4NLVA

Poliovirus polymerase - g289a/c290f loop mutant
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
461
structure length
458
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSAFSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
molecule keywords RNA-directed RNA polymerase 3D-POL
total genus 142
structure length 458
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nlvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nlvA02
3BREA 1RT3A 1TQLA 3FFIB 4ECRA 1T05B 1TL1A 1BQNB 4NLYA 4URQU 4FS2A 4OL8A 1C0UA 1N6QA 2UVRA 3DRSA 5C25B 4TLRA 4RU9A 5L1KA 4ECYA 1LWCB 3DYAA 4ZVEA 1QAIA 1JLAB 4EYHB 4Y3CA 1HARA 2R2UA 5DLGA 3PW4A 1DTQB 3KK2B 1TL3A 3KNAA 2ASJA 3HVAA 3DI6B 4WFYA 1RTJB 4H54A 4ICLA 2BQRA 4EEYA 1HYSA 3KJVA 4IFYB 2IM0A 2I5JA 4IOBA 4J9KA 1IKXA 1J5OA 3LP0A 5K14A 3NKYA 3E01A 5KT6A 1NHUA 4Q43A 4JUZA 5KFHA 4RNMA 5J2MA 1S6PB 4G1QB 2XGPA 2FVCA 5EUHA 1JX4A 4O3NA 3DDKA 1U09A 1SUQA 2VG5B 4RW7B 2W9BB 2D41A 3PW2A 3IRXA 1FK9A 4WE1A 1HMVA 3C6TB 3KLIB 1FKPB 4TQRA 3QYYA 5J2NB 2HMIA 3DOKB 5J1EB 2IC3B 5EWGA 4ED1A 3G86A 3PJWA 4I2QA 1D1UA 1JLGA 5C42A 2XC9A 2RKIA 4IDKB 3SI8A 2AQ4A 3KLEB 3CO9A 3NBPA 1LWEB 2WB4A 3IG1B 3DRRA 5KFRA 5JUMA 4YQWA 1Z4UA 4RW6B 2BE2B 3EPGA 3BQ1A 4PWDB 3UDLA 2VG7B 3TAMA 4DEZA 1FKOB 3RB3A 2BANB 4NLTA 1BQMB 2OH2A 3M8QB 3H4BA 5KFOA 3D28A 4QWEA 4NLXA 1R0AA 4WYWA 5KFTA 1KLMA 3RB0A 2ZE2A 1S1VA 2FVRA 1RT4A 4DL5A 4NLGA 4U6PA 2VG6B 2YNGA 1S1WB 5KFFA 3RAQA 4ECUA 1C1CB 4NRTA 3KHRA 3BR9A 1SH2A 3MEGA 5KFQA 3N6NA 4F4YA 4GC7A 5HP1B 2YKMA 2JEJA 3OLBA 5JXSA 3LANA 2BRKA 4MH8A 1QE1B 5DGAA 1BQMA 1EP4A 4YR3A 4KB7A 2FLPA 3NL0A 3QO9A 3TAMB 4RW8A 4RW9B 4K4WA 1S48A 4RW6A 1HQUB 3FSIA 4F50A 5KT5A 3QGIA 1JLBB 5HLFB 2C2DA 4EYIB 3DMJB 2IBKA 5C42B 5KFMA 3QLHA 5F9LA 3OSNA 2B43A 5F8LA 4IG3B 2HMIB 3H59A 2XCPA 3V81B 4RW4A 3RBDA 1IKVA 4ED8A 4TQSA 1S1XB 4EO8A 4ED2A 4ED0A 1REVB 3IGVA 1VRTB 3PR5B 4DL3A 2W9BA 5F8HA 4YR2A 2WTFA 4URSA 4PUOA 1ZETA 3CJ3A 1VRTA 2FJVA 2W9CB 4JV0A 5J2MB 1VRUB 1JXLA 4MKAA 2V4RA 4RZRA 1MMLA 1S9GB 4RUCA 1IKWB 4IFYA 3V6JA 5J2PB 3T5HA 5L1JA 4DL4A 1S9EA 1HPZB 3H5SA 1JKHA 1RT7B 5F8NA 2C28A 3TQ1A 5F9NA 1REVA 4ZPAA 2YNFA 1CSJA 4NLOA 1S1TA 2ZD1B 4ZHRA 4XPEA 4QW9A 4K4SA 3BSNA 1IKVB 4RW9A 5KG6A 4DG1B 1JLAA 3MR3A 3GQCA 4EBEA 3H40A 3DLEB 3QGGA 2XI2A 1S10A 3QLHB 3OHAA 2IMWP 2W7PA 2UVWA 3IS9B 3MEGB 3DMJA 4LQ3A 3OL7A 1TVRB 4R8UA 1C2PA 4K4ZA 3OL9A 3MF5A 3QZ7A 4J9OA 4KE5A 5C24B 1HNVB 1S1WA 2JEGA 1HQUA 4KHRA 3KK1A 2IA6A 3I0SA 4TY8B 4GC6A 3N6MA 2IJNA 3CWJA 2CKWA 1JLEA 1TKTA 2HAIA 3QO9B 4MIAA 4NLDA 3BSOA 3KLGA 2W9AA 4RNFA 4R5PA 4HKQA 1S6QA 2C22A 4ZPDA 2WRMA 4ZMMA 4JV2A 2HNYA 3JSMA 2UUWA 3H5XA 1RT2B 2UUTA 2BANA 5DG8A 3KLHB 1OS5A 4M94A 3H5YA 2D3UA 4PQUA 2BE2A 5KFKA 4PWDA 1MU2B 5KT4A 5T14A 3V6DB 1QUVA 2R2TA 2AGOA 2BRLA 5L1IA 1KLMB 4NYZA 5KT3A 3BSAA 5D3GA 4K4TA 4YR0A 4KV8A 3JYTB 4ECXA 1ZTWA 1TP7A 3KLHA 2AX0A 4ED7A 4B3OB 2R8JA 2OPPB 1IM4A 1JLFA 1T3NA 5KFAA 3RB4A 4IRKA 4IKAA 3ITHA 5KT2A 2GIRA 3QIDA 1K1SA 1SUQB 3NBPB 4RNOA 2W7OA 1T03B 3KK1B 1YVFA 5F8IA 4IDKA 3Q8RB 2OPQB 3I5CA 1C1BA 4G1QA 4NCGB 5KG1A 1SH3A 4IH7A 3NGDA 5I3UA 3MECB 1I6JA 4I2QB 5KG4A 3H98A 1IKWA 1S9GA 4I2PB 4KKOB 4LSNB 3PJXA 5CYMB 5KG2A 3KJVB 1HYSB 2J6UA 2W9CA 2ILYA 2RF2A 3EZUA 4Q8FA 2YNIA 4Y2CA 2FVSA 2J6TA 2B6AA 4I7FB 5KFWA 2W8KA 1S1TB 2ZD1A 3ISNC 3V6HA 1RT6A 1RT1A 2J6SA 4ZP6A 1LW0B 5F8JA 1HPZA 2RF2B 2D3ZA 2GIQA 3MFIA 2HNZA 1S0NA 4Q0BB 4Q0BA 4I2PA 1RTJA 4K4UA 2WCXA 4ICLB 4KKOA 2C2RA 3FFIA 1T05A 5KFXA 2R8HA 1RT6B 5KFIA 1DTQA 3E51A 3CJ5A 3OL8A 5EWFA 3KK3B 1T03A 2B6AB 4KHMA 3FDSA 4RW8B 4K50A 4O44B 4KFBA 2DPIA 4WYLA 1IKYB 3TVKA 3PW5A 3ITHB 5J2QB 2WOMB 1S1XA 2XCAA 5CYMA 4ZP9A 4RW4B 3CJ0A 1GX5A 4LSNA 4KO0A 1C0UB 4YMEA 2FLNA 4IG3A 3LAKA 4MKBA 2AGQA 4NLSA 3MECA 4XO0A 3KOAA 2HWIA 5KFNA 2ASLA 4KV8B 1C1BB 4NCGA 2OPQA 5L9XA 1S1VB 2V0NA 4J9SA 5KFBA 2UVVA 4Y2AA 2FJWA 2IM3A 2ASDA 1SH0A 2GC8A 4Q45A 1N4LA 3Q8SB 2AU0A 3M8QA 3T5KA 4KAIA 1QE1A 3CDWA 3KLFA 4Q8EA 2IM1A 4QWAA 4TN2A 1S6QB 4TYAA 4J9PA 2W8LA 5DLFA 3Q8PB 1TV6A 3M8PB 1TKTB 4FBUA 4M95A 3I0SB 4ZP8A 3I0RB 2VG6A 2YNGB 3H2LA 4R0EA 3DM2B 4PQUB 3PHEA 4MFBA 5C24A 1SV5B 3OHBA 2ZE2B 1JLGB 4TYBA 2OPSB 3M9NB 1TVRA 1RT2A 4R8UB 2IC3A 5KFGA 5DG9A 1RT5B 3GYNA 5KFDA 2WHOA 4K4VA 4ECSA 4R5PB 3C6TA 4ZVHA 4ZPCA 2WOMA 3DLEA 2ALZA 1JLEB 4WZQA 5DQGA 4O44A 2VG7A 4RW7A 4TY8A 3RAXA 1S0MA 1GX6A 4F4ZA 2QE5A 4O3RA 1K1QA 2YNHA 3T5LA 2YNFB 4ZHRB 1HNVA 1S6PA 4H4OA 2JEIA 4WZMA 1N56A 3I5BA 3LP0B 5K14B 5KFYA 3KLEA 4RNNA 1J5OB 1S9EB 4KSEB 4IFVA 4IR1A 2IJFA 2FVPA 5KFPA 5L1LA 3LP1B 5DGBA 2HNZB 5KFLA 5J1EA 2HNDB 3QZ8A 2YKNA 3BGRB 3G6VA 4NLRA 1LW0A 4QPXA 4DG1A 2BQUA 2IM2A 1HMVB 4WE1B 1JLQA 5KG5A 4LSLB 4ED3A 1JKHB 1RT7A 1RYSA 1RTHA 2R2SA 4PUOB 3MTKA 5KFJA 4ID5A 3RBEA 3V4IA 3DRSB 5C25A 4H4MB 5J2PA 2F8EX 1QAJA 3MEDB 4NLWA 3M9MB 5F8GA 1S0OA 4NRUA 2BR0A 1RTDB 1WNEA 5I3UB 2C2EA 1EETA 4J9NA 4HYKA 5KG0A 3DI6A 1JLBA 5HLFA 3C6UA 3C6UB 3KK2A 1S1UB 3D5MA 3OLAA 5DQIA 2OPPA 4ZPBA 2R8GA 1C0TA 3QIPB 2FJXA 4U7CA 1RA7A 4KBIA 5CYQB 3GIKA 4J9LA 3PR4A 5HP1A 5FDLB 2FVQA 5KFUA 1LWFB 2JLEA 1BQNA 1JIHA 4RUAA 4J9RA 