1RAJA

Poliovirus polymerase with a 68 residue n-terminal truncation
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
392
structure length
257
Chain Sequence
b'VDEYMKEAVDHYAGQLMSLDINTEGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALALPEYSTLYDRWLDSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein
molecule tags Transferase
source organism Human poliovirus 1
publication title Structural basis for proteolysis-dependent activation of the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
total genus 81
structure length 257
sequence length 392
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1rajA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rajA02
4.10.880.10 Few Secondary Structures Irregular Poliovirus 3D polymerase; domain 1 (Nucleotidyltransferase) Poliovirus 3D polymerase Domain 1 (Nucleotidyltransferase) 1rajA01
4IRDA 1TVRB 1C1BA 1W25A 4KKOB 2BQRA 4DG1A 1LWCA 1SV5A 2VG6B 3IS9B 3QGHA 4MFBA 4JV1A 3FRZA 4NLWA 4K4VA 3BGRA 4JUZA 5KG5A 4O3QA 4IR1A 4MFBB 4IDKB 1LWCB 1SV5B 2HWIA 1HARA 4DL4A 3MTKA 4TYBA 3QLHA 4TQSA 3QGIA 2HMIA 4Q0BB 3M9MB 1C0TA 1GX6A 4PUOB 3QIDA 1K1SA 5EWFA 2UUTA 4Y3CA 3BR9A 3LP1A 4EYHB 2FJWA 2GC8A 4XPEA 1TL1A 1REVA 4YMEA 4G1QA 4U6PA 3KHHA 5KFQA 1VRUA 5JUMA 4O4RA 3C6TA 3GV8B 3DLKA 4NCGB 2R2TA 1TL3B 2HNYA 3V4IB 4FBUA 1LW0A 2D3ZA 3LAKA 2YNHB 3D5MA 4ED2A 3V6DA 4ZPDA 5EWEA 2FJVA 5DQGA 1RT5B 3FQKA 4ID5A 4RW9A 1J5OB 4IG0B 2J6UA 3KNAA 1S9GB 3I5AA 4O3NA 3KK2A 1MU2A 4NLOA 1RA7A 4RUCA 2YNGB 2IBKA 1HYSB 5KG6A 5KFIA 4KV8B 1T05B 3MECB 3I0RB 3TVKA 4GC6A 3PHEA 4NLGA 5K14B 5L9XA 1HPZB 1TKZA 4FS1A 3DRPA 2YNIA 4ECRA 5KT2A 1RT2B 5F9LA 4KFBB 3RB3A 1HMVA 2YKNB 5T14A 4K4ZA 5KFUA 4ED1A 3I0SB 5DGAA 4ECSA 1QUVA 2IC3A 3EZUA 3TQ1A 2V4QA 2JEGA 2AX0A 3BQ0A 3H4BA 5DQHA 4WFYA 4K4WA 2BR0A 4KO0B 5HROB 1HQEA 3KHGA 5J2MA 1SH0A 1RT6B 5I42B 4JV0A 3G6YA 5J2NA 2EC0A 5CYQA 3T1AA 2AQ4A 3MEEA 2BQUA 1N6QA 4ZP9A 4RNHA 4I7FA 2IAJA 1BQNA 1QE1A 3QZ7A 1JLGA 4LSNA 5KFGA 3DYAA 3N6NA 3RB6A 3SFGA 4J9SA 3PR5B 1S9EB 4ECZA 3RB4A 3RAXA 1QAIA 4LSNB 1S4FA 4ZVHA 1QE1B 2BANB 2ASJA 3LP2A 2RDJA 2E9ZA 3I5BA 4KE5A 5KFOA 1TV6A 5KFJA 2V9WA 5CYQB 4URQU 5J2NB 2OPRB 2OPPA 1HQEB 3BSNA 2D7SA 3MF5A 3NGDA 1DTQB 3OL8A 2IC3B 3UDLA 4Q8FA 3DRRB 5KT3A 3ICLA 2W9CA 3Q8SB 4ZVEA 4XO0A 1C1CB 1RT2A 4MK7A 3M8PB 1HPZA 1TKZB 4OL8A 4IFYA 3KLHB 3TAMA 1FK9B 1JLQA 5KFRA 3PJWA 3KK2B 2CKWA 2FVQA 3KLFA 4QWCA 2JEIA 5C5JA 4EYIB 2R8KA 1XR6A 2YNFB 4WYWA 2YKMB 2AX1A 3BJYA 1LW0B 3HKWA 4YR3A 2UVVA 2FVCA 3DLKB 4R0EA 4NCGA 3C6TB 2W9BA 4XPCA 4ED6A 2IA6A 5KFZA 5C42A 5KFDA 5J1EB 2ILYA 1S48A 3KLVA 3KHRA 3DM2B 3OHBA 4K4UA 5KT7A 3H5XA 1VRTB 4I2PA 3CIZA 2W8KA 4KBIA 1TP7A 1N5YB 1DLOA 3DOKA 4ICLA 2D41A 3GIIA 4H54A 4K4SA 1SH2A 5KFLA 4J9OA 4J9QA 1R0AA 2ILZA 1DTTB 5KFMA 1R0AB 2VA3A 2HMIB 3QLHB 1DLOB 4ICLB 4K50A 3H2LA 2V4RA 1C0UB 3DLEB 4F4XA 4I2PB 3JYTA 4NLTA 2OPSA 4I2QB 3FFIA 5EDWA 1NNDA 1OS5A 3GV7B 2AWZA 3GIMA 2JLEA 3OL9A 1S1UA 2AGPA 4KKOA 1C1BB 1BQMB 4O4GB 2YKMA 3NKYA 1JLCB 3QGGA 4TYAA 5CYMA 3RBDA 3MFHA 3HVTB 1NHUA 1S1WA 3BSCA 2OPQA 1S1TA 2C2RA 3PR4A 4ZHRB 3KLEA 2RDIA 5D3GA 2ZD1A 3MEGA 3RAQA 4IR9A 3M8QB 2C28A 4MK8A 5L1LA 2IM0A 3M8PA 4O44B 1C1CA 2XI3A 4H4MB 4X2BA 1FKPB 2W9CB 1ZTWA 5I3UA 3DOLB 1LW2A 1RYSA 4RUAA 2W8LA 2WCXA 3PW2A 4NLRA 2C2DA 1RTHB 2WB4A 1TV6B 4ZPBA 2AGOA 2BQ3A 4R8UB 1JLBA 4MH8A 3LP2B 4LSLB 1Z4UA 4U7CA 1S0MA 3JSMA 3QYYA 3DYAB 1JLGB 3LALA 3DLGA 2XI2A 1BQNB 2IAJB 5F8IA 3GIJA 4IG3B 3OLBA 1WNEA 2CJQA 4WZQA 4H4OA 3I5CA 1IKWA 1D0EA 1RT6A 4QW8A 4ZP7A 4KO0A 5HROA 3BQ2A 1S10A 1HNIB 1UWBA 3Q8QB 4F50A 1EETB 4RU9A 4QW9A 3KK1B 1RTJA 1IKWB 3LAMA 3QIPA 2DPJA 3Q8PB 4KFBA 3ITHA 4GC7A 3V81A 5EUHA 3DRPB 3CJ5A 2IM1A 3FDSA 4QWBA 4ED8A 1RT3B 4KV8A 1U09A 3NAHA 1T05A 2BE2A 4PQUA 3VQSA 4RNNA 3T19A 2R2SA 2XC9A 1T3NA 2XGPA 1T03A 1NHVA 4RW9B 2BRLA 2RKIA 5FDLB 5KFVA 1J5OA 1N4LA 3E51A 2WOMA 5F8HA 4EO8A 4WXOA 2HNZB 5F8JA 3BSAA 1FKPA 1VRUB 1RAJA 3CDWA 1YVFA 2JC1A 4IFVA 2R2RA 3T5HA 2WTFA 4ZP6A 5JXSA 1ZETA 3E01A 1XR5A 4RW4B 5KFSA 4TQRA 1TL1B 2ASDA 4FBTA 2D3UA 5KG2A 3T5KA 1MMLA 4G3IA 4RW7A 1SH3A 5HLFB 3OSPA 5F8GA 4F4ZA 3KLEB 4O3RA 2IM3A 1JIHA 3CWJA 4MIBA 4PUOA 2OPQB 1C0TB 1S1WB 1S6PB 1HNVB 5CYMB 1S0OA 3D28A 4WZMA 3LP0A 4KHRA 4J9MA 2AGQA 1S1UB 1C2PA 4IH7A 2B6AA 4IDKA 4TY8A 3FFIB 1S1VB 4NLUA 2I1RA 3KK3B 3BGRB 3SI8A 4ED7A 1EP4A 3QO9B 3JYTB 2B6AB 2GIQA 2VG6A 3DLEA 1C0UA 2OH2A 1RYRA 1KLMA 4EBEA 3LP0B 4HYKA 1FKOA 3C6UA 3FQLA 4QWEA 1S6PA 1DTTA 1IKYB 4DL6A 4IQXA 2VG5B 4ECWA 4DL3A 1RT1A 4RNFA 3KHLA 1S6QA 3DOKB 5DG8A 3MR5A 5HLFA 4YQWA 3KOAA 5L1KA 3BREA 4TN2A 2FJXA 1VRTA 4ED0A 4RW4A 4IRCA 3E01B 2ALZA 4WFXA 3GV5B 3DI6A 1T94A 5C42B 3DRSA 3KLGB 4Y2AA 5EWGA 1IM4A 1RA6A 4NRTA 2HAIA 2VG7A 4EO6A 3CO9A 2WOMB 4IOBA 3IGNA 2UVRA 2R8JA 2IM2A 2YNFA 5FDLA 1T03B 5DG9A 1SUQB 4O3PA 5KFTA 4QWAA 4J9RA 4RZRA 4F4WA 2ZE2A 3IN5A 4F4YA 2BE2B 1FK9A 4QWDA 3TAMB 2F8EX 1JKHB 1RT3A 3GYNA 4IFYB 4Y2CA 3CJ3A 4IRKA 3ITHB 3IGVA 3H4DA 3V81B 4IKAA 5KG4A 3CDEA 3G6VA 4TXSA 5KFWA 2FVSA 4ZPCA 2WK4A 3DRRA 1S0NA 1EETA 3KK1A 1DTQA 1HNIA 1UWBB 2FVRA 1JX4A 4M95A 3UPFA 1TKTA 4KSEB 5KFPA 4EEYA 2HNDA 5F9NA 3NBPA 4H4OB 