1RAJA

Poliovirus polymerase with a 68 residue n-terminal truncation
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
392
structure length
257
Chain Sequence
VDEYMKEAVDHYAGQLMSLDINTEGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALALPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Genome polyprotein
publication title Structural basis for proteolysis-dependent activation of the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 81
structure length 257
sequence length 392
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1rajA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rajA02
4.10.880.10 Few Secondary Structures Irregular Poliovirus 3D polymerase; domain 1 (Nucleotidyltransferase) Poliovirus 3D polymerase Domain 1 (Nucleotidyltransferase) 1rajA01
4LQ3A 3DI6B 3BSOA 2HWHA 2OPPA 2FVCA 4ZP7A 2RKIB 5J1EA 3CJ3A 4R8UB 1FKOA 3PW7A 2C22A 3RBDA 1R0AA 3UQSA 1S0OA 1LWCA 3DYAB 4RW7A 3TVKA 2XWYA 3N6LA 4F4WA 4ED3A 5J2NB 4RW8B 1XR7A 4RW7B 2YNGB 1TVRA 4WYWA 2UUWA 3MEGA 2IJFA 1S6PA 3OL7A 2HNYB 3GQCA 3QO9B 3C6TB 3MEGB 4TXSA 3DM2A 3JSMA 2R2TA 4Q0BA 4WXWA 3OLBA 4J9KA 1RT1A 2HMIA 3FFIA 2YNIA 1FK9A 3JSMB 2W7OA 5F9NA 3DDKA 1RT6A 3DLKB 4YR2A 3V6DA 2IAJA 2FVQA 4M94A 4NCGA 1RT3B 3TAMA 5EWFA 3PZPA 3V6DB 2ZD1B 3PW2A 4NCGB 3HVWA 1N5YB 3I0RB 3DLGB 4ECYA 1SH2A 5KG4A 1FKPB 5J2QA 4MK9A 3OHBA 4ECZA 5DG7A 2WB4A 3G6YA 1T05A 4NLSA 4IFVB 2VG6B 1TKXA 1ZTWA 4O44A 1SH3A 1T05B 4NRTA 1RT5A 4J9OA 4J9RA 5F8NA 2YNHB 4Q43A 4IQXA 3Q8RB 3OSPA 1RT7A 1JXLA 2AX1A 3M8PB 1C1BB 5CYMB 5CYQA 3KK1A 2YKNA 5I42B 4O4GB 1TV6A 3KK1B 4WYLA 2ASLA 1JLGB 2HNDA 4K4TA 3QLHA 4GC7A 1SV5A 3T5JA 5J2PA 2FVSA 2CKWA 4WXOA 5HBMB 3KK3A 2HNDB 2GIQA 1T03B 4ZPDA 2OPRB 5HLFA 4IRCA 1QE1A 3DRPB 3V6JA 3CJ4A 1HQUB 4ECVA 1S9GA 1BQMA 4MKBA 4URSA 3QYYA 4LSLB 4IRKA 5HLFB 4PQUB 2IM2A 4I7FA 2UUTA 1S1XA 1NHVA 5F8HA 2W9AA 3D5MA 4EBDA 1BQMB 5KFMA 2C2EA 4IR9A 1LW0B 4EO6A 4DG1B 3BJYA 4DL3A 5F8MA 4Q44A 3PW5A 4JUZA 3RAXA 2YKMA 4Q8EA 4QWDA 2OPQB 2JEIA 2D7SA 3KMQA 4TY8B 1S1UB 2ATLA 5KFPA 4DL7A 5DLGA 2WK4A 1TKZB 4MFBA 1HQEA 5C42B 5HROB 3KJVA 1IKWB 2UVWA 3I5BA 3RB4A 4ECWA 3DRSA 4NLWA 3CDEA 1TL1A 2ALZA 1C2PA 5K14A 4YMEA 4ZVFA 3PJWA 3LP1A 3QGGA 4EYIB 4I2QA 1HPZB 4ID5B 3C6UA 2XCPA 1RT2B 1RTJB 1TL3A 4J9LA 1S9EA 3H98A 3M9MB 2R8HA 1TP7A 1LWEA 5DQGA 2W8KA 4ECTA 2UVUA 3ITHB 4O3RA 1S0NA 1DTQB 1MU2B 4QW8A 4FBUA 2XI2A 1VRUB 3PR4A 4F50A 3H5YA 4YQWA 2FLPA 2ASJA 3GV7B 1RTDA 3KK2B 5KFJA 1REVA 1JLCA 2VG7B 5L9XA 4FBTA 1S49A 5KG5A 5FDLA 1VRTB 2IBKA 4J9PA 1EP4B 5J2MB 1JLFA 4TYAA 1J5OA 4ZHRA 1JLCB 4IG0A 3HVAA 2I5JA 4DL5A 1RYSA 2AX0A 4HKQA 3BR9A 2W9CA 3E01A 1J5OB 4NLQA 4WE1B 1RT4A 2R8KA 1RTIB 4ECSA 4ED7A 1RA7A 1S1WB 2W9BA 3HVTB 4F4ZA 4ZVGA 3MEEB 1HYSB 4H54A 2B43A 3RB3A 1S0MA 5KFYA 4ZPCA 1S6QA 3BGRB 3BSCA 3CVKA 3JYTA 3KHLA 1JIHA 2R2UA 4DEZA 3BQ2A 5C24A 3GILA 3H5XA 3IS9B 4QW9A 3KLGA 1S97A 2R8IA 3Q8SB 3M9NB 2V4RA 4RUCA 3HKWA 4ICLA 5KG6A 4J9SA 1ZETA 1HNIA 1YVFA 3RB0A 5F8IA 4IH5A 3QIPA 3M8QA 4ECQA 4RW6B 4RUAA 4RZRA 3SFGA 3NBPA 5DG8A 2OPPB 1EETA 2O5DA 3T1AA 4IFYA 4ED2A 3V6KA 5KT5A 5J1EB 3CJ5A 1R0AB 1FKOB 3NKYA 2FJXA 4WFXA 3NL0A 3NGDA 3KLIA 1RTHA 3LAMA 5EWEA 1IKXA 1LWCB 2BQUA 3BSAA 4IDKA 2FJWA 2W8LA 2BANA 3FQKA 2IC3A 4LSNA 5KFAA 5KT6A 3MECA 1TKTA 4NLUA 4LSNB 2DPIA 1C0UA 1TVRB 3SI8A 5DGAA 1S6PB 1N6QA 4RNMA 5KT4A 1RYRA 1S48A 4KB7A 3OL8A 4QWAA 4EBEA 2VA2A 3DM2B 2W7PA 4MK8A 2XI3A 4YR0A 4Q0BB 1RT1B 4H4OA 3FFIB 2HMIB 4KKOA 2YNIB 1FK9B 1QAIA 2IM1A 3I0SA 3MEDA 4ECXA 1RT6B 2IAJB 3CJ2A 4KKOB 4K4YA 1HNVA 3V6HA 2FJVA 3QGHA 5KFDA 3TAMB 3VQSA 4QWEA 4WFYA 2HNZA 1ZTTA 4Y2CA 3IGNA 2ILZA 3PHEA 2OPSA 5J2QB 3FSIA 1JLQA 4J9QA 3CDUA 1TKXB 5F8JA 2OPSB 4MIAA 2FVRA 4O44B 4URQU 4KV8A 1JLQB 1RT5B 5DQIA 3PW4A 5EDWA 3SFUA 3ICLA 2AU0A 1DTTA 4MIBA 4M95A 3MR2A 5D3GA 1RT7B 3OLAA 4KBIA 1KHWA 3PR5B 3QGIA 1JKHA 2XGQA 4ZP6A 4K4SA 5CYQB 4IKAA 2RDJA 2YKNB 4WZQA 4K4VA 3DMJA 2AGPA 3EZUA 1TV6B 3MR5A 4TQSA 2CJQA 3BQ1A 5F8LA 1SUQA 4X2BA 5KFKA 3QLHB 1W25A 2I1RA 1SV5B 2B6AA 5J2PB 2D3UA 3RBEA 3KK3B 3OL6A 3H5UA 3LP2A 2WOMA 3IG1A 1QE1B 3IGVA 4F4YA 4MH8A 1TQLA 2R8GA 4B3OA 1S9GB 4RW4A 1JLAA 1UWBA 4I7FB 4NLXA 5KFTA 1S1XB 3N6NA 4MK7A 4EYHB 4ZPBA 3UR0A 5KFGA 3IRXA 4KAIA 3KLEA 1UWBB 5HP1A 4PUOA 1IKVA 1KLMA 5F9LA 2VG5A 3OHAA 2RDIA 3MFIA 3OL9A 3IRXB 2YKMB 5KG3A 5KFWA 5HP1B 2V9WA 4O3SA 1JLEA 1KLMB 2BRLA 5DGBA 4DL4A 3CJ0A 2C28A 4MFBB 1BQNA 1HQEB 3KJVB 4Q45A 3T5HA 3DRSB 2GC8A 1TL1B 2YNFA 2BQRA 5K14B 4O3QA 3Q8QB 3LP1B 4IRDA 4O3PA 4I2QB 3KHRA 5EWGA 3C6UB 3QZ7A 1TL3B 4O3NA 2RF2A 1S9EB 4ED6A 4R0EA 1LWEB 4F4XA 1C1CA 3NAHA 2RF2B 3CO9A 2F8EX 4I2PA 4XO0A 3G6VA 5KT3A 1D1UA 1T94A 4FS2A 2JEGA 5KFEA 1XR6A 1HMVA 2AWZA 3DOLA 1MMLA 1S1TA 2WONA 1RTDB 3GIMA 1REVB 3BREA 4IH6A 3PW0A 5FDLB 3MR6A 1K1QA 2B5JA 4ZPAA 2ILYA 3DLEA 1JLFB 3MF5A 2C2DA 4ZHRB 4IG0B 1S4FA 2I5JB 4KE5A 3G6XA 1N56A 4RW9A 4R5PA 2B5JB 1K1SA 3LP0A 3E01B 2W9CB 2IM0A 4NLOA 4EEYA 4G1QA 4WZMA 2OH2A 2UVVA 1RT4B 2VA3A 2BQ3A 4KHRA 4NLDA 4H4MA 1IKYA 2W9BB 4ED0A 3LP0B 5KFSA 4PWDB 2IA6A 2E9TA 5L1IA 2E9RX 4ZMMA 3GV8B 4NLTA 2ZE2A 4NZ0A 3RB6A 1LWFA 1S6QB 5KFLA 3JYTB 1S9FA 5C25A 1I6JA 2JEJA 