4NLPA

Poliovirus polymerase - c290v loop mutant
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
461
structure length
458
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGVSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein, hydrolase
molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 139
structure length 458
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nlpA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nlpA02
1EP4B 3QZ7A 4X2BA 3QIDA 4I2PB 4OL8A 5KFKA 4K4VA 2W7PA 2ILZA 4RNHA 1TL1B 5KT3A 1N6QA 3KOAA 2FLPA 2HMIB 1C0UB 1IKXA 3HVAA 1RT4B 3DMJA 3LP2B 4IH5A 5KFSA 1RTJB 4KSEB 2YNHA 1LWFA 4QWBA 4FS2A 4I7FA 2C2EA 4WE1A 3NMAA 4NLVA 2WONB 5HP1B 4NLTA 2B5JB 3T5KA 1HMVB 2VG7A 3CJ3A 2R2SA 3KLFB 2WRMA 3CJ5A 1SUQA 5KG7A 4ECQA 3I0SB 4IOBA 5KFNA 2IM2A 3CO9A 5KFDA 2FVSA 2FVPA 3HVTA 5KG4A 5DQIA 4YR2A 3RAQA 3SFGA 3PJWA 5HBMA 4EYIB 4GC7A 2C2DA 4IKAA 3NGDA 4ECYA 4ZPDA 3IG1B 3KK3A 3CIZA 4EO8A 1Z4UA 2XWYA 2YNIA 3BQ2A 5L1LA 3RBEA 3LP0A 3IGVA 4KV8B 3V6KA 2GIRA 2RF2B 3E51A 3LALA 4IH6A 5KG0A 3T5HA 5CYQA 3QIPA 4H4MA 4MK8A 3QGIA 3OL7A 3PW4A 3Q8SB 3KHLA 3FSIA 2RDJA 4IG0A 3V81A 1RTHA 5C25A 2UUWA 1J5OA 2IBKA 4ED8A 3OL6A 1TKXA 2HAIA 4KE5A 3JSMA 2BQUA 5K14B 1VRTB 5KFIA 4Y2CA 1T94A 3CJ0A 5EWGA 3V6DB 4IRCA 3MEGA 4KHMA 4PUOB 4LQ9A 2WCXA 5KG3A 3IRXB 3QGHA 4RW9B 4U7CA 3FQKA 1IKYB 4IFVB 4DL5A 1K1QA 2IA6A 3T19A 4J9SA 3EZUA 1HPZB 3KLIA 3DI6A 2YKNB 3G6YA 4ECZA 1TL3A 2BANA 1JLBA 3ICLA 1DLOA 3FRZA 2GC8A 1HYSA 2ZE2B 3DRSA 2UVRA 2OPPA 4U6PA 4ZVEA 3C6TA 5F8HA 3ISND 4FS1A 5J2PA 3T1AA 1D0EA 5KT5A 2DPJA 2E9ZA 2CJQA 2W9CB 2AQ4A 4EYHB 4R5PA 1BQMA 5I3UB 5KFWA 1DTQB 3OL8A 2YKMA 1BQNA 4O44B 4TYAA 5KFEA 3SFUA 4Y34A 3VQSA 3PW7A 4ECUA 4PQUB 1QE1B 1S1WB 3H98A 5DQHA 4ECWA 3PW0A 2R8KA 2ASDA 3DOKA 5KFZA 4WZMA 2C28A 2HNZA 1KLMA 4O3OA 4MKAA 1HQUB 1TKZA 3DLEA 2FVQA 4Q0BB 2HNDB 2JEIA 1C1CB 3UDLA 4Q8EA 2HNYB 3KLHB 4KB7A 1RDRA 1CSJA 3G86A 1S6PB 1SH2A 3H4BA 1OS5A 1S1XB 4J9MA 4Q45A 3BSOA 4RW4B 2W9BB 1LW0A 2OPQB 5D3GA 1FKOA 4IR9A 2BQRA 1LW2B 3DRPB 5KFOA 3LP1A 1S1UB 1ZTTA 5EDWA 2YNFB 3OLBA 1REVA 3I0RB 1QUVA 3CDWA 1RT2B 1RT5A 1JLFB 3QGGA 2AGOA 3QO9B 4JV0A 2RDIA 3H2LA 4URQU 2ASJA 2ZD1A 3KLEA 4ECSA 1HNVA 4NLGA 3DOLA 4RNNA 3GIIA 3CVKA 3H5SA 3MR3A 3M9NB 2CKWA 4DL6A 1JIHA 5JUMA 3MFIA 1SH0A 3DDKA 5J2NA 4HYKA 4J9OA 4ED6A 3MF5A 1S1TB 4ZHRB 2V4RA 3KJVA 2BQ3A 1S6QB 3D5MA 4EBEA 1LWEA 5FDLA 4LSNA 4ZP8A 2I5JA 5F8NA 4IG3A 4K4TA 3JYTB 3FFIA 2J6UA 1XR6A 1NNDA 3BQ1A 5F8LA 3MFHA 1S9FA 4Q8FA 2OH2A 3BGRA 1RA6A 3C6UA 3E01A 2VA2A 1UWBA 4ICLB 4RNFA 3BSAA 5DG7A 1MU2A 4H4OA 5KFPA 4K50A 1JLEB 1YVFA 3CJ4A 1ZETA 2OPRB 1JLGB 3GIMA 3DMJB 4G1QA 2R2TA 2BE2B 3NKYA 2VG6A 2WOMB 1ZTWA 1IM4A 4F50A 4NLWA 4ED1A 3DRRB 4MK7A 2WHOA 2R8HA 4TY8B 1HNIB 3MEDB 4KO0B 2RKIA 1NHUA 5J1EA 4RUCA 1JLAA 4EEYA 1RTIB 3RB3A 1RT3A 4DG1B 3G6VA 2AGQA 3NBPA 1RYRA 2AX0A 2AWZA 1S1VB 1HQEA 4R8UA 1T03B 3FDSA 1R0AA 1LWCB 4MFBB 1RTDA 3OHBA 1TV6B 2OPSA 3MEEB 5C24B 4WYWA 2XI2A 4URGA 4WFXA 1C0TA 3KK3B 1IKWB 4NRTA 1RT6B 1WNEA 1JLQA 1VRUB 3I5CA 4RW6B 4J9RA 3KLGB 5HLFA 4NZ0A 3HKWA 1EP4A 3NAHA 2D41A 2D3UA 4I2PA 4J9NA 5KT7A 5DQGA 5EWEA 2WK4A 1TL1A 3M8QB 4K4YA 1C0UA 1RT4A 1T3NA 4K4XA 1S0NA 1HARA 3LP2A 5KFCA 1RTJA 1JX4A 2FLNA 3PZPA 1JKHB 2UVUA 3JSMB 1RAJA 4Q43A 2R8GA 2WB4A 2WONA 2B5JA 3MTKA 3KK1B 3KK2A 1HMVA 4IRKA 4ZP9A 3KLFA 4O3RA 1S9GB 4PWDB 3I0SA 4O3NA 1N5YB 1N4LA 4NCGB 3DLKB 4QWAA 4RW8B 3OSPA 3BR9A 3M8PB 1TVRB 3HVWA 5KFQA 5I42B 3IG1A 1HYSB 1MMLA 4LQ3A 5DLGA 2IAJB 4DL3A 1QAJA 4NLYA 4KBIA 4IFYB 3D28A 4KV8A 4DL4A 2RF2A 4WXOA 4R5PB 3MECB 1IKVB 4IDKB 3IS9B 3GIKA 3GILA 4J9KA 1N48A 3KLVA 5KFVA 5KFFA 2ATLA 3UR0A 4F4YA 4TN2A 4LSLB 5J2MA 3KMSA 4ID5B 4O4GB 3DOKB 3N6LA 1C1BB 5KT6A 5K14A 1VRTA 1NHVA 2I1RA 2JEGA 1N56A 5JXSA 3Q8PB 4PUOA 4EO6A 3PW2A 3DLGB 3GIJA 2XGPA 3DYAB 1S4FA 2AX1A 3IRXA 4RW9A 1IKYA 4IFVA 1T05B 4K4SA 3IGNA 4NLSA 4MIAA 2J6TA 1TP7A 3ITHA 4WFYA 2BRLA 1QAIA 4K4WA 1HPZA 2DPIA 1FK9B 1XR5A 2YKNA 5KFYA 4DEZA 3Q8QB 3UPFA 4HKQA 5F8JA 3G6XA 3LAKA 1D1UA 2O5DA 3Q8RB 2ZE2A 4KFBB 3RB6A 2VG5B 3H5UA 1TKTB 5HROB 1FKPB 4NLRA 4I2QB 2IMWP 5KFMA 2YNGB 3QYYA 3QLHB 2W9CA 4Y3CA 2V4QA 5I3UA 1EETB 3GV5B 3GV8B 3N6NA 1DTQA 4ED3A 4O44A 3KLEB 3M9OB 2QE5A 4ZVGA 3SI8A 1QE1A 1S1WA 4J9LA 3RB4A 4PQUA 4IQXA 3I5AA 1GX5A 4KKOB 1S10A 4FBUA 4MKBA 3TAMB 4TQRA 1HQUA 4B3OB 4TXSA 4Q0BA 2HNDA 3V4IB 4F4XA 1C1CA 1RA7A 1RT7A 4ZPCA 1S9EB 2HNYA 2IM0A 4NRUA 4RW7B 2HWHA 5DGBA 1S49A 1S6PA 1JLCB 3DM2B 4NLOA 4NLQA 1S1XA 1SV5B 1DTTB 5C42B 4RW4A 5KG1A 2W9BA 5CYMB 4TYBA 5KFXA 3KHRA 1RT1B 4ZPAA 2JLEA 3OL9A 2OPQA 3KHHA 4EBDA 2FJXA 1LW2A 3DRPA 5KT4A 4ZMMA 2XC9A 4WZQA 2B6AB 4O3QA 2IC3B 5J2QB 1S1UA 2AGPA 2VA3A 2JEJA 2R2UA 3V6JA 1RT2A 5KFHA 1JLFA 5KFAA 4XPEA 3QO9A 2HWIA 3FQLA 3NAIA 4G1QB 3V6HA 5KFBA 1N6QB 4ED7A 1IKXB 2IM3A 3CWJA 3PHEA 1SH3A 2XI3A 1JXLA 3LANA 5KT2A 2YNHB 1LWFB 4I7FB 3MR6A 1S97A 4WE1B 5KFJA 4YMEA 3TVKA 4QWCA 1S1TA 4TY9A 4ZHRA 2VG7B 4WFZA 1HQEB 5KFRA 1SUQB 1S6QA 4ECTA 4ECXA 2J6SA 5T14A 3M9MB 4O4RA 3HVTB 3JYTA 5HBMB 2ZKUA 4URSA 2IJNA 2GIQA 3GYNA 5KFUA 4ECVA 1W25A 2YNIB 5KG2A 3BJYA 4ICLA 