1RAJA

Poliovirus polymerase with a 68 residue n-terminal truncation
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
392
structure length
257
Chain Sequence
VDEYMKEAVDHYAGQLMSLDINTEGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALALPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
publication title Structural basis for proteolysis-dependent activation of the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
total genus 81
structure length 257
sequence length 392
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1rajA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rajA02
4.10.880.10 Few Secondary Structures Irregular Poliovirus 3D polymerase; domain 1 (Nucleotidyltransferase) Poliovirus 3D polymerase Domain 1 (Nucleotidyltransferase) 1rajA01
2J6SA 3CO9A 4ZP9A 3OL6A 1C2PA 2E9TA 1KLMB 4YR3A 2JEFA 4H4OB 2XI2A 1T94A 4RNMA 3KLIA 3QGHA 1TV6B 2HNYA 2HWHA 5KT5A 3CIZA 1JLAB 1RT7B 3JYTB 4JV2A 3V4IB 4MFBB 3V81B 1RTHA 4IFVA 3IG1B 1U09A 2O5DA 4H54A 5EUHA 4H4MA 1S9EA 3IGVA 4ED1A 1NHUA 5KG7A 1IM4A 3HKWA 5L1LA 1FKOA 5C42A 4Q44A 3RAXA 2WRMA 1VRTA 5I3UA 3BSAA 1JLBA 3DLGA 4EEYA 1S1WA 2ZD1A 4JV0A 2ILZA 4ID5B 5KT6A 1RTJB 1D0EA 5F9LA 1C1BB 3RBDA 1SV5B 2V9WA 2QE5A 2YNHA 3E51A 2EC0A 4YR0A 2AGQA 5J2MB 5L1KA 3N6NA 1DTQA 3CJ5A 5CYMB 5J2PB 1S6QA 5L1JA 1RTIA 5KFKA 5K14B 5KFWA 3KOAA 1EETB 3MTKA 3QIDA 2HNDB 2WB4A 1JLQA 4LSLA 5KG4A 1VRUB 5J2NA 1FKPA 2FVRA 3UDLA 5KFDA 4Q45A 3PW2A 3KLHA 2RF2A 2HMIA 4B3OA 1TL3B 4ZPBA 1S0OA 4KFBB 4F4ZA 4ZPCA 2VG6B 2JC1A 5EWGA 3PW5A 4KKOA 4QWEA 2W8LA 1HPZB 3EZUA 3KHHA 4ECTA 5L9XA 2XCAA 1SH0A 2FJVA 5HLFB 1IKVB 4ZHRB 2RKIB 3T5HA 3KHRA 3NAHA 4FS1A 3QO9B 1TL1A 4J9MA 4R5PA 3NBPB 1MU2A 1N6QA 1LW0B 5KFGA 3NAIA 3KNAA 1QUVA 2IC3A 2IM0A 3G6YA 2YNIB 2AWZA 5L1IA 3M8PA 4Y2AA 1RT2B 5KFNA 2XGPA 4KHMA 1IKYB 4G3IA 5I42A 4PUOA 4J9KA 3ITHB 3MECB 2OPRA 3LP0B 3OHAA 4EBDA 3DRRA 4KO0B 4YP3A 3Q8SB 4MKAA 3LALA 4NLOA 1LWFB 3I0SB 3UQSA 2VA3A 1LWCB 2V4QA 3LP2B 1XR7A 2BRLA 3QIPB 4KAIA 4MK9A 4URGA 3G86A 3M9OB 2XI3A 4WZMA 4TXSA 5KFPA 4URQU 2AQ4A 2JEIA 2IJNA 2AGPA 4PWDA 2CJQA 2BQ3A 4FBUA 4WE1A 1BQNA 2R2RA 4G1QB 4GC7A 4ECVA 3BQ0A 2B6AB 4KSEB 5HP1B 5DG9A 2GC8A 3C6UB 2B5JB 3DOKA 4I2QA 3LANA 5KFEA 3MEDB 4LQ9A 4IH6A 3BJYA 2FJWA 2DPIA 4NCGA 4Q0BA 3FRZA 3NKYA 3IS9B 4KV8B 4ED6A 1K1QA 2WHOA 1RT4A 2I5JA 3TAMA 4YMEA 4IKAA 3CDEA 5KFHA 1TKTB 3DMJB 5KFZA 3IRXB 1JLCB 5KFQA 1RT6A 1C0TA 1S0NA 4U6PA 4ICLB 2R2TA 2HNZB 1QAJA 1RT5A 3BREA 1HMVA 3Q8PB 3IN5A 5KFCA 1FK9A 3BQ1A 5F8MA 2UVWA 4RW8A 4ECXA 2OH2A 3OL9A 2BE2B 3V6DB 4IFYA 2ASDA 3DRSB 2D7SA 5CYQA 1LW2A 2OPPB 3DOLA 3QLHB 5HROA 4MK8A 3BSCA 4I2PB 5J2MA 2WOMB 1S1TB 2V0NA 3DDKA 1UWBB 2VG5B 3DLEA 1JKHA 5J1EA 3PR5B 3GV7B 4OL8A 4NZ0A 1TKZA 3MEGA 3OLAA 1S1VB 4ZMMA 4IRCA 3CVKA 4IG3B 3I0RA 2AX0A 4NYZA 3NMAA 1HQEA 3M8QB 1S1XA 4IDKB 3DM2A 4MH8A 4NLPA 3LP1A 2AU0A 2FLNA 3KJVA 4NLTA 1LWEA 5JXSA 1DTTA 4PQUB 3V6JA 1T05B 1N5YB 5J2QA 5F8JA 5KG2A 2ZE2A 2OPQA 4EYIB 4MIBA 1EP4A 1REVA 3MR2A 1RT3A 4EO8A 3JSMB 4IH7A 4U7CA 5DG7A 1RTDA 3FFIA 2D3ZA 2AX1A 3CJ0A 3DYAA 3HVWA 2E9RX 1HNVB 3LAMA 4R8UB 1K1SA 5KFFA 2YKMA 4TY8B 3PW4A 1QE1B 5EDWA 4ZHRA 5C5JA 4XO0A 3HVTB 2C28A 2J6TA 4RNOA 4NLQA 5C24A 4WYLA 3MEEA 5DGAA 3MR5A 3MR6A 4GC6A 1QAIA 4FS2A 3DRPA 4J9PA 1S9GB 3KK3A 1R0AB 4RW6B 1RT2A 1BQMA 4IG0A 2IBKA 2IMWP 3OLBA 1S48A 3MF5A 2W9BB 2YNFB 4ZVHA 4EBCA 2FVSA 1HYSA 5DLGA 2WTFA 4ED7A 2YNGA 4I7FB 3PHEA 1RYRA 4Q8EA 1SUQA 3HHKA 4O44B 5KT2A 1HNIB 4DG1A 3EPGA 3KK1A 4RZRA 4IQXA 2VG7B 1C1CA 4KHRA 4O4GA 4NLRA 4ED8A 4F50A 4QPXA 5T14A 2UUTA 5F8IA 5DG8A 4NRTA 3KLGA 3DI6A 1DLOB 5DGBA 4XPEA 2DPJA 5FDLB 2ASJA 5EWEA 3E01A 1TP7A 4M95A 5HBMA 1IKWB 2ZKUA 1Z4UA 3ISND 1TVRB 2WONB 1HQUA 1TKXB 4DL6A 4RW7A 1JLGA 3QGGA 4J9NA 5D3GA 2W9AA 3KLEA 1OS5A 2UUWA 4WYWA 1RT1B 1S1UB 3T19A 5F8NA 4KV8A 3H4DA 4ED2A 1S9FA 4ZP6A 5C25A 3GYNA 2W9CA 1JLFA 4J9SA 2GIRA 3IRXA 3T5LA 4ECRA 3UR0A 1IKXA 4RNFA 3DLKA 3KLIB 2OPSA 1S97A 2HNYB 3T1AA 4DEZA 2IAJA 3CJ2A 1C0UA 4LSNA 5F8GA 4RNHA 1HARA 2YKNA 3SFGA 1RTHB 3T5JA 4ZVGA 3KLFA 3Q8QB 4IFVB 4RU9A 1WNEA 1NHVA 1ZTTA 4DL4A 4NLGA 1JLEA 4M94A 4H4MB 4ECSA 1S9EB 4TYBA 3CJ4A 1FKOB 5C42B 3Q8RB 4RW9A 4NRUA 4DL7A 1VRTB 1MMLA 3DLGB 3FQKA 3BGRA 4RW4A 1S1VA 1S1WB 2ZD1B 4TQRA 3GV5B 1J5OA 5F8LA 3H5YA 2BANA 4KB7A 2IM1A 4NLUA 3QYYA 3H4BA 2YNHB 4K4WA 1KLMA 4MIAA 1DTQB 4H4OA 3BSOA 4QWAA 2FLLA 1S6QB 3BQ2A 1RYSA 2BR0A 1TV6A 3KMSA 1RTIB 1KHWA 2IM3A 2D41A 1JLAA 1RT7A 3JYTA 2ALZA 1JLQB 1JX4A 3V4IA 4LSLB 4MFBA 5KFJA 3V81A 3PVXA 5J2NB 4Q8FA 1FKPB 5KFMA 3IG1A 2J6UA 5KFAA 4J9LA 1ZTWA 3KLHB 2W7OA 3NL0A 4ED0A 1D1UA 4LQ3A 2RF2B 5DQHA 5KFYA 2HMIB 4X2BA 2ATLA 4O3RA 5KG0A 2FJXA 3GIMA 4XPCA 3UPFA 1T3NA 4ID5A 3FSIA 1RTJA 4KKOB 1C1BA 1SV5A 1TQLA 4RUAA 2IM2A 4K4YA 4YR2A 5CYMA 4WFZA 4ZVFA 4NLWA 1TL1B 3BR9A 3HVAA 5KFVA 3M9NB 4R5PB 4ECYA 5J2PA 1MU2B 1N6QB 2W7PA 2IC3B 5K14A 3PR4A 4DL3A 1EETA 4KE5A 2HNDA 5KFTA 3M8PB 1XR6A 3RAQA 4O3NA 4JUZA 1VRUA 4ZVEA 5KFLA 3H2LA 3H40A 1T03B 2JEJA 4R0EA 5I42B 4PUOB 4FBTA 5KFRA 3TVKA 3T5KA 4J9OA 4NLDA 1KHVA 3N6MA 4WZQA 2OPRB 2XCPA 3GILA 3DRRB 3PJWA 2R8IA 2BQUA 1TL3A 1S4FA 4NLYA 4O3SA 5KFSA 