1RAJA

Poliovirus polymerase with a 68 residue n-terminal truncation
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
392
structure length
257
Chain Sequence
VDEYMKEAVDHYAGQLMSLDINTEGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALALPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for proteolysis-dependent activation of the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
molecule keywords Genome polyprotein
total genus 81
structure length 257
sequence length 392
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1rajA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rajA02
4.10.880.10 Few Secondary Structures Irregular Poliovirus 3D polymerase; domain 1 (Nucleotidyltransferase) Poliovirus 3D polymerase Domain 1 (Nucleotidyltransferase) 1rajA01
2AWZA 2OPQA 3BSCA 2FJWA 1RT3A 3LAKA 4NLQA 2IMWP 3NMAA 2AX1A 1S6QA 4QW8A 2YNGA 4GC7A 3CO9A 4YQWA 4WXWA 1RT5B 3DM2A 1DTTA 3DRPB 1XR6A 3MEDA 2AX0A 4J9NA 3LP2B 4NZ0A 2IM3A 5F8NA 2WHOA 4MKBA 4R5PA 3V6JA 4XPCA 3I0SA 4LQ9A 1QE1B 4IFVA 3KLGA 2W9AA 3NL0A 1JLQA 4IG0A 4PQUA 5EDWA 1C1CA 2RDJA 1RT2B 1TKXA 1RDRA 4WYLA 4ZP6A 4ZPAA 1TKTA 2HNZB 3H2LA 3GILA 2YNHB 2FJXA 3DLEA 1TVRB 1S1VB 4PUOB 2I1RA 5KFXA 4JV1A 5D3GA 3D5MA 5KG4A 4EBEA 4NRTA 1FKPA 2C2RA 2V4QA 1T3NA 2JEJA 2UVUA 3H59A 2C28A 2YKMA 3E51A 4RW7A 5KG6A 2R2TA 1RAJA 5DQGA 4WFXA 5KFSA 5KFMA 2ATLA 1IKWA 1LWEA 3H5UA 2JC0A 1DTQB 4TN2A 5KFFA 4PWDA 3PZPA 3GIJA 4ZMMA 5F8LA 4Q44A 2HMIA 1SV5A 4RW9A 4YP3A 2W9CA 3DI6B 4LSNA 1HQUB 1LW0B 4Q8FA 3EPIA 1HPZA 4IRCA 1FKOA 1GX6A 1RTIB 2HNDB 1KLMB 1SUQA 3ITHB 4RU9A 4ED0A 3N6LA 4IDKB 1S9EB 1QE1A 3KLGB 2R2RA 1EP4B 5HROA 3PR4A 1HARA 4U6PA 4XPEA 4J9QA 4IKAA 1JLFA 2UVVA 4URSA 4EO6A 5F8IA 1C0UB 3FRZA 3T1AA 5KFCA 5HP1B 2D7SA 2YNFB 2B5JA 4X2BA 3MEEA 4YR2A 4K4UA 4K50A 1HNVB 2B43A 5I42B 3T5HA 2IBKA 1TVRA 4Y3CA 3H5XA 2XGPA 4IG0B 4YR3A 3SI8A 3VQSA 2D3ZA 3IRXB 3QIPA 2WCXA 2I5JB 3M8PB 1K1SA 3HVWA 4ZVFA 1TKXB 3MFIA 2V9WA 5J2MA 4K4WA 2BQRA 4K4VA 2W9BB 3DRPA 1S97A 4NYZA 1RT6A 1REVA 2VG6B 4MFBA 1XR5A 4ECTA 1S1XA 4ED1A 3RB4A 4JV2A 3KNAA 3KLFA 1IKXB 3DLGA 4MIBA 2D3UA 2IJNA 4Y2CA 1S49A 1S1WA 3I5BA 4H4OA 1ZTTA 4QPXA 5KG2A 4HYKA 5HLFA 1RT4A 1S6PA 4K4ZA 4FS1A 4EYIB 1T03B 4NRUA 3I0SB 3LP0B 1LWFA 4KHMA 1U09A 1QUVA 4O4GB 2AU0A 4IH5A 4H4MA 1JLFB 5CYMA 3PVXA 3GQCA 2GC8A 1S4FA 3QLHB 4J9MA 3PJXA 1S0NA 4KB7A 4I2PA 3JSMB 1DLOA 3V81B 2XCPA 5D3GB 1NHVA 5I3UA 4KE5A 2BANB 4QWEA 4O3NA 5KFGA 1C0UA 5JXSA 4FBTA 5C25B 4QWAA 4DL3A 4LSNB 1HPZB 2WRMA 1FKOB 4TXSA 4RW8A 3G6VA 5KFJA 2R8HA 2E9TA 3KJVA 2HNYA 5K14B 3BREA 1SV5B 5KG7A 2JEIA 1JLEA 1T94A 1S9GB 3FFIA 2IAJB 3HKWA 5J2PA 1KHWA 3NBPB 4J9LA 2R8GA 5EWEA 5HLFB 4LQ3A 1GX5A 4M94A 5F8GA 4QWDA 1RYSA 5I42A 3NAIA 4IOBA 4NLXA 4RW4A 2J6SA 3KLFB 3DYAB 4ECYA 4NCGB 5KFRA 5EWFA 3IS9A 2UVWA 5FDLA 3DDKA 3QLHA 3OHAA 5KFBA 4ECUA 4RUAA 5KFQA 2IM1A 2W9BA 2ASLA 3V6KA 4U7CA 1TL1A 5J1EB 2VG5A 5J2NB 3OHBA 3V81A 5F8HA 2AGQA 1RT1A 4ICLA 4WE1A 4Q0BA 1SH0A 4WXOA 5CYMB 1JLBA 4KV8A 4DG1A 3CDEA 5KFAA 4MKAA 4F50A 5J2QA 2ZD1A 4KKOA 3DMJA 4TY8B 3KK1B 5KFYA 2JLEA 4I2PB 3KHGA 5C5JA 3ISND 1LWFB 4O4GA 4TY9A 2BRKA 2V0NA 2W8LA 2ASJA 2YNGB 5C25A 1WNEA 4ED6A 1C1BA 5KG3A 3M9MB 2HWHA 3QZ7A 2C22A 3KLEA 4QWCA 3LP2A 3JSMA 1OS5A 2WOMB 4Y34A 1EETB 4O4RA 2OPPB 3CJ0A 2XC9A 3CJ3A 1HMVA 1BQNB 4ZVHA 3H40A 4IR1A 3HVTA 2VG7B 2W7OA 4FS2A 4KO0A 1ZETA 4ZPBA 1R0AA 3GIKA 2WONB 4KSEB 1HYSB 3QGIA 3BSOA 2YNHA 3JYTB 1DLOB 2HAIA 4G1QA 5DQHA 1N4LA 4WFZA 4NLSA 4O3PA 2RF2A 2FVQA 4NLUA 3D28A 4DL6A 2OH2A 1TV6A 2IJFA 2OPSB 1DTQA 3KMQA 5JUMA 2W7PA 4R5PB 3LALA 4NLOA 1S6QB 4URQU 3PW4A 3GIMA 1RYRA 2J6UA 3OL6A 5F8JA 5F9LA 4RW9B 2BQUA 1RT5A 4ECZA 3Q8SB 2VA3A 3IS9B 5HBMB 4K4YA 1HQUA 1VRTA 2FLNA 4MK7A 3PJWA 4PWDB 1TKTB 2HNZA 2FVCA 1RTIA 3FSIA 4R8UA 3CJ2A 5KT7A 3KK2B 1RTDA 5KFKA 4NLDA 1K1QA 2QE5A 3IG1B 2R8IA 2RKIB 2FJVA 3DOKB 1T03A 4ZP9A 3TVKA 5KG5A 3Q8RB 2BE2A 3DOLB 4Y2AA 2C2DA 3DLKB 4O3QA 2J6TA 3MEEB 5KFVA 3KK1A 3PW5A 3DRSA 4RNFA 1UWBA 1TKZB 5KFEA 2AGOA 1ZTWA 4IG3A 1JLBB 4DG1B 3GV7B 1QAIA 4O3SA 2E9RX 3Q8QB 3DI6A 4KAIA 5KT3A 1IKVB 4I7FB 5KFLA 3KHLA 3DMJB 5DGAA 1C0TA 4O44A 3JYTA 3EPGA 1RTHB 4J9OA 2IM0A 4WZMA 1KLMA 1SUQB 2C2EA 4M95A 4G1QB 5DG7A 4IDKA 2HWIA 2HMIB 3BQ2A 4KHRA 1SH3A 3BQ1A 5KFOA 4IH6A 1XR7A 1S1UA 3KLEB 4IH7A 1RT4B 5DLGA 4IRDA 1HQEB 4YMEA 1HYSA 3I0RB 4KFBA 3CJ4A 5EWGA 2WOMA 3LP0A 3MEGB 3KK2A 2XI3A 5KFZA 3QGHA 4O3RA 3RBDA 1TL3A 2VG7A 3C6TB 4IFYA 3V6HA 4DL2A 4H4OB 3MECA 3TAMA 4Q8EA 1VRTB 1FK9B 2E9ZA 1HNIA 2YNFA 4DL4A 1TV6B 3H5SA 5KFDA 1N56A 2XWYA 3M8QA 3KK3B 3BJYA 2W8KA 3MTKA 2ALZA 3IRXA 1RT7A 1TKZA 3IGVA 4NLWA 4H4MB 3V4IA 2RF2B 2ZE2B 4TQSA 5J2MB 3NGDA 4I7FA 2OPSA 5KG1A 4ZVEA 2R2UA 4NLVA 2CKWA 3G6XA 3CVKA 4IG3B 4ZHRB 3KOAA 3E01B 4XO0A 3MR6A 4JUZA 4R0EA 3IG1A 4WYWA 3KHHA 2JEFA 2IAJA 1LWCB 4QW9A 3UQSA 3DM2B 3DRRB 3MEDB 4WFYA 1N5YB 3TQ1A 1RTJA 2XI2A 2WB4A 4F4ZA 2HNYB 4EEYA 4ED3A 4DL7A 5KFHA 3LP1A 3T5KA 1VRUB 4IQXA 5F9NA 1S10A 2VA2A 1JLEB 4B3OA 1JKHA 3GYNA 3KLHA 1QAJA 1S1UB 2OPRA 2UUTA 3C6UB 1HQEA 1JIHA 2WTFA 5DLFA 4K4XA 3M8QB 3KLIA 4J9PA 4ED7A 1MU2A 3GV5B 1JXLA 3QGGA 1RT3B 5K14A 4ED2A 5EUHA 