5KFUA 4O4RA 4EBCA 4EO8A 3KLHA 3M9OB 2IMWP 4KFBA 5C24B 3DOKA 1JLBA 3KLGB 4ED1A 2XC9A 1HARA 1CSJA 2J6SA 3DRRA 5L1JA 3MTKA 4ICLB 1JLBB 1HNIB 4IG3A 3QIPB 3M8QB 1XR5A 3NBPB 4YP3A 3QZ8A 2XCAA 1EETB 5KFHA 4G3IA 3H5SA 4IFYB 5I3UA 4ECUA 4KO0A 3ISNC 1NHUA 3KLIB 1RTHB 3TQ1A 3V81A 1IKXB 5I3UB 3GV5B 4URGA 3DI6A 3RAQA 4IDKB 4J9MA 2BANB 2J6UA 2IC3B 3H2LA 2RKIA 3MFHA 4R8UA 3MECB 5KFBA 1WNEA 3FDSA 1TKTB 5KFNA 1RA6A 4Y34A 1C0UB 3DYAA 1N6QB 3KHHA 4O3OA 5J2NA 4TN2A 4U7CA 4XPCA 4RW8A 4RNHA 4ZP9A 2JLEA 2HWIA 3NAIA 4JV2A 2YNGA 3I5CA 4H4OB 5C5JA 4KSEB 3T5LA 2HNYA 3I0SB 3QO9A 3MEDB 3C6TA 4Y3CA 5KFXA 3UPFA 5KG0A 1HNVB 3N6MA 3KLVA 2FVPA 3CWJA 4DL6A 3UDLA 2HNZB 5KG1A 4IR1A 1U09A 4TYBA 3DLKA 3ISND 5KFOA 3G86A 3GIKA 1RT3A 3HHKA 2BR0A 2ZD1A 3T5KA 2UVRA 4KV8B 2AGQA 1N5YA 3I0RA 3DLGA 4K4XA 4ZVEA 5KFVA 1FKPA 1DTTB 5D3GB 2WHOA 1RAJA 4J9NA 4IFVA 4ED8A 2VG6A 4HYKA 1JKHB 1GX5A 5DG9A 3CIZA 2R2SA 1OS5A 2BE2A 2FLLA 5F8GA 2QE5A 2YNHA 4MKAA 3DMJB 4QWCA 2QV6A 3PJXA 5DLFA 2BE2B 4RNFA 4NLRA 2DPJA 1N48A 5L1KA 3M8PA 1C1BA 1SUQB 1GX6A 2WCXA 2ZKUA 5CYMA 1C0TA 2B6AB 4TY9A 5KT2A 5I42A 2JC0A 4ZP8A 4O4GA 5JUMA 4NLPA 3GYNA 1DLOA 3LANA 3LP2B 1C0TB 3BQ0A 2E9ZA 2IJNA 2WOMB 5JXSA 3IG1B 2IM3A 4B3OB 1JLGA 3V4IA 4LQ9A 1DLOB 3I5AA 2WRMA 4RW4B 1S10A 4JV1A 1JLAB 5KFIA 1SH0A 3GIJA 2AGOA 5HBMA 2EC0A 4NRUA 4Y2AA 4ZVHA 5KFFA 3MR3A 3V4IB 1T03A 1N4LA 2OPRA 3KLEB 3D28A 5KFCA 5L1LA 2D3ZA 3DRPA 4PUOB 1QUVA 1IKVB 2JC1A 1HQUA 4NYZA 2VG5B 4LSLA 4DL2A 4PQUA 4IH7A 4ECRA 1JLEB 4IOBA 4WFZA 4PWDA 5KG2A 3KMSA 1BQNB 2WTFA 4NLGA 1LW0A 4DG1A 4Q8FA 3KNAA 4RNNA 4GC6A 2OPQA 2YNFB 2V0NA 4TY8A 1S1UA 1TKZA 5C42A 5HROA 3CDWA 1IKWA 4TLRA 2R2RA 4JV0A 2HAIA 3QIDA 3FRZA 4K4UA 1C1CB 4I2PB 3E51A 4RU9A 1D0EA 1HPZA 4ID5A 5T14A 4FS1A 1RT2A 1RTJA 4NLVA 2V4QA 1IM4A 3FQLA 1HMVB 3DOLB 1S1TB 1RDRA 2WONB 3ITHA 3PVXA 1JX4A 5KFQA 1DTQA 3NMAA 1MU2A 4TQRA 3H40A 4K4WA 4U6PA 1VRUA 4XPEA 3DLEB 5KT7A 1Z4UA 4RNOA 2ASDA 2J6TA 4NLYA 4RW9B 4R5PB 3Q8PB 3GIIA 3KK2A 2GIRA 2R8JA 2XGPA 2VG7A 4G1QB 2BRKA 1VRTA 4H4MB 5KFZA 1IKYB 1EP4A 5J2MA 4YR3A 3H4DA 1LW2A 3KLFA 4K50A 3KHGA 5KG7A 2JEFA 3KOAA 2ZE2B 4KHMA 1LWFB 4WE1A 1LW2B 3KLFB 5C25B 1RTIA 3OSNA 3KLHB 3IN5A 1S1WA 3HVTA 4KFBB 1T3NA 3DOKB 3MEEA 1HYSA 3EPGA 5DQHA 3H4BA 5EUHA 3DRRB 3EPIA 1S1VA 3LAKA 2C2RA 2FLNA 3BGRA 4OL8A 4IG3B 1KHVA 1QAJA 1S1VB 4K4ZA 3IS9A 1NNDA 3T19A 2AQ4A 3BSNA 4QPXA 3LALA 4KO0B 3H59A 4QWBA 5KFRA 2D41A 3V81B 4RW6A
chains in the Genus database with same CATH superfamily
2FVCA 2JOQA 3I32A 2RKIB 1FKOA 1EKRA 2BBEA 1TK8A 3DCAA 2E5GA 3OFFA 2MQLA 2Y1JA 1J27A 2UUWA 1N5VA 3E2EA 2GVDB 1VBYA 8RUCA 3JTNA 4GKKF 2WSEC 2RIJA 3HHLD 2VBXA 4QYZJ 4L75A 3CCZA 2DY1A 1X4CA 2XTJP 1LFPA 3NXZA 2AV5A 4N47A 1C1BB 1OYDA 4FNHA 2HS3A 2KXFA 4ZVQB 1FXRA 3MDFA 5J2PA 4LF5J 5HBMB 3KK3A 3HJFA 3RUBL 1BQMB 4USUA 2F3JA 3WIUA 1VBZA 1JK9B 3I82A 2O3DA 3U7JA 3UI3A 1U0HB 4ZLJA 3J7A1 1AFIA 1RAHB 4X4RA 1TL3A 2MMYA 3H98A 1LWEA 3OVAA 4PG4A 1BXNA 4DR4J 5FDLA 1IBLF 2DCLA 5EX0A 3ETMA 3E01A 5HAOA 3NGRA 5G4DA 3CVKA 3H42A 2OHDA 4RW6B 3P45B 4B9UA 3VGTA 2VICA 4DCJB 4P72A 2O01C 3A3PB 4M5LA 1WOSA 3G8TA 2FJVA 3QWUA 5KFDA 1UTAA 3VZHA 5E3QA 5K8NA 4DV5J 1NCLA 2BXJA 3ISZA 5EDWA 1U1PA 4OI0A 4MIBA 4JI2F 1UAWA 2F8MA 1FESA 2QA4G 1HNZJ 1GQEA 4CH0S 4TQSA 5HJYA 1W25A 1F6TA 3CJ8A 3IBWA 1Q82T 4MH8A 2E5LJ 3HHEA 4ES1A 1UWBB 3CEDA 2NSCA 3I6PA 4JI4J 4FYDA 3CJ0A 4DDFA 3ENQA 2LQ9A 3OJSA 2V8GA 3A12A 5K14B 3KNGA 3Q8QB 4AL5A 2VONA 5B0AA 2HHVA 1NDCA 4P6QA 1RB0A 4F4XA 4DPUA 2X1AA 2DKOB 5KT3A 4FXWA 1VQOS 2RSQA 2WONA 3GIMA 1REVB 3R2CJ 4IH6A 4ANEA 1K1QA 2C3OA 2A10A 3BN4A 2C2DA 3SMZA 4X64F 4NLOA 3NGKA 4G1QA 5HVFA 1U48A 2V2KA 5HMZA 5L1IA 4G65A 3RB6A 1BWVA 3MAAA 3AOCA 3W5YA 3AHPA 4DLEA 1HNIB 3M8QB 2VBZA 1GMWA 3L09A 3DI6A 3W8GA 2CG4A 4LMZA 1CPZA 4PG7A 5BXIA 5K20B 4FKYA 4RW8A 4MAKA 2JH3A 1DURA 3OFEA 4KSEB 5GMDA 3UCGA 3AOBA 3GR0A 4OJ3A 5KG0A 4ZCLA 2GHVC 5A8RB 2JVRA 3OQ2A 5CD4A 4DQRA 2UU9F 3G86A 2KT5A 4LF6F 4DSJA 2LECA 1AFJA 4DV0F 5D3GB 4C8OA 2MKIA 4L6V3 2BE2B 2N4DA 2VOOA 2W4DA 1R8PA 2CZ9A 2UUBF 5L9NA 2X51A 4LF2A 1U25A 1EHWA 4DV7J 2OPRA 2WSCC 4Q2LA 4DL2A 3D3BJ 1R8AA 4DU8A 3RBXA 2YNFB 4ID8A 3BM7A 1TKZA 2OLWA 4BHQA 3W64A 4ID5A 5T14A 3GJQB 5KFQA 2OKQA 1FJGJ 4U6PA 2ASDA 5KTQA 1Z4UA 3FK4A 3KKFA 4O0IA 2BRKA 4H4MB 5KFZA 1EP4A 3VAKA 3KLFA 1R8HA 2ZH6A 4CLLA 2G9OA 4V19X 3DOKB 4MIWA 4HL9A 3JB9k 2XS2A 2QRRA 3ILIA 3D1QA 1AYEA 1WACA 4FYVB 2B4VA 3D6MB 1M1HA 3BYPA 3N4WA 1TVRA 1UPMB 4QPTA 3N28A 3DDNA 3VHQA 2YNIA 4TLQA 1NZ8A 3FGVA 3JSMB 2IY5B 1NO8A 1IBMF 3EVMA 1N5YB 3FSYA 3QATA 1RCXB 1FKPB 3MM8B 4O0NA 2ALYB 1YJWS 4LR8A 2B51A 3CUNA 1F2GA 5F8NA 2F9DA 4ZJOA 1CG2A 5CYQA 5D0HA 2AW0A 2J0XA 5D6GA 4KHPF 2KG0A 4DQPA 2WVBA 4QYZK 4AQYF 2BUNA 7FD1A 2BE9B 3M30A 4IRKA 4OHZA 3TR5A 2RS2A 1PAEX 3HF5A 5IT4A 4NYPA 4I67A 1WTFA 2EFVA 4DG1B 3CC2S 4DX6A 3PW5A 4FF4A 9RUBA 2UXBJ 2MB0B 3BGFA 5HROB 1RZMA 2HHTA 1X5TA 4Y0FA 5CA5A 2EC2A 3O44A 3I55S 4TKTA 5IWAF 4DX5A 2E5HA 3AXMA 3I4PA 5GAGI 2DO4A 1YGYA 4X4QA 1JLCA 1VRTB 4LJMA 5EGYA 4HKQA 3BR9A 5GAHU 4IUFA 3VGSA 1VQ5S 3KHLA 1AZSA 3R5BA 1JQGA 4F0HA 2OIHA 3Q8SB 3M9NB 1MLAA 4FF1A 1PBUA 2I9SA 1EETA 2Z0GA 5D0RA 