4ECWA 2WONA 4KFBA 3KHLA 2IJFA 2VG6A 2JLEA 1HPZA 2AGOA 1SH3A 5EWFA 1XR5A 5HLFA 1IKVA 4PWDB 1S1UA 2RKIA 4K4ZA 4IR1A 3QO9A 1RDRA 3I5BA 4WE1B 1BQNB 3C6TB 3N6LA 3NBPA 3QGIA 2XC9A 1LW0A 4KBIA 4QWCA 3NGDA 3M9MB 3GIIA 2R8HA 3PZPA 4IH5A 2B43A 2UVVA 4ZP7A 1RAJA 4Y3CA 2YNIA 3MFHA 3CJ3A 5KFIA 4TQSA 3IGNA 3DOKB 4I2QB 4TLRA 3KMQA 3QZ8A 3KK2B 5F9NA 3KLVA 4ECUA 3ICLA 2RDIA 4DL5A 2C22A 3RBEA 4J9QA 3SFUA 1IKYA 4NCGB 3PW0A 4Q0BB 4NLSA 1RT4B 2I5JB 3TAMB 2FLPA 3ISNC 3ITHA 1S10A 3MECA 3LP0A 4ZP8A 4IRKA 4TN2A 4EYHB 1JIHA 3H98A 4KO0A 1RT6B 1C0TB 2I1RA 1LWFA 5KG6A 3I0SA 1LWCA 1RT5B 1HMVB 3LP2A 3QIPA 5KT3A 3RB3A 3MFIA 1FK9B 4RW8B 3MR3A 4IFYB 3CDUA 3OHBA 4IR9A 5CYQB 5KG3A 1LW2B 3DOLB 2R8KA 4TYAA 4G1QA 5HROB 3QZ7A 2HAIA 2R2SA 2B6AA 5HP1A 2JEGA 3DLEB 4URSA 3H5UA 3C6UA 1JKHB 5J1EB 3D28A 3FDSA 2B5JA 1TKZB 3MEGB 3EPIA 3MEDA 5JUMA 1RA6A 4ZPAA 5DQGA 3I0RB 2ASLA 2QV6A 1HQEB 3IS9A 1S1XB 1S6PB 4Q43A 4K4TA 4WFXA 3DM2B 2V4RA 3LP1B 3RB4A 3LAKA 3KJVB 1TKTA 3DMJA 1LWEB 1W25A 1JLCA 3PW7A 2R8JA 1DTTB 2CKWA 4K4SA 5KFUA 3GV8B 4ICLA 2HWIA 2HNZA 5J2QB 5KFXA 2ZE2B 2OPQB 4NLXA 2D3UA 4Y2CA 3RB0A 1EP4B 1REVB 3SI8A 1RT3B 4ECQA 3BSNA 3G6VA 4WFYA 2ILYA 2BE2A 3V6DA 1RTDB 3DRSA 3DYAB 3FFIB 3TQ1A 2WCXA 4QWBA 2OPPA 3QLHA 4QWDA 2YKMB 1GX5A 4MKBA 2GIQA 2FVCA 4I2PA 3RB6A 2W8KA 1I6JA 2WOMA 1S1TA 5KFOA 1T03A 1UWBA 2VG5A 4QW9A 2XGQA 5I3UB 1JLBB 3I5AA 5C24B 3MEEB 4HKQA 4IG3A 5KFBA 4O3PA 1SH2A 4IOBA 3DRPB 3M8QA 3KK3B 2UVRA 4IDKA 2F8EX 1BQMB 5KT4A 4IG0B 1N48A 3H59A 1HYSB 3PJXA 5KG1A 4RNNA 4IRDA 2YNGB 4PQUA 2FVPA 1S49A 1T05A 3GIJA 1SUQB 1ZETA 1N5YA 3CDWA 4YQWA 3CWJA 4Y34A 4DG1B 4DL2A 3OSNA 3KK1B 2RDJA 3V6KA 2C2EA 3JSMA 1C1CB 4O4GB 4F4YA 1HNVA 4R8UA 2R2UA 4F4WA 1N4LA 4TY8A 4WXOA 3KLGB 1QE1A 4K4VA 3DI6B 3KHGA 3V6HA 3G6XA 3HVTA 4ZPDA 3GIKA 3E01B 4B3OB 3C6TA 5HBMB 3I5CA 3FQLA 3OL7A 2E9ZA 1HQUB 4RW7B 1JLGB 4EBEA 1S9GA 3KK2A 4ECZA 4RW6A 5D3GB 2JC0A 1R0AA 4RUCA 4K50A 2C2DA 2WK4A 3KLEB 3OL8A 2VA2A 2W9BA 2YNFA 1S0MA 3H5XA 3D5MA 4WXWA 5C25B 4I7FA 3GQCA 2W9CB 1JLFB 4O3OA 4O44A 1HNIA 5KT7A 1IKXB 5KG5A 2VG7A 4J9RA 3OSPA 3DLKB 3H5SA 2OPSB 1CSJA 5DQIA 2IAJB 4O3QA 1C0UB 4LSNB 2FVQA 4TY9A 1RA7A 2BRKA 2XWYA 2YKNB 2UVUA 1DLOA 5DLFA 4K4XA 4MK7A 3KLFB 4JV1A 2IA6A 4K4UA 1NNDA 5FDLA 1JLEB 4ED3A 1IKWA 1TVRA 4HYKA 4F4XA 1TKXA 2BQRA 3VQSA 4O4RA 4RW9B 1JXLA 2C2RA 2R8GA 4EO6A 1YVFA 1N56A 3BGRB 4RW4B 1J5OB 1GX6A 5F8HA 1RT1A 2BANB 4QW8A 1S6PA 4NLVA
chains in the Genus database with same CATH superfamily
3CO9A 2P9GA 3US5A 4CO5A 3C3LA 2DXFA 4JI7F 2DGSA 4MFBB 3QWUA 5B0EA 5FJ4A 2YPYA 4X65F 3N79A 4JV0A 1OY6A 4DUZF 1NK9A 1YZ7A 1BE4A 5HVFA 1UFLA 3E51A 2LKZA 2RIJA 5L1JA 4DR2F 3W65A 3BF4A 2RQMA 4J91A 2HMIA 4AL5A 4ZPBA 1FRHA 4FVMA 4U7UK 2GMHA 1M1GA 4L75A 2W4PA 1T02A 5L9XA 2E5LF 4ZKAA 3QPIA 4V19X 2OD6A 3EICA 2MKCA 1B4SA 1KTQA 2IC3A 1QD1A 3FRYA 1RWMB 3DCAA 4NLOA 2CZ4A 3UQSA 2XSJB 2JRSA 2ZFHA 1PC4A 4FYWB 3QJPA 1FRJA 3NGUA 4GO7X 2FGOA 1KQFB 4I2QA 4FNIA 4YMEA 4IKAA 5KFQA 5E7OB 2WZ1A 1RT5A 1VQLS 1FRIA 4CO2A 4XAKA 3BQ1A 3OL9A 4QYRA 4ZS6A 4CDIA 1SI9A 3BSCA 3CT9A 3BKTA 4F3QA 3A3NB 4MH8A 2FLNA 2BX6A 1RADB 1FXLA 1VQNS 2VBWA 3MR2A 2EFGA 1HNVB 4RJVA 4TY8B 2AYEA 4OHVA 2QZ8A 4Y65A 2C28A 2XLKA 2MGZA 4IG0A 1TL5A 2LFVA 4WWSA 3U1MA 3ET6B 2C1EB 1C1CA 2YX7A 1G2EA 4ZPWR 4DV6F 4B08A 3M2RA 4YY3F 1IKWB 2ZKUA 1X5OA 1Q78A 2YWWA 3QGGA 2BJ8A 4CWBA 3WX8A 3H4DA 5L38A 2CNNB 3GYNA 2VFSA 5JVGQ 2R7QA 4NWBA 4JBCA 4ERDA 4DMZA 3L4BC 1UZHA 3MMBA 3TP2A 4H4MB 4R25A 2Z56B 1UVIA 3CCJS 1SKUB 4WCEQ 3NWGA 2FPHX 2X1GA 3D67A 1FRKA 1E6VB 4L3NA 2CJ9A 2AMCB 2H65B 5CCMA 2R7OA 1EKRA 2E7VA 3MUVP 3GIMA 3F0NA 4MJKA 3G8QA 2KL8A 2FHJA 1K73T 4K4YA 3Q8YA 4C98A 4HACB 3KG0A 1IBKJ 5A2QY 1FJGF 1J2VA 1VISA 3HJVA 3O1LA 4NLDA 4MYTA 1H73A 2H9ZA 3KXDA 1SJ1A 1HBUB 1UVJA 4DX5A 4NCBA 1FJCA 3GB0A 4WE1B 5IT9Y 3T1HJ 3ENQA 1RABB 4LF8F 2YNIA 1L5UA 5KFIA 3IGNA 1NXIA 3J81U 4Y6IA 3PO5A 3PIOQ 1X60A 4NLSA 3R9LA 3TEHB 2ZBCA 1TU0B 4RBVA 1LWCA 1P1TA 2ACYA 2VKZG 3MR3A 4DSEA 4WFAQ 4OI2A 3NGTA 2LYVA 4TYAA 1IQZA 5HP1A 2C3PA 5KOXA 2CFXA 2QV6A 1HQEB 1VIOA 4GKKJ 1HBOA 5LXYA 1RBAA 2AEFA 3G6VA 2WCXA 3BGFA 4N77A 1KSPA 2CQBA 4WTYA 4DUTA 3H25A 2UV8G 2HS0A 2UVRA 4F4AA 3PEJA 3Q83A 1SKRA 1S49A 2C2EA 4F4WA 4M63A 3DI6B 1T7PA 2BKNA 4M5GA 2B7BB 1HQUB 4J90A 4F7VA 2OSQA 1JLGB 2GJFA 1B64A 5CZVA 4YEAA 2NXUA 3MHYA 4DSIA 4OYIA 2VG7A 1URNA 1UAWA 4BC9A 4KQZA 4NCAA 2FC9A 3AOCA 4JV1A 4X4PA 5FDLA 1ZM2A 2J5AA 3CMQA 4RW9B 2O1PA 1S6PA 4LRCA 5B0GA 5LXRA 1KLMB 4I4BA 4ZJQA 1BLUA 1BWVA 3QGHA 1Q4RA 2NUUG 5GVQA 1UZDA 3B78A 5ETPA 3VV2B 4DV7J 2XLIA 1S9EA 1X5SA 2C42A 1YZ6A 2ZNZA 3CJRA 2LDYA 5KT6A 3DU6A 2M4MA 2ADBA 2FHKA 2AV5A 3MTKA 1EETB 1FX4A 1X5TA 2NXJA 3VALA 1DY3A 3A12A 1NDLA 3T41A 4DR6J 3V4MA 2DK2A 2QLJB 3AJ2A 4KKOA 3JTOA 4ZCIA 2XCAA 1SH0A 1VBKA 4LREA 1HWUA 3MEKA 4E2FB 3DRXA 2IM0A 5A8KA 3RAMA 4DLEA 3IWNC 2KYXA 1FFGB 1VBYA 3P45B 4G6VB 4F0MA 8ATCB 2DXDA 1NPKA 3W2VB 2ZH4A 1GXUA 2G0CA 3IR7B 1XR7A 4MK9A 2QMXA 3G86A 2PMZD 3D0HE 4TXSA 1WHYA 2HHSA 2R2RA 4G1QB 5IWAJ 3EM1A 3NGRA 4C2MA 2ZWPA 4B02A 1X9MA 3CULA 2VU5A 1RHMB 4BHQA 5F8MA 3GJRB 4RO0A 2BE2B 1HNZJ 2QLWA 3UE2A 2WOMB 4OL8A 1YX2A 4ZMMA 2MQPA 