1RT1B 4ICLB 4WE1B 2WK4A 2R2SA 2BANA 2QV6A 3TAMB 5FDLB 4Q0BB 1JLAB 3QO9B 3SFUA 4RW7B 4F4WA 3MR3A 5J2QB 1MMLA 4KKOB 4MK8A 3I5AA 4RW8B 4RW6A 2VG5B 3M9NB 4WZQA 4ID5B 2IA6A 5DG8A 3NAHA 2GIRA 3DYAA 2ILZA 3ISNC 4KV8B 4PQUB 3E01A 1S9GA 5J2PB 4YR0A 5DQIA 3MECB 3RAQA 1LWCA 1N5YA 3N6NA 5KT5A 2XCAA 4F4XA 1N6QB 1JLGA 3OSNA 3MR2A 3MEGA 2B6AB 4NLRA 4RW4B 5KT4A 3KK3A 5J2NA 4NCGA 3LP1B 4K4TA 1C1CB 4MK9A 3G6YA 3IN5A 3FQKA 1FKPB 3GV8B 1FK9A 5KFNA 2IC3A 3KLHB 5DGBA 1R0AB 4I2QA 2ILYA 3DLEB 5C42B 3OL8A 3KLIB 1RT7B 1VRUA 4B3OB 1BQNA 1J5OB 4J9RA 4ECWA 3QIPB 4NLGA 2YNIB 4RNMA 4TLRA 3OL9A 4RNOA 2W9CB 2UUWA 3Q8PB 1KHVA 1HNVA 1TQLA 3DRRA 4TY8A 5KFWA 1LW2A 2AQ4A 1RTJB 2FLPA 1RT6B 4RW6B 1TP7A 5L1IA 5KFUA 4NLYA 4Q43A 1JLAA 5KG0A 5KT2A 1LW0A 4EBDA 1D0EA 4G3IA 2JEGA 5KFPA 4ECRA 5HP1A 4JV0A 2IM2A 4ID5A 2HNDA 3ITHA 3OSPA 1S1XB 1W25A 2D41A 1RA7A 1S9EA 4R8UB 4ZPCA 2OPPA 3BSAA 4ECSA 1EP4A 1MU2B 5HROB 1IKXA 3DLGB 2V4RA 3OLBA 2ASDA 2FVSA 3LAMA 1JKHB 1S1WB 1NNDA 5KT6A 3DOKA 3QO9A 2OPRB 4URGA 2IC3B 3UR0A 4KO0B 2BE2B 1S6PB 3DOLA 3IGNA 1I6JA 1JLGB 1Z4UA 3PW7A 3H5YA 1CSJA 4ZPDA 1JX4A 4NLPA 4MFBB 1YVFA 3FQLA 1UWBB 2I5JA 1S1TB 4LSLB 4J9KA 3H4BA 1D1UA 3QYYA 4EO8A 2YNIA 2XGQA 1IKYB 3BR9A 5C24A 2R8KA 2GIQA 4MH8A 3ICLA 4RNHA 5HBMA 2FLLA 3RB0A 1BQMA 1JLCA 1REVB 2VG6A 1N6QA 2O5DA 2RDIA 1T05A 5L1JA 2OPQB 4MIAA 3RB3A 3MFHA 4K4SA 3PHEA 2B6AA 3NKYA 2YKNA 4EYHB 3PW2A 5I3UB 1RTDB 3QZ8A 3KHRA 1IKVA 5F8MA 3CWJA 3MR5A 4GC6A 2DPJA 3BGRA 1LW2B 1RTHA 3N6MA 4NLTA 1S48A 3HHKA 2BR0A 3V6DB 2DPIA 5C42A 4EBCA 4OL8A 4ZP7A 3BQ0A 4ECXA 1J5OA 3G86A 2RKIA 1RT2A 1NHUA 3C6TA 1DTTB 4ZP8A 3I5CA 3PR5B 3DLKA 2BQ3A 3M9OB 4I2QB 3I0RA 1C0TB 1C2PA 4KFBB 3OLAA 4O44B 4KBIA 4Q45A 1S1VA 3DRSB 4TYAA 5CYQB 3T19A 4TQRA 3KJVB 1RA6A 4ECQA 4ED8A 5KFIA 4RZRA 4ECVA 2ZKUA 1IKYA 5C24B 3GIIA 3PW0A 3UDLA 2F8EX 3NBPA 3T5JA 3BSNA 1IKWB 1LWEB 3CJ5A 4TYBA 3QIDA 4RUCA 3FDSA 4FBUA 4J9SA 4RNNA 2CJQA 1N48A 3HVAA 5L1KA 1JLQB 3LANA 4ZHRA 2FVPA 3CDUA 3FFIB 3T5LA 2ZD1B 5L9XA 4F4YA 3BGRB 3CIZA 1T05B 3SFGA 3RAXA 4DEZA 3EZUA 3V6DA 4H54A 1TL1B 4IFVB 5J1EA 3H4DA 2FVRA 3RB6A 4PUOA 4O3OA 3KLVA 3CDWA 1TL3B 4IFYB 5DG9A 5T14A 2EC0A 2JC1A 3HVTB 3V4IB 2R8JA 3OL7A 3RBEA 1HNIB 4ZVGA 1IM4A 4HKQA 2AGPA 3UPFA 1SH2A 2B5JB 3C6UA 1S9FA 2WONA 1S0OA 1BQMB 1JLCB 2UVRA 1EETA 5CYQA 3H98A 1HMVB 1S1TA 4LSLA 1S0MA 2YKNB 4IRKA 2BRLA 3M8PA 2ZE2A 2YKMB 3KMSA 4QWBA 4IR9A 5L1LA 5KFTA 1C1BB 4DL5A 3MF5A
chains in the Genus database with same CATH superfamily
2OPQA 2G0IA 2BE9B 3NOGA 2FJWA 4JI4F 1RT3A 3OVBA 3ONQA 2RQMA 5IT4A 2AX1A 1R31A 1ZH5A 2FC8A 3DGVA 5MLCV 1MW7A 2PMHA 3JQJA 4GC7A 1SJ1A 2E7WA 5L38A 2C3OA 4WXWA 2AX0A 4J9NA 4P75A 2HFSA 4KH1B 4MTPA 2OELA 4E8UA 3TUZC 2E29A 4R5PA 2XY5A 2HSEB 2B4PA 3NCQA 2CUYA 1HWLA 1S76D 4IQMA 4PCQA 1GAOA 3GFXA 3OPKA 2QYCA 4PQUA 5EDWA 3D4JA 3DNCA 2R7OA 4QZVB 2I6WA 3D9BA 7FDRA 2ZHBA 2EFNA 1TKXA 4ANDA 3AJ1A 3CD7A 3S6EA 2FJBB 2HBRB 4ZP6A 1TKTA 2KXHA 4C2MA 2YNHB 3IM9A 1TVRB 2F65A 3Q8VA 3OJUA 2RJZA 1Z2LA 2I1RA 1B0TA 2DTJA 3FZBA 4I6WA 1IR1A 3AA9A 1HNXF 4JV1A 4NZ6A 4EBEA 1T3NA 1FKPA 1N33J 2YKMA 1HI1A 4OV1A 4OV6A 4OZ1A 1RAJA 5DQGA 2GQQA 3HFVA 2W2QP 1YJ9S 1IKWA 3FC9A 3H5UA 5KFFA 1J2VA 3W2VA 1M90T 1EB0A 4PWDA 4NCAA 1KOOA 3FBBA 3FCVA 2V68A 1WOPA 5A8RB 3MI7X 1YI2S 1NDLA 1AYEA 1S57A 5DM7Q 4DV7F 3KJQB 2Z2LA 1LW0B 4Q8FA 3EPIA 4K5SA 1QJHA 1F9EB 3KDOA 3CCLS 1VI7A 2EW9A 1GX6A 3C16A 2Q6BA 3P5TL 1RAHB 5ETOA 5CD4H 4DZ6A 2DR8A 3AQPA 4U6PA 2K7JA 5DDQC 4Z7CA 4IKAA 1X7VA 2DBBA 4N41A 5F8IA 5HP1B 2CQBA 3POTA 2LEPA 1Q8BA 3AA8A 5HQ8A 4YR2A 1HNVB 1PYSB 2B43A 3QBCA 3AY0A 4N7TA 5I42B 5IV3A 3HT3A 1TVRA 2C42A 1Q7LB 1Y7PA 2VBXA 3HHLB 4QYRA 3ULHA 3VVUA 5D0EA 3UN5A 1BMQB 3I87A 2PDAA 3CCZA 2R7RA 1HNZF 2GFFA 1RBOB 4LF5F 4K4VA 2W9BB 1RWNB 1U45A 3U1MA 1XN9A 1DARA 1RT6A 1XNRF 3D0IE 2DVIA 2DEIA 2NXEA 1JMTA 1WG5A 5ETNA 3DFEA 3CC4S 4HTJA 4JV2A 2GMJA 2C2ZB 3DLGA 3C66A 2ZOFA 1IM6A 1FD2A 1S49A 4PG8A 1SIWB 3EGZA 5FJ4A 1WEYA 1D8ZA 4RWWA 4HYKA 5HK4A 4X84A 3I55S 5CYJA 2UXDJ 2CRLA 4C3MA 1U48A 3I0SB 4KHMA 1LWFA 1FO1A 1U09A 2AU0A 3K57A 3U1LA 3MM6A 2HS4A 3L9ZA 4H4MA 2E1RA 5CYMA 3D6TB 1U8SA 3SQOP 3GQCA 4K2XA 4J9MA 4USHA 1NUEA 2MQMA 3ADAC 4DSJA 3C8YA 5B08A 1GXUA 4DPTA 3A8JA 3IFEA 3JSMB 4QU6A 1N33F 3TQEA 1DLOA 1UAWA 2GS8A 2HFNA 2OFHX 3UD4P 1NHVA 3MCSA 1N0UA 4BDPA 5J1PA 5GMDA 1X4BA 2J9CA 2Y1RI 2DITA 1IWGA 3UN3A 1N36F 4O3NA 2QIFA 3HFZB 5KFGA 1KNZA 3J81U 2H48B 4CO3A 2Y1IA 3A8EA 4DLGA 2QTWA 3C15A 3RW7A 3ILOA 3D1HA 2LU1A 3M1VB 3NXZA 3J7YU 2M70A 1RHQB 2EFOA 2PFFB 4ZK7M 2E66A 1UPMB 2KT5A 1D09B 3I9ZA 4KH0B 1VJQA 3PX0A 5KG7A 3D66A 1H38A 1JLEA 2YWEA 3HKWA 2PN6A 2UUAJ 1CBKA 5IV4A 4U67Q 2FY1A 5F8GA 3MMCB 5I42A 2A10A 2FHKA 4ZA1A 1F0XA 3ISZA 2W7AA 3DYAB 3KLFB 3OTEA 1NDKA 5KFRA 3MM6B 4CO0A 2A2DA 2QLBB 2E1CA 3MPWA 4LRDA 4OYXA 1BXNA 2W25A 3QLHA 4M5NA 5GAGU 5IFMA 3DLJA 4RUAA 4DR1J 2W9BA 3RRHA 2ASLA 3V6KA 3K0JA 3OTDA 5J2NB 3B82A 3FSXA 3OHBA 2UUBF 5B0EA 2QFJA 1VHFA 2A0FB 2M2BA 4ICLA 4EWTA 2AGQA 5LMNJ 2VZ9A 1L3SA 4WXOA 4DUZJ 4TVAB 4DV2F 4DFPA 1DBDA 5J2QA 3CD5A 4PXCA 4KKOA 1O8BA 1XK8A 4I2PB 5KAKA 1RBAA 2CJAA 5GAHI 3KHGA 1F1BB 2X1BA 2HRYA 1FXRA 4O4GA 5CXTA 1F5AA 