2F8EX 2QV6A 1XR7A 4RZRA 3LP0B 3PR4A 1JLEA 3GQCA 2OPRA 1JLGA 5L1JA 5CYQB 3QIPB 4H4MB 2D7SA 3PJXA 4IRDA 2BE2A 1U09A 2WOMA 4DL7A 2FVRA 2HMIA 4JV1A 2ILYA 4IG0B 4ED2A 3V81B 1RTHB 5C25B 4ECRA 1J5OB 3DRRA 3KK2B 4TY8A 1TKXB 4RNMA 3OSNA 1HNIA 3MEDA 4KO0A 4J9PA 1S0OA 3H59A 3BSNA 1RTIA 5F8IA 4DG1A 5HP1A 2FLLA 2EC0A 4MK9A 1S1VA 2BRKA 3MEGB 3IN5A 1T03A 1RYSA 1S48A 5KFGA 3H40A 1LWCA 4NLDA 4MFBA 2WTFA 2JC1A 2V9WA 4M94A 1C2PA 4WYLA 1TV6A 3MEEA 5C24A 3KMQA 2XCAA 3KLIB 2D3ZA 3DI6B 1IKWA 1RT6A 4R0EA 3OLAA 1VRUA 4KHRA 1TL3B 2BANB 1JLBB 4RW6A 4TLRA 1DLOB 3KLGA 4RNOA 3DRSB 3ISNC 4FBTA 5F8MA 2OPPB 4TQSA 4NLPA 4KAIA 3C6TB 4XPCA 2UUTA 5J2PB 2XCPA 3PW5A 1I6JA 4YP3A 3M8QA 3H5XA 5F9LA 1BQMB 1KHWA 4YR3A 5J2MB 2YKMB 1BQNB 1JKHA 5KFTA 5L1KA 4G3IA 3KK1A 3T5LA 1KHVA 2AU0A 4K4ZA 3UQSA 1S9GA 2HNZB 4PWDA 1KLMB 3QZ8A 3V6DA 5EWFA 4Y2AA 1N5YA 1TKZB 5C5JA 4NCGA 3DLEB 3DLKA 3ITHB 4RUAA 4RW8A 3MR2A 4GC6A 4XO0A 3M8PA 1TVRA 5I42A 3I5BA 5F8GA 4JV2A 2IAJA 4IH7A 4WXWA 4K4UA 5KG6A 1LW0B 5D3GB 3HHKA 1FKOB 1GX6A 3RB0A 4IFYA 2FJWA 2FVCA 3LP1B 3MECA 4O3SA 2UVVA 1IKVA 3BREA 3IS9A 4ZP7A 4IDKA 3T5JA 5DG9A 3LAMA 5EUHA 1REVB 2JC0A 1S0MA 4ZPBA 3PVXA 2R8JA 5DG8A 1RT5B 2W9AA 2W8KA 3TQ1A 4LSLA 4ID5A 5DGAA 3CDEA 2E9TA 2BR0A 2ZD1B 4O4GA 3CJ2A 3CDUA 1C1BA 1HNVB 4QW8A 3DOLB 2W8LA 4QW9A 3EPIA 4J9QA 5KFLA 3RBDA 5L1IA 3DLGA 1RT7B 4YR0A 3DYAA 5J2NB 4MIBA 1T05A 4JUZA 4ZVFA 2IJFA 4IR1A 3KJVB 3GV7B 3N6MA 1FK9A 3KLHA 3PR5B 3H4DA 2R2RA 1LWEB 5FDLB 4KFBA 4LSNB 2I5JB 1TQLA 4MH8A 2VG5A 2ALZA 4ZP6A 1TKTA 4IG3B 4Q44A 5HROA 1FKPA 3FFIB 4I2QA 4QWEA 3KHGA 2YNGA 5KG5A 3QLHA 2W7OA 4ED0A 2R8IA 3RAXA 3BGRB 4DL2A 1EETA 2FJVA 2YNFA 4O3PA 2XGQA 2C2RA 3C6UB 3OHAA 3E01B 1UWBB 3I0RA 2IM1A 1MU2B 4H4OB 3BQ0A 2C22A 3NL0A 4NYZA 3KNAA 4KKOA 5F9NA 2VG6B 2JEFA 4NLUA 3TAMA 5DLFA 4B3OA 3MR5A 4F4ZA 3V4IA 1S9EA 5J1EB 3EPGA 4YQWA 2RKIB 4F4WA 1JLAB 4RW7A 2B43A 4QPXA 1RT3B 1JLCA 3BSCA 2E9RX 3DM2A 3NBPB 1SV5A 4R8UB 1DTTA 5C42A 1R0AB 5CYMA 4RU9A 1RT1A 1RTDB 4QWDA 2OPSB 4EBCA 5L9XA 4NLXA 2B6AA 2UVWA 2IC3A 5J2QA 1C0TB 2V0NA 4H54A 1JLQB 5HLFB 1K1SA 4ZVHA 4M95A 3H5YA 2ASLA
chains in the Genus database with same CATH superfamily
1WHYA 2KI2A 1NRKA 3TA0A 2AKWB 2EKYA 3TVZA 3MPDA 1RZMA 4DPTA 3M8RA 2GFFA 3K89A 2HHWA 4CO3A 2CPDA 3MR7A 2F63A 2KVQE 5LMUJ 4NEYA 1HR0F 2P6SA 3E51A 3FEXB 1HBUB 2MKKA 4ZLJA 1KQKA 1WWHA 2CQBA 3BGFA 3PX6A 2Q43A 2OD4A 3ZTRA 3BN4A 1NCLA 3NOGA 3M8WA 4MKYA 1TU0B 1UPPA 4DPOA 3L95X 3D2WA 4OZ0A 1YHQS 2DCLA 2ASDA 1KLMA 1U0SA 2VPWB 4A46A 2R42A 3HZGA 1X4CA 3ZXWA 2W25A 4QIWD 2WBRA 1QUVA 4USKA 3OR2A 4CO0A 2AGOA 4UQGA 2DY9A 4L3KA 2LU2A 1HI1A 1HBNB 2QFJA 2FGCA 2V2KA 4DLGA 2LQBA 2MQNA 3BQ1A 4DQSA 5ETRA 4PYAA 3W2VA 2O67A 3CMES 4WWSA 3BGUA 4C3KA 2ZEJA 4DN9A 1F5BA 1VQOS 2QN6B 1NHUA 4RUCA 2XEXA 4R8UA 4JI7F 4CLSA 3TI0A 1C0TA 1KOOA 2GAGC 3M2UA 2VOPA 5D0GA 2NYIA 1NZ8A 5CCMA 5DQGA 3J80U 4L3NA 4G6VB 2VIHA 2WONA 9ATCB 5CQGA 4M63A 4NCGB 3P45B 2A6OA 3ZZYA 2RS2A 3VGTA 3W5XA 4FVMA 3CJ8A 3AAWB 4WXOA 4ZIWA 3KUHA 3P96A 3A8KA 1UZDA 2ACYA 1K47A 3W62A 1Y7PA 3Q86A 5JXSA 2DEJA 1R6VA 2QTWA 1NAQA 2AX1A 3J7Z5 2J6TA 4I56A 4CLUA 3UPFA 3Q8QB 1Y9OA 2AF6A 2Z4PA 4IOAQ 4N56A 2VZ9A 4FYXB 2JFKA 3TZYA 3RZAA 3RB4A 1Y5IB 1CJTA 4GVLA 2XNRA 4QYZJ 1C1CA 2KZZA 1VR6A 1OIAA 3HFVA 3KHRA 2GQQA 1ZAWA 5CHCB 4E2FB 1TZ0A 1HD1A 4C8ZA 3NAIA 2DHXA 5KFBA 1N6QB 3AXMA 3LQVA 1KTVA 3QGPA 3QJLA 5KT2A 1JB0C 1GFWB 4C8LA 1RAFB 2QRRA 5KFRA 1RHKB 3J81j 3R1LA 3R27A 3HVTB 1D9DA 1K9MT 5AE1A 1H7XA 2XWXA 4OYPA 4LFCJ 3RBXA 4PXBA 5E0OA 2WOMA 1NMEB 2GO8A 4IG0B 1RTHB 1U02A 1D8ZA 2HZVA 3BSNA 1NKEA 2HK2A 1G7CB 4DG1A 3I55S 3FEYB 3IN5A 1S48A 2BYCA 3MEEA 1RAGB 4X4VA 3R5BA 3I9ZA 3R2DJ 1GAOA 1S12A 2ZZNA 5LMUF 4XO0A 3MCNA 5F8GA 4WXWA 1RAAB 1P8GA 2BMBA 2YH0A 3PO5A 1QSSA 1QM9A 5C7PA 2CQ3A 2RAQA 1C1BA 1YSJA 3DLGA 2ZKTA 2J9DA 4JUZA 1UEUA 2HRTA 5M2PA 1FK9A 1ZBTA 2VQEF 2CNOB 3H4DA 3ZFVA 2I5JB 5IM0B 1FKPA 3A1YG 3AJDA 1YJ7A 3R5GA 4RL1A 1UWBB 3SV3A 1MU2B 3KJQB 3W2WB 2BJ7A 1RWUA 4NLUA 1X9MA 1VISA 2ZOGA 2Y1JA 1JJ2R 2B43A 3P3DA 4A48A 4NASA 2SXLA 1Q4RA 3PDNA 1DHMA 2RMLA 4YDDB 4LRAA 4M5IA 4ZA1A 2LYVA 4X2BA 2GHVC 3LP2B 1KR4A 1NK0A 4QWBA 2NR0A 5HP1B 3CJSA 2R2SA 4GRSA 5KG7A 5THWA 2FVSA 4IKAA 1T0TV 5EN1A 4F8RA 1VQSA 2RF2B 3G6ES 3LALA 2NSBA 1XNRJ 3OL7A 2DT9A 1NDLA 5FLXU 3LW5C 2N4CA 4I6YA 1VRTB 1IKYB 4J9SA 3JAMY 3EZUA 1G2EA 3QAUA 4DSLA 3FRZA 5SUHA 3T1AA 2BACA 2E9ZA 4TYAA 2DO0A 4X84A 3M2VA 1Y4ZB 4UZCA 2HNZA 4CO5A 4DJBA 1OWXA 4MKAA 4M5NA 3H42A 4Q8EA 3MEKA 2HNYB 1KS2A 2P5VA 2VPYB 3H0PA 1SC6A 1MWYA 1SJ4P 2BQRA 4DU8A 2MXYA 3E3XA 2YNFB 2BW2A 2KT3A 3AJ2A 1J2VA 2IMOA 1EKSA 3S01A 2VPXB 2AHOB 1SPBP 4RNNA 4FDFA 4ZVSB 4I6WA 5J2NA 2DNYA 4HYKA 4X4SA 4ED6A 3SYZA 4ZHRB 1NPRA 4LRFA 1HFEL 2LEAA 2MLXA 2B4VA 1GT8A 4C0OC 4B02A 3VWSA 1DJ0A 1RU1A 1PC4A 1WDDA 4H4OA 1JLGB 3GIMA 4G1QA 4DQPA 3PKYA 4CYUA 3C66A 2DCUB 5LJ3Y 3SZ2A 5A8RB 1T03B 1Z2ZA 3MMBB 4P73A 5ADZA 1NO8A 2PC6A 4FYDA 1W26A 2WK4A 3G82B 1Y00A 3JTPA 4K4XA 1T3NA 2FLNA 3CMQA 2YX7A 3JSMB 1WKLA 2VKRA 1UFWA 2M0GB 1LQ9A 2EG2A 2HHVA 4LFCF 1NKBA 2D1CA 3U7JA 4DS5A 3KYLA 3IS9B 4J9KA 3PFOA 1S5ZA 2MPUA 5T7LA 1EJ7L 