4CNZA 5LMNJ 4IDKB 3ENWA 3AXMA 3POTA 2NCKL 1N52B 3AD9C 2KTQA 3R2CJ 1SPBP 1JNZB 2XMMA 3MCOA 2XEXA 3RJMB 2VJVA 1Q79A 3NG8A 1CJKA 4WYLA 2A1BA 2VUGA 2CJXB 1RYRA 2HFOA 2XTJP 1TUVA 8AT1B 2D9OA 4IQXA 3RZAA 4ELTA 1SC4B 2DY1A 2ZH7A 4K59A 2KXNB 1FO1A 5IFMA 2J0SD 2GIRA 3UR0A 2EPIA 2CJBA 4ZITA 3KJQB 4FF3A 2YKNA 1HW8A 1Y7PA 1WNEA 2Q6BA 3IR6B 3Q8RB 3TVYA 2UXBJ 2YNHB 3TI0A 4HL9A 1RYSA 2WAQD 4IOAQ 2D41A 2MKJA 2DRDA 1X9WA 1RI7A 5B0BA 5KFAA 2VFRA 3R5CA 3N0VA 1CC7A 2CJKA 1SV5A 4CLWA 1YGYA 3PG9A 1NLKL 3BR9A 3HVAA 1D09B 1S77D 4DU7A 4HTIA 5DO2A 3RAQA 5K8NA 4TKTA 4ZLNA 1GQEA 1RAHB 2OMOA 3KHLA 3VGTA 3AX5A 3MGJA 1X4EA 3GIIA 1CJVA 5CAAA 2V8DA 1WACA 4BC7A 3KK2B 2KDOA 4JI3J 2Y3YA 1X4AA 1HBMB 5DS7A 1FNXH 1RUSA 4ZP8A 3TA0A 1IWAA 5KT3A 4X4OA 1F9HA 1FK9B 3OHBA 1W2BR 3EGWB 4LUBA 2LQ5A 3Q2TC 3RB4A 1VHIA 1DTTB 5IT0A 4NLXA 1REVB 3T6BA 3THVA 3GR1A 3CMAS 5D0HA 1RAFB 2RS2A 3A8KA 1I94J 2OGUA 1H0HB 3CJ8A 3U27A 2N7YA 1ZAXA 4F0HA 3OV7A 3H59A 4OMFG 4KGMA 4ZVUB 1X31C 2HHQA 1VS3A 4A8MP 1ZETA 2BE7D 2FUG9 4KY3A 2PA3A 1K47A 2VODA 4WXOA 2P8IA 3G6XA 4DV4J 4RW7B 4RWWA 5T41A 5IXUA 5D3GB 2WK4A 2U1AA 3D5MA 4CYUA 5ITHA 1N32J 3TARA 1HNIA 3VQTA 3CD7A 2ZNYA 3I82A 5EGYA 1DLOA 4K4UA 3U1LA 3DXSX 4I56A 2IYGA 1YRXA 3IA0A 1WF2A 2EG1A 2BVZA 2ZHOA 1S79A 2XI2A 1R8PA 1PYOB 1EX8A 3L09A 4P52A 3NGKA 4S0MA 3BN7A 4QPTA 4RKUC 4USUA 3GJQB 4DCOB 2QFIA 2MYFA 4CLPA 3ZZYA 1RCOB 4BBYA 4CLZA 4IO9Q 1TTHB 2BJ7A 3CJ5A 5CYMB 1MWZA 4ID8A 4DCPB 1UEUA 3UVJA 3CCWA 3DDNA 4CZCA 1D8ZA 2FVRA 4LRFA 3CB4A 5HSPA 5A6PA 3TO8A 3OTEA 1RCXB 3C15A 2RKIB 3T5HA 2RILA 1NSAA 4AQYJ 1YIJS 4QBUA 1MROA 1UVMA 4HEA9 1IKYB 2HEKA 3G96A 4PUOA 1VQ8S 3M2VA 1LFPA 2V4QA 2FGCA 4OX7A 1SXLA 1YBAA 2DR7A 2Z57B 3K2YA 4GC7A 3D1QA 1M5VC 4GKJJ 4LR8A 3AT1B 4ES3A 1Q95G 3G4SS 3GG0A 2V8HA 4YS2A 1YJ9S 1RT6A 2KXHA 3A8JA 3ZZUA 2R2TA 2V34A 5HVGA 4DBQA 3MM8A 3W9IA 1JJ2R 3D6MB 2ATCB 4Z37A 1RK8A 2R7VA 1PJ5A 1VI7A 3IWLA 2B8PA 1JKHA 1X4FA 1F5AA 3J7YI 2DNYA 3M8QB 1S1XA 2B0GA 2JOQA 1NK6A 4DF8A 3DNCA 4GKKF 5DG7A 2E9RX 1VC5A 4U9RA 5B08A 4RU2A 1QLNA 1RHJB 4DSLA 1ZYQA 1T95A 2ASYA 1KDNA 3W63A 2R7TA 2M3DA 4EBCA 4E0DA 3TRGA 2G0IA 4DG1A 2MEWA 4A8OA 3R5JB 3D66A 3VAGA 3RRHA 2FJAB 3PX4A 2DEJA 3ISND 3MD3A 1VQOS 5IS2A 2LECA 3FK4A 1ULRA 4NMXA 3KLEA 4WYWA 1S9FA 2QT7A 3SZ2A 2GNKA 5CYJA 3T5LA 1FWLA 1F2GA 4LSNA 2HHTA 3ENVA 2ABYA 1HHTP 2VH7A 4OYAA 4NRUA 2DXEA 4F0KA 3LOUA 2MKIA 4DV3J 2UUAJ 3UDVA 2XTDA 1VCTA 1PIEA 4JV5J 3V81A 4C4WA 1WC6A 2L9NA 4J9LA 2YVSA 5DQHA 5KFYA 3H0PA 1UVLA 1M1KT 5D78A 4DV7F 4DXLA 1CLFA 1N6QB 4B3MJ 5LMUJ 3GZ7A 4JYAJ 2W24A 3CCZA 4ANCA 2I9SA 2MZTA 3KYLA 3GILA 2OD4A 3DRRB 1OPZA 2V1TA 3Q2SC 3SDEA 3OXFA 3D0IE 2JWNA 4IR1A 4QJVA 3NBPA 2M5YA 4LBPA 1RHRB 1GMWD 1M90T 4ZIVA 5K8MA 2RDIA 4NCGB 4USVA 3ITHA 2ZJPQ 2UXCJ 1FEEA 1HI8A 1JJ4A 1C0TB 3EJMA 2JX2A 3LP2A 4TU7A 1SL2A 3U7JA 1SQGA 2B9YA 2F65A 3I56S 3EPIA 1H2VZ 2AW0A 2HFSA 1S6PB 4K4TA 3QSYB 1Q8KA 3DMJA 2AJ2A 2Y0BB 2AKWB 3D68A 1RAAB 2CKWA 4PWUA 4QIFA 1EP4B 2Y0SD 4I6WA 2Q1LA 1UWBA 2XGQA 2H4WB 1KWMA 2DIUA 1HNZF 1NMEB 4OHXA 5LMNF 3JSMA 2B56A 2E5HA 3MMAA 2XMVA 4DPWA 3J7A1 1TELA 3KHGA 3OQ2A 3VCDA 2J0XA 2NYIA 4DFKA 2NPIA 3HHLC 4RW6A 4C8OA 1BY9A 3GQCA 4RBUA 5A8KB 1UFKA 1IKXB 2KJWA 4LRDA 3TR5A 2CQGA 4NASA 1C0UB 1RA7A 2BRKA 3PJ9A 4I6AA 1O0PA 1FTCA 4EO6A 1YVFA 1M5HA 2KRBA 2HK3A 3AAWB 2FZCB 2ZZTA 2MZSA 2E9TA 2MB0B 1D8YA 3MD1A 2WW4A 1WJ9A 3G87A 1G3OA 4AYBD 4ED1A 5GADU 1TK0A 1S57A 1REGX 5H9FJ 1FD2A 1FE4A 4EEYA 1AZSB 2G2ZA 4CT9A 2POKA 4Q2MA 1H3DA 4HH1A 2B3TB 3KOAA 4FN5A 2UXBF 5IT4A 3PRBA 4B9NA 1RGVA 1F3VA 1OSCA 3NAHA 3QO9B 5B0AA 1MU2A 2XGPA 5I42A 3K57A 5DDRC 1NSKL 2XNQA 1ZAVA 3Q86A 4M5HA 5DDPC 4DCJB 4WP3A 4P73A 2I38A 4CO3A 4ECVA 2ROEA 1NK0A 1JLCB 3IN5A 3NS7B 2EKYA 3D54A 5HROA 1KVKA 2RJZA 1PBAA 3D2WA 4OZ3A 2VICA 2H5JB 4NYZA 3NMAA 4BWMA 1N8RT 4D3HA 3HHLD 2B9WA 5JXSA 1QAXA 2CPIA 1P6TA 3HFVA 4IH7A 3FFIA 3DYAA 2HIQA 4B9SA 1RWWB 3UFCX 4Q5VA 2JL9A 2YKQA 4OFZA 4J9PA 5ETVA 1R8CA 3ZNUA 1HFEL 3OLBA 1I94F 2W9BB 4X66F 3IAM9 1SVDA 3PHEA 4PG6A 4O44B 3TX0A 4F3OA 1QSYA 4JI8F 2PMWA 2MLYA 3PX6A 2DB1A 2LP4A 4KV8A 5CQGA 4DV4F 1G4CA 4J9SA 4WKYA 3IRXA 1N32F 3SFGA 1NO8A 4A8FA 5L8RC 1FKOB 1UPPA 3TZXA 3SMZA 1HHSA 1S1VA 1S1WB 3X1LB 1VLYA 5DRKA 4KB7A 2F40A 3BQ2A 3HX9A 3OFGA 1RTIB 4NL5A 3T9ZA 2H51B 1G6BA 2NUHA 2JLGA 1NM2A 4P9SA 3OTOJ 5ETKA 2ZJRQ 2R7RA 1WF1A 1S0VA 1C4CA 2FJXA 2R7WA 1RTJA 1XBWA 2OUGA 3PFOA 2W2OP 3AQOA 4WFZA 3MM5A 2OLWA 5K14A 2DGWA 1Y3JA 3N6MA 2DEIA 5KFSA 1GTEA 1TR0A 1SH3A 7FD1A 4C8YA 1XR5A 4QWCA 4Y3CA 3CJ3A 2KXFA 3MPWA 2AJ0A 3KMQA 3KLVA 3PW0A 2O3DA 2NPFA 4TU9A 4AQYF 2FD2A 2I1RA 3I0SA 5ETSA 1M5PC 3W5XA 4RW8B 3QT7A 1NSQA 4CLYA 2ZBRA 1SC1B 3KKFA 3MPVA 4ALZA 3DGPA 3MEDA 3I0RB 3U1NA 3D6TB 4WFXA 5E3RA 3C16A 3TEGA 3LP1B 3UNGC 1S5ZA 4GKJF 1N0UA 4ZVOB 4OIXA 2VQFF 2VD3A 4K5SA 3BKUA 4QWDA 4X4UA 4ZJOA 3W5ZA 5F41A 4ILMA 1X0PA 1NPRA 4DV2F 4YQWA 1XTZA 4LFCF 2CNKB 1HI1A 4O4GB 4YDDB 5AJ3J 3MM7B 3MCSA 2ROPA 2MSTA 5CD4H 4ENOA 2XS2A 3GIKA 2GZOA 3OL7A 2EW9A 3NS5A 1R0AA 1U1MA 2JC0A 1KR4A 3C46A 3C15B 4OX9J 5C25B 3CE8A 2VB6A 1KFSA 3GFYA 2M52A 1Y9OA 4WP9A 2JH3A 3CD0A 1TVRA 4O4RA 4Q7AA 5LJ5Y 2OEJA 3UCZP 2DKOB 1CBKA 2HHHJ 