1C1CA 4NZ0A 4J9MA 3KLVA 4IH5A 1XR7A 1MU2A 4LSLA 4DL2A 3V6DA 2VA2A 3OL6A 1RT4B 3BQ2A 3T5JA 4G3IA 2E9RX 4TXSA 1W25A 5HBMB 4F4XA 1NHVA 4WFXA 1RTIB 1S4FA 4MIBA 2ILZA 4NLUA 1UWBA 4LQ9A 2O5DA 2D7SA 1FKOA 4WXWA 2EC0A 3KHGA 1DLOB 4ECWA 5I42A 4H4OB 1XR6A 2ZKUA 4K4XA 4YP3A 3UPFA 1DTTA 1DTTB 1TKXB 3CDUA 2YNHB 3DRPB 3DRPA 4RNHA 3DLKA 3T19A 5EWEA 1LWEA 3LP2A 2UVUA 1R0AB 3IS9A 3M9OB 1ZTTA 2OPRA 5KFEA 2WONA 5C5JA 2WONB 1HNIA 4K4YA 4ECVA 3FQKA 5J2NA 1RA6A 1RT5A 1T94A 5DQHA 4XPCA 1TKZA 2V4QA 4JV1A 3LP2B 4QWBA 1KHWA 1SV5A 1TKXA 3LALA 1HQEA 5KT7A 2XWYA 3Q8QB 4NLQA 2AGPA 3IG1A 4ECZA 3GV8B 2R8KA 4MK9A 2RDIA 3MEEB 3HVTB 2RKIB 2JC1A 3ICLA 5KFVA 4IRCA 5FDLA 1D0EA 1LW2A 2CJQA 1RTIA 2HWHA 3V6KA 1IKXB 1FKPA 4MK8A 5KFZA 4IG0B 4ED6A 1N48A 4WFZA 1VRUA 4F4WA 1RYRA 3IRXB 1NNDA 4IRDA 2VG5A 2R2RA 4O3QA 1S1UA 5DG7A 4ECQA 1S9FA 3G6XA 3MR6A 1RAJA 1EETB 2E9TA 3GIIA 3V81A 4TY9A 2DPJA 2XI3A 5KFSA 3SFGA 5F8MA 3MEDA 3CJ2A 1JLCA 4H4MA 3IGNA 3DLGB 2RDJA 4QWCA 5J2QA 1TL1B 4O3OA 3HHKA 4QWDA 4ID5B 1TL3B 1S97A 4KFBB 4DL7A 1RTHB 2XGQA 3KK3A 2AX1A 2R8IA 3GILA 3BSCA 3H4DA 4O3SA 1JLQB 4EBCA 3FQLA 2BQ3A 1LWCA 3DYAB 5KG3A 1RTDA 4O4GB 1EP4B 3H5UA 4IG0A 3DLGA 3BGRA 1KHVA 3DOLB 4NLPA 1JLCB 1LW2B 3VQSA 2YKMB 1N6QB 3BQ0A 4Y34A 4IFVB 4DL6A 4FS1A 3V4IB 3GIMA 1RT3B 3HVTA 3MEEA 3IN5A 2V9WA 1RT1B 1HQEB 5HROB 4ZVGA 4NLVA 4QW8A 5KFCA 3CIZA 4I7FA 1S49A 1XR5A 1N5YA 1RDRA 2YNIB 3HKWA 3G6YA 3PW0A 3KHLA 2YKNB 2HNDA 3T1AA 2WK4A 3PVXA 3NMAA 3LP1A 2IAJA 4J9QA 3N6LA 3RB6A 3ISND 3MR2A 3GV7B 3KMQA 3NAIA 4Q44A 3MR5A 2B5JB 2OPSA 3GV5B 3DM2A 2VA3A 3DRRB 4FBTA 2JC0A 5KG7A 3PW7A 1DLOA 2AWZA 2JEFA 3BJYA 1TV6B 3NAHA 4IQXA 3KMSA 3MFHA 3OSPA 3EPIA 2ATLA 2B5JA 1UWBB 1TKZB 1JLFB 3DOKA 3SFUA 3KLFB 2FLLA 4IR9A 3KLIA 1HNIB 3FRZA 4ZVFA 4B3OA 2IAJB 4WXOA 4EO6A 2OPRB 3CVKA 3JYTA 1FK9B 4MFBB 3PZPA 4ZP7A 5D3GB 4ECTA 3I0RA 3DLKB 3GIJA 4O4RA 3M8PA 5EDWA 3KHHA 3QGHA 1LWFA 2I1RA 4MK7A 3CDEA 3UR0A 2E9ZA 5I42B 3I5AA 3UQSA 3E01B 4O3PA 5CYQA 4IH6A 1C0TB 2HNYB 2I5JB 3QIPA 3JSMB 4URGA 4KO0B 3CJ4A 3DOLA 3HVWA 5HBMA 3KLGB 4O4GA 1N5YB 1IKYA 2QV6A 4EBDA 4X2BA 3LAMA 5HROA
chains in the Genus database with same CATH superfamily
3LGMA 4G65A 5D0EA 3VF0B 3KFWX 2BYCA 3RRGA 1TL1A 4URQU 4IOAQ 2VPZB 4FS2A 1VQ7S 4KIAA 5DO2A 4LFCJ 1M5KC 2UVRA 3TA1A 2DIVA 3SSSA 5J1PA 5HMYA 3T1YJ 2CVEA 2G2YA 1LEOA 4DSFA 3BKFA 4TLRA 1S7IA 2HFNA 3QBCA 4ZVEA 1QAIA 1QAXA 1RWWB 2QJ3A 3PW4A 1BE4A 1DTQB 3KK2B 2DGUA 1EX8A 1NDLA 1TL3A 2H5JB 3O8WA 1JNRB 4P2SA 4U8VA 1I94F 4ENOA 1TELA 4WFYA 4ICLA 1NJXA 1U25A 2BQRA 1S79A 5HATA 3FZ2A 2C2KB 2DNNA 2RU9A 3MUVP 1B4SA 2H51B 4IOBA 3R7BB 1MWZA 3HZEA 4J9KA 1RWXB 2NXNA 3N0VA 3E01A 3PEHA 5K14A 1NHUA 4USMA 4JUZA 1VC6A 5GMKa 4RNMA 2AJQA 2XTDA 5D0GA 2PI4A 1RWUA 2KU7A 2K1RA 2COLA 5HN0A 2XGPA 1RADB 1KNZA 2NCKL 3AB4B 1U09A 4ETXA 1VIOA 1P1LA 3D67A 3PW2A 5AXLA 1HBOB 4WE1A 1GMUA 3C6TB 2KM8C 1UFLA 3HHEA 2XYHB 4K59A 2XMKA 3KLIB 2R4FA 3MM7A 2IPOB 4JI2F 3QYYA 2DGSA 3PACA 3DOKB 3DU6A 3PJWA 1D1UA 1N88A 3WX4A 2HS4A 2V63A 1RHRB 1FA0A 2BA9A 3R3TA 1ZM2A 1UPPA 1DARA 2HRUA 3CIMA 4YQWA 1B64A 1Z4UA 3R1HA 2UUAJ 4NXNJ 3BQ1A 3POTA 2G1DA 2XSJB 5LM7E 4CT8A 3K0JA 2NQPA 2EKNA 1BGXT 4PQAA 3HT3A 1U2CA 3BM7A 3RB3A 4NLTA 1BQMB 2DK2A 3M8QB 3H4BA 5KFOA 3QSYB 2G1HA 4LF6F 3D28A 1H0HB 4QWEA 4NLXA 4ELTA 2FPHX 3D6TB 4HT5A 1RCXB 3PYDA 4MMOA 4PYAA 2B4OA 2CG4A 4USWA 4USTA 4PG8A 2Y1IA 1IJFB 3DHXA 5HJXA 2IYGA 4OJ1A 1IBKF 4K5SA 4USUA 2YNGA 5KFFA 3CCLS 2E5GA 3J7Z5 1L3TA 3DN9A 2R7XA 2HHPA 1DURA 5IT9U 5D8HB 4Y2MA 4GC7A 2IDEA 2YKOA 1G6BA 3FCWA 5JXSA 3H42A 3LANA 5D0HA 1MW7A 1RAAB 1BQMA 3J7YU 4BCAA 4YR3A 2YY3A 2OD6A 1R8AA 3OR2A 4OHXA 3NMRA 4B17A 4QYRA 4M5NA 2VBZA 2J8AA 2XZWA 4NI2A 1NBEB 1KFDA 2PT0A 3A4TA 3W8PA 2C2DA 4W92B 2O3DA 4EYIB 2HS3A 3D7SB 3LGHA 4DL0C 4CP5A 3SCJE 3KXDA 4YY3J 1WSVA 2L9DA 2OFGX 4WPAA 5KFMA 2QLJB 4WFNQ 2MQQA 3CD6S 1Q8IA 2AEMA 2BJ7A 2B43A 2CQ3A 3CD7A 5DRKA 3SQOP 3OSNA 4FN5A 1XERA 3MM7B 3RBDA 2VH7A 3ETOA 2GVDA 1S12A 2OGUA 4ED0A 3GU0A 4HVZA 2W9BA 2DXFA 2WTFA 1VK8A 3PCOB 4PUOA 1ZETA 1VRTA 2FJVA 1X60A 4OYXA 2VUGA 4CLPA 2ASYA 5J2MB 4XAKA 4C8KA 3MPDA 4U95A 1Y9OA 1U24A 3V6JA 2HURA 1AFIA 1X5TA 5J2PB 3IXQA 4DL4A 4ANEA 1S9EA 2EI5A 1HPZB 3B4MA 2M70A 3SZ2A 3M2VA 1RT7B 1PYTA 1LQ9A 1S1TA 2ABYA 2W2PP 2ZD1B 4QW9A 3GQCA 3ZZRA 3BSNA 4DG1B 4RW9A 2ZH6A 4DR1J 4EBEA 2M4MA 3PNIA 1A9NB 3H40A 4DN0A 2CVIA 1X4GA 4DV2F 1S10A 3QLHB 2CA9A 2CQBA 4OZ5A 3US5A 1SQEA 2L9NA 3M6UA 3OHAA 5ETVA 1T9XA 3M6VA 2CDQA 4LR9A 3NRBA 5B09A 2C2NA 2J7WA 4LFCF 1SKUB 4F4AA 3OL9A 3ZTQA 1HNWJ 4JYAF 4KE5A 1S1WA 4M5HA 4R0JA 4A8QA 4FXDA 1F5CA 4KHRA 8RUCA 3KK1A 2IA6A 4F3QA 4LR7A 4TY8B 3N6MA 4C8MA 5LT5A 2XYPB 2CKWA 1Q79A 1WOPA 4NLDA 2V8PA 4UUWA 4M5GA 1DBDA 4CO3A 2W9AA 2K06A 1R0CB 4OZJA 4RNFA 4R5PA 1FJ7A 2MZRA 3J7YI 3E3XA 1H3DA 2RAQA 3M7VA 4OX9F 1FXRA 3UWTA 3CSKA 1RT2B 2GHVC 4UQTA 4I56A 4LF4F 1FWLA 1WACA 3H5YA 3DLLQ 1UA1A 2BE2A 5KFKA 5IXUA 5DM7Q 3MMAA 4PQUA 1TL7B 5KT4A 2LEPA 1SKWA 5DS7A 4NEZA 2XY6A 1FEEA 4ED4A 1KQFB 1FERA 2RB7A 2ZWOA 1VGYA 4QOTA 1N5VA 2W01A 4OZ2A 1WF0A 5IQQA 4KV8A 4ZJOA 2J9DE 3NS6A 4DQIA 2LDYA 4ED7A 1U0HB 1RBOB 2CXEA 