ZC3A 3HD1A 1VQ6S 3SFUA 2IC3B 3K5PA 3F73A 5K14A 1T05A 2P9CA 1F2GA 1KQSR 3CSKA 4YB6A 3RBXA 4P73A 4ICLA 2VHGA 2R7SA 2NPFA 2CJYB 1BXNA 2I1RA 4JUZA 2OPPA 2HS0A 3HFKA 1MWQA 1P27B 5AE1A 1OQ6A 1EJ7L 3ETOA 1G4CA 2CG4A 3DLGA 1U4BA 1U1LA 3Q24A 3IAS9 3TVYA 2ZHBA 3J80Y 3D7SB 4L3NA 4WKRA 1VBXA 1NDPA 2K8GA 2MSSA 3T1HJ 3RG6A 1QLNA 4WP3A 2VOPA 1TK0A 2FY1A 2ZDPA 1IJFB 2HQIA 4CNYA 3G8QA 5EUHA 4PKDB 2P6TA 2MGZA 5K8PA 3M8SA 3D54A 1JLGB 2ZH2A 3M7VA 2CJKA 3EDRB 4JI0F 1G3OA 3ZNUA 2ROGA 4CLKA 1DBDA 1XNRF 2HMIB 3MXHP 1P9QC 2NXJA 2K7JA 1LW2B 2J7WA 4AXJA 4OQJA 5KG0A 3OVSA 2XULA 3AODA 3UDLA 3BGLA 2YH0A 4ZP7A 4PXDA 3V4IB 2HLTA 2BRLA 2J6UA 4P2XA 4L6V3 2ROPA 2KT5A 3QJLA 5F8NA 2A1BA 3DOKB 4F25A 3G96A 2ZHAA 3CJ2A 2OFHX 2F8HA 1R8CA 5KFDA 3JSMA 1GK8A 1CSJA 3QZ7A 4G1IA 1XIQA 4ZP8A 3BN4A 1IR0A 3C16A 3BN7A 3HVTA 1Y0HA 3MEEB 1DLOB 2XZDB 4JI3J 1DURA 4M63A 3V6DB 3CJ4A 3C6TA 5J2MB 4J9UE 1WKLA 4KY3A 4UZCA 2R8JA 4C2MA 2Z56B 3NGUA 3PIPQ 2LXIA 3D66A 3C3LA 4HHUA 4Z7YA 5C42A 4NLOA 2OELA 2FHJD 5KFXA 2HBZB 5KFNA 2Y0BB 1S1VB 3KNGA 3KLFA 1ITPA 2GHVC 2RRNA 3QSIA 1PAUB 1U1MA 3ZZPA 4FPRA 2PEBA 4PQUB 5F41A 3ENWA 4DUYF 2VC1A 1CVJA 5LT5A 1WTBA 1X4EA 4OYPA 4ZN1A 3IXQA 2YPYA 3DDIA 2CQGA 3M6XA 2HFSA 1U02A 3MM6A 4U7UK 4EBEA 3M32B 3PX0A 4C8NA 5KFQA 2BVZA 1MMDA 5IT4A 4LUBA 3IWNC 3GIRA 3I0SB 3PEHA 3I9V9 2CQ2A 3C14A 2DRBA 1WG4A 3G8TA 5AXKA 3G71S 5LL6d 2M9KA 1QAIA 2UUBF 2DCUB 5L39A 1R27B 2XTCA 2OPQB 1D09B 5B0DA 2HKEA 4KGKA 2EG1A 2Y0SD 4ZVTB 3DFEA 2VBWA 2C2NA 2PA8D 1AFJA 3MR6A 4QYRA 2B4VA 5G0RA 3UN3A 5D15A 3T1HF 2MLZA 3IC1A 2G13A 4IFYA 4X4PA 4TU9A 2Z58B 2GMHA 3G86A 3GCWP 1SL1A 5IT0A 4DWIA 3M8YA 5A2QU 2VG6A 4ED6A 4LFBJ 5C5JA 3MI7X 4X4QA 3CJKB 4C3MA 3NXZA 2EFQA 2C2RA 3HX9A 4J9MA 2DO4A 3G6ES 4RUAA 1YLXA 2YBVA 2RJZA 4M5MA 3OVBA 3KUEA 3U02A 4WK3A 4RW7B 4CO3A 2IHR1 2XBPA 2GHWA 4OZNA 2G1DA 1L3SA 3BSOA 2CJQA 3R5DA 2WW8A 1Y7PA 4K50A 2HQCA 4ZLLA 1UA1A 1UA0A 5KFVA 4ANEA 1TAUA 3AX5A 2HHQA 2XNRA 4F4WA 2F3JA 3HZEA 2BE9B 1VDHA 4B9MA 2A10A 3ZTOA 1G6BA 4J90A 1NB2A 2HBYB 1M1GA 1RI7A 1J5EJ 2DGSA 4LSLA 4Q2MA 2XMMA 1DY3A 3E2EA 2X7IA 1N6QB 2CDRB 3FBFA 2M52A 1F3VA 1IWGA 4FZVA 1TL4A 1NRKA 5CYMA 7FD1A 4JI3F 2NYHA 5DDOC 2WBRA 3POTB 3H2UB 3IA0A 3UE2A 1GTHA 4USWA 3PX6A 1URNA 