1FKOB 3LWMA 4X4TA 3EGWB 2R7TA 3A1YG 4CZCA 3HM9A 3AT1B 3UCUP 1RAGB 5DGAA 4HLBA 4ZN3A 1HD1A 4MK8A 1AB8A 2FZCB 1TKDA 1VHFA 1WWHA 3QGHA 4DHVA 3MAQA 3W66A 2BACA 3LWLA 1JLQA 4A47A 3IAS9 3PFOA 2XGQA 4DSEA 4DV4F 2Q66A 2DXEA 2CJQA 2RB7A 5KFKA 5J2PB 3RBEA 4X4OA 3KK3B 1SKWA 4CDIA 3IGVA 4B08A 3OTCA 2BABA 4MK7A 5JMNA 3NY0A 4L72B 4KAIA 4YDDB 3OFHA 3OHAA 3IRXB 4O3SA 3CCRS 3NCPA 2MZSA 2X1FA 1SKSA 1NK5A 1HIYA 4OYAA 1TL3B 1WG4A 1LWEB 2HLUA 4KRWA 1UMJA 1GAOA 3OTOJ 2DITA 4W90B 1D1UA 4ILLA 2OTJS 1HMVA 1I3OB 2YBVA 3GFXA 5FDLB 1S4FA 1K1SA 3DGVA 3E01B 2BKNA 2OH2A 2IA6A 5DRKA 1H72C 1I6JA 3KLHA 4UOHA 1JLBA 1XBWA 2J6SA 4CLWA 3WBZA 1SJFA 3OW2R 4LRDA 4UZBA 3QZ8A 3RJMB 2CPFA 4X65J 3IR7B 3MHYA 4DSFA 3CO0P 4O3OA 4U7CA 2JLEA 2YNGA 4NMXA 1X4GA 3LO3A 2LEPA 1U2RA 4PG5A 4A8MP 1GTEA 3MPVA 3W5ZA 1Y9OA 3QPIA 3PY8A 1DQ9A 1S72S 4LF9J 3GTYX 4L74A 2QE5A 5DLFA 2LEBA 2LQ5A 4DSKA 5CCLA 2ZH1A 4ZCMA 2IJNA 3TX0A 2NUUG 2CXEA 4TU9A 5KFFA 4ZOSA 4C3KA 2JC1A 4QIFA 1NPRA 3J7AN 4LRAA 2V1SA 4K7QA 1WC4A 3BS9A 2D3O1 2N3OA 2VQFF 2MSTA 4JV0A 2J9DA 3RZAA 2RQMA 3ENAA 2Q6BA 4OHXA 4TVAB 2WONB 4K2XA 1B7FA 5IT9U 5AJ3F 4XPEA 5I3PA 2FJAB 1XNQF 4OMFG 1EB0A 4G1QB 4A4JA 1BE4A 4K50A 4C98A 1FWPA 4WE1A 3MAAB 1EQMA 3HVTA 2DNGA 1HNXF 1H74A 5DQHA 5D4PA 4C6AA 5ETPA 1VQPS 2V2VA 5IV3A 3LGMA 3JSYA 2YWHA 4HEA9 5B08A 3DI6B 2J9CA 1RADB 2C22A 3MTJA 4DV2J 4RW8B 3IC1A 3SCJE 4IO9Q 3ILLA 1EZZB 2XY6A 2Z30B 2Q6CA 3NGTA 3CGIA 5JVHQ 4OX7A 4CNYA 2DRBA 4M94A 2QYCA 1JMTA 2AJFE 4W98A 2KFNA 2P8IA 3SBMA 1YZ7A 1SQEA 4JI0J 1U2CA 3OPKA 3PYFA 4OI4A 2IRXA 3T6JA 2ZOFA 2FVSA 2EG1A 1TFYA 2OPRB 1VHIA 3MAHA 2CNKB 5HATA 5A8WA 4DL3A 3VALA 2AJ1A 1XQIA 1TKZB 3OXFA 1F0XA 4OZ1A 1T9XA 2PEBA 3Q0AA 4ID5B 3C6UA 4AXJA 2DYAA 1YX2A 1ZS6A 3M7VA 2XMJA 3I96A 4USKA 1WG1A 2M8HA 1EP4B 4ZHRA 4IG0A 4C2MA 1J2VA 3P4UB 1GT8A 5IM0A 4F4ZA 1H2VZ 4GO5X 2LQBA 3B4MA 3IBFB 2X1BA 3K2YA 2V4RA 1VLOA 1FI4A 4HR2A 4RZRA 1WEYA 3NNAA 2FHKA 3H90A 4PKDB 5KFAA 4NLUA 1TVRB 2LVWA 1URRA 3CCLS 4YR0A 4JYAJ 5A6PA 4QBUA 2YNIB 5LXYA 4ILRA 3I0SA 3K5LA 4Y2CA 3NCRA 5K8PA 2OPSA 2Y1LB 4F0MA 2J0QD 4DR6F 4CO5A 2GIFA 4M95A 1SCJB 4ZS6A 5CYQB 3NNHA 3DMJA 4ZVSB 3BQ1A 1HBNA 2OSRA 2FJDB 3HD1A 3MCNA 2MKSA 4EZ6A 1PJ5A 1JLAA 4NCAA 3GCXP 4FVMA 4KGXB 4PUOA 2V9WA 2M70A 3N79A 3PG9A 2L9DA 3LUYA 4O3QA 4CLPA 4IRDA 5EWGA 5AXKA 3BO3A 1BY9A 5L46A 4HTIA 5B0GA 4TU8A 3FMBA 3R5GA 5I3QA 3DLEA 3AA8A 2V67A 4B17A 5AXLA 2V94A 4PWDB 1Z1ZA 1YQHA 1W2BR 1AZSB 3TARA 3ETOA 1XN9A 1UVLA 3PNIA 3HI9A 4IG3A 3UCZP 4YUDA 4EWTA 2RILA 1EETB 2PFFB 3GJTB 2B4UA 1W2IA 4OZLA 4RL1A 1RUSA 2ZHAA 4M5HA 1RAEB 1RU1A 4NMLA 2Z2ZA 1VQYA 1PJ6A 3T5LA 4P75A 1M5OC 4CLTA 2XMMA 2RAQA 2W7AA 1NK7A 3TUZC 5HJXA 1Q1KA 2WHOA 3E3XA 2VH7A 4HYKA 3RRHA 3MCMA 2HVEA 1SIWB 3UE2A 3J7ZT 3A3NB 1UETA 4NLPA 3BQ0A 2E9ZA 3M05A 3D0GE 2DD8S 4Y65A 4F02A 2WRMA 3KJNB 1N4LA 4BLGA 4LF5F 4IOBA 4WFZA 4NLGA 4F04B 1RXOB 4XK8C 2QEXS 1PYSB 3CDBA 2E29A 3DNCA 2B3TB 2MKCA 4G6VB 2YX1A 3BPDA 1HMVB 3PVXA 1FRIA 4OX8A 1ULRA 2NR0A 2COLA 1D9DA 5KT7A 1VQLS 1L3VA 4HTJA 3OFGA 2OD6A 3H20A 4ITSA 1VI7A 3KLHB 4DR4F 3S6EA 5EUHA 3EPIA 1QSYA 2AEFA 3QT7A 2CQDA 2D9OA 2XYHB 4FVCA 4JI8J 4J37A 4PYDA 4PWUA 5LMNJ 3QFHA 1YWXA 1S0OA 2ZH3A 3JQKA 3TVKA 2AYBA 1L3KA 2P9GA 3UNYA 2XZWA 2YNGB 4Y00A 2RQKA 1W26A 3MEGA 1EARA 1S6PA 3CJKA 4GKJJ 4DSLA 2HKEA 4DF4A 2C3YA 3SXLA 1CJTA 4J9KA 2HMIA 4NXNJ 4DV6F 5F3TA 1K0VA 1QAXA 4DZDA 1TL7A 4ELUA 2NSBA 1YLXA 3D68A 2H5IB 2Y1RI 3UN2A 3ZNJ1 4DV5F 3CMAS 3VR1A 2YKPA 1UA0A 3P6YC 3KK1A 2YKQA 2H54B 1NJWA 2DEJA 3T5JA 3C46A 3GG0A 4USJC 1QE1A 4MKBA 4IOCQ 5HLFB 2B9WA 4CT8A 2Z57B 4B3MJ 3AJ2A 1FKAF 4E8UA 4NXMJ 4ECWA 1VMBA 2YY3A 1VBXA 2EW9A 2ACMA 4OZNA 3MUTP 4DPXA 3AOAA 1AA1B 1JLFA 4USTA 5M2PA 1TK5A 4WE1B 5IC6B 3HVTB 1U0SA 3A4TA 3X3UA 4D3GA 2LFVA 3GILA 2R8IA 3CCJS 3OR2A 5EN1A 4FZVA 1NH8A 4ETZA 1QUPA 2AYGA 4NPOA 3NL0A 4CO3A 5HVHA 3GG1A 2FHJA 1Q16B 5H9FJ 2PGCA 2IM1A 4ZJQA 4YEAA 4UTGA 3DLLQ 1ZM9A 3EXCX 3V5RA 2HBRB 3EZOA 2ILZA 1HA1A 4DX8H 3SFUA 2WVEA 3ICLA 1KWMA 3SCIE 3KFWX 1BHNA 4C8LA 1MN9A 3HFZB 2HQIA 2AGPA 4E98A 2XHCA 2VF3A 1YITS 3PV8A 2BJ3A 2R8GA 1TQLA 2XS7A 1HR0J 4X4VA 2XNQA 5A8WB 2MKHA 2RDIA 1FDNA 2AMCB 4DV7F 2HVHA 3BKUA 4WJBA 3T9NA 3C6UB 4O3NA 3AQPA 4KH1B 3PDNA 1XR6A 1Y11A 2W2QP 1F9EB 3B4DA 4ZHRB 4IG0B 4LRBA 3Q83A 4JOUA 2AEJA 2R9LA 5IM0B 1FJGF 1GTHA 2P6TA 3GV8B 2ZE2A 3TOQA 1QY7A 4C11A 2ZC3A 3M9OB 1CLFA 4HI1A 3R7NB 3DOMB 4YP3A 3PRVA 2B9XA 2AF6A 3EVWA 3M6UA 3H2LA 5FLXU 1O5JA 1UA1A 4NASA 4TN2A 2QZ8A 1ZBTA 1L3TA 2LA6A 3I0SB 3QO9A 4Y3CA 1WDDA 3KLVA 2ZD1A 4YHHJ 4ZK7M 2ZJQQ 4OI6A 1RAJA 2C2KB 3N01A 4WP3A 3CIZA 5F8GA 4YB7A 3DMJB 5L1KA 5A6WA 1HBNB 3ZZRA 4B9NA 2BM1A 5JUMA 3W3SA 2X3DA 3I5AA 3IO1A 1JLAB 4LFBJ 2HQCA 5L1LA 5KFCA 4PUOB 1XC9A 1CJUB 4P7VA 5CQGA 2CUYA 2OPQA 2VUGA 1SKUB 1U8SA 3PYDA 3HX9A 1GK8A 2UXBF 2HHUA 1FRKA 2CQ2A 1EX8A 1DTQA 3FKBA 3DLEB 2V4JA 4LF4J 2U1AA 4ZCKA 4X62J 1S7HA 2BVZA 5J2MA 3EMTA 5LJ5Y 2XLIA 4ATNA 3OSNA 2QLFB 5IQ6A 2F9JA 4IG3B 4ES3A 1NNDA 1H6KX 3LALA 3H59A 2ZUGA 1F5CA 3Q2TC 2V68A 2BJ7A 4ZVRB 3AJ1A 4OYZA 4LIWA 1R0AA 2DR9A 1UW9A 3HULA 1T9UA 4NCBA 2DNMA 1JJCB 2ZH5A 2QYGA 1QDUB 1HD0A 1WKKA 3TZZA 2DIUA 1X5SA 3V6DB 1JWWA 2XSFA 