4NLVA

Poliovirus polymerase - g289a/c290f loop mutant
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
461
structure length
458
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSAFSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein, hydrolase
molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 142
structure length 458
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nlvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nlvA02
4NLXA 5KG2A 4HYKA 4LQ3A 4ID5B 1TL3B 4YR3A 3V6HA 3V6DA 2VG6B 1JLCB 4Q0BA 4NLYA 2W9CA 1HNVB 2ILZA 3RAXA 2WB4A 4KE5A 1T03B 1QE1A 3I0RA 3Q8QB 2OPPB 4RU9A 4IRKA 4NLPA 1LW2A 1LWEB 2D41A 2JC0A 3CJ5A 4MFBA 3BSCA 1S1XA 2R8JA 5I42A 3BREA 4RNNA 1S4FA 1R0AB 1JLGB 1EETA 1RTIA 2BE2B 2CJQA 4ECSA 2YNFA 4XO0A 3KLGA 4URQU 4RW8A 4TY8A 3UR0A 4K4UA 2C2EA 2WOMB 3NBPB 2DPJA 2ATLA 4J9MA 3FDSA 4WXOA 3NMAA 4LSLA 1REVB 1OS5A 2BQRA 5KG3A 2C2DA 4IH5A 1BQNA 4R8UA 3QLHA 5F8HA 4IRCA 4ZP7A 5JXSA 5EUHA 3OL7A 4O3SA 1RTJA 5DQHA 4O4GA 1QUVA 2UVUA 3NGDA 3KLFB 3G6VA 2BQUA 3HVTB 4YR0A 1JLEB 3M8PA 3BSNA 3DLGA 3QO9A 4DG1A 2XGQA 2UVVA 2AGQA 1FK9B 4I7FB 2UVRA 5HP1A 3G86A 4RZRA 3PW7A 4ICLB 3PR4A 3CJ3A 3DMJA 5FDLB 4O3RA 1RT5A 1RT7A 4NLOA 3E01B 1IKXA 5K14A 1HPZA 1MU2A 3T5LA 2FJXA 3NAHA 1S1VA 1KHWA 1RYRA 5KFZA 4IR1A 4PUOA 3V4IA 3LP1B 2FJVA 3H2LA 5KFHA 1VRTB 5F9NA 2AQ4A 1RT1A 4NLSA 4MK7A 1XR6A 4IFYA 3KOAA 5C24B 3DRSB 2YNHB 4ZVHA 3BQ0A 3BR9A 1S9GA 4NLVA 1ZTTA 1LW0B 4KKOA 5KG6A 5J2MA 1XR5A 1HQUA 3HKWA 4EBDA 2HWHA 2R2TA 5L1JA 3RB0A 5I3UA 4TYAA 5DG7A 4ZPBA 1NHVA 2YKMA 2ZE2B 4J9PA 4M94A 4ECYA 3DI6B 5KFOA 3OHBA 1S49A 3Q8PB 1JIHA 3CVKA 3H40A 5J2PA 3KK3A 3IGVA 2YNGA 2AU0A 4G3IA 3GQCA 3OL6A 1FKOB 3RAQA 1RTDB 3KLIB 2OPSA 5KT5A 3OL9A 3I5BA 3GV8B 1JLQB 3M8QB 4RW9B 3BQ1A 3DM2B 5DG9A 4Q45A 2GIRA 3PJWA 3JYTB 2JEJA 3N6NA 5J2QB 4IDKB 3GV5B 5C42B 4DL7A 2I5JB 3C6UB 4ED0A 2QV6A 4B3OA 4NLDA 1FKPB 3MR5A 1RAJA 4ZP6A 2D3UA 5KG5A 4R5PA 1C0UB 1DLOB 3DLEA 3LP0B 3IRXB 3DDKA 3KNAA 3PJXA 1RDRA 2W7OA 4ID5A 5CYQA 1TL3A 4RUAA 4XPCA 4J9SA 2FLLA 4ECRA 4TY9A 2J6UA 1HNVA 4KV8B 4J9RA 5C25B 4KFBA 1GX6A 1C1CA 1S1UA 4MK9A 3M9NB 2YKNA 3DYAB 1N5YB 2FLNA 1DTQB 1SH2A 2BRLA 3DRPB 4MIAA 2XCAA 1WNEA 2V4QA 4ECWA 2JEGA 2VA3A 1HYSA 3JSMB 4ED3A 2BE2A 4LSNA 3TAMB 1GX5A 1J5OB 3T19A 2JEIA 3DOKB 1S1WB 2VG5B 4KSEB 2ALZA 2IA6A 3I0SA 3IG1A 4ZPAA 2HNDB 5D3GB 2IC3A 1TKTB 3LALA 2ZD1B 4RW7A 3H4DA 1RA7A 3QYYA 4NCGB 4GC6A 3DRRA 2WK4A 1T94A 3H5YA 4I2PB 4ZPDA 4J9LA 3H5XA 1TVRA 5DQIA 1KLMB 4KHRA 1HNIB 2XC9A 5F8NA 1LWFA 5KT3A 3KLFA 4O44B 4EO8A 3ITHA 5KFXA 1N6QA 4G1QA 1Z4UA 1DTTB 2HWIA 4DEZA 1C2PA 2RF2B 5KT6A 1TL1B 5KFLA 4EEYA 1HMVB 2OPQA 5KG0A 2B5JA 3GV7B 3RB3A 4ZP8A 4MKBA 5KFMA 4NLUA 3DLKB 1VRUB 3E01A 3E51A 5J1EB 2W9AA 4ECZA 2BANA 1RT3B 1W25A 4IH7A 5CYMA 5F8LA 5HBMB 1JKHA 3BSOA 3I5CA 5KFGA 2OH2A 4O3NA 4IFVB 4J9KA 4PWDB 5KG1A 1LWCA 1C0TB 2HMIB 3EPIA 1RT4A 2R2RA 1TP7A 4FS2A 1RT2A 4I2QB 5KFKA 4JV1A 4Q8EA 2FLPA 1S6PB 2ASDA 3MECB 1JLFA 3OL8A 3BQ2A 3OLBA 3CIZA 5DGAA 5F8MA 1IKVB 3CJ0A 2AX0A 3MFHA 1TQLA 1S1TB 1JLAB 4Q43A 3DOLA 3QIPA 1IKYB 3C6TB 4Q44A 3KLEB 1N4LA 1EP4A 5KT2A 4TLRA 3PW2A 1TKZB 2IJFA 1BQMB 4WE1A 2C2RA 3LP2A 1RT6B 3DI6A 4RW6A 4URSA 4RNMA 1RA6A 5EWFA 4NLQA 3LAMA 4IG0B 5KFFA 4MK8A 1RTDA 3IS9B 3CDWA 1HQEB 3I5AA 3PW4A 5KT7A 3KK1A 5EDWA 4NRTA 2XI2A 2IAJB 3KHGA 3DM2A 5DLFA 3H5UA 3JYTA 4IH6A 2XWYA 4O4RA 5J2QA 3TQ1A 3N6LA 5C42A 1SV5A 4KO0A 2IM3A 1K1SA 1S9FA 4H4MA 1FKPA 3ICLA 1TKXB 4ED6A 3MEGB 4QWEA 3QZ8A 2ZKUA 2W9BB 4JUZA 3V6DB 3M9MB 5KFTA 4Q0BB 1C0UA 1DLOA 2W9CB 1JXLA 2HNZA 2RDJA 5HROA 1JLBA 2O5DA 4TQRA 3FFIB 4WFXA 4ZHRA 2B6AA 4MFBB 2OPRA 3IGNA 4IG3B 1D1UA 3KK2A 3V81A 1QAJA 1S0MA 1XR7A 2WHOA 1EETB 3MEEA 1RTIB 4NZ0A 1N5YA 3DYAA 2YNFB 2AX1A 2EC0A 2W7PA 3KLGB 4EBEA 3IN5A 4TY8B 4DL6A 1T3NA 2FVRA 1I6JA 1J5OA 1SUQA 3OLAA 5L9XA 5KFQA 2YNIA 3DOKA 2IMWP 4HKQA 3FQKA 3GIMA 4LSLB 4MH8A 2XCPA 4PQUA 3MF5A 2DPIA 4NYZA 1TKTA 5KFYA 4U6PA 4TQSA 2R8IA 4TXSA 4K4XA 2C28A 4ZVEA 3QLHB 5KFPA 3RB6A 4OL8A 4NLGA 4WFYA 3KLVA 1S48A 4O4GB 2HNYB 3KLHB 4F4XA 4WZQA 2WONA 3M8PB 3QO9B 3DLGB 5JUMA 1TV6A 1MMLA 3KJVA 1T05A 2JEFA 2CKWA 4ECTA 5L1IA 2VG7B 4KHMA 2VG6A 1JLCA 2C22A 5HP1B 2I1RA 1S0NA 1T03A 3DMJB 2OPPA 3KHRA 1RT7B 1RYSA 3UPFA 1LWEA 4JV2A 1IKXB 1KHVA 1TL1A 1MU2B 2RKIB 5K14B 2R2SA 3RBEA 3H5SA 3MEDB 4KBIA 1N56A 2R8KA 4RNFA 1S1VB 3CJ4A 5DQGA 3MR3A 1R0AA 3V4IB 1JLGA 4JV0A 3CDEA 4DL3A 4EO6A 1UWBB 4NLRA 4PUOB 3V6KA 1RT1B 3MR2A 2BRKA 3LAKA 4R0EA 4IFYB 4ED1A 4EYHB 1S9GB 3HVAA 4PWDA 4KKOB 2WOMA 4MKAA 1HQUB 3NBPA 4U7CA 2FVCA 3MFIA 1K1QA 4I2QA 5I3UB 3MECA 4K4WA 1REVA 4NRUA 3H98A 5J2NB 2BQ3A 2IBKA 2R8GA 3MR6A 4EBCA 4F4ZA 5J2PB 1IM4A 4ECUA 4DL4A 2E9RX 1TKZA 4ED2A 1BQMA 3HVTA 1ZTWA 1JLEA 2OPSB 1RT6A 4H54A 4QW9A 2W8KA 4RNHA 2R2UA 4TYBA 4Y3CA 2ILYA 4IKAA 1FK9A 4I7FA 3N6MA 4YQWA 4Q8FA 1HQEA 4ICLA 3GIKA 2XGPA 3QIDA 4ZVFA 2J6SA 3G6XA 2WTFA 4IQXA 2IAJA 1HARA 5FDLA 3D5MA 5KFIA 