3FNNA 1L5UA 2EEYA 2Y1LB 2GS8A 1SJQA 5AXNA 3IR5B 2E5GA 2WTFA 1LW0B 3MMBB 4QIFA 1X9SA 4TYAA 2CQDA 2ZITA 1JNZB 3GSIA 1IN0A 4ELTA 1QAYA 3SI8A 4DV6J 5E41A 1P6TA 1I3OB 1F0XA 1LXNA 5A8KA 5BXIA 2CVIA 2BUNA 3R7NB 2KVQE 3RZAA 1NJXA 4Q8EA 2ZHOA 3ZZYA 4YQWA 2LKZA 3DDKA 2KI2A 1IBLF 1YJUA 4RNFA 1HFEL 2QA1A 1SJFA 2DH7A 4P10A 5D4OA 5B0AA 3KLIB 2RUGA 3BB5A 2VPYB 4G65A 1U26A 2Q43A 1SJRA 4RLEA 1LWFA 2VKZG 5CYQA 1TUGB 2V68A 1T03A 3QRRA 4H4MB 3NS7B 1X4BA 3GFXA 1REVB 4F3QA 4B3OB 2ZBCA 2IY5B 5KTQA 1KN6A 3NS6A 2YQ0A 3THVA 2W1BA 2ZD1B 2DNMA 2CZ4A 1IXKA 4NLVA 4XIUA 2XHWA 3M6VA 2MZQA 3JXOA 1RT6B 3MAAA 9RUBA 1T02A 4DSIA 1NEEA 1RWKB 3M8WA 2GMJA 4AL5A 2MQLA 3HHKA 5MLCV 4LFBF 2KFNA 2JEIA 4CH0S 2G2YA 1YITS 1NAQA 3HO1A 3EZ5A 4R5PA 2HG4A 4NZ6A 4P7TA 5E3AA 2X1GA 3U27A 2LQ5A 3R6GB 2C3PA 2BANA 2EC2A 1S9GB 4AQYJ 4Z7CA 2BBEA 3CE8A 3W7BA 2IBOA 3MTKA 1GEHA 1WELA 4LBIA 4R0EA 3QFHA 5KFZA 3PJWA 3Q8UA 3VTIA 5KFFA 3V6KA 1FJEB 2XMVA 3BBBA 3VQTA 1N88A 2IA6A 2HQDA 2ZM6J 3EPIA 2BQRA 4P2SA 1N0VC 4NMLA 1M5SA 3BKTA 4DN0A 3OT9A 1RZMA 3FZ2A 2XSJA 4JYAJ 1KP6A 1Q8IA 4Y34A 2CWKA 4NLWA 4DR2J 3S1TA 2VG7B 1J5EF 7FDRA 1URRA 3DLKB 1C4CA 3RW6A 5IT9U 4R8UB 3KNAA 2AJFE 1BC6A 1NKEA 5J2QB 1YJVA 4DLGA 2FQQB 3T1AA 1FXRA 4PXCA 1TKZA 1O0PA 1L3VA 3A3PB 4MKAA 1NK9A 2AX0A 1KBRA 1FD2A 3NMRA 1TVRB 2WCXA 3GIIA 3UD5A 3ENAA 5ETVA 1WHXA 1S7IA 4I68A 2D41A 1TL1B 3FCVA 3RR8A 5HP1B 4ZPDA 1NK8A 4QIWD 4FXDA 4E8UA 1VQSA 5HROB 3J7AN 1VMBA 1OWXA 2N7CA 2PA3A 5A8RA 4W90B 4IYQA 5LMUJ 4MMOA 1FWKA 3UDCA 2IYGA 3VZIA 4X66J 3G8SA 3GJRB 5DDPC 4WFZA 5ETQA 1MLAA 3FMBA 1WOSA 4EI2A 3TAMB 5HAOA 5AT1B 5HATA 1TL3A 1RBOB 1HHQA 1FRJA 2RIJA 4OI2A 5GADU 4DV6F 1HWLA 2IM0A 5DRKA 2JOQA 4DS4A 3DKDA 1QVFR 3CJTA 2DR6A 3VALA 3KHHA 4IRCA 2KXNB 3JSBA 3OXLA 4CYUA 4ZMMA 2R9LA 2YTCA 1AT1B 1SPBP 3KK1B 2FUG9 1RT3A 1TMJA 3MECA 4YUDA 1QJHA 4DL5A 4DSJA 3TVZA 3EZOA 3CGIA 1EX8A 1BUXA 3VGUA 2UVUA 4HT5A 4PEOA 3F56A 3K58A 1NH7A 3UQSA 3I96A 1ZM2A 1K47A 5GMEA 1TKXA 3W8PA 4KPCA 4A4JA 2RQ4A 4WPAA 4M5DB 2KJWA 3R7SB 4OZJA 4RUBA 3UWTA 4EMDA 1X0FA 4FNIA 1H7WA 1VIXA 4HDGA 5DQIA 4KHRA 4ZLNA 2ZOMA 1CPZA 3RTVA 3GLJA 2LCWA 2V8HA 3KLGA 5KFHA 1EARA 3QFWA 4J9RA 1AROP 2FVSA 4KHPJ 3R5GA 4KV8B 4MK8A 1VQYA 2OHDA 4I2PA 4M94A 4NCGB 