4Y34A 5J2PA 3KMSA 4IG3A 3QZ8A 3OHAA 1IKVA 2BANA 1ZTTA 1JLEA 1IKXB 2B43A 4ZMMA 5KFEA 1JLEB 1JLFB 4LSLA 5DLGA 1IKVB 3UQSA 4I7FB 4J9LA 4R8UA 3RB0A 2RF2B 2R2UA 2E9RX 1RTHA 1N6QB 3NBPB 4PWDA 2HNDB 3DDKA 3G86A 4MK9A 4RW8A 5C24A 5C25A 4KB7A 4FS2A 3IG1B 1KHVA 4J9PA 2UUWA 3ISND 4KAIA 1RTIB 3PW7A 2FVPA 1RT7A 5KFKA 5I3UB 3KJVB 1RTDA 4NLVA 4H4MA 3SFUA 1HMVB 2YKNA 5KT5A 4K4YA 3T5JA 1N56A 4O44A 1QAJA 4URSA 2IJFA 1K1QA 3UR0A 5K14A 3M8QA 3KLIA 3NL0A 2QE5A 3MECA 2FLNA 2V0NA 2WRMA 3MEGB 4ECTA 4NLSA 2BRKA 2YNGA 4WXWA 5D3GB 3H5UA 2WHOA 2ZE2B 3HVAA 5DGBA 1S9GA 5KG3A 1N48A 4B3OA 4IG0A 5HBMA 4ID5B 3HVTA 3BQ1A 1JLCA 4IH5A 3M9NB 4ZPAA 4TLRA 2W9AA 1BQMA 2VG7B 1TL3A 2HNYB 3IRXB 2R8HA 2R8GA 3CJ4A 4NLPA 3FSIA 2W7PA 3DI6B 4RW6B 2ZKUA 5J2QB 4I2QA 3V6JA 2ATLA 3EPGA 5F8LA 2OPSB 1S97A 1REVB 2DPIA 1TQLA 4EBCA 3DMJA 3CDUA 1RT4B 2FLPA 1RT1B 2VG5A 2UVWA 3PW0A 4YR0A 3MR2A 2O5DA 3NAIA 4MKBA 4HKQA 1RT4A 3DMJB 1N5YA 1JXLA 1KLMB 2GIRA 1XR7A 4NYZA 3QO9A 5KG7A 1EP4B 2IJNA 3KK3A 3DM2A 4RW6A 5J2QA 1S1VA 2C22A 5J1EA 4TY8B 3IS9A 5KFNA 1I6JA 2W9BB 3IRXA 1D1UA 4DG1B 2XCPA 2R8IA 1TVRA 4DL7A 3G6XA 4DL5A 4YR2A 1HNVA 3N6MA 5HBMB 3H59A 4B3OB 4M94A 3KLFB 1TKXB 4Q44A 2C2EA 4LQ3A 3H5YA 1JLQB 3MFIA 4RW7B 3N6LA 2XGQA 3PVXA 3KMQA 3KLIB 5HP1B 3KLHA 3MR6A 4K4TA 2B5JB 2WONB 4WE1A 3H40A 3BSOA 4RNOA 2VA2A 3OL7A 3PW4A 5F8MA 3OL6A 2W7OA 4IFVB 2QV6A 1LWFA 3MR3A 3KJVA 1RTDB 1RT7B 2HNZA 5KFCA 1RTIA 4O3OA 3PW5A 4DL2A 4MIAA 5DLFA 1HQUB 3IG1A 3MEDB 2HWHA 2RKIB 5DG7A 2J6SA 2OPPB 4RW8B 5C24B 5C25B 2OPRA 4ECYA 2JEJA 2UVUA 4NLXA 2I5JB 5KG0A 4PWDB 3HHKA 4Q43A 2RF2A 4NZ0A 4PQUB 2E9TA 2XCAA 5F8NA 1JLFA 4TY9A 5KT4A 4WYLA 1S9EA 3CJ2A 3H98A 3ISNC 5KFXA 1IKXA 4ZVFA 4ECQA 4Q8EA 4ECVA 4RNMA 5KFAA 2JC0A 4R5PB 3V6KA 2ASLA 1LWEB 5J2PB 3HVWA 1S1XB 3NMAA 4QPXA 3MEEB 3PJXA 3QIPB 3M9OB 5DQIA 3GIKA 1GX5A 1RTJB 4ED3A 5I42A 1TKTB 5KT6A 2AU0A 1RDRA 5L1IA 5J2MB 1JLAA 3H5SA 5KG1A 1JLAB 4K4XA 2J6TA 2XWYA 3T5LA 3I0SA 1S1XA 3OLAA 1LWEA 3GILA 2JEFA 4R5PA 3DLGB 3Q8RB 2YNIB 3JSMB 4ZVGA 1JKHA 3I0RA 1JLBB 4ECXA 3EPIA 3LANA 3GQCA 1MU2B 1S49A 4URGA 2I5JA 4J9NA 3CJ0A 1HYSA 4ZP8A 1SUQA 4IH6A 4JV2A 4WFZA 1RT5A 4DEZA 4NLDA 5KFFA 1HQUA 3MEDA 2YNHA 3V6DB 3OSNA 3CVKA 1KHWA 1LW2B 3DOLA 2FLLA 5L1JA 3V4IA 1LWFB 4ECUA 3DRSB 3KLGA 3V6HA 4LQ9A 4G1QB 4NRUA 4WE1B 4YP3A 2WONA 4NLYA 2B5JA 1S9FA 5HP1A 4KHMA 5KFBA 2ZD1B 4Q45A 4O3SA 5KFYA 1S6QB 3LP1B 4NLQA 4ZHRA 5KFHA 1TKXA 1CSJA 1S1TB 4EBDA 3PZPA 1IKYA 4J9KA 3RBEA 4Q0BA 4MKAA 3C6UB 2IMWP 1FKOB 4O4GA
chains in the Genus database with same CATH superfamily
3J7YU 3MZIA 1C1BA 1I5OB 1W25A 4DG1A 4F04B 2FZGB 1S0VA 3R5CA 1WC0A 3HK2A 4NI2B 3TW0A 4MFBA 5KOWA 4JV1A 1KP6A 1WHYA 1VJQA 1Y5NB 4HACA 4USTA 1LWCB 1SV5B 3H20A 2LEBA 2E1CA 5EN1A 1Y3KA 2BJEA 1R31A 3AY0A 4Q0BB 1EHWA 2HZAA 1YBAA 2K06A 2ZOGA 1GX6A 1SKWA 2KT3A 3HFKA 3QIDA 2IBOA 3Q8UA 1N52B 5EWFA 1FRJA 3CC7S 1YDLA 4CLLA 4B3MJ 2QO3A 3ELHA 1BWVA 1SBRA 2MPUA 2I8EA 2ZZTA 4AE5A 4CP5A 3VGVA 1REVA 3WIVA 2OUGA 2Y8YA 4JI8J 2J9DE 2A3JA 4G1QA 2BKNA 1WDTA 1SL2A 2LXIA 1B7FA 2QL7B 1NO8A 1GMWD 2CQ1A 4FDFA 4NCGB 4UW2A 2PA3A 4LVOP 3IAS9 4ZA1A 2D3ZA 3FVYA 2D74B 4NPOA 1R27B 2EBEA 3LAKA 4OYMA 2HQCA 3D5MA 3DRXA 2CPHA 4ZPDA 4DCJB 3EE3A 3FCWA 2O01C 5H9FJ 5EWEA 3Q22A 2B0GA 3HHEA 2FJVA 3AA8A 3KNAA 4PXDA 1S9GB 3I5AA 2CVEA 2MQPA 1G3OA 2MYFA 3AOAA 3R5DA 2EEYA 3MECB 1YZ6A 3I0RB 3MMAB 5A2QY 4Z37A 1M5SA 4OYWA 3K5MA 1KQSR 3IM8A 1HPZB 4HT7A 5L9XA 4OZNA 2CADA 3EUNA 1WKJA 4C0BA 1Q53A 5KT2A 4CO5A 2BM1A 4PXCA 2L9NA 2RU3A 1YHQS 5T14A 4OX8A 4P6QA 4HKQA 1P8GA 4ECSA 2DR7A 2B8QA 4ELUA 2IC3A 2FYXA 2NCKL 3TQ1A 2V4QA 2BACA 3TVYA 3BQ0A 3DHWC 2AJQA 1HQEA 1KVKA 3Q89A 1SH0A 2EW9A 3O44A 4M1KA 1RKIA 5M2RA 2EC0A 1EKRA 4LR9A 3PO4A 3T1AA 1HI0P 3BEGB 3MEEA 1YLXA 2FHMA 2VIHA 2BQUA 2F4FA 4QR2A 3R7SB 2IAJA 3NXZA 1FD2A 3VQTA 3QZ7A 3MCSA 1VBKA 5JVGQ 4J9SA 3RB4A 3UWTA 4DUYJ 2CQGA 2H5EA 5HJYA 2LFVA 1X5PA 1WC3A 4KE5A 1CC8A 2V9WA 5G4DA 4HVZA 5A8RA 2FJEB 2R7WA 1BE4A 4F0MA 5IT9U 4ZLLA 3TP2A 1Y0HA 5A8KB 2E66A 5ETVA 4QU7A 3M8SA 1RWMB 2HHTA 1IBCB 4EFAC 1DTQB 3JS9A 4Q8FA 3HPOA 3DRRB 3KTQA 5KT3A 3GU0A 3I32A 1QVGR 1TFWA 5D8HB 3M7VA 5LJ3Y 1C1CB 3J7A1 3PTWA 1WACA 2BUNA 2YY3A 2DCUB 1TKZB 2V6AA 3HI9A 3JQKA 3QFWA 4IFYA 4BWMA 1LOUA 4AD6A 2LA6A 3ILIA 2WVBA 1JLQA 2FC8A 3RW7A 1CBKA 3FEZA 5M2PA 4F0HA 2DY9A 3KLFA 4DR7J 1G6BA 2Y0SD 5C5JA 1T0TV 3I82A 2YNFB 4RWXA 4WYWA 1T9WA 4ZPTR 2YKMB 3OFHA 4DV7F 1QTMA 1LW0B 1RE1B 1S79A 2UVVA 1H3DA 3CIMA 3DLKB 1HBUB 1TTHB 1V5IB 3C6TB 4XPCA 4ED6A 4PQUB 1YRXA 4KHPJ 3PDNA 5J1EB 2ILYA 5KFDA 1B70B 3FJ2A 3KHRA 1K9MT 1TAUA 2Z57B 1OWXA 1MROA 3NGTA 4MT1A 4KBIA 1TR0A 2WW4A 1OQ6A 2FZKB 3GIIA 1FDDA 4H54A 2LVWA 4CYUB 2GGPA 1N33F 2ZEJA 1MLAA 4J9QA 1HR0F 1GFWB 3TVZA 3FMBA 2YVSA 4KGZB 5B08A 2DR6A 2N82B 1R0AB 3C14A 2HK3A 4DPOA 4K50A 2MKSA 1YBTA 4ILRA 2DGSA 3E3XA 4WTYA 1JNRB 2PN6A 1PBAA 3LUYA 4X65J 2V4RA 3UW1A 1F6TA 5ETTA 2OPSA 3G9CA 2YX4A 2CPDA 3B4DA 4OHYA 1MROB 2R7QA 4JV5J 2MKKA 1F2GA 1N32F 1JB0C 1UVKA 4U7UD 5A6WA 2AWZA 1HBUA 2FD2A 2W2PP 1VQMS 2UU9F 1NJXA 3P6YC 4LBHA 2R7XA 1OYDA 4F36A 2YKMA 2KZMA 1GMVA 2ACMA 3QT8A 3MFHA 1I51B 1S1WA 2UV8G 2OPQA 5GADI 1IJFB 4HR2A 2LECA 2XY5A 