2V2KA 3P45B 3ZNJ1 1WNEA 2DYAA 1NB7A 2HHXA 1K9MT 1VJWA 1UW4A 3KLEA 4QWCA 1M1GA 2HEKA 3K5PA 2XNQA 2GGPB 2MKYA 1OS5A 1KBRA 1EETB 4X4VA 1WDDA 2OPPB 2G2ZA 3NOCA 2ZZTA 2HVHA 3LWMA 2JL9A 1NEEA 2WW4A 4ZITA 3M30A 1LEOA 2LCWA 1U1NA 1QSSA 2VBYA 3HSZA 4NYOA 4BC7A 4FS2A 4F36A 2IHR1 4MJKA 4ZKAA 1X5OA 2GCFA 2V6AA 3GIKA 4DQSA 4B3MJ 4CLTA 2YNHA 3D6FB 3CMES 1H3DA 4DF8A 4ETZA 1F9FA 1TMJA 2HPUA 4ZS6A 4NA2A 4KJIA 2B9XA 3D2WA 2ROGA 2DXEA 2FPHX 4O3PA 1HBUA 3NGUA 3KUEA 2JX2A 2OH2A 1ZBTA 1LK7A 2ALYB 1JNRB 3BO2A 3M32B 5LXRA 2W7PA 1XEZA 1XNQF 2W24A 4NLOA 2KI2A 3G8QA 4DR5J 3PW4A 2M8DB 1SCJB 2GVZA 2ZNYA 8AT1B 4B9SA 2CQ1A 4RW9B 3SDEA 4JYAF 3D3BJ 4C8MA 2DT9A 4WP3A 1M1KT 2FLNA 4FXDA 1FWPA 4X66J 1T9XA 3QNWB 1RAGB 1RTIA 1QD1A 3QJLA 1ULRA 5BYSA 1XWLA 2K3KA 2ZH5A 4AL6A 3PXGa 3UD5A 2XNRA 3U02A 2VBWA 3D7SB 2RKIB 3UCGA 4DV6F 1U1KA 1FJ7A 4ZP9A 5KG5A 5HJYA 4AFFA 5IM0B 1Q95G 2C2DA 2KXFA 2W2OP 1OM2A 2ZM6J 1RB0A 1CC7A 3R6GB 3DRSA 5KFEA 1TKZB 2MY8A 2FHMA 3HHLA 3O3LA 1CS4A 1ZTWA 5CABA 4DG1B 3GV7B 2DNQA 4ZN3A 4YEAA 1RK8A 1TL4A 1SJ3P 2BM0A 2ZH4A 1W7WA 2OEMA 1RTHB 1KEKA 4Y28C 4DUTA 4X4OA 4B3SF 1SUQB 2GGPA 4G1QB 2FHOB 4JI7F 2HWIA 3BDEA 4FYYB 1XC9A 3B4MA 2J0SD 3X1LB 1FFSB 4IH6A 3VGVA 1XR7A 1Q5YA 2D9PA 2FZCB 3R8YA 2A6OA 1RT4B 4QPTA 1S5ZA 1HQEB 3GP9A 3KNGA 2O66A 4YMEA 4LVNP 2ZH1A 2WOMA 1DAXA 1HW9A 1XJWB 3W8GA 2AW0A 4K5RA 3TUIC 4DUZF 4DQRA 2VG7A 3CJSA 2LDIA 3MUMP 3R27A 3R6LB 3U27A 3ZZUA 1T0TV 4DL2A 1VRTB 1FK9B 1VBYA 3T1HF 3CMQA 2RQCA 3H5SA 1FFWB 4N5SA 1H7XA 3MMAB 1PAEX 3M8QA 3OXLA 4ZLJA 3J80U 1NSKL 3CPWR 3R5BA 4IYQA 3PEJA 4LF6F 2VUGA 1RT7A 4GVLA 4FF4A 1FEEA 2B4UA 2Y0SD 2NREA 4NLWA 3IC1A 1JJHA 5LOQA 1SC3B 1TFWA 1UJ4A 1YZ6A 3PRBA 2K3IA 3PYGA 1UEVA 2P8IA 1VBZA 3MM5A 3HULA 3B8HA 4ZVEA 2R2UA 3PCOB 4C8YA 4ZOSA 2LMIA 1N34J 3MXHP 4FN5A 4WFNQ 1MMDA 2P9CA 4NE9C 2XYGB 2Z4PA 4C6AA 1V5VA 3MR6A 1RJJA 5IZHA 3ET6B 3TW0A 2CZVC 3DM2B 3DRRB 4JI1F 1R8HA 2XI2A 4TU8A 3TNVA 1F5CA 1U6FA 4EEYA 2E5JA 4ED3A 3BB5A 3HD2A 4UUXA 3TJ8A 1ICEB 3H8YA 5IQ6A 2ZHOA 1CS4B 2VA2A 1WOOA 2ASYA 1IXKA 2LQ8A 4KYZA 1JKHA 2DRAA 4W92B 3KLHA 1QAJA 2MJNA 3LPYA 1GXLA 5FLXU 3J7ZT 3ZZYA 1Y9OA 5A76A 4F26A 1RADB 4MYTA 5DLFA 2PA3A 1MU2A 2V2QA 5A6PA 3QGGA 1G2EA 1U0SA 5LMUF 5EUHA 1RI7A 2WK4A 4X65J 2QV6A 3TAMB 4LF8F 1JLAB 1PC4A 1WEXA 3ENVA 2N3LA 3FKBA 3O44A 2RIJA 2CPDA 3OXGA 3QO9B 1MMLA 4LIWA 4RW7B 4LF1A 2MXYA 2R9LA 1EQ0A 3I5AA 4NZ7A 4RW6A 3W9JA 5I3QA 4WZQA 3H7HB 4P74A 2RILA 4A48A 2XTEA 5DG8A 4B9MA 1RTZA 3BF4A 2I8EA 3E01A 1HR0F 3CJKB 2B51A 3RTVA 2ZZMA 1F6TA 1W26A 2AEMA 4F25A 3CUNA 4F02A 1HBOB 4LMZA 2NZ4A 3I4HX 1F3FA 1PBAA 2RDDA 1N6QB 3TA2A 3ENAA 4H4KC 2PI4A 1V6HA 3TVZA 2Z30B 1FRXA 3ZZOA 4RW4B 5KT4A 3KK3A 1ITPA 4PG6A 1QLNA 4NCGA 1T9WA 3HHEA 4PAAA 4WFAQ 2FHJD 4K8RA 4U95A 3KLHB 2AJ1A 4DL0C 2V8VA 1IBMJ 4ES1A 1J27A 2KJVA 5M2UA 4LBIA 3CXCR 4DR3F 3LWLA 3CCWA 3OL8A 5C42B 4JI3J 2Q6CA 1KQFB 3BDPA 4C4WA 2NXCA 2EKNA 3AX2A 4PQAA 4DSFA 1U4BA 3QIPB 1J5OB 3PTWA 2UUWA 4AQYF 1YJUA 3EVOA 2BM1A 1KHVA 1H7WA 5F41A 1TQLA 3DRRA 4WTOB 4ED5A 2HQCA 5DO2A 2BJ9A 1UCNA 2HK3A 1FX4A 5JVGQ 3CC7S 1T11A 2XYHB 5L1IA 4GVBA 2BUNA 3MAHA 5ITHA 4HVZA 4DN9A 5GAHU 5IOLA 1BD6A 2MKHA 4JOUA 4X4QA 2XS5A 2RHSB 2PFDA 2FIUA 1LW0A 1TUVA 1WG1A 3IWLA 4QOTA 4EBDA 1S0OA 2UU9F 1RWVB 1UVIA 4AL5A 1RWOB 1FWLA 2Q43A 4QCLA 1RA7A 4J37A 3Q24A 2WBMA 4DV6J 4ZPCA 3BSAA 3RAXA 4OZJA 1EP4A 1MU2B 1S7HA 1IKXA 4U9RA 5HROB 4FKYA 3JS9A 3BV8A 2HURA 2MHEA 3M30B 1KFSA 4LR9A 3DOKA 2XMJA 3QO9A 4JI6F 4B17A 2WTFA 3DDNA 2MDAA 1S6PB 2B7BB 1H2UX 2KDOA 1JLGB 3HHLD 4M8LA 3T6BA 1A7GE 2ZH2A 1CSJA 1JX4A 1WORA 4MFBB 3W2WB 2ZKTA 1UL3A 4DU8A 3FQLA 2C3MA 1Q53A 1R89A 4DZDA 2I5JA 4LSLB 1OYEA 4DX8H 3HXMA 3BO3A 1GMVA 2VPWB 4CNYA 1UFWA 5C24A 3RUBL 4KPCA 4CYUA 1OQ6A 3VAJA 5THWA 1X4GA 3DOMB 1BQMA 3GYXB 1DFDA 2XO6A 3RW6A 2JJ4D 2ZOGA 1TL5A 2Z56B 4A8OA 4K4SA 4X64F 1RTDB 2B9WA 1N0VC 3VAHA 3MCOA 1VLYA 1AUDA 2DRBA 3BGRA 3BH7B 4NLTA 2RS2A 2AEFA 5GADU 5C42A 4YDXA 3BPSP 4OL8A 1U8WA 1GK8A 4MMOA 2CFXA 3TA0A 4ECXA 3G86A 3TX0A 3OTOJ 1DTTB 3BGLA 2VPYB 4M5LA 5L9NA 1U47A 4OYBA 1JJ2R 2ZZNA 3D1QA 3AX3A 4PXEA 4CO2A 3I0RA 1C0TB 4DFKA 4Q45A 1QTNB 3DRSB 1MN7A 4USTA 4DFMA 2YKQA 5LMUJ 4TQRA 2XSJB 1NRKA 2KH9A 3KJVB 1NK6A 3L95X 1FKAF 4QU7A 4ECVA 4GKKJ 1BHNA 3NCPA 3QMQA 1Y5LB 3W65A 3KYLA 4F2SA 2OLWA 1SBRA 5D0HA 2UP1A 3PW0A 4DWIA 1I3OB 2OP5A 3NBPA 4JV5F 1CULA 1M5VC 3DOMA 4LVOP 1UJ5A 3GYGA 1WHYA 2YX7A 3IBWA 3QT7A 3FDSA 4P52A 1REGX 1WWHA 2E1MC 4I56A 3SIPB 4RNNA 4J9SA 2DNYA 4OHZA 3O8WA 3FCWA 1SKRA 2C2NA 1N54B 4LF9F 3M05A 2CG4A 1FX2A 1WF1A 3T5LA 2UUBJ 1XTZA 3GZ7A 1O5JA 2F8MA 5ETLA 5L9XA 2XY6A 2PD1A 3BGRB 2ZBPA 3FEZA 5A8KA 2DHAA 4OX8A 1PCAA 4M5IA 4DEZA 1TL1B 4Y2MA 3H4DA 4PUOA 3JQKA 4LFAJ 2BBEA 3SQGB 1TL3B 3AFGA 1OSDA 1Q5VA 2ZBIA 2QL7B 4KC5A 2DGVA 4BLGA 2XMKA 3HVTB 3OBIA 2HBZB 4GRSA 3ETOA 4ZVGA 3D1OA 1WACA 5B0CA 2VV5A 5HMXA 2CA9A 4NEYA 5IS2A 2AGPA 1N5TA 1S9FA 3OSPA 2WONA 3ELHA 1FRKA 1BQMB 1VQSA 3HZEA 4QIFA 2HFVA 1EETA 1UMJA 4XTTA 3T6JA 3SYZA 1FDDA 4C0OC 3DLLQ 1NHKL 1YG0A 3RBZA 4X4RA 1S0MA 2UXCF 4DR7F 2VU5A 3HZGA 2H5EA 3DCAA 1FDNA 4F3MA 3M8PA 2DNGA 1E6YB 4P10A 4CWBA 4MT1A 4YB1P 1V3SA 4W98A 1IBCB 3L3CA 