4QQBA 3P96A 1RAAB 5GAGI 3ZZOA 4HVZA 3NGKA 3PRBA 4DPUA 4E2FB 1WJ9A 2GHPA 4B9VA 4BC9A 2AYEA 2VQEJ 5L46A 2BACA 1IR1A 5T7LA 3AOBA 4FYDA 4AQYF 3I82A 1VCTA 2MDAA 3CNQP 4ZVHA 3IS9B 2KB2A 3KOAA 1CJTA 3TR5A 2BM1A 2CPJA 4NXNJ 4OZ0A 3LALA 1H6KX 3LAMA 3JYTA 3SCLE 3I55S 4PUOA 5RUBA 2HIQA 4EWTA 3D5MA 3QO9B 1I6JA 4FS1A 3TI0A 2RQCA 2AYMA 2QLXA 2I5JA 4IFVB 1RDRA 2CPDA 3O44A 5F0UA 5IM0B 3SDEA 4Y28C 3UNYA 1APSA 1TUVA 4RZRA 3G87A 3TRGA 1NDLA 3MMAB 4J9NA 4JB8B 5L9NA 2RQKA 2V4JB 1S1UA 1T3NA 1TL7A 1VQNS 3OL9A 1SCJB 2B8QA 2YNFB 2GFFA 1RT7B 4DCOB 4ELUA 2JLGA 1QAXA 4HR2A 4MFBA 4DX8H 1JX4A 2KN4A 1VJWA 2XS5A 4XK8C 3B4DA 4L76A 3T3FA 4OZ1A 3BSAA 4ZCMA 2PO4A 5LMUF 4TY9A 4X66F 3UR0A 4URQU 1JLBB 3MEDA 3MD1A 1X4CA 3HFVA 4I7FB 1X5TA 5GAHI 5C24B 3Q8YA 3M30A 4F4AA 1NPPA 3LGHA 2A6MA 3AOAA 2R8HA 4DR3J 1KONA 3BBFA 1W7WA 2W01A 2X51A 1CS4A 3KJFB 4JI5J 5A8WA 3LPEA 1KSPA 2ALZA 2JEGA 2DGQA 2F8MA 3OR2B 2NSCA 4YFUA 4P2MA 3IAM9 2DTJA 5D0EA 3MPVA 2E66A 3M8RA 5DLGA 3P3DA 3M8ZA 4ECRA 4NE9C 5KFEA 3KLHA 2NUHA 3IO1A 3K7RA 1HWKA 1ZBTA 3ZZUA 3EXCX 1SV5B 2XS7A 3HVRA 3AXKA 4WF9Q 3TUIC 1FWLA 4HH1A 1IJEB 4NI2B 1MW7A 4USMA 3Q89A 3BO2A 4GC7A 2HGNA 2HGMA 2HSEB 4Y3CA 4O3NA 2G1HA 4YP3A 2HWIA 3HZGA 2GA7A 1NO8A 3P6YC 1RTIA 3WBZA 2Z57B 4XAKA 2Y8YA 1UZDA 3HSDA 4DMZA 2X3GA 3W5ZA 3OJUA 2DR8A 1OJ4A 2VODA 3MHYA 2V5HG 2VB6A 3IWXA 3K57A 4FS2A 2YNHA 3D0HE 4ECXA 3GV5B 2CPFA 3NGTA 4CO4A 4MKVA 2MTLA 3KK3A 1RWPB 3QNWB 4A8OA 2F40A 4CM0A 4NXMF 2JH3A 5KT7A 4LVOP 1BE4A 3US5A 4UT4A 3SMZA 2QE5A 2OSRA 3GG1A 2FVQA 1HNVB 2VQEF 1JB0C 3MDFA 2KT3A 4H4OA 3CWJA 4FXWA 2RHSB 2ZH7A 1WC6A 5J2NA 1RSCA 1UCNA 1S1XB 2HNZA 4XDCA 1RB0A 1C1BA 1YBUA 2AX1A 2QEXS 4NXNF 3CVKA 4NWBA 2ZH4A 4AL7A 1F9EB 1FVQA 1RWUA 3PIOQ 3TEGA 3CMAS 2H4WB 4ZA1A 3V5RA 4DR5J 2HHHJ 2FHJA 4DI6A 4RW4B 3AQOA 3IMQJ 1KHVA 3MGJA 4I69A 3D3CJ 5DJBA 5L38A 4F4YA 5EGYA 3G82A 1L3UA 2V8GA 4PRFA 3PO5A 1J5OA 1U0HB 4F50A 2H5EA 3QIPA 3HJFA 4XO0A 5CYMB 3RU0A 1SB6A 4OI6A 1X5SA 2OAUA 3CCWA 2MB0B 5C2CA 4CI0B 1HWJA 4QJVA 1U25A 3UCZP 3W8GA 3J80U 1RT5B 2DGOA 4OZLA 3AFGA 2V1TA 2KT2A 1GTEA 2BRKA 4M5JA 3ZZZA 1B0TA 1HHTP 1H0HB 3H0PA 3H25A 4DF4A 1OO0B 3BQ0A 4RNOA 4NYOA 5FLXY 4MKYA 2H3EB 4C6AA 2CA9A 2WW4A 1JLAB 1AZSA 2YWGA 3DOLB 2APOA 5IQQA 