4NE9C 4KYZA 1TV6B 4P2MA 4DR3J 4YOEA 5T7LA 5A0YA 1U09A 3V2UC 1CS4A 3FBFA 3AODA 1AUSL 3WDOA 2IVMA 1CULA 3J81Y 4TVAB 4D3GA 3G8SA 5EN1A 1U0HA 6AT1B 3KJNB 1Z2ZA 4DV3F 1L3UA 4LSLA 3LWLA 1LKZA 3PKYA 3UDLA 1WTFA 5A8RA 1V6HA 2QA4S 4B3OA 3QT8A 1WC1A 4JI4J 4M5NA 1GNKA 1IKVB 1R6VA 2VPZB 2CQHA 4DX8H 3TUPA 1TL1A 2KT5A 1O5JA 1QUVA 5AE3A 2I0XA 4QIWD 1S72S 4KHMA 1P9YA 4J9KA 2GQCA 3LP0B 4B3MF 5LMUF 4EBDA 3OPKA 3NY0A 5E33A 1S4EA 2JEIA 4URQU 4HVZA 1U2CA 3DOMB 4FBUA 2LU2A 3C6UB 5IV3A 4IH6A 3UR3C 5ETOA 2R7UA 3KDNA 3KFWX 4ECXA 1TL4A 4DL0C 3DRSB 4BWJA 2UXCF 3QLHB 3CPWR 1W26A 4IO1A 3FUYA 4USIA 4IG3B 1QTNB 1NDKA 2ZH1A 4NLPA 3PCOB 4CLTA 2ZEJA 2UV8A 2DRBA 2FY1A 3TX8A 4R8UB 3ZZTA 2YQ0A 1QE1B 3HHDA 1Y10A 1X4DA 1CJUA 1VQYA 1MW7A 3DRPA 2DISA 1RSCA 1S48A 5IM0A 3EGZA 1TL7B 5B0CA 2GVZB 3I96A 4RZRA 1RWPB 3RR8A 1VQPS 2UUTA 5DG8A 1VR6A 1RU2A 3OW2R 2J9EA 1CEZA 3IP0A 4XPEA 5ETNA 2DPJA 2ASJA 5EWEA 3E01A 4M95A 5HBMA 2KM8B 1MMDA 4P75A 3KUEA 2ZVSA 4ANEA 2L41A 3NP5A 1BXNA 2W9CA 1H6KX 4Y0FA 2HNYB 3T1AA 2Q66A 2V4JA 4CO1A 3GSDA 1T0TV 2VV5A 3BGRA 5F8LA 3N5BA 4NLUA 3MDFA 1F5BA 4EK2A 3WC2A 1RT7A 1RISA 2P6SA 5J2NB 1HWIA 4LVNP 2RF2B 1E6YA 3BR8A 4ID5A 3FSIA 3HJFA 3DKDA 2YQ1A 2XO7A 3NCPA 2ZITA 2RQKA 3B4MA 4Y2MA 1PO6A 3VF0B 3M8PB 5ETMA 3KNGA 4C0BA 2CJAA 1EZZB 5J1PA 4I0WA 2R8IA 4O3SA 4C6AA 4OZ5A 2OAUA 4EU0A 5G0RB 3JXOA 1BQNB 1TFWA 2UUCJ 4UOCA 5JMNA 2B43A 4QR1A 2M8DB 2WVFA 4Q0BB 3T9NA 3CJKB 2N3LA 2OFGX 2RD5C 3CO0P 2A3JA 4CT8A 3QIPA 2DNGA 3CDUA 2XY7A 4GVBA 1TUGB 3QFWA 1TKDA 2C3MA 3A8IA 3TNVA 4IQMA 2V4RA 2CPFA 1VK8A 1XNRJ 3GPAA 2R8JA 3OR2B 1Y5NB 4ICLA 5J2QB 3ETMA 1PAEX 5KFXA 2DGTA 4ECQA 3LW5C 4NXMJ 3ILOA 1GX5A 4HKQA 5C24B 1RWOB 1WG1A 2CQPA 1NH7A 1SJQA 4LR7A 5KTQA 2YNGB 2J7WA 1WSRA 3HPOA 5I3QA 5A8WB 2E66A 1XEZA 4IYQA 1C4AA 3W62A 4OI6A 2ZUGA 2XWYA 2RQCA 4OYOA 3M32B 1CQNA 5DLFA 3KLFB 2L48A 4UW2A 5LOQA 2BQRA 4QYZK 1F6TA 2Y1LB 4LBIA 4QW8A 3KWMA 4UQTA 1C2PA 4EFAC 4YR3A 2DO0A 1FDAA 4P7TA 3M8SA 2XYGB 1ZOTA 1HNXJ 2W01A 3EX7B 1JLBA 1OY9A 1KFDA 2ZD1A 1U1RA 1H74A 3RTVA 4HHJA 3HDSA 1FKPA 4B9MA 5BYSA 4QWEA 3OTOF 1WKKA 3KHHA 2ACMA 3B8HA 2RS8A 4JI7J 4JI1F 4NXNJ 2C2OB 2QMUB 2C3YA 3AQPA 4ITSA 4G3IA 3GFXA 2GJIA 4DUZJ 2NR0A 3A4TA 2OPRA 2VF3A 3OHAA 3ZZRA 1IUJA 2VA3A 4ZN3A 4I6YA 4FYYB 1U8WA 2AQ4A 2VASA 2ZHAA 2GC8A 5KFEA 4NEYA 3FRZA 3NKYA 4KV8B 5HN0A 1WOOA 1Z2LA 1K1QA 4N5SA 4V19J 3CDEA 1TKTB 4OYPA 3IRXB 1CG2A 2MJUA 3W3SA 3DOLA 3H7HB 3TWZA 2G1DA 1T03B 3DLEA 4YB1P 2VG5B 1TKZA 2PGCA 1S1VB 2IPOB 4IRCA 4OQJA 4HR2A 1T11A 2V6AA 4ZCKA 2AF6A 2VL1A 3EDRB 1T05B 2QLBB 3R7NB 4FXWA 1RT3A 4HHUA 1NK4A 1YI2S 2HHUA 1SJ4P 5IC6B 4MIWA 3DDIA 3MR5A 2BM0A 1S9GB 1RAEB 2BJ3A 3UD4P 3BGLA 3MF5A 2CQIA 1OMSA 5MAOA 3EPGA 1ZZNA 1Q82T 3N5FA 3L7PA 4QPXA 2XWXA 3M6WA 4P71A 4KPCA 4C3MA 4K2XA 4LF5J 2UUWA 1JLFA 5AXMA 3L9ZA 2V5HG 3GWCA 4RNFA 2GVDA 3CJ2A 4OX9F 2KU7A 4QU6A 3VHQA 3U02A 3MXHP 2P6TA 1KRPA 2FZKB 3BV8A 3H4BA 4FXDA 1YDLA 2FLLA 4DR5F 4YY3J 1JLAA 4FF4A 5IOLA 3C16B 3PVXA 3PIPQ 2HHHF 3IG1A 3NL0A 4DR3F 2ATLA 2LA4A 2A10A 2PFDA 1S6UA 4NMLA 5KFVA 5BR8J 1ITPA 4X4NA 2Y1RI 3CD6S 2OHDA 4FBTA 5LL6d 1KHVA 3J7YU 1TL3A 4NLYA 1GMWA 2QYGA 2WONA 2ZOGA 2IJFA 3W7BA 3NCRA 1UA0A 3FMBA 4PXBA 1N33F 3N9UC 4EUVA 3MFHA 1WC4A 2QIFA 2DR9A 3MECA 3SSQA 4TN2A 5KG6A 4B3SJ 1SQEA 5B0DA 3SQGB 2IBOA 4IFYB 5KG3A 3M30A 1FJGJ 4DQQA 3KG1A 1KVJA 2HBZB 2QN6B 3R2DJ 3KJVB 1ROFA 1IWGA 3PW7A 3QAUA 3PRDA 4USTA 3GV8B 2ZE2B 3KJFB 4NYPA 1G7CB 4LF8J 5F3ZA 4KGXB 2M88A 1U26A 2CA9A 4I2PA 3DXBA 5KFOA 5FD1A 2XZDB 3HFZB 1I5OB 2LQ9A 3SEOA 2I2YA 5KT4A 1U0HB 1N5YA 4RPFA 5GAEI 2AHOB 4L72B 1SIWB 4M5IA 5ETQA 1MWYA 4CTAA 1KVIA 3MM6B 2GMLA 3AA9A 4B3OB 3I5CA 2JZ5A 3UDEA 4QIGA 3OL8A 5AXNA 4USKA 4I7FA 4CM0A 2A6MA 2OPSB 4ZDNA 3GJTB 3MUTP 4YDXA 2PI5A 2JVOA 3JB9k 2PT0A 4HYKA 5D4LA 4WPAA 3D4JA 3K89A 1U1QA 1J5OB 5F8HA 3EMTA 2HVHA 5KOWA 1T94A 3JYTB 1QVGR 1RTHA 2ZHBA 4IFVA 1XQIA 3IGVA 3RAXA 3BSAA 3DLGA 3HZGA 3GR0A 3F41A 4YR0A 4V1Ak 2CIMA 1S6QA 2M9KA 3LO3A 2WB4A 1JLQA 4OZ2A 3NMRA 3LPYA 1IR0A 5KFDA 2XSFA 1S0OA 4F4ZA 4ZPCA 2VG6B 2JC1A 4C8ZA 2PC6A 3CDAA 1UEVA 2W2MP 1SL0A 3GE9A 1LW0B 3KNAA 1S59A 5L1IA 3LTOA 2FQQB 5HMYA 1RWKB 2CDRB 2GGPA 2QG9B 5CD4A 4PWDA 2XM3A 3FZ2A 5DG9A 2AJQA 2B5JB 3FC9A 3SIPB 3T1YF 3HI9A 4NPOA 4FYVB 4RR5A 3GYGA 4J37A 3Q8PB 2DR5A 4DQPA 2W4DA 1AA1B 2C2KB 3HHLA 1S1TB 3PR5B 5K9FA 3MEGA 2QO3A 2FC8A 1LWEA 3DLLQ 4HT5A 1BUXA 4PQUB 5KG2A 4NI2B 1AFIA 4EO8A 5LJ3Y 4FPIA 5IC4B 1KS2A 3CDBA 1VQKS 4NLQA 1YG0A 4U95A 3MEEA 4LBHA 4OYWA 3KK3A 1QTMA 1RT2A 4O23A 1HYSA 4X4VA 5E41A 2WTFA 1SUQA 3R1LA 3KK1A 2VDHA 4KHRA 3G2XA 1FFSB 4ED8A 2G4BA 2H1YA 2LU1A 3CNQP 4NRTA 3HHNB 3RR7A 4QCLA 4DL6A 1SC6A 3SCJE 4FP9A 4LSZB 5H9EK 1S97A 4LF1A 5M2PA 5DDOC 3G82B 2KO1A 2FJEB 3NOCA 5HJXA 2DNZA 3PYFA 2EWHA 1SL1A 3P6YC 1WI8A 4OYZA 3HXMA 1VRTB 3FQKA 5BXIA 4LFAJ 2WVBA 2BANA 1Y00A 3C2PA 1DTQB 2FY8A 1J27A 3DLHA 2ZOMA 2DJWA 2P5VA 4LF6F 1KHWA 3A1YG 3HULA 3V4IA 3BZQA 3KLHB 3MM9A 1Q8LA 1NCLA 3CC4S 2EBGA 1T3NA 1HNXF 2GFFA 3TUIC 3QBCA 2IM2A 1SQFA 4R5PB 5J2PA 3FEXB 2HNDA 3OUYA 5LM7E 1VHFA 4F2SA 2N4DA 4J9OA 4N8NA 3ELHA 3EZ5A 1HPZA 2HGNA 4YHHJ 1MSWD 3WIUA 1JMTA 1QVFR 4KBIA 4LF4J 1FEHA 