2QSWA 1B0PA 1MWQA 1NBEB 1UKUA 3GWCA 2LFVA 4K4WA 2J0WA 2Q1LA 5F8JA 3RB6A 3HZEA 3QLHB 1DTQA 4O0IA 1TK0A 2E1AA 4QIEA 4MKBA 3KFWX 4P2SA 1FTRA 1VDHA 2HNDA 3THTA 5DGBA 4LBHA 3N4WA 1UFKA 3TUIC 4RW4A 5HQMA 1DY3A 3AODA 5K20B 3DRPA 4IO9Q 2ZITA 1S1UA 3KTQA 1O8BA 2R2UA 1RT2A 1AA1B 1TTHB 4CIOA 5F3ZA 2J76E 1RE1B 5IQQA 2NCKL 3DRXA 3SBMA 1UEVA 1U24A 3T41A 3TVKA 5H9FK 4WFZA 2V8HA 3OR1A 5ETSA 2FQQB 2MQLA 2XG8A 5HBMB 2H54B 3ZZTA 5KFUA 2EG1A 2DGUA 1W25A 5KG2A 3BJYA 3AT1B 1SKSA 1F5CA 1FEEA 4YHHJ 3OSNA 3MEDA 2R4FA 3DOMB 2EVZA 2XCAA 1VRUA 5G0RA 4RNOA 4TQSA 1BQNB 2HPUA 3MZIA 1C4CA 3FMBA 1NK8A 3V6DA 1LOUA 4GC6A 2C3PA 3M8PA 4DDFA 2RRNA 4RWWA 2MQMA 2VPZB 2H9ZA 2V34A 1RUSA 1IKVA 3BREA 4RUBA 1DURA 2NXJA 4O0NA 2DR5A 1SJFA 2DITA 4WU2A 1WKJA 2FIUA 2CIMA 3MAAA 5FD1A 3BH6B 1RT7B 4QR2A 2LQJA 4YB1P 4NMXA 2PA3A 2R2RA 5B0EA 3GJSB 3C19A 4N8NA 2RH3A 4ZP6A 1TKTA 4OX6A 3D9BA 4FYYB 2R8IA 3EDQB 1Q95G 3ET6B 3OHAA 3NL0A 3MAHA 4USTA 2RNEA 3A3PB 3JSRA 3HVRA 2RKIB 1RT3B 5E3CA 3CUNA 4RJVA 1UAWA 1KVJA 4BC7A 3QZ7A 4LJMA 3MM8B 3KOAA 4M5HA 4DSKA 1LWFA 3NMAA 3QRRA 4NLVA 1X5OA 2HHQA 2CNLB 2CPFA 3SFGA 2XQCA 3NGDA 2MJUA 4LMZA 2PN6A 2OEMA 2VONA 2BJ1A 3QGIA 4Y65A 4Z2XA 5C25A 4WFAQ 3CT9A 4PUOB 4U7CA 1XJWB 3G6YA 3VTIA 1OYDA 3G2XA 1SJQA 5IC4B 4DV2J 2M52A 4C97A 1FT8A 1Q8IA 2CQ2A 2GHPA 1SKWA 2DNPA 1QE1B 2ZH3A 2OUGA 1WHWA 1VQMS 4D3GA 2JEIA 5IC6B 4WKYA 2EFQA 5U47A 3VAGA 1AZSA 2VFRA 1FRJA 1G3OA 1PBAA 3MCSA 4KHPJ 1ICEB 1GMWA 5CH7B 1L3SA 3QO9B 4P7TA 2XMKA 1JIHA 4NX9A 3P49B 2BOAA 1XTZA 3KXDA 4IG3A 1Y0HA 4CH0S 4WK1A 1ZETA 2VH7A 2OPRB 3DMJB 2F3JA 4CNYA 2LQ5A 3BPDA 1IBMJ 3G87A 1QUPA 4NA1A 2C2KB 4IO1A 3I5CA 2M9KA 3KLGB 1ZZFA 1BMQB 4J9NA 3HT3A 5IXUA 1C0UA 4USWA 2VV5A 2R8GA 4R25A 2VB6A 4ZVQB 3DLKB 3BO2A 3M30B 5AXLA 3ILJA 2I38A 4LQ3A 1YLXA 3OV7A 3PXGa 3J81U 4YHHF 1LXNA 1SC3B 2MQQA 4ED5A 4WF9Q 1RAEB 5KT6A 2XLJA 1NDKA 2XMAA 3UCGA 5F0UA 5BXIA 2AV5A 4UOFA 3DRYA 2XMJA 2HHUA 2BKNA 2DPIA 1ZA1B 4J7CA 4WTYA 5JMNA 2NXEA 2O5DA 3FBFA 4IQMA 1FRLA 2HLTA 5T41A 4Y3CA 2P9EA 4LFAJ 3SCJE 1O0PA 5BJRA 3I5AA 1B3TA 3PYDA 1UL3A 3TAMB 5C2CA 2BZ2A 4TXSA 1G6BA 4Q0BA 5KFXA 4B9MA 1WSRA 3NWGA 1LW2A 2C42A 4WZQA 2AGPA 1L3UA 2HQ3A 3TZZA 4I67A 4C11B 2HWIA 4LBIA 1F3FA 4YOEA 2DISA 5DJBA 3IAM9 3WHIA 2ROGA 4I7FB 3R9LA 3O44A 4TY9A 4CTAA 5CD4H 5EX0A 3A3OB 3N28A 2YNIB 4G65A 3PR4A 1FWKA 1LV5A 2D7SA 2FVRA 3KK2B 2MYFA 5CAAA 5CD4A 2FLLA 1S1VA 1ZPVA 3MEGB 4OZ5A 3FJ2A 1LWCA 1RLDA 2OMLA 3GG1A 4OYXA 3DI6B 1IKWA 2V2ZA 1JLBB 1DLOB 3SSSA 3UN2A 3W7BA 1M5PC 5ETMA 3C6TB 1VGYA 3F44A 3P5BP 4QR0A 4I1TA 4ES2A 1RI7A 1S9GA 3LA0A 2I8EA 5C5JA 1NHKL 4RUAA 4DN0A 4CH1A 1UP1A 1K0VA 1PBUA 4FPIA 2HHSA 4RUHA 4HI1A 1S0MA 1R8CA 3NCPA 2W8KA 2XZ2A 1IQTA 3ULHA 2ZD1B 4O4GA 4PPZA 4B9NA 4G1IA 2HYIB 5HMWA 2DYAA 1YRXA 3KLHA 2HW3A 5CZXA 1OYEA 4LSNB 4DV2F 1U8SA 5KG5A 4LIRA 1EETA 2KN4A 3C6UB 2E66A 3I0RA 4XIUA 2ZH8A 3UVJB 1YITS 2R7RA 4CLLA 4WP8A 3ENQA 4RW7A 5D6GA 4NCAA 3NBPB 4KHPF 1PILA 2ZH5A 1VC5A 4H4KA 1K73T 2CVEA 1K1SA 1VQ6S 3W3SA 2M8DB 2AP6A 3SSQA 3FUYA 3TUPA 4ZPWR 1FD8A 3AOAA 4C9DA 4I4BA 1KSPA 1HMVB 1X4BA 2IM2A 2LVWA 4YR2A 4EGLA 1E6YB 3BKUA 4A8KA 2XWYA 1CC8A 3GB0A 3FZBA 2CZ4A 4KV8B 1PJ6A 2J8SA 3T5HA 3QIPA 1GMWD 1HWIA 2RDJA 4ZN3A 2KXFA 4P7VA 1NJZA 1VQLS 2KO1A 1NK6A 5CCLA 1R27B 3E8OA 3D3CJ 4ANDA 4Y2CA 5IV3A 4LQ9A 2WCXA 4JV5J 2BJ8A 3QGHA 4OZ2A 5LM7E 2QA1A 5B0FA 5IOLA 4EI2A 3DRSA 2B9EA 3AA8A 4WFNQ 3M32A 5BYRA 5B0DA 2YKMA 3KG4A 2ZH7A 4Y34A 3D68A 1KC8T 3PYGA 5A0YB 4DFPA 4JI6J 1B7FA 3LWMA 3RAMA 3NY0A 1RDRA 3QNWB 1FKOA 4IR9A 3VV2B 3VAFA 2RB7A 5EHHA 4CM0A 4PRFA 2MLYA 1VC0A 3CVKA 2CPXA 3H5SA 2CDQA 2KZMA 2RVJA 3MF5A 1S1TB 4X4RA 1FWPA 4EBEA 1LWEA 1Q5YA 2M70A 4P74A 4K4TA 2WBMA 4USVA 5IT0A 5DG7A 2W4DA 4RWXA 1EKRA 1QTNB 2FDNA 3R1HA 3CD7A 4W92B 1U1MA 2R8HA 3CCSS 1U48A 3UD4P 1ZAVA 1TELA 4XDDA 1FDNA 1RTDA 5C24B 4USUA 1W7WA 2G1DA 1GMUA 3NAHA 2QA2A 1GK8A 3ZC4A 2B5JA 3KK1B 3HLUA 4PWDB 3OTOJ 4LR8A 2RT3A 3L4BC 4U7UK 4LREA 3TAQA 3I32A 1C4AA 3GILA 1Q16B 4F4YA 1IWGA 1NK7A 1P1LA 1CJUB 1LKZA 3BM7A 1TUVA 2B4OA 3IRXA 3M6UA 2QL7B 4K4SA 2BRLA 3LGNA 4GVBA 1XR5A 1VQNS 3LUYA 2FUG9 3ZO7A 3ZZOA 4KFBB 3FSYA 4PXEA 5HROB 2A10A 5I3UA 3N6NA 3PRDA 2YWWA 1S10A 1MWZA 2B4PA 3BDPA 1WF0A 2YQ1A 3CCUS 4NRUA 5KG1A 3CSKA 2XMTA 4X4UA 4NYOA 4Y2MA 1JLFA 2XMWA 3FC9A 3ILOA 4KC5A 2IM3A 2ROEA 3MR6A 4DSFA 4F26A 5A2QU 4X62J 5F41A 1VYAA 3T6JA 4HH1A 2IJNA 4PR6A 3QQCD 1EQMA 4AXIA 1JLEA 4FZVA 3QATA 3V81B 2VFSA 4PG5A 3BO4A 3DRRA 1NK5A 2O01C 4TY8A 1S0OA 1HNIA 4FF2A 2U1AA 1LK7A 2GVZB 4Y00A 3TW0A 1RBAA 3GCWP 2X3GA 2J7UA 4KAIA 5J2PB 2Y0BB 4YP3A 1X9SA 2CAJA 4O23A 2X7IA 4DWIA 2AU0A 3GMGA 3Q8YA 4F67A 2XY6A 3DLEB 4RW8A 2VJVA 1LXJA 2H65B 1FFSB 1OQ3A 2QSFA 4JI3J 2DO4A 1R7IA 3GE9A 4OHWA 3JAMU 4A8OA 3G4SS 2KM8C 1N88A 3HHEA 4JV5F 3BBFA 4YR0A 5ETTA 1R89A 2L3MA 3KKFA 4F2SA 2ALZA 2M7SA 1U1KA 3MOJB 2XLIA 5HL7Q 3WBZA 3H7HB 4O3PA 4HI2A 2C2RA 3S1TA 4ETXA 1GXLA 2DGVA 4JI6F 2VG6B 2IPOB 1S0VA 5DS7A 4UF4A 1JLAB 3EXYA 3BSCA 3GR0A 1R43A 1S72S 1CEZA 1RHUB 1WTBA 2V63A 1WTFA 4DR7F 2IC3A 3ZTOA 1HHQA 2F9DA 3PNIA 1H38A 1KLNA 1U45A 5KFKA 1V5VA 2JL9A 1FNOA 4CLZA 2MJNA 3M7VA 3HM9A 