4OYIA 1U1RA 2W4DA 3CGIA 1B0PA 2QA1A 3N5BA 1V5IB 2V1SA 2XZ2A 1WF0A 2HZCA 2L48A 2C2OB 3MF5A 1KC8T 1VQKS 1O51A 5DRKA 1U1OA 3LAKA 2YTCA 2CPZA 4AT1B 2IMWP 4OYZA 2DEJA 2XTCA 4QW8A 4CTAB 2E7XA 1YJTA 3LH2S 5IT9U 4DV2J 4DBQA 3MEDA 3DRPB 4PEOA 4ZVRB 1S59A 3DHWC 3J7Z5 1EKRA 3LP2B 4IRDA 1SB6A 2HVDA 2WHOA 5HO4A 4A8FA 3SV4A 3BBBA 4XPCA 4LQ9A 1GT8A 3KLGA 1NJZA 2VDIA 2XZDB 3NL0A 1JLQA 4ILLA 4W90B 2DGUA 3BKFA 1RT2B 3TAPA 1TAQA 4NI2B 3T9NA 1RDRA 2GW8A 4UY8T 2DY9A 1HBMB 2HNZB 4J7CA 2FJXA 2MHNA 3Q89A 3OR2B 3DGPA 5KOWA 4QYZJ 5D3GA 1IR2A 3PNIA 1I51B 3D5MA 5H9FJ 1B0VA 2DISA 3E51A 3IWXA 1GNKA 3GFYA 4UZCA 5KFSA 4UT4A 2JC0A 5IC4B 3W5ZA 2MYFA 3PZPA 4DPXA 4ELTA 1Y5IB 3R1LA 1U0HB 2IVYA 3NCRA 2XULA 1LXNA 4ZMMA 4Q44A 4DR6J 1LFWA 4RW9A 4O0NA 3I56S 2F4FA 4ZVSB 4WCEQ 1KRPA 1R43A 2WVEA 3HFKA 5M2RA 4IRCA 3I82A 5IT9Y 1RTIB 3SSRA 3ITHB 1SUQA 4ED0A 2MTLA 4CNZA 4TNOA 1EX8A 1S9EB 2GZOA 3KLGB 2BKPA 1APSA 1EP4B 5HROA 3R5CA 3PR4A 4J9QA 5A0YB 2YQ0A 5AXNA 2DGXA 3IR5B 2M7SA 2RRBA 1QVFR 4EO6A 3J81Y 3P5BP 3T1AA 2YNFB 4X2BA 4KY3A 4K4UA 3EGWB 4JI1J 5CZVA 2HBQB 4E2FB 1WHWA 3H5XA 3K59A 4IG0B 4YR3A 5D4LA 3VQSA 2MEWA 1UZDA 2AZ3A 2X51A 2I5JB 3QIPA 3R9LA 1K1SA 1Q0NA 4ZVFA 1HL6A 1R7IA 3MFIA 2V9WA 3IR7B 2BQRA 1S97A 2H54B 4NYZA 2ZITA 1OSCA 1REVA 1X31C 1Y5NB 2VG6B 3J81j 4HHJA 1MNEA 3LGNA 4DV5J 3CB4A 4F3OA 1I5OB 3ZZRA 2GJIA 4A8WA 3KTQA 5HVHA 2KVIA 1UW9A 2HZAA 2WW8A 4Y2CA 3FEYB 4LF6J 4S0MA 1S1WA 4LF8J 1FD8A 2KKHA 2GHWA 2CNLB 4YY3F 1FJGF 5HLFA 2E1AA 1X8DA 1RT4A 4FS1A 3AAWB 4LFCF 4NRUA 3W1YC 1QUVA 1NJWA 2B9YA 4CLWA 1QTMA 5LXYA 4ED7A 4OI3A 3M6WA 4TU7A 1IBKF 3PIPQ 2VICA 2BACA 2A2CA 3HHLC 2EK6A 2P9GA 3L4BC 3PRVA 4IOAQ 3GJQB 5F3ZA 3K5LA 4KB7A 4I2PA 2LECA 3V81B 2RT3A 2JH3A 2HK2A 2NSBA 3IXQA 3F44A 4KE5A 4QWEA 4ELVA 2HQFA 1RLCL 3KG1A 4DL3A 4ZPVR 3DU5A 1YRUA 3G6ES 4FXVA 1UETA 4ZJLA 2PI5A 2VHGA 5KFJA 3PRDA 3EXYA 1SQEA 2DGWA 5E2QA 5H9FK 3BREA 1SV5B 3QSIA 1VQMS 5EX0A 2DR7A 1TR0A 2JEIA 2DH7A 1T94A 1S9GB 2IAJB 3F0NA 1KHWA 4BCAA 4JI0F 5BR8F 4EI2A 3HCXA 5HLFB 4M94A 1ZZNA 1RYSA 5T41A 4RKUC 3UNGC 2EG2A 1YDLA 2J8AA 2PGCA 4P2FA 2UXBJ 2YKAA 2B8PA 4NWBA 1DJ0A 2HKEA 3IS9A 1UP1A 4OQJA 2H5JB 3KFWX 3POTB 1S12A 1OYDA 2CYYA 5KFQA 4Q0BB 4C8LA 2JDJA 4AXIA 3JAMU 2CJBA 2Z2ZA 4OIXA 4P7VA 4U7CA 4M5JA 1U1PA 4CDIA 4N8NA 1TUGB 2E5HA 4OLOA 1OY9A 1X4DA 4FYWB 1VIOA 1JLBA 3QGPA 2RH3A 4KV8A 1CC8A 3W5YA 3HSJA 5IWAJ 2KYXA 2J0XA 3CDEA 3AOCA 5KFAA 4RUHA 5LJ5Y 4DV5F 2ZD1A 1YITS 1YRXA 2AJFE 4ZCKA 4F2RA 1K73T 3BR8A 1LFPA 5HMYA 5C5JA 3CDAA 2ATCB 2ABYA 3IRWP 1LWFB 2O67A 4PG4A 4TY9A 1RXOB 4OZLA 1OIAA 2V0NA 4N56A 1KN6A 2ASJA 4CTAA 2Y8YA 2RAQA 4YOEA 1M5KC 2F4VJ 1HFEL 1JQGA 2Z58B 4OHYA 1XMQF 2HWHA 2C22A 2VFSA 1KLNA 2R7QA 4LRAA 2M8HA 2ZVSA 3LP2A 2X1AA 2HHHJ 3JSMA 2WZ1A 2A3JA 4O4RA 2XC9A 2WSEC 1HMVA 3AXKA 2QL9B 1BQNB 1YLXA 4IR1A 2E7VA 2OI2A 3HVTA 4Y65A 4C48A 4NMLA 1L3KA 4G1IA 2W7OA 1DQAA 1M5SA 1D9AA 1HBMA 3QPIA 2DR6A 2WONB 1P6TA 1T95A 4B08A 4C11A 7AT1B 3V2UC 2NYHA 1DLOB 3JYTB 4X64J 1WSRA 4RBVA 1DY3A 1U1LA 3N28A 3GJSB 4KIAA 2LDYA 4G1QA 4DQIA 2DNHA 4EGLA 1N4LA 5HAOA 4NLSA 1RCOB 3OFEA 1E6VB 1RWMB 4FXWA 4BWJA 4DL6A 2CPYA 1NSPA 5IXUA 2QN6B 2NLWA 3PV8A 2IJFA 3R5JB 2OPSB 2MGZA 2K1RB 3TI0A 3KMQA 1LK5A 1NZAA 1R3NA 1GTEA 2QSFA 5L39A 2ERRA 3K8WA 2VQEF 2GJFA 5DS7A 4JI0J 2LQ9A 1X9MA 2J6UA 3OL6A 1X4CA 3OQ2A 4CYUB 4ECZA 2RRNA 5D0RA 3IS9B 4WP9A 5HBMB 1HQUA 1VRTA 6AT1B 1SIZA 2VB6A 2DH8A 2C3UA 2AZ1A 3MM8B 3OTCA 3PJWA 4QR0A 3GIRA 3BS9A 1KSPA 2R7SA 1YRTA 5CAAA 3KK2B 1OMSA 1Y3KA 3JTPA 5KFKA 2MQOA 3DLBA 3M8RA 3W9IA 1DZ5A 2MZRA 3SEOA 2V1TA 3DOKB 1WC0A 3J7YI 4NXNJ 4X4TA 3N79A 2BE2A 3TWZA 1H72C 4O3QA 2MKSA 1FA0A 5KFVA 3PW5A 2RQKA 5DDPC 2VBZA 4JI4J 2AGOA 4RNFA 3SSSA 2RE1A 4DHVA 2QLFB 3MD3A 4DS4A 2CQHA 1YQHA 4IG3A 1D9DA 1XERA 2N7YA 2E9RX 2AIRB 1VISA 2AV5A 2YBVA 3DI6A 1E6VA 4PG7A 4TYBA 1VIXA 5KFLA 2K7KA 3Q8QB 3KHLA 1YTYA 1C0TA 1R8BA 4JB8B 1S0VA 5DG7A 4IDKA 2QRRA 2AT1B 2XMVA 1W2IA 2L08A 3QFHA 3BQ1A 5BR8J 2NQPA 2BX6A 2HHHF 1R27B 1UVMA 2BZ2A 2YKPA 3KLEB 1RISA 2VFTA 4IO1A 3WIUA 5DLGA 1B7YB 4B9UA 5EN1A 1SC1B 4KFBA 3C14A 1H98A 3PKYA 1VR6A 4XDCA 2XG8A 3NEKA 3S1TA 2DHHA 3M2VB 2BJEA 4O3RA 4DSIA 3KDNA 3JTNA 4H4OB 1S4EA 3TAMA 3W8PA 1NU4A 1MG7A 4DMZA 1J5EJ 2UZAA 2YNFA 4GKJF 5A8KB 2KFZA 2QGFB 3JSYA 2XWYA 3CCRS 1Q1KA 1UKUA 4HACA 2W8KA 4PKDB 4A46A 4DPYA 2ALZA 1TKZA 3TP2A 1PYOB 4AYBD 5E7OB 3QRQA 4H4MB 5CZXA 3A4TA 3DXBA 2RF2B 4TQSA 3AD8C 3OTOF 3QT5A 1U2FA 2QLJB 2Q79A 3WX4A 1VCTA 1ZM9A 4OYPA 3NGDA 1N88A 4Z7YA 3G71S 2R7TA 2AP6A 4FF3A 1B64A 3RYLA 3SCJE 4HH1A 4LR8A 2KM8C 1GH8A 2LEAA 4HR2A 2B8QA 3MMBA 1IR0A 2UXDF 3BN7A 1VHIA 4WYWA 3UW1A 3KHHA 3Q22A 2IAJA 1LWCB 1PILA 3UQSA 2F7VA 5G4DA 4DI6A 4WFYA 4QW9A 1RTJA 3EDRB 4ILRA 4UOFA 3T9ZA 1MWZA 2HNYB 1PC5A 3CMAS 1M5OC 5EX3A 2LU2A 4ZIWA 3A3NB 1S79A 5F9NA 4MYUA 3G4SS 1A6LA 1S10A 3A3PB 1WC4A 2FY8A 4F4AA 2XMAA 3HLUA 3GYNA 4N76A 2OJ3A 2OPRA 2P6SA 2ZBCA 3AQOA 2M52A 3K89A 2HQDA 3KUGA 1NJXA 1JIHA 2UV8A 3GFHA 3MAAA 1NPKA 1B7FA 1MROB 5HI7A 4K4XA 2HVZA 3BN4A 3M8QB 4MAKA 1JXLA 4LFBF 1VS3A 5HMWA 3LQVA 1TK5A 4ANEA 1NK4A 2IJRA 2NXNA 4WE1B 5DM6Q 3AT1B 2R2SA 2NYIA 2VFUA 4DSLA 1CQNA 5FDLB 2XB2D 1KQGB 1OY8A 