2IDEA 4KGXB 2HHHF 1RWWB 1U2CA 2MDAA 4OHXA 4C8NA 5D3GA 3AD9C 3NRBA 1R6VA 1WEYA 4QIGA 4MK8A 3DKDA 2HYIB 1F5BA 2OSRA 3NGKA 2IM0A 4O44B 1FF2A 1X5TA 1C1CA 3TA2A 4TNOA 5E5NA 5LT5A 1FO1A 3LTOA 2Y1JA 4C8KA 5H9FK 3Q83A 2C2KB 1RISA 3DOLB 1LW2A 1ZYQA 2YWHA 2CJKA 3M1VB 2B9EA 3HCXA 5B0DA 3PW2A 1UP1A 2LKZA 3G82A 2BABA 4M5MA 5A8KA 1UUJA 1OSDA 3D67A 1TV6B 4ZPBA 3TANA 2CAJA 4N41A 4MH8A 4D3GA 2VBYA 3IWLA 1Z4UA 1TU0B 4OZ3A 2HHSA 1XJWB 2KXFA 1SIWB 1RHUB 1IWGA 1JLGB 4KYZA 2F8MA 1R8PA 3K5NA 5F8IA 3GIJA 1KS2A 4WPAA 2ZJRQ 3OLBA 1RAIB 4KJIA 5LMNJ 3CB4A 5IZHA 4P2FA 4DDFA 4WFNQ 4C97A 1D0EA 2BJ3A 3BN7A 5CD4A 1EAYC 4KPCA 2GV1A 4WTOB 2CWKA 1RJJA 2U1AA 2H65B 1UFWA 4LVNP 3R8YA 4Y00A 1FTCA 3ZZ0A 1S10A 1KQGB 1FRXA 1UWBA 1WC5A 1F0XA 4UF4A 2EFOA 2KB2A 5D6GA 1UA0A 3RR8A 3Q8VA 4O0NA 5HVHA 3QWUA 4C0HA 3EYZA 1M5VC 2VC0A 4DSKA 3GFXA 4KGVB 2DPJA 2BV3A 2ZBPA 5EUHA 2KRBA 3DRPB 4WBFA 3CJ5A 2IM1A 1UWAA 3L9ZA 2YKOA 5DDPC 3PRBA 3ZTRA 3LWLA 4ED8A 3R1LA 1KLNA 1KQFB 2VQEJ 1Z2ZA 4KV8A 4DBQA 5GAGI 2DVIA 1QD1A 2H54B 5AXLA 4RNNA 1VLOA 2OHDA 3RUBL 2JHEA 1NJWA 4RW9B 1J5OA 1QSSA 3CJRA 2RQKA 1N4LA 2M2BA 1IBLJ 1MW7A 3W9JA 3RW6A 2H5IB 2XO7A 1KQKA 2XZTB 4EO8A 3T5HA 4IFVA 1R0BG 1WOSA 5J1PA 2VICA 5JXSA 3PIPQ 3DOMA 2W4CA 4TQRA 3ILLA 5HMZA 1ZS6A 3OTOJ 3CCLS 3ETMA 3CTRA 4LBIA 4DCPB 4HHHA 3O2IA 3CCES 4OX7A 4NXNJ 5A76A 3AX2A 1SXLA 1T9YA 4A8QA 1Q5YA 2XLJA 4F4ZA 3KLEB 1O8BA 5HLFB 1HWUA 3AOCA 1SCJB 3CJ8A 1S1WB 1S6PB 1HNVB 4PG4A 4A48A 5CYMB 1S0OA 4GKKJ 3OD2A 1UVJA 4KGMA 1YJTA 3O8WA 4KHRA 3UE2A 1LQ9A 3MUVP 3UD4P 1FDBA 2HHVA 1HQ2A 4IH7A 2ADCA 4HH0A 4RBUA 4DR6F 3FFIB 2HSEB 5FD1A 5IC6B 3KUEA 2PEBA 4LF2A 2B6AB 3T1HJ 3DLEA 2DK2A 1C0UA 1KLMA 2GVZB 1WC4A 1XBWA 3A4TA 2Q6CA 3LP0B 2V69A 4EBEA 3C14B 3FQLA 3HHLC 4DV4J 2CQDA 3ZZRA 3J7Z5 4ECWA 4DV3F 2GGPB 4DL3A 3EZOA 4NMLA 2QYGA 2XZWA 3KHLA 4CO2A 1U1PA 3UO0A 1GTEA 3AOBA 3EDQB 4YQWA 3ENAA 4PAAA 5L1KA 3NNCA 1P9YA 3AB2B 4TN2A 1YJWS 2FJXA 3MEKA 3OBIA 4ED0A 4RW4A 3VHQA 4IRCA 3DNCA 3GV5B 3NGUA 2MSSA 4DV2F 1HA1A 3W61A 2K2PA 3MM9A 1S57A 1IM4A 4NRTA 1L3KA 2HAIA 2ZVSA 2PO4A 1JXVA 4IOBA 1CS4B 4L3KA 5GAHU 2IM2A 2BOAA 1RWNB 2QLJB 2VBWA 2ZHAA 2HVZA 2MLYA 5KFTA 3L7UA 4J9RA 3M6XA 3ZNJ1 1D9DA 4GO7X 3IN5A 3ADAC 2BE2B 3LPYA 4DSIA 1SQGA 2V4JB 3FZ2A 5CZVA 3TAMB 5B0BA 4IFYB 4IOCQ 3RRGA 3G87A 1TMMA 3F41A 2ZITA 4G1IA 4DV1F 4MKVA 2OMLA 5KG4A 4L76A 1AFJA 4QR0A 2COLA 2WK4A 5MAOA 4HI1A 1EETA 2W4DA 2Z30B 3HO1A 1JX4A 3ILOA 4GRSA 4ZPWR 3UPFA 3ZNUA 3OUYB 4DZ6A 4DV3J 4B9VA 5LXYA 4OHWA 4EEYA 1XMBA 2HNDA 5F9NA 4ENOA 2OJ3A 4Y34A 1ZPVA 2AJ4A 4CLKA 2VUGA 5A8RB 1TZ0A 4IG3A 3NLCA 2V2VA 3BS9A 3T3FA 4AQYJ 4LFCF 3A12A 3OVSA 3HX9A 2DRDA 1X4HA 4ZMMA 1NPRA 1JLEB 1H72C 2ZBQA 3SCKE 1CVJA 2XMJA 2OD6A 5DLGA 3UVJA 1GXLA 4J9LA 3RB0A 1N6QB 3SSQA 3OFFA 2ZWPA 3DDKA 5BR8J 5C24A 1WF2A 2Y3YA 1VJWA 4DR4F 2F9JA 3BM7A 4CTAA 2P9CA 1KHVA 2XSJB 2NSBA 3B4MA 2RH3A 2CNOB 6AT1B 4J9PA 2NQPA 4E2FB 1T3OA 2KDOA 5K5MA 3OR2B 5E3PA 5KFKA 2FVPA 3KJVB 5AJ3J 2VPZB 4H4MA 2DRAA 2Y9HA 1V3SA 3ULHA 3OTCA 1IUJA 5DM6Q 1N56A 3MDFA 5EX3A 3RRKA 1FT8A 4Z7CA 1RKJA 3RR7A 1X4AA 4DR1J 2UXDJ 3W2VA 3MECA 1HNXF 5GVQA 3VCDA 4CLWA 2VOOA 3AX5A 2WRMA 1FVSA 4PG6A 2UUCF 2WZ1A 3MCMA 4ZLPA 4FF1A 4UQTA 1RHKB 3AA9A 1CULB 1S9GA 2G13A 2R42A 3PEHA 4USVA 5E33A 2LYVA 5DDOC 2X1AA 1N48A 2HZVA 1JWWA 3HVTA 3L4BC 4DR5J 1AW0A 1RAOA 3OQ2A 4ZPAA 1NMEB 3BGUA 1BQMA 3CJTA 3MPVA 1FTRA 1N5TA 2QRRA 1SQFA 1XMQJ 1AZSA 4B3SF 2R8GA 3CJ4A 2DNQA 5K8PA 3Q8YA 4K2XA 5F3ZA 3BBBA 2FPHX 5D4NA 2DCLA 5J2QB 2E5LF 4EUVA 4F3QA 4I2QA 4YHHJ 2ZNZA 3MM5B 1FJCA 4YB5A 1CJUA 4ANEA 4LIWA 1KVIA 2BE9B 1LFPA 3AX3A 2NSCA 3LA0A 3R7BB 2BVZA 3DMJA 1T9XA 3CCVS 2WVEA 2DO4A 2YH1A 3EWGA 2VONA 1WHWA 1NZAA 4B3RJ 1YBUA 1UFLA 3R5JB 4CQ1A 5AE1A 1LXJA 1RT4A 5C7PA 5CCLA 4NZ6A 2MXYA 1N5YA 2XTEA 2WSEC 2WVCA 3MMBB 2XS5A 1XR7A 5D0RA 4B17A 8RUCA 1TUWA 2HRTA 4JYAF 2WVDA 3U7JA 4DZDA 3MMCA 4YB7A 3L7PA 3KK3A 3MM7B 4X4OA 2C22A 3GP9A 4NI2A 4YDXA 4QJVA 4ZN1A 5H9EJ 4DG1B 2HFSA 2BJ1A 2XMUA 3THPA 2HHPA 1U49A 1ULRA 1V3ZA 4B9TA 2XMMA 5EX0A 1FVQA 2A2DA 4N56A 2XSFA 3GLJA 1QSLA 3EVWA 2A6MA 4LQ3A 1PIEA 1RUSA 1UW9A 1HBNB 2W2MP 2XGQA 1IBKF 2YQ0A 4CLPA 3MR6A 4GKJF 3J80U 1NCLA 4BBYA 1J5EJ 4N76A 2V1TA 1PGZA 3CCWA 1MMNA 2HQFA 2GO9A 3PW4A 2W7OA 2HQ3A 3MR3A 1LWFA 1RTDB 3UDEA 3W64A 1VQNS 1RT7B 2HNZA 1REGX 3KDOA 2KHCA 3CO0P 1OSCA 1OQ3A 5DLFA 3MEDB 1F9EB 2RKIB 3G6ES 1FWKA 3LOUA 1LNQA 2JEJA 4TU9A 3VAFA 4HI2A 2UVUA 4NLXA 1WD6A 1HW9A 2I5JB 3EVMA 3GMGA 1N5SA 2RF2A 5KG0A 3DCAA 3TNVA 3MURP 1YITS 1NB7A 2HHQA 2E9TA 3GJQB 4B3TJ 2XTCA 1AXQA 4KH1B 3RTVA 1WUUA 2V2ZA 3AH6A 1IBMJ 2PMHA 4DR4J 4WYLA 2HVIA 3N0VA 4ECQA 2C3MA 1IKXA 3GIRA 4ZVFA 5D4OA 4RNMA 1NK7A 1LKZA 2CQHA 5J2PB 3OT9A 4TVAB 3NMAA 1PCAA 2HIYA 3QIPB 4WFBQ 3M9OB 5DQIA 1GX5A 1RTJB 4X65F 3FNNA 3P3DA 1MWZA 1FCAA 2FY8A 3FCVA 1YKWA 3W1YC 1P6TA 3R3TA 2CPEA 2PI4A 5LMUF 1FFSB 3T5LA 3I0SA 4OLOA 5D0EA 4B3TF 1LWEA 2IRYA 4W90B 2XYPB 2ZOMA 5SUHA 3BYPA 3DLGB 3CCSS 2FJAB 3Q8RB 1VQ4S 3MR7A 1NPPA 1HD1A 4LF5F 1CJKB 2D9OA 1ZOTA 3UN5A 3W66A 2RUGA 2JL9A 3PIOQ 4URGA 1HYSA 1GNKA 2I5JA 3BPSP 3CJ0A 2UXCJ 1BMQB 3D0HE 2J8SA 2DGUA 3HT0A 4PRFA 1HQUA 2KFYA 1WDDA 3OSNA 3QGPA 1Q8LA 4K5RA 