3M9OB 3BGRB 3PVXA 1ZETA 3UDLA 3EZUA 3DLEB 4M95A 2UUTA 3LP1A 3QGGA 3SI8A 1IKWB 1TKXA 2FVSA 3MEGA 5CYQB 1VRTA 2W9BA 5KG4A 4KB7A 4ZVGA 3RB4A 1S6QB 5C24A 3DRSA 2YNHA 5KT4A 2FVPA 4WXWA 4KFBB 1LW0A 3FFIA 4QWDA 4K4SA 1C1CB 1RTHB 1S1UB 4J9OA 1N48A 4TN2A 4X2BA 2YKNB 4H4OB 4IG3A 4O3QA 2QE5A 4QW8A 4ZP9A 3CWJA 3H59A 4ECQA 2FVQA 1HYSB 2ZE2A 3NL0A 4LSNB 3TVKA 3Q8RB 1S9EB 1C1BB 4RW4B 3BSAA 3I0SB 1FKOA 3OSNA 1T05B 3KLIA 3IG1B 3ISND 4KAIA 5EWGA 2IC3B 4GC7A 1CSJA 1JX4A 1JLQA 3M8QA 4RW7B 2ASLA 4RW9A 3KHLA 5HLFB 3DRRB 4IDKA 2I5JA 1S97A 3C6UA 1U09A 2D7SA 4K4YA 1TVRB 3Q8SB 3BJYA 2HNYA 1LWFB 4F50A 3KLHA 3ITHB 3QZ7A 3LP0A 1N6QB 3QGHA 3IRXA 4G1QB 3GILA 5L1LA 1QE1B 3I0RB 4K4VA 2VG7A 4QWAA 1LW2B 2V4RA 4IOBA 4ECXA 5KFDA 5KFJA 4KV8A 1S1XB 2OPQB 3HVWA 5C25A 4QWCA 2B5JB 1YVFA 5I42B 4ZMMA 3FSIA 3PW0A 3HHKA 4FBTA 2RKIA 2BANB 4Y2CA 4ED7A 4NLTA 3MEDA 3VQSA 1DTQA 3MTKA 5CYMB 3LANA 3DRPA 1JKHB 3ISNC 4RW8B 3JSMA 1UWBA 3TAMA 1LWCB 4YP3A 3T1AA 1RT4B 3GYNA 1S1WA 2VG5A 1RT2B 3CO9A 4Y34A 4K4TA 3PZPA 1JLFB 4YMEA 2UVWA 5D3GA 3T5JA 2HNDA 5KFUA 2IM1A 4K50A 2BR0A 1SH0A 2V0NA 2ZD1A 4R8UB 3SFUA 1BQNB 1S0OA 2UUWA 3H4BA 3DOLB 3QIPB 4O3OA 1D0EA 1RTJB 4NCGA 2WRMA 1EP4B 4XPEA 4DL5A 5EWEA 4QWBA 5J2NA 4I2PA 4WE1B 5DLGA 3LP2B 2WCXA 4RW6B 4DG1B 3OHAA 5KG7A 3OSPA 1KLMA 2XI3A 3NAIA 4ZPCA 1HNIA 2HAIA 4O44A 3EPGA 2JLEA 2D3ZA 3NKYA 1QAIA 3KK1B 1DTTA 3PR5B 3KHHA 2GC8A 1RT5B 2RF2A 2AWZA 1HPZB 3KMSA 1HMVA 5KFEA 5F8JA 5DG8A 4ECVA 4IRDA 1NNDA 1SV5B 4KO0B 4K4ZA 4H4MB 3DLKA 1VRUA 5F9LA 5J1EA 4LQ9A 3BGRA 4QPXA 1RT3A 4IR9A 2J6TA 5HBMA 2V9WA 3SFGA 2R8HA 2ASJA 2HNZB 2GIQA 5KFNA 4WFZA 4WYWA 1IKWA 1JLBB 4IFVA 5HROB 4YR2A 3FQLA 5J2MB 1C0TA 4EYIB 2HMIA 4MIBA 3CDUA 2RDIA 1S6QA 4ZHRB 2IJNA 2F8EX 2B6AB 5KFBA 3GIJA 4F4WA 3PW5A 2OPRB 5KFRA 1S6PA 3D28A 3KK2B 3V81B 3UQSA 2W8LA 3T5KA 2B43A 1RTHA 2JC1A 2YKMB 3V6JA 4DL2A 1S10A 3MEEB 1IKVA 5KFSA 2FJWA 4H4OA 1S1TA 3KLEA 1JLAA 4Y2AA 1IKYA 3C6TA 3FRZA 2AGOA 4J9NA 3KK3B 5KFVA 2YNGB 5KFAA 4FBUA 2IM0A 5KFCA 4J9QA 1SUQB 4FS1A 2AGPA 1S9EA 1C1BA 1NHUA 2YNIB 4RW4A 5L1KA 4ED8A 4IG0A 1SH3A 2IM2A 5F8GA 2E9TA 3G6YA 5T14A 3QGIA 3IS9A 3PHEA 4PQUB 5F8IA 5DGBA 4F4YA 3GIIA 3RBDA 4URGA 4RUCA 4B3OB 4WZMA 4WYLA 2E9ZA 5HLFA 5C5JA 3T5HA 4NLWA 2VA2A 3CJ2A 3KMQA 4O3PA 4R5PB 2WONB 3KJVB 4RNOA 1TV6B 5KFWA
chains in the Genus database with same CATH superfamily
2B56A 1CPZA 4KE5A 2V1SA 1T03B 1LW2A 1LK5A 2ZHOA 5ETLA 3AQPA 2CJQA 4ECSA 4TY8A 3M6UA 2WVCA 3MDFA 3NMAA 1VQNS 4EU0A 3E8OA 1RTJA 2J7UA 1JLEB 4DG1A 1NKBA 3OD2A 4MYUA 2CQCA 4QR2A 5HI7A 2XM3A 1HBOA 2E5JA 1Y9OA 3H2LA 2XYGB 1RT1A 5CYJA 1NDKA 3N9UC 5B09A 5KG6A 2CQHA 4Y00A 2LXIA 4PG6A 2FHOB 5I3UA 1MN7A 3CCZA 1IBKJ 1B70B 5J2PA 1Q53A 3GQCA 1FVQA 3R9LA 4EGLA 4USVA 3MMAA 2ATCB 2GIRA 3D1OA 2AJQA 3M7VA 3KUGA 4ES1A 4CLKA 1TK0A 3U02A 1C4CA 3T1HF 4OV6A 2FLLA 1Y5IB 4ECRA 3NP5A 1RUSA 4N47A 2BM1A 3RBXA 2CQGA 2GMJA 1N5YB 3DYAB 4QJVA 4OX9J 2I8EA 1OY6A 4OV1A 3M6WA 4ERDA 4C8KA 1Q95G 2EG1A 2IC3A 4C3LA 1B4SA 2QJ3A 2QLBB 1TVRA 1KLMB 1VQOS 3QT6A 1F9EB 2WSFC 1MROA 1VRUB 2W9AA 2Y1IA 2KB2A 3I5CA 3D3BJ 4J9KA 1LWCA 4M5GA 4JI4J 2GGPA 2J9CA 1WC6A 1BQMB 3H8YA 2AP6A 4UF4A 1PBUA 4CO2A 2FC9A 3IS9B 1GXUA 3J7YI 1KC8T 2DGOA 3KK1A 2XI2A 3DM2A 4DUYF 4RWXA 4HDGA 1SV5A 1S9FA 1WHWA 2KKHA 4JUZA 2BE9B 2W9CB 3NG8A 4ZOSA 3FFIB 4KT0C 2CNKB 4MFBB 4PG5A 4NZ0A 3RGIA 1FNOA 2YNIA 1Y7PA 4DF4A 3R6GB 4PQUA 1RWNB 1WOPA 1X4GA 4B9LA 1SCJB 4WFYA 1S48A 1M5PC 3THTA 2IIHA 4F4XA 2JEFA 1G1XA 3QJJA 3AHPA 4PZVA 2Z2LA 1T03A 3UPFA 4C97A 2HQ3A 1FF2A 4ZLLA 3QT8A 4DV6J 4ANEA 4DUTA 1SL1A 4DL3A 2AYGA 3QT5A 4JI2J 3QWUA 5GADU 2RS2A 1X4EA 1S9GB 4USWA 2DNKA 3PM9A 2QGFB 1KFDA 5IWAJ 2N82B 4F4ZA 2F5GA 4X4PA 4DR3F 1JLEA 3OT9A 1RBAA 4TYBA 1NO8A 3OUYA 1B64A 3POTB 3GIKA 1TR0A 3P96A 3D5MA 1WORA 1UVIA 4ZK7M 2DCLA 3MEGA 3W2WB 1F0XA 4KB7A 1FD8A 4DR7F 2CQ4A 2FVQA 1QLNA 3K5MA 4LSNB 1M5VC 4KH0B 1R7IA 1CG2A 1RABB 1RCXB 2RDDA 4PXBA 3PX0A 3MAAB 3RBZA 4WIIA 1N36F 3CJSA 3LGHA 3CD5A 4XDDA 3KYLA 2F9DA 5F0WA 4QIVA 4LUBA 2YWFA 3MPDA 4ECXA 2H48B 2YQ1A 4H4KA 2OPQB 4QWCA 2OEKA 3BV8A 2Y8WA 4KHPF 1JMTA 2J9DE 3BPSP 4B9VA 4DSKA 2UU9F 4KC5A 1RT4B 5CD4H 4Y34A 3NS5A 1R8AA 2M88A 1IBLJ 5A2QY 5DLGA 4DU7A 3RRHA 1VQ4S 2IA0A 1KLMA 3OSPA 4ELTA 3ZZZA 1H0HB 3KHHA 1RT5B 4IRDA 2ZVIA 2D1CA 1XNQJ 2HS4A 2LMIA 3G82B 4WKYA 1VRUA 3BGRA 2IYGA 1QAXA 2I6WA 5KFNA 4WYWA 3GZ7A 3JXOA 5LOQA 2RJZA 3OVBA 3V6JA 5KFSA 4JV5J 5KFCA 2HBRB 1SH3A 2IM2A 3IS9A 3PHEA 3UW1A 3AX3A 4URGA 2CZVC 4ZVRB 3A13A 2HHHJ 4NLYA 2W9CA 1QE1A 3RRKA 2CG4A 4DSEA 2DCUB 2B51A 4MFBA 3RW6A 1PBAA 4JI5F 4X84A 5RUBA 3UR0A 3NBPB 3OR2B 4J9MA 3W9JA 1GMUA 2P6TA 3W64A 2C2DA 2VICA 3KNGA 3OTEA 3VGVA 3KLFB 3MM7A 1VIOA 3N28A 2UXBF 3CE8A 3EXCX 3K59A 2ZJPQ 3TNVA 3TJAA 2ZEJA 4KY3A 5C7PA 3GR0A 1MMNA 1RKJA 1S9GA 1X5TA 5A8KB 3ZTQA 2R42A 2EC2A 3KTQA 3QJPA 4KGVB 3H40A 3TEHB 2HHWA 3C8YA 1NXIA 1P9YA 4FF4A 3BQ1A 2MTLA 3N6NA 5AXKA 3PY8A 3NGTA 4ZP6A 2MKHA 3C66A 2ASYA 