2MTLA 4AE5A 2WB4A 4OJ1A 1T05B 3K7RA 4IQXA 2RQCA 2AX1A 1XMOJ 2QJ3A 1V3SA 2EBGA 2OEMA 4WYLA 1FFSB 5F0UA 2ASLA 2HNDA 4U95A 3NRBA 2GIQA 2VBYA 4IRCA 2B9YA 3KG1A 2CZ4A 3QYYA 2V63A 2F40A 1FXDA 2V50A 1Q4RA 5F8MA 2LLZA 3S8SA 2GO9A 5LSRA 3M8SA 2VU5A 2OEJA 4EYIB 3DFEA 4BWMA 1U6ZA 3RBZA 1Q5YA 1SJRA 3OTOF 3BDPA 3GCWP 4OZ0A 1N33F 4ALZA 4CP5A 3ZFVA 1VQ9S 1R27B 3RB3A 2VKRA 1KS2A 1JIHA 2R2UA 4Q2MA 5C24A 4F36A 2VDHA 3RYLA 1ZETA 3QIPA 1GH8A 4YB1P 4DR7J 4FKXA 2CPZA 2L08A 2VD3A 2Y0SD 1RTHA 5HI7A 3H8YA 1XTZA 2VJUA 3FQKA 3QQCD 5IQQA 1S6PB 3CJKB 4X65F 3TWZA 5CD4H 2GMHA 2OJ3A 1CJTB 2HMIB 4LFAJ 1T3OA 4KKOB 2UXDJ 4K4YA 1SC6A 2NUHA 3P5BP 1TL7B 1XIQA 2GW8A 2NLWA 5LL6d 4URQU 4RR5A 2PN6A 1DTTA 1S59A 5T7LA 2J7UA 1Z2ZA 4LF9F 5GAEU 1RWPB 1QE1B 2EPIA 1A9NB 4RKUC 3X1LB 4PCQA 2MGZA 1RQ0A 9ATCB 3OV7A 1KLMB 5E3AA 1DQ8A 4Q45A 1CBKA 1I51B 3TAQA 2DR6A 2PE8A 3EJMA 4XO0A 1QVFR 2F8EX 2XO7A 1FJEB 2CJBA 2P5VA 3A8EA 1JLFB 1YG0A 2G4BA 4NI2A 3G6XA 1N56A 5DZ6A 2JLFA 4KHRA 6FD1A 2MDAA 4ED0A 2Z8QA 3CB4A 4NLTA 5IT0A 1WTBA 5F0WA 3BDEA 7FDRA 2HSEB 1CSJA 4PEOA 3OR2B 3W7BA 1ZPWX 2R7XA 4ZLNA 1HWIA 4ECUA 1NHUA 2ZDPA 1OSDA 4URGA 2CJKA 2VFVA 3M6VA 3FDSA 1TUVA 4KGVB 3H2VE 3EX7B 5C5JA 5FD1A 4DV2F 2WAQD 2HHPA 1JJ4A 4B3SJ 1M5SA 2K1RA 4IR1A 4EK2A 4UF4A 1TMJA 1MMNA 4MKVA 2BW7A 5K9FA 4M1KA 2R4FA 2VBWA 3FBEA 1OS5A 4MKAA 5BJRA 4RNFA 1N48A 3K5OA 3ZC4A 3HD2A 2IFXA 2OMLA 4JI0F 3LANA 4HHHA 5IV4A 1QTMA 2M88A 4OX9J 3V4IA 1YBAA 4Y2AA 5T41A 1N32J 4DR1J 2J7WA 3KNAA 1P1TA 2JNJA 4ZCIA 4DWIA 3FMWA 2XYPB 2B56A 2HAIA 1YIJS 2E1CA 1S99A 4M5NA 1HPZA 1NSAA 1HW8A 2DGQA 2ZNYA 1VRUA 3C8YA 1JXEA 1I5OB 4CLKA 2MQQA 4NLYA 4JV5J 4D3HA 2O67A 3CCUS 2ZE2B 1LW2B 4C11B 2OAUA 1HYSA 5GMEA 2C2RA 2JRSA 4BDPA 1OO0B 2KYXA 5DM7Q 4IOAQ 2NS1B 2OPPA 2QL5B 4RW7A 2DT9A 4RUBA 2ROEA 5A2QY 4WYWA 3MWBA 4ZIWA 2GMLA 3QO9B 1UFWA 1KKHA 3V2UC 4YR2A 3DGPA 2ZD1B 3CC7S 4JYAF 2J76E 5ETVA 2KRBA 4ECYA 1OSCA 1SQGA 3UWTA 1R43A 2CAJA 2QG9B 2V6AA 1HBOA 2VJVA 3OSPA 3Q8RB 2HRYA 1WC6A 4U8YA 2NXUA 2P6SA 2MHEA 3K57A 4Z2XA 3BGLA 1HHQA 1YSJA 2IRYA 2DR8A 3G4SS 4LREA 3PX4A 4F3QA 1VK8A 2QFJA 2DNPA 2OPQB 1Y7PA 2OFHX 5DS7A 5DLGA 3EDRB 4DV1J 3RB4A 1SJ1A 4C4WA 2E5IA 2W8KA 3DHXA 1FX4A 1DTQB 2DGXA 4F67A 2IBKA 5J2MB 3GP9A 4TYAA 3THPA 4AXIA 3BO4A 1RYSA 4HT7A 1SPBP 4XTTA 1J5OB 3PKMA 1H0HB 2R42A 2W9BA 2F8HA 2WZ1A 1S97A 5E0OA 4RUCA 4J9SA 4ECQA 5MAOA 3TANA 3H25A 2RS8A 3TJ8A 5KT5A 3PHTA 1R0AB 1RBLA 2FJXA 4WFXA 2DGVA 4B9TA 3HVRA 1FDDA 3MECA 2ZJRQ 2KYZA 4MYUA 3JQMA 3M2RA 2RMLA 4L76A 4H4OA 4X4UA 4NYOA 1XNRF 3WC2A 3J80U 3IGNA 3PACA 2MQNA 5ETSA 2F4VJ 5C2GA 4KV8A 2D9PA 3CCTA 3PW4A 1UWAA 1XK8A 4CT9A 1FVSA 3R27A 4MYTA 2E7WA 4ZP6A 2EKYA 4RX6A 1M0SA 3KUGA 1N52B 2R7SA 1SUQA 2XMVA 1PYTA 2XO6A 3FCHA 3MMAA 2XLJA 2HFOA 5AXMA 1FCAA 2XTEA 2DK2A 5HP1B 1X0PA 1SIZA 1K47A 2MQ8A 4QOTA 1VYAA 2ZH8A 2KZZA 4WP8A 4B3TJ 2RQ4A 3J7Z5 3QZ7A 1X31C 2XM3A 2RF2A 2QX0A 4ED6A 4OYMA 1OM2A 1FRLA 4K59A 1S7IA 3K8WA 1NJXA 1N0UA 4JBCA 2DHSA 4DPTA 1BD6A 3IR5B 3POTA 4KE5A 3QGPA 1HI1A 2B5JB 1OMSA 2A1BA 2BQ3A 4CWBA 1Q8IA 2DR7A 2B8QA 3EDQB 4ZMMA 4NZ0A 1LWFA 1HQ2A 5C25A 4JB8B 2OO4A 3FVYA 5C24B 3BPSP 4QIGA 4BWJA 3QIPB 2YH1A 2XCAA 3L95X 5KFHA 4HDHA 1NDPA 1RTHB 1U26A 4DCPB 3P96A 3RAQA 2R7RA 2XB2D 1Q7YT 1HI0P 4WP9A 1PSDA 4LBHA 4JI6J 2UUCF 1LV5A 4RNHA 1UJ4A 5BR8J 3TUPA 2EK6A 1DJ0A 3N6MA 3D66A 1WEZA 4GKJF 3RR7A 1IUJA 5KFOA 1VC0A 1Y3JA 1DTTB 3MPDA 3UFCX 2AD9A 2FLLA 1NPPA 2DPJA 5D15A 5CZXA 1C0TA 5I42A 4O4GA 3WC0A 4GO7X 2AJ0A 2GAHC 5KFIA 3GIJA 1LXNA 1OJ4A 4UT4A 2MGZB 1GMVA 3UO0A 3DRPA 1B0VA 4WK3A 4IH7A 2POKA 2CFXA 3UVJB 3MCSA 3I9ZA 2HGMA 1ZPVA 4X66F 1KBRA 5C42A 2WBMA 4B3MF 1OY8A 3FRZA 3E51A 2YH0A 2DNKA 4NXMF 3PFEA 3TP2A 3AXKA 4NI2B 2H1YA 4TU7A 2GIRA 4ZVOB 3W62A 2VG7A 2F5GA 3SEOA 3DXSX 2XMUA 4P71A 5ETRA 3ZXWA 3MM7A 3OTEA 1X5OA 3IS9A 1UVIA 1V3ZA 1H3DA 2V2ZA 1TAUA 3QBCA 4MKYA 3KUEA 2HWHA 2HW3A 1RWXB 1R89A 2X1GA 2B7CB 3RBDA 2VZ9A 2E66A 1SL2A 3N6LA 1B70B 1T11A 5DZ7A 4WFAQ 4WFBQ 2FDNA 3H0PA 1F5BA 4KGZB 1O6XA 3JSRA 2K1RB 1RT6A 1FX2A 4P2MA 2BZ2A 3TAMA 3EZ5A 4NCGB 2A18A 4DR3J 1SH2A 4OIXA 1YDLA 3GMGA 2GJFA 3L7PA 2K2PA 4PRFA 4Y2IA 4ZPWR 4C8NA 4PABA 2I38A 4QQBA 4WXOA 2VPWB 2PFDA 2XSJA 2ADBA 4DPWA 4LF8J 5ETQA 1Q78A 1N5QA 3ZZOA 2J0WA 3MOZA 5B09A 1RLCL 1HPZB 5I4MA 1S9EA 2UVUA 4XDCA 3PYEA 1VRUB 4PAAA 2FLPA 1IR1A 2ASJA 3Q22A 3HJVA 1FRXA 1HYSB 3BSCA 3M8YA 2CPEA 2N7YA 2GAGC 3KLGA 1S12A 2OPPB 3CDAA 3CJ5A 4OZ5A 3NGDA 2DBBA 4HVZA 2UUAJ 3BSAA 2A3JA 3J81U 4LSNA 2ZFHA 2M0GB 5K5MA 2BA9A 1N8RT 4R0JA 3MUMP 2FIUA 3RAMA 3CCMS 1M5KC 3AD7C 3V6HA 1HLWA 3DGPB 2ZZNA 4WFYA 3PRDA 4JP8A 4CLYA 3CDUA 1HBOB 2MQOA 1NMEB 1RWWB 5LXRA 3CJRA 3VGVA 3W2VA 2RDJA 2HZAA 3CCSS 1UCNA 5ETTA 2Y3YA 2Z2LA 2RE1A 2FB0A 2CQGA 1V5VA 4X4PA 2PC6A 2BX6A 4USMA 3M8ZA 2BRLA 1V3RA 1YRXA 2G2OA 2LEAA 2HPUA 2IDEA 3BR8A 3B54A 2UXCJ 3MURP 1HKAA 3EM1A 2CPIA 4FS2A 3B8HA 2B0GA 2YQ3A 4ZPAA 4ZKAA 1TL4A 3MF5A 3L7UA 2DHAA 3LP0A 4EEYA 2VA3A 4NLDA 4LVNP 2W9BB 4EFAC 5KFSA 4X62F 2V8DA 2IVMA 4ED1A 5CYJA 2CVIA 3OT9A 4G3IA 5I3UA 3TQEA 1VQ4S 3WDOA 4GKKJ 3MECB 2H5JB 1U7LA 3Q8YA 1QSSA 2IDLA 1G6BA 3M2RB 2DGTA 2HRTA 4A8SA 4H4OB 3A8JA 2HAFA 4ELVA 1RGVA 3C6TA 4KIAA 