3TX0A 4C2MA 5ETMA 2XY6A 3N01A 3UR3C 4C8OA 5IOLA 3V4IA 3IM9A 1RBAA 4ECUA 3KLGA 1GAOA 2QC3A 1OO0B 3WDOA 4C11B 2EBGA 1FXRA 4NRUA 1R43A 4CT9A 4NLYA 4B08A 1X4GA 3VGTA 1BC6A 1SJQA 2HRYA 2ZD1B 2XMKA 3ZTSA 4G6VB 2YTCA 3SIPB 4V19J 3NS7B 1JNZB 4XTTA 3FBCA 1IKYA 3ZZYA 1U8SA 4I67A 2ACYA 3IWXA 1VQ6S 2N3OA 3GIKA 2IMWP 5M2UA 4O4GA 1TVRB 3BYRA 3MI7X 3JAMU 4KKOB 2CNNB 2P9EA 1JJHA 3KWMA 2DNLA 1YRUA 2C2ZB 2RQMA 1EKSA 2QFIA 3IS9B 3PKYA 1WG1A 3FRZA 4LRAA 1DY3A 3U1MA 3BGRA 4JUZA 5KG5A 2JLGA 4U7UK 4C3MA 3EMTA 4P7TA 5DDRC 2W24A 3EGVA 2E5JA 5DZ6A 5DJBA 3UCZP 3WQPA 4YS2A 1X9MA 3MMBA 4JI3F 3D7SB 4QOTA 4DL4A 3HHNB 2DHXA 2AZ1A 2XO6A 3RBZA 2KZZA 1NDCA 3J80Y 5LSLA 3QGIA 4TQSA 2HMIA 3W3SA 4ILLA 1C0TA 4DHVA 1BQXA 5AE2A 2XG8A 3R97A 3ZXWA 4ZCIA 4ZKAA 4I0WA 3J7AN 3D68A 2FJWA 1KFDA 1G1XA 4GKKF 3U1LA 4PQAA 3HZGA 1HWLA 2APOA 1U0SA 3M2RB 3NCPA 2YWGA 1PYOB 4DR5F 3N28A 5B0CA 1VRUA 1PC5A 4UY85 2B56A 2KVQE 1NH7A 3MCNA 3V4IB 2HNYA 2L9WA 1WC1A 2MZ1A 4FBUA 4D3HA 1VFJA 4GVLA 5HVGA 1I3OB 1RHMB 2A18A 1ZA2B 3EGWB 4YN3B 4ED2A 2NXCA 4X64F 4X64J 4FF4A 4HT5A 4ID5A 4M5HA 1WKLA 3DC2A 2J6UA 4DR1F 2F40A 2CPFA 2WB1D 1VC5A 1TFYA 1WWHA 2XB2D 2RAQA 3KK2A 1HYSB 2IVYA 1HHQA 4RUCA 2R4FA 2EC2A 5IWAF 2OFGX 4PPZA 3QPIA 1T05B 3KNGA 4AXIA 4OX9J 3TVKA 3A3OB 4FF3A 4NLGA 4CRJA 5K14B 2KFZA 3CJQA 2DTJA 3AJ1A 3MXHP 1UJ6A 4C8MA 5F9LA 1LEOA 4KFBB 3SYZA 2DGOA 2OAUA 2QLWA 2PDAA 2OFHX 5BR8F 3I0SB 3T1YF 5DGAA 1E6VA 4DQSA 2ZH9A 1QUVA 2RDDA 4NEYA 4LFAF 5AXMA 5I4MA 2JEGA 4B3MF 3WX8A 5LSOA 4WF9Q 2XSJA 3AD8C 5HROB 1VDHA 4MIWA 3BH6B 1NKEA 5I42B 1YWXA 3NEKA 1VI7A 1XN9A 2D1CA 1ACMB 4JV0A 5CYQA 2DXFA 2EKNA 2EKYA 2AQ4A 1N6QA 3QT5A 2QLFB 1B0TA 4FN5A 4WJBA 1SJ4P 1BQNA 3W63A 2EWHA 2I9SA 2Z56B 1R7IA 4AYBD 3GJRB 1B64A 1S9EB 1WELA 4Z7YA 1QAIA 4ZVHA 1QE1B 2B7BB 4N77A 1PG5B 3RJMB 2ZH1A 2E9ZA 5CHCB 3W65A 4NCAA 4BS2A 4DQQA 3PYDA 3QT6A 1TUGB 2XS7A 2B9XA 1CJTB 4ZN3A 3BSNA 2RHQB 2D7SA 1BGXT 3W9HA 3NGDA 3LPEA 1WC6A 2DO0A 2DH7A 3HT3A 3D0IE 1XEZA 4ELVA 3N5FA 1UVIA 2HGLA 2ZDOA 2W9CA 4ZDNA 3SZ2A 3CT9A 2Q79A 2M9KA 2EK1A 2ZDPA 4EWTA 4OL8A 2GMLA 1EQMA 2VD3A 3KLHB 2N3LA 2CJAA 2V4JA 3TAMA 1VQOS 3IWNC 2NYHA 1JJCB 4L3NA 4HDHA 3KK2B 2FVQA 1K0VA 4MMOA 1YGYA 2ZWOA 2JEIA 2R7RA 1TMJA 3VGUA 4I6WA 3PFEA 1KR4A 1S7IA 2IHR1 4Y28C 3JTPA 1GTHA 1NAQA 1OY8A 2B3TB 1YJ9S 1YG0A 2IA6A 4LF5J 3KLVA 1Q4RA 1Z2LA 3KG4A 4OYAA 3B8HA 3H5XA 3BPDA 4A46A 3CIZA 4UY8T 2HW3A 1CQNA 2W8KA 2HGMA 3HDSA 2N7YA 1BHNA 3F44A 3BDPA 4RL1A 2GAHC 4K4SA 1SH2A 2H1YA 1W26A 2VFUA 3O6QA 3R27A 3R6LB 4ZCKA 3LF0A 2ILZA 5CXTA 3RG6A 2DNMA 3UFCX 4OI0A 2VDIA 1WTBA 3QLHB 1DLOB 4ICLB 1FESA 4J5OA 3H2LA 5F0UA 1C0UB 3DLEB 5GMEA 1CJUB 4I2PB 1NUEA 4CLSA 3MPWA 4CM2A 5HQMA 1VMBA 4C0OC 4YUDA 2CUYA 3FFIA 5EDWA 2EFVA 1EB0A 2JLEA 2ZM6F 3K7RA 3OL9A 3ETOA 3PO5A 1T8EA 4DPTA 4KKOA 1BQMB 4OI2A 3PY8A 5ETRA 3W8PA 3QGGA 3THVA 4DPUA 2J5AA 2VOPA 5CYMA 3ZZZA 3CD0A 4KHPF 2KYZA 3I9ZA 1NHKL 2FHJD 3V5RA 2EXUA 3PR4A 3KLEA 4HTIA 2B9YA 4YOEA 2ZD1A 1WF1A 2C28A 1VK3A 2XHWA 3T6JA 3Q23A 3HSJA 3MGJA 1CPZA 2XI3A 5GAEI 2H4WB 1HBMA 1TK0A 4PWWA 4RUAA 4EI2A 5K20B 4NXMJ 4A8KA 4P72A 5E3QA 3EXCX 2JSXA 5J1NA 3MHYA 2L41A 2HVDA 3KXDA 2C2DA 1BUXA 4F2RA 1BWEA 4DLEA 2DD8S 2LQ8A 1E6YB 3MM6B 4Q2MA 5T7LA 4P75A 2A0FB 3LP2B 3L09A 5CA5A 4R8UB 1S72S 1CJKA 2RRNA 3WIUA 4ZVRB 4ETZA 3ZO7A 2FGOA 2BYCA 2M4MA 3AJDA 3C8YA 4RR5A 4IG3B 3NS6A 4P2SA 3JAMY 4DX5A 3KG1A 4X66F 2DHAA 1IKWA 4RUBA 1RAGB 1ZM9A 4AL7A 1RT6A 3CC4S 4V19X 5L8RC 1TL4A 2QL9B 4ZP7A 3OFGA 4I69A 4KO0A 4P9SA 4DX6A 3U02A 1NEEA 3VGSA 4TU8A 3BQ2A 4JI7J 1OM2A 1EETB 4NWBA 4ETXA 1RTJA 2QA4G 1U0HA 2OLWA 1IWAA 4NASA 1F5AA 3K58A 2BJ8A 3KYLA 4GC7A 2VFRA 3V81A 1D9FA 4MJKA 3TEHB 4ANDA 2M8DB 2V34A 1RADB 2ZHBA 2J9DA 5GMKa 5E7OB 2F63A 3H90A 3IP0A 3NAHA 3GSIA 4A8MP 4OZ5A 2BE2A 1RP5A 5B0GA 4ALZA 3K5PA 4NYOA 3T19A 3PX4A 1W2BR 2XGPA 5A2QU 1YJRA 2ZNYA 1T03A 5D4LA 1KWMA 5GMDA 1CS4A 3LQVA 1NK6A 2WOMA 1ZAVA 1YI2S 5F8HA 3UCGA 3GYXB 2Z58B 3A8KA 4L74A 4X62F 2NLWA 1JJ4A 1RAJA 1HWKA 1KONA 2JC1A 5RUBA 4B02A 2WTFA 1P27B 1ZETA 1V3RA 2JWNA 3E01A 1FA0A 3R5GA 4RW4B 5KFSA 1YZ7A 3C16B 4CWBA 5IV4A 1NLKL 1TL1B 4UZCA 4FBTA 2V8VA 2DEJA 5BYQA 4M5GA 5KG2A 1MMLA 2R3VA 5MLCV 4RW7A 1SH3A 2CRLA 1IQTA 4M5JA 1UEUA 2IM3A 2GHPA 2GO8A 3EDRB 5HMWA 4Q7AA 4PUOA 2OPQB 2GJIA 2RJZA 3QSIA 5E0OA 2DR9A 3D28A 3H25A 2CPXA 3UDVA 3R1HA 2R7VA 4FVCA 3LP0A 4X4QA 4J9MA 1VQ8S 3M2UB 1VGYA 4OZLA 4CDIA 3P49B 1WI8A 2E5GA 2B6AA 4JOUA 3SXLA 3E2EA 2KXNB 2RQCA 3MM7A 4AQYF 2I1RA 3KK3B 3CD5A 1DQ9A 1RSCA 4FYXB 2CNLB 2XZ2A 1D9AA 2BJ7A 2VJVA 4J90A 2I0XA 2GIQA 2VG6A 3N4WA 1HR0J 3P4UB 1X31C 1GXTA 2MZTA 1NXIA 2JJ4D 2RB7A 3B82A 2OH2A 4HYKA 3MCOA 1Q79A 4P2MA 2OTJS 4CI0B 1M5OC 2KHDA 4QWEA 1DTTA 3VAIA 4DL6A 1VCTA 1WTFA 2N4DA 2CJ9A 2VJUA 1X0FA 4RNFA 4E8UA 2IY5B 1S6QA 3DOKB 3GPAA 4J9UE 5DG8A 4A8WA 4J37A 3KOAA 5HN0A 4OQJA 3W5XA 3D2WA 1DRZA 2BDPA 1VRTA 1WEXA 3E01B 2EG1A 3O1LA 2ALZA 5A8WA 3ENQA 5I3QA 2QJ3A 2QLXA 5C42B 2P8IA 5HMYA 2GQCA 1QM9A 2YWKA 3AQPA 3GWCA 1QTNB 3US5A 1APSA 2JNJA 2WOMB 4ZVOB 3QAUA 2C2OB 3IGNA 1U24A 2LCWA 5IM0A 2UVRA 2YNFA 2R7UA 3ENVA 1T03B 1SUQB 2XMAA 2QMXA 1WORA 2GX8A 4DSJA 1FK9A 1HW8A 4OI1A 5IFMA 5JJBA 3M30A 1A7GE 2GHVC 