2JEJA 3BKFA 4WU3A 4W4MA 2ZKTA 3T1HJ 3DLHA 2FZCB 3BBBA 3Q89A 8RUCA 4LSNA 2MSSA 1RJJA 4QIEA 1ZZNA 2XQCA 3IC1A 3JQKA 4DOZA 3H4DA 3MAAA 3DRYA 2ZITA 1MG7A 4K59A 5KT3A 2NREA 1HKAA 4PAAA 3IMQJ 1U6FA 1H7WA 2QL7B 2OPQA 1M5SA 2E1CA 4A8YA 2P9CA 5J1EB 1RWOB 3ILOA 3M2VB 2AYEA 5KG1A 2G2OA 2Y1LB 1RT4A 1AB8A 5KFKA 4Q8EA 5DJBA 3MMJA 3GPAA 2DPIA 1EAYC 5L9NA 1D09B 4ILLA 4FYWB 1SQGA 1K9MT 2KTQA 2YH0A 3B54A 5ETKA 4BHQA 3AJ1A 2IM3A 4DUYJ 2MXYA 3J7ZT 4WFXA 1CS4B 2RH3A 2A0FB 2RRAA 1KD1T 2GHWA 5DDRC 2YKAA 1VQ7S 1D9FA 3L09A 2ALYB 1HI0P 1X7VA 2QSWA 2C28A 2F4VF 2R7VA 3GSDA 1BD6A 2LQ8A 4ECTA 4WP9A 1S7HA 2B9YA 2MLZA 3DMJB 1H2UX 3U1MA 3RBEA 3P8BB 3CJ4A 4Z7YA 3W1YC 2B9WA 3NBPA 3DLBA 3MFIA 3OR2A 2GVZB 4K4WA 1R3NA 1EZZB 3PDNA 3EDRB 2CPIA 2EWHA 4ED2A 3TWZA 1FRHA 1RT6A 4H54A 1FRJA 4Y3CA 1F6TA 5ETSA 4JOUA 5GAEI 2XGPA 1FXLA 3LPYA 1H3DA 4PR6A 1R27B 4L72B 3JQMA 2QLFB 1VC6A 1WI6A 2NCKL 3RB4A 2RS8A 1N5SA 2E66A 4S0MA 5A8KA 1WACA 1DRZA 1EQMA 1TU0B 4OJHA 4H4OB 5FLXY 2QE5A 5C2GA 4DR7J 2H65B 2DNMA 3AY0A 2M0GB 4RW4B 2V63A 3D3CJ 3W63A 1FRKA 2XS2A 3NXZA 3FK4A 2V2ZA 2BYCA 4ZA1A 2E44A 1WF0A 4A46A 4LRDA 3UN2A 3MTKA 5DM6Q 3ISNC 2VFRA 4KHPJ 2QEXS 2ZNZA 4OI3A 2UUCF 3DLLQ 2R7WA 3GJTB 4DPOA 1WC0A 1DY3A 1YJ9S 4DFJA 1AUDA 3MMCB 1EP4B 1RAHB 4M5KA 1SJFA 3GG0A 1ZM9A 1LFWA 1WSRA 2RB7A 3HFZB 5DG8A 3HLUA 5J1EA 3CXCR 3M2VA 1IKWA 2NXNA 3M8WA 2D9OA 5KFRA 3D28A 2YKMB 2J7WA 3FRZA 1RK8A 1QSYA 2GJIA 1KFSA 1D8YA 4O3PA 2EFVA 2P9GA 1RHMB 3EM1A 5BYQA 3T3FA 5HSPA 1OM2A 3Q8QB 3MPWA 1BWEA 4M5LA 3W8PA 1YQHA 5HMYA 5HN0A 1CS4A 3D6MB 2DEIA 2DO0A 2H1YA 4QYRA 5E5NA 2GAHC 1Q1KA 3MGJA 4JI5J 2BVZA 1FE0A 3PJ9A 2DH9A 2ZWOA 4WP3A 1TZ0A 4IH5A 1KR4A 1T9XA 5B0EA 2EFQA 3SCKE 3DKDA 2XGQA 4NX9A 5DS7A 2QRRA 5K8OA 3T9NA 4RZRA 3W7BA 1HIYA 2NLWA 3DMJA 1WELA 3EYZA 2UXBJ 1VHIA 6AT1B 3LP1B 2DIVA 5K5MA 2XMWA 3QQCD 5ETPA 3QRPA 3UN5A 3L95X 4OI6A 2Q66A 2GVZA 1NZ8A 2D74B 4ECYA 2IRXA 3CCLS 2CJXB 3RAQA 2IRUA 3IR7B 2QX0A 2NXEA 3W5ZA 5DG9A 1YJVA 3GV5B 3Q83A 3C6UB 1FKPB 1K47A 3D66A 2D3UA 3EDQB 3LP0B 4X65J 3IRXB 3J81U 4J9SA 1TL3A 4XPCA 2VC1A 4ELVA 4DQQA 2DNYA 2C2OB 3JSMB 4LREA 3TAMB 2HAFA 2MDAA 5D4PA 4DSFA 2DD8S 3LALA 3QYYA 1KSPA 1CC7A 5HJYA 4QIFA 1M1KT 4J9LA 5H9FJ 4HHJA 4KHRA 4OI2A 2B0GA 1DTTB 1U8WA 1CJKA 1S6OA 4DEZA 1NAQA 3PTWA 1CBKA 5E3RA 3GJQB 2O66A 2RT3A 2EG2A 2IHR1 3MFHA 2AJ4A 5D0EA 4Q44A 4JI0F 3MMCA 1EP4A 1NSKL 4KYZA 3FCHA 3F56A 2ZHAA 2V8HA 2EKYA 3HSJA 5C42A 4LF5F 1XMOF 1Q7LB 3SV3A 2W9BB 2CADA 1C0UA 3CC7S 2RHQB 2HVIA 1E6YB 3WZ0A 2XZTB 1D1UA 3IGNA 2ZH8A 1QAJA 1IQZA 4YB6A 1EETB 4BDPA 2AT1B 2W7PA 4YDDB 1VQ5S 1T3NA 2PIIA 3OLAA 1V5VA 1VBZA 1R0CB 5H9FK 1NM2A 2XZ2A 4OLOA 3VZIA 5KFPA 2F4VJ 1RB0A 3DLGB 2VG7B 2XY6A 1URRA 3UDEA 2GQCA 3L3CA 4PABA 4CO0A 3LA0A 1UWBB 2AZ1A 1YRUA 4C8LA 3LAKA 3J80U 3Q0AA 2YX7A 1E6VA 4DV5F 4O0NA 4CO4A 1NLKL 4LRCA 4ZVUB 2FZKB 4MIWA 3DU6A 4RNHA 4C9DA 1HNZF 4ZPVR 1NHKL 5B0GA 5KFIA 1NBEB 1U1QA 3B8HA 4M95A 3LP1A 4B3MF 3SQGB 3VVUA 1S1UB 1ZOTA 4WKRA 1VQ9S 5D77A 3NL0A 4GKKJ 2VBWA 1U1LA 2DNHA 4LF8F 3UNGC 2X51A 5D4NA 4DLEA 3NEKA 3CJKA 3TZWA 3OXGA 1M1HA 3C6UA 4B17A 4UTGA 2AKWB 3SBMA 5IT4A 3LP0A 2XMUA 3IRXA 1Y5LB 1PJ6A 3I0RB 4IOBA 5KFDA 2BDPA 3JSMA 3TAMA 5AXMA 3TVZA 2UUCJ 2VKZG 4OHXA 3I9V9 4TKTA 3UD3P 2V94A 3M32B 2XI3A 4DV2J 4UOGA 1NK7A 1DTTA 4YUDA 1QVFR 2HVZA 4E2FB 2V68A 4DQPA 3NOCA 2QN6B 1PGZA 4JI7J 2E7XA 2HNZB 5U47A 3FQLA 1FO1A 2ZH7A 2F8EX 3A4TA 1AA1B 2DGWA 2AEJA 1JNRB 1TMMA 3MEEB 3HHLC 1IN0A 4B3TF 4I69A 2DRAA 3K57A 4JI3F 4ED8A 3NGKA 3TANA 2XLJA 1T0TV 4NPOA 2EK1A 2FZGB 4R5PB 5HMWA 4P71A 1TV6B 4Z37A 1SJ4P 5KG2A 3CB4A 3GMGA 4NCAA 1E6YA 2OFGX 4IRKA 1PYOB 2R8JA 4HH1A 4I68A 5I42A 3BREA 2XY5A 1EETA 4B9SA 1LK7A 2C2EA 2ZUAA 4K5SA 2LVWA 5J1NA 1JWWA 5IT9U 3OTDA 3CEDA 5DQHA 3DLGA 2LXUA 4NMXA 5E0OA 3WC0A 4FKXA 2FJVA 2YX1A 5KFHA 3GP9A 4MK7A 2ROPA 5HQ8A 4X4TA 1Z1ZA 4UW2A 4DPUA 4ES3A 1SL0A 3VV2B 2VUGA 3UI3A 3OL6A 1FKOB 3DRXA 5KT5A 1Q4RA 1JLQB 3ZZYA 4NE9C 1IBCB 1VQ6S 3TA0A 1H74A 3I87A 1CQNA 3TRGA 3KFWX 3SQGA 2DHAA 3ZXWA 4KV8B 3QPIA 1WOSA 1S1UA 3JSRA 1WKJA 4CT8A 2BRLA 4QU7A 4MIAA 4YEAA 1J5OB 1KVIA 1FWLA 3R5DA 2XB2D 7FDRA 3R2CJ 4ZPDA 3CC4S 2PD1A 5IOLA 1Z4UA 3K5NA 3EGZA 5GVQA 4CNYA 1M0SA 4DX7A 2GA7A 1RAOA 1AW0A 2C2RA 2LQBA 4JI0J 3M32A 4RNMA 3RAMA 5EWFA 3Q8UA 4BBYA 3SIPB 3CDWA 2RQCA 1HQEB 4YN3B 2PMZD 2IAJB 1WF1A 3TQ1A 4WP8A 3EVMA 1XMOJ 4Q0BB 2HNZA 4FYVB 4ED4A 3PRVA 4IG3B 3ZZUA 3HHNB 2DVIA 3MEEA 1SVDA 2HZCA 4EBEA 4USHA 1H38A 3PEHA 2EW9A 2XCPA 1HLWA 1FJEB 2B4PA 4K4XA 2FY8A 1ZAVA 2EI5A 1TV6A 4MKVA 2CKWA 4X4OA 2LDIA 4KHMA 1CULB 3EGWB 1S0NA 5M2RA 1UVJA 5E3AA 2BA9A 3BDPA 2ZBCA 4X62F 2U1AA 4DCPB 4DV5J 2YWEA 3A12A 1RHQB 4IKAA 2CVIA 2GQ2A 4OMFG 3TAPA 1HNZJ 4GKJF 1HNXF 1R6VA 2FJEB 4OYXA 2L9DA 2KHCA 4ZVQB 1K0VA 4B3MJ 3HHEA 1RTHB 3A1YG 3V2UC 3BN7A 3DDNA 3H59A 2QFIA 1NB2A 2PC6A 2UZAA 1FKOA 3I0SB 3KUEA 2OSRA 2V6AA 1JLQA 4LF8J 4I6WA 3H2UB 3EMTA 2C3UA 2FJBB 4RPFA 2JLFA 2IRYA 3D68A 3GILA 4NMLA 3A8IA 