3I56S 3AA9A 3L4BC 3DRXA 3J81j 1U09A 2HVDA 4W4MA 2BR0A 4KV8B 1HHSA 4Q5VA 2NREA 5J1PA 3D9BA 4IFVA 4B9MA 2XBPA 4FF3A 3N5FA 3CJSA 5LMUJ 3M8PA 1SUQB 2WCXA 2DCUB 2CWXA 1DLOA 3MMAB 5JXSA 4JV1A 3PEHA 1CULA 4H4KA 4NRUA 2MSSA 2AZ3A 1WC1A 2DXFA 2JDJA 2P9CA 1EJ7L 2Y8YA 3GFYA 3GONA 3OVBA 1NK0A 1KSPA 1O8BA 4QIWD 1BQXA 1NK8A 1IBLJ 2R2RA 2LA4A 5K8OA 4OHVA 1RSCA 4K4UA 2QLBB 2HFNA 2HHQA 2GO8A 1SC3B 1LK5A 5B0FA 3WHIA 2EI5A 1OQ6A 3POTB 5ETKA 2ZBIA 4DZ6A 1B7YB 3KK2A 4LF7F 1Q8BA 2XMKA 1CQNA 4N77A 5F3ZA 3GU0A 4KHMA 1LWFB 2MZRA 5C25B 1BLUA 1T9WA 1N54B 4PXCA 3DLBA 2FUG9 3ZZYA 1TTHB 3TNVA 1KOHA 1HFEL 4CRJA 2N82B 5E41A 2KT3A 1U47A 3VAIA 2VFSA 1VCTA 1R8CA 2ZC4A 2XWYA 1KRPA 3MM9A 1CS4A 1FERA 3T1HF 2HURA 1PKUA 2A6MA 1U2FA 3OL7A 3QAUA 3Q24A 2MPUA 1RT1A 4J5OA 4JI2J 4MJKA 1UUJA 4I1TA 2AHOB 1HWLA 3CF5Q 3VAJA 3PZPA 3HVWA 4M5MA 4LFAF 1MMDA 2VC0A 2UXDF 4C8KA 4YFUA 4I6AA 3Q23A 1SL0A 1K8AT 2CPYA 4I6WA 5CXTA 5GAEI 5I42B 4O4GB 5E3CA 4B3RJ 3CE8A 1NKEA 2VIHA 1IM6A 3DRPB 2IM2A 5HVGA 4KPCA 2RH3A 4IR9A 5LOQA 2ATLA 3CJTA 4QYRA 4MFBA 5C42B 3KDOA 3KJVA 3O2IA 1C2PA 5HK4A 2L41A 2RUSA 1UJ5A 3HSDA 2FHOB 1RHJB 4A8QA 3J80Y 5E5NA 1N36F 4F50A 1IR0A 1X7VA 5EX3A 4H4KC 1RTDA 2VG7B 1PGZA 2DGSA 3T9ZA 3HVAA 4OI2A 2MJNA 4DMZA 4F25A 4ED7A 1T9VA 5DETA 1IBCB 3MM7B 3HP6A 2G1DA 1SJQA 1S6QA 5B0DA 2DH9A 3IS9B 2QMXA 4NZ7A 2C2OB 3MZIA 4IFYA 2L3MA 2PSZA 2DNYA 4OYBA 1TKTA 1VBKA 2UU9J 1RYRA 3ZZTA 1RT6B 3TAMB 1ZAVA 3W9HA 5F8JA 3M1VA 4MIAA 4B3SF 2J9DE 3LGHA 2ZDOA 2MKYA 1U1KA 1N5SA 3AODA 3OLAA 1KHWA 3BGUA 5BYQA 5F8LA 2Z58B 1KFSA 4S0MA 3LP2A 2XQCA 4N8OA 4DN0A 4RW4A 4NLXA 2XSJB 2DNOA 3KLEA 2KI2A 4OX9F 1JLEA 2EWHA 3ELHA 4J7CA 4DR1F 2BJ9A 3C66A 3US5A 2BQRA 2OP5A 1VFJA 2B9EA 4OX6A 1Q86T 2PDAA 1S9EB 2W4CA 3DDIA 1GNKA 3IWLA 3G6VA 4CH7A 1R6VA 3I4HX 1RAOA 3QT6A 1L3UA 3LQVA 2Z2MA 3CCWA 1VIXA 2LP4A 4WF9Q 2QLXA 5KFUA 4EBCA 4JV5F 3KLGB 5D0EA 4DLGA 3HDSA 1DBDA 1YBUA 5ADZA 4EUVA 2APOA 4OJGA 2R7OA 2DNRA 1R31A 1PIEA 3ENWA 3BH6B 5J2NA 2KFYA 2IYIA 3TRGA 4DQIA 4A48A 3MGJA 3FNNA 1SVDA 4IQMA 2FLOA 1TUWA 5C7PA 4ZVEA 2MKKA 4KGMA 2VG6A 4QCLA 3IM9A 3W2VB 3C2PA 1TAQA 4LSZB 1FRHA 3HKZD 2QV6A 3OTBA 4P52A 2GJ2A 2E7XA 3QWPA 2NCKL 2JC0A 2AEMA 3GYNA 2ZKTA 3JS9A 2HVIA 1FJCA 3BGOP 1E6VA 1NM2A 2CG8A 2AGOA 3FBBA 1FNOA 5HSPA 2MZ1A 3TEGA 2D3ZA 2AYMA 3G8SA 1OPIA 2RT3A 5KG2A 3JAMY 2MYFA 1S1UA 1FRJA 2OGUA 1CJVA 2BOAA 2IA0A 1RTJA 1APSA 4NLVA 1JJHA 5HQLA 2V4QA 4DV1F 3FQLA 3NG8A 1RDRA 2CQ1A 2AKWB 4OFZA 1UW4A 1RISA 1RHMB 2KO1A 4OYXA 2B7BB 1MROA 2EFPA 2YQ0A 4QR0A 1NAQA 2G0CA 3B6BA 1S1VA 3LAKA 2AJ2A 3BGRA 2ERRA 1QAJA 1HBUA 2AQ4A 4QPXA 3AX2A 5JVGQ 1DY3A 2HRUA 1M1GA 5J1EA 3CJ3A 3PW7A 3ZZUA 3EGVA 4P74A 1TELA 2JVOA 2DEIA 2HEKA 3OR1A 3C6TB 1RWUA 1UJ6A 1URNA 3OLBA 2GZOA 4M5GA 4CLSA 5C2CA 3FEZA 2KHCA 1RAIB 1V9OA 4IFVB 3M2VA 4O44A 5IOLA 1U1OA 1SH3A 1WSRA 1B0TA 1RT7A 3MPYA 4AD6A 3M8PB 3MI7X 2F4VF 4P2SA 3N9UC 3R5AA 3TVZA 1KOOA 4K4TA 1SV5A 1CULB 1GMWD 3GLJA 4QU6A 1NU4A 2C2NA 1M5VC 1S9GA 4TNOA 1BQMA 4E0DA 1NHVA 5IC4B 4C97A 4R25A 3J81Y 2DHHA 3KMQA 4LFCJ 1HQEA 3NMRA 1TL1A 4YMEA 3LP1A 2V1TA 3M9MB 4DBQA 3MM5A 1MWYA 2ZZTA 1G3OA 3UN3A 3R97A 2DNNA 3GR1A 3KK2B 4Z37A 2H65B 5KG5A 1PG5B 3AH6A 2KL8A 4DL5A 2AX0A 2HS0A 2E1RA 4ZVGA 3R7SB 2K7KA 2R3VA 3BQ2A 3UN5A 3H5XA 3LW5C 1C4CA 2DGOA 5KG6A 3PXGa 1F9HA 3AFGA 3NBPA 3VQTA 1WF0A 1H73A 2F63A 3G8QA 2DB1A 4ES2A 4ZIVA 1DHMA 1CS4B 2W8LA 1X4BA 2UP1A 1WC5A 1NSPA 4L73A 1RT1B 3ZZPA 4JI6F 1KN6A 3MEDA 3EWGA 1JJ2R 2ZM6J 2DVIA 1DFDA 4J9QA 2DH8A 4FPRA 2CA9A 1NJYA 1QVGR 3QGIA 2H51B 3EXYA 1K0TA 1BMQB 2K06A 1D9FA 1YK9A 2MEWA 1IR2A 4I69A 2WOMA 3HSZA 3AB2B 1UWBA 5KFTA 3KTQA 3UR0A 2HBZB 1X60A 4ETXA 2EK1A 3RRGA 1X9MA 4N8NA 4JI7J 2C28A 4MFBB 1X4AA 3KJVB 3T5HA 2CZVC 4I64A 2W24A 3ONQA 3LOUA 2JEGA 3HHLA 1MMLA 1RTDB 1J5EJ 3O1LA 1RKIA 4DUTA 1LWXA 3MD3A 3NEKA 4R5PA 1MN7A 2LCWA 4HHUA 1NB7A 2E9TA 2KM8C 2YX4A 1S6QB 3HHNB 4DR2J 4K0KJ 2HQ3A 3W65A 3H7HB 4IFYB 3OUYA 2VB6A 4KO0A 3ISNC 3GV5B 3I9V9 2FHMA 2C2MB 1TKTB 3DLHA 1VQNS 4JI1J 3Q86A 1SQFA 4DQSA 3T6BA 3F41A 3LGNA 4I0WA 2BYCA 1SKRA 2KDOA 3GWCA 4K4XA 1XWLA 1HNWJ 2BE2A 1OPZA 4RWXA 3SCKE 1I1GA 2OFGX 3LP2B 4UOGA 1FNXH 4RW4B 3R2DJ 2PD1A 3KLEB 3Q8UA 1U6FA 3NS6A 3HSGA 2FD2A 1JLEB 3R9LA 1U45A 2WTFA 1HWJA 1LW0A 1R8BA 1WKJA 1Y4ZB 3CTRA 2IPOB 4ANCA 1FWKA 4LF8F 1IM4A 1SXLA 2CQ0A 2J6TA 3A8IA 2XY7A 2R8JA 2FTRA 4FXDA 4WCEQ 3TW0A 3KLFB 2QN6B 2GX8A 5H9EJ 1VQ8S 1SL1A 3BSNA 2JFKA 5KFRA 4F7VA 4OYPA 3HHLC 4YB5A 4DSIA 1RHKB 1VRQC 4CO0A 5E3RA 5J2NB 2VKZG 3DN9A 3O5TB 4EI2A 1QTNB 2WW4A 2XLKA 3JSMA 2EVZA 1KDNA 4A8XA 3AD8C 2AJ4A 3HLUA 5IXUA 3PW2A 2DTJA 4MK9A 1CEZA 4NLSA 2VG6B 1EIYB 4DUZJ 4J9VA 4J9OA 3G6ES 5LJ3Y 4Q43A 1WC0A 2XZTB 3GB0A 2WVFA 4PZVA 2YKNA 3D1OA 1D3WA 2V8VA 1TV6A 2W25A 4UY85 1E6VB 1FD2A 1GEHA 1Q53A 1DQAA 2KRRA 1P1LA 4USVA 2OD4A 2UUTA 2W9AA 3M30B 2W2MP 3Q89A 4K8RA 5A8KA 3HFKA 2PMHA 3ILOA 1YZ6A 4PR6A 2WVDA 3RAXA 2O1PA 2D7SA 1S1UB 3IXQA 2KFZA 1K73T 4CLZA 3DRSA 3IM8A 1CJVB 2HVZA 2HQFA 3QGGA 4I2QA 5K8MA 1ACMB 1YJRA 1RTJB 1KP6A 2UXCF 2MY7A 1JLCB 4XDDA 3QRPA 2N3LA 3GYGA 1FRMA 1RT4A 2MZQA 4ECSA 2QSFA 2QA2A 3NOGA 3BGRB 2UV8A 1AW0A 1I94J 3J7YU 5U47A 1HBUB 4QW9A 1SB6A 