4KGZB 4KC5A 1YZ7A 4ZPTR 5KFAA 1T3NA 3G8TA 3POTB 4DLEA 3ZNUA 4V19J 3IWXA 4FF1A 1WF1A 1XBWA 2LDIA 3FJ2A 3ITHA 2Y1JA 2Q6CA 4KYZA 1LFWA 2QC3A 2VF3A 4A48A 5F8IA 1T02A 4OIXA 4NCGB 3NGDA 3C16B 1H2UX 2MGZA 2RQ4A 3MECB 2RQKA 2BKPA 1U26A 3H98A 4HI2A 1WG4A 4I2QB 4WP3A 3VAHA 2W1BA 1U6BA 4I2PB 4IQMA 4LSNB 3WHIA 1KD1T 2GCFA 1PC4A 3O3LA 3PJXA 3MMJA 2J6UA 3MM8A 3UDEA 1Q8LA 4QJVA 5JJBA 5ETTA 2QMUB 5C2CA 1VQ9S 1I1GA 2XEXA 4LRAA 2WVFA 1RABB 1BC6A 1RT1A 3CCMS 4F26A 1YWXA 2XY7A 4C0HA 2YKAA 3K57A 3U02A 2WAQD 3CCZA 3MFIA 1AW0A 1RBLA 1FVSA 1ZAWA 2R8KA 4Q0BA 1BHNA 3W66A 2QFJA 4P9SA 3R5AA 3NGRA 2IMWP 4I2PA 1RTJA 2ZZTA 1O51A 3ZZOA 3FFIA 2XHCA 2NXCA 4OZ1A 5GAHU 2AW0A 5KFIA 1DTQA 3CJ5A 3FKBA 1G7CB 2KYZA 3R2CJ 1T9TA 4KHMA 2UU9J 3FDSA 3AA9A 4K50A 3RBZA 4KFBA 4WYLA 3TVKA 4RX6A 3HFZB 3ZC4A 3ITHB 4BWJA 1GT8A 5J2QB 3PW5A 2XCAA 3OBIA 4WBFA 4AYBD 1UVJA 3WZ0A 3DGPA 1O6XA 2DO0A 4YMEA 2PEHA 1MSWD 2DT9A 4LR8A 4LF5F 3B54A 5DDQC 5B0BA 4XO0A 1X9SA 4QZVB 2OPQA 3FZBA 1QD1A 2UUCF 4M63A 1B0TA 4ILLA 1JB0C 5L9XA 1S1VB 1HNXF 4FYXB 1NJWA 3H8YA 2QRRA 4IO9Q 2MZTA 2GO9A 2IM3A 2G9OA 6FDRA 4F25A 1XMOF 1NK9A 5CABA 2GC8A 2VICA 4FNHA 4N8NA 3CDWA 2VASA 3CTRA 2M5YA 2VPYB 2FZKB 4TN2A 2OTLS 4DMZA 4Z2XA 5CH7B 5DLFA 4I69A 1T8EA 4X4SA 2GJIA 1TV6A 3M8PB 3NS7B 2JX2A 2ATCB 3I0SB 4RBVA 4B9TA 3GJQB 1P1TA 1Y11A 3H2LA 3M1VB 3RR7A 3DM2B 3PHEA 4B02A 2ZE2B 1TVRA 2DHAA 4R8UB 1KFSA 1HWJA 1RT5B 3GYNA 3KG4A 4TU7A 1KBRA 1HWIA 2VD3A 4N47A 5KFDA 1O8BA 5A8WB 1UVMA 2V4JA 4I6WA 4JI8J 4YOEA 4FXVA 1JLEB 2UU9F 5EX0A 2D1CA 3FSXA 2LQ5A 2ZZMA 1K1QA 2HYIB 1S6PA 2Y3YA 5IM0B 5ITHA 3I5BA 3LP0B 5KFYA 3KLEA 1Q8BA 2RT3A 2CPZA 1S9EB 2EXUA 3HHLB 1N0UA 1J5OB 4IR1A 4EMDA 2FZCB 2B4UA 5KFPA 2JL9A 3LP1B 5L1LA 2Z30B 2YKNA 3MZIA 3EWGA 3BGRB 3GR0A 4K2XA 4Q2MA 3ZO7A 4QPXA 1ZS6A 2BQUA 2IM2A 3MEKA 1GFWB 4CM0A 2Q79A 1HL6A 3MHYA 5KG5A 4PUOB 4JV5F 1XNRJ 5D78A 1CJUB 2R2SA 4CLZA 2NYHA 4DR2J 3MAAA 1FI4A 5C25A 3PX6A 3BGUA 3OVBA 4NPOA 2JFDA 1QAJA 1MLAA 4NLWA 1NUEA 4MKVA 2MZ1A 3CCSS 5F8GA 2JHEA 3PRVA 3QT8A 4WP8A 4C97A 2XM3A 1WNEA 1ZM3A 2UVWA 4L3NA 2JDJA 4ZVTB 4J9NA 4HYKA 1OJ4A 1VMBA 1NK8A 4B9LA 2X1GA 5CA5A 1JLBA 3Q83A 3MI7X 4G6VB 2IDLA 2HHTA 2CRLA 3D5MA 4I68A 5GAEI 1CJTB 1G3OA 3OR2B 4FZVA 4QBUA 1IN0A 2FGOA 2LQ8A 3T6JA 2MXYA 1F9EB 2DNPA 3M32B 2ZH1A 2ZHAA 4B9SA 3G4SS 3QIPB 2CYYA 2FJXA 3HZGA 2DNYA 2MQ8A 4U7CA 1NJZA 4C9DA 1UWAA 2C1EB 3KUEA 1XWLA 2DKOB 4J9LA 5HP1A 1SIZA 1V3RA 3HK2A 2PE8A 3D68A 3FK4A 5T7LB 1LWFB 4DV6F 1FRMA 1S76D 1LK5A 4DOZA 2GO8A 1S6UA 1F5BA 3R8YA 1MU2A 2I9SA 4OQJA 3OT9A 1R43A 1TTHB 4DPYA 3OL6A 3MWBA 1NZ8A 4N56A 4CH1A 3T5JA 3PX4A 2XZDB 3W5ZA 2PMZD 2Z58B 3C19A 4BHQA 2VQEJ 2RRAA 5KOWA 4WFXA 2H4WB 1VS3A 2ILZA 3P5BP 4MIBA 3RR8A 5D15A 2EC2A 3G87A 1X8DA 1R7IA 4ATNA 5H9EK 3P4UB 1JXEA 2D7SA 1UAWA 1Y5LB 4JP8A 4KRWA 3KHGA 1DLOB 4ECWA 3FRYA 2HGMA 3VTIA 1XR6A 2ZKUA 1LXJA 1J2VA 3V6HA 2CNOB 2O1PA 3WC0A 2HFUA 1IBLJ 3HLUA 1WDDA 3CDAA 1B0VA 2G13A 4P74A 4OX9J 1GMWD 3D1HA 3IS9A 4C0BA 4GO5X 1FJEB 3JSRA 1HNIA 1HBMB 2R7OA 1T9WA 3UCGA 3FQKA 2R7RA 1Q8KA 2VBXA 4WP9A 4JV1A 3I4PA 3P45B 1TKZA 3KG1A 4P7VA 4P7TA 4WK3A 4ZCLA 4TVAB 4QWBA 4CTAA 2KXNB 4N8OA 4O0IA 4DUYF 1HI0P 2DRAA 1RJJA 1O5JA 1HQEA 1GK8A 2XWYA 3G6ES 4NLQA 1AZSA 3K5LA 4ECZA 1X5SA 3PY8A 4MK9A 2BEFA 2RQMA 3B6BA 2IHR1 1H73A 4JI1J 2MQNA 3NOCA 2YWWA 2HEKA 3G71S 2RU3A 2CJQA 2HWHA 4DR1F 3GYXB 4H4KC 1CJVB 4PPZA 5ETRA 1IBMJ 1VRUA 5LSOA 2HBRB 1W7WA 2ZWPA 2ZH4A 1DRZA 3IRXB 4O23A 3JQJA 1NNDA 5THWA 4IRDA 3EYZA 1NU4A 4ECQA 5DG7A 1SVDA 1S9FA 4ZKAA 2V2VA 2V94A 5HANA 2GX8A 4U67Q 1RAEB 4Q7AA 3LWLA 2GVDB 1OMSA 1EETB 2E9TA 3Q2SC 3K5NA 2J0SD 3E2EA 3OXGA 1TFWA 1U8SA 3EGNA 1VBXA 3C8YA 2J8SA 2HQDA 3DDIA 1GNKA 1WEXA 2CQ4A 2ZNZA 3BPSP 2XMTA 4FKYA 4QWDA 1S4EA 2VONA 4CDIA 1WF2A 2C3UA 4HT7A 2HHHJ 4X66J 1PILA 3KK3A 2R8IA 4K0KF 3BSCA 4CYUA 3H4DA 4EBCA 1PO6A 2DNHA 3FQLA 2BQ3A 3J7AN 1TMJA 1LWCA 5FJ4A 1RTDA 2GAGC 1EP4B 3IFEA 3QWUA 1PAEX 4IG0A 1KHVA 1NKCA 4NLPA 1L3UA 5B0FA 1S59A 2RDDA 4ZK7M 3AODA 2VHGA 1RZMA 5HVGA 4DL6A 2YWFA 1RT3B 3IR6B 2DGXA 1ELOA 1IWAA 3BBFA 3W63A 1P6TA 1U2FA 2PDAA 2Y9HA 4ZVGA 4FYYB 2PSZA 1HHSA 2HHVA 5A2QU 4DF8A 2CPEA 3VVUA 1RDRA 4MTPA 2ZNYA 3TVZA 3RW7A 1R3NA 2WK4A 1V5VA 2ZBQA 4J9QA 1RUSA 3C15B 2QT7A 3BR8A 3FMWA 3PHTA 3RG6A 1MROB 3DU5A 3GV7B 2PFDA 3VAKA 3W7BA 2B5JB 3GV5B 3DM2A 3MCMA 4X4QA 1YJUA 4NA1A 1U8WA 5KG7A 3CULA 1DLOA 1APSA 1UUJA 4RR5A 2AWZA 3KJNB 3BJYA 3NAHA 4IQXA 4HACB 3KMSA 3MFHA 3B4DA 4LSZB 1AB8A 3AX5A 3S7RA 3V4MA 2FTRA 3EPIA 2RNEA 2ATLA 3DOKA 3ZZUA 4Q2LA 4ANCA 4FYVB 4OLOA 4EFAC 1VQ8S 3KLIA 1HBMA 1HNIB 1D3WA 2FLLA 3R5GA 2IAJB 5JMNA 5IWAJ 3CVKA 2B51A 4MFBB 2RJZA 1UETA 4CNZA 3NEKA 2B0GA 4GKJF 4DLGA 1FT8A 1Y7PA 2HLTA 3DLKB 3IM9A 1VYAA 4ZJLA 2L08A 2YWGA 1RP5A 1LWFA 2YXLA 1RAGB 1X4FA 3EDQB 5I42B 4EI2A 1UVLA 1WC0A 3E01B 1K0TA 1F3VA 2UUCJ 2M8HA 3FNNA 3CCES 2HNYB 4KO0B 4LRDA 3OTEA 3Q86A 2ZHBA 3QAUA 4OHWA 2FC8A 3CT9A 1I94J 3DOMB 4YS2A 3AQPA 4B3RJ 3QRRA 1MN9A 4LJMA 1IKYA 3Q2TC 3GFZA 3VAIA 5U47A 3JTNA 3MDFA 2UUBJ 3UD3P 2RMLA 1UEKA 2GFFA 2HGLA 3FUYA 2FQQB 2ALYB 3V5RA 1TQLA 1RTZA 1BQNB 3BBBA 3CJKB 4JB8B 4NXMF 1FX4A 2NSCA 