3HI9A 4LRFA 1UWAA 4KV8A 3B78A 3VQSA 2AMCB 1IWAA 1G2EA 4QYZK 1M5OC 5BXIA 2CQ3A 2PDAA 1FRMA 3LP2B 4F4KA 2UP1A 5M2UA 4HACB 5CHCB 3PR5B 4U8VA 2BJ1A 3PX6A 1Q7YT 2KH9A 1GNKA 2WBRA 3ZZRA 3C46A 4V1Ak 5J2MB 4DSJA 5KFBA 3PW5A 1NPPA 2OTLS 4K7QA 2B8QA 1Z2LA 1WHYA 4DV0J 1RCOB 4B3TJ 1DFDA 5B0DA 2J76E 5L1KA 4CLPA 4JI3J 4WYLA 1X31C 1FHTA 3KMQA 5C2CA 1HQ2A 2LCWA 1TL7B 3FBCA 5HMZA 5L8RC 4Q0BA 4ZCIA 2PGCA 2DHHA 4ETZA 2GIFA 2YKQA 3BSCA 4IOAQ 3R2DJ 1WG4A 3VGTA 2Z0GA 4LFCF 3OFGA 4RW8A 2BJ8A 2XSJA 2J5AA 3FSXA 4RX6A 2U2FA 2H54B 3K7RA 1OS5A 5KG3A 3PACA 3VTIA 3M2RB 3OL7A 2FJDB 3PYGA 4YR0A 2UVVA 1QY7A 4W92B 1CULA 3HXMA 4C3MA 3PKYA 3HKZD 2J0QD 3NAHA 1T9UA 1VDHA 3AWRA 3K8WA 3MM6B 2QMUB 5CAAA 2R9LA 1S49A 3KDNA 4DZ6A 2YNGA 1VQKS 3I5BA 5KOXA 3O44A 3AD7C 5DRKA 2I5JB 3R3TA 2XY7A 3WC2A 4N76A 3I82A 3LGMA 2JWNA 5KG5A 3QWPA 4OQJA 4J7CA 5IT0A 2DNRA 1VQSA 2H9ZA 3M9NB 2UV8G 2PO4A 1S5ZA 2V8VA 3CCTA 5I4MA 3I0SA 3PIPQ 4NL5A 4CO1A 2RSQA 1T94A 3H5YA 3I6PA 2VASA 2RHSB 5KT6A 2RF2B 4MKBA 4LJMA 5F8LA 3TX0A 5KFGA 1C0TB 2MMYA 1S76D 2MQ8A 4BWJA 1NK5A 3OL8A 4F3MA 4NOHA 3LP2A 3AAWB 4FVCA 1WEYA 1YK9A 1RTDA 1UEUA 3KHGA 2A1BA 1FFSB 3JYTA 2WBMA 5J2QA 2DR7A 2MKKA 4P2XA 1KN6A 6FDRA 1FTRA 1Q0NA 1S0MA 2IFXA 1V3SA 4K5RA 3C15B 4PYDA 3R5BA 2R8IA 5KFYA 4OHVA 2NSCA 1AXQA 3L7PA 4O4GB 2VC0A 4WZQA 3SCIE 4DZDA 4USKA 2C22A 3I4HX 2DNLA 2R8KA 1EKRA 2HFOA 3W60A 3MR2A 2QSFA 2AF6A 2XLKA 3FBBA 4MKAA 1U8SA 1NPRA 1K1QA 2E1PA 1YJ7A 2M8DB 4M5MA 3I56S 2E1MC 3DU5A 4I64A 1X4AA 3M2RA 4DL4A 3D0IE 4C48A 4DR4F 2R2UA 1NSAA 4FYDA 4LFAF 4YQWA 1M5HA 5MAOA 4M5DB 1FESA 2FQQB 3PVXA 4GKJJ 3AJ2A 3DLEB 3ENAA 1HNXJ 1NSPA 4C98A 3RJMB 4ZVGA 2LLZA 4M8LA 2FVPA 1I1GA 1AZSB 4Z7CA 2DT9A 4OIXA 4M5JA 2HHPA 4U96A 1SKRA 1X4HA 1F2GA 3GFZA 1RLCL 5LT5A 3D67A 4LT6A 2DHSA 1ZBTA 2I5JA 1MWZA 5LM7E 4G6VB 3VAKA 1WC1A 3QGHA 4FNIA 1S1XB 1DAXA 1ZM4A 1NH8A 4DR2J 1VISA 2UUBJ 3MEDA 4Q2LA 4ZIVA 1JKHB 4RBTA 4YP3A 4DR5F 1RAAB 1BQNB 1WEZA 4KPCA 4DSLA 5AE1A 2V50A 3CCRS 1JQGA 1O8BA 2HAIA 5LJ3Y 1X5SA 2RF2A 4FYYB 3FJ2A 4KO0B 2VBYA 3NNCA 5F9LA 1L3VA 2Z57B 4QPXA 5D0RA 4IR9A 2KRBA 2L48A 1JLBB 1C0TA 2IJNA 3C16B 3DOMB 2B43A 2OELA 3R7BB 2AGOA 1GH8A 2OHDA 4FBUA 2B7BB 2JZ5A 1J27A 3TZYA 5T14A 4USIA 1KBRA 2M3DA 2QA4G 4QIGA 2E9ZA 1RHKB 3AXMA 4ZS6A 4NLWA 2VA2A 2HEKA 1PYSB 2WONB 1VBYA 1K8AT 4YS2A 1NJIT 5A76A 5DZ6A 3KG1A 3MD1A 2WW8A 4ZPTR 3C15A 2L41A 4XAKA 4LFCJ 2ROGA 1OPZA 5F8HA 3L9ZA 5EUHA 3C19A 3DLJA 4O4GA 2B4VA 2YXLA 3AOBA 3CD7A 4DJBA 2Y3YA 3L4BC 4KIAA 3GONA 2KT5A 4I7FB 4AL5A 5GAHI 4X4VA 2QA1A 1HPZA 4LBIA 5IM0B 5AE2A 2AQ4A 4FYXB 2WVDA 3BQ0A 1FJCA 2Q3PA 2PFFB 3UDVA 1N32F 3KG4A 4M1KA 3IAS9 4M94A 3FZBA 3A3NB 2WVFA 4OYMA 3OFFA 4AD6A 4WFBQ 4XIUA 3HZEA 3TVYA 3V4MA 2DY9A 2JDJA 3DLEA 1RWPB 1VI7A 1SJ1A 4FPIA 4FXVA 1HNVA 1VIXA 3UCGA 4MK9A 2RRBA 2XYPB 1AZSA 3A3OB 2XCAA 4ZCMA 1WNEA 1N33F 2JJ4D 3BGFA 3DOKB 4ZPAA 2HNDB 3D0GE 2F1FA 2UUAJ 2G0JA 5EGYA 3MEKA 4LMZA 2UXDF 3DNCA 1ITPA 1ZH5A 2HWIA 2CJYB 1TL1B 3OR1B 2ZBRA 1UL3A 1N0UA 3RB3A 4OJ3A 1LKZA 2P8IA 1JKHA 4Y6IA 4B02A 4IFVB 1G4CA 3MMBA 1J5EF 3TUIC 4P7VA 3I4PA 2BKOA 2QIFA 1LFPA 4Q43A 3VF0B 3SMZA 3LW5C 1KNZA 3UD5A 4P9SA 1T9TA 3CJRA 2MKYA 5EDWA 4OZ2A 3H5UA 4IH6A 4CI0B 2FJAB 2E1RA 2XWYA 4KO0A 4LF7F 2HQGA 2KI2A 1QTMA 3QZ8A 1A9NB 1DLOA 2P6SA 1JLBA 2C42A 3DOMA 2I9SA 1RTIB 1SBRA 1MWYA 5L9XA 3FQKA 2C3PA 4Q2MA 4Y2MA 2CWXA 2P9EA 4U6PA 3KLHB 2WONA 5JUMA 2VF3A 1XMQF 5AT1B 5HP1B 1OQ6A 3M30B 1IKXB 3MR3A 2O1PA 4F0KA 1FWPA 2FUG9 3HFKA 2W2QP 3MECA 2XMJA 4QU6A 4J9UE 2IBKA 2BKPA 3D0HE 2E5LJ 2NXJA 2FIUA 1B7YB 3HULA 4I7FA 4DR4J 1WEXA 4RLEA 3QATA 2CJAA 4LFAJ 2M9KA 4H4KC 2NR0A 1ZETA 3W66A 2ZFHA 5IM0A 1FX4A 4FNHA 3SI8A 2OFHX 2MQNA 2NQPA 4QWDA 1C1CB 4J9OA 4LBPA 4A8FA 3DGVA 5ETQA 4BCAA 3D6TB 3C3LA 1YJWS 3TVKA 1X5PA 3ULHA 1C1BB 3PYEA 1RU2A 5HLFB 3TO8A 5FLXU 4LF4J 3NNHA 5K8PA 2RQMA 1HI1A 5IQQA 2KYXA 4K4VA 1XMBA 2BACA 3HVWA 4MJKA 3WDOA 2YWHA 1RHUB 4F36A 3M1VB 1ZA1B 2MKJA 1RT2B 2H5JB 1ZPVA 4Q5VA 3THPA 3DHXA 2HNDA 5KFUA 4DR5J 4GMKA 4R8UB 3DOLB 4C8ZA 4ILMA 5J2NA 2OAUA 3SXLA 3NAIA 2VIHA 1Q79A 1QAIA 5GMDA 3OR1A 2DITA 4ECVA 3ONQA 4C4WA 1I94F 2GJFA 2DNNA 5HROB 4IFVA 4EYIB 3CDUA 1TAUA 3PRBA 2ACMA 2WSCC 3UNYA 4UZCA 4DPYA 3KK3B 5KFAA 4B08A 2XTDA 4F4YA 1HBNB 4JI1J 4YFUA 1YJTA 5ETTA 1JJ2R 2IVYA 4LR9A 3OTOF 1B7FA 1CEZA 3V6HA 3KJQB 3NRBA 5F41A 3I9ZA 2ILZA 2D41A 2CRLA 4RBUA 2CJBA 1DURA 1JLGB 2HKEA 1RTIA 3M2UB 4XO0A 3GR1A 1WTFA 3O2IA 3QJLA 2Y0SD 3US5A 1K0TA 1T3OA 2IDEA 1UJ4A 2VJVA 2FB0A 3HDSA 4OJ1A 4F3OA 1S0VA 5HP1A 3G86A 3PW7A 2YBVA 1EB0A 1IKXA 4DWIA 2QTWA 4N8NA 4CLSA 3VVTA 5C24B 3DRSB 4NLVA 2OO4A 1CJVB 1FRIA 1J2VA 1OPIA 3E3XA 1HHQA 3DI6B 4OFZA 2MQMA 2J0WA 2MJUA 5FD1A 2KHDA 4KJIA 4A8KA 3M8QB 1V3ZA 3R5AA 4NA1A 3PJWA 1P1LA 1GT8A 3O3LA 5B0FA 1KWMA 1KTVA 4OI1A 4LF2A 4DFPA 1C1CA 1SB6A 5IC6B 4I4BA 1T9YA 2R7QA 4ECWA 2V4QA 2XBPA 2MB0B 2Q1LA 1SI9A 1WG5A 1N33J 2ALZA 1P8GA 1TKTB 2HW3A 5CCLA 1PC4A 4CLZA 2GFFA 4M5IA 5F8NA 