1RKJA 4FPRA 3CCTA 4ECUA 3QZ8A 1O6XA 2DNQA 1RT4B 3FEYB 1YLXA 4NXNF 3H98A 3ZC4A 4QR0A 1LWFA 1Q8IA 3AXKA 5D4PA 3CCUS 1LW2B 2AP6A 3IO1A 1JB0C 2V67A 2QEXS 2ASLA 1X0FA 4M8LA 3E3XA 5KFUA 2K2PA 2D3UA 3SI8A 1RQ0A 1HBNB 2F8HA 2OPPA 2CRLA 1U48A 1VC6A 2J0WA 4UOGA 1JLBB 1L3TA 1RE1B 2F8EX 1WG4A 2OO4A 2MKSA 2QLFB 4LIRA 2EFVA 4X4QA 4DL2A 2RDJA 1P8GA 1N34J 4PXEA 1N4LA 2A6OA 4KGZB 1XC9A 1VC0A 3ILIA 3BS9A 1I51B 3NXZA 1U1OA 3VGVA 3DLBA 3QSIA 2CDQA 4OV1A 3N01A 2CG8A 1FF2A 3R5AA 2VA2A 4PPZA 4FNHA 1RHUB 4N8OA 5KG5A 3UN3A 3R7SB 2FHJD 2HFZA 1ZA1B 2IA6A 1JLEB 1TKXA 1R27B 2CNOB 2W2QP 8RUCA 4FVCA 4NLVA 2QJ3A 4DDFA 3M2UA 1NB7A 1FESA 4ZLJA 4LF5F 4AD6A 2AJFE 3M8RA 3KLIA 5K8OA 1U1NA 3TZZA 2F63A 1S6OA 1KKHA 1K0VA 2VQEJ 2DNLA 4M5DB 1UL3A 2MZRA 3KUHA 2BABA 1HHQA 2D3OR 3HSGA 2AT1B 1HLWA 1W7WA 3E2EA 2LCWA 2J9DE 4WF9Q 2HZVA 4QOTA 4CQ1A 1SCJB 1RWNB 3K5MA 4ECTA 5HLFB 3VAHA 4KT0C 3HKZD 4EMDA 1YBTA 4KPYA 1T9VA 5BR8F 1KQKA 3ZZ0A 2HFNA 4KO0B 3LALA 5EX0A 3M9OB 4MTPA 2OSRA 2B6AB 2MKHA 1KD1T 4DPUA 3DOKA 1H2UX 2DPIA 3MAAA 2I5JA 3TAMA 5KFHA 4CRJA 2EK1A 1XN9A 2HNZB 2ASDA 5CYQA 3OR1A 1OWXA 1XNQF 4B3SF 3DDKA 5J1EA 4JI0F 4B3RJ 4W4MA 3HD1A 1X9SA 3KDOA 1VYAA 2OPQA 2BEFA 1UW9A 1WG5A 1RTDA 3J81j 3HVWA 2K1RB 5JVHQ 2YKMA 2BOAA 4L74A 5EDWA 3HVTB 4PG7A 4NZ7A 2IBKA 1UVNA 2F1FA 1G1XA 2YNFB 3MI7X 2OELA 1HWKA 3LPEA 1WKLA 5KT2A 1T8EA 1V5IB 4MMOA 2JJ4D 2LVWA 3VVUA 1VJWA 3KLGA 3C66A 4DHVA 2WONB 4JI6J 1B0PA 1RT1B 2XY5A 3IMQJ 3DLKA 4PG5A 4ELUA 2IAJA 1EQMA 1Q81T 3JTPA 1F1BB 3PACA 2RE1A 4ZLLA 3TA1A 5C42B 2CAJA 1MMLA 4RW4A 1OJ4A 2B4OA 3SCLE 2IM1A 5DZ6A 1NKCA 3OXLA 3AOBA 1AB8A 5F0WA 5CA5A 3ZTSA 2BR0A 5DM7Q 3KMSA 2IM3A 4MFBA 2VHGA 2BZ2A 5JJBA 5AE2A 4A8YA 1WEZA 2OKQA 3RRGA 4X2BA 4F2RA 3P5BP 1X4BA 1V5VA 1F5CA 4A8XA 3C14A 1WC5A 5FIIA 1FCAA 4KE5A 1R7IA 1BWEA 3K8WA 2XYPB 2MLZA 2BQUA 1LNQA 4U7UD 4QR2A 3Q8UA 2PMHA 3UNYA 3K7RA 4K4ZA 3TZWA 2W2NP 2R8HA 2OFHX 3FKBA 4PXCA 2RH3A 4CI0B 3ZTPA 2XULA 2XSJA 3D1HA 1HMVB 1WI6A 1R8BA 1WDTA 2R8KA 2QA2A 2IY5B 2ZWOA 4F25A 3H5UA 2HZAA 3D28A 4CLLA 2PIIA 3R7BB 4Q43A 3DM2B 1NEEA 2XMJA 1VQMS 4K4SA 2QL5B 5BJRA 2HWIA 4TNOA 3OT9A 3RB0A 4WFYA 4C0OC 3O6QA 2BKOA 3I31A 2YX1A 3UI3A 3W1YC 1ZS6A 1BQMB 3NLCA 2AEMA 3PJXA 1NK5A 4WFNQ 2D1CA 1JXVA 2V63A 1DAXA 1HNVA 4TY8A 1PKUA 3C6TA 4AL6A 3CC2S 2BJ1A 1U6ZA 2C2DA 3MMCA 3K8VA 4P2FA 1EKSA 2QYCA 1W2IA 3M05A 4O3OA 3ET6A 1VQSA 4NX9A 3DRYA 4O3QA 5F3TA 2OI2A 1PJ7A 4LF9F 3RW6A 3MOJB 1KC8T 3DHWC 1IKWA 1XWLA 3PNIA 4F4XA 3G8TA 2CPDA 3HHEA 3RB3A 3OFFA 1V9OA 3JTNA 4DPTA 1WC0A 4H4OB 4P10A 1HL6A 3CIZA 3D7SB 1HNWF 1WHXA 2O5DA 4H4MA 3HKWA 2WRMA 3I4PA 3BDEA 2DY9A 2PE8A 1C1BB 2V9WA 3N6NA 4UF4A 2IIHA 4N7TA 1LK7A 4LFAF 3R1HA 5RUBA 2J9DA 1VRUB 2H5EA 1E6VA 2Z2LA 3HZEA 1U7LA 2BYCA 4KFBB 1AW0A 4PABA 3SQOP 2ZOFA 2QSFA 3K5PA 4HACA 3KHRA 5KFGA 3NAIA 2HK2A 2KN4A 4C11B 4OI1A 1RT2B 2EVZA 2HBRB 3FMWA 2KZZA 2VPWB 2C3UA 4YP3A 5B09A 4ZVQB 4YFUA 1PSDA 1EJ7L 1HBUA 4B3TJ 4DSFA 2J0QD 3QRPA 5IQ6A 4WE1A 3R27A 5CHCB 3H20A 3BJYA 2FTRA 4YHHF 3CMES 3IS9B 4ED6A 1B0TA 4LF4F 1WHVA 5CZXA 1FDDA 2XMAA 4KRWA 2UVWA 1TFYA 3L7OA 4DX6A 3V6DB 1S7HA 2YBVA 4MK8A 5J2MA 3P5TL 2V0NA 3I87A 3OJUA 1HQEA 4WU2A 3ZZZA 1D3WA 2ZH5A 2DITA 1FRMA 5HAOA 2VBYA 3W2WB 4DS5A 3CCSS 3PW4A 2ZC4A 2PEHA 1RWVB 2QTWA 1R43A 3VZIA 2AZ3A 5FLXU 4FKXA 3SBMA 2UU9J 4ZVHA 3BGUA 4DX7A 3SSRA 2DHXA 5H1SV 2DH7A 2K06A 3DI6A 3R8YA 1TP7A 1HQUA 4DS4A 3VAIA 1JLGA 1N34F 1A9NB 2VPXB 4TLQA 2DCLA 2KYZA 2OEMA 2KH9A 4ED2A 3IBFB 1FI4A 4ZLPA 1RACB 1RB0A 1Y11A 2HQ3A 3SCKE 1ZM3A 4ZPVR 4DV1F 2QSWA 4EWTA 2Z2MA 3ULHA 4ETXA 4ECSA 4DZ6A 2KHCA 4X66J 3PRVA 1R6YA 4RW9A 2RRAA 2G1HA 2UUBJ 3MUMP 1WDDA 3QYYA 3GLJA 4O0NA 4K4WA 1KLMA 3Q23A 4JI8J 2HHVA 5B0FA 4G1PA 3QAEA 3I4HX 4MYUA 5HQMA 4ED0A 3SSSA 3HK2A 4CP5A 2HMIB 1F9FA 4CO0A 2KM8C 2JNJA 1TMMA 2MHNA 1U24A 2VQEF 2IC3B 2Z2YB 1EETA 2DNOA 2R4FA 2C2MB 1XR6A 4JUZA 3D1OA 4EGLA 4Z7YA 5GMEA 3MR7A 2VDIA 2BMBA 4A47A 4ECWA 2AGOA 5HJYA 2DR6A 3TJ9A 3HT3A 1N36J 2LA6A 1YJWS 1VQ7S 4I2QB 2O66A 4TLRA 9RUBA 2B7CB 3IM9A 4DL5A 3H90A 2X51A 3ISNC 1S10A 3CCMS 3H2VE 3W2VA 3GFZA 1RT5B 3UCGA 3C19A 5M2UA 2DNPA 4G1QA 1SC3B 3QZ7A 1BGXT 1QAYA 5B7WA 2P9EA 1URRA 2HWTA 1NJZA 3LAKA 3GTYX 5HO4A 1VLOA 5E3QA 3PTWA 1H2TZ 5D4OA 2BE2A 1D9DA 4AFFA 3THTA 3RB6A 1WOPA 2W8KA 2WOMA 3LUYA 4QW9A 1WORA 2MGZB 4IDKA 4DV5J 4IG0B 5D6GA 1EAYC 3GIJA 4B3RF 5GAHI 2M7SA 1F0XA 1C1CB 3GP9A 2R2UA 2Z8QA 3V6HA 3M2RB 4ZPDA 3S7RA 2GX8A 2LEBA 1VK3A 2WVEA 2VQFJ 2YX4A 4KTQA 1M0SA 4M5JA 5KT7A 4F26A 3RYLA 4J9RA 5DJBA 2WBMA 1Z1ZA 2HURA 4B9VA 3MMBB 1ACMB 1H7XA 4K4XA 3GCWP 2YWFA 4X4TA 4U96A 5A76A 2C2RA 1EQ0A 2YKPA 4DV2J 2OTLS 4LFCJ 4ZP9A 4JI6F 2R9LA 3OTBA 1UEKA 3HLUA 2MY7A 4OV6A 3C8YA 2PD1A 5L1LA 4Q44A 2CYYA 3OR1B 1NK7A 4FF1A 2YNHA 2AGQA 4JI2J 2UZAA 5HQ8A 2X3DA 4OZ0A 2PA8D 1MMNA 4C48A 2LXUA 3IBCB 4Q45A 2CQ3A 3BKFA 5EWGA 4JI5J 2DGUA 3DLJA 3EZUA 2FJVA 5LSLA 2CWKA 4CH1A 3K59A 3HO1A 3QQCD 2V50A 2YNIB 1RLDA 2VFTA 1GMVA 5U47A 2E44A 2HSEB 2RUGA 1LWCB 2J8SA 5KFPA 4USWA 5KAKA 1R3NA 2CJQA 2IRYA 5GAEU 2JFDA 2HHWA 4KSEB 5HP1B 2D3O1 2UP1A 4DPXA 2CPXA 4PCQA 1OM2A 3RG6A 2DCUB 1HBOB 2YQ3A 2F7VA 3BREA 3BO2A 1FK9A 1VQ5S 2X1FA 1NJXA 2B4PA 3UN2A 