3S7RA 3PXGa 2VDIA 3TA1A 2H9ZA 1WORA 5CYJA 2DR9A 4DV0J 1JXVA 1HNXJ 5HANA 4C3KA 3H40A 3TAQA 2W9AA 2W25A 4LF2A 3AJ1A 4TQRA 2E7WA 1QVGR 5KFWA 3V6HA 1IQTA 3DRPA 4PQAA 1EKSA 3Q22A 4OHZA 4PG8A 3ENVA 1ZZFA 2N3OA 1Q78A 4JV0A 3K5NA 1JLFA 5JMNA 3QWUA 5L1JA 4DQRA 3DGPA 3KK2B 4DFKA 1FE0A 2ZBQA 3QGHA 1PSDA 2RILA 2HWTA 3D1HA 1CJVB 1DJ0A 4LRBA 1SJ3P 4GKKJ 1FE4A 1PJ6A 3MPWA 1A6LA 1HBUA 5B0CA 3FKBA 4G6VB 1S6OA 3PYFA 1Q82T 5F8JA 3L3CA 2E5HA 1V3RA 2KG0A 4F4XA 3DM2A 2PMZD 3NBPB 4F0KA 1T9VA 3ILOA 1NB7A 3VZHA 1N48A 6FDRA 2AU0A 4FF2A 2MQQA 3M2VB 1KEKA 2DXEA 4IDKB 1Q95G 1Y9OA 1QE1A 1JXEA 3HHEA 4N5SA 3L9ZA 4K4TA 2XCPA 3FGVA 1HIYA 1WSVA 4HYKA 1NCLA 2L08A 1JMTA 4K4VA 5J1EB 4CRJA 1ZS6A 2R2TA 2KM8C 2HURA 1D8ZA 3MEGB 1KQGB 5KFGA 2LU2A 1CULB 2CVEA 2CKWA 3WIUA 1UVNA 5JJBA 2BABA 1ZAWA 1GX6A 1O8BA 2W2PP 1N36J 2M8DB 3QPIA 3W5YA 3SSSA 2DVIA 4F2RA 2MPUA 3K0JA 3M6WA 2ACMA 3C6UB 4ED7A 4C11B 2YX1A 2MHNA 3G4SS 1D9FA 3ADAC 3KWMA 3MUVP 2WRMA 2MKJA 5L8RC 2QLBB 5K8MA 2PC6A 4Y6IA 3QATA 1JLEA 4KKOB 2EBEA 2JEFA 1SJ1A 1UP1A 4IO1A 2CNKB 4ID8A 3VAMA 1R0AB 4N47A 1SIWB 1ZM9A 2BW2A 5D4NA 1JLQA 2IAJA 1FNXH 1S9EB 3PR5B 3MURP 4A48A 2OTLS 3KLEA 2XGPA 3SYZA 5I42A 1XC9A 1SVDA 2YXLA 3ET6B 1Q16B 6AT1B 3G6XA 4EO6A 5E3CA 2HEKA 1RA6A 1YQHA 3HHDA 4WKYA 1ZH5A 2GGPA 2POKA 2GVDB 4QWDA 5GAEU 3UW1A 3H4BA 1FDBA 1VI7A 4DL4A 1RBAA 2PN6A 2CQ0A 2G9OA 4HTIA 2NXEA 4DV0F 3RB0A 1XMBA 3CCES 4RBTA 2LEAA 4NLUA 4PZVA 3ZTQA 1S1WA 3GYNA 4B3RJ 1B64A 4QWEA 3HMJG 3ITHB 2FDNA 5DZ7A 3W2VB 2K1RA 3J81Y 1SKUB 5AE3A 3GU0A 4H4KA 2B6AA 1SC4B 2CQBA 1UEUA 2DNZA 1NNDA 1WOOA 5D3GA 4FF3A 2MZRA 2Z2LA 2FZGB 4IH7A 4URGA 2QLWA 1KS2A 3CJSA 3OJSA 4PWDB 1N52B 2YWHA 3I4PA 4DSFA 5HMZA 4GKKF 5HL7Q 1C1CA 1MMNA 4DZDA 1ZAXA 2Y3YA 4J7CA 4O44A 4X4UA 2V1SA 1TR0A 2QMXA 2G2ZA 1KQKA 2DBBA 2ALYB 4IUFA 5KG4A 2XLIA 1FK9B 2LEBA 3J7YU 1QAJA 4BDPA 2CPEA 2E29A 3HVAA 5KFAA 2I8EA 2VPWB 1DFDA 2PIIA 3F41A 4N8NA 1HNZJ 4LF6J 2HRTA 3UPFA 3EVOA 4UUXA 1U7LA 2OPSB 4DV1J 1CJTB 4ZHRB 1OIAA 3PEJA 4Q0BB 4HTJA 1WD6A 1Q53A 2J8AA 3EVWA 1YIJS 4ZVUB 1HPZA 1WDTA 3Q2SC 1N36F 3KMSA 1WHVA 1YJ9S 1S49A 1UJ6A 3T9NA 1T8EA 1CQNA 1OSDA 2HW3A 4EGLA 1U1RA 3BS9A 1VQ9S 3BM7A 1VQPS 2IM2A 1NXIA 4RW9A 4X4TA 1RADB 1S1UB 1KOHA 2P8IA 2CPXA 