2HPUA 2KG1A 3W5YA 2FPHX 2UXDJ 4K2JA 2CNLB 1QVGR 4O3NA 2MKCA 4PWDB 2XHWA 1RT2A 1S6PB 2ASDA 2RVJA 3RR8A 1J5EJ 3DOLA 2HFUA 2F8MA 2DTJA 3HK2A 2KFZA 3WIVA 3LAMA 2W4PA 2ZDPA 4IG0B 1NPKA 1T9VA 4HI2A 2HQFA 4CM2A 2A18A 1K1SA 4OLPA 4YB5A 1FWKA 3V6DB 5HROA 2IJRA 2ZZTA 1H6KX 2XMKA 4YY3F 3HMJG 3FBFA 2XMMA 2DNPA 2VBXA 3K2YA 4OZLA 4AL7A 3NWRA 2CDQA 2EC0A 3UD4P 3EZOA 1NJXA 5A0YB 3P6YC 4G65A 3O5TB 4OYBA 3B4DA 3RB6A 2FHJD 2Y0BB 4TU9A 1MMLA 1IJEB 3WX4A 4B3SF 3H90A 3G9CA 1A7GE 1EX8A 1S1VB 5DQGA 3LH2S 3NGRA 1JLGA 3PYDA 3R7SB 1KQSR 4IFYB 5T7LB 4F0MA 2GHVC 4O0IA 2PMHA 3HX9A 1CQMA 1F3VA 3T9ZA 1VYAA 1SKUB 4P2SA 3PEJA 2XTCA 1SKSA 3HSDA 4Q8FA 4X64F 2XMVA 2HGMA 1X5OA 2YWWA 1TKXA 5KG4A 5C24A 3DRSA 5GADI 4DV7F 1CJVA 1D3WA 4HDHA 4B9NA 5H1SV 2JNJA 5BR8F 1JJ4A 3NS6A 2CZ9A 3QMQA 5GMKa 1S9EB 4CLLA 1ZPWX 3ISZA 5EWGA 1CSJA 3OTCA 3CW2C 3M8QA 2BUNA 4C8NA 4P2FA 3Q8SB 3PV8A 1Q81T 2ZH2A 3FSIA 2GX8A 2HG4A 2RKIA 3BGOP 4XDCA 1FJ7A 3O6QA 1HR0J 1U1NA 3H0PA 2ZJQQ 3CO9A 1XC9A 3HHLB 4OI0A 4OZJA 1U24A 3QIPB 2NUUG 3N5BA 1W2BR 2MY8A 3SSSA 1KOOA 1T02A 2JLEA 3D2WA 3TA1A 4OJGA 2NPIA 1JK9B 2C3OA 1DHMA 3H20A 1FA0A 2AV5A 5D4LA 1IR2A 1UVMA 3P45B 1Q8IA 1I94J 3MPUB 2MEWA 2B6AB 1S6PA 3QFWA 4K0KF 1IUJA 1RWUA 4NEZA 1GK8A 3JTPA 1SUQB 4IG0A 1NKCA 3GIIA 3KJVB 2BE7D 4MAKA 3V6DA 3PCOB 3TARA 7AT1B 2V2KA 2OPPB 3M6VA 3C14B 4NEYA 1UPMB 3D4JA 1YDLA 2ATLA 3BF4A 5A0YA 4CYUB 4LRBA 2BQRA 1GXLA 4C8MA 4DQIA 4DMZA 2BQUA 3AH6A 2O67A 4LBHA 2AGQA 1VC0A 2DGVA 5LMNJ 3RRGA 2CG8A 3ZTRA 1BC6A 5B0BA 1S1VA 1YG0A 1Y3KA 2ZHBA 1VRTB 4IFYA 4ZVHA 3RYLA 5CZXA 1ZTTA 4ZJLA 3R7NB 3CC2S 3R5CA 4TYAA 2IPOB 2DHXA 4CM0A 1VCTA 1EKSA 2AU0A 4G3IA 2LQ9A 2FC8A 1R8PA 1PAEX 4RW9B 2YPYA 1Q8BA 2XLIA 4B3OA 3MZIA 5DDOC 2CPEA 3GYGA 1QTNB 3KNAA 3N4WA 4J37A 1VQPS 4J9RA 1QM9A 4UOHA 4MT1A 2DRBA 2LFVA 1JNZB 1VHFA 2BOPA 2IA6A 4ZJOA 1RA7A 3BH7B 3CCQS 1U45A 3J7A1 1NJZA 1B0VA 4QR1A 5G4DA 4EO8A 4WCEQ 4QPTA 4C2MA 3D6HB 4WK1A 2V67A 1QJHA 3ZC4A 3UFCX 3BO3A 2VD3A 3AXKA 2OH2A 1FKAF 2KU7A 4I2QB 2ZBPA 2ACYA 4ZLNA 2FLPA 2MGZB 5GAGU 4YOEA 1OY8A 2J9EA 3CCWA 5F8MA 4CP5A 3KLEB 3QIPA 3EGVA 4DV4F 3VCDA 1TKZB 3HFVA 2HFZA 3FEXB 1F5BA 3R1LA 4DV3F 1IXKA 5KFFA 1UPPA 3WX8A 1UUJA 1CJUB 4U7UK 2RQ4A 3N6LA 3HSZA 5L39A 3GU0A 1RWMB 1KOHA 4QWEA 1FE4A 2E29A 4J90A 3ELHA 2B6AA 3LF0A 1N5YA 3DYAA 3TX8A 3U1NA 3J81Y 1SUQA 2OMLA 3G8QA 4TQSA 4C0BA 4D3GA 3PFOA 1X4FA 2ZUGA 3QO9B 3KJVA 3RU0A 3S7RA 1UA1A 2OPPA 3P5TL 1RYSA 4JV2A 1MU2B 1N56A 2XS5A 2K8GA 2A6OA 1LXNA 3C14A 2N3LA 3Q8VA 4Y28C 2G2YA 4KKOB 1HQUB 2K1RB 2UXCF 2X1BA 3QT7A 4CYUA 1MW7A 2PMWA 3ETMA 2BQ3A 5L46A 2X7IA 2E9RX 1BQMA 1VQ8S 1B3TA 5CXTA 2ILYA 3N6MA 1A0OB 3G6XA 2EFPA 3R5JB 3MUVP 4F3QA 4AQYF 4X64J 1YTYA 4NYPA 1VRTA 1WHXA 1S6QB 4J5OA 1ZM2A 1APSA 3MWBA 3FFIA 1OIAA 3ZZOA 2G0CA 4QW8A 3CWJA 5B0AA 4DV7J 2VJUA 4TVAB 3VAGA 5IV4A 3K5LA 3SCJE 3D6FB 5BR8J 4N5SA 4RW9A 3DRRB 3BJYA 1HD1A 2QT7A 1X8DA 3SV4A 2QLXA 3W8GA 3W9IA 1O5JA 3IAM9 3FC9A 5E33A 5CYMB 4J9VA 4P6QA 3GCXP 5HMXA 3Q24A 2XO6A 5B0CA 2AYBA 2CPYA 2GW8A 3UWTA 2BR0A 1UVLA 2ZVSA 1YRXA 2KM8C 4ZPCA 3TEGA 5BYRA 5H9EJ 4MKYA 2XHCA 3POTA 2AWZA 1NNDA 4G1PA 2R7RA 1YGYA 4DV1F 4OYIA 1YSJA 3W2WA 4OHZA 3JQJA 3W2VB 4ZN1A 4C3KA 1BXNA 1U7LA 1S10A 3NLCA 4LIRA 3BH6B 3KLEA 1PIEA 4ETXA 4D3HA 2P2CB 1IQTA 5F8IA 1CJUA 2BJ3A 2RAQA 3RBDA 4B3RF 2HHVA 4LF6F 1VQMS 4RNOA 1T05B 4IQMA 4ID5B 4F02A 1JLCB 2LYVA 4HT5A 1VFJA 1KDNA 2VDHA 1O51A 3CF5Q 2EPIA 3SQOP 2KFYA 1LWEB 1NMEB 3OJSA 1BQXA 2XYHB 1S4FA 3KDOA 2FYXA 2BE2B 3HSGA 1XK8A 1UETA 1NJWA 2HIQA 2GQQA 2OD6A 2R7TA 2LQ5A 1VMBA 1RWVB 3HF5A 5H9EK 1KVKA 3GLJA 2VBZA 5JXSA 4O3SA 1JXEA 4X4NA 1IM6A 3HVTB 3QO9A 4DFMA 2F65A 3GSIA 1FK9B 3TR5A 4BWMA 4DUZF 2DK2A 1RT5A 2PI5A 3E01B 1MU2A 4DR1F 4KQZA 2FJXA 4DCOB 3G82A 4U7UD 1U6ZA 4PWWA 2N4DA 1GMWA 2W4CA 4KKOA 1HQUA 1HFEL 2K1RA 3OBIA 2ZE2B 2DGUA 3UCUP 2CWKA 2AZ3A 1VRQC 5D6GA 1BLUA 2XULA 3NGSA 5GMEA 4PG8A 3MR5A 3CMQA 3AOAA 2XO7A 3PJXA 2C3MA 4FP9A 4TY9A 2JX2A 5C25B 2EFGA 1NZAA 3HT0A 5IS2A 1NDLA 2W4DA 4F2SA 2DXEA 4ED3A 2JEIA 1IR0A 3D1HA 3GB0A 3BYPA 2C1EB 5D3GB 4JI8F 1ZAXA 1VOMA 4WTYA 3HCXA 3DRRA 2WK4A 1WI8A 4LVNP 1NEEA 3KLFA 3DN9A 2XMTA 4DR3J 2MHNA 3BGUA 1TUGB 5KFLA 4B9TA 5IT9Y 1WF2A 3HM9A 4ECZA 1RT3B 5CYMA 2HBYB 1RBOB 4BLGA 2WW4A 4I6AA 2R2RA 3NMRA 5DZ7A 1R89A 3OLBA 2B3TB 5DGAA 3CJ0A 2AX0A 3U7JA 1IKYB 3AD9C 4FDFA 2KXNB 3TUZC 4DV4J 2F63A 3KWMA 3FBEA 4V19J 5KT7A 1RAGB 4DV3J 4DBQA 3IM9A 3GTYX 4E98A 1BWVA 1N36J 3MR7A 2ZKUA 4ZLJA 1NU4A 2VB6A 4CLTA 1M5KC 5L38A 2E5IA 4DX5A 3OW2R 1IBKF 3R27A 3K5PA 2KVIA 2DXDA 2OUGA 4AXJA 2OMOA 1PJ5A 5KFQA 4OI4A 3GIMA 2HHTA 2A3JA 2UU9J 1Q16B 4NYZA 1S59A 1DJ0A 1NKEA 3KLVA 2HNYB 2V4JB 1T05A 1JLCA 4A8MP 4QIWD 4RO0A 2DGTA 1H98A 3IRWP 1LWEA 5KAKA 1MN9A 4R0EA 4PQAA 5LSOA 2FVCA 4UUWA 4FKYA 2Q79A 4HTJA 4I1TA 3HVTA 1ZTWA 2OPSB 3BKUA 1XN9A 1KLNA 3KUHA 4A8QA 1FK9A 4FVMA 5ETVA 1R31A 3B6BA 2K7JA 1OWXA 4AQYJ 2CJ9A 4MTPA 3N0VA 1Q5YA 3G96A 2YKOA 4EWTA 3S6EA 3T6JA 2YKNB 