1QVGR 4RU9A 3AOAA 1WKKA 3LPEA 3PFOA 1LWCB 2C2OB 4KGKA 3ZZPA 5BXIA 1S0VA 2XBPA 1FWKA 3TQEA 2R2UA 1FNXH 4LMZA 5FLXU 1X0PA 1T9YA 3KNAA 3HFVA 3HSZA 4ALZA 3HVAA 2J9DA 4JV5J 4H54A 1FFGB 1VLYA 4OI3A 3EVWA 4EEYA 1A7GE 1X9MA 1HYSA 2CZ9A 2KT3A 2IM0A 3KUHA 4NCBA 4OI2A 1Q4RA 1J5OA 3LP0A 3NKYA 5KT6A 3IR5B 3ZZYA 5KFHA 2QO3A 2GMLA 3NCQA 1F9FA 4G1QB 2MKIA 1X0FA 1VI7A 2RUGA 2QSWA 2LYVA 4O3NA 3T41A 1JX4A 2I0XA 4LREA 2AJ4A 4QIWD 4RW7B 2D41A 5G4DA 2QA1A 3IRXA 4PPDA 5HVFA 3JB9k 2J9CA 1FK9A 2M52A 3QMQA 3SEOA 3I9V9 4ZN1A 2LEBA 2YX4A 5C2GA 5A8WA 4C3LA 4TQRA 2D9OA 2OSRA 2IC3B 3C66A 4WU3A 4DXLA 5BR8F 2ADCA 4M1KA 3HHNB 4C8ZA 4UZCA 1P8GA 1NRKA 4JI6F 2Z57B 2XC9A 3GG0A 2ZM6J 4L73A 4DQSA 3OJUA 3SI8A 2F65A 2DY1A 2RHQB 1LWEB 2WB4A 1F6TA 4I6AA 4JI6J 8AT1B 1MWYA 2OKQA 3UN5A 1KKHA 4UUXA 4X4TA 1NB7A 3JQKA 2AYMA 1R27B 2VG7B 2VL1A 5AE2A 1YIJS 1ZH5A 1TKDA 1VQ5S 2BKOA 3L7UA 1FXLA 4QIGA 1Y5IB 3FBCA 1NSAA 4R25A 1QJHA 3J81U 4P72A 3JQMA 5IT9Y 2BMBA 2ZE2A 1KOHA 1S1VA 3NY0A 1M5VC 1RT4A 1T7PA 3HHDA 2R7UA 4NLGA 2VG6B 2DCUB 1S1WB 1UMJA 2N7CA 3HXMA 1KP6A 1C1CB 1KSPA 1RKJA 1KVJA 2KDOA 2NR0A 3BR9A 1SH2A 3K7RA 5KFQA 1Q86T 1LK7A 5CXTA 1I51B 1OQ6A 2YKMA 3DGPB 3OLBA 2WVCA 2ZC4A 5H1SV 2JEJA 3IWLA 3D6HB 1OPIA 2YKPA 3DRXA 3QT6A 4GVBB 2R42A 1ZZFA 4RW9B 1VCTA 2AEJA 1M5PC 4RW6A 1HQUB 4F50A 5ETSA 1WC5A 1KDNA 1KQKA 1M0SA 4OI4A 3RRHA 2N3OA 4LBPA 4B3TF 2XMUA 5HQLA 1QY7A 4NXMJ 4B3MF 4CI0B 5K8PA 2Y8WA 1WJ9A 5F9LA 2AP6A 3VALA 3ZTPA 5F8LA 4ZLNA 2DXDA 3SCLE 3TA0A 4Y6IA 3W61A 3H59A 3M32A 3CUNA 2HMIB 3J80U 3PYEA 3QJPA 1VQLS 4OMFG 4ED2A 4PWWA 1HA1A 2AZ1A 3Q8VA 4DSKA 1XNQF 1JQGA 5F8HA 2KT2A 3H2UB 4YR2A 1KC8T 4URSA 1E6YA 1U1NA 4WTYA 4DV0J 2K3IA 4C4WA 3NG8A 1JXLA 4MKAA 2CQHA 5AT1B 1NKEA 4OYZA 4ZS6A 1VRQC 3IBCB 4X84A 1TAQA 2J7UA 4GO7X 2P9CA 1NK0A 3T5HA 4AD6A 3OXFA 4CQ1A 4MYTA 4B3MJ 1FEHA 3HX9A 4QYZK 3W2WB 1WSRA 4WFAQ 5D4OA 5F8NA 1VLOA 2DYAA 3PKYA 3MR7A 4ZPAA 1ZA1B 2YNFA 4ECYA 1ROFA 4K4SA 1YJTA 5KG6A 3EXYA 1ZAXA 2BOAA 2HQCA 3D9BA 1LXNA 2EG2A 2VJUA 5F3TA 2E7WA 5B0DA 3RYLA 2GQQA 2VIHA 4EUVA 4TU8A 1ZBTA 2D3OR 4CCHA 1VQPS 4XDDA 1W26A 3T1YF 1PJ7A 2CNKB 2FHJA 4I0WA 1KRPA 1C2PA 3QZ7A 3MF5A 2JWNA 4J9OA 5C24B 2HS0A 3OXLA 3W5XA 1FDDA 2IJNA 4GC6A 2HHSA 2M0GB 3CWJA 1JLEA 3QO9B 1YJVA 4CT9A 2KVQE 3DOMA 1PJ6A 2PMHA 2UXDF 1S6QA 4Y0FA 2E5IA 4ZPDA 2WRMA 2VOPA 1M90T 2X1BA 4FDFA 1YQHA 1BD6A 3JSMA 1U1PA 2UUWA 5IV4A 2X1AA 4PAAA 1U0SA 5DG8A 1FCAA 3NCRA 3UE2A 5HMZA 2HSEB 2AGOA 2JVRA 1N5TA 2WVEA 1M1KT 4KPYA 4X62J 2W2MP 4OYBA 1AUDA 1YJWS 4NYZA 3BSAA 2CNNB 4YR0A 2U2FA 3PIPQ 2LXIA 1D8ZA 1PBAA 2MQMA 3TEHB 4DPUA 2AX0A 1T95A 5M2UA 2LP4A 2ZZNA 3NGKA 4USIA 1LFPA 2DY9A 2OMOA 2OPPB 4OHZA 3M8WA 3PJ9A 4G1IA 3EZ5A 1N8RT 4IRKA 4KH1B 5A8KB 3QRQA 2DR7A 4P73A 5KOXA 2I2YA 1Y3KA 2P9GA 4KY3A 2W7OA 3FGVA 1T03B 2CZ4A 3Q8RB 2OPQB 2WSEC 1C1BA 4LRCA 2QA4G 2Z2YB 2IVMA 2FJEB 4ZIWA 2QL7B 2HVHA 3AX3A 1R31A 1WORA 2RH3A 1RWNB 2ZVIA 1P9QC 5CYMB 2ZKTA 3CNQP 1NK6A 2DGWA 2ILYA 2ZBPA 4Q8FA 1U6ZA 3PTWA 2XO6A 2OEKA 4Y2CA 3S01A 2ZH5A 1EQ0A 2ZBRA 1RACB 2H3EB 4QIFA 3D1QA 1RT6A 3GP9A 2XULA 2J6SA 4ZP6A 1FESA 5I3PA 5CYJA 1HPZA 2RF2B 3UN3A 1MN7A 3W5YA 2GIQA 1WTBA 1SC3B 2XQCA 4Q0BB 2B3TB 3H25A 2EG1A 2QTWA 2DVIA 1DFDA 1WI6A 4N76A 4JI7F 3HSGA 2C2RA 4DCOB 1RWOB 3D4JA 1TK8A 3E51A 1SQFA 3OL8A 3DDNA 4NWBA 3UVJB 2CPJA 3PX0A 2HW3A 3HFKA 2B6AB 2JFKA 3CJ8A 1FX2A 2LA6A 3H90A 1RBAA 1VQYA 1S1XA 1UW9A 4HH0A 4XDCA 3SDEB 4RW4B 4YDDB 2YWKA 1Y4ZB 2VKRA 4HR2A 1YRXA 4WTOB 3QWPA 2CIMA 2O67A 3BB5A 3BGOP 1KQSR 1HWUA 2ASLA 4NCGA 1HLWA 2FJDB 4ZVUB 1GMVA 4DPOA 2LXUA 4K8RA 2V0NA 5KFBA 4DR4F 2OMLA 4C3KA 3SXLA 1SH0A 2FJAB 3MGJA 4HTIA 3DCAA 4LBHA 1RAIB 2VQFF 5A76A 1N4LA 5E3AA 3Q8SB 4CO0A 3M8QA 4DFKA 4DF4A 2AU0A 5CCMA 4DSJA 3KLFA 2IRYA 4QWAA 1OIAA 1CVJA 2CAJA 4DCJB 3IBWA 1JJ4A 1ZOTA 4X62F 4LIRA 3CJSA 4E8UA 4UOCA 1FKAF 4ZP8A 1J5EF 3M8SA 4KHPJ 2YNGB 3VQTA 1WWHA 4R0EA 4MFBA 4OZ0A 1SV5B 1TUVA 1Y0HA 2DGTA 2M88A 3K5OA 2IBOA 4TYBA 1PSDA 2DGOA 1FRKA 1RT2A 1J27A 1PG5B 4ZVOB 5KFGA 2DIUA 3TA2A 4BLGA 5DG9A 2E44A 3VWSA 1UA0A 2ZC3A 2ZM6F 1OO0B 2BUNA 3C6TA 4ZLPA 4ZVHA 3SQGB 3B82A 1VQNS 5DQGA 5L38A 3SBMA 2AJ2A 1IQTA 5B0EA 1S0MA 1GX6A 1YG0A 3SSQA 1XQIA 1MMDA 3VGVA 3VR1A 4ZHRB 3ZTSA 3J81j 2QA4S 3T5LA 2IVYA 2V9KA 4MT1A 3EVOA 1R8BA 3DC2A 3K8VA 1HIYA 2CPIA 2SXLA 4RNNA 1HBNB 4A47A 2FVPA 3MM6B 2PD1A 3IRWP 5DGBA 4WF9Q 3QZ8A 2HNDB 1ICEB 3P96A 4N41A 2YTCA 1QAYA 3PRBA 1LW0A 3BPDA 2FB0A 4WCEQ 4DG1A 2V8DA 3X1LB 3OFHA 3OUYA 2OJ3A 1XMOJ 3I82A 5EX3A 1Y00A 1RTHA 5E3RA 1QM9A 3R7NB 1U1RA 3A3PB 2VFTA 2FD2A 2EFVA 4DS4A 2GHWA 3MPVA 2UXCF 1V5IB 4PKDB 2X7IA 4H4MB 2F8EX 3ZTRA 4W90B 3EMTA 2XMVA 2RS8A 2G0IA 1UVNA 1P27B 3A1YG 2PIIA 2ZUGA 5BYQA 5HSPA 2Z2LA 4QIEA 2QZ8A 2JSXA 2MZSA 4UOHA 3UDVA 2BACA 5HLFA 2P6SA 3AFGA 3C6UB 1S1UB 5EHHA 4A46A 1U02A 1GMWA 5E2QA 3TOQA 1PYSB 4DV7J 3TRGA 1N33F 3MMCB 2BE7D 1FJGJ 2DNZA 2O66A 2LECA 2Z2ZA 4C8NA 2R8GA 2FZGB 5CYQB 3GIKA 4B3TJ 1BXNA 2F4VF 2HBZB 2CFXA 2H1YA 4CLLA 2JLEA 3AD8C 1LWXA 1VIXA 4IH5A 3THTA 1XR7A 2ROGA 5AXNA 2J0WA 1TK0A 1V3ZA 2IRUA 2P5VA 3GSIA 3BQ2A 2E9RX 3GJSB 4TXSA 2MB0B 4ID8A 1U49A 3SIPB 2C2ZB 3ILIA 1RHUB 