4WE1A 4QCLA 4CCHA 2DNNA 2FGOA 4P71A 2C2DA 2R9LA 3IG1B 2IRYA 4TU8A 1Z4UA 2GVDA 5IZHA 3MURP 2HBQB 5KG0A 1F9HA 4FXDA 4H4MA 4CQ1A 2IBKA 3O6QA 4KY3A 1PYTA 4ZJOA 2CJYB 3TA1A 4RW9B 2B7BB 2PE8A 3HX9A 3KLIA 3W9IA 2ZE2B 2CG8A 2FY1A 4QJVA 5KFEA 4KIAA 5G4DA 3OTOF 2UUAF 5KFZA 4D3HA 1NEEA 2P2CB 2GJFA 2Y0SD 3J7AN 3VAKA 1S1XB 1RWXB 5D3GA 3I4PA 4X4QA 2J0SD 1SQEA 4DR3J 5A8WA 3DDNA 1H74A 2KJVA 4ECSA 3MR3A 1I5OB 2BM0A 1TKDA 1UMJA 2QJ3A 1K8AT 5GAHI 1S6QB 1U49A 1FX2A 2IFXA 2MZQA 1CJVB 4E0DA 3BGRA 3AY0A 2VA2A 4ICLB 4RNFA 3BSAA 1ZTWA 2BE7D 2WHOA 1ACMB 2YXLA 2DBBA 3J80Y 3RW6A 1ZM9A 4CH7A 2ADBA 3OHBA 4N41A 3HJFA 1KEKA 2BJ9A 2E5JA 5B7WA 4NRTA 1RT6B 1JLQA 4RW6B 2BVZA 1FO1A 3BGOP 4X66F 1SQFA 4BCAA 3HHLC 1VQ4S 3IMQJ 3VALA 1H2TZ 4X62F 1IJEB 3I0SA 3NEKA 1B0TA 1MMLA 4W90B 4IFYB 2AYGA 1F1BB 3D1QA 4TLQA 1FRKA 5J2MA 2XBPA 1TL4A 4I64A 1ZZNA 3U1LA 1WHXA 2AJFE 3WC0A 2YKNA 1NJYA 5IS2A 1CLFA 2E29A 3JSYA 3CPWR 3LAKA 1O6XA 5A8KA 1RWKB 3PEJA 4TKTA 4P72A 4Q2LA 3KDNA 3KLEB 3M9OB 3SEOA 4S0MA 4QPTA 2DGQA 3ETOA 2H5EA 1S9EB 3QT5A 2HWHA 1S49A 4JI3F 5GAHU 2W9BA 3KHHA 4WIQA 2B6AB 3E2EA 1VQ8S 3V5RA 3TP2A 3DLJA 1Y11A 4ED7A 3D66A 1SH3A 4A8FA 2FHKA 1BWVA 5E3AA 5AXKA 2UU9J 1Z1ZA 5T14A 4XTTA 4NCBA 1P27B 3JYTA 3TJAA 3TQEA 5IWAF 5LOQA 1Q1KA 3WX4A 4ED2A 3EMTA 2KT2A 5K9FA 4KO0A 4OYOA 1RTIA 1WUUA 3US5A 2HHHJ 3EZ5A 3H40A 4DV0F 2VKZG 2E44A 3H90A 3AFGA 3GTYX 1GTHA 2F9JA 1VLYA 1J5EJ 4FBTA 2UV8G 3SDEA 3M8QA 1RGVA 3N0VA 3T5LA 1N0UA 1PO6A 3OFFA 1KLMB 1T02A 4Y2AA 2DIVA 2JLGA 2G2YA 3MM6A 1Q8KA 3RRHA 5I42A 5ETNA 2JH3A 2IAJA 4QQBA 3HHKA 2YKPA 2XTCA 2FVCA 4HHUA 3NNAA 2VFTA 2JOQA 4IDKA 2AIRB 2D9OA 5DG8A 3OR2B 3G8SA 2XYHB 2RUSA 2ACMA 5AXMA 2HFOA 3U02A 1HHTP 2AYBA 2KG0A 1T05A 2I9SA 4UQTA 1HBMA 2OD6A 3D6MB 4C8OA 2DKOB 4MH8A 3ETMA 3S8SA 4QWEA 3W2VB 4HL9A 4DUZJ 3D4JA 2KHCA 2JEFA 5DLFA 4BWJA 2DB1A 2E9RX 4AUKA 4R8UB 1NLKL 2PI4A 5CYMA 4DR3F 1RT1A 4EBCA 2UVWA 1C0TB 4H54A 4DFMA 3M2UB 1M1KT 3RRGA 2QYGA 5IT4A 2IYIA 3QIDA 4EFAC 4EMDA 4IOCQ 3PKMA 2HFNA 2MZ1A 1AFIA 3P6YC 2WONB 1RHJB 4DU7A 2VG7A 3CJ5A 4OYMA 5FLXY 3PJWA 1UVNA 1KOHA 3R3TA 5K8OA 4WK3A 4IH6A 1T95A 4MK8A 2CYYA 2NUHA 3Q23A 3W60A 3NCRA 1LK5A 2DGWA 1KQGB 3IM8A 3B4DA 1NDPA 2OPPA 5F8HA 1OSCA 4K59A 2CJQA 4EYHB 2XTJP 1Q82T 4ECWA 1TMJA 1HW8A 4QU7A 1CJTB 2W01A 1C1CB 1MG7A 4AD6A 4KYZA 1IQZA 1UETA 2IDEA 2Q6CA 1IM6A 1N54B 1NM2A 1VQKS 4L6V3 3C14B 2K1RA 5MLCV 1RQ0A 2GMLA 1OM2A 1RT5A 2F4VJ 2ASJA 3NG8A 3DOLA 4ITSA 4DV4J 3W64A 4K5SA 4R0JA 4L73A 3BGLA 3KJVA 1PAEX 3BYRA 4ZITA 3J7ZT 4B9VA 1WC5A 4PG7A 4WU3A 1NNDA 1S9FA 2DHGA 4TU9A 1H2VZ 4ELVA 4OHYA 2WOMB 1UTAA 1D9AA 3RB3A 4DG1B 3K17A 1WEZA 3MEEB 4WYWA 5HLFA 2RRBA 3C16A 4F4AA 2FY8A 4F36A 2PEBA 1SVDA 4XAKA 1B4SA 4N77A 5KT7A 3RYLA 2E7WA 1S0NA 1QSYA 2XMMA 1WELA 2UU9F 3K5NA 3W61A 1YJUA 4F0HA 4IRKA 3OUYA 1IR0A 1W2IA 1D09B 1RAIB 3BR9A 2ZM6J 3UR3C 1QAJA 1V6HA 4NPOA 5LL6d 2A6MA 4MIWA 1YTYA 1FEHA 3GIKA 3PIOQ 3K5LA 4UOGA 1HNXJ 1S79A 4TN2A 2HHHF 1C1BB 1HD0A 4NYPA 4EO6A 1A0OB 1U25A 3DLGB 4MIAA 1J5EF 1WC0A 1IR2A 1FK9B 2CQGA 4K2XA 3Q8RB 3MMAA 1FKPB 3TZXA 3A13A 1DRZA 1DFDA 4O44A 2C3UA 4LF4J 5FJ4A 1JWWA 1YX2A 4J9LA 1GX5A 1G4CA 4A8WA 4UOCA 4QIGA 2EFPA 3NS7B 4EBDA 3QFHA 4Q7AA 1RJJA 3NLCA 2C3OA 1SXLA 2DHSA 2OSRA 3L7UA 4OYAA 3THPA 1Q79A 3L3CA 1YWXA 1CJKA 1A7GE 2EEYA 2C2ZB 1WC4A 3K5OA 1REGX 3JSBA 2AYEA 2KFYA 2E1PA 4DCPB 2Z58B 4J90A 4DOZA 4HR2A 1XBWA 4A47A 2QV6A 4UUXA 3KWMA 5L1JA 1Q53A 3CTRA 2ZDPA 2XS7A 1L3KA 3F41A 3JB9k 4AL7A 3K5PA 5DETA 5HP1A 3PM9A 3FVYA 2GAHC 5H9FJ 1XMOJ 4QIVA 4R0EA 2H3EB 2ZUAA 1QAYA 2ZHBA 4B3MJ 3Q2TC 1BE4A 3M2VB 2HNZB 1S59A 1T9VA 3I87A 3C15B 3SCLE 1UVKA 4ZJQA 1LNQA 3MECA 3T5JA 4ZP7A 5DG9A 3LAMA 4DV1J 4ZPBA 2UV8A 2R7OA 2BR0A 3CJ2A 3R6GB 4EZ9A 1U2CA 3CDUA 1RISA 3W8GA 3EPIA 4ZN1A 2QEXS 5J2NB 5HAOA 5JVGQ 2QLXA 1HI0P 3JTNA 3RAXA 2COLA 5A6WA 1ZH5A 2YNFA 1DARA 4H4OB 4L75A 4JYAJ 3BQ0A 4JI2J 4CYUB 2CQ0A 3RRKA 3EPGA 3NNCA 2F4VF 1LFWA 1WG4A 2DR8A 2MSTA 1B7YB 4DV4F 2P9CA 2YNHA 2I0XA 2JVOA 2KXNB 5KFNA 2OIHA 2OFHX 4ECYA 3GONA 4RBVA 2M88A 1UW9A 4GKJJ 2JWNA 1BWEA 3IGVA 2J7KA 4RR5A 5CYQA 2F40A 3CCMS 4ZS6A 2XHWA 5T7LB 2AT1B 3JSMA 4OIXA 3R7NB 2R7TA 2QO3A 3KJFB 3GCXP 4FF4A 3FCHA 4MAKA 4F3OA 3EWGA 3QT8A 4ZVEA 2R7XA 3GYGA 1DTQB 4A8MP 3IAS9 3MCMA 4FF3A 3SIPB 5CXTA 1TKZA 2ZM6F 2HNDB 4JI1F 1DAXA 4V19J 3MM9A 3MCOA 2K7KA 2PT0A 4RW4B 1VC6A 3DRPB 3TEHB 1HNXF 1S1UB 1ZTTA 5EDWA 1RT2B 3KNGA 3QGGA 4JV0A 3TZWA 3O3LA 3DXSX 2PI5A 2HHXA 1S6UA 3C2PA 1SH0A 2KHDA 4F7VA 4ID8A 2M2BA 1P1TA 3OR1B 1R31A 3BKFA 3AHPA 5FDLA 4ZIVA 2CPJA 2UXDJ 3DHXA 3CJKA 2OLWA 2RU9A 1KTQA 1RTZA 1N5QA 3QJJA 2QMXA 2KRBA 4ZLNA 2JNJA 5D15A 5DM6Q 3MEDB 1H7WA 3FDSA 3PIPQ 3NGUA 1FF2A 4WPAA 1VRUB 4ZVOB 5G0RB 3HD2A 3K7RA 4M8LA 1HW9A 2CQHA 1BLUA 2FHOB 4JB8B 2WB4A 3MTKA 3ZZRA 3KLFA 3J81Y 2JZ5A 2M8HA 3CO0P 3M8PB 5KFQA 1HYSB 4OI2A 4KQZA 1M5SA 1G1XA 4DV6F 3T1YJ 1IKVB 2GQ2A 4ZCLA 1YZ7A 2HEKA 5E3RA 2LDYA 1OY6A 2Y1LB 4F04B 1NHVA 4RBTA 4WTOB 1IBCB 3MAAB 1XMOF 3CCTA 5EGYA 1QAIA 4B3MF 1FKAF 5J1PA 1TKTB 4BDPA 2W9CA 2DEIA 2CUYA 3EGNA 3VR1A 4F4KA 2K8GA 1RABB 3CCQS 1V3RA 4DSJA 4I69A 2CPIA 2PO4A 3ZZZA 1RT7A 5D4OA 2WW4A 