4RKUC 2XY7A 4DFPA 5B7WA 2B9WA 5KG2A 2AKWB 3DU6A 1WI6A 3VHQA 2F63A 3C15B 2F7VA 3D6MB 2ZJPQ 5KT4A 4B3TJ 1F5AA 1IR2A 3K5LA 3QQCD 5KFRA 2RQMA 3DLEB 3JQMA 4WCEQ 4A8FA 1RTJA 3LANA 2RDIA 2YKNB 2MKSA 1VC0A 2VASA 2YNIA 4USUA 4QWAA 4K59A 2FC9A 3AB2B 4UOGA 3PHEA 4CLUA 2IC3A 1UWAA 4CDIA 3M8QB 4MYUA 4QR1A 3R5CA 4DV3J 4NYZA 2EXUA 4MK9A 3VAKA 3ISZA 1V3SA 2ASYA 3KLHB 4DQQA 3GSDA 1NLKL 1WC1A 2O1PA 3CCSS 5IQ6A 3D1QA 4RL1A 3BSCA 4DUTA 4ENOA 1ZA1B 1Q4RA 1Z4UA 5DGAA 2YKAA 1SQFA 2MSTA 4E98A 2H5JB 1OYDA 1U6FA 3I6PA 1TK8A 5KT2A 4WFNQ 4QPTA 4F36A 4F26A 1HQEB 3PG9A 3JB9k 1X9MA 1U24A 2R4FA 1RTIB 4YEAA 4OJ1A 1X5OA 4GO7X 2QSFA 1JJ4A 2YPZA 4RU2A 3B8HA 1OY8A 1XNQF 4W92B 2HK3A 2YNHB 2IFXA 3LUYA 1JLGA 1FRIA 3QRPA 1WF1A 2MQMA 1C0UB 5CD4A 3HF5A 2HMIA 3KJNB 3MM8B 1LW2A 3V6JA 1RWOB 2BYCA 3TJAA 5A0YB 2K06A 3CCZA 4AD6A 2RHQB 2XTEA 3SFGA 3IP0A 2JC0A 1FJGF 3AJ2A 3MFHA 4LF6F 3I4HX 1GT8A 1NJIT 3D1OA 4LF7J 3V4IA 4DV1F 2XQCA 4UY8T 3TUZC 2OUGA 4WK1A 4RPFA 4DBQA 2LXUA 3DOKA 1RYSA 5LMNF 3R1LA 4P52A 1TZ0A 4BCAA 4FF4A 1YZ7A 3CDEA 4ECVA 1JWWA 3OD2A 4O3QA 2HQFA 2IDEA 1FRXA 2XMJA 4ZVRB 4GVBB 3MEEA 1DLOA 2UZAA 1B4SA 3FQLA 2FPHX 4K2JA 5EWFA 2NPIA 4DV7F 2BW7A 2QLFB 5ETLA 3V6DA 2FB0A 2NLWA 2UXBF 2XMWA 5J2MA 1J2VA 4OL8A 1MN7A 3I5CA 1ZPWX 3RAXA 2OGUA 4GMKA 2YKMB 2OP5A 4FBTA 1HQUB 3SSQA 3DLBA 3DXSX 4OV1A 1OPZA 3L7PA 1QDUB 3CCRS 3FEZA 2DXFA 1KNZA 1RWWB 4JV5J 4B3TF 1S1VA 3NNAA 3MM9B 1B99A 4PXBA 1JK9B 4LF4J 1V5VA 3HHLB 4TN2A 4JI2F 4JI4J 2MKKA 2JC1A 3MZIA 2CG8A 4PQUA 3EGWB 2WSCC 1UEVA 2YQ3A 4P2FA 5U47A 2NQPA 2E5IA 2HZAA 3A3OB 5DGBA 1AW0A 5LJ3Y 2YQ1A 3PW7A 4IOAQ 1Z2ZA 1KD1T 4OLOA 2Y9HA 3CCLS 3PKMA 2JDJA 3M32A 2CYYA 1FT8A 1WNEA 4DV3F 2OSQA 2ASLA 2DPJA 3Q8VA 3DU5A 2LQJA 3F0NA 1YJWS 2DPIA 3FEXB 3AB4B 2R8GA 4NZ7A 2DY9A 2VFTA 3I0SA 5GAHU 7AT1B 2XHCA 4U8YA 5FJ4A 2HHXA 4CM2A 2O67A 4O4RA 2LDIA 2GV1A 4HKQA 1IWAA 4OX6A 2XI3A 3GR1A 5BYQA 3FBBA 2OPQA 3EYZA 2F4VJ 3PYGA 1UW4A 3RGIA 1SKWA 3CIMA 3LP0B 4MH8A 4L3KA 2VJVA 2CFXA 3HKZD 2GJFA 1KVIA 3IWLA 1FTCA 4EFAC 4JI6F 3UN2A 4MYTA 2BOPA 3B4MA 5KFIA 3CJKA 2XSFA 4X84A 1SC3B 1S0VA 3ELHA 3RBEA 4LRAA 2AHOB 2Z2YB 1S4EA 3QT5A 2DNRA 4RW7A 1SI9A 2HAIA 3MMCB 1J27A 2C3YA 3I5BA 1N5VA 2ZKUA 2R2SA 4YB1P 2JJ4D 4BLGA 3A12A 1ZTTA 