2EWHA 4F4WA 3NY0A 3A8IA 3C15B 4CCHA 5HSPA 1H6KX 3MCNA 1N8RT 4QR1A 2VG5B 3GR0A 4BWMA 1I94J 5L46A 4X62J 4DFJA 2IA6A 3VAFA 1A9NB 2GIRA 4BBYA 2MZ1A 1HR0J 4PQUB 4QR2A 3IWNC 1S9GA 2D1CA 4YR0A 5DQIA 4PZVA 1HIYA 4LREA 1LWCA 7FD1A 3RAQA 2J5AA 2ZJPQ 4F4XA 1HKAA 2FJAB 1JLGA 3H40A 2V4JA 4ZDNA 2IBOA 2B6AB 3HHDA 2CQGA 2KFNA 3VHQA 4BHQA 5HMZA 1FKPB 2MKCA 2YY3A 1FK9A 4OJHA 5C7PA 2OD6A 1SC4B 4DSKA 1CQMA 4I2QA 3MMAA 2ILYA 3DLEB 1FE0A 4F67A 2FHJA 4EUVA 1UFKA 3FMBA 3IAM9 4WBFA 1VRUA 3CO0P 1IJEB 2B56A 2QYGA 4J9RA 4ECWA 3JQMA 1YBAA 4NLGA 4ZLNA 1Q7YT 1Y10A 4RNMA 4TLRA 1YX2A 4RNOA 2JFDA 2W9CB 4MKVA 1XIQA 2K2PA 2AYBA 2Q66A 1HNVA 2XMTA 3CDBA 5D4OA 4C3LA 4F8RA 2MGZB 4JI2J 2F9JA 4RW6B 2P9EA 2QLXA 3VQTA 3GCWP 1Q82T 1IQZA 1WUUA 3KG0A 4U7UK 2XLIA 1U02A 4NA1A 1IN0A 4DCPB 4B9LA 3H90A 2DNPA 4DS5A 2OFGX 1HWUA 4G3IA 3RG6A 5HP1A 4WTYA 2A1BA 4JV0A 1IBLJ 3CULA 3ITHA 1HHTP 1S9EA 2OPPA 1QUPA 4Y6IA 5MAOA 2V4RA 3DLGB 3NS6A 5ETMA 3T3FA 1VC0A 2N4CA 1X0PA 2Z2MA 3K5MA 1JKHB 3KXDA 1S1WB 1YJNS 2VD3A 4B9NA 1T9UA 2CZ9A 1YZ7A 3SDEB 3THPA 4JI6J 1SJRA 3ZTQA 2BE2B 3IGNA 2L9DA 3TEHB 2GMLA 2KG1A 1NSAA 2B9EA 1OQ3A 1RAFB 5CA5A 4ZPDA 2NCKL 2HHTA 4YY3J 1FJGJ 2YQ1A 4XAKA 3GTYX 3O6QA 1CJKA 4A47A 3PY8A 3CT9A 3D0GE 3QYYA 4EO8A 2L41A 3ILLA 3NWRA 4J90A 2XGQA 1T9TA 2AF6A 3OTBA 3P49B 2CQ3A 1U26A 2U1AA 4RNHA 3UE2A 1FESA 3X3UA 3RB0A 1JLCA 1REVB 2VG6A 2MPUA 1N6QA 2DNKA 2O5DA 1H74A 2RDIA 3VGTA 4OX7A 2CWXA 3PHEA 2B6AA 2YKNA 3E3XA 3HVRA 3CCUS 1RWKB 4LT6A 2V34A 1UPPA 4CLKA 2HQGA 3SCKE 3KHRA 4RX6A 4PYDA 1IKVA 5F8MA 1VYAA 3CW2C 4U8YA 4GC6A 4NXMJ 3M6VA 2RNEA 1LW2B 1RTHA 3N6MA 3WC2A 1D8YA 2BR0A 3V6DB 3R5DA 2CJXB 4C0BA 3CIMA 1FNMA 1HNWJ 3M8SA 1Q4RA 3AJDA 1N52B 4ZP7A 2ZFHA 2JOQA 3BQ0A 1J5OA 3TZYA 4PXBA 2RKIA 5DDRC 1NHUA 1SPBP 4OZ0A 4HH0A 2XO7A 4ZP8A 1KTVA 1E6YA 2D68A 3NRBA 4NMXA 1XMOJ 2BQ3A 3RZAA 9ATCB 4LR7A 1GEHA 2QJ3A 1C2PA 4O44B 4DCJB 4ATNA 3DRXA 1AB8A 1XMQJ 1S1VA 2HVEA 4OZ3A 2CIMA 3T19A 2R7WA 3PYDA 4WWSA 1RA6A 4A8SA 5KFIA 4RZRA 4ZCMA 4K0KJ 5C24B 3GIIA 2UXBF 3UDLA 3Q8YA 1IKWB 1C4AA 2BKNA 2VJUA 2CPIA 1NJYA 3CJ5A 2CNOB 3QIDA 4FBUA 2IDLA 3EVWA 2FZGB 3MMCA 4ZVOB 4QBUA 5CD4A 1ZM4A 1FERA 5L1KA 4G1PA 3DU6A 3LANA 4OX6A 1HWIA 4ZHRA 3CDUA 4X4PA 2FVPA 4CO1A 2JFKA 2DXFA 2ZD1B 4F4YA 1OPZA 4LRFA 1RU2A 1VQOS 4QIWD 2GV1A 2KYZA 3SFGA 3CIZA 1T05B 4FYDA 3V5RA 2Y1LB 3OW2R 3J7AN 1R8CA 4EZ6A 4I6YA 3RB6A 2XZWA 2VH7A 3PACA 3CDWA 2WVBA 2XTDA 3BM7A 4O3OA 1N32J 1FRHA 1YBUA 2DNNA 2FJDB 3JB9k 2ZEJA 4WPAA 3V4IB 1BE4A 5T7LA 3UDEA 2R7VA 3OVAA 2BA9A 2B5JB 1FRJA 1ELOA 1JLCB 2XHCA 3BYRA 4DV1J 2UVRA 3PX4A 1S6UA 1JJ4A 4B3SJ 3OXFA 1HMVB 1S1TA 3FMWA 2YKNB 3B6BA 2CJ9A 1G7CB 2D3O1 3EE3A 1NSQA 4GO7X 3M7VA 3PYEA 2R2TA 2IY5B 1RHJB 1JXEA 1RCXB 2KT2A 3BKUA 2BJ7A 1RHRB 3BKTA 1C1BB 3LPEA 5KFTA 3UNYA 2O1PA 4C97A 4C7QA 2IRYA 1KD1T 2AWZA 2XM3A 3BSCA 3N4WA 5SUHA 2D74B 5DDOC 3R2CJ 1QDUB 3TYTA 2V69A 2MKKA 2VDHA 1PSDA 2CPJA 2MLXA 2YNGA 3FZ2A 4CLLA 5BJRA 3G8TA 5B0AA 2EI5A 3OT9A 4YQWA 1RT5B 3DM2A 1DTTA 3GONA 1XR6A 2F5GA 3CEDA 4C98A 3ZO7A 1PBUA 3LO3A 4NZ0A 4LFAF 4OZ5A 4MKBA 2MSTA 3T1YJ 3V6JA 5D8HB 3I0SA 1QE1B 2W9AA 3ENWA 4IG0A 1FJEB 1AA1B 2J9EA 3EM1A 3JSRA 3PJ9A 1VBKA 3LGMA 3TUPA 2QMXA 2C1EB 2CPHA 4ZVPB 1K0TA 3RAMA 3TR5A 2IYIA 2ZJRQ 2HYIB 2CQIA 3PYFA 4ZPAA 1VLOA 1WC1A 3DC2A 1NKBA 3DLEA 1YJWS 2EVZA 2OMLA 2XS7A 2QZ8A 4DR6F 2EBGA 2POKA 3M2RA 4LF2A 1NB2A 4OFZA 2E5LF 2I9SA 4DR4J 4NRTA 3HD1A 1OY6A 2V4QA 1I1GA 2LA6A 2OSRA 3BBFA 4DV4J 1A0OB 1DQ8A 2EFPA 4RW7A 2JEJA 2VOOA 2X3DA 2R8HA 5HANA 1D9FA 1GMWA 1LWEA 4TN2A 1DTQB 5E3PA 2K8GA 4ER8A 1PJ6A 3AODA 1AZSB 3LUYA 4ITSA 3GIJA 3VALA 4DUYF 1IBMF 2CQ0A 5F8LA 1UUJA 1WOSA 2BJ1A 2NUHA 1HHQA 2R42A 4RBTA 3MHYA 5LM7E 3DI6B 4C8KA 4NXMF 2V8GA 4L76A 1NMEB 1HQUB 1NAQA 3IR6B 4I64A 2G2OA 4LSNA 1HPZA 1PG5B 3GCXP 4NX9A 2ZC3A 4OI2A 5AE1A 1FKOA 3DLHA 4F0MA 3CD0A 3AD9C 2HNDB 5U47A 4RU9A 2NR0A 1HBNA 3WQPA 1QE1A 2R2RA 2KM8B 3FGVA 3IO1A 1HARA 4K59A 4RPFA 3LF0A 4XPEA 2VQEJ 4YUDA 3C2PA 1HWKA 1JLFA 3GJTB 4ZJOA 4URSA 3HHNB 4UUWA 5KFCA 3FRZA 4W4MA 2DPJA 2DO0A 3F41A 1WDTA 3LOUA 1ZM3A 3MEEA 4DJBA 4C0HA 2IBKA 1RAEB 4AQYJ 4Y3CA 2RQ4A 2ZVIA 5F3TA 4ZN1A 3JTOA 2IRUA 2XGPA 1PAUB 3IRXB 3SI8A 2WCXA 3TUJC 1IVZA 3M8PB 3HVWA 1TKXB 1AROP 1FXDA 2UV8G 3NGSA 4R0JA 5J2MA 1XQIA 1Y4ZB 2ZUGA 3UCZP 3FVYA 2ADBA 3AJ2A 4DF4A 1U6ZA 3DRPA 1XBWA 2VQFF 3W3SA 2V67A 1RE1B 4MFBA 3GJRB 1XR5A 1AZSA 4ED1A 2O01C 2ZWOA 5D15A 3RB4A 2GA7A 3CTRA 2APOA 1KQKA 2M0GB 3KLFA 3OUYA 2WSFC 3S01A 1FTRA 4N47A 2DCUB 5SZTA 1F60B 3I5BA 3ZZ0A 1IWAA 4CLZA 2CQ4A 5F0UA 2QX0A 3P96A 3HJVA 5A8WB 5HQMA 2MLZA 4EYIB 3ZTOA 5LJ3Y 1RUSA 2CWKA 5K8NA 4FPRA 2HVIA 1CJVB 1SI9A 1U2CA 4DXLA 1QM9A 3SCLE 4EZ9A 2DIUA 1KQSR 1JLFB 3VZHA 1QAXA 3VGSA 2R7UA 3ZZZA 1VQ9S 3CE8A 1U1QA 2CQCA 4ED4A 1G3OA 4P73A 3UWTA 1S0NA 2HGNA 1FRMA 1UWAA 3WBZA 2L9NA 2W2MP 2XCPA 1CJKB 5D3GB 5B7WA 1KR4A 4E0DA 3UD3P 1V3RA 2HS0A 1XMBA 4WIQA 5GAEI 2XEXA 2BANB 2YWWA 5I3PA 1C0UA 5JXSA 3UDVA 4FBTA 3TOQA 4ZLPA 2XZTB 3BGUA 1VFJA 4WK3A 1RWWB 2WRMA 3CSKA 3IMQJ 4V1Ak 4OHXA 4O23A 1FKOB 3GB0A 3H2UB 1X4FA 2HLUA 4RW8A 3ZZTA 3G6VA 2E9TA 2W01A 2YWHA 2ZDOA 3MMJA 3BBCA 1DRZA 4CI0B 1TL7B 4LFBJ 2ADCA 5J2PA 3FEXB 