1PO6A 2WW8A 1SKSA 4Y2CA 9ATCB 3L3CA 4XAKA 3CJ3A 2HFUA 1VYAA 4QR1A 2MQLA 3GV8B 4IRKA 3V81B 3IGVA 4ES2A 3A8JA 4IKAA 1B3TA 2WBRA 2J8AA 3G6VA 5KFWA 2FVSA 2ADBA 1U0HB 1GEHA 3DRRA 1A0OB 1OJ4A 1S0NA 1DTQA 4NE9C 1UWBB 4W4MA 1QLNA 1GMUA 4FKYA 4GMKA 3LO3A 4HL9A 4DUYF 1TKTA 1JMTA 2YXLA 1T95A 3HFVA 4KSEB 3RAMA 5KFPA 4QYZJ 3GSDA 1J2VA 2IRUA 2XNQA 3BF4A 2CQBA 1ZTTA 1U48A 2HG4A 2XWXA 3O5TB 3FRYA 3I87A 3AAWB 3T41A 2RUSA 1DZ5A 4AT1B 2GS8A 1YJUA 2AYGA 3R5BA 2E29A 2HS4A 4I7FB 5T7LB 1WI6A 1DQAA 4R8UA 4WFAQ 5DM7Q 1V6HA 2E9RX 2WSCC 1MNEA 3QFHA 4Y65A 1DBDA 3PV8A 2HNDB 4PWDA 3IR7B 4C7QA 3IR5B 4RW8A 2A6OA 4UUXA 3G82B 3AXKA 2XQCA 2DR5A 4KB7A 5HK4A 2J9EA 4DPXA 3AODA 3DLJA 1XMOJ 4KAIA 1RTIB 1B99A 4BLGA 3KUHA 2MGZB 3HXMA 3SFUA 2YKNA 3Q2SC 3T5JA 1OPIA 4URSA 2IJFA 1N36J 2UUAF 1CEZA 3UR0A 3WBZA 3IXQA 2Y0BB 2A1BA 2JLFA 2QE5A 3KLIA 3NP5A 4DUZF 3GJTB 4NLSA 4ECTA 3WZ0A 1IBLF 4RLEA 1KD1T 2WHOA 3H7HB 1FERA 2MQ8A 1A9NB 4DV0F 1T02A 3CJKA 4B3OA 2GJFA 2UUBJ 1QUPA 1H7WA 4ITSA 4F25A 5JMNA 4RX6A 4JI8F 2CJXB 3M9NB 2OKQA 5HVFA 3RBXA 2W9AA 1UVNA 1TL3A 3A3PB 3H0PA 2HBZB 3IRXB 4UOCA 2R8HA 5D0GA 3AJ2A 2VQFF 1KKHA 1Y00A 4OZJA 2IYGA 3WC0A 2BXJA 1FJEB 1D3WA 1U02A 1HIYA 2LA4A 2LDYA 3V6JA 3S8SA 3EPGA 2MTLA 3OXLA 2ROGA 2OPSB 1S97A 1REVB 4U9RA 2Y1RI 2HURA 2XYGB 3KDNA 3GB0A 3KG0A 5FIIA 1X60A 3I6PA 3F0NA 4YR0A 3MR2A 3ZC4A 4JI7F 2K1RA 1H6KX 2MSTA 3SEOA 1FHTA 3IA0A 4NA3A 2GVZA 1KLMB 4JI0F 4DMZA 1NJYA 3EJMA 2CYYA 3V6DA 4NYZA 3TUIC 3UNYA 3BR8A 2F4VF 1RLDA 1X8DA 4PYDA 1UEVA 4RW6A 4USWA 4I64A 1I6JA 2Y1LB 1DJ0A 5HATA 3IRXA 3P96A 3B6BA 1D1UA 4LFBJ 4Z2XA 2ABYA 4LF9J 4DL5A 3EX7B 4YR2A 4C4WA 1HNVA 4JI4F 1S6UA 2VHGA 1SL1A 2M5YA 1SC6A 3KLFB 4DSLA 4M94A 2PA8D 2DYAA 4Q44A 4ZITA 3D6HB 2KFNA 3H5YA 1JLQB 1KTQA 2YWFA 4RW7B 2NXUA 1HWJA 3KLIB 3GZ7A 8ATCB 3W5ZA 3KLHA 4K4TA 1N0UA 1AROP 2P2CB 1FRKA 3D6TB 1Q1KA 1H98A 1RHJB 3D3CJ 4WE1A 4DV0J 3DLBA 3DOMB 1OIAA 2E5HA 2VA2A 2IPOB 4WU2A 1SVDA 1SJ1A 2QV6A 4NMXA 1Q5VA 5D0HA 2MGZA 4DUZJ 4CO3A 5KFCA 1RTIA 4O3OA 1O6XA 4DF4A 2H3EB 2UUAJ 4DL2A 3G8QA 1FI4A 2LLZA 1B7YB 2V68A 1NSKL 3IG1A 4QYRA 4WWSA 2YWWA 3G8SA 4DV5F 5C25B 3R2DJ 1L5UA 2KRRA 1FE4A 2UU9J 3W60A 3HHKA 4Q43A 1XC9A 4NZ0A 4K2JA 4PYAA 4WK3A 5BJRA 4DXLA 2CZ9A 3C2PA 4A8YA 1HFEL 1JLFA 3GJSB 5KT4A 1R8BA 1S9EA 3EZ5A 2FGCA 3ISNC 4C8YA 3AXMA 2RT3A 4OFZA 5KFAA 2UV8A 2ASLA 2UXBJ 2HRUA 2OELA 2DHGA 3MEEB 3PJXA 5K8OA 3MUMP 4LF8J 3IFEA 4K59A 5BYSA 5I42A 1TKTB 2AV5A 2DNRA 2KVIA 5KT6A 5L1IA 1JLAA 3H5SA 3OXGA 5KOXA 3V4MA 1VBZA 1RTZA 3MPDA 4PPDA 3W2WA 1MMDA 4IYQA 4AFFA 3DLLQ 3QWPA 1S1XA 1QJHA 4I6YA 5AT1B 4DU8A 3TUZC 4M5DB 4C8LA 5L46A 5HMXA 1ZH5A 4CLFA 3DU5A 4OZ2A 5KAKA 4WIQA 4P73A 2CNKB 3I0RA 3MMAA 4JI6F 1X5SA 1PJ5A 3J7YI 4RUHA 2BA9A 4DV5J 2R7TA 3MM6A 1B0VA 3GQCA 4LR8A 3CCQS 3TJAA 1I94F 1OMSA 3KJFB 4IH6A 1Q95G 1XK8A 4JV2A 4DFPA 1TL7B 2LXFA 4NLDA 5KFFA 4HDGA 3M1VA 5IM0B 3CVKA 4OYXA 4DFKA 1KHWA 2BEFA 3MPUB 1F1BB 2ZH2A 1U2RA 3HULA 3CF5Q 4OMFG 2VPXB 2DHSA 1H74A 3DRSB 2X3DA 3EICA 3V6HA 2WONA 2B5JA 1S9FA 4LF7J 2W1BA 2J0SD 5HP1A 5KFBA 2BM0A 1YTYA 2LU1A 1S6QB 4JI5F 4NLQA 4DV6J 2KJVA 2KJWA 3FUYA 3W62A 6FD1A 2E1AA 2HQIA 1H38A 1FFGB 1NB2A 4J9KA 4Q0BA 2HFOA 4KH0B 3C6UB 3D6MB 3JTNA 3GILA 1FKOB 1M1KT 4IO9Q 2BQRA 3ISZA 2B4VA 4DCOB 2MEWA 1LWCA 1SV5A 2VKZG 4G65A 4WKYA 1YJNS 2Z0GA 4JI0J 1U25A 2PD1A 2GVDB 3VVTA 4O3QA 3HM9A 4IR1A 1YX2A 2DISA 2Z2YB 2R9LA 4IDKB 4F7VA 4LT6A 1HARA 2ZVIA 2AJ2A 2VFTA 4U67Q 1IR1A 1H7XA 2C3UA 3QLHA 1ZPWX 2LEAA 4N8NA 2LP4A 4E98A 3M9MB 1FDNA 5AE3A 1K1SA 2AYBA 4U95A 2UUTA 4Y3CA 2ZH5A 3IMQJ 3EGNA 4EYHB 3PX0A 1FEEA 1S4EA 2GC8A 2VQFJ 3T1YJ 3NNAA 4USIA 3VR1A 3PYFA 1S5ZA 4KT0C 4EZ9A 1RACB 4U6PA 1WJ9A 4BWJA 4CNZA 5JUMA 2OMOA 3C6TA 2R2TA 1UVMA 2ZOFA 1LW0A 1HHTP 4FNHA 1WHVA 2BW2A 2V2QA 3PNIA 2BMBA 4DX8H 3HHLD 1FEHA 3FQKA 1QDUB 4FYVB 4ZPVR 3TARA 1NKCA 2MMYA 3K0JA 3NMRA 2Z8QA 4O3NA 4Y0FA 1MU2A 4NLOA 1RA7A 1O5JA 2YNGB 3F73A 2IBKA 1G2EA 5KG6A 4NA2A 4J7CA 2DGVA 4LRCA 2VZ9A 2O66A 4R25A 1TKZA 4FS1A 1SJFA 4NZ7A 2C42A 2YNIA 3VVUA 3NCRA 5LXRA 4ZVSB 3RB3A 1HMVA 1UJ4A 2OEKA 4K4ZA 4CM0A 2RU9A 4ED1A 4ES1A 4ZVUB 3EZUA 2D68A 1FNXH 2AX0A 2K7JA 3K8VA 2BR0A 1RHRB 2BBEA 3KHGA 5J2MA 3DGPB 2I2YA 2BX6A 2OP5A 3BGLA 2C3PA 3CE8A 3M8YA 1D8YA 2CZ4A 2A10A 2GAGC 2H9ZA 3MAQA 2ROEA 3FKBA 4RNHA 3HP6A 2EFPA 3AD7C 1QE1A 5ADZA 5ETLA 3RB6A 3DYAA 2E5IA 1SL0A 2D3O1 1O51A 2FUG9 1Z1ZA 3EVOA 3RAXA 1S4FA 1VRQC 2BANB 2ASJA 2LEPA 5KFOA 3I5BA 5KFJA 2VV5A 5CYQB 4PZVA 4URQU 3BGOP 4ANCA 2OPRB 2KYXA 2OPPA 3ET6B 2RRAA 1HQEB 4QYZK 3POTB 3MF5A 4J91A 1N34F 3W5YA 3OL8A 3UNGC 1HBMB 3TA0A 3NGRA 4JI1F 2RILA 4ZVEA 4DPYA 4XO0A 4CT8A 4MK7A 3M8PB 1VBXA 3F56A 1AUSL 3GONA 1HPZA 2C3YA 2CQ4A 3KKFA 1VQ9S 3JQJA 4LMZA 5HJXA 3J7ZT 4XIUA 2F9DA 3NY0A 3AWRA 3TZZA 2DNKA 2PI5A 2GZOA 4QWCA 4P10A 2QTWA 1U47A 1XR6A 2BKOA 2R8KA 2OD4A 3DLHA 2NZ4A 4OYIA 1SJ3P 4K7QA 1GH8A 3SQGB 3BJYA 2VKRA 4P52A 4YR3A 2G1HA 1M5PC 2FVCA 2UXCF 1TUVA 2POKA 2ZBIA 1QVFR 2XS2A 4P7VA 4Y2MA 5KT7A 4ELTA 2X51A 3M2RA 2ZKTA 3K59A 2LQ9A 2NREA 2F1FA 2YH0A 2J7UA 2KT2A 3GCWP 3BV8A 1NKBA 1EZZB 2J9CA 1DLOA 3BGFA 4ICLA 1N5YB 2XMVA 3HJVA 4OI4A 2WVFA 1VOMA 2CDQA 5LMUJ 4PWUA 1OPZA 2VA3A 4QIEA 2HMIB 