3UE2A 3GFZA 4NLQA 3HT0A 4OI0A 1KNZA 2RS8A 2DNGA 2G0JA 1YK9A 2W2OP 3R5JB 1YJNS 1CS4A 3SSRA 4F0KA 1H0HB 1UVJA 1JXLA 1LWFB 2HQIA 4N5SA 5HMZA 1SC1B 1BGXT 4FKYA 4FYVB 2ZBCA 2K7JA 2IVFB 1IJFB 4JYAF 4JI2F 2Y8YA 1M5OC 4OZLA 2OEJA 2PDAA 5C25B 2CA9A 3M05A 2L41A 2JC1A 4M94A 1TV6A 2NZCA 2KFZA 2HVDA 2N3LA 4P2FA 4OLOA 4XPCA 3ZZUA 3QT7A 4CT9A 1KHWA 1JKHA 4QU6A 5L1KA 2RHQB 1H73A 3A8JA 3I31A 1TVRA 2VODA 4GKJF 3GZ7A 4EUVA 1SQGA 2VQEJ 3PACA 5LJ5Y 5JJBA 1FXRA 3IC1A 4B9LA 4B9TA 1WDTA 2W2MP 1VOMA 2HSEB 4E8UA 4LSLA 3QWPA 2VQFF 1F2GA 4DR1J 4RO0A 1RACB 2WW8A 4JI5J 4C0BA 1BY9A 3IWNC 4C8KA 2O3DA 2HQDA 4IG3B 3BBBA 1GEHA 1D8YA 1WI6A 1X0PA 4NYZA 1NB2A 2XMUA 1X7VA 3MI7X 2DNRA 3EGVA 4PQAA 1JLCA 2BJEA 5LT5A 1SV5A 2FHMA 3IWLA 1Z2LA 1R0CB 2RSQA 1FJEB 2C3MA 2O66A 1NJWA 1F60B 3VCDA 2FLPA 1C0UB 3DMJA 1RHMB 3GIRA 2UXDF 4Y0FA 3F56A 1SKRA 1T9XA 4GC7A 5H1SV 4PCQA 2V6AA 4DZ6A 4DSEA 5L1LA 4ZPTR 3LP0A 2IRXA 2FB0A 4B3RJ 3PW4A 3PG9A 1J5OA 3OL6A 3EJMA 2BQUA 4ELUA 1XMBA 4USHA 4IRCA 3T19A 1TL3A 2J9DE 1MN7A 1D0EA 2DPJA 2MGZA 1SJRA 3N79A 2D69A 4HH0A 1RKJA 4DX8H 2GQCA 3H98A 2C28A 2DNOA 3GG0A 4Q0BB 3DGVA 3T1YF 1RAOA 3MUVP 4Q45A 3BSOA 2N82B 1LW2B 4ED4A 4CLPA 4YY3J 2MZSA 3OLBA 3H2UB 3AOBA 3NMRA 5HMXA 4ZCIA 4A8QA 3B4MA 3CC7S 1GXUA 3GJQB 3AD7C 2OEKA 1U1NA 2DGSA 2BQ3A 1L5UA 4CTAB 3R5AA 2Q6BA 3FFIA 2EI5A 4P2XA 3TEGA 5ITHA 1OQ6A 3C46A 3LF0A 5ETOA 3MXHP 2E5GA 4BBYA 5DO2A 4MK7A 1B99A 2AX0A 1S1VB 1LWCB 3BS9A 4WFXA 1IKWB 2BV3A 1UZHA 4PG4A 3HKWA 4B9UA 4NL5A 1WHVA 5EWEA 4CM2A 4B3SJ 8RUCA 1KWMA 1RTJA 1VRQC 4M5GA 1RAJA 4N8OA 2J5AA 3KK2A 1S9GB 1VBKA 4QWAA 1FD2A 4PXDA 2DH8A 3HVWA 5DLGA 1SBRA 2V2VA 1TMMA 3TX0A 3CCES 5AT1B 4R5PB 2GGPA 4FXWA 1SC4B 5IV4A 4O4GB 3N6LA 4ZVUB 3RBZA 4WCEQ 5K14A 2GA7A 2JEGA 2C2MB 1IVZA 2M5YA 2PFDA 2MKJA 3MM5A 5IFMA 2XB2D 5HO4A 5LSOA 3DN9A 5JVHQ 3QYYA 2NXNA 1EETB 2H51B 4GO5X 1YZ6A 2WVDA 2QL5B 1RA7A 4RW7B 1SIWB 1UJ5A 2HGNA 2VBWA 3AA9A 2FZCB 5A2QY 2QLJB 4DR1F 3ZTSA 3DHWC 4JI5F 4MT1A 3CWJA 3UVJA 2MY7A 3EM1A 3B78A 2ZKUA 1JK9B 2V68A 3QIPB 3AX3A 3K59A 2KT5A 4RNMA 2DXDA 1RYSA 2GV1A 5D4PA 3KUEA 2V9WA 2ZH2A 4RX6A 5ETVA 3DRSB 2XCPA 2UUTA 3M32B 3G9CA 4DBQA 2RDDA 2YKMB 3AJ1A 3R5DA 4DV7J 1URRA 5HVGA 1GTEA 1N5YA 2HZAA 1XK8A 1FKOB 5FIIA 4B3RF 2VUGA 2BUNA 1ROFA 1Q7LB 1ZPWX 2VFVA 2UVVA 2EC2A 5EUHA 2KB2A 4CDIA 2E1CA 2KYZA 5DGAA 3K8WA 3DKDA 2JX2A 1MN9A 3EGWB 3DYAA 5GVQA 3AQOA 3BF4A 3M8YA 2YKAA 2OHDA 3EICA 2Z2LA 1LWEB 4UOHA 4Q44A 1UCNA 1AFJA 5F0WA 1FDAA 5K8PA 1FVQA 1NB7A 2RUGA 4B3OA 2VJUA 2ZJPQ 2ZOFA 4YQWA 3G8TA 4YY3F 5C42A 3EVMA 3CF5Q 1SJ1A 1RTDB 2DRAA 2JDJA 2KRRA 3TAPA 4RNHA 2HRYA 3M1VA 2HS4A 4L74A 2IVMA 3W5ZA 4NLTA 2B5JB 1H72C 2FJBB 1XMQJ 2CFXA 3MMCA 2CWKA 4EO8A 3OJSA 1QVGR 4OYBA 2ZZMA 1TKXA 2R3VA 3Q24A 4DR2J 4DFKA 4FNHA 5EWGA 2W24A 1BUXA 3IRXB 3VVTA 4GVBB 1CPZA 1K44A 4DZDA 4U6PA 4B3SF 1R6YA 1YIJS 1A6LA 5I3UB 1M5HA 1OPZA 4P75A 4KPYA 3PEHA 3VAHA 3UCUP 3DLHA 4O3OA 4CLFA 3QWUA 1Q81T 2V1SA 3VZIA 3H4BA 3K0JA 4IYQA 1PC5A 1JLFB 5D4NA 2MLZA 2FYXA 3PFEA 2Q3PA 3OT9A 5ETQA 3G8QA 5IQ6A 5F8NA 4ELTA 1FE4A 3JQKA 3L9ZA 2LQ8A 5F8LA 1RB0A 3HSJA 3E01A 5E3PA 1JLEB 2R2TA 2AJQA 1IM4A 3DRRB 1XEZA 4TY8B 1HNIB 5J1EA 1SKUB 3G6VA 2NYHA 3HO1A 1TR0A 2MZJA 4I2PA 2DTJA 4MYUA 4PWUA 1RT4A 5BYSA 2XMVA 4KGKA 4JI4J 2UVUA 2AYMA 1X4EA 4YDXA 1RAHB 3CJTA 4O3RA 7FDRA 1QY7A 3OFHA 4P52A 2HWTA 4RW8B 5IT9U 1KD1T 3DCAA 1NK4A 2HFZA 4DL3A 2FPHX 3D28A 3DOKB 4FN5A 1FXDA 3DGPA 3AQPA 2UXCJ 1S4FA 1WKKA 1HPZA 4PPDA 4ZDNA 1D1UA 3WX8A 2WSEC 1RLCL 5DM7Q 1YJWS 4DV7F 4DV5F 3S6EA 2LEBA 1S1WA 3TUZC 2BXJA 3UD5A 4C6AA 3RTVA 3R7BB 2AEFA 1MLAA 5L9NA 4PXCA 1UVMA 1RADB 4KRWA 2QA4G 2IC3B 2MTLA 5KFHA 1EARA 1K0TA 4N47A 2PFFB 3LWLA 2JVRA 4LRBA 2H4YB 4LF9J 3IA0A 2KTQA 4WE1B 4WP3A 4M5DA 1JJCB 4QWCA 3AOCA 2IY5B 2EKNA 2B51A 4ECTA 1RHQB 3UDCA 2N4DA 3PTWA 3TR5A 2GVDB 4HTJA 2KM8B 4H4MB 2YPZA 4JV1A 4ERDA 2V5HG 4EWTA 2EC0A 1R8PA 2DRDA 3BDEA 2W4PA 3P8BB 3KMQA 3KLIB 5KFMA 2G2OA 3IP0A 2F65A 4KHRA 3GP9A 1FTCA 1TUGB 3G71S 4UT4A 4GKKJ 4FVCA 4CO4A 1XMQF 2YKQA 4K4ZA 1F3VA 2QGFB 3AD9C 1WOSA 3ZNJ1 3M6VA 1KDNA 5D3GB 1GX6A 1S4EA 4ATNA 3WIVA 4DR2F 3CC4S 5A8WB 4CI0B 4QW9A 4DR4J 1YBUA 2C2OB 2RE1A 3HI9A 3PYEA 4DPWA 4I2QA 2W7OA 4ED0A 4LF6J 1JJ4A 5A6PA 3BGRB 2X1GA 3IBWA 5CABA 3OJUA 4KKOA 3JS9A 4QIFA 2ZNYA 2V8PA 5B0GA 1JQGA 1FDBA 1WSVA 2W2QP 5HN0A 4RU9A 2GJ2A 3W9HA 1TFWA 1JLQB 3AD8C 3CCLS 4ILLA 1FJCA 4X65J 4OL8A 2ZBPA 2ILZA 1N36J 2UUCJ 3R97A 1PJ7A 3OVAA 3R5CA 4LF1A 3KG1A 1DQAA 3I0SB 2J8AA 4OZ1A 3QMQA 2FVPA 5KG4A 1RWVB 1V3ZA 2HQCA 1X5PA 2X1AA 4DLEA 3RBEA 3V6KA 2V50A 3MHYA 3ZNUA 2I6WA 1DQ8A 3JTOA 3FSIA 2UUWA 3EYZA 5D0HA 2HAIA 3IFEA 2MSSA 2ZBRA 1EZZB 1CQNA 2YKNB 8ATCB 2BANA 3BN7A 1RWOB 1N5TA 2KDOA 2K2PA 2UVRA 4JI8J 5A8KB 1VI7A 4JI4F 5KT5A 2AQ4A 2CDRB 4OJHA 4ECUA 1CULA 4M5MA 3TANA 2H4WB 3HHDA 2KU7A 5GAGI 1XNQJ 1BHNA 1RBLA 4BLGA 2W9BB 1M1GA 5ETLA 3HHLB 3LH2S 1P9YA 1YBAA 2G1HA 3CEDA 3KLEA 2UXCF 6FD1A 1HNVA 3GIIA 1NK9A 3BBCA 3RJMB 5GMKa 2KJWA 4NI2A 3D5MA 4OX7A 3JYTB 2E5LJ 3BKTA 3ZZPA 1OY9A 4OFZA 3I56S 2XSJA 2QL9B 4ED1A 1JXEA 4KO0B 2G0CA 1RTIB 1NZAA 3P4UB 1YG0A 4URGA 2QLBB 2Y3YA 1B70B 4LF9F 1IUJA 