3NBPB 2HZVA 4PPZA 1OWXA 4ZPTR 3F73A 2Z2YB 4EFAC 1YWXA 2PEHA 4J9LA 2OIHA 1GX5A 2R8GA 1XNQJ 3CD6S 4USWA 4QWDA 4CLYA 3VTIA 3W62A 3AH6A 4JV5J 5ADZA 2MMYA 4ECYA 3PX6A 3SCIE 4OJ1A 3Q8UA 4WKYA 5EWFA 2JLGA 1BY9A 2UVWA 5E3CA 1U6BA 3DDKA 2GO8A 3OHAA 5KFBA 5AXKA 1K0VA 4K2JA 5B0FA 3EGVA 1NK0A 2R3VA 2CDRB 4OI4A 4M5MA 3NNCA 2J9DA 5J1EB 3G96A 3D54A 3IP0A 3V81A 1MSWD 2PSZA 4WE1A 4DV4F 3U7JA 1SH0A 3ZTSA 3ZNUA 4Q0BA 2MKJA 4F3QA 1RAOA 4MIWA 4MKAA 1G4CA 2PIIA 4NASA 4F50A 3FJ2A 2AD9A 3DMJA 1NK8A 4TY8B 2FD2A 5KFYA 3KK1B 1VK3A 3MM8A 4HT7A 1MMNA 2M9KA 4YS2A 2MQQA 1WHXA 3IBCB 3C3LA 2RHQB 2HQIA 1VQ7S 2YNGB 5K8MA 5C25A 3BO4A 3N01A 2BJDA 2N4DA 5KG3A 3QZ7A 1UA0A 2YH0A 4ERDA 4WF9Q 1U2RA 1FI4A 2PO4A 5GAEU 2XLJA 4RWXA 2GHVC 2WOMB 3EWGA 1N5VA 3CJ0A 4M5KA 3CJ3A 3GLJA 2HS3A 2HAFA 1YBTA 2ZC4A 3MCMA 2V2VA 1FDBA 2VG7B 2XTJP 3NG8A 4V19J 3NMRA 3HX9A 1PKUA 4KO0A 1ZETA 4ZPBA 1R0AA 2MQPA 2WVDA 4KSEB 1VDHA 3QGIA 4QJVA 3BSOA 5H1SV 2XY7A 1HYSB 2VODA 1AFIA 2H5IB 2QMUB 5M2PA 1YIJS 4CRJA 5DQHA 1HD0A 1WTBA 2ZH8A 3CCTA 1VQ6S 4CO4A 3M6XA 4NLUA 2BJ8A 3D28A 3R5GA 1TV6A 2RUGA 1NXIA 2BKOA 2YVSA 2VPZB 1DTQA 1KVKA 1X0FA 3SXLA 4OX9F 5JUMA 3EICA 3HO1A 4PYAA 1HD1A 2P2CB 2DD8S 3OR1B 3LALA 4UOCA 4HDGA 1SC6A 5BYQA 1L5UA 1NDCA 5F8JA 3Q2SC 4QIVA 4RJVA 5F9LA 1H73A 4X4SA 2VA3A 2IMOA 1Y00A 1F5BA 3D3CJ 4B3TJ 2X1FA 3W2VB 1Y11A 4PWDB 1SL1A 1TKTB 1U0HA 5E3RA 2J0QD 2FVCA 4JI2F 4PXDA 4YB5A 1CG2A 3LGHA 3MDFA 1UA1A 2WBRA 1RTDA 4HACB 5I4MA 3R97A 4U96A 4DR7J 2ACYA 3N9UC 1KVJA 2DH9A 3BEGB 2QE5A 3IG1B 2R8IA 1NCLA 3DKDA 3TVKA 3Q8RB 2F8HA 4Y2AA 4A8KA 2HHUA 3DLKB 3W64A 1IBLF 3MEEB 2FQQB 3MPYA 2VASA 4A8YA 2A18A 2D9OA 1RAAB 2KT3A 1VQ4S 1UWBA 4DN0A 2GJ2A 2F40A 2J8SA 4MKYA 2COLA 4K7QA 4EU0A 1JLBB 2VKRA 2Y3YA 3ZXWA 9RUBA 2OKQA 4KAIA 4I7FB 1RLDA 5AE3A 5IQQA 5DGAA 1L3TA 2HBYB 4O44A 3CCJS 4LF4J 4HHHA 4J9OA 2Z0GA 2AYGA 2IM0A 5HJXA 2I0XA 1KLMA 3I6PA 4DV1F 2C2EA 4M95A 2ROPA 3UVJA 4FNIA 3BQ2A 1B4SA 4ID8A 4KGKA 2Y8WA 2EEYA 1ZAWA 4CLUA 5KFOA 1SJFA 3D0HE 2AMCB 2ZNZA 4AUKA 1WG4A 2DXDA 3R1HA 3TJAA 3M32A 1HYSA 1RHMB 5EWGA 5JVHQ 4F0HA 5JJBA 3MEGB 3KK2A 2VC1A 2XI3A 5KFZA 3WC0A 3QGHA 4CM0A 5H9EJ 1VQPS 1WI6A 3RBDA 2UUCJ 4IFYA 2H65B 3S8SA 5LMNF 2DR9A 1TK0A 2UU9J 2FZKB 3MECA 4I4BA 2YWFA 2E9ZA 1SQGA 1HNIA 1JNZB 4DL4A 1H2TZ 3MWBA 2RVJA 3H2VE 1N56A 3EGNA 3QT8A 4Z2XA 2G1HA 1NH7A 2LVWA 5AXMA 1W2BR 3BJYA 3RR8A 4LF7F 3AB2B 3MTKA 3IRXA 5AT1B 2JVRA 5B0BA 1HNWF 1FXLA 5ETTA 2YKOA 2HQ3A 1GMWD 1NZ8A 1HBUB 2C3PA 2KO1A 3K2YA 5J2MB 4I68A 2ZH6A 5D4PA 2H4WB 1WF2A 1HBOA 2C2MB 1YJ7A 2OPSA 3HF5A 3Q83A 2MZJA 5E3AA 4PR6A 4NLVA 1HI0P 4BS2A 4F4KA 4JYAJ 3E2EA 2J9DE 2CKWA 3CVKA 3SMZA 4ZHRB 3UVJB 3KOAA 3KJFB 4XO0A 1QY7A 3A8KA 4JUZA 4R0EA 3DN9A 3IG1A 4LRCA 1KVIA 1N5YB 4EMDA 3D68A 1RHKB 1UFLA 2GNKA 2H3EB 3D6HB 4RLEA 2WB4A 1TZ0A 3NGKA 1EAYC 3FK4A 4F4ZA 4FF1A 3KJNB 2BV3A 1WHVA 5BXIA 5KFHA 1DHMA 3T5KA 2F63A 2AJ2A 1F9HA 1JLEB 5AJ3F 5E33A 1HW8A 2LKZA 2XBPA 4I6AA 1S1UB 4ES2A 2RU3A 1RZMA 2QLWA 4LBHA 4BC9A 1HQEA 3HSDA 3EJMA 3VAGA 3FBEA 2OO4A 4NPOA 4LFCJ 3KLIA 4J9PA 3W2WA 2J7KA 2KHCA 1RT3B 3T41A 5K14A 2G1DA 1RT1B 1Y3JA 2G9OA 3EDQB 1KP6A 2BANA 3CNQP 3J80Y 4KHPF 3GE9A 3UDCA 3PO5A 2H1YA 2NZCA 5K20B 1TMMA 3FSYA 4OI6A 2FJEB 2LLZA 4C8OA 2U2FA 4RW8B 1H2VZ 4XIUA 3OFGA 5D77A 3OV7A 1JB0C 1VMBA 3WX8A 5K8OA 2BW7A 1VQYA 2XSFA 2ILZA 1WTFA 3WDOA 3VF0B 2DRDA 4F7VA 1HNZJ 5J2PB 2CJKA 4DV0F 2CQPA 2N7CA 3R7NB 1N5YA 5KT5A 1BUXA 5G0RB 2KRRA 2XCAA 2MQ8A 3OSNA 2VQFJ 4ALZA 4WP8A 4NLRA 2AJ0A 2W4PA 5FIIA 2XHWA 1Q8IA 2VIHA 4PRFA 1C1CB 2DGOA 2GQ2A 3FQKA 3IN5A 1CEZA 1S99A 2QA2A 1EIYB 2CDQA 2C3YA 1CLFA 3K5NA 1AUSL 1R0AB 1N5QA 1SKUB 2BOAA 2SXLA 1DURA 3HKZD 4HTIA 4UW2A 1S72S 2OTLS 2RMLA 3KLIB 1RT7B 3VGUA 4OHWA 4B3OB 2OSQA 2HIQA 1UEUA 2E5IA 2LP4A 4FP9A 3HK2A 2DCLA 2IPOB 3Q8PB 4OHVA 4Q7AA 1YJVA 4TY8A 4LF4F 5KFWA 1LW2A 2BMBA 2KU7A 1RTJB 3TZWA 1RT6B 4AL7A 2FLPA 4HHUA 4CO5A 4YDDB 3U1NA 2D3OR 1PGZA 2XS2A 2V2ZA 3OR1A 4M5DA 5A2QU 1NDPA 3VVTA 3HMJG 2DHXA 3G82B 5KG0A 1FE4A 1V9OA 5KT2A 1CJUA 2ZJQQ 2VF3A 3ET6A 4KGXB 2HHSA 2HFUA 4I0WA 1RWXB 2D69A 3L7UA 3MPDA 2IM2A 1EARA 2HNDA 1FTCA 2PC6A 3D67A 3ILJA 1W25A 1WC3A 2LA4A 4ID5A 3MUTP 3QRPA 4R8UB 3R7SB 1MWYA 3QATA 3OFHA 2ASDA 2GO9A 3LAMA 2YXLA 3SQGA 1OPIA 1T9VA 1NNDA 3MEKA 5KT6A 1T03B 2JSXA 3GMGA 3QAEA 4KO0B 1I6JA 4GMKA 3CCSS 3RRGA 1VQNS 1Z4UA 3R7BB 1YHQS 5F0WA 2OEJA 2QT7A 2AJQA 3FNNA 1LKZA 5CCMA 1UWBB 5DG9A 1ZS6A 1P9QC 2MQNA 3L09A 3HP6A 1TAUA 3VWSA 1R8AA 2R8KA 1IKYB 1T3OA 3TVYA 4PWUA 2R7XA 2L3MA 2AYEA 2FLLA 3M1VA 3TAQA 4G6VB 4D3GA 1FCAA 3PFEA 4ENOA 5L1JA 2OPQB 2ZH3A 3MFHA 4EYHB 1X9WA 3PW2A 2J6SA 4C9DA 1BWEA 3PEHA 2GAHC 3MZIA 4WFBQ 4O0IA 3VV2B 2LXFA 3QZ8A 3Q2TC 3MR5A 4J9VA 1X4EA 5GMKa 4UF4A 3QJPA 1LV5A 3I9V9 5IM0A 2RRAA 3HHKA 4CQ1A 1HA1A 1YKWA 3UR3C 3GWCA 2DPIA 3LA0A 4EBCA 2M88A 1NPPA 3Q0AA 5AJ3J 2FGCA 5K9FA 5EHHA 2B7CB 3C6TA 1LOUA 2KB2A 1SVDA 5GVQA 3PR5B 2EC2A 3HDSA 1H0HB 3DLKA 4L74A 3PDNA 3NWGA 4I2QB 2EK1A 2KRBA 4KFBB 4C8ZA 3OLAA 1DQ9A 2HFZA 4TYAA 4CLFA 5CYQB 3MAQA 3I4PA 4TLQA 4UOHA 4ECQA 4ED8A 1C4CA 2V8HA 4TKTA 3JAMY 2ZKUA 1BQXA 4DV0J 2V5HG 2JVOA 3ETMA 2N3OA 1EQMA 2F8EX 3GSDA 1X5SA 4KR0B 2GVDB 3SSQA 