2YX7A 3LWMA 3X1LB 4LRCA 4OZ3A 2EK1A 1S6PB 3GTYX 5ADZA 4LF7F 3FC9A 1FF2A 1R3NA 3ZNJ1 2GCFA 2LP4A 3BDEA 2DNKA 2ZVIA 3KHLA 2VPXB 4UQTA 3A8EA 3H5SA 2UP1A 3LQVA 5A6PA 1NSKL 1N6QA 4HDHA 2ROEA 2CPIA 1VHFA 5G4DA 1LWCB 2DKOB 3H5UA 5HO4A 4ED1A 2CRLA 4LQ3A 5IZHA 2ZWPA 3K2YA 1I51B 1LFPA 3WDOA 2IDLA 3POTA 4EU0A 1C2PA 4IKAA 5B0GA 4DPTA 2ILYA 2OO4A 1MU2B 3ISND 4KT0C 1FEHA 2AF6A 5GADI 3PRVA 4X4RA 2W4DA 5H1SV 4BHQA 2DNHA 3NGRA 1JXLA 1RXOB 4OIXA 4DOZA 1LW0A 3MMBA 4L75A 3N5FA 2MZ1A 3AT1B 1YJNS 3CJ3A 4ED0A 1IKYB 3P8BB 4WZMA 1E6YB 4I56A 4FYXB 1FA0A 2XC9A 4NCBA 1XQIA 4EBDA 3O1LA 4I6WA 4NEYA 2QA4S 5F8GA 3UD4P 4LF4F 4GC6A 1X4FA 3KLEB 3RBZA 2R8IA 4M5GA 4JI4F 2D9PA 1H73A 4U95A 3U1LA 2KDOA 1SBRA 1X60A 3NAHA 4MT1A 3MCMA 4MIBA 1FRLA 4DPOA 2KYXA 3Q8PB 3PW0A 3M9NB 2O66A 4C7QA 2AW0A 4V19J 1TUWA 4I2QB 3SQGB 4DL7A 3MR5A 1WHYA 4GVLA 1RCXB 5DO2A 3KLIA 5H9EJ 3D6HB 3CEDA 3TAPA 2BQ3A 3D28A 4K0KJ 1VRTB 4H4MA 2XMKA 3GV7B 3J81j 2LQ8A 1NH8A 1REVA 3W3SA 3ZTPA 4B3OA 4U7UD 2XTDA 3W9JA 1T9YA 4RWXA 4AL6A 1BMQB 1KLMB 2WVEA 2IJNA 2FHMA 4IG3B 4ZOSA 2DY1A 2CQ3A 2ZD1A 2J5AA 2Y1RI 4TY8B 4CO5A 3T5JA 1BD6A 4M95A 3SXLA 1S72S 2QFJA 2BJ1A 1RU1A 1R8BA 1RT6A 2RU9A 3K17A 2VG5A 2R7QA 5ITHA 3CD7A 1GXUA 3L7UA 2JFKA 2XI2A 5AXMA 3AA9A 3IRXB 2J0SD 3W65A 3MCOA 2BJ9A 5JVHQ 2B9YA 1S9FA 2DNGA 2KO1A 3DC2A 1AA1B 3QAUA 3IBFB 1XNRJ 4Y65A 4U7CA 2QV6A 1S9GA 1SC6A 3JSRA 4WXOA 1B70B 3I87A 3VGVA 1SUQB 1ROFA 1FJ7A 4S0MA 1WTFA 1UTAA 2VDHA 1FDNA 1KR4A 2PI5A 4JOUA 2DB1A 1VRUB 5KFUA 1YZ6A 4ITSA 2VICA 4KIAA 2VG7A 3DLKA 2LA6A 3HXMA 4K4WA 4R8UA 2OKQA 3BPDA 4P7VA 1HNWF 3CPWR 3D2WA 2ATCB 2R7VA 4ECSA 4NLQA 5J2QA 2XGQA 3BR9A 3SZ2A 1NK6A 4DL0C 4UF4A 1YBTA 3CCMS 2M8HA 1TVRA 2HHSA 3MR7A 3OQ2A 3R97A 3GQCA 2AGOA 3PY8A 4AT1B 1VK3A 1U09A 2QSWA 4WIQA 1WKKA 5CCLA 5HQ8A 1TL1A 1QSSA 1JKHB 5HP1A 4TKTA 1BGXT 2X1BA 2C2DA 1UJ5A 1LV5A 2JLEA 4DU8A 4Y2IA 5HROA 1VJQA 3HK2A 2RS8A 4LBPA 4I0WA 4Q7AA 2G2OA 1GH8A 2QZ8A 4URSA 4ES1A 5D0GA 5J2PB 2LFVA 1KRPA 4Y00A 2LLZA 1Q7YT 3TAMA 2DNQA 4HH0A 3I31A 1N8RT 2IJRA 3H8YA 3SSRA 2UVRA 2V94A 4R0JA 4XDDA 5FIIA 1ZTWA 5KG7A 4XPCA 3W60A 1NBEB 4MK7A 3PFOA 3G9CA 1NMEB 1E6VB 4PWWA 4C48A 4LVNP 1FDDA 1IKVB 1RU2A 5ETOA 2ZZMA 3KK1A 2DRDA 3V81B 4DSEA 2BKPA 3VVTA 4DV5J 