3HPOA 3SDEB 1TL1A 3M8QB 1U1PA 1UJ6A 4TNOA 2NPFA 3PZPA 3OTCA 4Q43A 2DJWA 2E5HA 2ZC4A 3AX2A 1Y3JA 1OSDA 3MM6B 4C2MA 2V67A 3W65A 5I42B 3MUTP 4DQRA 2IAJB 2DVIA 3A4TA 4H4KC 3MPVA 4KBIA 1QD1A 4IDKB 1E6VA 1F9EB 4LUBA 4B3TF 3KMSA 1FDDA 3QRQA 1Q78A 5HSPA 1N0VC 5AJ3J 3POTA 2V1TA 4K0KJ 1T05B 3PCOB 5GAGU 1TP7A 1HBMB 3MPYA 3BEGB 1U47A 1V3SA 4GKKF 1VBXA 2HS3A 2IMWP 2QLFB 2Y1IA 3IRWP 2A1BA 1SJ3P 4AQYJ 4PQUA 3FGVA 2ROPA 2I2YA 4TQRA 1HQUA 1FRMA 4UW2A 1SCJB 1S6PA 3Q0AA 3A8EA 3UD3P 3R7SB 3NRBA 5CYMB 1RT1B 2OPQA 2FJXA 5ETKA 1KN6A 4J37A 3AXKA 2APOA 5L8RC 4EU0A 3RR7A 5KOWA 3FQLA 4DR4F 1AXQA 4J91A 1EB0A 2XI3A 1PYOB 1NSKL 4YMEA 5KFJA 3NXZA 1VLOA 2VG7B 1HQEB 2LP4A 4LF6F 2DHAA 2IVYA 2GW8A 1S57A 5E3QA 4XK8C 3HFZB 4CRJA 4RZRA 3QRPA 1YJ9S 3PJXA 4DL7A 2CJKA 1R8BA 5HQLA 3WIUA 4ECRA 3H59A 5F8IA 4MK9A 1GXTA 1BD6A 2WTFA 4MFBA 4BC9A 4F3QA 4B08A 2D3ZA 3KK3A 5ETPA 2QMWA 4X65F 3HK2A 4C4WA 1N36F 5F8MA 2OPPB 1MMNA 3GJRB 3M8SA 2UUCF 4ZLLA 3VGSA 3IR7B 4YR3A 2MZTA 5HATA 4G3IA 3UQSA 3FMWA 2GJIA 3B8HA 5DZ7A 3Q8UA 3MR2A 1RCOB 4U7UD 1UW4A 2RQ4A 4ES1A 1NSPA 2FJWA 2VICA 1V9OA 2K1RB 4O3SA 2RQCA 1CBKA 3R8YA 2KG1A 3N5FA 5A76A 1RT5B 3FBCA 4ID5A 5HVHA 3DOLB 5K5MA 3DC2A 2PMWA 3CDBA 5CA5A 3W1YC 3MOZA 4IR1A 3KJVB 4JI8F 1WC3A 1NSAA 1TQLA 1FCAA 1ZAXA 2VG5A 3RGIA 2J7WA 4DR7J 1V5IB 2OMOA 2PEHA 3C14A 1NJXA 5RUBA 2NLWA 3KJNB 4LF8J 2IM1A 3D6FB 2MKYA 1XNQF 2W2NP 4F4ZA 3V4IA 2VC1A 4C3MA 1TL5A 5E7OB 4C8NA 3CMAS 5HLFB 3B6BA 1PYSB 3C16B 3H5YA 3EGZA 2ZC3A 3GSDA 2W7PA 3OXFA 2HMIB 2R7UA 3I82A 5KFSA 4KSEB 3RR8A 1VMBA 3W63A 1WOPA 4CO2A 3T5KA 3CJ3A 5B0CA 3OUYB 1SUQA 2EK1A 5KFDA 3UN3A 4EYIB 3LO3A 2E5LF 1RP5A 3CIZA 3BZQA 4KH0B 1JNRB 4C8MA 2K3KA 2HG4A 4PZVA 2GIRA 4DXLA 4YFUA 4KHMA 2UUAJ 1I1GA 4DL5A 1H98A 2HBYB 1K1QA 1KBRA 3OXLA 5H9EJ 4X4PA 4MTPA 3MMAB 3ISND 1IBKJ 1JNZB 4AE5A 1BQMA 3OTBA 4O44B 3OTDA 3LOUA 3PW0A 1FRXA 2NZ4A 1HI8A 3HSDA 3TOQA 2F8MA 3OFEA 2FVQA 4KB7A 1SH2A 2FJAB 1LW0A 2Q66A 4LT6A 5KFOA 3LP1A 4CNZA 1Q5VA 3VQTA 1REVA 4AT1B 2ZBQA 5AJ3F 1WC1A 2ZWPA 2ZWOA 1RXOB 3CCVS 4K0KF 1CJKB 2CPZA 3MFIA 1VQ5S 2QX0A 1U1OA 3VHQA 1YJVA 5HMYA 1MW7A 2DR9A 3HXMA 2V8VA 4ZP8A 3BYPA 3EE3A 2IHR1 4USMA 4UY8T 2V4JA 4AQYF 5M2UA 4X66J 2HFVA 3H20A 3W9JA 4NLWA 4P2MA 2FLOA 4EEYA 1XERA 2R7SA 2AGQA 3I4HX 4NEZA 3K58A 4LFBJ 2XI2A 4OI4A 2A3JA 1EP4A 2FJEB 4ALZA 2D41A 2OSQA 3UNGC 1VQ9S 1WORA 2E5IA 1HBOA 2D3OR 1JX4A 2RILA 2RQKA 1A9NB 1QLNA 1T9UA 3QFWA 3KUGA 4OV6A 2WB1D 2FZKB 2NUUG 4TU7A 2UUBJ 3B82A 3FCVA 4PG8A 2ZUGA 2BA9A 4XDCA 3N9UC 3MECB 4JBCA 3RW7A 5KFFA 2ATLA 2QT7A 2PSZA 1EAYC 1XC9A 1PCAA 3HD1A 4KT0C 4IFVA 3GSIA 1TL7A 2QLWA 1S99A 2BEFA 3C15A 2XY7A 1NJIT 4Q5VA 5LXRA 4CZCA 3VAJA 1U0HA 4Y2IA 1R8AA 4A8SA 2IYGA 4U67Q 2IM0A 4L76A 2B56A 4USIA 1U8WA 4O3QA 5L46A 2ZH9A 2V9KA 3M2RA 4XPEA 5IWAJ 1Q8BA 2LXUA 4UTGA 2L9NA 3LANA 1X4HA 2YNHB 4U8YA 1S97A 1YRTA 1X4GA 4LF5J 4ANEA 1T8EA 4O4RA 1LEOA 3IR6B 4DV0J 2DIUA 2LXIA 5E5NA 4LF8F 3GYNA 4ECVA 4CO1A 4Q2MA 5CYQB 2VU5A 2BE2A 1Y10A 2ERRA 1YBTA 2XNQA 4WYLA 2B9WA 3UDVA 2OFGX 1R8HA 2AZ3A 4ZK7M 2WVCA 1TK5A 1XN9A 3H5XA 4F2RA 1RWWB 2QA4S 2FTRA 5D78A 2XZTB 1X8DA 1ZYQA 4W98A 3ISZA 1VQ7S 2E7VA 3WQPA 4F02A 1TKZB 1ZS6A 4Z7CA 3ITHB 3MM9B 3BO3A 1VQYA 2OP5A 5KG6A 3PY8A 4RU2A 3RUBL 1TAUA 4DX7A 2W9AA 3TQ1A 2UZAA 1U4BA 2MHNA 1BQXA 4J9QA 3RBDA 2ZJRQ 3GPAA 2XYPB 3D0IE 2XS5A 4ZVFA 1T9WA 2Q79A 2CRLA 1IBKF 4JOUA 2E7XA 5D0EA 5FDLB 2VFUA 5CZVA 2YNGA 3CJKB 1SL2A 2VHGA 1WD6A 1P6TA 2Z2ZA 1MROA 4QR1A 2DD8S 2XO6A 4J9UE 3DM2A 1DTTA 4KGZB 1XWLA 4WJBA 3TUJC 5HQ8A 2HS0A 2GMJA 2IIHA 5J2QA 3TWZA 2V0NA 3UCZP 2BABA 4K4VA 3MM7A 1IKXA 1UA0A 3KLFB 4KH1B 4OMFG 1AW0A 2JHEA 3OD2A 4MJKA 2ZHOA 2HURA 3PRBA 2JLFA 1TUWA 2EXUA 1FESA 4KE5A 4X64J 1KVIA 2QMUB 4QOTA 1HA1A 4LFBF 2FC8A 4CP5A 2HGMA 1GQEA 2MQ8A 1D3WA 5K8MA 2F1FA 1HYSA 2GC8A 3J7A1 1XNRF 1ZA2B 1X60A 2W9CB 2V8DA 3PRVA 2OGUA 2CQIA 2UUBF 1AYEA 3UDLA 1OMSA 1CSJA 3MWBA 1OS5A 3T9NA 4PEOA 2V8GA 2M3DA 3NGKA 2O1PA 3SQGA 3THVA 4Y28C 2LXFA 1O51A 4LRDA 4URQU 1I51B 1R3NA 1CS4B 1OPIA 2CKWA 2NQPA 2A18A 2EPIA 5I3PA 2ZOMA 1UEKA 2ZH4A 3H8YA 1VHIA 2YWKA 3FZ2A 4Q8FA 4OV1A 2IBOA 4IUFA 2YPYA 3CDAA 1NH7A 3CCWA 1NUEA 1GNKA 1M5KC 2LEPA 3IM9A 2AWZA 2JSXA 3BPSP 3V4MA 1R0AA 4F0MA 2DGTA 3BH7B 1TV6B 2OPSA 5D77A 5F3TA 4HACA 4NZ0A 4DUYJ 3WC2A 4OYIA 5L39A 3K2YA 4C0HA 1HARA 3O5TB 3JXOA 1JKHB 4LF5F 1GMVA 5HANA 1RWMB 4ZP9A 4HHHA 2HFSA 4ER8A 1CC7A 3OSPA 2G9OA 2ASYA 4WIIA 1TVRB 1ITPA 4PABA 1U7LA 4F25A 4DL4A 3A3NB 1HBUA 3KLVA 3GR1A 4LSLB 4NWBA 1NPKA 2ZFHA 1N56A 1WJ9A 2LA6A 3CCJS 4F3MA 4NLSA 2VF3A 4DR6J 1FXLA 1OO0B 2KFNA 1FE0A 4CWBA 4A4JA 2BJDA 3LGHA 1CQMA 3CE8A 3UWTA 4IQXA 4FBUA 4NXNJ 1N5VA 4J9VA 1Y3KA 3FK4A 1BC6A 1JLCB 4NLOA 1SV5B 2WSCC 1UFLA 4NLGA 1BXNA 5KT4A 1X0FA 1NDCA 5HJXA 3T1HJ 3QJPA 3TO8A 2HIYA 4LVOP 3M4XA 2EFOA 1FRIA 2QIFA 4HLBA 3SQOP 1HBNA 2ADCA 3DFEA 2BOPA 3CD5A 2QG9B 3AB2B 4HT7A 1XQIA 1UA1A 2U2FA 2Z0GA 2KXHA 1QSLA 2GIQA 1T3OA 3LP0B 3NP5A 3GQCA 3NCQA 5BYQA 1U09A 2JJ4D 1QTMA 1J5OB 4J9PA 2ZJQQ 4OZ3A 2JFDA 1C2PA 2QZ8A 2RD5C 1TL3B 2DXEA 2EFVA 2H5JB 2EFNA 4YS2A 3HJVA 2OI2A 2YQ3A 2G2ZA 4FNIA 3GFHA 2MGZB 4WFBQ 3CIMA 4ZPVR 4BS2A 