1PJ7A 2OUGA 3HKWA 4ICLA 2CJ9A 3V4MA 5F8IA 3IWNC 4LIRA 2O5DA 3T1AA 5J1EB 3VAMA 4KYZA 3TAPA 2EFNA 3OR1B 2ZHOA 1SJ3P 4KB7A 1EQ0A 4F3MA 4RJVA 5ETMA 2HQDA 1RABB 1QAIA 2AIRB 4DUYJ 4KQZA 2D3OR 1PCAA 3DU6A 2HYIB 1T02A 2ZBQA 1NHKL 4Q7AA 2HBYB 3HO1A 3M2VB 4O44B 5E3PA 1JLQB 1R0CB 5DQIA 4F0KA 3A8KA 2GQ2A 1IJEB 1RT7B 3G87A 3GJSB 3PR5B 2CIMA 2NQPA 2Z4PA 4DL0C 1LFWA 4X2BA 1SV5B 2B6AA 1Y5IB 2BW2A 1NUEA 1IWGA 1NEEA 3IG1A 2Z2YB 5LMUF 3GIRA 1S9GB 2H3EB 2X3GA 4ZN1A 3IRXA 1MSWD 1RI7A 4CTAA 1U02A 3OL9A 5J1NA 2KM8B 1KEKA 4DL4A 1HQEB 2GC8A 1TL1B 1RWNB 3NGUA 3LP1B 3BN7A 2M2BA 1WHYA 2CPJA 3MM5B 3CO9A 2E7VA 1T94A 3WX4A 2DNQA 1QSLA 1RWVB 3L9ZA 3BREA 4AYBD 2PI4A 4CO2A 3OTDA 4RW9A 3W63A 4CIOA 2DGWA 2N7CA 1NKBA 4O4RA 3B82A 4KFBA 2HZVA 4LR9A 3DC2A 3SCLE 1JLBB 1E6YA 2HFUA 1OIAA 2Y1IA 3NBPB 3H5SA 5MLCV 4QIEA 1H2UX 1IWAA 2CPXA 4J9MA 1H2TZ 2F7VA 4YY3J 4DV6J 1FEEA 4Y34A 3DYAA 2C42A 3KHHA 4XPCA 4OZJA 4Y2MA 1RBOB 2HWIA 2BMBA 1FXLA 3P49B 4OQJA 3I5CA 1S5ZA 1VGYA 3MEDB 1XMQJ 1NK9A 3BO2A 2GFFA 4WTYA 2CQCA 3GIKA 2LQJA 2AGQA 3DLGA 3LTOA 4ANDA 1ZH5A 1V5IB 2A2DA 3R5CA 2Q3PA 3K8VA 4UOCA 2YNHA 3R6GB 3K58A 3T3FA 2ZKUA 5CYMA 1T7PA 4ZP8A 2LDIA 3DXBA 5E7OB 2ROPA 2WOMB 4L3KA 3C15A 2XTCA 2EC0A 3PYGA 4HT5A 4ZVHA 1HNZF 2CJXB 4B3RF 3RW7A 1X4FA 3KMSA 1VQSA 4GC6A 4P7TA 3QT8A 5D78A 5LSLA 2ZBPA 2E5LF 3QIDA 5A2QU 4GVLA 2ZH4A 3RR8A 4PPZA 1RT2A 3HHLB 4JI4F 2B4OA 3NMAA 1MU2A 3CD5A 1ELOA 1KVIA 1WKLA 4R5PB 3CD6S 2VQEJ 1ZM4A 1N34J 1LEOA 2GA7A 5KG7A 3VAGA 1RE1B 3HCXA 3HXMA 2AYEA 1RTIA 3IN5A 4F8RA 3GSIA 3IWXA 1T3NA 2CNNB 3H4BA 1WUUA 2V69A 2FLNA 4OL8A 2CQIA 1BC6A 1H98A 3OUYB 5L39A 1WOPA 4KO0B 2JHEA 4ZP7A 3D0IE 3UQSA 4DS4A 1NB2A 1XR7A 1DAXA 5H9EK 3OXLA 2LXFA 3RU0A 4CI0B 2VL1A 2YWFA 3G2XA 4CLUA 3PO5A 1RLDA 2W7OA 3DDKA 1SBRA 4IO1A 5EWFA 1FD8A 1IBKJ 5J2QA 5DG7A 3G6YA 2MLYA 3ZO7A 3PM9A 2RHSB 1D8ZA 4NRTA 2Y0BB 1Q79A 3ZTRA 3ZTOA 3CW2C 4FXVA 1SC1B 2V8PA 4CM2A 2M5YA 3M6XA 4ZPDA 2XHWA 3CJ4A 4U8VA 3W2WA 4K5SA 3WQPA 3BKTA 3QNWB 2C2EA 1LW0B 3BJYA 2GJIA 4OHYA 2ZEJA 4JUZA 4QWDA 2NYHA 3K59A 2HHWA 2GS8A 2A2CA 2CQBA 4NLWA 2ALZA 2VFTA 3F0NA 3Q8VA 2R8HA 1TP7A 5DQGA 4K5RA 4WIQA 1S0NA 3AB4B 1VIOA 2XI2A 3VF0B 3ULHA 1WHWA 2ZWOA 4E2FB 5L9XA 3PO4A 1NLKL 3VVUA 4J9PA 2E1PA 2DISA 2EFGA 2W9CA 4NLQA 2FY1A 2V5HG 2AT1B 3P5TL 3U1MA 3CT9A 2MJUA 2G2YA 3SSSA 3LF0A 1A0OB 2H4WB 2IYGA 3RB0A 3D6FB 5DG8A 4GMKA 2GNKA 1CJKA 1WHXA 1GXUA 3KUHA 4IDKA 2FJWA 2IC3A 1IXKA 5IS2A 2XMWA 2VA2A 3SSRA 4M5IA 3AAWB 1K9MT 4ECXA 1PYOB 4BBYA 1H38A 4OYOA 4YN3B 3PIPQ 3VVTA 5IFMA 1L3SA 4ED4A 2HFVA 2PA8D 1AXQA 1S77D 2OPSB 4UQGA 2V8HA 5B0CA 2VV5A 2HHHJ 2YKNB 1Q8LA 1TV6B 3W61A 1YRUA 2KN4A 4MT1A 2ATCB 3W1YC 3TZYA 1NJZA 2EFOA 3H5UA 4RBTA 2BJ8A 4ENOA 5GVQA 5KFGA 1L5UA 5A8KB 3ZTPA 5KG3A 2RDDA 4WKYA 5ITHA 3M4XA 3CXCR 3DRSB 3S01A 3EGNA 2QTWA 4I2QB 4WWSA 4NA1A 2VDIA 3NAHA 1FTCA 2ZH9A 4F4KA 3C14A 3W9IA 3QJJA 1G7CB 1S1TA 2DH7A 1NPKA 2ILYA 5CAAA 1U1RA 4PWDA 4WZMA 1RT4B 2QL9B 3D67A 5GAHI 4WU3A 3FUYA 2E9RX 2M8DB 2KJVA 5KFLA 2RRNA 2YWWA 4ICLB 3DU5A 2OELA 4PWWA 3TQ1A 3F44A 3V81A 4KC5A 1VK3A 3MD1A 5M2RA 1G4CA 3MFHA 5KFNA 3MMBA 1GXTA 2QL7B 5KFXA 2ZZMA 3C19A 2BOPA 1VLYA 4A8KA 4Y6IA 2YXLA 1WEXA 3SZ2A 3FCWA 3HPOA 2QC3A 3HZGA 1K44A 2HFZA 2BM0A 4ED8A 1NRKA 5AE2A 1F5AA 3PJXA 1P8GA 3I87A 4M5JA 3IR6B 4P73A 4DR5J 2B6AB 3S1TA 3M8WA 2BJ1A 3IG1B 2IM3A 1HI8A 1T03A 4OZ3A 3D28A 2RU3A 2R7WA 3PJ9A 4CTAB 3GSDA 3VAHA 4ECRA 3A3OB 2RU9A 2FPHX 2I6WA 4PYAA 2C2ZB 1CC8A 2FHJD 2ZITA 3M32A 1N33J 4LFCF 1CC7A 2ASYA 1JB0C 3AJDA 4RW9B 4DOZA 4U7UD 3VZIA 1UVJA 3KOAA 3UDEA 5DO2A 4KFBB 3EPGA 1QLNA 2RHQB 3AQOA 1E6YB 2JJ4D 3S7RA 3TA1A 2UV8G 5BYRA 2YTCA 5HQMA 1KNZA 2KT2A 2ZNZA 3T1YJ 1LXJA 3DYAB 2V2QA 1VR6A 1IN0A 4CO1A 3R1LA 1XJWB 2W2PP 3GQCA 3MEGB 1Y0HA 2R7VA 2YWKA 3D6HB 1FK9A 5F9NA 4RUHA 1RHQB 3DLGB 1S0VA 1Y00A 1RWOB 3MPWA 2ZM6F 5CH7B 2LDYA 2YNHB 3EE3A 5CYMB 1U6BA 2W1BA 3FJ2A 2WBRA 3KK1B 3QLHA 3C15B 2ZVIA 3SIPB 5HLFA 1ICEB 4URSA 4I7FA 5F8HA 2NXEA 5KFMA 2H4YB 3E8OA 1YKWA 3QRRA 2ZBRA 4KY3A 4Q8EA 1JNRB 3LH2S 3VTIA 3QJPA 5KFPA 2WK4A 4OYIA 2UVWA 4UUWA 5EHHA 4J90A 4HHJA 4JI7F 4HACA 1RT2B 4ECTA 1NSQA 3QAEA 1MU2B 4QW8A 3PR4A 3H5YA 4YQWA 2ZWPA 2YVSA 1UPPA 4CLFA 5CHCB 2L9NA 1J5EF 1RTIB 3SV3A 5HN0A 1WI6A 2Z56B 1RWMB 2FZKB 1VJQA 3NS7B 4DR2F 4K0KF 2YKOA 3FZ2A 3R6LB 1ZOTA 3GZ7A 2DHGA 3KLIA 1R0BG 1MG7A 4ELTA 2C3MA 3RTVA 4PG8A 1FT8A 2ZOGA 1VC5A 2BKPA 5HMXA 3R5JB 3VGUA 2VASA 4EBEA 4AFFA 3HHDA 4JI1F 3ZNUA 3FBFA 3TJAA 2HNZA 1ZTTA 5J2QB 4ZLPA 1RACB 2GMJA 4JI3J 2L9WA 4WZQA 4A8YA 1RAAB 3MR5A 4MTPA 3THTA 2I1RA 1FHTA 4QR2A 1HNWF 1KONA 4CYUA 5DDOC 4C8MA 1T9YA 1M90T 2YPYA 3W2WB 2XNRA 4EZ9A 5F9LA 2VG5A 3MFIA 1FO1A 3O6QA 2QO3A 3CJQA 3DHWC 3M2UA 2JFDA 2RRBA 2WSFC 2R7QA 1YRTA 1YI2S 1RKJA 2CADA 1C1CA 4YS2A 1NK4A 4RBVA 2J8SA 3MCOA 2Y9HA 3N5BA 5L38A 1P9QC 3MR6A 1NXIA 4Z7CA 2XS5A 2W9CB 1NJIT 3K5NA 4B9LA 3TA2A 1IKYA 2GGPA 3U1NA 2EFQA 4USWA 1KLNA 3DOMA 3ILJA 3ZZ0A 4A8FA 4FN5A 3RRKA 4JI5J 1CJKB 4NOHA 5FIIA 2HS4A 4IDKB 2IC3B 1UEUA 4EU0A 2ADCA 3MMCA 3TZXA 5G0RA 1S4EA 2ZHBA 1VQ6S 1VQMS 2HNYA 3UPFA 4OI3A 5B0EA 3DLKA 2NYIA 3I0RA 4WBFA 5KFVA 3ET6A 2LKZA 1Y5LB 1Z2LA 1F1BB 2CNLB 2FZGB 3QJLA 4FP9A 