5HBMB 4F4XA 2D3O1 2V69A 3M30A 4AXJA 3LH2S 1H98A 2Z0GA 3TI0A 2N4DA 3G8SA 3AAWB 3HD2A 2O5DA 3M6WA 1Q95G 3NOGA 4WXWA 2ZBCA 2L9WA 4TLQA 1NK5A 1DQ8A 2BW2A 2MZQA 3TJ8A 4YFUA 4K4XA 2V50A 1DTTA 3D3BJ 1DTTB 1TKXB 3CDUA 1PJ5A 2VFUA 3O5TB 1IWGA 1EKRA 2DB1A 4DV4F 1LWEA 1U4BA 2VOOA 2LMIA 4LBIA 2XZ2A 1I5OB 3ZZTA 1J5EJ 4KHPF 2XY5A 1ZTTA 2A2CA 2OPRA 2VDIA 4WIIA 2WONB 3MM9B 1MNEA 1T9UA 2QX0A 1RA6A 1N54B 4DX7A 4F36A 5LMUJ 2D68A 2E1AA 1KHWA 4Q5VA 2P9EA 1VISA 5H9EJ 1X4BA 4CZCA 5KT7A 2HQFA 1KQGB 1UCNA 3M1VA 3M6XA 5K9FA 2LVWA 2PGCA 3GV8B 1YBTA 1GTEA 2EFQA 2QGFB 2RDIA 3HVTB 1KLNA 2B7CB 4FNIA 4N5SA 5KFVA 4DPXA 2DJWA 2ROEA 4DR7J 2DH7A 4OYOA 3CXCR 2YQ3A 1RTIA 3HHLC 1IKXB 2AV5A 5HQ8A 1ULRA 2J0XA 2LFVA 4GVLA 3TAQA 1U47A 2KH9A 1HHTP 1RYRA 3OTOJ 1E6YB 2A0FB 2NPFA 2VG5A 3QAEA 4PR6A 2FY8A 1RAJA 3FVYA 2YQ0A 2DITA 2XG8A 3HT0A 5FIIA 4TY9A 3V81A 4LF7J 2B9EA 1JMTA 4PG5A 1SJ3P 3GONA 4A8XA 4KTQA 3CJ2A 2QEXS 1JLCA 4ANDA 1KTVA 3KDNA 3NS5A 4E2FB 1CJTA 2AEFA 3DLGB 3DXSX 3L4BC 5LSLA 1ZZNA 1FE0A 5IZHA 1S97A 1V6HA 4KFBB 4F0HA 1NXIA 2DR6A 3WIUA 3DLJA 4I1TA 5K8NA 3GILA 2PMWA 1JLQB 2RVJA 1XC9A 4O4GB 2RRNA 5D6GA 3PO4A 1UVKA 1VJQA 3MCOA 3U27A 4DV5J 1LW2B 3VQSA 2YKMB 1UL3A 1PKUA 1GXUA 1N6QB 5A0YA 1S5ZA 2H9ZA 4DR6J 4Y34A 3V4IB 4FS1A 2B7BB 4GKKJ 3HVTA 1N5SA 3JSYA 3K2YA 1EIYB 1RT1B 5GMEA 3MM5A 1SQGA 4DR3F 4FF4A 3CW2C 1IVZA 3CIZA 2RILA 3TUIC 1XR5A 4DV0F 3HKWA 2ZJPQ 3P6YC 5DJBA 1SJ1A 2WB1D 3ADAC 3D3CJ 4WWSA 4B9UA 3QSIA 4LFAF 1XNQJ 2IAJA 3DNCA 5DDOC 2XMMA 4JI8F 3MR2A 2PN6A 2AYBA 3UNYA 3MR5A 2AYEA 2Y0SD 2H48B 1YI2S 1E6VB 2G4BA 5E41A 4HI1A 2VA3A 2CQPA 2PO4A 4N77A 2JC0A 4YY3F 3PW7A 2XMWA 2V8VA 3MPUB 5IC4B 2IFXA 3OV7A 3RGIA 4HHUA 4LFBJ 4DV2J 3W65A 2WZ1A 1WDTA 2V4JB 3LPYA 2B5JA 2OI2A 1UWBB 3WIVA 4XIUA 1JLFB 2VKZG 3KYLA 1XJWB 2ACMA 3RUBL 2FJBB 2OD4A 4USHA 3KLFB 4IR9A 4B3OA 1GH8A 1SB6A 4P2FA 3PRDA 1OSDA 2WW4A 4TNOA 4EO6A 3PO5A 3A12A 3BH6B 1KVKA 3F41A 5KFWA 4ECTA 4P75A 2DNRA 4AT1B 1YITS 1X5OA 3IM8A 3G9CA 5HMXA 1K73T 2UXDJ 1KN6A 1RKIA 3QGHA 2I1RA 3HULA 5DZ6A 1RHQB 1KONA 2E9ZA 2HFZA 3CDEA 2CNLB 3GYGA 2HWTA 3I5AA 4DPTA 1F9HA 3F73A 4FPRA 4PYDA 4D3GA 3THVA 1C0TB 2I5JB 2AT1B 3AD7C 3UCZP 3M30B 4A8OA 5DM6Q 5J1NA 4X4OA 1XEZA 5HQMA 3HVWA 5HBMA 3UD4P 2WBRA 2GW8A 3FCHA 1FD8A 3JXOA 2FGCA 2W4DA 4LT6A 2CJKA 4EBDA 3RAMA 5K20B 5HROA 2AJ1A 2WSCC 4NXNF 3CD0A 1T05B 4KR0B 3VHQA 3M2RB 3UNGC 3GFXA 3GE9A 1N6QA 4C6AA 1LV5A 2R7TA 3CJKA 1NSKL 2DGQA 1WG1A 3DRSA 3N28A 1YJ7A 2ZH3A 5BR8J 4OX8A 1JLAB 4Y3CA 1IR2A 1HARA 1FRIA 3K89A 3R5CA 3VAJA 5DLGA 3OW2R 3G8QA 4F2SA 4JI2J 4FF3A 2E1CA 4UY8T 4F2RA 2VPWB 2VBYA 2ASJA 1FRJA 1FDAA 3DI6B 3GLJA 1RTJB 2MHNA 1CG2A 3CCUS 1RCOB 3W62A 3KKFA 3S1TA 4LIWA 2G0JA 5I3QA 2GIFA 2DEJA 2E5HA 3RZAA 4OJ3A 1RI7A 4OHVA 4PXBA 1CEZA 4Q43A 3AOCA 2HBYB 5CHCB 1U48A 5J2MA 4JI4F 3M8YA 4LRBA 2FYXA 4ZVQB 5A8RB 4ZJQA 2F1FA 1WOSA 2VG5B 1Q5YA 2QLFB 3DFEA 1VFJA 4OFZA 4UZBA 2W9BB 4FYDA 3W9JA 5GAEU 2NZ4A 4CTAB 2CQ1A 5GADI 4F4KA 1NJIT 2AZ3A 2LCWA 2HVZA 4NA2A 4CLYA 1FKPB 3FBFA 5J2NB 2HFVA 3UCUP 5J1EB 4KJIA 4ZVSB 3LOUA 2PA3A 4I2QA 1JLGA 1ZPVA 5C42A 1QUPA 4IDKB 1HR0J 2DD8S 3NBPA 3IG1B 3QJLA 5JUMA 2J9EA 3Q24A 3W64A 1YHQS 3L95X 3KJFB 2MKYA 5CAAA 4LF8J 3OR1B 1MMNA 4M5MA 3MAQA 2XTEA 2J5AA 2CJYB 2OH2A 2L48A 2GV1A 1Q0NA 4ZCMA 3I87A 1SC1B 3ET6A 1D9DA 2ZH2A 1RWVB 4WYWA 1XTZA 5G0RA 1R0AA 3H7HB 3A13A 2OSQA 5F0WA 4DV1J 1DZ5A 5HK4A 2FVRA 2MPUA 2HZVA 3HCXA 3ZZZA 4GKKF 4EU0A 4M5JA 4USVA 3RAQA 3I96A 2P8IA 1ZPWX 2WVDA 3MMBA 2MLZA 3BGFA 4JYAJ 4ZVPB 3MEGA 4IOCQ 4F4YA 5HP1B 2XLJA 4V1Ak 4GKJJ 2F9DA 1Q16B 4UTGA 2BRKA 1GXTA 2CQGA 3OTCA 2ZDPA 1EP4A 1ACMB 1QTNB 2MKHA 4MH8A 4KB7A 5IWAF 3NL0A 5CQGA 3OR1A 4OYMA 2FLPA 4RW8A 3MXHP 2A6OA 3RW6A 2EEYA 1RAHB 1S48A 2MKKA 1FRHA 1NPPA 3FSIA 3F56A 3I31A 4QPTA 3CCVS 4DV6J 4AL6A 2R7VA 5KT5A 3HM9A 3QGIA 3RTVA 1K0VA 3I56S 1JLBB 2V1SA 3EZOA 3EVMA 3IP0A 4X65F 2IBKA 5AXMA 5C42B 2HFOA 3OTDA 2HG4A 3QLHA 3MD3A 3GPAA 2R7WA 4IG3B 4L76A 2XS2A 4LF7F 3AHPA 3MMCA 2XCPA 4RW4A 1DJ0A 4F02A 4ETZA 4TQSA 1S1XB 4EO8A 2YVSA 3MAAB 1R0BG 1UTAA 4RBUA 3PR5B 1WELA 1WC4A 1FE4A 3EXCX 1NK4A 1VBYA 2E1MC 2YBVA 3CJ3A 4ED5A 2KXFA 1RE1B 1FRXA 4ES2A 1XIQA 4JV0A 2W9CB 1VRUB 4DV3F 1ZYQA 3EDRB 2GMHA 4JOUA 2V2QA 4RZRA 2EPIA 2H4YB 3JSBA 1MMLA 1Y3JA 1OYDA 4ITSA 2HZCA 1QSSA 2UXCJ 4J9VA 3PFEA 3UFCX 3OQ2A 5L1JA 2HK3A 3A8KA 1TU0B 2AJ0A 5ETQA 3ZFVA 1VQ4S 3HF5A 3HHLA 3TWZA 3H5SA 4YB6A 1FDNA 2AMCB 4JI3F 2QIFA 5E3PA 1AZSB 1OWXA 5HAOA 1NSPA 1U1MA 3QQCD 2MZJA 5F9NA 5LMUF 2GS8A 3M9NB 4OV1A 4ZOSA 4DR5J 1TK5A 4JI5F 4B3SJ 1UP1A 2EK6A 3MR3A 1JLAA 3LUYA 4MJKA 3FSYA 4U7UD 2L3MA 3DLEB 3QGGA 2RHSB 2XI2A 3TARA 1EAYC 5E7OB 1CS4A 1X4HA 5BYSA 2W7PA 4HEA9 3PYGA 2HIQA 3IS9B 2RD5C 1HI8A 1HBNA 3A3NB 3PV8A 2AD9A 3M2RA 5C7PA 1RK8A 4LQ3A 3OL7A 1IR0A 1TVRB 4R8UA 3NGSA 2JEGA 2XS7A 3GTYX 1HNVB 1H7XA 2IRXA 3Q8YA 4QR0A 1EJ7L 4XK8C 5H9FK 4DWIA 1AROP 3I0SA 2HHXA 1M5OC 5CCLA 3EGWB 2HAIA 3U1NA 4H4KA 3KLGA 4OJHA 3QRPA 4OZ3A 5E33A 3ULHA 2C22A 3O44A 4ZMMA 4L6V3 2MJNA 4NZ7A 1WUUA 4LF9F 2A18A 3KLHB 3H5XA 2CQIA 2BANA 4NYPA 3G96A 4M94A 3CCWA 2B4PA 2XS5A 4DX5A 2D3UA 2VU5A 2AF6A 1SJFA 1SL1A 3JTOA 