2ZZNA 3GE9A 2IRXA 3R5AA 2GMHA 1FWLA 4K0KJ 2UXBF 1M0SA 4F4AA 2N7CA 4BHQA 2ZC3A 1H0HB 1Y5LB 1F9FA 1VK8A 3M2VB 4GO5X 2V1SA 4HACB 1SJRA 3JYTA 4DS5A 2EI5A 3MM5A 2VDHA 5IV3A 4I2QB 1P9QC 1VQLS 3MAHA 1NNDA 1PSDA 2D69A 2GW8A 2AGPA 1C1BB 2H48B 3SQGA 4X4UA 4O4GB 4C98A 2KG1A 2IA0A 4LF4F 3HVTB 2FJBB 2OSQA 2BE7D 2YBVA 1PAUB 4FYYB 2C2RA 4MAKA 2JOQA 4PCQA 5LM7E 4CCHA 2GQQA 4GVBB 1Y4ZB 3RAQA 2Q6BA 1NK0A 1L3TA 1DQ8A 2MB0B 4IR9A 2QLBB 2HLUA 1KTVA 2EFNA 4KGKA 4N8OA 3OVBA 2H4YB 3M8PA 4NA1A 4KRWA 5HL7Q 3D4JA 2GQ2A 3LW5C 4H4MB 3IO1A 1MN9A 1FKPB 3I4HX 1UFKA 2HKEA 2W9CB 1ZTWA 4ZVTB 4USMA 2W4PA 1NZ8A 2W8LA 2EK6A 2WCXA 2DGXA 2M52A 3V2UC 4QU6A 3POTA 1K8AT 2MY7A 2AEFA 1HL6A 3MTJA 2DR8A 4LF9F 5ETPA 1VC6A 2FLOA 2F7VA 2KL8A 2G4BA 5CABA 3VAGA 2MZSA 2AGOA 2QEXS 2ZH3A 3TX8A 4C3LA 4DR2J 1LK7A 4LSLB 2YX7A 2I6WA 5E2QA 4U7CA 1S0MA 1N5VA 2MQMA 4YB6A 3JQMA 3QYYA 4BCAA 1UPPA 1F2HA 3DYAB 4X4PA 3LALA 3DLGA 2LMIA 1BQNB 2XI2A 2DT9A 2CPJA 2AP6A 2VL1A 2JFDA 3C15A 3TOQA 2AHOB 1K0TA 1WNEA 1RGVA 3K17A 3MAAA 2C3OA 2NPFA 3I5CA 1N54B 4X66J 2ZBCA 2DGTA 1WOOA 3GTYX 3M6WA 4DUTA 3O3LA 3MMJA 1RCXB 4C6AA 4FXVA 3Q8QB 4F50A 4TLRA 3KK1B 4NOHA 3D3BJ 3VALA 3QIPA 1F3FA 1Y10A 3P5TL 3M8WA 3C15B 5ETQA 4B9LA 1HNZJ 2CPIA 3FDSA 5CD4H 1RT3B 2V8PA 3LGNA 3P5BP 4YHHF 1ZZNA 4NXMF 1T05A 3ILJA 3CGIA 1T9UA 2E5LJ 2BJDA 3JSYA 1CG2A 4PQUA 2X3GA 3VQSA 2R2SA 2CJYB 2E7VA 2YQ1A 2XC9A 1U2FA 4L6V3 2DIUA 1T3NA 1JQGA 1NHVA 2BRLA 2RKIA 1CJVA 5BYRA 4OX9F 5KFVA 3ZZTA 4YDDB 1WEZA 3EM1A 5IWAJ 1GXUA 4Y6IA 1OY9A 3B78A 2VBZA 2HNZB 4WXOA 1RWXB 3MM9B 3BSAA 4RWWA 1VRUB 1N36F 4N7TA 2QA1A 2HEKA 1TAQA 3UN3A 5DS7A 1XR5A 2G0IA 1ITPA 3K89A 4K5SA 4ZLJA 3CCUS 5JVHQ 1VQSA 4ZIWA 2D3UA 2W01A 3W7BA 3T5KA 1HBNA 5F8GA 2ATCB 5U47A 3CWJA 4LF6J 2AF6A 3TUJC 1C0TB 2DH9A 2HFZA 2M70A 3R2CJ 4XDCA 2AYEA 5IQ6A 2KKHA 2AIRB 3UDCA 1S1UB 2DHHA 2FZCB 4ED4A 1C2PA 4DQPA 4LFBF 4FP9A 3QSYB 2MZQA 4IDKA 3CULA 1GT8A 4OJ3A 1S1VB 3CCJS 3N79A 4F3MA 1RCOB 3BGRB 1X4EA 4ED7A 4WP8A 4JI3J 2DY1A 1C4CA 1FKOA 1AYEA 3BKTA 3C6UA 2G0CA 1S6PA 3UD3P 4USHA 3TI0A 2XULA 2QFJA 2VG5B 1RT1A 1VIXA 2DNZA 2P9GA 1ZAXA 5HLFA 3SBMA 3MR5A 1VQPS 2U2FA 2XHCA 4FXDA 1KRPA 2MHNA 4OLPA 3BREA 1UZHA 2UZAA 1OYEA 2AT1B 2ZC4A 3PRVA 4WFXA 5K8NA 4DV1J 1FWPA 5E3RA 4C11A 4C48A 4ILMA 3IBFB 3DRSA 4Y2AA 4CH7A 2KT5A 5EWGA 3I31A 3IBCB 4ZIVA 1L3VA 3CO9A 4X84A 5DDQC 2B4OA 2R8JA 2MLXA 2GMJA 2DNPA 4HTJA 4OX6A 5FDLA 3UD5A 1H73A 4OV6A 3W8GA 5DG9A 4O3PA 4H4KA 4CH1A 4QWAA 2HHWA 1AFIA 4F4WA 3THTA 2DJWA 3ZZPA 2CWXA 3CMES 4JP8A 2F8HA 1UA1A 4QWDA 1L3UA 2PT0A 4EU0A 2VF3A 2F8EX 2FQQB 2V8DA 3GYNA 1NJZA 1IM6A 1M5KC 8AT1B 2DXDA 4DV2J 2XYHB 3H8YA 3M05A 4Y2KA 2KTQA 4M5DA 5ETKA 2OEMA 2OI2A 1BLUA 2NUHA 2V2KA 3FZBA 4PEOA 2EFGA 1HNIA 2FVRA 2CQCA 1X4FA 2G9OA 3A8IA 2KN4A 3C19A 1RLCL 2O67A 2D9PA 5E3CA 4H4OB 1VLYA 3D1OA 3KMSA 1R3NA 3FK4A 4J9VA 3S1TA 4F67A 3QZ8A 1Y11A 2BANA 4S0MA 3OHAA 5AXNA 1YIJS 1JLEA 4R0JA 1IKXB 3T9NA 1EX8A 3QAEA 1RWVB 4OHVA 5KFEA 1KNZA 1JLFB 5H1SV 5GAGU 2JH3A 3DHXA 1IKVB 3UQSA 3SCIE 2PEHA 3D9BA 2MJNA 2VH7A 1KEKA 2RF2B 2R2UA 3KFWX 4LFAJ 3NBPB 3SQOP 2IJRA 4MYUA 3AQOA 4V1Ak 2YKAA 1PC4A 4OJ1A 3G86A 3R6GB 4RPFA 1Q8BA 2G2OA 4WP9A 4JI2F 5C25A 3SV3A 3VF0B 4FS2A 4E0DA 3IG1B 3HD1A 1HWIA 3A1YG 3TZYA 2O3DA 4RBTA 3PW7A 3PRDA 1RTDA 4NLVA 1DAXA 1HMVB 2DEIA 5KT5A 1FRIA 4O44A 4F0KA 3OTOF 1X4BA 3MPYA 1RI7A 1K1QA 1IJEB 4IUFA 3OR1A 1C4AA 5CH7B 3QRPA 3NL0A 2J0XA 4OYOA 2FLNA 2J0QD 2V0NA 3MEGB 3ENWA 3PG9A 1P1LA 2YNGA 3OJSA 4DV4F 5D3GB 1PYSB 3H5UA 5F41A 1FNMA 3HVAA 5DGBA 3H2VE 2HZCA 3A8EA 4IG0A 1J5EF 5IT0A 1D8ZA 2CPYA 3D66A 4IH5A 5LJ5Y 1Y3JA 2B7CB 4YFUA 5H9EK 2Q66A 2QX0A 3AHPA 2Z2ZA 3N5BA 4DR3J 4M5LA 3TQEA 1B0PA 5B0EA 2KH9A 3FSIA 3J81Y 3DI6B 2W7PA 2MLZA 4RW6B 3QBCA 2ATLA 3MMCB 4IOAQ 3N9UC 4H4KC 3K57A 2JVOA 2G1DA 3SDEB 3CW2C 3Q86A 2NS1B 1AUDA 5EHHA 3J81j 3CDUA 2JFKA 1X4CA 2B51A 2K1RB 4OYPA 2UVWA 2FHKA 2J7WA 2V9KA 4JYAJ 3TAPA 4MKBA 4M5NA 3WC2A 4BC9A 1HNWF 2HS0A 3DMJB 5ETSA 1JXLA 2VPWB 4FXWA 4B9MA 2GIRA 2ZBRA 3IAM9 1IBKJ 1HNWJ 1Q8IA 4DX7A 2RRBA 2CQIA 1EP4B 4USKA 2VASA 3TWZA 1LFWA 2ZUGA 4WCEQ 3DM2A 4LRFA 2XMTA 4TY8B 1VISA 5J1EA 2VPYB 5KFNA 3CCMS 2W9BB 3EGZA 1AZSB 2EVZA 3TYTA 2K3IA 2QL5B 3U27A 2GA7A 2IMOA 2PC6A 4PXBA 3JXOA 1FD8A 1ZM3A 3H59A 3CJKB 1U1LA 4B3OB 1TKXB 1CULA 2E44A 4USUA 4DR3F 2HQDA 1NM2A 2C2EA 1FJGF 1RZMA 4DU7A 3N6LA 3KMQA 4F02A 3P8BB 2B5JB 1FNOA 1RQ0A 4ZJLA 1QY7A 2RVJA 2ZJPQ 1X9WA 4DN9A 2LDIA 3BSOA 1G7CB 4RNOA 7AT1B 3OL7A 3MWBA 1KFSA 4ED5A 2ZH8A 1N88A 2XEXA 4IFVB 4QIVA 4DJBA 1DHMA 2FC9A 3MOZA 5BXIA 2Z4PA 3AB4B 1PILA 3FBBA 1Y9OA 2NYIA 1SC1B 2RQ4A 4I4BA 4MIAA 5B09A 3SCLE 2KI2A 3X3UA 2CG4A 2HWHA 3OFEA 3TAQA 4RW8B 2HQGA 2L48A 5AJ3F 4ECYA 1SB6A 4NCBA 4LF4J 2Y8WA 1RU2A 2W2QP 4PWDB 2NR0A 1VS3A 4KY3A 3BBCA 3UVJB 6FDRA 2V5HG 2XCAA 3HHDA 3HMJG 4LSZB 2VU5A 3CJ2A 3QJPA 2CA9A 2M0GB 4Q8EA 1HBOA 2PFFB 2Z2LA 4N47A 4ECVA 5ETNA 4KR0B 4R5PB 1U6FA 1WSVA 2OIHA 1N32J 4JV5F 3HVWA 1NK8A 1PJ6A 2H5JB 1X0PA 1XERA 5DZ7A 2PMZD 4ED3A 1RDRA 1V5VA 3OUYA 3BO3A 3X1LB 1R0CB 2QGFB 4K0KF 4QPTA 1MN7A 1M90T 2MKYA 1NDLA 4K4XA 1NSQA 5L9NA 1YSJA 5D78A 3CPWR 2XWYA 3OTDA 5EGYA 3OLAA 1BY9A 2ZZMA 1IR0A 4R5PA 2YPYA 4F8RA 