3GV7B 2DBBA 1NBEB 3EWGA 2RUSA 4NZ0A 3ONQA 3FBEA 1YJTA 3VR1A 2VFUA 1FKAF 1HA1A 1ZM4A 1DTTA 1TUWA 4ANDA 1IBCB 1REVA 2F9DA 4A8KA 5D0RA 4OZNA 2C2NA 5E0OA 2WSFC 2MLXA 3K0JA 5C5JA 1RXOB 3MR6A 3AD8C 3EZOA 4U67Q 5K20B 2FVSA 1NZAA 3C14B 1PGZA 4PG4A 2F9JA 3QNWB 1TK8A 1X4CA 2G2OA 4L3KA 1Y3KA 2VG7B 2VOPA 1H98A 4F50A 2FJDB 3QWPA 4DFPA 5FDLB 4YB6A 4RW7A 1WSVA 5D3GA 1OS5A 4K2JA 1F9EB 1FXRA 2H3EB 2XMWA 1YKWA 3BH7B 2Q3PA 5AXLA 4DEZA 4TU8A 2WVDA 3BM7A 2YPZA 3AX3A 3T5JA 1DJ0A 4M94A 1S9EB 4AXJA 5CABA 2YWHA 3FCWA 5HATA 1RHQB 4RBTA 5E3CA 3JAMY 1U45A 3CGIA 2QL7B 4BDPA 2KFNA 4UZBA 3NEKA 3PXGa 3GYXB 5K5MA 4O3RA 1FX2A 4XPCA 3FGVA 4PKDB 4KKOB 4PQAA 1UJ6A 5CYMA 2HPUA 3ZZOA 4K8RA 3OBIA 2RT3A 4JOUA 3TUJC 3H40A 1N0VC 3CEDA 1X8DA 3TJAA 4I69A 1KOHA 1LFWA 1CPZA 1T9WA 1S4FA 3PDNA 2RKIA 3I5BA 3C6TB 3PZPA 4FYXB 3BBFA 1IKYA 3MMCB 3NOGA 2FLPA 4JP8A 2CZ9A 5DM6Q 3I6PA 4LF2A 4F67A 2AZ1A 2RHQB 5LSRA 1MLAA 2CNLB 3KUGA 3R5DA 2E5JA 4CNYA 4B3TF 3P4UB 5DQGA 3FCVA 2GIFA 3POTB 1U1LA 4X4SA 3CUNA 2HIYA 4Z7CA 2DO4A 1DRZA 2YY3A 1CJKB 2WBRA 2ZC3A 3L7UA 1NPPA 1XMOJ 1MNEA 2EG2A 3M8QA 1VGYA 3H2UB 7AT1B 4Y28C 3F73A 2ZBIA 3Q24A 4C8MA 2YWGA 2FJBB 3V6KA 1XIQA 3IXQA 3K17A 2HRYA 4K4VA 3FJ2A 1FHTA 2EBEA 2E9ZA 1T9XA 1RWXB 2EKNA 4ECZA 4K50A 1Q5VA 2F3JA 3NCQA 5DQIA 4PAAA 3AB4B 2UU9F 3EXCX 2YKNB 3LA0A 4MK7A 1UPMB 3OTDA 4OI3A 3EVWA 2J76E 2HLUA 2F8MA 1U6FA 1Q8BA 1N5SA 1FWKA 3B4DA 5HANA 1RHKB 1YWXA 1IJFB 4LT6A 4H54A 1S99A 4GVLA 5DZ7A 2NYHA 3JS9A 3RBZA 3TYTA 5I3UA 2LEAA 3M4XA 2Z30B 1SJFA 4FKYA 3BDPA 1SV5B 4OJGA 2EC0A 2D74B 3I9ZA 5J2MB 3QJJA 2RB7A 4K0KJ 3HT0A 1IQTA 2K7JA 2UUBF 2J8AA 2N3OA 3MWBA 2JSXA 1HW9A 4CLFA 4DSKA 2DNRA 4DR1J 3CSKA 1FFWB 3SV4A 5C2CA 3TZYA 3OTCA 1N6QA 1CJVB 3FBCA 2V8GA 3G71S 4WK3A 5ETTA 1X7VA 3DRRA 2Y9HA 5A6WA 3HSZA 2AGPA 1Q53A 1OIAA 2Z0GA 4NCGA 2EFQA 2WHOA 3ZZPA 1N36F 1MN9A 1C0TA 4KH1B 4JI1J 1RTZA 2CPJA 2EFPA 2YWEA 1UMJA 4E98A 2V2VA 2IHR1 4X64F 5AE1A 2CVIA 1K9MT 3A13A 2Z58B 1PBUA 1K8AT 4NLTA 4PEOA 5GAGU 1EP4A 1CC8A 1SB6A 4OHZA 4DQRA 3THPA 3OVSA 3AOAA 4ZHRA 4M1KA 2MQ8A 4AL7A 3AY0A 3AFGA 2GCFA 3OFHA 4CYUB 1GK8A 4DFJA 4EZ9A 1HNIB 1FDBA 4DV5F 2DR8A 3ENAA 5F8IA 1DLOB 2XBPA 3TANA 3R6GB 3J7AN 1YQHA 1QY7A 1RP5A 3CJSA 1IKXA 3VAKA 4LJMA 2DNMA 1C0UA 4ZVGA 4YB5A 4RU9A 4NLGA 2CPHA 3T6JA 4CLSA 3PYEA 3JSYA 4TQRA 1NJYA 3W9HA 2BW2A 2VBZA 1Y4ZB 3ZTQA 3R5GA 2O67A 2ALZA 3UVJB 1ZZFA 3BYRA 7FDRA 3VVTA 2QL9B 3QT6A 4EZ6A 1CVJA 3EGNA 4M5LA 4RUBA 1AZSA 5KG0A 1XMQJ 2MDAA 2CVEA 3KTQA 2W1BA 1OPIA 4ZVFA 4NLWA 4ECYA 5L39A 1AXQA 4ZCLA 2BOPA 2VC1A 1MROB 4M5MA 1VBZA 5HMWA 2JEJA 3H2LA 4KR0B 4PUOB 4JI2F 4CM2A 3T5KA 4LFBF 3M2VB 2MTLA 4OZJA 3OXGA 1NK8A 1FVSA 1P9QC 4DR5J 1S1UA 2V2QA 3QO9A 4HI2A 2H54B 4JB8B 4JI5F 4TQSA 3JQJA 1KOOA 1X4HA 2ZDPA 1HR0F 3CCLS 3OJSA 3GU0A 1RT6B 2XTEA 4N76A 3MM8B 3MPDA 1J5EJ 4IR9A 3SYZA 3MCMA 3B54A 2ZH8A 1JKHB 1U2RA 2IJRA 2QLXA 3SV3A 1S1XB 3MMJA 3FZBA 1JLCA 1N33J 3TOQA 2XO6A 2NXNA 1U49A 3M6VA 2V1SA 2YH0A 4BLGA 2XLJA 4UOHA 1B0VA 3HSDA 3RU0A 1WEYA 4RNNA 1KP6A 3GFHA 4Y34A 1JK9B 3S01A 4DG1B 3CC7S 3O3LA 2H5IB 4KH0B 3QMQA 3NS6A 4C97A 2EFNA 2XQCA 2EFOA 2EEYA 2X1AA 4KJIA 2ALYB 4B9LA 3KLEB 2W9BA 2XG8A 1NSPA 4O44A 3ZNJ1 2HZCA 3O2IA 2DGQA 4LR9A 3TA2A 1L3SA 5D4NA 4H4KC 1GH8A 5C2GA 3IFEA 4LSNB 2FVQA 2EC2A 2V8VA 4MKYA 3A3PB 1PAUB 3J80U 5F0UA 2NREA 1JXLA 2R8GA 1N56A 2XS7A 1VBXA 3L95X 4Q2LA 4C8NA 4L76A 2E5GA 2DVIA 2VONA 2J6SA 3HD2A 1KQSR 2DHSA 2HG4A 2ROGA 3R97A 2OIHA 4JV2A 2LEPA 3V81B 2B9EA 2M2BA 3QT5A 1FXDA 1NHUA 1FKOA 2XZ2A 1JJCB 4ATNA 1R8HA 4UQGA 1S1WA 2LXIA 4N41A 2HGMA 1D0EA 1CJTA 4ZVSB 2XTCA 1R31A 1RTIA 2PFFB 3R3TA 2W25A 2JVRA 2KFZA 5MLCV 4WP8A 3SDEB 4ZVRB 4N47A 2M70A 2KT3A 4X84A 2RU3A 1GEHA 2MKKA 3NBPB 3WZ0A 3O5TB 3NNHA 2AWZA 1EHWA 2MJNA 2K3KA 2HKEA 3ITHB 5AT1B 2PEBA 3P3DA 4CH0S 1VQ9S 2MZ1A 3LP2B 2BRLA 5J1NA 4X4RA 2BQ3A 3O44A 1OYEA 2MHEA 3BQ0A 4YUDA 3AJ1A 2NLWA 2JHEA 2DIVA 4Y00A 1R8AA 1R0CB 3DMJB 1WD6A 3EGVA 5E2QA 2KKHA 3UO0A 5KFCA 4RW8A 2OH2A 2D7SA 1GXTA 2RRNA 2BJEA 1Q1KA 3UN5A 1UWBB 1MN7A 4U8VA 4ZA1A 3I0RA 3MURP 2W2PP 2XNRA 3QJLA 3LP1A 2GJ2A 2IA0A 2ZBQA 3IC1A 4FXVA 4MIBA 3JSMB 4U7CA 3MMAB 3CJ0A 3DU5A 2MQMA 2ERRA 3CF5Q 1NDPA 3T1YJ 2QX0A 4A4JA 1SKWA 1NU4A 4RW6B 2Q43A 2VIHA 2A18A 1XMOF 2DHGA 4O4GA 2CQCA 1XMBA 2E1AA 3MM7A 2B4UA 2E1CA 2KG1A 3GONA 3D3BJ 3X3UA 5HL7Q 5H9FK 1VIXA 1FJEB 4ZP6A 5C25A 4OYBA 4PZVA 4ECRA 2NZCA 3J7Z5 2OTJS 1KNZA 1IBKF 3Q8QB 2DYAA 1NHVA 4TYBA 3CJ4A 2SXLA 3CCES 4P2XA 1MWQA 1TV6A 3T1HF 2CQ4A 3DGVA 2V2ZA 5D77A 4LQ3A 2M0GB 2MKYA 1B99A 2COLA 3JQMA 1HI0P 4ILLA 2HW3A 2JDJA 3W8PA 1UJ4A 1MU2B 1I1GA 3WQPA 4PPDA 2R3VA 5D0EA 5I42B 2J7KA 4K0KF 2QA4G 4AXIA 4USHA 2JLEA 2HQCA 4P6QA 2DNNA 4LF6J 2XMTA 1IKVA 2YTCA 1RDRA 2XC9A 4DR1F 2EXUA 3NGDA 3D0GE 2VZ9A 4J5OA 1QSSA 1Q7YT 3RBEA 2OJ3A 2DGOA 3VAJA 3LP0A 3ISZA 1T9UA 3ZTRA 1OQ6A 3S8SA 3TUZC 1NUEA 3DOMA 1LK5A 5FLXY 5HROB 2R2SA 4KC5A 3C6UA 2ZBPA 2DTJA 1GFWB 4F8RA 1W25A 4K5RA 3L3CA 3MAQA 3MPYA 4DPYA 3BSNA 2L9WA 3DRSA 3DYAB 3FFIB 3QLHA 2FVCA 1H7WA 4AE5A 3HSJA 5I3UB 4IG3A 4IOBA 2N7CA 4B17A 1LEOA 3RRKA 4HDHA 3QATA 1UVKA 1Y0HA 2L08A 2C3OA 3FVYA 2DGXA 2KZMA 4R8UA 1BD6A 3MOZA 4OZLA 3J7ZT 1QE1A 