1VBXA 2UVUA 4RUCA 1U7LA 2FYXA 4L72B 4DQQA 1RACB 1U25A 1VRQC 3EZ5A 1N48A 1JLQB 4CLPA 1BLUA 1R6VA 3FFIB 3GG0A 2MZSA 1MLAA 3KKFA 2QEXS 2AJ4A 4FDFA 2ZDPA 1VC6A 3V6DA 4IFVB 1MN9A 2Q3PA 2YX4A 3DGPB 4DOZA 3KLVA 2XWXA 1O6XA 2X7IA 3FUYA 5T14A 1F2GA 2JC1A 1VOMA 4D3HA 1HNIB 1IM4A 4KGMA 4G65A 3RRKA 3VCDA 3C6UA 1Y0HA 4OI1A 1PYTA 2P6TA 1T02A 2KJWA 2DY1A 3SBMA 8ATCB 1LNQA 1WC6A 1X5PA 3H98A 3CCMS 4LSLA 5RUBA 4TU9A 1AXQA 2BRLA 2HRUA 3AWRA 1RWPB 2YKMB 4UY85 3KMSA 3L7OA 4QWBA 3L7PA 4IR9A 1P1LA 4OJGA 3K5OA 3CJTA 4RU2A 5L1LA 2C28A 2DR5A 2YQ3A 3AHPA 2CADA 4A8QA 2B4VA 2EFGA 1M1HA 4LSZB 4NLQA 2R4FA 3NMAA 4YHHF 1S6QA 5HVGA 1AW0A 3UO0A 2A6MA 1M5PC 3CO9A 1FRLA 2LXIA 2O3DA 3K8VA 4RR5A 5E5NA 3FBCA 4F04B 4DR5F 2CJYB 3O5TB 2IM3A 1RU1A 5F8NA 1YGYA 2QSWA 2VL1A 3NP5A 5G0RA 4AXJA 4DX7A 2H4YB 4FYXB 1BGXT 1GXTA 2XMMA 4CIOA 4IFVA 4FVCA 2NPFA 4JI7J 2IFXA 1C1CA 1WI8A 2RDJA 3GSIA 2MSSA 1Q78A 5B0DA 3ZTRA 4WYLA 1S77D 4NEZA 2EFVA 3VZIA 4CH7A 2CVIA 3M8YA 2RUSA 3Q86A 3H2LA 3GILA 4ANCA 3NNHA 1S1VB 4RL1A 2HHPA 4PUOB 2B4OA 2CXEA 3OD2A 4HEA9 4LJMA 3F56A 5KFXA 4QQBA 1RKIA 2PT0A 3S7RA 6FDRA 4DLEA 5KG4A 2BW2A 2C2RA 1KOHA 4CZCA 1HI8A 3H59A 2CNKB 5KG6A 4X62F 2DNZA 4WFXA 5DZ7A 2B0GA 2DIVA 2LQBA 5KFMA 3CCES 1CULB 1X5TA 2ATLA 5HN0A 3BGOP 3DDIA 1WJ9A 2BE7D 5GAGI 1RHUB 1EKSA 1X4HA 2CZ4A 2KXNB 4USUA 3W7BA 1G1XA 2YPYA 2HFOA 2YPZA 1SV5A 2HMIA 4L75A 4YP3A 2W9CA 5AXLA 2JRSA 1CJTA 3I31A 3RGIA 4Q2LA 4DR2J 1B99A 2MY7A 5HATA 2EG1A 3P6YC 1JK9B 1WD6A 3QRRA 1KLMB 3N6LA 3GU0A 4IDKB 4A4JA 2DNOA 3OVSA 2HRTA 4ZVQB 5D0GA 3SZ2A 1L3UA 4Q5VA 2ZBRA 3MM9A 3RBXA 3Q23A 2UVVA 3MPUB 1C0UB 5LT5A 2D7SA 4CH0S 2B5JA 3MURP 4DR4F 4ZJQA 4K50A 3T5HA 1VQ5S 1I94F 1JWWA 3M2VA 4NA3A 2D3ZA 3IBFB 3T1HJ 2NS1B 3FBFA 4Y00A 1P1TA 3KUHA 4UQTA 2CG8A 3KWMA 4K4WA 4DQPA 3C46A 3W66A 2HGMA 2OAUA 1MWQA 4CM2A 1NK9A 1N36J 2M5YA 4J91A 2QO3A 4ECTA 1S1XA 3IA0A 2CPXA 3WHIA 2QA4S 5LSOA 2CNNB 3P3DA 4P6QA 1FVSA 3KNAA 2XMUA 1IKXB 4MIBA 2YH1A 4LF7J 4WKRA 2D3UA 2IJNA 2AHOB 4UQGA 2KVQE 2F9DA 1TKDA 1GFWB 2PA8D 4H4OA 1ZTTA 4QPXA 2HG4A 2FB0A 5KG2A 4V19X 1S6PA 3EMTA 4K4ZA 3HT0A 2E44A 3LP0B 3LW5C 3OJSA 1FDAA 4O4GB 2KHDA 2W2NP 1TUWA 3GFZA 1GTHA 2V8DA 4NL5A 3I96A 3PIOQ 3THTA 1CPZA 4IH5A 2YWGA 3MD1A 4OMFG 1QVGR 3HPOA 3ZC4A 3PVXA 1R8PA 2GC8A 1S4FA 3QLHB 4NYPA 3QWUA 2DJWA 4L6V3 3QAUA 3PJXA 1PO6A 2IVMA 1HWJA 1Z2ZA 2EFQA 5DJBA 3PM9A 1F3VA 4B9TA 2DB1A 3M2RB 4M63A 1FEHA 2EKYA 3K17A 4HI1A 3P4UB 5I3UA 4FKXA 1S7IA 2AKWB 2WVFA 4ZVTB 5ETPA 5C25B 4HL9A 4QWAA 2J7WA 1JXVA 2DNLA 1NO8A 2HGLA 4LSNB 5D4NA 2IDEA 1T8EA 1HPZB 2BXJA 1FWKA 1MROA 3W5XA 4TXSA 5E0OA 4Q2MA 4WK1A 3MOJB 4KPYA 2XSJA 3KJVA 2HNYA 2CQ2A 5K14B 2ZHAA 4DV3F 1XMOF 2GIFA 1SKSA 4P2MA 3MTJA 4PABA 2OD4A 5HVFA 1RP5A 3FFIA 4QYZK 3GG1A 2Y0BB 2G0CA 2V63A 3AX5A 3LTOA 2LYVA 5EWEA 2UUAF 4LQ3A 4X4NA 2PMZD 4DR3J 3M2UA 4ETXA 1D3WA 5DETA 3HI9A 3MAAB 3NAIA 5C2CA 4IOBA 4X65F 2LEBA 2AEJA 4NLXA 4RW4A 4IO9Q 2GVZB 4NCGB 5KTQA 1ZM2A 5LL6d 2FLOA 4P9SA 2PEBA 2YWKA 5FDLA 2ACMA 4WU2A 1RKJA 4ECUA 2IM1A 2V4JB 2MKIA 2DNRA 2VPXB 3E8OA 3QFWA 1SKWA 1TL1A 2VG5A 4N77A 4WIIA 1SL2A 5F8HA 1RT1A 3BYPA 2IVFB 2AYMA 5CYMB 3WZ0A 4DG1A 3CCVS 3PO4A 2CAJA 3DHXA 3JXOA 3O2IA 3TA1A 1VK8A 4OX9J 1UVNA 3R2DJ 1P9YA 4P7TA 2W2PP 2J0WA 1JJCB 3G87A 1LQ9A 2JLEA 3NGTA 3W61A 1LWXA 3TEGA 2P5VA 4DX5A 1OJ4A 3O1LA 1QSYA 3ISND 2GAGC 4C3KA 3QWPA 5A6WA 4JI8J 2BRKA 3EUNA 4HDHA 4RUBA 5GADI 3SV3A 2W8LA 5DZ6A 1T9YA 3UFCX 3FRYA 2ROEA 1M5HA 2LQ5A 4A8XA 4ED6A 2EXUA 4B9VA 2OUGA 3M4XA 1C1BA 1N32F 3M9MB 1EJ7L 1NLKL 1HHSA 5D78A 1EZZB 4YB7A 4JI5J 4HT5A 2XYPB 1Q16B 4J5OA 2NUUG 2I2YA 3C14B 4Y34A 2H9ZA 1Q8KA 4KGZB 2JHEA 2QL5B 4ZPWR 4ZVHA 2OGUA 2Y9HA 5BYRA 4USJC 5T7LB 1R6YA 2MQLA 2VC0A 4N8OA 1HQ2A 2IYGA 2CPEA 1M0SA 2MZQA 2WB1D 4FVMA 2KFYA 4ZLLA 3US5A 4C11B 3FCHA 3N5FA 1ZAXA 2HAIA 4DR1F 4FYVB 2QMWA 2HLTA 4OYWA 1UVLA 4GKJJ 3A13A 1G6BA 3T1YF 4WFZA 4P72A 2KTQA 1UZHA 2RF2A 1ZA1B 2FVQA 3OFFA 1ROFA 1VGYA 1U49A 2X3GA 1FFGB 3G9CA 4WU3A 2G0JA 4WJBA 2GHPA 4PPDA 2DKOB 3VAIA 1L3VA 4LRBA 2Y1JA 4B3RJ 4R5PB 2ZH9A 3TRGA 1S6OA 4URQU 1S6QB 2MB0B 3GIMA 1RYRA 5ETKA 5AE2A 4C8NA 1RSCA 3ZFVA 1CJUB 2BQUA 1RT5A 3Q8SB 2E5LJ 4P2SA 1T7PA 4K4YA 4MK7A 2KZMA 4DPWA 3MUVP 4CH1A 4X66F 2HNZA 1PJ7A 5K5MA 2FUG9 3C16B 3FSIA 4R8UA 2FGOA 3CJ2A 5KT7A 1AFJA 2BYCA 1K44A 4NLDA 1NK7A 3BH6B 1K1QA 1WEZA 3KG4A 4YFUA 5LSRA 2XQCA 3PFOA 2FJVA 1T03A 3MPVA 2VJVA 2J76E 3DOLB 2Q1LA 1NH8A 2EBEA 2KL8A 4LUBA 2J6TA 1RABB 3V4MA 5IWAF 1XNRJ 3KK1A 3EYZA 2N82B 2ZM6F 1KDNA 1TELA 1ZZFA 2E1PA 4KQZA 4QIEA 3NNAA 1QAIA 1PJ5A 4O3SA 2QC3A 5CHCB 4KT0C 4HLBA 1UTAA 3NGRA 4ZCIA 1U24A 5KT3A 1ZYQA 1IKVB 4ILMA 3DMJB 2HHWA 4AD6A 2KG0A 3UCUP 4JI8F 2DHSA 2RU9A 3JYTA 3EPGA 2BOPA 4WZMA 3ENQA 2I38A 2V50A 4GKKF 4B3OA 3VAKA 1TU0B 4Z37A 4L73A 2HMIB 2RSQA 4J9UE 1UVJA 1KS2A 3A1YG 4KHRA 1SH3A 5A2QY 1OO0B 3CJKA 3J7A1 1NBEB 1EHWA 2OHDA 1S1UA 2GVDA 3DRYA 4L3NA 5EGYA 4IH7A 3I0RB 3CCQS 3CJ4A 3LP0A 2WSCC 1ZPWX 4DX6A 5IC6B 4YHHJ 3OUYB 4AE5A 1TL3A 3B78A 3C6TB 4DSEA 2VFRA 3V6HA 4Q8EA 2RS8A 2BJ3A 2NXUA 4HI2A 4Y2KA 3AXMA 4P71A 3NS7B 1NK5A 2ZWPA 3GR1A 1TV6B 3BPDA 5KFDA 4LBPA 3H25A 2ZH7A 3P8BB 1GMUA 1F2HA 4UTGA 3KK3B 1RGVA 4CT9A 