5G0RB 4O3QA 4A47A 1HYSB 2L9NA 2ZE2A 1O6XA 2W1BA 1EJ7L 2HQCA 3BSAA 2OJ3A 2HFVA 5M2PA 2RUGA 4DLGA 1ROFA 5B7WA 2MQQA 4G1QB 2OGUA 3VGUA 1NUEA 4KGXB 1LW2B 2ZWPA 5KFJA 1SC6A 1G3OA 1FVSA 5C25A 3VALA 2AHOB 3LANA 2DRDA 4CCHA 4HVZA 2KJWA 3GYNA 3R6LB 2DO4A 4YMEA 5D3GA 3M8SA 4USTA 5EX0A 3GG1A 1RTJB 2JFDA 2IVMA 3G87A 3FEZA 2AJ0A 4RW6B 4DG1B 1NK8A 2L3MA 2G9OA 1WUUA 4HLBA 3NKYA 1LOUA 2C2MB 2CXEA 3FEYB 2JL9A 1ZAWA 3Q8YA 1AFJA 2A2DA 1RT3A 7FD1A 2WB1D 2RRNA 2PSZA 2DR5A 2OLWA 2ASJA 4YR2A 5D0GA 2ZZMA 3HP6A 5D15A 2HLTA 3JS9A 3I55S 2MHEA 4DV1J 2DNZA 2W8LA 2JC1A 2FJWA 2C2NA 4H4OA 1IKYA 2VL1A 5T41A 2NYIA 2CPHA 4RW4A 1IBMF 3EWGA 3G6YA 3MMAB 3QGIA 3CJ8A 3ILLA 4WJBA 4RUCA 4B3RJ 5IQ6A 4TNOA 1WC5A 5K9FA 2FHMA 4LF6J 2VG6B 2W2MP 1UZHA 3JB9k 4FXWA 3Q22A 1R0AB 1FEHA 4PPZA 4K4UA 3T1YF 2WOMB 4ZCLA 4WXOA 4WU2A 2Z58B 4IRCA 4C0HA 3NGDA 2V4JA 4RL1A 1HNWF 4HEA9 4O3RA 5FDLB 4DUZJ 4IR1A 1S79A 4LR8A 2HK3A 4YHHF 4F2RA 2YNHB 2SXLA 3BR9A 1IBLF 2K2PA 1UCNA 1XR5A 4FPRA 1F9FA 1OMSA 1V9OA 2HIYA 3G8TA 2F4FA 1NHVA 2YKMA 4J9PA 1FFGB 4CO3A 1JIHA 2OPSA 4FN5A 4DPXA 3DM2B 1GQEA 4ER8A 2BJDA 1Z2ZA 1WHVA 1UMJA 2KYZA 1VK8A 2H5IB 2NZ4A 2YKNA 2WSEC 1HYSA 2HYIB 5IV3A 3ENVA 1S1WB 2GMHA 1OYEA 1H7XA 4WBFA 3VAHA 4JI8J 2HHHF 1WJ9A 5ETNA 1UA0A 1L3TA 1RTZA 4L6V3 4G1QA 1I3OB 4ID8A 2NPFA 1U2FA 1U2RA 4P52A 3BKTA 3TAQA 5KFMA 3FMWA 4LF9F 1OY9A 3FKBA 2HMIB 3IA0A 1RGVA 4ED5A 2ADBA 4NA2A 2CQIA 3C6TB 1Q5VA 4TLRA 4W98A 1YZ6A 4RW6A 1RLDA 4DN9A 4NLQA 3OUYB 1GFWB 1W2IA 4NRTA 2MPUA 5DLFA 3F41A 1FDAA 2C3YA 3OTBA 1FKPA 4X4QA 3MEGB 4HI1A 1V3RA 4TU7A 2IMOA 4TQRA 4OZNA 2VPWB 4C11B 1N34F 1RADB 1GXTA 1V6HA 1XR7A 2WHOA 2BJ7A 1K44A 1UW9A 4N7TA 1RACB 1YITS 1U6BA 2E5HA 4OL8A 4QOTA 4GVLA 1OYDA 4ZLPA 4JI6F 1U1RA 5CABA 3EICA 2VG6A 2H4WB 4O23A 2HRYA 1YBTA 1U4BA 3NCRA 1R0AA 4X4SA 1T9WA 2BRKA 3CMES 4DSIA 2WOMA 4BC9A 2CPFA 2CUYA 4UQTA 2ROEA 5HJXA 5SZTA 1XJWB 3RZAA 4ECUA 4QW9A 4PCQA 1TMJA 2G2ZA 2J6SA 2W7AA 5FDLA 3M9OB 1HBMB 3BGRB 4DCJB 4ZPWR 3SSRA 1U1PA 1WDDA 2UUTA 3K8VA 2MJNA 2VFSA 1VBKA 2W9BA 2HGNA 1QSLA 3W61A 3MAQA 1MSWD 2YNHA 3AOCA 4K4SA 1WC4A 4X2BA 4ECQA 4NASA 4C6AA 5E41A 2ASLA 1MWQA 3BZQA 1ICEB 1LV5A 2CPDA 4F50A 1S72S 4AE5A 3PO4A 1QE1B 2VG7A 3IBCB 3CD6S 4F67A 2VFTA 4ZJQA 3CO0P 1HHSA 1UWBA 2AEFA 1S1WA 1LEOA 4DQRA 2UVWA 1SH0A 3SFUA 3ZZPA 1D0EA 4XPEA 5EWEA 1UTAA 3MM7B 5IFMA 3N01A 1U0SA 3GJSB 4OX8A 3AJDA 5KFEA 1FNMA 2GVDB 3I96A 3CCES 1U26A 2HMIA 3PHTA 1DQ8A 2HS0A 3R5GA 5D0HA 5IXUA 3VQTA 3C6TA 2CNNB 1GMWD 2HVEA 3N5FA 2XTJP 1KKHA 4J9QA 4FS1A 1KTQA 3GFXA 1PILA 1IBMJ 3VR1A 1DZ5A 2LP4A 4NI2B 4FF3A 3CJ2A 1TUVA 1S99A 5KFWA 2A10A 1WTBA 3I0RA 2CA9A 3SZ2A 3HD1A 3LO3A 4NLPA 1RHRB 4C11A 3HVRA 3GFYA 5LJ5Y 2CPJA 4X66F 3MD3A 3CCMS 3FDSA 3K5OA 3T1YJ 1REVB 3PX4A 1OSDA 3LOUA 4YDXA 2EBGA 1UJ6A 2UVRA 1HNWJ 3ZFVA 3CJ3A 1OJ4A 2IVFB 4B9UA 5BYSA 1FRLA 2BW7A 3UE2A 5F9NA 3M6XA 4RBVA 4LF5J 4OYZA 1B0TA 4YHHJ 1LW0B 1UVKA 1UJ5A 2EBEA 2HZAA 3M8YA 2KN4A 3KLIB 3RG6A 4N41A 2RIJA 2G1DA 2Z2ZA 1W7WA 2O3DA 1HBMA 3NS7B 4R5PA 4DU8A 3DDKA 3MM8B 2J6UA 4U67Q 3W65A 2V34A 3L7UA 3VGSA 2JEGA 2VA3A 4P2MA 3IR5B 1YX2A 2VG5B 2HHSA 2N4CA 2HFNA 5DETA 3B4MA 4ATNA 1NDPA 3LGNA 4QYZJ 3AA8A 3J7YU 1C2PA 3UN3A 1AUSL 2BXJA 4CH7A 4LF9J 2X3GA 4OZ1A 3JAMY 1HA1A 2G1HA 2ERRA 4Y65A 1AFIA 4XK8C 3MM5B 3BQ2A 2V2QA 2BX6A 1TK8A 2IJFA 1R8BA 1RT6B 2NXCA 2MZTA 1BHNA 4CT9A 3M8ZA 2RU9A 1NJYA 2OKQA 5E3CA 2VOOA 4O4RA 5ETRA 4USJC 1AROP 4ED6A 4UY85 2V8PA 2GVDA 5KFTA 1JXLA 3E2EA 1FDDA 2RDJA 2O5DA 1HWLA 2L08A 1N5TA 3WBZA 1N34J 4V19X 1S4EA 4DX8H 1FDBA 1J5OA 4HKQA 1N5QA 3D9BA 1Q86T 2XZDB 2AW0A 4NYOA 1VLOA 4NI2A 4X65F 1JB0C 1SL2A 4CNZA 3ADAC 4E0DA 1TTHB 2M52A 4JI6J 1FX2A 3F0NA 3DDIA 4PG4A 2DNOA 1RBLA 4RNFA 2I2YA 3PIOQ 3CDEA 4EO6A 1EQ0A 2HSEB 4EYHB 4QR0A 1GEHA 3CJQA 1REVA 2CFXA 3MR6A 2V1TA 2YWGA 4OZ5A 4WTOB 2QG9B 1HQEA 3MI7X 4PXEA 2IAJA 4OHYA 4RU2A 2GJ2A 2LA4A 3UDLA 1X9SA 1IKWB 3BBFA 1SC3B 2V9KA 2DISA 1YLXA 1T8EA 4GO5X 4KFBB 1LW0A 4EUVA 3OVSA 2DKOB 2BKNA 3TQEA 4IG3A 2YY3A 1QUPA 1PC5A 1SIWB 4QCLA 4DR6F 2V8DA 3ZZTA 4CWBA 3KLIA 3EUNA 4JP8A 1KQGB 4EZ9A 4RW7B 4LF1A 3OQ2A 3RUBL 2QL9B 3ITHB 2ZC3A 3MM8A 1S6UA 3BR8A 5IZHA 5D8HB 3T6BA 4FBTA 2BANB 5D4OA 2YQ3A 4CO5A 1H73A 1TL4A 4CQ1A 2VG5A 2E1AA 1URNA 4K4TA 1S7IA 2HURA 3TOQA 2QZ8A 3R97A 5EX3A 3P49B 4WE1B 1X60A 1JJHA 4KPYA 4KH1B 4U9RA 4GVBB 3EPGA 2FTRA 1NRKA 1V5IB 3KKFA 2ZM6F 2W25A 4ZKAA 4LR7A 3KK2B 3MM5A 4ZIWA 1RTHA 5HQLA 2NYHA 2K06A 2QMWA 4J9NA 1U1KA 2DGQA 3A8EA 2E9TA 2LEPA 2DB1A 4NXNF 2DJWA 4HHHA 3AODA 1WKLA 2YX4A 4EK2A 3WIUA 3TI0A 1TL3B 1OSCA 2CDRB 4RU9A 3CJ5A 4GKKF 2V2VA 4RNNA 1GTEA 1SXLA 2HBQB 2PEHA 4ENOA 4R25A 4X66J 2DR6A 1NB7A 2ZNYA 4ZN3A 2ZOGA 3IM8A 2AYMA 2RNEA 3B82A 2CQ1A 2ZH1A 1TFWA 4HACA 1CJKB 4PKDB 3WHIA 4OYAA 1H2VZ 4TLQA 3OFEA 3CCSS 1N52B 5J2MA 3HKWA 4EBDA 5DG7A 4DV2F 4LSZB 2EFNA 3GYXB 1UEKA 2VQFF 1D9AA 2VDIA 1BGXT 3WQPA 1YJUA 4IDKB 2YWKA 5C42B 3OPKA 1VBXA 4LIWA 2QV6A 4JI7F 4NLDA 3MUMP 3ZNUA 