3WBZA 2GHVC 1Q0NA 2HFUA 1QSLA 3W60A 4RUCA 4OHWA 1PC5A 1TL7A 1RLCL 4WIIA 2LMIA 2GVZA 2ZVIA 5BYQA 2V9KA 2Q79A 4OI4A 1JJHA 1DBDA 2ZUAA 4ED3A 2HFVA 5E5NA 3VQSA 5IQQA 3M6UA 4DR6F 4C8LA 5ETRA 3CCVS 2QRRA 2HNYA 2KRRA 1M5SA 2E1PA 1ZAWA 4RX6A 2YKOA 2AJ1A 1FNOA 4G65A 4XK8C 1RTJB 1AFJA 1UETA 4ZOSA 1DHMA 3MM5B 1HQ2A 5K14B 3MZIA 2MZJA 4C8KA 5J2NA 5IWAF 3HFKA 1UTAA 2RF2A 4J9UE 2ZH3A 3CXCR 1PILA 1VDHA 4ZHRB 4CO4A 5EX3A 4ZVTB 2NZ4A 4OYXA 1XMQF 4UZCA 3EVMA 3M8PA 1EB0A 1ELOA 5KFNA 2LLZA 1B7YB 2E29A 2B4VA 1L3VA 2H4YB 2BUNA 4YN3B 3I0SB 2XMKA 3WIVA 2W4CA 5G0RA 3G6ES 2HQGA 5G4DA 5GAHU 2BW7A 1BQNA 3AX2A 3MPUB 2CADA 3CIMA 3DGPB 3MEDB 4LQ9A 2HQFA 4Q0BA 1H38A 2ZH2A 4NEZA 3CJKA 5KFZA 1L3KA 1HIYA 4U6PA 3HMJG 3GMGA 1FDNA 2RMLA 3R5BA 1J5EF 2B51A 2OMLA 3LGMA 1RKIA 2G13A 3OR2A 3TW0A 4PRFA 5J2QA 4W90B 4OJHA 1UWAA 4DWIA 1HWLA 3GJSB 3W9JA 5SZTA 5LSOA 5C24A 4GC6A 1R0AB 3PX0A 2IMWP 1GT8A 3ILJA 4KGVB 3HCXA 2YNGA 3H8YA 1XNQJ 5A8WA 2IDLA 1ZM9A 4JI0J 2DNKA 1ZH5A 2PO4A 4LRAA 4MAKA 3UCUP 1F2HA 1TVRB 4MKVA 2DH8A 4FZVA 2G0JA 1EARA 2XZWA 1R0BG 1S1UB 5F8NA 1T9TA 2GO8A 2BKPA 4RNHA 2DHHA 2ZZNA 3M32A 5T7LB 3KLFA 5A0YB 1ZTTA 1YTYA 1CS4B 2YWKA 4RL1A 2FHMA 4OJ1A 3VGUA 1CULB 1M5KC 3BSOA 4LMZA 1TMJA 3SXLA 4LSLB 4DN0A 4Q8FA 3OVBA 3AB2B 1D1UA 5A8RB 4JI3F 4QYZJ 3EYZA 1N5VA 4UT4A 2JLFA 3JQKA 3I9V9 3UD3P 4YR2A 4DUYJ 3BPDA 1TL1B 5KFTA 4O3NA 1QJHA 2R42A 4ZVEA 4GMKA 2HHPA 4U8YA 3ZFVA 3PJWA 1H72C 2NS1B 1Y5IB 1U1PA 4NZ6A 4DI6A 2N82B 1IBMJ 2PDAA 1RAIB 3PV8A 4ZP7A 3OVAA 1VOMA 3VZHA 5F9NA 1U2FA 3M8WA 4N56A 3NNCA 1NAQA 3NRBA 3E8OA 1RJJA 4DR4J 1FRLA 5HVHA 4AT1B 4XDDA 2DRAA 1YJVA 2HAIA 2JEGA 4URSA 3BGOP 4IOCQ 1RA6A 4ZPAA 4P72A 3GIRA 1S76D 1TKTA 2MMYA 3PM9A 1NDCA 1RZMA 3WHIA 2ZM6J 1T03A 2VG5A 4ED5A 1CJUB 3I5AA 1OY8A 3DRPB 4F04B 1CJTB 2CPYA 5IM0B 4WBFA 4RLEA 1T05A 3JAMU 3CWJA 1IM6A 1WEXA 2MPUA 2F4VJ 1LQ9A 1FA0A 3LF0A 2R7SA 5M2RA 4LIWA 5CXTA 4DZDA 3E01B 5HBMB 2VC0A 3FQLA 4DU8A 2N4CA 1D9AA 1S9GA 4ZN1A 1YRUA 2KJVA 4WXWA 2IMOA 1QM9A 2W9CB 4DR7J 3OSPA 3H5SA 4HLBA 3DC2A 2V4JB 1WWHA 3OFEA 5HMXA 2ZJQQ 4ZVPB 4ZIWA 2L3MA 2XZTB 3BGRB 3H42A 3AHPA 2MQQA 1NHKL 2JEFA 2IDEA 1EIYB 2LDIA 1IR1A 2KVQE 3CJQA 4A8QA 3DFEA 1RT7B 2BE9B 5EUHA 1B7FA 1UP1A 2IFXA 1E6YB 4XTTA 3UD5A 4O0IA 5EHHA 1K44A 4DFMA 2ILZA 4ID5B 1U25A 4F4KA 2QE5A 2BACA 2QGFB 4LF9J 2KI2A 3FCHA 5KFKA 3QIDA 9ATCB 3PW2A 3DHXA 4DPOA 2OP5A 3VGSA 4ZCMA 5DDQC 1HNWJ 3PEHA 1DQ9A 5C7PA 1N5TA 1R89A 3FSYA 2WSCC 4WTOB 2NQPA 2YKAA 1UCNA 5ETLA 2FIUA 3M6XA 1GMUA 2XY6A 3QIPB 3RUBL 4URGA 5ADZA 2XI3A 5E3PA 2E7WA 3Q0AA 4GVBB 4P2SA 5GMKa 1YJUA 4WKRA 2GQ2A 1U1KA 3T3FA 4CLKA 2PSZA 1GXLA 1QUPA 3F44A 1UW4A 1YITS 5A2QU 4ICLB 1JXEA 3SQGA 4IFYA 6FD1A 4QIEA 1WUUA 1X5PA 2CJYB 4ED4A 4UY85 3V5RA 3KG4A 3W61A 3TAPA 3QGPA 2DNHA 5IT9U 3KJVA 3Q89A 5AXKA 3FBBA 4PG8A 1RAOA 2GQQA 2ZE2A 4WIQA 3W5YA 2XMUA 2KFYA 4ER8A 2E1MC 4A46A 4M5KA 1NKEA 1XERA 2MZQA 2LQ8A 2NXEA 4RNOA 2J6TA 2K8GA 1U47A 5DGAA 1QAIA 2MSSA 2HRTA 1VMBA 4ED7A 3B6BA 2UUAF 2D9PA 4NLRA 3MM6A 5T14A 4C9DA 2XS5A 4R0JA 1Z4UA 3K5NA 4JV5F 3LWMA 4RWXA 3W64A 2ADCA 2YXLA 3VAMA 3T19A 4NA2A 2RU9A 5CCLA 2OPSA 5F8GA 1HARA 1FJ7A 3K58A 1A0OB 4DL4A 4JYAF 1OSDA 1J5OA 2ZD1B 3H5YA 4CIOA 3NWRA 4FF2A 4PXDA 4L6V3 1JWWA 3JYTA 2DGVA 1JX4A 4IRKA 2Q6CA 1DZ5A 1FKPB 5KFMA 2J6UA 5HMZA 4PWWA 2NSBA 5HQLA 4F02A 3EDQB 4E8UA 1YJRA 1TQLA 4RUAA 3CTRA 2EK6A 2I6WA 4OLPA 1DFDA 4HI1A 3M9NB 2W7PA 4DV1J 2GMJA 3PR4A 1NH8A 4I64A 2HHXA 3TVKA 2OPRB 1UA1A 3MCNA 3N28A 1NB2A 3M8ZA 1Y5LB 2VG6A 1N54B 3G9CA 5GAGI 1PYSB 2P2CB 5EWFA 1FTRA 3N6LA 3M9MB 1LW0A 2FHOB 2HS4A 1WTBA 4IH5A 4C3KA 4C0HA 2YH1A 2K3IA 4UY8T 3ICLA 3SFUA 1Q86T 3EVOA 1BMQB 2RRBA 4CH7A 3I32A 1FRXA 1FT8A 4ZK7M 2F5GA 1KQGB 2IYIA 3PFEA 2BBEA 3DOLB 2E1RA 2PN6A 3DLEB 3FDSA 2B5JA 1TKZB 5JUMA 1U0SA 4CLUA 1PG5B 2U2FA 1VQ6S 4C7QA 2XYHB 4OZ1A 2J9CA 2LQJA 3ADAC 4LVOP 4Y2CA 1RT3B 2H48B 3DN9A 4C3LA 2GIQA 2B8QA 2PI4A 1S1TA 3PYGA 1CQMA 2X1BA 2VOOA 4F3MA 1YHQS 3BB5A 4HDGA 1AT1B 1AUDA 4ZPTR 4PQUA 4L73A 1I3OB 4NI2A 3OSNA 2V2KA 4F4YA 1BQXA 1HWJA 3D9BA 3OD2A 1RAGB 2CQ1A 1Q5YA 2DD8S 3FNNA 4ELVA 2AYMA 1XK8A 4EBEA 1U6BA 4HH0A 2BJ9A 3TAQA 1V3ZA 2CXEA 2FDNA 1JLFB 1O51A 4OX8A 2GVDB 2ZH6A 2G2YA 1VJQA 3BN4A 2UVUA 1NJIT 2HVIA 1NNDA 3LQVA 2FYXA 3M1VA 2UXDJ 1ZPWX 1GX6A 2QA1A 3WC0A 5KT5A 1JLAB 3G82A 2BXJA 4ILRA 4J9VA 1AROP 4USJC 1VFJA 3IG1B 1BHNA 3HF5A 1KBRA 3AA8A 1K0TA 5KG7A 1IM4A 3PO4A 4KHPJ 1VRTA 3NGSA 4LF7J 3RBDA 1NRKA 4WJBA 3D6FB 4X62J 5L1KA 1DTQA 3AD7C 4HTJA 2MQLA 5H9EJ 3VAFA 2RNEA 5KG4A 1OO0B 4YB7A 1XJWB 1B3TA 4P74A 2HQDA 3KLHA 1ZPVA 1TL3B 3PW5A 2W8LA 3JSBA 4FS1A 3FSXA 2DT9A 4R5PA 1JQGA 2RQ4A 4Y2AA 4DUYF 2HAFA 3JSRA 1Q7LB 3MECB 3Q8SB 4KAIA 1X4GA 5IV4A 1VQ4S 3IAS9 3ZO7A 3M30B 4OX6A 4Y2KA 2IVYA 3LANA 2FJWA 2Y1IA 1P27B 2GHWA 5E3AA 4DSJA 1RT4A 1IBMF 1KEKA 2CPZA 4OJ3A 1NZ8A 2HLTA 2LQBA 1QAJA 4DN9A 1V3RA 3ZTOA 1LW2A 3GSIA 4EI2A 1PCAA 4KGKA 2EI5A 4I2PB 4XIUA 4DR4F 3OLAA 4NYOA 3CVKA 3EUNA 2FZGB 2AU0A 4DV0J 1PJ6A 4H4KA 1N5YB 3J80Y 4MT1A 1HBNA 2RDDA 3HP6A 2AX1A 3Q22A 1DURA 4CTAB 5I4MA 4FYDA 5L46A 2D68A 3LGNA 4K7QA 1HKAA 4ZJLA 2ZM6F 1FNMA 3GG1A 4I7FB 2KB2A 4Q8EA 2CWXA 4NA3A 3HHKA 4FDFA 2P9CA 2A2CA 