The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
81
|
sequence length |
392
|
structure length |
257
|
Chain Sequence |
b'VDEYMKEAVDHYAGQLMSLDINTEGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALALPEYSTLYDRWLDSF'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Genome polyprotein
|
molecule tags |
Transferase
|
source organism |
Human poliovirus 1
|
publication title |
Structural basis for proteolysis-dependent activation of the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb |
total genus |
81
|
structure length |
257
|
sequence length |
392
|
ec nomenclature |
ec
2.7.7.48: RNA-directed RNA polymerase. |
pdb deposition date | 2003-10-31 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Mitochondrial Import Receptor Subunit Tom20; Chain A | Mitochondrial Import Receptor Subunit Tom20; Chain A | ||
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits | ||
Few Secondary Structures | Irregular | Poliovirus 3D polymerase; domain 1 (Nucleotidyltransferase) | Poliovirus 3D polymerase Domain 1 (Nucleotidyltransferase) |