3R9LA 1IXKA 4X4SA 1WHXA 4DN0A 1WF0A 2Q1LA 3CCZA 3M30B 3QRRA 1JLBB 3MD3A 3NOCA 2KXHA 3QATA 4NX9A 3HZEA 4EK2A 3LANA 4ER8A 1S49A 4ECXA 3VAKA 1SQEA 4MTPA 7FDRA 4ZP8A 1SUQA 5DO2A 3GR0A 4WFZA 2GNKA 4DWIA 3D0GE 3B54A 4IO1A 1W7WA 3V6DB 1EIYB 4UOFA 1A6LA 1LW2B 3DOLA 4KTQA 2O1PA 4HHJA 5L1JA 3ZTQA 2V50A 2DKOB 2NXJA 4RJVA 4LQ9A 5A8WB 4G1QB 2QYCA 3OJUA 1FJGJ 5AXKA 2NXNA 3A13A 1RWOB 3FSYA 2CVIA 3S6EA 1RAHB 3E8OA 4QIWD 1F60B 3BKFA 4KHMA 1M5HA 2DNGA 4DL0C 4UQGA 2ZJQQ 1P1TA 5KFYA 3LP1B 4DSEA 4O3SA 4QIFA 4ZHRA 1TKXA 1CSJA 4B9NA 5D4PA 2GFFA 4EBDA 3PZPA 4L73A 1L3SA 1VHFA 2R7OA 1XQIA 3S7RA 3QQCD 1URRA 4MKAA 2RNEA 2IYIA 5L1LA 3RBEA 1VQ7S 4IRDA 1H2UX 2P5VA 1SKUB 3NCQA 2W2OP 1JK9B 1WOPA 1S6OA 2Z2MA 4CO1A 2VG6B 1T7PA 1DFDA 3QGHA 2DNNA 4NLWA 4K4VA 3NWGA 3AT1B 2MHEA 3CSKA 3G4SS 3T9ZA 3CDBA 2KO1A 4MFBB 1CC7A 1R8CA 2HWIA 2LU2A 2PMWA 3GYGA 4FYWB 3VAHA 1RWKB 4PXEA 5D77A 3MTKA 4NEZA 4TYBA 2HIQA 4DQRA 4KC5A 1K44A 4Q2LA 1U4BA 2AMCB 4PUOB 4DR6J 1LV5A 3BZQA 3BR9A 3CD7A 3LP1A 3S01A 1Q81T 1RB0A 2ZH4A 1LK5A 3MM8B 3TA1A 3SDEA 1H2TZ 1T9TA 4PABA 3GFYA 4XDDA 4I1TA 1IN0A 1TL1A 2K7KA 7FD1A 4XPEA 1AB8A 1XMQF 1TK8A 4YMEA 1LWXA 2FJDB 2QSWA 4PG5A 2HBQB 4ZJOA 3KHHA 3K2YA 5KFQA 3CJSA 3Q0AA 1S12A 4O4RA 2WBMA 1S59A 1KBRA 1W2IA 3DLKA 1TL3B 1UEKA 2B4PA 1XTZA 2RSQA 3M6UA 4C3KA 4DS4A 2UUCJ 2YNHB 3CXCR 1HNXJ 3LWMA 5DQGA 1RT5B 1SPBP 4RW9A 1J5OB 4IG0B 2QZ8A 2DXEA 3CEDA 1TL5A 1GMWA 5KFIA 4KV8B 1WG4A 4A47A 3CNQP 4GC6A 3OR1B 1R89A 3PHEA 4NYPA 3H42A 3DRPA 4ECRA 3BH7B 2MZJA 1RT2B 2CZVC 2YKNB 4WP3A 3SSRA 4OIXA 4TLQA 1S99A 5KFUA 2NPIA 2AZ3A 2OTLS 4JI2J 4KIAA 3NG8A 2BW7A 3HSZA 3H4BA 5DQHA 4WFYA 4K4WA 3DN9A 4KO0B 3CD6S 3CDAA 2PSZA 1RT6B 5J2NA 3G6YA 1DARA 2KU7A 5LL6d 4ZP9A 4A8XA 3ZZUA 4I7FA 4F2SA 1NDPA 1JLGA 4LSNA 1HBOB 4PKDB 3N6NA 4M5IA 3SFGA 5KFGA 3PR5B 4ECZA 1YQHA 3NS5A 1HLWA 3BB5A 4LSNB 4U8VA 1U6BA 3BBFA 3LP2A 1KVJA 2RDJA 1T11A 5KTQA 4OZ1A 4HLBA 1TV6A 1U1RA 2E7XA 3G8TA 2EG2A 4KQZA 5J2NB 5B0AA 1UW4A 5T41A 4ES3A 1Q78A 3QRQA 2IC3B 2CQPA 1ROFA 1Y7PA 2I38A 2V94A 3UDLA 4HEA9 4ZJQA 1Q7YT 4X4VA 3ICLA 3G2XA 1FDAA 3PFOA 3Q8SB 4JI5J 4ERDA 1N8RT 2FTRA 1RT2A 3W9IA 1NK9A 2P6SA 4LF7F 4P2XA 3BN4A 4UZBA 2F3JA 4DSFA 2JVRA 1MG7A 2IDLA 2QSFA 3NGSA 1FK9B 1FRHA 2XMWA 5KFRA 3PJWA 3PYEA 2CKWA 3CMAS 3NOGA 3PACA 3SCJE 4AUKA 3BO2A 4OV1A 1TELA 2C2NA 4FZVA 4EYIB 2W7AA 4F3OA 3I96A 4B9UA 2ZUAA 2AX1A 2ROPA 2V8HA 3HKWA 2DNYA 4NCGA 4R0EA 2W9BA 2B8PA 2HHHJ 5KFZA 5C42A 2LXUA 4LF1A 1S48A 2D3OR 2WAQD 3T6BA 2XLKA 3DM2B 3OHBA 5HQ8A 4CNYA 4FF2A 4K4UA 1EARA 4JI6J 1VRTB 4I56A 4I2PA 3VZIA 3ZTPA 4K8RA 3VAJA 2F65A 4NL5A 1OY6A 1KOOA 2NXEA 1TP7A 3ZTOA 3DOKA 5L39A 2D41A 3OW2R 4LUBA 3LH2S 1IR2A 5KFLA 3DGVA 4J9OA 3DXBA 1R0AA 1DTTB 2L9DA 2YWEA 3GG1A 5THWA 5KFMA 3K5OA 1Y5IB 4CYUA 5GAEU 3FEYB 3MD1A 2QIFA 2CG8A 5IQQA 4LF8F 1QSYA 4F4XA 4NLTA 3UI3A 1XNRJ 4P74A 1YRTA 3HSDA 1U8WA 4OI6A 3TR5A 2CQ0A 3JB9k 1OS5A 2QN6B 3GV7B 5HSPA 3GIMA 1S1UA 3M2UA 2QG9B 3CMQA 3DU6A 5FLXU 2K3KA 3HD2A 4TYAA 3NKYA 1JLCB 3DRYA 3OTEA 4O23A 4NXNF 4FNIA 3RBDA 3TZXA 1RXOB 1NHUA 3BSCA 1CQMA 3IRWP 3K5LA 1XNQF 1S1TA 2E1PA 3ZFVA 4ZHRB 1NSAA 2RHSB 2RDIA 4MYTA 3MEGA 4OZ0A 4WU3A 1U1QA 3M8QB 5ITHA 4UUWA 3C16A 4M63A 4DF8A 3LGMA 4DR7F 4GKJJ 1RWPB 4ATNA 2YKPA 3VTIA 2XTDA 2P6TA 2PGCA 1SI9A 3TUPA 4X2BA 1J27A 4DOZA 2QT7A 5I3UA 1SKRA 1U26A 2OEJA 1VQ5S 1RYSA 1DURA 2VBXA 3ONQA 4HHUA 1X9SA 3M8ZA 2VQEF 1NPKA 2YQ3A 4I6AA 1CJVB 4CLUA 1CJTA 4DFJA 4NLRA 1KDNA 3RRHA 4JI1J 2GHWA 4JI4J 2CQ3A 1RTHB 2WB4A 2V63A 4LIRA 1UMJA 3D1QA 1JLBA 3K8WA 3BO4A 1LXNA 1Q7LB 5D15A 2BQ3A 5A0YA 1IVZA 3JSMA 4QBUA 2QMUB 2IAJB 1F5CA 3H2UB 1FXLA 1NSPA 2IVFB 2CJQA 4WZQA 4H4OA 4EGLA 4B3RF 1F9HA 5LMNF 4QW8A 1UAWA 5HROA 3RZAA 1HNIB 3CUNA 2RMLA 4RU9A 4QW9A 5CZXA 3HSGA 1IKWB 1E6VB 3LAMA 4CLYA 3C66A 2MY8A 5B7WA 4O3RA 1FKAF 2Q43A 4KFBA 3ITHA 5IXUA 2MQQA 3JSBA 3Q8PB 2FY1A 3P45B 1ZM4A 4QWBA 3HVRA 3PCOB 1KC8T 3IR6B 4UTGA 4CLZA 3L7OA 4B3SJ 1SC3B 4OJGA 4QZVB 1U09A 4F4KA 1E6YA 2LQBA 1UL3A 1SIZA 4DPWA 2BJ9A 3HFZB 4ZLNA 2HBYB 1U45A 1X7VA 4OHZA 3JTOA 2ERRA 2FHJA 2E1RA 1S7HA 2N4CA 5FDLB 3TZWA 1S77D 3E51A 2CDRB 1RABB 1UTAA 4AL5A 2UUBF 1TKDA 1FJ7A 2IIHA 2MZRA 3I9V9 4WIIA 1S76D 3QJLA 5F8JA 2AEMA 2VB6A 1FKPA 2M8HA 3CDWA 1YVFA 2AJ0A 3DXSX 4WK1A 2FB0A 3HKZD 2R2RA 4ZP6A 4A8FA 2UXDF 1O0PA 1NK5A 1VC0A 1NRKA 3NWRA 2AEJA 4MKYA 1YJVA 2MKHA 2ASDA 2AJFE 2E1MC 5C2GA 3PXGa 5HI7A 5HO4A 5I3PA 4G3IA 5G0RB 3I56S 3OSPA 2F5GA 2IVMA 4M5KA 4ZK7M 4MIBA 1JIHA 3CCRS 1U1NA 4DQIA 4A8SA 1M1HA 2JDJA 2OO4A 3OVAA 1XMOF 1UPMB 2FHOB 2NZCA 3ZZOA 1VBYA 4WZMA 2DNOA 2CIMA 5ETOA 3IBWA 5CCMA 5SZTA 2AGQA 4EMDA 2DGQA 1HI8A 3HLUA 5K9FA 4RBVA 3TJ9A 1URNA 3RYLA 1U1OA 4TY8A 2NUUG 1HKAA 4NLUA 5IT4A 2GIFA 4LFCJ 1AT1B 3SI8A 1T9VA 3NNHA 2VC1A 1EP4A 3FC9A 3QO9B 4AXJA 3JYTB 1R8AA 1PYTA 5CYJA 1KSPA 1N33J 1MWQA 1FXDA 1RYRA 1BD6A 1FX4A 2XBPA 3VWSA 1RHQB 3M32B 1SC4B 5GADU 2J0WA 1D09B 1IKYB 1K73T 3PJ9A 2K8GA 4IQXA 2AW0A 2UP1A 2X1GA 4W98A 4ZS6A 2OGUA 4OYZA 1NDKA 2B9WA 2FIUA 2PIIA 4ZVPB 2R7SA 4C9DA 1XIQA 3DI6A 3M6VA 1T94A 1ZM2A 2X7IA 4YEAA 4CIOA 3KLGB 3FMWA 4DI6A 2JRSA 3M4XA 1RA6A 2VG7A 3FSXA 4LRBA 4U96A 4EO6A 2BOPA 1N0VC 1NJIT 3OXFA 1JJ2R 3D1HA 