4R25A 1ACMB 1NM2A 2HIYA 3EXCX 3IGVA 2WVCA 4OYMA 2VOPA 3V4IA 1FHTA 4YN3B 2ZE2B 3A12A 3THVA 5FLXY 4KTQA 4I7FA 2F4VF 2BEFA 4DU7A 3AOBA 2K1RA 5KG1A 3NS5A 2QFIA 1FJCA 4DDFA 3C19A 1LXJA 4OYOA 3G6XA 5E3QA 1KFDA 4IG3B 5ETVA 3E01B 3G8SA 2CVEA 4OZNA 4UZBA 1SJQA 4I69A 3HSGA 4I1TA 2JEFA 4U7UD 3MEDB 5ETRA 3K7RA 3TQ1A 2GX8A 4OLPA 1Q81T 3QQCD 3B4DA 2UXCJ 2HHQA 3M2UB 1CVJA 2RB7A 1FRIA 3AOAA 3CJQA 3LP1A 4DL7A 1KKHA 1TL7A 1VRUB 4IQXA 3CC2S 4M5HA 1X4AA 1VQ8S 2M3DA 3JSBA 5HQLA 1WKJA 5HL7Q 2IA0A 3R3TA 2M4MA 2UUTA 1QAYA 3C6UB 2XMWA 1YK9A 4DR2F 2BDPA 4XDDA 3K58A 4GO5X 3MM7B 1FNOA 3ZZPA 2WAQD 5J1NA 2ZOMA 3NLCA 1K47A 3GV5B 2JWNA 1ZA2B 4ED2A 3EX7B 4ICLB 1TTHB 3QJJA 2HW3A 5CCLA 3M8WA 3G82A 3AB4B 2E5GA 3SFUA 3D6MB 3MR3A 5J2QB 1RBLA 2Z8QA 4ZCLA 4A8MP 2VONA 4DCOB 4KKOB 4MK8A 2JZ5A 3TX8A 2FDNA 1YSJA 3TANA 3M9NB 4ID5B 5B0GA 1NJIT 1WKLA 1UJ6A 3NAHA 1RQ0A 4B02A 3DYAA 3ISNC 4KV8B 4IOCQ 4USIA 5LSLA 2DNMA 4ZVUB 3MECB 2V9KA 3N6NA 4X4UA 3W9HA 1IUJA 3DXSX 4KRWA 1V3ZA 2PMWA 4CT8A 3MR7A 4YB6A 3MR2A 3MEGA 1J5EF 1KTQA 1X60A 2MZTA 5J2NA 1NPRA 3LP1B 4K4TA 1U1MA 1YJRA 2V94A 1PIEA 3MGJA 4MK9A 3GV8B 3IAS9 3G6YA 1CJTB 2GQCA 2C2KB 2W4CA 5KFNA 1WC5A 2IC3A 1WSVA 4I67A 5DGBA 4H4KA 2ZBQA 1VQLS 1FF2A 2DO4A 2FTRA 2OMOA 3MM7A 1TK8A 1BQNA 4B3TF 2NXJA 2X1GA 3PKMA 4LIRA 2YNIB 3QT6A 3OL9A 1RAIB 3TJ9A 1SL0A 2MJUA 3H0PA 8RUCA 1Q86T 2QA4G 4L3KA 2AQ4A 1KONA 4FPIA 1FNXH 4Y0FA 1TP7A 2LXUA 1SJ4P 1B3TA 2CPFA 5KFUA 3MMBB 4Y2IA 4NLYA 1HLWA 2DGQA 2W1BA 3H42A 1JLAA 4Q43A 5GMEA 1D0EA 2G2YA 2CQDA 3AD7C 5KFPA 4ECRA 2JEGA 5KOXA 4K0KF 1S1XB 2D41A 5B09A 2VKZG 3VAMA 4IUFA 2OTJS 4FZVA 4ECSA 2FVSA 3RU0A 2XLKA 3OLBA 3W63A 2BVZA 1NKCA 4USMA 3PG9A 3MM9B 5H9EK 1UEKA 1P27B 3CJ8A 4E98A 2OPRB 4URGA 2IC3B 3UR0A 1K8AT 3DOLA 5A8WA 5CH7B 3ILIA 5C2GA 3PW7A 3W60A 1R0CB 3H5YA 4NLPA 2H51B 4JBCA 1IBKJ 1YVFA 3WIVA 2DHGA 5ETQA 1S1TB 4J9KA 4ES3A 3H4BA 1D1UA 2JNJA 4JI3F 1QSLA 2YNIA 1NKEA 3BR9A 5D6GA 1BC6A 2GIQA 4MH8A 3ICLA 1WELA 5HBMA 3I32A 5K8PA 2RD5C 2LQJA 4OI0A 1SQFA 2IIHA 4KHPJ 2V8PA 1T05A 3HJFA 3PHTA 4MIAA 3RB3A 4LF5J 1O0PA 4ELUA 1ZOTA 3NKYA 3BGFA 2HHVA 1CJVA 5I3UB 2L9WA 1HNXJ 4F0KA 1ZPVA 2KZZA 1IJFB 1BWVA 3CWJA 1R0BG 5FD1A 5E41A 4M1KA 2B3TB 4B3MF 6FD1A 4QIGA 4RO0A 3RJMB 1S48A 1RWUA 4EK2A 4FF2A 4DUYJ 4PG5A 2YX1A 2DK2A 1ZAVA 4GVBB 3IM8A 4NOHA 1B70B 4USVA 2PE8A 4ZIVA 1RT2A 3B54A 4CP5A 2FC9A 5CQGA 3I5CA 2VFVA 4DV3J 4FNHA 3M9OB 2G4BA 5IT0A 4KBIA 1N34F 2GMHA 3A3OB 3BZQA 4OJ3A 3UN2A 3TZXA 2F1FA 3EVMA 2J7UA 3RR7A 4KGVB 4U8VA 5L8RC 4NI2A 1VC5A 3G2XA 1WKKA 1IQTA 4B3RF 1IKYA 4OZ2A 3HM9A 2DGTA 3TARA 2UUCF 3T5JA 3TZZA 3BSNA 1LWEB 3MM5B 3OR2A 1FT8A 4P2XA 2NPIA 3M8ZA 3MOZA 2CJQA 3H20A 4M5DB 4M5GA 3HVAA 3QSYB 3EZOA 5JMNA 4JP8A 1GQEA 4LF9J 1TFYA 1AT1B 2HWTA 3CF5Q 3ZTPA 1URRA 2LFVA 3VR1A 4RBUA 2K06A 3CJRA 4DV7J 4OYAA 4DPUA 3EZUA 2FVRA 4H54A 2NSCA 2JLFA 2OEKA 1FVQA 4XK8C 1UVKA 1HBNB 5ETSA 5A8RA 5J1EA 4IFYB 1KWMA 2IRXA 2KN4A 2EC0A 1Q79A 4DPOA 2R8JA 2EPIA 3OL7A 3RBEA 1URNA 4HKQA 3UPFA 1Z1ZA 1SH2A 2MLYA 1X9SA 4USKA 2F3JA 3M6UA 1N5SA 5CYQA 4JI5F 2BABA 3TO8A 5A0YA 4NCBA 2ZUAA 4IRKA 3N0VA 4PWWA 2ZE2A 3UI3A 4NXNF 2DGSA 2G13A 1SXLA 4UOGA 3R5AA 4CLSA 2QG9B 1P8GA 3GPAA 1Q8LA 2Z57B 4DL5A
chains in the Genus database with same CATH topology
2OPQA 2FJWA 4JI4F 3OVBA 1RT3A 3ONQA 2RQMA 5IT4A 2AX1A 1R31A 1ZH5A 2FC8A 5MLCV 1MW7A 2PMHA 4GC7A 1SJ1A 2E7WA 5L38A 2C3OA 4WXWA 2AX0A 4J9NA 4MTPA 4E8UA 3TUZC 2E29A 4R5PA 2XY5A 3NCQA 2B4PA 1HWLA 1S76D 4IQMA 4PCQA 1GAOA 3GFXA 3OPKA 2QYCA 4PQUA 5EDWA 3DNCA 4QZVB 2R7OA 7FDRA 2ZHBA 2EFNA 1TKXA 3AJ1A 3CD7A 3S6EA 2FJBB 2KXHA 4ZP6A 1TKTA 4C2MA 2YNHB 1TVRB 3OJUA 2RJZA 1Z2LA 2I1RA 1B0TA 2DTJA 3FZBA 4I6WA 3AA9A 1HNXF 4JV1A 4NZ6A 4EBEA 1T3NA 1FKPA 2YKMA 1HI1A 4OV1A 4OZ1A 2R2TA 1RAJA 5DQGA 2GQQA 1YJ9S 1IKWA 3H5UA 5KFFA 1J2VA 3W2VA 1M90T 4PWDA 4NCAA 1KOOA 5A8RB 3MI7X 1YI2S 5DM7Q 4DV7F 2Z2LA 1LW0B 4Q8FA 3EPIA 4K5SA 1QJHA 3CCLS 1VI7A 2EW9A 1GX6A 3P5TL 5CD4H 2DR8A 3AQPA 4U6PA 2K7JA 5DDQC 4IKAA 1X7VA 2DBBA 4N41A 5F8IA 5HP1B 2CQBA 3POTA 2LEPA 1Q8BA 3AA8A 5HQ8A 4YR2A 1HNVB 2B43A 5I42B 3AY0A 3HT3A 1TVRA 2C42A 1Q7LB 1Y7PA 2VBXA 3HHLB 4QYRA 3ULHA 3I87A 2PDAA 3CCZA 2R7RA 1HNZF 2GFFA 4LF5F 4K4VA 2W9BB 1U45A 3U1MA 1XN9A 1DARA 1RT6A 1XNRF 3D0IE 2DVIA 1JMTA 1WG5A 3CC4S 3DFEA 4JV2A 4HTJA 2GMJA 3DLGA 3C66A 2ZOFA 1FD2A 3EGZA 1S49A 4PG8A 1SIWB 5FJ4A 1WEYA 1D8ZA 4RWWA 4HYKA 4X84A 3I55S 5CYJA 2CRLA 4C3MA 1U48A 3I0SB 4KHMA 1LWFA 1FO1A 1U09A 2AU0A 3K57A 3U1LA 3MM6A 2HS4A 4H4MA 2E1RA 5CYMA 3GQCA 1U8SA 4J9MA 4K2XA 4USHA 2MQMA 4DSJA 3C8YA 5B08A 1GXUA 1N33F 3IFEA 3JSMB 4QU6A 1DLOA 1UAWA 2HFNA 2OFHX 3UD4P 1NHVA 3MCSA 1N0UA 4BDPA 5J1PA 1X4BA 2J9CA 2Y1RI 2DITA 1N36F 4O3NA 2QIFA 5KFGA 1KNZA 4CO3A 3A8EA 4DLGA 3RW7A 3M1VB 3D1HA 2LU1A 3J7YU 2M70A 2EFOA 2PFFB 4ZK7M 2E66A 2KT5A 3I9ZA 3PX0A 5KG7A 1H38A 1JLEA 2YWEA 3HKWA 2PN6A 4U67Q 2FY1A 5F8GA 3MMCB 5I42A 2A10A 2FHKA 4ZA1A 1F0XA 3ISZA 2W7AA 3DYAB 3KLFB 3OTEA 5KFRA 3MM6B 4CO0A 2A2DA 2E1CA 3MPWA 2W25A 3QLHA 5IFMA 5GAGU 3DLJA 4RUAA 2W9BA 3RRHA 2ASLA 3V6KA 3K0JA 3OTDA 5J2NB 3B82A 3FSXA 3OHBA 2UUBF 5B0EA 2QFJA 1VHFA 2M2BA 2AGQA 4ICLA 4EWTA 1L3SA 2VZ9A 4WXOA