1YIJS 2HRUA 4L73A 1C0UB 1TL7A 2YVSA 3A8JA 3IO1A 1VQLS 4KFBA 2HGLA 3FMBA 1X4DA 1DTQB 1SH2A 4CIOA 3JTNA 4KSEB 2VQEF 4RW7A 1RWWB 1G7CB 4X62J 4GC6A 1ACMB 2JHEA 2R7SA 4M5NA 3DC2A 5DQIA 2XC9A 2K3KA 2QFJA 1YZ7A 3ITHA 5KFXA 1HWJA 3CCVS 1FCAA 4XTTA 1QSSA 1HMVB 2BM0A 4CH1A 3SDEB 2BANA 1REGX 3FSYA 1E6VB 1LQ9A 2XNQA 2BJ9A 4DQSA 1D9DA 3MM6A 2LXFA 2OEJA 3GFHA 1KVJA 1N4LA 2DH8A 3EX7B 1R43A 5KT2A 3RTVA 1PG5B 4WE1A 4F7VA 4URSA 2CJKA 4DS5A 2HK2A 2BBEA 4GVBA 2LEBA 2ZH9A 3PW4A 2HQIA 3U27A 2IDLA 2MKSA 1T95A 4CH0S 1IWGA 1U48A 1U0HB 1NSQA 3KJNB 3CULA 3HZGA 2KDOA 3KK2A 3FCWA 2DGXA 2AJ1A 1NK9A 4I0WA 5HANA 1BUXA 1N88A 4C7QA 4B9MA 3CJKB 3MF5A 2W2PP 4F25A 2XWXA 3CT9A 3M05A 5L1IA 5GAEU 2I1RA 2I38A 4I6YA 1R0BG 2MQPA 3W9HA 2HBZB 3EJMA 5A2QU 4JV0A 1WOOA 1FXRA 4M63A 4ED1A 3HVAA 1R6YA 2MLXA 2R3VA 3HD2A 4FF1A 2R7XA 3QGPA 3UO0A 5AE3A 3ZNJ1 1IM4A 2BABA 3NGUA 3FVYA 4FF2A 3NOGA 2B9EA 1SJ3P 1UFWA 2WTFA 1HARA 3HJFA 5BJRA 3EZUA 2Z2YB 4EFAC 1FNXH 3SCLE 3J81j 2GHPA 4I56A 2PE8A 1ZA2B 3OVAA 4P75A 4RKUC 3OSNA 3G4SS 2KM8B 3IG1B 4DR6J 2OSQA 1WG1A 4IDKA 1BE4A 5ITHA 1SIZA 3LQVA 1N6QB 3IP0A 3G8SA 4AYBD 5I42B 3TZXA 3SYZA 4ZMMA 1X0FA 3HHKA 1DTQA 3T1AA 3CNQP 1KRPA 2HRTA 4OYOA 3T5JA 1S0OA 2Y9HA 3ILJA 1L3KA 2MZRA 4Y2KA 3H4BA 2QA2A 2F7VA 1RAEB 2V8GA 3Q2SC 2CVEA 2W2OP 4N77A 2KG0A 2D3ZA 1UFKA 2JLGA 1UZDA 3H2VE 5JMNA 4DS4A 1HMVA 1ZM3A 3BGLA 4M5DA 2W2NP 1FJGF 3SDEA 3OJUA 5EHHA 3MXHP 3P4UB 4USUA 3LWMA 5JVHQ 3DCAA 2EVZA 3SFGA 2R8HA 2ZM6J 4WFZA 4OZ3A 1FERA 2OPRB 1F5AA 2KJVA 3PFEA 1NDCA 3ENWA 1NHUA 2PN6A 3AA9A 1YHQS 3KG0A 1RISA 4NXNJ 2GV1A 2ZJRQ 4IH7A 3DFEA 1U1OA 3U1LA 1U0HA 4L75A 3RAXA 3NNAA 4OZ0A 4U95A 1X9WA 1S1XA 3QAEA 1VGYA 1X4CA 2G13A 1MMDA 2B8PA 2BOAA 3N79A 4A8SA 2PEBA 3ET6B 5I3QA 4CTAB 1BQNA 1W26A 2VODA 4HTIA 4LRAA 3R1HA 5HATA 2J0XA 3ILIA 3TJ9A 1B0PA 2Z56B 4I67A 2QL5B 3VZHA 4CRJA 5ETOA 3HJVA 3MCMA 4MYTA 4ELUA 1TAQA 5AXLA 3X1LB 1I51B 1KEKA 3C16A 2XSFA 4ZPBA 1JXVA 1TL5A 3IXQA 3J7Z5 3Q8PB 3CVKA 3IGVA 3S8SA 2GS8A 1UFLA 4QBUA 2VQFJ 4DL7A 2KXFA 1K73T 5A8RB 2QMXA 3PYFA 1RAJA 1RP5A 2DEJA 2MZQA 1RWXB 2KZZA 4Y2IA 3ENQA 1TUWA 3MM9B 4P74A 2WZ1A 4L3NA 4DV0F 2FLNA 3IBWA 2NXUA 3IG1A 3CCUS 2D9PA 2VQEJ 1RE1B 4NCGB 1HNIB 1CJTB 4G1IA 1N6QA 4N56A 2ZBQA 1ZYQA 2GZOA 5MLCV 2RD5C 4PWUA 3DLKB 2YPZA 1SQEA 2RMLA 3HO1A 1TP7A 4FS2A 4F4AA 3CIZA 3SSQA 5AXNA 2RUSA 1UW4A 1KONA 1SC4B 1WKKA 2CPZA 4NWBA 3QRRA 5HQMA 5CQGA 3IBFB 3M9MB 2NUHA 3OFHA 5THWA 2OPRA 3GE9A 3LWLA 5F0UA 3KLGB 3W3SA 3LPEA 4UOFA 3TA2A 4DDFA 3W62A 4DL0C 3DOKA 1FT8A 1HWIA 1JJCB 2ZH3A 3SEOA 1U02A 2BV3A 2KL8A 2ZOMA 3MURP 3M4XA 2MY7A 4NLGA 1YI2S 3K58A 4NCBA 2KFNA 4AT1B 4IO9Q 2JVOA 2HFSA 1WWHA 4HT7A 2DNGA 1RT7B 1TL1A 3H5SA 4KBIA 3MTJA 4ZVOB 4PUOB 4DFKA 2LU1A 1BMQB 2MSTA 2D3OR 2AJFE 4P73A 1PYTA 3FNNA 3ET6A 2MKIA 2B7CB 4CTAA 3TZZA 1PCAA 5AJ3F 3UVJB 2HHUA 2PT0A 2H3EB 3AB4B 1C4AA 4EMDA 3CTRA 5HVGA 3QIDA 2LECA 2LU2A 3QGGA 1O0PA 1VJWA 2J8SA 3Q23A 3K17A 2CQPA 5DDQC 3ZTPA 4EI2A 2L9WA 2YKPA 4M5HA 2F40A 3KHLA 5E7OB 4AXIA 2K3IA 3A8KA 1S97A 2J0SD 2OIHA 2EXUA 2D7SA 5A8RA 3KLHA 2FHKA 4RJVA 2LQJA 3NY0A 1N54B 2V4RA 3MM9A 2B5JB 3M30A 4PPDA 4UT4A 3MOJB 1WSVA 4NLTA 1OQ3A 3MCOA 4RW8B 4IUFA 1CC8A 3BYRA 2XSJB 3GCWP 3BDEA 2XEXA 2M2BA 2IM1A 3TJ8A 2UUWA 2WAQD 2FLOA 3CGIA 4NCGA 2WRMA 4DPWA 4EZ6A 4HL9A 1N32J 3LUYA 3OHAA 2LA6A 1HNIA 1CJTA 2LEAA 4QQBA 1YJNS 2Y8YA 2DR8A 3KMSA 1LNQA 4H4MB 3DLKA 3R8YA 1RU1A 2V9WA 1FJGJ 3AT1B 2RDIA 4F4WA 2D3O1 2CIMA 3V81B 2V5HG 2E7VA 5E3QA 2YNGB 1NCLA 1Y00A 2IM0A 2A2CA 3FGVA 2FY1A 1C1BA 5CD4A 5DM7Q 4CLFA 5DGBA 4A8OA 4WZMA 3TW0A 5HLFA 4C8YA 3S01A 4DN0A 3A3PB 1UP1A 4NLXA 4LQ3A 2BEFA 4YR3A 2VPZB 3EE3A 5FIIA 3MPYA 2JRSA 3LTOA 2DNQA 1CVJA 3M1VA 3KLGA 3BPDA 3BO2A 2OEMA 1YKWA 1ZZFA 5KOWA 5ADZA 4R8UA 2B9XA 5IC4B 2FGCA 4RUHA 1VJQA 3G6VA 3BSNA 4PG7A 1UAWA 4DR2F 3PR4A 2UUBF 5LSLA 5HVHA 1RT7A 3T5LA 1RYRA 5KFZA 4PUOA 1GTHA 2QO3A 8ATCB 4LF7J 4C8OA 4P10A 4E8UA 1FEEA 2CQ2A 2HWHA 2I0XA 5L1JA 3RB0A 2GAGC 3UVJA 4KRWA 4AFFA 3OHBA 3KK3A 2JOQA 1RTDB 3OL9A 3GV8B 3JYTB 1Y11A 5J2QB 1HBNA 2OTJS 4P72A 1G6BA 2NSBA 2MQLA 2H5EA 5F3TA 1L5UA 5HAOA 1XMQJ 3DRPB 1SJRA 2KT2A 1GX5A 3M2UA 3T19A 3L7OA 2KZMA 2O01C 2VU5A 1PO6A 1VLYA 3IFEA 2M7SA 3KXDA 3CPWR 4I2PB 1EIYB 2YQ0A 4ANCA 2CPXA 4O44B 5HL7Q 1NH7A 1VC5A 5CZVA 2B5JA 2BW2A 2VV5A 3BSOA 1YWXA 5HVFA 5JVGQ 3IWLA 2DIUA 3FUYA 2WVEA 2QLWA 2Z30B 1S1TB 3S1TA 3PW2A 3V5RA 2CQBA 3DI6A 3MCNA 2X1AA 3BN4A 1HWUA 1HW9A 4KTQA 3W5XA 4H4MA 2Z8QA 5LXRA 2HHQA 2CNOB 3V81A 4RR5A 3VAMA 5GAGI 2WVBA 2YNFB 2VPXB 2AX1A 3M8RA 1I6JA 4BS2A 4OX6A 1RZMA 3NWGA 1TKTA 4ZVEA 3QLHB 3D7SB 3M8PB 3AFGA 1UVNA 4ANDA 2PI4A 1DQAA 1FXDA 4DI6A 3MPVA 5K14B 3MEDB 1N8RT 2CZ4A 3IR6B 1GAOA 2GCFA 3V6KA 2VHGA 3F44A 4RWWA 4CLYA 3IWNC 4PWDA 2V69A 2UUAF 1YBAA 3PNIA 2R8GA 5AJ3J 2C2KB 4EBCA 1A6LA 1U25A 1HI8A 1XWLA 1DARA 2EEYA 3RR7A 2PA8D 3CUNA 3I32A 3MOZA 2FVSA 5CYQB 2W01A 3OTOJ 3O8WA 1YJRA 4TN2A 4YB7A 4NXMF 4PYAA 3TUPA 1HW8A 2BJEA 3GWCA 