4DUZF 2YKAA 1FFGB 4A8WA 1F3FA 3UNGC 3RG6A 1SH0A 5ETLA 2IMOA 1CJUA 3O3LA 2CJYB 1QUVA 1HQUA 3CC4S 1U1QA 1KFDA 1H7XA 1X0FA 1RTZA 1OQ3A 4OZ2A 1XMBA 2KH9A 4RNNA 2IJRA 4KH0B 2KXNB 2V0NA 1AUSL 4KT0C 1Y5NB 4RU9A 3C14B 1S1TB 5GADU 1JX4A 3BB5A 4Y28C 3H40A 4AUKA 2GQQA 4UQTA 2V4JB 2OTLS 1Q7LB 3AY0A 1TK0A 1WC3A 3O8WA 3D7SB 4DFJA 1VQKS 2JEFA 2XMTA 3D54A 3HSJA 2C3UA 1S1WA 3J7YI 3MEEA 4WTOB 5H1SV 1KHVA 1ITPA 4EMDA 2DIVA 5DDRC 3VAFA 1R3NA 3V81B 6FDRA 2XY5A 1OWXA 1I94F 4OLPA 2PT0A 2KVQE 2RUGA 1D09B 4NZ6A 1XNRJ 1LWCA 3MMBB 4ED3A 3PRBA 1PC4A 2CYYA 3SDEA 3R7BB 4TXSA 1T9TA 3DM2A 2R2TA 2LU2A 3IBCB 4USHA 3V6DA 2IAJA 4USIA 4WFNQ 1UVNA 3CMES 3KJFB 5KOWA 2WVCA 5DDPC 1T05A 2M52A 4DUYF 2VPZB 1KTQA 2QMWA 1JXLA 3JSBA 2Y8WA 5SUHA 1LOUA 3THVA 4V19J 1P6TA 4DF8A 4A8OA 2OEKA 2RD5C 2CPDA 3TJ9A 2HNDB 1T03B 4F2RA 1WJ9A 1S1XA 1VC6A 4ZDNA 2KB2A 2WB1D 4UUXA 4Q44A 2G13A 2FGCA 1RCOB 2VOPA 3M6WA 1JXVA 3I5BA 1PBAA 3HT3A 2LXIA 4OYWA 4ZVFA 3M32B 3PJWA 1P9YA 3IP0A 4J9LA 4GVBA 3VV2B 1S6OA 2B8PA 4O3RA 3UR3C 2K3IA 1N5TA 2J8AA 3OBIA 3WIVA 4ZVTB 2H9ZA 1RJJA 3SQOP 2GQCA 4ZVPB 5DDQC 1KC8T 2K3KA 2YX7A 4ZPCA 2ZJPQ 3JXOA 1FDBA 4DEZA 4N41A 2UUCJ 1LK7A 3BH7B 2EKNA 2FJEB 4ED2A 4AL6A 2ZOMA 2CJAA 2HZCA 2BQUA 2BANA 1D9AA 3K0JA 1C0UA 1N6QA 2FC9A 4JI8F 4QU7A 4QWAA 4YY3F 3AD9C 4KKOA 5LMNF 1FE0A 1FK9B 3AX5A 3UDVA 1TFWA 1HNVA 3TI0A 2JZ5A 4M5DA 1JNZB 1PO6A 1XMQF 4NXNF 2HIQA 1S76D 4K4SA 4IKAA 2NZCA 3WZ0A 5T7LB 3PIOQ 1G2EA 2RVJA 3QLHB 3CD7A 3OL6A 3ZTQA 4KGKA 4X66J 3MOJB 3PTWA 4DXLA 4I7FB 2QA4S 3A13A 4ZPBA 1X8DA 2IIHA 1S79A 3K89A 1KLMA 3MMJA 1UFKA 1TZ0A 4CNZA 5BYSA 2GHPA 4DX7A 1KQGB 5DGBA 4F2SA 1N0VC 2W4PA 2HK2A 5L8RC 2DGUA 3BF4A 4P2XA 4HACB 4M5KA 2RJZA 2ZBCA 2AWZA 1ZZNA 3KYLA 2HHXA 5DJBA 3P3DA 3EICA 2SXLA 2IM0A 2K7JA 2UVVA 2HHSA 5D4OA 5LT5A 2VQEF 2IMWP 1N34F 2YQ1A 2M3DA 5L1JA 1U1NA 5THWA 1B64A 1UZHA 3KLIB 2FJBB 1CVJA 2J6UA 4DCOB 3CPWR 3TYTA 4HI2A 1NDLA 2NXCA 1T0TV 2QLWA 3NAIA 3CMQA 3JAMU 1B4SA 3UDCA 2CQ3A 4C0BA 3EGZA 2M7SA 3CNQP 2HNZB 5KG1A 4ED5A 4TYBA 1PAUB 1HBMA 1QM9A 4EGLA 2UVRA 2VODA 4KR0B 3TA0A 4F3OA 4B9VA 4DPOA 3W60A 2GCFA 4O23A 1ZA1B 1IBKF 2J7KA 4DS5A 2QLJB 2GVZA 4CYUB 4C0OC 1JLGA 4LQ9A 1S10A 3V4IB 4N76A 1WG5A 4DV3J 4AT1B 2VG5B 3CCQS 4PXDA 2LMIA 1V6HA 3RGIA 2PIIA 4KPYA 4Q8FA 1X5PA 1X4HA 2D74B 3M2UB 5HMWA 1FWLA 3AWRA 1HR0F 4WK1A 4QJVA 1NK6A 2FC8A 1C1CB 3UD3P 1F3VA 4GRSA 3MM6A 3ITHA 2J9EA 2L48A 1RBAA 4XAKA 1YJ7A 1HHTP 4ZVUB 2R7UA 3BBBA 3GYXB 1IKYB 3H4DA 1LW2A 2GGPB 4YB6A 1UVKA 2CDRB 3U27A 4IYQA 1NH7A 1VQ7S 2PO4A 3T19A 3MEKA 3H2UB 2VPXB 5ETNA 2DY9A 1WF1A 2D1CA 4LQ3A 3BSOA 1OY6A 4J91A 4C8ZA 3MMCB 2J5AA 5G0RB 2RRAA 4F4WA 3NP5A 4RW7B 1RAFB 2H5EA 2ZUAA 2HNYB 4WXWA 4HH0A 4DI6A 4ZPVR 5IT9Y 1YTYA 3PX6A 3DLKB 2EEYA 2VPYB 2HQGA 3I0RB 2G2ZA 3ET6B 3OHBA 4ECZA 1N88A 2ZH2A 1YJTA 2JWNA 1RT5A 5CABA 1RHRB 1WELA 2LYVA 4YHHF 2HHHF 2KKHA 4UW2A 2CKWA 3CCES 1HQUB 1T8EA 4ECVA 3SV4A 4N7TA 4EO6A 4RPFA 1NZAA 3G82A 3UD5A 4I68A 4LFBF 1GFWB 1F60B 4WKRA 1BWEA 2IRUA 5D8HB 1R6YA 2XZDB 3QRQA 3EYZA 4L3NA 4HDGA 2BDPA 3GV7B 3D2WA 1KQSR 2MXYA 1WOOA 1ZYQA 1J5OA 2I5JA 1B0PA 1Q5VA 2KG1A 4FNIA 1CQMA 3TUJC 1S1WB 3MEEB 2B43A 2MLXA 4OHWA 5A0YA 1KQKA 2QSWA 3HZEA 3JYTA 3BEGB 3TO8A 2LU1A 4LF4F 1AT1B 4IH5A 4C9DA 1O51A 4B9SA 4RUAA 3SFGA 2CWKA 1REGX 3OVSA 2CPHA 1WDTA 1MW7A 3LAMA 1LWCB 1Q8KA 2DNZA 2JLGA 5KT6A 3SDEB 4C7QA 1P27B 5KT4A 2GHWA 3IMQJ 3DM2B 2MQPA 2W7PA 2XI3A 2YPZA 4FDFA 1VS3A 2IVYA 3NLCA 2IAJB 3I31A 3VQSA 1WI8A 1TL5A 3FSIA 3FCVA 4LBPA 2FVRA 3HT0A 2AZ1A 1YJVA 1A7GE 3MR7A 4KBIA 4NEZA 3D6TB 5HQ8A 3DRYA 2MZJA 4C3MA 3QSYB 3F73A 4BCAA 4B3OA 4DR5F 1S1XB 3KG4A 1YJUA 1XEZA 2HGLA 5HP1A 1XMOF 2C1EB 4U9RA 1S57A 2FQQB 1UEVA 4O3PA 3KHRA 4LF7J 4GVBB 2RF2B 4UOFA 4U7UK 3QSIA 5D77A 5KFEA 2HWTA 4LBIA 3FC9A 2DNHA 3DOLA 4I56A 2A6OA 4X4SA 1UP1A 2B5JA 4CQ1A 1KVKA 2BJDA 3DKDA 2BE7D 4Y2KA 4RU2A 2JEJA 1HWKA 4X4NA 2DNLA 2XC9A 3DRRA 3FRYA 3WX8A 3T1HJ 3IRWP 1YJ9S 1XR5A 4OI1A 4YDXA 2MKJA 4YOEA 2P2CB 2BANB 5M2UA 4R8UA 5KFBA 1C0UB 1YBTA 3N0VA 1N6QB 2W2OP 3TZWA 2HGNA 4DR7F 3T1YF 2DRDA 4U67Q 1X9WA 2XG8A 1SJ4P 4BS2A 1HNVB 2VFUA 2FVPA 4M5DB 3VCDA 4PQAA 1RT3A 3HHKA 5H9FK 2PEHA 1IQZA 1RU2A 4J9NA 2E1AA 1NBEB 5DG9A 2CDQA 4A46A 1C0TB 2KXHA 1IVZA 2PMWA 2VHGA 3MR3A 3UVJA 4N5SA 4LSLA 8ATCB 4PQUA 4NL5A 3QT5A 4KJIA 1HL6A 1N36J 2BJEA 3UD4P 1MWZA 4DFMA 4TY8A 4QR1A 4DJBA 4FYXB 1IKWA 4TLRA 2QGFB 3KXDA 3VWSA 5F41A 1D0EA 3IFEA 4X64J 1RK8A 4FF2A 1U1MA 3NS5A 2IVFB 1QJHA 4TQRA 1GXLA 2VFRA 4DN9A 2DJWA 3R3TA 1T95A 4YR3A 2NZ4A 3KHGA 4I6YA 3W9JA 1UKUA 2KU7A 4ZA1A 1DZ5A 4RWWA 4K4ZA 5E2QA 1S6UA 3RW6A 4LT6A 2GV1A 3HK2A 3B78A 3T41A 1LKZA 2IJFA 4LF6J 4Q0BA 3FFIA 4BC7A 4DV0J 1EAYC 1HBMB 1XERA 4NCGA 4LRFA 4P2FA 5KG4A 1LNQA 3EUNA 1A6LA 3W8PA 1TKXA 1ZTWA 3SQGA 2UUBJ 3BZQA 3D3CJ 3CCVS 2ZVSA 5RUBA 3D4JA 2LXUA 2X7IA 1ROFA 2GVZB 2UZAA 2HK3A 1JLGB 1X4EA 4GC7A 5AE1A 4JI3F 1TMMA 3FEYB 3JQJA 2FGOA 3V6JA 1FA0A 2XZ2A 3NCQA 2BKOA 4EBDA 1C4AA 3HMJG 4OV1A 2YKMA 2FY8A 2JEIA 4BC9A 4KTQA 2C3PA 1QAYA 1ZA2B 1FF2A 3CDEA 1N32F 1RWKB 1Y3KA 4C0HA 2O66A 4F4AA 3MM6B 1NKCA 4P9SA 2AJQA 3ITHB 2MHNA 4J9UE 1B3TA 1VDHA 4FBUA 1WORA 4MMOA 5KFJA 4FBTA 1S49A 1U4BA 1F9FA 