1MU2B 3V6DB 2EFNA 1N32F 2R2TA 4RU2A 2BRLA 1SPBP 2NSBA 4DSEA 1A0OB 1H2VZ 2ZHOA 3AT1B 5D3GA 2BM0A 3IR7B 5T7LA 3M8ZA 3D0HE 2DR5A 4K4TA 2CQ2A 1B99A 2DISA 2Z2MA 3ET6B 4Z7CA 3JYTB 3GCWP 1ZTWA 1IM6A 1TP7A 1ZM4A 2MSSA 2KRBA 4B3OB 3SCIE 4U8YA 1WC3A 3GSDA 4DUYJ 1SL0A 2R8JA 1N33J 1IM4A 1JLFA 1CJKB 2D74B 2C3PA 3LA0A 4A4JA 2KL8A 3I6PA 3C14B 1T11A 2X3DA 1NPKA 2DH8A 2DRDA 2GIRA 3CJTA 2MQOA 5GMDA 1K1SA 1R6VA 1SUQB 3JS9A 3NBPB 4LVNP 3VVTA 4CM2A 1QDUB 4RNOA 2KM8B 2K3KA 4IDKA 3OVSA 1QTMA 4G1QA 4AUKA 3CO0P 5E5NA 1E6VA 4IH7A 4Y00A 4HHHA 4CO1A 5I3UA 2KTQA 1H2TZ 4P71A 4PXDA 3IWNC 1IKWA 3W2VA 1S9GA 1Z2ZA 3UW1A 2ZEJA 2CDRB 2V68A 2KG1A 4IO1A 4NMXA 3KJVB 3C46A 1HYSB 3ELHA 2KB2A 1HBOA 4FP9A 2KFNA 3EZUA 4ELVA 5IFMA 1D8YA 2OAUA 5ADZA 4DV5F 2B6AA 4X4RA 2FVSA 2J6TA 3BO4A 2CADA 3MPWA 5GVQA 2W8KA 3ISNC 2K1RB 5IV3A 2ZFHA 1F60B 3CMES 3N4WA 4JI7J 3SV4A 4OX6A 4TKTA 4GMKA 2VV5A 5F8JA 1IJEB 5ETPA 2ZH8A 2RS2A 1OYEA 2HHHF 2QFIA 1BQXA 4PEOA 1IQZA 2HNZA 2IA0A 3AJ2A 9ATCB 2ZDOA 1RHMB 3JTPA 5ETLA 5F3ZA 3BO3A 1U1QA 4JI1F 4QU6A 4ICLB 2EKYA 1U2RA 3TX8A 4CLWA 1F3FA 4B08A 5GAGI 2R8HA 1RT6B 3GZ7A 4O0NA 1CQMA 5AE3A 5EWFA 4DFPA 4NE9C 4F0KA 4FYWB 2VFVA 1FFWB 2Q6BA 4ZCIA 2DPIA 2PI5A 4O44B 4BC9A 3HO1A 2DNGA 1IKYB 3Q0AA 1N36J 3C14A 4L72B 5CYMA 2M2BA 4FPIA 4KO0A 2FLNA 2B56A 1UFKA 3LAKA 3HP6A 4MKBA 1IBMF 4NLSA 3CMQA 2HWIA 3SCKE 3KTQA 4F3OA 4KV8B 1C1BB 2HK2A 3MAHA 1TAUA 4HH1A 3J7ZT 4OX7A 4YUDA 2DCLA 4DR7F 1SJQA 2MLXA 1TUGB 4ZIVA 3HVRA 2FJWA 2EFPA 3DLHA 2ASDA 1IXKA 3MPYA 4PXCA 2LEAA 2RRBA 4G1PA 1NSQA 1QE1A 4Q8EA 3K58A 2GJFA 3IBFB 3GFHA 2YH0A 2IM1A 3U1LA 3PDNA 4X4PA 4CH0S 1NJYA 4L3KA 2YX7A 2ADBA 3Q8PB 1R8HA 4OYAA 2F4VJ 1FFSB 2LKZA 3W1YC 2ROPA 5HJYA 4A8MP 3TZZA 3VAFA 4M95A 2OEMA 3I0RB 2WSFC 3CF5Q 2VG6A 1W2IA 2ZITA 3OHBA 4HL9A 1IBLF 7FDRA 5L9NA 2B9XA 3WQPA 4ZA1A 2IC3A 4Z7YA 1WC6A 2IMOA 3DKDA 3C15A 4N7TA 4K4VA 1CS4B 4KGMA 5H9FJ 1Q5VA 2F7VA 2K8GA 2XTCA 4ZPCA 2W25A 3AB2B 3DLEA 4NZ6A 4AQYF 4WZQA 4O44A 2VG7A 4RW7A 3AJ1A 5DETA 3L09A 2CQ0A 4MYUA 3AJDA 4D3HA 5KTQA 4O3RA 2GNKA 3ENVA 2XLKA 2JEIA 2CJ9A 1FNMA 2E1RA 2W2QP 2MQPA 2I8EA 1N56A 3OJSA 3TX0A 3M2UB 3EX7B 4KSEB 4UOFA 2IJFA 1WHXA 2WVBA 2HNZB 3GWCA 2FUG9 1RGVA 2AKWB 3NWGA 2E5LJ 2VPXB 1TZ0A 3RB0A 1HMVB 5GADU 1QLNA 1JJHA 3MUMP 4KGVB 2P6TA 1HWKA 4LSLB 4RL1A 3BDPA 1JKHB 3W2WA 3EUNA 1YJ9S 1T9VA 4B9NA 5KFJA 4ID5A 5B08A 3RBEA 2RE1A 3V4IA 1NCLA 4C11B 5A0YB 1IR1A 3LW5C 1AYEA 2N3LA 2RUSA 3GJRB 5ETKA 4DZ6A 1WI8A 2NUUG 5EGYA 2CPYA 2H54B 2OFHX 4NRUA 3QATA 3TZWA 1S0OA 2WW8A 1QVFR 4LF5J 2OO4A 1M5SA 3C16A 2R7QA 1Y5NB 5I3UB 1EETA 2XTJP 4EZ9A 4DFMA 4CIOA 3UN2A 1VOMA 2GMJA 3R5BA 2MHEA 2CPXA 3AA8A 1WHWA 3C6UA 4ZPVR 1YSJA 4WKYA 5IT0A 3FMBA 3CDBA 3QNWB 3EM1A 3T6BA 5B0AA 1YLXA 2JH3A 1ZM9A 3BDEA 3OD2A 5MLCV 4CLTA 1CBKA 1H6KX 4C2MA 1NDCA 2D9PA 1U0HA 2AYGA 1VQOS 2HVEA 1URRA 3CMAS 3PR4A 3AX2A 3CPWR 5FDLB 2FVQA 5KFUA 1BQNA 2BBEA 2BZ2A 3EGVA 3MMBB 4P6QA 4C7QA 2FC9A 4J9RA 1SJRA 2B4VA 3BKUA 2JRSA 1TL7A 3OUYB 2CG8A 3MMAB 2V2KA 3BH7B 4DL2A 1YJNS 3P8BB 2K7KA 2LA4A 4G3IA 4C8LA 1K47A 4Y2IA 1HNZF 2VC0A 1O0PA 1OY8A 3TR5A 1XK8A 2CQCA 1NHVA 1RTIB 1RHJB 3VZHA 4ELUA 1RWPB 2Z4PA 3KJQB 2MKCA 2LLZA 3I4HX 2VFRA 1WHYA 2V34A 3MM6A 1VC0A 1B3TA 3NNHA 3A8JA 2EC0A 1WEZA 1IBKJ 2XSJA 5I42A 3BYRA 4H4OB 4YP3A 1FHTA 3DRPB 1SCJB 3DRPA 2CWKA 2FLOA 2YNHB 4RNHA 3F0NA 3DLKA 4YN3B 1YBAA 3BYPA 5EWEA 4RWWA 3D66A 1WOOA 2UVUA 2QSFA 1BLUA 5LXYA 4E0DA 3SQGA 5K8MA 2N4CA 2WONA 3MM9A 3TUJC 3R2DJ 4K4YA 4ECVA 2HRTA 5J2NA 4NL5A 1UKUA 2LQJA 5HMWA 1T94A 3TW0A 4DJBA 5DQHA 4XPCA 2V4QA 3A8IA 1YDLA 3LP2B 4PG6A 1S72S 2UUAF 5D4NA 1SV5A 1TKXA 3OFFA 1NO8A 2KI2A 3Q8QB 2BX6A 2PA8D 4PABA 2AGPA 2V1TA 3ONQA 3HPOA 2OELA 3MEEB 3ETMA 4ZCKA 3UVJA 4EK2A 1SL2A 2RKIB 2RSQA 4YB7A 4YEAA 3VCDA 4IRCA 3CE8A 2AJFE 5FDLA 5LOQA 1D0EA 2Y1LB 4K2JA 3QFHA 4CLSA 4ED6A 2Y1RI 1MROA 3BKTA 4IG0B 4Y2KA 6FD1A 3LQVA 1N48A 4DV3J 1Q81T 1GAOA 4NASA 1FRLA 3NGTA 2GA7A 3OTBA 1EARA 2YPZA 4P52A 2GZOA 4CO5A 4CWBA 4EWTA 4F3MA 4F67A 3LWMA 2KHCA 2EK1A 4O3QA 2BKNA 3Q23A 1I3OB 4ZN3A 1X4DA 3G6XA 4ILMA 4M5IA 3TO8A 2V8HA 1XN9A 4DSIA 1H38A 4W98A 2YQ1A 3C3LA 1HI1A 3I32A 4DU7A 3G82A 3R6GB 2QG9B 5KFSA 1HNWF 2R9LA 3NNCA 3SFGA 1JWWA 1RU2A 3MOZA 2OTJS 2W4CA 2DH9A 2BDPA 2XB2D 3DLBA 1TL1B 4O3OA 2KYXA 4HHJA 4ID5B 1FF2A 4NI2B 4ILRA 1URNA 1CJUA 2XGQA 2AX1A 1FTRA 1TUWA 1X4CA 4O3SA 4WJBA 2AHOB 4DN9A 3DYAB 5KG3A 3W9IA 1R8PA 2G0CA 3H5UA 1KS2A 3UD5A 3BGRA 2DNLA 2O01C 3DOLB 4X65J 2FDNA 2QMWA 3BQ0A 1FDBA 1UZDA 5DZ7A 1UW4A 1YKWA 3G82B 1HHQA 3GIMA 2G2ZA 2H5EA 2IJRA 2J7KA 1SI9A 2LU2A 3MEEA 4M8LA 4Y65A 4ZPWR 3TYTA 5RUBA 5IM0A 5HO4A 3OVAA 1HQEB 2QYCA 4IUFA 4NLVA 5KFCA 1NEEA 4ZITA 4I7FA 3TZYA 4B3RF 4M5DB 4QCLA 2R3VA 1PCAA 3NGUA 2OP5A 2YNIB 5G0RB 2XWXA 4KH0B 4PXEA 4YB5A 3KHLA 2HNDA 5CZVA 1FJCA 2FHOB 2BM1A 3PVXA 3NMAA 3IAM9 4HLBA 3RB6A 3NAIA 4OYPA 4RPFA 9RUBA 4DQPA 1N52B 3EE3A 2HHWA 2Y0BB 5E3QA 3KUGA 4J37A 1SKSA 4FBTA 4WFBQ 4RUBA 1HD1A 1WG5A 4J91A 5FLXY 1HW9A 1Y10A 4FVCA 2JEFA 1TV6B 2VODA 2OLWA 2F8HA 4KPCA 3OSPA 1M1HA 4JI0J 1TKZB 5JVHQ 2BXJA 1RWMB 7AT1B 4KQZA 3TANA 3FRZA 3DGVA 2CWXA 4ZVFA 2B9YA 4WXOA 1D9FA 