1Q79A 4OV6A 2XCAA 2JVOA 1Q8LA 2KFYA 2M70A 3A13A 3EM1A 5KOWA 3CJRA 4HI1A 1VLOA 2B7BB 4K0KF 4CO2A 4YOEA 2N4CA 2VA2A 4B3SJ 3IR6B 1YX2A 4QYZJ 3LPYA 1YRTA 3CD0A 2HBQB 3AX2A 1U0SA 2ZE2B 4DQPA 4M5DA 2UUBJ 3TA0A 4CH1A 4PG5A 2YKQA 5KG1A 2V4QA 4DPYA 2QC3A 3AX3A 3CIZA 1U8WA 3BO3A 1SH2A 2Z30B 3JS9A 4CLFA 4EUVA 4LT6A 2Q1LA 1ZYQA 1UUJA 4OX9J 4ECYA 3HSZA 2B5JB 2EKNA 4OX8A 4KV8A 5FDLB 5F8HA 2DIUA 4FVCA 4NCGA 1U2RA 1RQ0A 3CC2S 1SL0A 2QTWA 5M2RA 1SQGA 2DH9A 1F5CA 2MQOA 2MQ8A 3DYAB 1PO6A 3MPYA 5HQMA 4DQSA 2X1AA 3IS9A 2XMAA 1Q0NA 3S8SA 3K8WA 3M05A 2AQ4A 2CIMA 4N56A 3BPSP 1JIHA 2ASDA 2J7UA 1PC5A 3QO9A 1JJCB 4ELVA 1HBNA 2PGCA 2MYFA 2NR0A 4JV1A 4IFVA 3P5BP 1VBZA 5I3UB 1H74A 1DTQB 1UMJA 3OPKA 4M1KA 5K9FA 1NZ8A 2ZH9A 2D3O1 1H7XA 5IM0A 3DNCA 4O3SA 2YNGB 2GIFA 3TQ1A 3NY0A 1H38A 3MMAA 2JRSA 1PG5B 3PDNA 1FHTA 3KMQA 1M1KT 2V4JA 1S76D 2DNLA 3NNHA 2QYGA 2IRXA 5A2QY 2QX0A 2YNFA 2W8KA 3HT0A 1TP7A 3MCNA 3ZXWA 5KFBA 1W26A 4ED4A 1RT7A 1RT2A 2M2BA 4A47A 2GVZA 4GO5X 2GX8A 4TU8A 2DGXA 1NK7A 2FJDB 2R8KA 3OW2R 5DZ6A 4B3MJ 5EHHA 2P5VA 4QWBA 5E3QA 3FSXA 4FNHA 2IM1A 1S10A 3PNIA 3DRSB 4KSEB 1YRUA 2UXDJ 1JLBA 4ZVEA 1WEZA 3CJQA 4RW6B 4OYWA 3T5KA 4LSZB 3D9BA 4I7FA 3OTOJ 4V1Ak 5C24A 4DUZJ 3RW7A 2HPUA 5HI7A 5K5MA 4WTOB 2ZNYA 2MZTA 3W63A 2NYIA 1DQ8A 2B0GA 4KGMA 1TK5A 2W2OP 2NXNA 1GMWD 4B9LA 2Q66A 4Y2MA 4KHMA 1TKTB 3JAMU 1MMLA 3OR2A 3C19A 1XR5A 3HCXA 1VISA 5J1NA 2W2MP 3IN5A 3AD8C 4QBUA 2B43A 4L72B 3I0RB 3ILJA 4M8LA 3EJMA 3M9MB 2CNLB 4DV5F 1SV5A 1NJZA 1WEXA 1YVFA 1IBLJ 3W61A 4WU2A 3SV4A 2ZC4A 3ONQA 4NI2A 3MF5A 2VKRA 4ANCA 3CCJS 3MPDA 2W2NP 2QO3A 2PE8A 4IRDA 3HHLD 4B3SF 2RKIB 3K59A 2RE1A 3G6YA 1KKHA 4Y2CA 3T41A 1Y10A 1RWXB 1HBOB 1X8DA 1IKWB 4ZLPA 4USKA 2HFUA 2IA0A 4ZCKA 3EUNA 1S4FA 4A8YA 3TQEA 4BS2A 2F9JA 3KJVB 3ZZ0A 5E7OB 1N5TA 3QWPA 5IS2A 1W25A 4M5IA 3MR3A 3PO4A 5BYRA 4OX9F 2MZSA 2R7RA 1U1KA 4WJBA 4K5RA 1F9HA 4ZVQB 4F4KA 4NLPA 1XR7A 2NZCA 4CLSA 3GZ7A 3D67A 3J7A1 1CLFA 1SH0A 2LXFA 4IOCQ 1HMVB 2DNYA 1HNVA 2OH2A 2WK4A 8ATCB 2E5LF 2XWXA 4OJHA 2FJXA 4KFBB 1H2UX 4ZK7M 2M4MA 3MPUB 1S1XA 4K4YA 4DV4F 2Z0GA 1C0TB 1A9NB 4QU7A 3GMGA 2ZH1A 1Z2LA 1Y4ZB 1BQMB 1REGX 4DG1B 4U96A 5CQGA 2GC8A 3DN9A 2L41A 2DYAA 1RGVA 1ACMB 4C97A 4RW4A 3MAQA 1CQMA 3PCOB 1CC8A 2SXLA 3O8WA 3IM9A 5C25B 2D74B 2J0XA 4CZCA 1U0HA 2CQ1A 1HHSA 4OHWA 3ZO7A 4C4WA 1RYRA 2MQNA 2PT0A 3QIDA 1WUUA 3TVKA 4UOFA 5F3TA 2AEFA 3R2DJ 2ZZNA 4FKYA 2OTJS 1FKOB 3H98A 4WXWA 4E0DA 3FBCA 2MHEA 4B3MF 4F4ZA 1R8AA 2QG9B 4ID5B 2YKPA 2AIRB 1RT5A 4PABA 1SKRA 2D3UA 5GAEI 1OMSA 3KG4A 2HGLA 4OI0A 1PILA 5CA5A 1VC5A