2QMWA 1KTVA 1QDUB 1GAOA 4UOFA 1S7IA 1IBLJ 1T3OA 1FVQA 2MQNA 3BPSP 3PHTA 2F4VF 5HK4A 2V8PA 1M5OC 3VWSA 2XHCA 4QU7A 3W66A 4QQBA 4X65J 3WX4A 1RTHB 4IFVB 4B9UA 4DR7F 1JLEA 1NKBA 1O8BA 2CQDA 4DL7A 3DLGB 3GV5B 4DR2J 3D6HB 4QZVB 2JFKA 2WVCA 4MIAA 1DARA 1S6QB 4CCHA 3PKMA 4Z2XA 1JLQB 3FEZA 3CCQS 1WOSA 1DQAA 2HVDA 4W92B 2E5LJ 5IZHA 2BJDA 3UPFA 2HVZA 1YJ7A 5LT5A 4M5DA 3IM8A 4Y2IA 1WKJA 2D69A 4DL3A 3PY8A 1BC6A 5KFRA 2XCPA 3BO3A 3IR5B 2AJ4A 1UUJA 2GGPB 2GHPA 3TVZA 3UDCA 1FERA 2NXCA 5HLFA 4PWDB 2G9OA 1WF0A 1YBUA 2CQ2A 4UUXA 2HS3A 2UVVA 2RAQA 2HVEA 4J9QA 2Y8YA 1JIHA 4KO0A 2MQOA 4KIAA 3MFIA 3HHLB 2B6AA 5AJ3F 3MEGB 4PR6A 1U8SA 1LWEB 4QIVA 3CJTA 3SCIE 2HNZA 3W8GA 4PYDA 2ILYA 4GO5X 4WFBQ 4QWBA 2A2DA 2LXFA 3N4WA 2DHAA 4I67A 1I6JA 3MEEB 3TQEA 1SH2A 3KK3B 3NNAA 2DH9A 4OYMA 2KVIA 1N48A 1HYSB 1F3FA 1RBLA 4DV6J 2FVPA 1SUQB 1N5QA 3CDWA 3HM9A 1TAQA 3KK1B 2E7XA 2GAHC 2K1RA 1ZBTA 1IVZA 2WB1D 2ZH9A 1YSJA 3HVTA 1N88A 4I1TA 1UKUA 2RSQA 5BYRA 2I8EA 2YNFA 1S0MA 3H5XA 2E5IA 1CSJA 3D3CJ 1RWUA 4TY9A 1ICEB 1IJEB 2VBXA 1RBOB 2AYGA 6FDRA 2ZKTA 2NSCA 5D0GA 1RT1A 1AYEA 2BANB 3CW2C 3OL6A 1KLNA 5SUHA 4RNMA 2BV3A 4JI4F 1ZA2B 3BH6B 2HWHA 5THWA 3V4IB 4WU3A 2A0FB 3QFHA 3MAHA 3P96A 1SJ3P 4ES1A 3MM9B 5C42A 2GAGC 3QRRA 2VKRA 2AYBA 3B82A 3CD5A 2KG0A 5F9LA 1M1HA 2GA7A 5J2PB 2AIRB 2CUYA 5KFWA 2HNDB 3OUYB 1VRQC 2J7UA 3A8EA 4F36A 3MTJA 5GMDA 5DETA 3R6LB 1HPZB 2L9DA 3EE3A 3RGIA 2X3GA 1B70B 3A3OB 1GTHA 4J9MA 2BA9A 3G6YA 2CG4A 2ZDOA 2HQIA 3PYDA 1WHWA 1IN0A 1UFWA 2HRUA 4MKAA 1LWFB 5HI7A 4A8WA 1HD1A 2ZZMA 4WZMA 2IJNA 4P7VA 2APOA 1FD8A 4UUWA 4XDCA 3EXYA 2CPEA 3HVRA 1S12A 4HT7A 1S0NA 1SKSA 1HMVA 3AWRA 2RHSB 3RBXA 2OPPB 1LWXA 2WW8A 2HBYB 3ILLA 3LGHA 2OEKA 5D15A 1SIZA 1LXNA 2AX0A 4DJBA 3M8YA 1KONA 3DM2A 3IWXA 3V6JA 5F8JA 4EYIB 4ETZA 4BS2A 2D3ZA 5KFFA 3LAMA 1K1SA 1D9FA 2VFVA 1HD0A 1V3SA 4XO0A 3BBBA 1A7GE 3GCXP 4BCAA 4FS2A 1BQMA 2QC3A 5DLGA 4USMA 2HYIB 4X64J 4DF4A 2M8HA 2RVJA 1WC3A 2AD9A 1Q16B 2R7XA 4RUHA 3LH2S 1NJWA 2X7IA 5DGBA 3M7VA 2VJUA 1YK9A 4OLOA 3BBCA 1TKXB 4J9NA 2IRUA 2W9AA 2VPYB 1TZ0A 3M2UB 1IXKA 2B9XA 2AEJA 3P49B 3UW1A 3KLIB 1U4BA 1F60B 1LV5A 2BDPA 1T9YA 4DQSA 3BEGB 4OHYA 4PYAA 3Q8VA 1LOUA 2C2ZB 2GO9A 1MG7A 2UXDF 1KN6A 4H4OA 4DQIA 3F56A 4QWAA 2GV1A 4A8SA 1U02A 4J7CA 2BM1A 4NOHA 5KFJA 2UUCF 3P8BB 3I55S 2MY8A 1ZTWA 2W7OA 3BYPA 4NA1A 3ETOA 1C1BA 3QRQA 4KHPF 2CZVC 4LF7F 2IRXA 4B9TA 1FWPA 3O8WA 1FE0A 1VRUA 4X62F 5KFLA 4IUFA 2W7AA 4R0EA 4DOZA 4WZQA 5L9NA 1RU1A 4KFBA 1XNRF 1PYTA 1P1LA 1OQ3A 3QGIA 4NXMF 4WK1A 1RAJA 4C11A 5GADI 3DOKB 4G1IA 2C22A 3CCRS 3MAAB 2I5JB 3TAMB 2Y1JA 4EYHB 5CH7B 2O01C 2FB0A 2CQ0A 3BO4A 2FLOA 1SBRA 4GRSA 1APSA 1LXJA 5CYQB 3M1VB 5J1EB 5I3PA 2QFJA 4LFBJ 1UJ5A 3IS9A 1TAUA 1YRTA 1WELA 1TK5A 4W98A 2V68A 2KT2A 3IBWA 4OI0A 2OPQB 1JNRB 3K5LA 3V6DA 3UWTA 1RTDB 3S1TA 3TQ1A 2YKMB 4MKBA 4I68A 2GW8A 3TJ8A 4AUKA 1HR0J 1OYDA 5KFBA 4O3PA 2F4FA 3AJDA 5KG1A 4IRDA 2XHWA 2Y8WA 3W2WA 2XB2D 4A48A 4DV0F 2GS8A 2HGLA 4DLGA 3KLGB 3K5OA 3S6EA 4UTGA 2K7KA 1DQ8A 3KK2A 3AH6A 2WSEC 1IR2A 3IRWP 3ZXWA 5K8PA 2MXYA 1HBMA 3RW7A 3DLKB 5D8HB 2IAJB 4HHHA 2KHDA 2IVFB 2Z4PA 4ES2A 1SJRA 2Z2ZA 2HBQB 1A6LA 2V69A 4RW4B 1IBLF 2V94A 3VTIA 1YJNS 4LRBA
chains in the Genus database with same CATH topology
3CO9A 4C8LA 2P9GA 3US5A 4H4OB 3CCVS 1HL6A 2QRRA 4CO5A 1TV6B 2HNYA 2KRRA 3C3LA 4YOEA 3CIZA 4JI7F 1HNWF 2DGSA 4MFBB 3QWUA 5T7LA 1M5SA 1ZAWA 1WHXA 5A0YA 1U09A 2O5DA 4RX6A 3K5LA 5B0EA 4H4MA 3V6DA 2YKOA 3V2UC 2AJ1A 3HKWA 2WRMA 1FNOA 5FJ4A 4X65F 3WDOA 3I4PA 3BDEA 2PE8A 3N79A 4JV0A 4DUZF 1NK9A 4XK8C 1RTJB 1AFJA 2IVMA 1C1BB 3J81Y 2V9WA 1UFLA 1UETA 3E51A 4ZOSA 1DHMA 2LKZA 3N6NA 4D3GA 3G8SA 5EN1A 3MM5B 1LK7A 2RIJA 5L1JA 5K14B 4DR2F 4LFAF 1Z2ZA 3R1HA 4DV3F 3MZIA 2MZJA 2J9DA 1L3UA 4C8KA 4LSLA 1VRUB 5J2NA 2H5EA 1LKZA 1E6VA 2Z2LA 3HZEA 5IWAF 3PKYA 3HFKA 3LWLA 3UDLA 1WTFA 1U7LA 2BYCA 3BF4A 2RQMA 2RF2A 5A8RA 2HMIA 1V6HA 2QA4S 4B3OA 4AL5A 4ZPBA 1FRHA 4FVMA 4U7UK 4KFBB 2GMHA 2ZH3A 3CXCR 2W4PA 1AW0A 1T02A 2ZOFA 5L9XA 1PILA 1GNKA 2QSFA 1IKVB 3K5PA 2VPZB 4ZHRB 3KHRA 2CQHA 4CO4A 5EX3A 4DX8H 4ZKAA 1TL1A 2E5LF 3QPIA 2KT5A 2NZ4A 1XMQF 4V19X 1O5JA 2OD6A 2MKCA 3NAIA 1QUVA 5KFGA 5AE3A 1KTQA 2IC3A 2I0XA 2KN4A 4QIWD 4C11B 3M8PA 4OI1A 1RT2B 1ELOA 5KFNA 2LLZA 3FRYA 1S72S 2EVZA 4KHMA 2E29A 2B4VA 4J9KA 3FMWA 2GQCA 2KZZA 3LP0B 4B3MF 2VPWB 1L3VA 5LMUF 4EBDA 2C3UA 2BUNA 4YP3A 3DCAA 5B09A 4NLOA 3OPKA 4YFUA 2CZ4A 3I0SB 3UQSA 1PSDA 2XSJB 2JRSA 2XMKA 5E33A 2ZFHA 1HBUA 2W4CA 1PC4A 5G0RA 3G6ES 2JEIA 4URQU 4HVZA 4DSFA 5G4DA 2J0QD 3QJPA 5IQ6A 4FBUA 5GAHU 4WE1A 1BQNA 3R27A 5CHCB 2LU2A 1FRJA 3H20A 4GO7X 3C6UB 2FGOA 1KQFB 3CIMA 4I2QA 2FTRA 3BJYA 3MEDB 4LQ9A 4FNIA 4IH6A 3UR3C 4YHHF 3CMES 4Q0BA 3IS9B 1H38A 2ZH2A 4ED6A 3CJKA 4YMEA 4IKAA 1B0TA 2R7UA 4LF4F 5KFZA 1L3KA 5KFQA 5E7OB 4U6PA 1WHVA 1RT5A 5CZXA 1VQLS 1FDDA 1FRIA 4CO2A 4KRWA 4XAKA 3BQ1A 2UVWA 3KFWX 3GMGA 3HMJG 3L7OA 4ECXA 3OL9A 1FDNA 1TL4A 4QYRA 4DL0C 3DRSB 4BWJA 3V6DB 4ZS6A 1S7HA 2UXCF 2RMLA 3QLHB 3CPWR 3R5BA 4MK8A 1SI9A 3BSCA 3P5TL 5J2MA 2V0NA 4IO1A 4USIA 3I87A 3CT9A 3OJUA 4IG3B 4F3QA 1J5EF 2B51A 1HQEA 4WU2A 4MH8A 2OMLA 2ZH1A 4NLPA 2FLNA 3ZZZA