1NPRA 2JLFA 1H72C 2NYIA 3MCNA 2OUGA 5DDPC 4WKRA 2MY8A 1CULB 2B8QA 1GEHA 2EBGA 4JI4J 5EDWA 3KHHA 2DRBA 3VGSA 1N34F 3UR0A 1BWVA 3Q22A 3FC9A 3UQSA 2GVZA 2W4PA 3WX8A 3QIPA 3JSMB 4URGA 4HTJA 3CCQS 3H20A 1FO1A 2A10A 2ZUAA 4QIVA 2DHHA 4LF9J 2KJWA 1Z2LA 2V2ZA 3CJRA 4O4GA 4ES1A 1NDPA 4LF6J 4OZNA 5ETOA 1N36F 2Y8YA 3LAMA 3PZPA 3BREA 2W2NP 3IMQJ 5IT4A 2KVIA 5B0GA 2UZAA 4OYIA 5K8OA 4E98A 3SYZA 1RT3A 3FFIB 4NMLA 4ECRA 4OL8A 4NLYA 4RUHA 5HL7Q 1C0UA 2QL5B 3OFGA 4KGXB 1U6FA 1RQ0A 4NCAA 4W4MA 2HAFA 5C25B 2DHSA 5L1KA 1DQ9A 3DYAA 2EWHA 4J5OA 2IVFB 1Z1ZA 4A8WA 1MWQA 4EYHB 2XNRA 2X3GA 3BN7A 1XMQJ 2YPYA 1X31C 2ZBIA 1BUXA 3QT7A 3HHLD 5M2PA 2JLGA 4JI5J 6AT1B 4CNYA 4BDPA 3DHWC 3KJVA 1RWKB 3M05A 4IFYB 2I5JA 3AXKA 5AJ3J 2HVDA 1QSYA 1IKXA 2F8MA 1YZ6A 4HDGA 4QYZJ 4C3MA 2HQ3A 1NK7A 2HPUA 2QMXA 1X7VA 1SKRA 1S6PB 2XNQA 3IA0A 3MOJB 4OYWA 2FVCA 5EUHA 3DDKA 2CJAA 4DPWA 1SUQA 3UO0A 1L3SA 1K9MT 4PG7A 1B0PA 4P2MA 3R6LB 1HMVA 3IC1A 1UEUA 1CJVA 2DR9A 2HHQA 1CC7A 3CCTA 1XMQF 1PGZA 2Q3PA 2KN4A 2ZJRQ 2HMIA 1JNZB 5EWGA 2W24A 4ED1A 2U1AA 3G86A 4OI0A 2HHUA 2VZ9A 3CCRS 4RJVA 4DX6A 2BW7A 1WD6A 1U7LA 2RKIA 2F63A 4JBCA 3O1LA 2AQ4A 3W9HA 3JAMY 3KLEB 3CO9A 4TU9A 4X64J 1PYOB 2DNQA 3DRRA 4RBTA 4WIQA 5KFRA 5A8KA 3P5TL 1IUJA 4RW6B 4C98A 3I9ZA 3QT5A 2BE2B 3R7SB 3EPGA 4A8FA 2H65B 4PWDB 3UDLA 3TAMA 4DEZA 3MD1A 1FKOB 1Q1KA 2BANB 3NXZA 4LFAJ 4JI0F 3UI3A 1X4AA 2B8PA 1PC5A 1UZHA 3VGUA 2PFFB 3R1LA 5KFTA 1KLMA 4I6YA 3T1HJ 4YHHJ 4IYQA 4PRFA 3TUPA 3PEJA 4DL5A 3PM9A 1TFYA 4U6PA 5D4PA 3W8GA 3HD1A 1HQ2A 3CCJS 1UVIA 4ECUA 5K5MA 4F4ZA 2HBQB 4NRTA 2DO4A 2C3YA 3NLCA 5L39A 3KHRA 4DV1F 3N6NA 1RHKB 4LUBA 5IOLA 2VQEF 4A8KA 3GR1A 1A6LA 2WBMA 3VAGA 1FVQA 1QE1B 3S6EA 2I38A 7FD1A 1S77D 3D0IE 3D1OA 3QO9A 3R5JB 3TAMB 4Z37A 1WC1A 2DEIA 2KJVA 3VAMA 1OY9A 1VQKS 4K4WA 2BJ3A 1VQ6S 1F5AA 1C4AA 1KTQA 4L74A 2I6WA 3ILJA 4DR5F 3M2VB 4DR6F 5HLFB 5M2RA 1OY6A 1F0XA 4NYOA 3M4XA 4S0MA 3W60A 3Q8UA 3DMJB 3ENWA 2J0QD 3FBEA 2W7AA 1TL4A 1BMQB 2ERRA 1UPMB 2HRYA 3GB0A 3OFEA 3V81B 2X51A 3BF4A 1IKVA 4ED8A 4QU7A 4OLPA 2XSFA 1KVIA 1REVB 3IGVA 1SIWB 1VRTB 1JJ2R 3FEXB 2NXUA 4WK1A 2MJUA 2XZTB 3TEGA 3ZZ0A 4DL3A 3LTOA 1VR6A 2IY5B 5B0CA 2EVZA 4PZVA 3MM8B 2CQDA 2IYIA 2H5IB 3CD5A 2B9WA 2V4RA 4KT0C 2N7YA 5SUHA 1S9GB 4RUCA 1IKWB 4IFYA 2YWEA 3W2VB 1W2BR 2YH1A 3J81Y 2HIYA 2M3DA 4C11A 1Q82T 3D6FB 1AXQA 2Q1LA 2BJ1A 3EGZA 2KRRA 2MDAA 1YJRA 1JKHA 1HFEL 2C28A 4CRJA 3TQ1A 1NM2A 2A3JA 1X5PA 2KG0A 1REVA 4ZHRA 1CSJA 4NLOA 5A6WA 3O2IA 4XPEA 4DFJA 1IKVB 2HZAA 3M8RA 2FY1A 1FWPA 2UUBF 5LJ5Y 4X4UA 4AXIA 3HSJA 3V2UC 1U45A 2BV3A 3HSDA 2NLWA 1WKJA 3MEGB 3DMJA 1OSCA 2J76E 5CD4A 3BN4A 5E3CA 4K4ZA 3U1MA 1HW8A 1HQUA 4RKUC 2E7VA 5AE1A 8ATCB 1BY9A 4CO4A 3D2WA 3QJJA 4YB1P 1TKTA 2G2OA 4MIAA 3BSOA 4YHHF 3T9NA 4HKQA 3WDOA 1CJKA 4DU8A 2DGVA 1NH7A 2FHKA 4JV2A 1EB0A 2HNYA 2MEWA 2UXBJ 1U1KA 2UUTA 4A8SA 1DQAA 1OS5A 3LF0A 4DSLA 2GVZB 4DHVA 5MAOA 4LF8F 1D09B 2JJ4D 5T14A 1Q7LB 1JJCB 1QUVA 2DXEA 5L1IA 1EKSA 3N79A 4NX9A 2OIHA 1KLMB 3N5BA 2RQCA 2DTJA 5KT3A 4F7VA 2BJDA 2F3JA 1VBKA 3TJAA 1VK3A 2ZOMA 3CC2S 4ECXA 2XLIA 3HKZD 3KLHA 3G2XA 3N5FA 4AE5A 3RB4A 4LRFA 3NNAA 2RIJA 1G4CA 4IKAA 2E7XA 1UFWA 3FEYB 4HACA 2JVOA 5KT2A 3C2PA 3P3DA 3QIDA 4J9UE 1GQEA 1YVFA 3KK1B 3N9UC 2FHJD 4P10A 2Z8QA 3A3OB 3I5CA 3B8HA 1I6JA 2ZH9A 5KG1A 1SH3A 5KG4A 1RXOB 3NP5A 3RU0A 1T3OA 4UOGA 3HJFA 4ERDA 4DV7F 4KKOB 1KOOA 3SV3A 5IC6B 3PG9A 2FHMA 5KG2A 1GTHA 1K44A 4DR2F 4QR2A 2QLBB 2W9CA 1VHIA 2RF2A 3B78A 2EBEA 5KAKA 4LF1A 2YNIA 2HKEA 4FF2A 4FXWA 2X1FA 2K2PA 2DNKA 4DX8H 1UJ5A 1HBUA 2NPIA 1JXVA 2XMJA 4I7FB 1S1TB 2ZD1A 2C42A 4RLEA 2PC6A 1UEVA 1RB0A 5E0OA 1R8CA 4M5LA 1HBUB 4DR3J 1XMBA 1LW0B 3U7JA 4K0KJ 2D3ZA 5LXRA 1QSLA 5D77A 1NMEB 1S0NA 2BOPA 2DBBA 2GHPA 5FD1A 3CC7S 2HVIA 2M8DB 4MAKA 2CZVC 4KKOA 4RWXA 4K4UA 2WCXA 3QFWA 4ER8A 4EZ6A 3TNVA 2R7SA 2ZOFA 1T05A 5KFXA 3THPA 3K59A 3P49B 4DQRA 4PCQA 4C8YA 3KK3B 1T03A 1RLCL 3QPIA 2KKHA 4RW8B 3GIRA 4BS2A 4PWUA 5ETNA 3RBXA 4X66F 1U1OA 4MKYA 2WOMB 1ZAVA 1NZAA 3CEDA 4OI1A 4ZP9A 1AUSL 3CJ0A 2XMAA 1M1GA 1GX5A 2BJEA 2K7JA 4LSNA 1C0UB 4P2XA 1VC5A 1UJ6A 1CC8A 4IG3A 3MURP 2AGQA 3D0GE 3MECA 3KOAA 5KFNA 5DDRC 2P2CB 4A8YA 1F1BB 3R27A 3TZXA 1K8AT 1ZA2B 4CLKA 2E5JA 2VC1A 3T9ZA 4AQYJ 1EZZB 4J9SA 2UVVA 2ZJQQ 4USKA 4USJC 4Y2AA 1NHKL 1CPZA 3AH6A 5LSRA 3HDSA 1S7HA 1PIEA 3FEZA 1S6OA 3UR3C 1L5UA 4DUTA 4AFFA 4Q45A 4ZVRB 3OTOF 4DUZJ 3T5KA 4KAIA 1HNZJ 1F2GA 3K5PA 3E8OA 1L3VA 3BEGB 5HI7A 4C8OA 1CLFA 3TVYA 2E5LF 1S6QB 4TYAA 4J9PA 3ENQA 2W8LA 1X9WA 2KFZA 2C3OA 5D4LA 4ZLJA 1B7YB 1TKTB 2MTLA 3SMZA 4FBUA 4LFBF 1CULA 4X4VA 1SBRA 4PQUB 4L75A 5C24A 1YRTA 1NKBA 3CC4S 1JLGB 1R89A 1NB2A 2OPSB 3DXBA 4FKXA 3GCXP 3VV2B 1SC4B 3Q89A 3BS9A 2WHOA 3ILLA 1BWEA 2VFSA 2QYGA 2LU1A 4DR4J 4R5PB 2WOMA 3HI9A 3R9LA 2ALZA 1N0VC 1B7FA 3LGNA 5DGAA 4DDFA 4TY8A 3RAXA 2QE5A 3WBZA 1NH8A 2YNHA 2YNFB 4F8RA 1HNVA 2KO1A 2CPDA 2F9JA 4H4OA 2XHWA 1KWMA 4WZMA 1N5QA 2QN6B 2VJVA 3BO2A 5K14B 4DV4J 5LJ3Y 5EN1A 2UP1A 1MG7A 1HWLA 3QGPA 4IFVA 5F41A 3ZTOA 4DCPB 2N82B 3MUTP 3PYFA 3VGTA 2A1BA 3AY0A 3K5MA 1KEKA 2F4FA 5KFLA 5J1EA 1IBCB 2PEBA 1U1LA 1H74A 3G6VA 4NLRA 4DBQA 