chains in the Genus database with same CATH topology
4RW6A 3PR5B 3MURP 3CDUA 2UXDF 1DTTB 3HT3A 2EC0A 2QA2A 4YDXA 4QCLA 4A48A 2W4PA 3CCQS 3NCQA 2OTLS 5K8OA 3KLEA 4PG6A 2XGPA 3OTOF 3GIKA 3SYZA 3H5XA 5I42A 1M5VC 2PEHA 1FXDA 3RAQA 4CH7A 1XC9A 4DUZF 1S7HA 3LP1B 3KLFB 1O5JA 4KBIA 1ZAVA 2I38A 2B3TB 1KLNA 2AJQA 1GQEA 2L9WA 5DDRC 1RTJB 1OS5A 2RSQA 1Q16B 4ZVFA 3FDSA 1FO1A 1RT1B 1KQFB 2RD5C 3HHLC 4U67Q 1P1TA 1JLAA 1KFDA 4QIGA 2XZ2A 3G6XA 2JFDA 3DOLA 4EO6A 5E3CA 1RA6A 1YQHA 1TKTA 3HHDA 4WKYA 2DIVA 2XNQA 3VAFA 1ZH5A 2YNIB 2GGPA 1HD0A 2QMWA 2POKA 4ZDNA 3U1MA 4AYBD 4QWDA 4AFFA 5HMXA 3UW1A 5GAEU 2ZC3A 1FDBA 3H4BA 1VQ6S 3SFUA 2W24A 4Z2XA 2VA3A 4C8LA 3IRWP 4YMEA 1VI7A 2IC3B 5DQHA 2ERRA 4DL4A 1Y5IB 3P5TL 3K5PA 4J9KA 2LU1A 3QJPA 2COLA 3F73A 5K14A 2PN6A 2CQ0A 3I0RA 1T05A 2G9OA 1YJRA 4HTIA 3S6EA 3MM6B 4DV0F 3RB0A 1N5QA 2VBXA 2P9CA 1XMBA 1F2GA 3CMES 4Y2KA 3DHXA 3CCES 1KQSR 4RBTA 2KH9A 4X4NA 2LEAA 4NLUA 2GO9A 3CSKA 4AE5A 1GAOA 4YB6A 1S1WA 3GYNA 4ICLA 4OJ3A 4CTAB 4YR3A 4ECUA 1B64A 2YKOA 5A6WA 4QWEA 3HMJG 2R7SA 2NPFA 2CQHA 3M6UA 3D0GE 3ITHB 2FDNA 2I1RA 4JUZA 3W2VB 1IUJA 2K1RA 2OPPA 3J81Y 4KB7A 1NZAA 1OSCA 1FEEA 2HS0A 3NL0A 3HFKA 3KLVA 5AE3A 1P27B 3SCJE 5AE1A 1OQ6A 2RKIA 4H4KA 2B6AA 4DQIA 1HR0F 2CQBA 3ETOA 3WX4A 3TNVA 5K8NA 4WTYA 2L48A 4U6PA 2CG4A 1UEUA 2DNZA 1NNDA 3GFYA 3DLGA 5D3GA 1U4BA 3CC7S 1HBOA 2WBMA 3N6MA 1U1LA 2JHEA 3OSPA 4QW8A 1R43A 1VQOS 4FF3A 3Q24A 2MZRA 3IAS9 4EEYA 3TVYA 2Z2LA 2ZHBA 1VQKS 1IKWA 3J80Y 2V0NA 2ZOGA 4IH7A 4URGA 4L3NA 2QLWA 3KK2A 4WKRA 1VBXA 3CUNA 2FC8A 2K8GA 3E8OA 3NP5A 3J7YI 2MSSA 1KS2A 3OJSA 5G0RB 4PWDB 1N52B 3FEYB 1QLNA 2VOPA 3KJVA 1TK0A 2FY1A 1WG1A 2ZDPA 2E9RX 1IJFB 4O23A 2AV5A 2MY8A 2HQIA 1N0UA 2RF2B 2YWHA 3I4PA 4NLSA 4IFYB 2C28A 3TARA 4CNYA 4DSFA 4C8KA 3G8QA 5HMZA 4GKKF 2YWEA 1NJYA 5HL7Q 5EUHA 5I4MA 4PWUA 2FJWA 2JX2A 4PKDB 2P6TA 1MWYA 4KHPF 2VG5B 2MGZA 1C1CA 1MMNA 2NSBA