1RA7A 2MQMA 4H54A 1S0MA 5KFYA 1U8WA 3LA0A 3TUIC 1YVFA 5LM7E 3CIMA 4DQQA 3FSXA 4I4BA 3NKYA 3LPYA 3GFHA 2P9EA 5EWEA 3UW1A 1IKXA 3ENVA 4LSNB 2DPIA 3SI8A 4JI5F 2JX2A 1S48A 3OL8A 4FPIA 1IBMJ 1UEKA 3G9CA 3IAM9 1BUXA 5GMKa 1ZM2A 5D4NA 4OJHA 3NNCA 3KG0A 5HMYA 5FJ4A 3PHEA 2HG4A 1ZAWA 1RT5B 2MLZA 2AU0A 3MR2A 2ROGA 4KHPJ 4NWBA 2HFSA 2XTDA 1JKHA 1FVQA 4K4VA 1G1XA 4AQYJ 2KTQA 1F2HA 3EZUA 2M9KA 3MUVP 1HW9A 3AX3A 1VOMA 4C48A 2QIFA 4EYHB 3C16A 3FEXB 3GE9A 1IKVA 5A76A 3Q2SC 2JSXA 3FZBA 5KFWA 2PMZD 5ETOA 3ADAC 3G82B 2HBQB 1BQNA 5IWAJ 3BBFA 3HFVA 1SI9A 1U24A 1ZZFA 1O0PA 4R0EA 1SC4B 1FE4A 5GADI 2PA3A 4I2PA 1KQFB 3JTOA 4CH1A 3L3CA 3PW0A 1OY9A 1HWUA 5GAGU 2I5JB 4LR7A 1AROP 2MZTA 3LP0B 5HANA 5A0YB 3TVYA 3JYTB 2XEXA 3GJRB 1MNEA 2BEFA 4EO8A 3KDNA 1HARA 3MTKA 2FYXA 4CM0A 2D68A 5I3UB 5LSOA 2RKIA 1TUGB 1FNMA 1OYEA 1WNEA 4OV6A 1RHUB 1RA6A 7AT1B 4C8YA 4JV2A 2ZH7A 4C3LA 4WU2A 4QIVA 2GVDA 1YJNS 4DL6A 3UDLA 1KD1T 2DHXA 4FYYB 4DV4J 1ZM3A 3PEJA 2E44A 2R2SA 3D1HA 2N4CA 1FEHA 4M8LA 1C1BA 1NDKA 1GX6A 3SSQA 3MPUB 4TY9A 5KT2A 1UVMA 2QMUB 2BV3A 2Q79A 1WD6A 4B3OB 2F1FA 4OLOA 2CQPA 3R8YA 1DLOB 1TU0B 5HBMA 5FLXY 2KHDA 6AT1B 1ZAXA 2EBEA 4NYZA 3U1LA 1FFWB 3D0HE 2Q43A 1EKSA 2NXNA 2I0XA 2QT7A 2CQHA 1U49A 1Q81T 1U0HA 2DO0A 1B99A 4FS1A 3PX0A 3NGSA 2G0IA 3DOLB 4K2JA 3TEHB 4B3TF 4N56A 3Q8PB 4RO0A 3PKYA 1UFLA 4ZPTR 5B0BA 4FYWB 4WIIA 1H7WA 3DRRB 4LUBA 4G1PA 4UZCA 4QWBA 4RW6A 3TX8A 1Q0NA 1IJFB 4NA2A 4R8UB 2K8GA 2B4PA 1NSKL 4Z7YA 3KJQB 3MM9B 2F65A 3FBCA 2E1MC 3KWMA 1UZDA 2FVQA 2OSQA 1RT3B 4XIUA 4NE9C 2IBOA 4LVOP 2Q1LA 5BR8F 4J9RA 4HH1A 5D4LA 2E5JA 3K17A 3NWRA 3F56A 2NXJA 4CCHA 1KVJA 1D8YA 2HIYA 3ZTSA 1WHVA 4P10A 4LSLB 4PQUB 2DXDA 3D5MA 2VQFJ 3IA0A 3OD2A 2D69A 4TY8B 5AE3A 4DL7A 4ZJLA 1BGXT 2G0JA 2RNEA 1IKWB 1DRZA 5K14A 5AJ3J 2XCPA 2IHR1 1XNQJ 1WSVA 2CNOB 3SYZA 3QMQA 3C3LA 1M5PC 3EVOA 4U96A 1REVA 4B02A 1HNXJ 4DFPA 1WF2A 3NOCA 1X9SA 5JJBA 3M8RA 2I8EA 2CVEA 2R8KA 3R1HA 2G1HA 1M5HA 2M4MA 3JTPA 3DLJA 3MXHP 1MWQA 1VJWA 2I2YA 1AUDA 1HNIA 4ZLLA 3GPAA 3M8QA 3OJUA 3V6KA 1VISA 3CD0A 8AT1B 2JL9A 3NWGA 4RNMA 4Q0BB 1FJ7A 4X84A 3FFIB 2AP6A 1RP5A 3CJ2A 4PXEA 4QWEA 5A8RA 1GMUA 4F26A 2V34A 5CCMA 5HO4A 4ILMA 2NPIA 1TKXB 3SQGB 2MY8A 3M1VB 5D3GA 4PG6A 1LQ9A 1Y10A 4DR3F 1PILA 2D3UA 1R7IA 4F4YA 4LF1A 3G71S 1FTRA 3QFWA 2KVIA 4CO4A 3BBCA 3N6NA 5B7WA 2LQ8A 3K5MA 2YKMB 4V1Ak 1X4DA 4DV3F 1KR4A 2YNFA 2XWXA 2F4FA 4RBUA 4ZITA 2CQ4A 2A0FB 2QFIA 2NPFA 3BYRA 5KAKA 5DM6Q 2YWEA 4H4MA 4DU7A 1S9FA 3DOKA 5AT1B 4LRCA 2W01A 4RLEA 1UL3A 4NEYA 1IKXB 2W2NP 2XYGB 1TR0A 2DR5A 3W5XA 1KTVA 5E33A 2V9KA 4PPDA 2YWGA 4ZP9A 4UY8T 5AXNA 3GFZA 2EXUA 1M1KT 4DR6J 2UUAF 5CZVA 3CWJA 2HLTA 3BV8A 3CULA 5IZHA 3ISND 4AL7A 3OXGA 2H48B 3L7OA 4DFKA 3T5KA 2XMAA 1N5YA 2EG2A 5SZTA 1FKPA 3MM8A 4QZVB 1DARA 1JKHB 1GX5A 5D0GA 3K5PA 3BKFA 1QD1A 4QWCA 1PC5A 4NLRA 2DRAA 2WW8A 4W92B 4ER8A 1YHQS 4WPAA 2OMOA 3C16B 1IKVB 2VC1A 2QA1A 3R5DA 4G1IA 2XULA 3P8BB 1BQNB 3CSKA 4DG1A 3PCOB 2PI5A 2OI2A 4DPYA 4PXBA 2CRLA 5HROA 3CDWA 4NA3A 2ABYA 5KOXA 4I2PB 1Q95G 2KJWA 1FDAA 4K4WA 1W7WA 3U02A 4RNOA 1U1LA 4ERDA 3GIIA 2U2FA 2XGPA 1VRTA 4NX9A 3G96A 2J0SD 1IQTA 5HL7Q 1MROB 3ZZZA 1S1VB 2KZMA 3LPEA 4M63A 2D41A 2ACYA
chains in the Genus database with same CATH topology
2HRUA 1OWXA 1I94F 4OLPA 3AJ1A 2FVCA 2JOQA 3I32A 2RKIB 2PT0A 4LIWA 5J1EA 2RUGA 3CJ3A 1FKOA 3PW7A 3ZZUA 1R0AA 2DR9A 4NZ6A 1LWCA 3MMBB 2BBEA 4ED3A 1TK8A 3PRBA 2JVOA 3DCAA 1PC4A 2CYYA 3SDEA 2E5GA 3OFFA 2MQLA 2Y1JA 3OR1A 4NCBA 2UUWA 3C6TB 1N5VA 4TXSA 1RWUA 1UJ6A 3E2EA 2DNMA 3DM2A 2R2TA 2LU2A 1VBYA 2ZH5A 1URNA 3OLBA 1HD0A 3JTNA 4USHA 4GKKF 2WSEC 3V6DA 2IAJA 2DIUA 1X5SA 3FEZA 2KHCA 4USIA 4WFNQ 2RIJA 3HHLD 1UVNA 2VBXA 3V6DB 1JWWA 3CMES 2XSFA 4QYZJ 5KOWA 4AE5A 2WB4A 5DDPC 1T05A 1V9OA 2M52A 4IFVB 3CCZA 3M2VA 4O44A 1U1OA 1SH3A 4OJ1A 4DUYF 1T05B 1X4CA 3K7RA 1LFPA 2AV5A 2VPZB 4IQXA 1B0TA 2RQCA 1KTQA 1RT7A 2QMWA 1JXLA 2AX1A 3JSBA 3MPYA 3M8PB 4N47A 1C1BB 3MI7X 5SUHA 1LOUA 3THVA 4FNHA 4V19J 1P6TA 2F4VF 2HS3A 1V3SA 4DF8A 4A8OA 2KXFA 2EBGA 2CPDA 2RD5C 4P2SA 4WYLA 5F0UA 2ASLA 3N9UC 3R5AA 3TVZA 1FXRA 2HNDA 1KOOA 4K4TA 1SV5A 3MDFA 5J2PA 5HBMB 3KK3A 3NRBA 2HNDB 4QU6A 2GIQA 1T03B 2VBYA 1NU4A 4IRCA 4F2RA 2B9YA 3KG1A 1M5VC 1S9GA 2CZ4A 1BQMA 4TNOA 3QYYA 2F40A 1S1XA 1NHVA 1FXDA 4ZDNA 1VC6A 4E0DA 3HJFA 2KB2A 4C97A 1BQMB 1Q4RA 4R25A 2F3JA 2WB1D 3J81Y 4UUXA 5F8MA 4Q44A 2G13A 2LLZA 1VBZA 1JK9B 3I82A 2FGCA 2O3DA 3KMQA 3S8SA 3U7JA 2GO9A 2VOPA 5LSRA 1HQEA 3M6WA 3I5BA 3M8SA 3UI3A 3NMRA 3HT3A 1TL1A 2LXIA 4YMEA 4ZVFA 3M32B 3PJWA 3J7A1 3LP1A 4EYIB 1AFIA 4X4RA 1TL3A 4J9LA 2MMYA 3H98A 3M9MB 1LWEA 3OVAA 1S6OA 4DBQA 3DFEA 3MM5A 1MWYA 1U6ZA 4BWMA 4O3RA 3UR3C 4PG4A 2K3IA 1G3OA 1SJRA 1N5TA 2DNNA 3GR1A 3KK2B 4Z37A 2J8AA 3OBIA 5KG5A 3OTOF 5FDLA 1IBLF 3BDPA 2DCLA 5EX0A 2H9ZA 3AH6A 4DL5A 2AX0A 4OZ0A 2HS0A 2E1RA 1RJJA 3E01A 1N33F 2GQCA 4ALZA 5DDQC 1KC8T 2K3KA 4ZVGA 3ZFVA 1VQ9S 1R27B 2YX7A 2K7KA 3RB3A 2VKRA 4ZPCA 2ZJPQ 5G4DA 3CVKA 1FDBA 1KS2A 1JIHA 2R2UA 4DEZA 3BQ2A 4Q2MA 5C24A 3H5XA 3LW5C 4N41A 1C4CA 1LK7A 2DGOA 3RYLA 1ZETA 5KG6A 3PXGa 3QIPA 1GH8A 4RW6B 2FJEB 4YB1P 3NBPA 3VQTA 2CPZA 1WF0A 4ED2A 4B9UA