4U96A 4GRSA 1HKAA 1JLQA 3L9ZA 4WE1B 3W3SA 2MY7A 4YDXA 4OV6A 3T3FA 4ED3A 1RT7A 2KFYA 1RYSA 5LMNF 4FVMA 4B9MA 3MTKA 5A8RA 1WKLA 2MLYA 3D54A 3DRSB 1B70B 2KHDA 2LQ9A 2YX1A 3H2VE 3ILOA 5LL6d 4ECSA 5J2PA 4F04B 2A6MA 2VDHA 2GGPB 3MEDB 4J7CA 2D69A 1NLKL 1FD2A 2NZCA 3FCVA 1NDKA 2DNOA 4NOHA 3M9MB 2BR0A 1VBZA 1RTDB 1CQNA 2DHGA 4ZLLA 1FJGF 5JVGQ 3HJVA 5KG0A 2W2OP 3DI6A 3F44A 4UY85 3K17A 4I64A 3KNGA 3KK2A 1RU1A 1S57A 3TP2A 2GJ2A 4BWMA 3ZXWA 2EW9A 5BYRA 3OLAA 4M5KA 3A8EA 4OI6A 4UF4A 4J90A 2GAHC 5DQIA 5ETMA 5LMNJ 2OPPA 4WU2A 4ZPBA 2FIUA 3GMGA 1C0TA 1V3SA 1YK9A 3RJMB 1RA7A 3BGLA 4KBIA 2F40A 1AT1B 1T0TV 1F2HA 3R5DA 1ITPA 5T41A 5A2QY 3H0PA 1JIHA 1AA1B 3UDCA 4RUAA 1C1CA 4NZ0A 4J9MA 3KLVA 1FNOA 3J80Y 2OEJA 4LSLA 3GJTB 2VA2A 4LF4J 1RT4B 1V9OA 2UV8A 2E29A 4UT4A 3ZNJ1 5IS2A 1W25A 2VB6A 3L7PA 1OM2A 1RLDA 1S4FA 4NLUA 2EFGA 1C4CA 1UWBA 4LQ9A 5A6PA 1SC6A 5I4MA 4AL5A 2VBWA 2XYGB 2BJ9A 1FKOA 1N32J 2NXEA 2EFOA 3R97A 1EHWA 5BJRA 3AXMA 1PAUB 3CB4A 2KZZA 1YBUA 3UPFA 2MYFA 2C2EA 1LNQA 3T19A 3S8SA 3IAS9 2MQLA 1FTCA 1YRUA 2NREA 3LP2A 2OHDA 3N01A 3VZIA 1R0AB 1RSCA 1NAQA 1VQSA 1WEYA 2E66A 5KFEA 3M9OB 5C5JA 4BC7A 1VDHA 1RAFB 2V5HG 1KR4A 3MTJA 4LF2A 1RT5A 1DY3A 1YX2A 3AQOA 4MIWA 2C3MA 4V19X 1P9YA 3NWRA 3OPKA 2GQ2A 1GXLA 2NS1B 5F0UA 4C0OC 3LALA 4DUZF 4X64F 3IG1A 2C2MB 3JAMU 2Q43A 3EJMA 2APOA 5B7WA 2JC1A 4C48A 3ICLA 3EICA 1VJWA 2DNMA 5CD4H 4XTTA 2F5GA 2XO7A 1LW2A 1WHVA 2JNJA 3V6KA 2GQCA 2QL9B 4MK8A 1FKPA 1LOUA 5KFZA 1TL5A 3GFYA 2ACYA 3KWMA 2QLWA 4WFZA 2HGNA 4F0MA 4F4WA 1SJ4P 3BV8A 4B9VA 2CJXB 4U9RA 2LXFA 4OHYA 3PXGa 2R2RA 1VQMS 1DAXA 1S1UA 3GG1A 3SSRA 3BZQA 3MR6A 3MM5B 3TAPA 3AD9C 4NEYA 4QQBA 4UQGA 1HNXJ 3GIIA 4CLFA 2DPJA 5AJ3F 1Q78A 2XI3A 3AOBA 5CZXA 2DR8A 1S99A 1H7WA 2GGPA 5F8MA 2JZ5A 2V8GA 1DHMA 3MEDA 5L8RC 3TUZC 1JK9B 2BE9B 4H4MA 3IGNA 4ES3A 5SZTA 2CUYA 4QWCA 2RDJA 5J2QA 3HHKA 3J7A1 5IQ6A 1TL3B 3MCSA 3ISZA 4DL7A 1RTHB 4CH7A 1TR0A 4B3SF 2ZOGA 2HFSA 4K7QA 1RAOA 4GVBA 2KZMA 1D9AA 3I55S 1L3KA 3DLGA 2Q66A 2DHXA 1JLCB 2ZVSA 3LO3A 3CGIA 3HMJG 1VHFA 3PKMA 4IFVB 3KG0A 4PG4A 2JOQA 1LKZA 2UV8G 3CJQA 4DZDA 3IN5A 2V9WA 4X4NA 2LQBA 3IO1A 5HROB 5GAGU 4QW8A 2UXBF 1X4EA 2KXHA 2MSTA 1S49A 1SXLA 2NXJA 1N5YA 3RRKA 3PW0A 4EGLA 3G6YA 2E1PA 2M9KA 3AWRA 2POKA 2YKNB 2QA2A 4U7UK 1HD0A 3T1AA 3LP1A 3N6LA 4UW2A 3WC2A 2M7SA 1EQMA 2MKJA 3ISND 1TMMA 3M2UA 3KMQA 4QR1A 1AFJA 1PBUA 1N34J 4Q44A 4LVOP 4I4BA 2MKSA 3KDOA 4I67A 2OPSA 2MGZB 2CPFA 4ZDNA 3DRRB 2L41A 2HQGA 4BBYA 2V6AA 4K5RA 5HVHA 4CO2A 1FXDA 4DS5A 2CJBA 4DI6A 1G2EA 2ZH7A 2QLXA 2CPHA 2AIRB 1OPZA 3D6MB 3SFUA 2MMYA 2V67A 2YKQA 1Q53A 3PIOQ 4HDHA 4DQQA 1G1XA 2BJ8A 5L46A 2OPRB 4OJGA 3JYTA 1FK9B 1YGYA 4PWDA 3ENAA 1HR0F 4JI3J 2NUHA 2VQFJ 4ZP7A 5D3GB 3O6QA 2IIHA 2BVZA 3FBBA 2HLUA 3I0RA 4M5DA 1REGX 2YWHA 2BABA 3GIJA 4O4RA 3M8PA 3L3CA 3K8WA 4MK7A 1XNRF 1RISA 4O3PA 4CLUA 2HQIA 4OZLA 4RO0A 4IH6A 5CYQA 5AXKA 5D0RA 3NCPA 1YTYA 3L7OA 3T1HF 3V6DA 3CJ4A 2A2DA 3DRYA 2KT5A 3BBCA 3TJ9A 3SDEA 3DOLA 4AL7A 4NA3A 1OQ3A 1UJ4A 1M5HA 2Z56B 5GAHI 3KLGB 1Q7YT 2QV6A 1R6YA 1N5YB 3X3UA 4X2BA 4CYUB 1WTFA 4Y28C
chains in the Genus database with same CATH topology
3LGMA 3VF0B 3KFWX 2BYCA 3RRGA 1TL1A 4URQU 4IOAQ 2VPZB 4FS2A 1VQ7S 4KIAA 5DO2A 1M5KC 2UVRA 3TA1A 2DIVA 3SSSA 5J1PA 5HMYA 2CVEA 4DSFA 4TLRA 2HFNA 4ZVEA 1QAIA 1QAXA 3PW4A 1DTQB 3KK2B 2DGUA 4P2SA 1TL3A 3O8WA 1I94F 1JNRB 1NJXA 4WFYA 4ICLA 1U25A 2BQRA 1S79A 3FZ2A 2DNNA 2RU9A 3MUVP 4IOBA 4J9KA 1MWZA 3HZEA 3N0VA 5K14A 3PEHA 3E01A 1NHUA 1VC6A 4JUZA 2AJQA 5GMKa 4RNMA 2XTDA 2PI4A 1RWUA 2KU7A 2K1RA 2COLA 5HN0A 2XGPA 1KNZA 3AB4B 4ETXA 1U09A 1VIOA 1P1LA 3PW2A 5AXLA 1HBOB 4WE1A 3C6TB 2KM8C 1UFLA 3HHEA 4K59A 2XMKA 3KLIB 2R4FA 3MM7A 4JI2F 3QYYA 2DGSA 3PACA 3DOKB 3DU6A 3PJWA 1D1UA 1N88A 3WX4A 2HS4A 1FA0A 2BA9A 3R3TA 1ZM2A 1DARA 2HRUA 3CIMA 4YQWA 1B64A 1Z4UA 3R1HA 3BQ1A 3POTA 2G1DA 2XSJB 4CT8A 2NQPA 3K0JA 3HT3A 1BGXT 4PQAA 3RB3A 3BM7A 4NLTA 1BQMB 2DK2A 3M8QB 3H4BA 5KFOA 4LF6F 3D28A 1H0HB 4QWEA 4NLXA 4ELTA 2FPHX 4HT5A 1XNRF 4MMOA 2B4OA 2CG4A 4PG8A 3RB0A 2Y1IA 1IJFB 3DHXA 2IYGA 4OJ1A 1IBKF 4K5SA 2YNGA 5KFFA 3CCLS 2E5GA 3J7Z5 1L3TA 3DN9A 2HHPA 1DURA 5D8HB 4Y2MA 4GC7A 2YKOA 1G6BA 3LANA 5JXSA 1MW7A 1BQMA 3J7YU 4BCAA 4YR3A 2YY3A 2OD6A 1R8AA 3OR2A 4OHXA 3NMRA 4B17A 4QYRA 2VBZA 2J8AA 2XZWA 2PT0A 1KFDA 4W92B 2C2DA 2O3DA 4EYIB 2HS3A 4DL0C 3SCJE 3CD6S 2L9DA 2OFGX 5KFMA 4WFNQ 2MQQA 1Q8IA 2CQ3A 5DRKA 2B43A 3CD7A 3OSNA 4FN5A 1XERA 3MM7B 3RBDA 2VH7A 3ETOA 4ED0A 4HVZA 2W9BA 2WTFA 1VK8A 4PUOA 1ZETA 1VRTA 2FJVA 2VUGA 5J2MB 2ASYA 4XAKA 4C8KA 1Y9OA 1U24A 3V6JA 1AFIA 1X5TA 5J2PB 3IXQA 4DL4A 1S9EA 2EI5A 1HPZB 3B4MA 2M70A 3SZ2A 3M2VA 1RT7B 1LQ9A 1S1TA 2ABYA 2ZD1B 4QW9A 3GQCA 3ZZRA 3BSNA 4DG1B 4RW9A 2ZH6A 4EBEA 2M4MA 3PNIA 1A9NB 3H40A 4DN0A 2CVIA 1X4GA 4DV2F 1S10A 3QLHB 2CQBA 4OZ5A 3OHAA 3US5A 1SQEA 2L9NA 3M6UA 4DQQA 2IMWP 3NNCA 3M6VA 2CDQA 5B09A 3NRBA 2J7WA 4LFCF 3OL9A 4JYAF 4KE5A 1S1WA 4R0JA 4A8QA 4FXDA 1F5CA 4KHRA 3KK1A 2IA6A 4F3QA 4TY8B 5LT5A 3N6MA 4C8MA 5IS2A 2CKWA 1Q79A 4NLDA 4UUWA 4CO3A 2W9AA 4JV2A 1DBDA 4RNFA 4R5PA 4OZJA 1FJ7A 2MZRA 3J7YI 3E3XA 1H3DA