2KM8C 3J81U 3DDIA 3KJQB 4RZRA 1RBOB 2ZE2A 4U8YA 2DGWA 1RAAB 4JB8B 4F4YA 4OI3A 1MWYA 4QCLA 1JKHB 1RT3A 5LOQA 2KG0A 4TKTA 2RD5C 4LR7A 4AL6A 1IQZA 5K8MA 1N34J 2QMWA 3ITHB 3H4DA 1BXNA 1FFWB 3OPKA 3PYGA 3CDEA 4LRDA 4CO4A 4X4NA 4TXSA 4A8OA 2QA2A 3UN2A 3KJNB 4ZPCA 5E3AA 2RIJA 3KK1A 4X4RA 4FVMA 1MSWD 2M88A 4L75A 2DITA 4P71A 4M95A 2HHXA 2IFXA 3UCUP 3SMZA 3U1NA 4KPYA 3NBPA 4RO0A 3MAAB 5HANA 1GK8A 1NBEB 3FCHA 3T1HF 5J2PA 2VODA 2VFSA 1IKVA 1V9OA 4ZCMA 4FPRA 4O0IA 4DLGA 4B9SA 2B43A 3BKUA 3A3NB 3CC2S 2M7SA 3VAMA 1UKUA 3QJJA 1PBUA 2CFXA 2CJBA 3FBEA 3PHTA 4LSLA 1UVLA 1G4CA 2HGNA 2HBRB 4M8LA 2HHUA 1RTHA 2AKWB 3BDEA 2B4UA 2ALYB 2AYMA 4MK9A 2HPUA 3DGPA 4LF6F 1VQYA 2ZFHA 1R8HA 4BDPA 2V8GA 2UUWA 5B0FA 5C2CA 2AJ1A 1VHIA 2X1BA 3ISND 1AA1B 2HFVA 1RT7A 5I3UB 4PG7A 3L95X 1VQKS 1TK5A 3MOJB 2FDNA 3R7NB 4K4YA 3HHLB 3GFZA 4OYBA 1QAJA 4ZVQB 3OTBA 2G0JA 4L72B 1NU4A 4X4TA 5K14A 4EZ6A 3M8QA 3PKMA 9RUBA 3PX6A 4WKRA 4GVBA 2BRKA 1F3VA 3AFGA 4WXWA 5FLXY 2ZE2B 2CQ2A 5KG3A 1EJ7L 3FBFA 4X62J 2L08A 3D54A 5HBMA 4ID5B 3GFHA 1WG5A 1N5QA 3BQ1A 1JLCA 1UJ5A 5DRKA 5FJ4A 2DIVA 2VG7B 4PG8A 2CXEA 2HNYB 3WX4A 2C2MB 2XY7A 3TEGA 1NK4A 4NLPA 4DFMA 3GCXP 2MQNA 1HNZF 2GJ2A 1U6ZA 2ZKUA 3GG0A 2HVHA 2RS8A 1ZAWA 1ZZFA 5F8LA 2PE8A 3CCTA 2DRBA 1KN6A 2ZHOA 2WSFC 3M2VA 1H2VZ 1K47A 4F26A 4ID8A 3OV7A 2DPIA 1TQLA 4EBCA 2HAFA 2X1FA 2AD9A 1RT4B 2FLPA 1RT1B 2M3DA 2VG5A 1I1GA 3PW0A 4Y2IA 2O5DA 3NAIA 3HF5A 3RU0A 4CO0A 1WKKA 2YX1A 2J7KA 2PFDA 3M32A 2HVEA 1HD0A 2LQJA 2XTJP 3RGIA 1IBMF 5IT9Y 2VFVA 2MKIA 4LBPA 1RWUA 2G2YA 2XLIA 3QO9A 5KG7A 1HHSA 3I55S 4BC7A 3KUGA 4CZCA 5E41A 1XWLA 2DBBA 1YK9A 2IJNA 5IC4B 5J2QA 1RU1A 1S1VA 2GVDA 4DR2F 3IS9A 3Q2TC 2H51B 2HLTA 2XCPA 1UCNA 2KM8B 2R8IA 3D6FB 1FX2A 4DV6F 1TVRA 4FKXA 5GAHI 4DL7A 3G6XA 4RU2A 1PKUA 2MJUA 4HH1A 3N6MA 3TJ8A 3WHIA 5HBMB 3Q24A 2W2NP 2YKQA 1ZA1B 3MFIA 2RE1A 5G0RA 3VZHA 2EPIA 3PVXA 2RS2A 5HP1B 3TO8A 1FRMA 2G2ZA 3W2VB 2WONB 3SV4A 1RBLA 1WSRA 3H40A 1RK8A 4G1PA 3HHLA 3C46A 5F8MA 3OL6A 1GQEA 5CAAA 1CLFA 1I94J 3KJVA 3OR2A 4CLTA 3PW5A 2V67A 2HFNA 4ZCLA 1UZDA 1HQUB 3EXYA 3PM9A 1TL7A 4CTAB 5DG7A 2J6SA 2OPPB 3ET6A 3FGVA 5C24B 2OPRA 4YB1P 1FRLA 1PJ7A 2HS3A 1X5OA 3IC1A 3VV2B 1XNQJ 4UT4A 4UOGA 1QAYA 1YJ7A 4YY3F 1Q16B 3G71S 5F8NA 4JBCA 2XM3A 2ZM6J 4OJHA 2DH8A 2HWTA 4TY9A 2MQOA 3H98A 3G96A 5KFXA 3C3LA 2JC0A 3V6KA 1XNRF 1LWEB 1S1XB 3QNWB 4QPXA 1EQ0A 1Q82T 2XNRA 2J76E 3W2WB 1Q0NA 2GCFA 4TU7A 2AU0A 1ELOA 1PAEX 1VR6A 2A2CA 5J2MB 5KG1A 4Q5VA 1JLAB 4XK8C 3I4PA 4LREA 2W25A 2ZH7A 2Y1IA 2CPZA 2J6TA 4LJMA 4PR6A 3FEXB 1ZBTA 3LGHA 4YY3J 4C8ZA 1Q8KA 2BKPA 3DFEA 3SSSA 1U1MA 4CH0S 4UOHA 2JEFA 5F0WA 5IS2A 2BZ2A 2YNIB 2SXLA 4USJC 4I68A 3JSMB 4ZVGA 1FE0A 3QT7A 1JKHA 5A0YB 3HJFA 1JXEA 3MUTP 4DV7J 3EPIA 4J9NA 1MU2B 4RKUC 4A4JA 1M1GA 1ICEB 2JZ5A 5L38A 1RT5A 4IQMA 4DEZA 2LQ5A 1R6YA 2MKCA 3JSRA 3MEDA 2YNHA 1NH8A 2ZH6A 2EFQA 1U7LA 5HAOA 3PEJA 5DETA 2FLLA 1VIOA 3GR1A 1LWFB 1UETA 2XZDB 3TRGA 5LSRA 5A6PA 2DNHA 4N5SA 3QMQA 4W92B 3DDNA 1U1KA 1RAFB 4WE1B 4YP3A 2DB1A 1QAXA 2Q3PA 5F3TA 2YPZA 2JX2A 1KOHA 2HK2A 3MM8A 5CQGA 4Q45A 1RAEB 4QQBA 2E7WA 1B4SA 5KFHA 1X4DA 2L3MA 1S1TB 2C1EB 3M8RA 2MKJA 4ZOSA 2ASYA 1Q86T 5HQLA 2QA4S 4FYDA 1HI1A 4FPIA 2F4VJ
chains in the Genus database with same CATH topology
3J7YU 3MZIA 1C1BA 1W25A 4DG1A 1S0VA 3R5CA 3HK2A 3TW0A 4MFBA 5KOWA 4JV1A 1WHYA 1Y5NB 2LEBA 1LWCB 1SV5B 3H20A 2E1CA 5EN1A 1Y3KA 2BJEA 1R31A 3AY0A 4Q0BB 2ZOGA 1YBAA 1SKWA 1GX6A 2KT3A 3HFKA 3QIDA 2IBOA 3CC7S 1N52B 5EWFA 1FRJA 2QO3A 1SBRA 2MPUA 4AE5A 2I8EA 1REVA 2J9DE 2A3JA 4G1QA 1SL2A 2LXIA 1NO8A 2CQ1A 3GV8B 4NCGB 4UW2A 2PA3A 4LVOP 3IAS9 4ZA1A 2D3ZA 3FVYA 2D74B 4NPOA 1R27B 2EBEA 3LAKA 3D5MA 3V6DA 3DRXA 2CPHA 4ZPDA 3Q22A 5H9FJ 5EWEA 2O01C 2FJVA 2B0GA 3HHEA 3AA8A 3KNAA 4PXDA 1S9GB 3I5AA 2CVEA 2MQPA 1G3OA 2MYFA 3R5DA 3MECB 3I0RB 3MMAB 5A2QY 4Z37A 1M5SA 3K5MA 1KQSR 5L9XA 1HPZB 4HT7A 4OZNA 3EUNA 4C0BA 5KT2A 1Q53A 4CO5A 2BM1A 4PXCA 2L9NA 2RU3A 1YHQS 5T14A 4OX8A 4P6QA 1P8GA 4ECSA 2DR7A 4ELUA 2IC3A 3TQ1A 2V4QA 2BACA 3TVYA 3BQ0A 3DHWC 2AJQA 1HQEA 1SH0A 2EW9A 3O44A 4M1KA 1RKIA 5M2RA 2EC0A 3PO4A 3T1AA 1HI0P 3BEGB 3MEEA 2BQUA 2FHMA 4QR2A 2IAJA 3QZ7A 1FD2A 3VQTA 3MCSA 5JVGQ 4J9SA 3RB4A 3UWTA 2CQGA 2H5EA 1X5PA 4KE5A 1CC8A 2V9WA 5G4DA 4HVZA 5A8RA 2FJEB 2R7WA 3TP2A 1Y0HA 5A8KB 2E66A 4QU7A 3M8SA 4EFAC 1DTQB 4Q8FA 3HPOA 3DRRB 3KTQA 5KT3A 3I32A 1TFWA 1QVGR 5D8HB 5LJ3Y 1C1CB 3J7A1 1WACA 2BUNA 2YY3A 2DCUB 1TKZB 3HI9A 4IFYA 4BWMA 1LOUA 2LA6A 1JLQA 2FC8A 3RW7A 3FEZA 5M2PA 3KLFA 1G6BA 2Y0SD 5C5JA 3I82A 2YNFB 4RWXA 4WYWA 4ZPTR 2YKMB 3OFHA 4DV7F 1QTMA 1LW0B 1S79A 2UVVA 1H3DA 3CIMA 3DLKB 1HBUB 3C6TB 4XPCA 4ED6A 1YRXA 3PDNA 5J1EB 2ILYA 5KFDA 3FJ2A 1K9MT 3KHRA 1TAUA 1OWXA 1MROA 4KBIA 1TR0A 1OQ6A 3GIIA 1FDDA 4H54A 2LVWA 1N33F 2GGPA 4J9QA 1HR0F 1R0AB 3TVZA 3FMBA 2YVSA 5B08A 2N82B 4DPOA 4K50A 2MKSA 4ILRA 2V4RA 2DGSA 3E3XA 4WTYA 1JNRB 2PN6A 3LUYA 3UW1A 2OPSA 3G9CA 2YX4A 2CPDA 3B4DA 4OHYA 1MROB 2R7QA 1F2GA 2MKKA 1N32F 1JB0C 1UVKA 5A6WA 2AWZA 1HBUA 2FD2A 1VQMS 2UU9F 3P6YC 1NJXA 2R7XA 2YKMA 2KZMA 3MFHA 1S1WA 2UV8G 5GADI 2OPQA 2XY5A 1IJFB 2LECA 2HHHF 2MDAA 4OHXA 4C8NA 5D3GA 3NRBA 1WEYA 4QIGA