1KFSA 1YQHA 4CLTA 4X4NA 5EWFA 4NCGA 3U27A 1WF1A 2Z56B 2Y8WA 2EBEA 3HMJG 1RHRB 4DSIA 2KL8A 3PVXA 2ZH1A 2CZVC 4X64F 1U2RA 3CDEA 2HGLA 2MQPA 4TVAB 4FXVA 5L1IA 4KR0B 2AD9A 4C7QA 2HRUA 2IJFA 2YVSA 3PR5B 3P5TL 4HDGA 3VGUA 3DXBA 3FFIB 1RCXB 3H2VE 1H2UX 4M5JA 3KNAA 4FYWB 3FKBA 3OQ2A 2C2NA 4I0WA 1CVJA 2XZWA 2HAFA 1ELOA 4MMOA 4USJC 4K5RA 2V94A 4HDHA 3PO4A 1JMTA 1RKIA 4M95A 1HL6A 1U1RA 3TRGA 4DI6A 1N6QA 3R2CJ 3HVAA 1RTJB 2ZDOA 1QDUB 2VBYA 4FS2A 2C2EA 4MKVA 4DS4A 3U1MA 1N52B 4DUTA 1JJHA 4ECQA 3CO9A 3HVTA 3RAQA 4K8RA 3TJ9A 3MUMP 4LRCA 2GGPB 4Y2KA 1RK8A 4IG0A 1RTHA 2KYXA 2AEMA 5K14B 1PSDA 5KFIA 1FX4A 2VDIA 4PG6A 3FQKA 2IA6A 5D4LA 4JI1J 4DUYF 4ECZA 3MM5B 3ICLA 3CW2C 3TJ8A 2J9CA 4GO7X 2Z8QA 4R5PA 3OL8A 1DZ5A 2R7QA 3OPKA 3CXCR 4WZMA 2CXEA 4DF4A 5DZ6A 4YEAA 1Q86T 4OYWA 3PYFA 3AX5A 2M4MA 5GADI 4DQIA 3ENAA 2BE9B 3OBIA 4U96A 1NU4A 3QSYB 1HKAA 3M9NB 1FA0A 4M5KA 5JUMA 2H48B 4DR6F 2YWFA 5GAEI 4KGMA 4QZVB 2UXBJ 2I5JA 5IM0A 4OI1A 2J6UA 1XR6A 3MFHA 4ZOSA 5C2GA 1RA6A 3ELHA 1FWLA 1UWBA 3S7RA 1MU2A 4NXNF 3HSGA 3CJ4A 1FI4A 3W2WA 1WG1A 2B3TB 3UO0A 5LXYA 2NXUA 2FZGB 3JQJA 4LVNP 3Q83A 3T1HF 2DNQA 4DV6J 1HLWA 3BR8A 4K4YA 5IT9Y 1FNXH 3LP2A 5KFCA 4LR7A 1IBMF 3EZOA 1NH8A 3X1LB 4DL0C 4OX8A 1N5YB 3EX7B 5I3QA 3ZTPA 3CC2S 4Z7YA 2OELA 2HVHA 4OJ3A 2YH1A 2RF2A 2XSFA 1S7IA 1VRTA 1FNMA 4QYZK 3W8PA 4OZJA 3Q8PB 3D0GE 3GIJA 2XGPA 3DYAB 2HLUA 1IKYA 3IGNA 4HHJA 4C8YA 4DEZA 1TAQA 3HHNB 2AZ1A 4C3LA 2DXFA 2X1FA 2WVFA 2Z2YB 3GV5B 3ILLA 5GADU 1SL0A 4DPUA 3SI8A 2GMHA 4Y6IA 3J7YI 1AB8A 4B3OB 4DX6A 2HNYA 3GYXB 1ZM4A 3K8VA 5GAEU 5C42B 3ZTQA 3ENVA 4DV3J 3OL9A 5KOXA 3IXQA 1Y5LB 1F9FA 4LFAF 2Z57B 4G1QB 2ZBIA 2Y9HA 3M1VB 1I3OB 2YWGA 2VL1A 3AB4B 2LCWA 3K5MA 1M90T 4ZHRA 2QFIA 2J6SA 3M9MB 2MMYA 2IRUA 3DU6A 3O8WA 3MMCB 4JP8A 1AT1B 5D0RA 2L08A 2DNHA 3L7PA 4C48A 2RHSB 1XR7A 2AEJA 1JLGA 2L9DA 2RRAA 4KGVB 3D6TB 2PA8D 1TKXB 1YJTA 2KVIA 2PGCA 1F6TA 1T03A 5A8RA 3EDRB 1X5SA 1IWAA 3D0HE 3MMBA 5DDPC 1U2FA 4NLPA 4RKUC 3G82A 3D67A 1EIYB 1QJHA 3FBEA 1KHVA 1KRPA 2VQFJ 2XYGB 8AT1B 2LQ9A 1FRHA 3D54A 1WEYA 2JRSA 1OY8A 3RB0A 1HWKA 2PMHA 4V1Ak 1H3DA 1UPMB 3IS9A 4HTIA 2W8LA 4WBFA 2DGXA 2VDHA 3J7YU 2XTDA 3X3UA 3GV7B 3FCWA 4OI6A 2OKQA 2G13A 3QLHA 3CCRS 2AJ2A 4CLWA 3EVOA 2FJVA 2DR6A 3CNQP 2WZ1A 3E01B 3VZHA 1JXVA 1VS3A 1APSA 2GCFA 3SXLA 5F9NA 1RWNB 4E98A 2GS8A 1X5TA 1YDLA 2X3DA 3A8IA 2PMZD 5J1EB 4DPXA 1KQSR 2VD3A 3LTOA 4ZVHA 2HK3A 4I2PB 3TVYA 2XZDB 1KFDA 2ZVSA 1RT4B 2W2PP 3IO1A 4NA2A 2UXBF 2E1MC 2IJRA 1N32J 2IA0A 1URNA 1FFGB 2LMIA 5HBMA 2RU3A 4ZPDA 5KAKA 4ZCMA 3CJRA 3OFGA 3PJ9A 2DH9A 2B7CB 3DGPB 3V6DB 1T94A 3DOMA 4DQQA 3PV8A 2DY1A 1HPZB 4BWMA 1ZOTA 2MKIA 1X4DA 4RLEA 2VASA 3F0NA 1BQNA 2N7YA 1D9FA 1S1WB 1HNWJ 2CNKB 3DOKA 4QYRA 5KTQA 2BBEA 2ZH6A 2CPHA 5DDOC 3F73A 3DLLQ 4B17A 4LF7J 3MTJA 2CPEA 3C3LA 3I96A 2RDIA 1U6FA 3Q89A 1H6KX 3ENWA 3L7OA 4KPCA 4DL6A 1KKHA 1SB6A 4M5DB 2V4RA 4OYZA 1YKWA 2MY8A 2UP1A 2VOOA 1HWJA 3M6WA 2J9EA 3ET6A 3FSXA 5KFPA 3MD1A 1M5VC 3CB4A 4HT5A 4DR5J 2J0QD 4U8VA 2RKIA 4DV3F 1RT3A 1RYRA 3T3FA 3WDOA 1AUDA 3GFYA 3HFKA 1YJRA 2D3UA 4RPFA 4CT8A 1U6BA 1FJ7A 3MM8A 2CJAA 1Q7YT 1IBLJ 1VJQA 2B9YA 4YN3B 1N4LA 1N5SA 3O1LA 4CLKA 5HVFA 1UJ4A 1FFWB 1S6OA 5KFVA 2HBZB 3LPEA 1FHTA 2CJXB 3MMJA 4PUOA 3PW2A 2Z2MA 1N34J 4DFJA 5B0BA 4CLYA 1IN0A 5LSLA 2ABYA 4LF2A 2AW0A 2XM3A 1AZSB 1ZM3A 2BKOA 2F8HA 4Z37A 3H5UA 4I2QB 4NLRA 4NZ6A 3Q2SC 4ED3A 1AROP 2DH7A 4ZVGA 1QE1A 4KKOB 5E41A 5DRKA 2ATCB 5LSRA 3NS6A 4NOHA 1HIYA 4RBUA 2XS2A 4ZMMA 2VA3A 2JEJA 3KG0A 1U6ZA 1UVLA 3LGMA 5KFAA 3QO9A 1L3TA 3V6HA 3W5YA 2GX8A 3PHEA 3KDOA 5I4MA 1NPPA 4DHVA 4NA3A 4EZ6A 5MAOA 2WAQD 4LIWA 3TX8A 2CJ9A 5J1NA 3DDIA 2LA4A 7AT1B 2F8EX 3GU0A 2OPRA 2B9XA 4IRDA 1L3VA 4C98A 1R0BG 1SL1A 1T7PA 7FD1A 5BR8J 3HDSA 4NLDA 3TYTA 2V2QA 3D1OA 4TLRA 2BANB 3R6LB 3KLGA 2YWHA 3RU0A 4AXJA 3DLBA 1FERA 3ILIA 2G0IA 3QBCA 4ANCA 1NSQA 5KFTA 1CULB 3CCZA 1N32F 2MQOA 1EQ0A 1T9YA 3DLKA 3M30A 4OHXA 4K4UA 4ETZA 4KJIA 2HHTA 4PWWA 2H1YA 4FPRA 2HVZA 1X31C 4M1KA 1HNVB 5KFLA 3CGIA 4NI2B 2CZ9A 3KHGA 3HHLA 4DL2A 5D8HB 1HNWF 1VHFA 3Q22A 3OTEA 4KGXB 4MYTA 4OZNA 3TAMA 4AYBD 2XSJB 4M5LA 2AMCB 1HNZJ 2BM1A 4YB6A 4LF7F 1TFYA 3CD6S 5L9XA 2ASLA 4C11A 1TL1B 2N7CA 4AFFA 1YRUA 4N76A 3OVBA 4I7FA 4LSZB 4IOBA 5DQIA 1B64A 2D68A 1VIOA 2NS1B 3DNCA 2CJBA 4BHQA 1VBYA 3GFXA 4OJGA 5GMEA 2YNIA 2MKSA 4DR5F 2ALYB 3Q8SB 1E6VB 2EW9A 4ED8A 2W7AA 3MEGA 3POTB 5KG3A 3CULA 3DI6A 4DPYA 1JLBA 1Q0NA 1DLOA 3I9V9 2F5GA 1N8RT 4DF8A 4FS1A 3C6TA 2KH9A 6FDRA 2VC0A 1I94J 1IBLF 2HZCA 1FVSA 2K3IA 5KFWA 3VQSA 3PW7A 4PQUB 2R8KA 1EX8A 3UDEA 1HQUB 4AL5A 3AWRA 3KLHB 3G86A 1Q8LA 1S6PB 2B4UA 2OPQB 3IR5B 4LR9A 1QVFR 3I0RB 2MHEA 2XHCA 3H2LA 3B54A 2ZD1A 2GZOA 1N34F 2XULA 4ES3A 3DDKA 2LLZA 1WEXA 2PD1A 1RWPB 1OJ4A 1N33J 4FKXA 4LSNA 1SI9A 2OH2A 2R7VA 3C6UA 2RIJA 3BV8A 1YVFA 3MD3A 3D1HA 1IR1A 4F50A 2MEWA 3L09A 3NBPA 1HQEA 1B0VA 1KP6A 4MFBB 2BW7A 3NS5A 3KK3B 3ONQA 2CQ4A 1WNEA 4FP9A 4DCJB 3FRYA 3SCIE 4X4TA 2EFGA 2CWXA 1T11A 3JQMA 1HHSA 3O2IA 2OJ3A 2AJ1A 1J27A 1HMVA 3DU5A 4L72B 4O3NA 1P9QC 2J0XA 1U1LA 4YB7A 1E6YA 2NSCA 1XIQA 1PKUA 1WACA 4KV8A 3TARA 1AUSL 3EUNA 1WOOA 3HF5A 4DV5J 5LMNJ 4ID5B 3PHTA 5BR8F 2BKPA 3FEZA 1NXIA 2GHWA 3UNYA 2P6TA 4WFYA 3ZZ0A 4HKQA 2LKZA 2LU1A 1WI8A 2VG5B 2X51A 3T6BA 4HEA9 2V4QA 3SMZA 3OVSA 2HBRB 1KVKA 2NXCA 5E2QA 2QE5A 2EBGA 1EHWA 5A0YA 1YGYA 3V4IB 4AL6A 3W66A 4X4OA 1X9WA 2YTCA 1U26A 4TYBA 4ZPAA 2JLEA 2DNZA 2XC9A 5EX3A 4ZVTB 4PYDA 2DNKA 3IBFB 2C3YA 3Q8VA 2POKA 3D3BJ 4UUWA 2L48A 2QC3A 2RQMA 1S1TA 1WC6A 2PIIA 1SUQB 1SIZA 4OHZA 1WF2A 3N01A 5K8NA 4JI0J 4URSA 5B08A 2CQCA 2FJDB 3CJQA 2ZZTA 1PIEA 3NOCA 2MB0B 2HQFA 1W2BR 2HMIA 1HNZF 4FF1A 2FHJA 4NXMJ 3UN5A 3QAEA 2YWEA 1VBZA 2VBZA 2MDAA 3K57A 1DQ9A 4P10A 5C24A 2DK2A 3HKZD 1NKCA 3OLAA 3TNVA 4OJ1A 1I6JA 2NREA 3UW1A 3HHLD 5F9LA 1BQMB 1MNEA 4UZBA 2MKCA 4HVZA 3HCXA 2X1BA 3KK1A 1CG2A 3VGVA 4PWDA 3QZ8A 5HJYA 2HHPA 2XLKA 2OAUA 5SZTA 4JV2A 4QBUA 4V19X 2OTJS 4UY85 4PAAA 1LW0B 4I6AA 3LP1B 1QAXA 1REVB 2JC0A 2WVBA 2R8JA 5B0AA 3OXGA 3D6HB 4OI3A 1CJUA 4QW8A 4DX5A 3ADAC 4PKDB 4I68A 4MIBA 9RUBA 2W4CA 1KONA 3N6MA 2HIQA 3IWXA 2B8PA 4NE9C 3A12A 5HK4A 3NWRA 4KFBA 1I94F 4EK2A 4OX9J 5HROA 2H5IB 2V4JB 2DRBA 2YX1A 1O5JA 2XGQA 1IXKA 4NZ7A 3MR5A 2ZNZA 2XO7A 4QPXA 2CQDA 4U9RA 4QWDA 4NLXA 2E1RA 3NNHA 2MKHA 3G96A 4ZVPB 1EP4B 4DUZF 1LWXA 2AJ0A 5KT3A 3BB5A 1HBOB 4IH5A 1N33F 2QYCA 2BX6A 2WRMA 4WKRA 2VBXA 1RSCA 3EXCX 4GMKA 1FJGJ 1UWAA 3TA2A 3BQ2A 2DNMA 2F7VA 2D9PA 5DDRC 4W4MA 1ULRA 3KHLA 2CQ1A 3V81A 2OO4A 3CJ0A 3UI3A 2B8QA 2GVZA 5M2RA 2CPYA 1KQFB 4IFVB 1TL7B 4N7TA 5J2PA 2MZRA 4ZVRB 3QT6A 2YX4A 1HWUA 2ZHAA 3SFUA 3RG6A 2L9WA 4K7QA 1U0HB 1RBOB 2C1EB 5DQHA 3D7SB 4WP9A 1Y5NB 3NGSA 3DLEA 1S76D 3AH6A 4J9MA 2V69A 4DMZA 3I6PA 5L38A 5LMNF 3CDWA 1PAUB 3M2RB 1UUJA 2RJZA 4NMLA 3VAIA 3FNNA 2P8IA 1F5AA 5E33A 4J9OA 4ENOA 2G4BA 2YY3A 5DDQC 1HQ2A 2LDIA 3MPUB 2XY5A 2BDPA 4K50A 1U1QA 2A2CA 1ZM2A 1HR0J 2DGOA 2BE2B 3NKYA 2BJ3A 2VG6A 4OLPA 4J5OA 1YI2S 1JLAA 2ZVIA 4ZKAA 3PX0A 4ILRA 3MAQA 4YUDA 2GO9A 5H9EK 3M6XA 1VQPS 4J9RA 4YB5A 1PJ5A 2HVIA 2EWHA 2D3O1 5CYJA 2WVEA 2B0GA 2CQPA 4B3TJ 2HFUA 3FBBA 1VK3A 4JI0F 2OTLS 1VK8A 5AXNA 4G1PA 3IG1A 3HSZA 5HI7A 4NLYA 4OHVA 2CADA 5AE2A 1N48A 4NXMF 3H25A 3UR0A 4OQJA 2N3OA 4B9SA 2I1RA 2Y1RI 3U1NA 4RW9A 2CNNB 3ITHA 5KFYA 2K06A 1VIXA 3G6XA 2ZE2A 2YNGB 3MGJA 3GV8B 1VCTA 2KKHA 3PX4A 1TK8A 1HWLA 2WSFC 3NGRA 1MROB 4F4XA 2EK6A 4ZPCA 2FHJD 3DM2B 1S1XA 2HVEA 1DTTB 2CVIA 1F2HA 1DBDA 3VAMA 5J2QB 4JI7J 1M0SA 2GNKA 3N5BA 2A2DA 4LF4F 3V6JA 2D74B 3EVWA 3MM7B 1IKXB 1PGZA 3VF0B 3C8YA 1UVIA 3LPYA 4OX9F 2XTEA 1S6QA 1X4AA 4ECXA 2FC9A 1LFPA 1CJVA 1PG5B 2IDLA 4ICLA 6AT1B 1GH8A 3M8ZA 4DCOB 2ILYA 5AE3A 2DR7A 4ZJLA 4ZLPA 2BRKA 1VJWA 2YQ0A 5KFGA 5B09A 2F4FA 5GMDA 2HQGA 2YBVA 1RT6A 4RW6A 4A8XA 3ISNC 3HP6A 3PW5A 3MDFA 1F0XA 1S7HA 2A0FB 2R7WA 2GIFA 5J2MB 2CG4A 3IBCB 4K2JA 1MMDA 3MPWA 2Z30B 1FJGF 1S77D 3I5BA 2LECA 2YKOA 3V2UC 4IH7A 4LBPA 4U95A 3GJTB 4IFYA 3QPIA 4P9SA 4ILMA 2W1BA 3SQGB 1X4FA 4P6QA 2E9TA 1VFJA 3T9ZA 2AJ4A 2HKEA 3CD0A 3HULA 4KTQA 4ZCKA 2DNLA 4DV1F 2P9GA 3WZ0A 3GLJA 2FD2A 3VVUA 1T9TA 1M1HA 2C22A 3UFCX 1RU2A 3QSIA 1S9EA 3OW2R 4F4WA 1R0AB 2NPIA 2OPSB 1MSWD 2B6AA 3NGTA 4HACB 1WG5A 3SCKE 3SV4A 4A8YA 2DHHA
chains in the Genus database with same CATH topology
1HL6A 1U1RA 3TRGA 3PNIA 1H38A 1KLNA 3TAPA 1U45A 5KFKA 1WHYA 1N6QA 4RNHA 2JL9A 2HRYA 1FNOA 3M1VA 2KI2A 1NRKA 3HVAA 2HS4A 2IVMA 3TA0A 2MJNA 1RTJB 2ZDOA 2VBYA 4FS2A 3HM9A 2C2EA 4WE1A 4QCLA 4DS4A 3U1MA 4NLTA 2B5JB 2EKYA 1N52B 2FJBB 3TVZA 1JJHA 4ECQA 3M8RA 4CCHA 3CO9A 2CFXA 3HVTA 2DNNA 2FGOA 2GFFA 3RAQA 2HHWA 4CO3A 2CPDA 2C2DA 3MMCA 2R9LA 3IG1B 2IRYA 4TU8A 4EO8A 1Z4UA 3OJSA 3MURP 5IZHA 1QVGR 1HR0F 2P6SA 3E51A 5KG0A 3MUMP 4FXDA 3FEXB 1HBUB 4H4MA 2MKKA 4CQ1A 2GGPB 4Y2KA 1RK8A 4IG0A 1KQKA 1RTHA 2IBKA 2KYXA 3O6QA 1TKXA 2ZZMA 1WWHA 3Q24A 4DFKA 5K14B 4FNHA 1PSDA 5KFIA 5EWGA 2W24A 2CQBA 3TA1A 3BGFA 3PX6A 4PG6A 3IRXB 4RW9B 2B7BB 3FQKA 2IA6A 5D4LA 2Q43A 2PE8A 3HX9A 4DUYF 3KLIA 2OD4A 3MM5B 4ECZA 3BN4A 3ICLA 1CPZA 2J9CA 2ZE2B 4U6PA 4B3SF 4GO7X 1R6YA 1YIJS 1A6LA 2Z8QA 2FY1A 4MKYA 4DPOA 4R5PA 3L95X 3D2WA 5I3UB 4QJVA 3OL8A 4OZ0A 5KFEA 1DZ5A 1YHQS 1M5HA 2R7QA 1OPZA 4KIAA 2DCLA 3OPKA 3CXCR 5G4DA 4KPYA 3PEHA 3OTOF 3VAHA 3UCUP 5KFZA 4D3HA 2ASDA 2UUAF 1NEEA 4WZMA 3DLHA 1KLMA 4O3OA 2VPWB 3QWUA 4DF4A 2Y0SD 4A46A 1Q81T 3VZIA 3VAKA 3HZGA 3H4BA 1S1XB 4YEAA 1X4CA 5D3GA 3I4PA 1Q86T 3K0JA 4IYQA 4X4QA 2J0SD 1SQEA 2M4MA 5GADI 4DQIA 2W25A 4QIWD 2WBRA 1QUVA 1PC5A 3OR2A 3OBIA 4CO0A 1JLFB 5A8WA 2AGOA 3DDNA 1NU4A 4UQGA 2KJVA 4ECSA 5D4NA 3MR3A 3M9NB 1FA0A 2LU2A 2BM0A 5JUMA 3PFEA 2Q3PA 1HI1A 1TKDA 4DR6F 1HBNB 2YWFA 5GAEI 1UMJA 1K8AT 5GAHI 1S6QB 2QFJA 4KGMA 4QZVB 3G8QA 2FGCA 2V2KA 2I5JA 5IQ6A 5IM0A 1U49A 4DLGA 5F8NA 4OI1A 4ELTA 2IFXA 1FE4A 2J6UA 1XR6A 2LQBA 2MQNA 2MZQA 4E0DA 3BQ1A 5F8LA 3MFHA 4DQSA 4ZOSA 3BGRA 1RA6A 3AY0A 3E01A 2O67A 1UWBA 4ICLB 3W2VA 3BSAA 5E3PA 3S7RA 1MU2A 4RNFA 3CMES 4NXNF 1JLEB 3CJ4A 3BGUA 3W2WA 2R2TA 4C3KA 2AJQA 1WG1A 4DN9A 1ZTWA 1IM4A 2B3TB 1F5BA 3DRRB 2WHOA 1XEZA 4TY8B 1VQOS 1HNIB 5J1EA 1NHUA 5LXYA 4RUCA 2XEXA 2NXUA 3G6VA 2DBBA 4R8UA 3J80Y 3RW6A 1ZM9A 4CH7A 4JI7F 2ADBA 3OHBA 4LVNP 3TI0A 4N41A 3HO1A 3HJFA 1KEKA 3T1HF 1TR0A 1C0TA 1KOOA