5J1PA 3Q8RB 1FI4A 3GIRA 1S77D 2YTCA 2MYFA 1HD0A 3EVOA 3ZO7A 1U09A 3QFHA 4RUBA 1YRTA 2GNKA 4LFBF 4OYWA 5ETMA 3VAJA 1LWXA 4USMA 3VWSA 4PRFA 1B99A 4ES2A 3DRPA 1QAYA 2P5VA 5T7LA 2DH7A 1JLFB 3K89A 2COLA 1QDUB 4O3OA 4F8RA 4I2PA 1I5OB 4DX6A 4O44A 4OYPA 3OXFA 2GC8A 5KTQA 2CAJA 1HPZB 4Q7AA 2ZH5A 2H4YB 4W90B 3QNWB 4ITSA 2BMBA 2CQDA 2GIQA 4BC7A 1Q82T 4MIBA 4ZHRB 2E5LF 1KQFB 1S1TA 4KGKA 1S9EA 5CCMA 5A6WA 1H2TZ 4L76A 4ZVPB 5F8GA 1M1GA 2NZCA 3TYTA 5C5JA 2J8AA 2X1GA 3JTOA 2BZ2A 4HYKA 2IYIA 4ZVSB 1HNVB 2AIRB 2WB4A 2JC0A 4KGZB 2F8HA 4WWSA 1EHWA 1WDTA 2YNFA 2FHJA 4J91A 1TELA 3HHDA 1KQKA 1H72C 4LF4F 2DPJA 3HHLA 1WC3A 3H7HB 3QLHA 2VONA 4ZP7A 1QUVA 4NZ6A 3M8PA 4C0OC 4NA3A 1UKUA 5K14A 2MZSA 1TK5A 1HHTP 3MMBB 1DBDA 4NLSA 2DGSA 3KOAA 3UCZP 1AT1B 1FRXA 1Y10A 1F60B 4GRSA 2GO8A 4YY3J 2PFDA 4P7TA 3GJRB 3TP2A 5KFOA 4IO1A 2Y1JA 2Q43A 3DGPB 2UV8A 2HQDA 4Q45A 4ED0A 1RWKB 3OV7A 1DLOB 3CIMA 1RDRA 2W7OA 1UEVA 5CYQA 4RUAA 4B3SJ 1GX6A 3G2XA 1LXJA 3UR3C 5K20B 1RI7A 2FD2A 2OP5A 3NCPA 3CDBA 4JI1F 4JBCA 2ZD1B 5LL6d 2EKNA 4PXDA 4CLUA 2Z2MA 1XNRF 1L3UA 4EEYA 2MZJA 1X9MA 5KG0A 3GV7B 5CH7B 1FDNA 1W25A 5HBMB 2EFOA 1OO0B 4JV1A 3MECB 1JLFA 1ULRA 5DO2A 1Y3JA 2E7WA 2JVRA 1JLAB 4DPTA 5A6PA 3PKMA 2LDYA 3DXBA 3JAMU 4F26A 5A8WB 3QAUA 3I5AA 4LVOP 4F0HA 4CZCA 2K7KA 2MZ1A 2Q6CA 3TUJC 4ZHRA 1XBWA 5E2QA 2NS1B 1T11A 2VFVA 2FVRA 4UUXA 2HS3A 2DBBA 4LSLB 2M70A 2ABYA 1FD2A 2ZH4A 2CQ0A 3MCSA 3BM7A 3J80Y 4A4JA 3KHRA 2D68A 2X1FA 3V4IB 4IOCQ 2VH7A 4HH0A 2JFKA 3PRDA 3DHWC 3T41A 1RHJB 4FZVA 1RQ0A 1WD6A 4I2QA 2MGZA 4AL6A 2AJ2A 4NRUA 5J2NB 2H51B 1RKIA 2VZ9A 4K0KJ 1HBUB 1RAIB 2C2ZB 1TKZA 3Q2TC 3EGNA 4GO7X 1IJFB 1SQFA 4ZVFA 4IQXA 4QZVB 8AT1B 2HVHA 1ZS6A 5SUHA 3QSIA 1Q8KA 2EK6A 3P5BP 3G6ES 1VQYA 2ZBIA 2QYCA 5KT4A 3D54A 4ZP9A 4NXMJ 2DXFA 3FCVA 3DGPA 3ISND 4GC7A 2MQOA 1XEZA 2OI2A 1HWKA 2B4UA 2APOA 3MUTP 3VAFA 1QD1A 1LWFB 5L1LA 1PSDA 2KO1A 4L74A 2GO9A 4QWAA 5I3PA 4LFBJ 3MHYA 4Y2CA 3ETOA 5HO4A 4K8RA 2Q6BA 4A48A 4U8YA 4MMOA 4K50A 2ZD1A 2AD9A 1IR1A 4IYQA 4R0JA 4DL5A 4QWBA 2VOPA 4ZCKA 1XIQA 1VK3A 2N7CA 2XZWA 1GMVA 2HLUA 5F8JA 5LMUF 3RW7A 4K4ZA 4LQ9A 1Q8LA 3Q86A 2J6TA 5HBMA 3AQOA 4ILRA 4PEOA 3HPOA 1S6QA 1PJ7A 4JYAF 3T5KA 4DL2A 1JLAA 4Y2AA 3D1QA 1ELOA 1M90T 5D78A 3AX2A 5A8WA 2KVQE 4X4UA 1D8ZA 1VR6A 2R7OA 3PXGa 4UZBA 1NK6A 3K0JA 2M5YA 1N5VA 5GAHU 1P6TA 4DXLA 1P1TA 1P9QC 9RUBA 4L3KA 2A6MA 1Y0HA 4WK3A 4URQU 4KR0B 3AD8C 4F04B 1PKUA 4LSLA 4JB8B 2J9DA 5F3ZA 3ZTOA 2JH3A 1L3SA 2UVUA 2R7UA 4ICLB 2PA3A 4NLOA 1HR0F 4DHVA 3BS9A 1KHWA 3V4IA 3F73A 1NK0A 2IY5B 2CYYA 1XR6A 3CCJS 4A8WA 4NZ7A 4K2XA 2J7KA 2MLYA 3BO4A 2R2TA 3W2VA 2E5GA 4WF9Q 1X4BA 1SC1B 1HBUA 1SJQA 3P3DA 2FGOA 3FRYA 1KP6A 5CA5A 5JJBA 2XTEA 4OHWA 4ID5A 1XTZA 4OX9F 4CLWA 1S57A 1X0PA 2ZH6A 4PXCA 2BE2A 3I31A 2VKRA 2R4FA 2XG8A 2UXCJ 3VHQA 3H5XA 1LWFA 2RU3A 1XNRJ 1P27B 1FTCA 2YH1A 4KGMA 1T7PA 4UQGA 2QLJB 3AB2B 4ZP8A 4NLUA 3E01A 1MLAA 3E51A 4JI4F 2G4BA 3EPIA 1PAUB 2B4OA 1IKVB 2JSXA 1TQLA 2X3DA 2DYAA 3BBCA 3JSYA 2VPYB 1XERA 4UOCA 3PG9A 1RA6A 1U1MA 4Z2XA 2RE1A 4MK8A 5LMNF 5LSRA 2RILA 3X3UA 4ZITA 4A8XA 2XNRA 2VFUA 3ICLA 1TKXB 2KRRA 1U2CA 4OX7A 4N8OA 3QBCA 4ZDNA 3BB5A 2IBOA 1Q78A 3IN5A 4TY8B 4DL6A 2IMWP 2ZOFA 5DDPC 3CMAS 5K8MA 4MH8A 5E3PA 3ZTSA 3QRQA 5FJ4A 4TXSA 1R8CA 4HR2A 1F1BB 1EARA 1SPBP 5LXYA 1TFYA 4YB1P 5HK4A 1VS3A 1F2HA 1MNEA 1U49A 2DR9A 2HVDA 4DV6F 4DF8A 1KHVA 2R2SA 2RKIB 6FD1A 1HBOB 4JI2F 2HWTA 4NLRA 1RT1B 2F3JA 2M8HA 3VAIA 2ZZNA 2HZVA 5IWAF 3KJFB 1CLFA 2ZDOA 4U7CA 2OD4A 3EZ5A 5I3UB 1XQIA 1AYEA 3CD0A 3H98A 2HHXA 3ZZ0A 1DQ9A 5J2PB 1F3FA 1S12A 2W8KA 3HT3A 2XS7A 1NK4A 4ICLA 3THVA 3G71S 1TKDA 2F9JA 2D69A 1RAFB 2DY1A 2QYGA 3J7AN 2POKA 2XMAA 4WIQA 2G0IA 4WXWA 1N48A 1KS2A 3AX5A 3NCQA 2Z4PA 4X4RA 3CJTA 4KAIA 2IC3B 5B08A 4UY8T 1JX4A 4FXDA 3OXLA 1SKWA 2AEMA 1TVRB 4K4YA 2GMLA 2N7YA 2KT3A 1FFWB 2ZC4A 1RXOB 1Y4ZB 2HNYA 3QZ7A 3CSKA 3JSBA 1MROB 1YVFA 4TU8A 4WFAQ 2QC3A 3BEGB 2KXHA 3PW0A 2Y1RI 4ED7A 5K8NA 2QA4S 4DR1J 1LWCB 2N3OA 4WPAA 1F9HA 3PZPA 3MAHA 2GGPB 3IWXA 2V0NA 4Y0FA 2M4MA 3PO5A 2WCXA 3UDCA 5KG7A 3HHLD 3DXSX 3CDAA 3H42A 4ZVTB 1HL6A 4AUKA 1F5CA 3KK1B 1XNQF 1N0VC 9ATCB 1BY9A 1SV5B 5LMUJ 1Y5NB 1R8HA 4ALZA 1YBUA 5EN1A 3EXYA 3GIJA 4JV5F 3UQSA 1IKVA 4JYAJ 4HHUA 5G0RA 2FDNA 1RSCA 3C2PA 3QSYB 5KFVA 3EVWA 2AGPA 2YNIB 2RQKA 2ADCA 2DHGA 3FZ2A 4CDIA 2W24A 4PQUB 1U47A 4WFNQ 1IVZA 4B3OB 3T5HA 3H25A 3O1LA 2LKZA
chains in the Genus database with same CATH topology
4ID5B 3DFEA 2B56A 5HMZA 5L8RC 1U1OA 4F02A 1JLCB 2LYVA 4HT5A 4Q0BA 3U1LA 1VFJA 3RAXA 1CPZA 4KE5A 4ZCIA 2PGCA 1T03B 1O51A 3CF5Q 2EPIA 3NNAA 4OZ0A 1LW2A 1LWEB 4ETZA 2YKQA 2KFYA 1X9WA 3BSCA 1S1XA 4IOAQ 3OJSA 3QAEA 1BQXA 1LK5A 1WG4A 1S4FA 2ZHOA 3AQPA 1VGYA 2BE2B 2CJQA 4ECSA 1X4CA 2G13A 1XK8A 1MMDA 4A8SA 3N79A 2Z0GA 4LFCF 1UETA 3OFGA 3M6UA 4RW8A 4TY8A 1NJWA 2HIQA 5I3QA 2XSJA 3MDFA 4CTAB 2J5AA 3FSXA 2GQQA 4RX6A 2U2FA 2OD6A 3K7RA 3NMAA 1VQNS 2R7TA 2LQ5A 1OS5A 4EU0A 1VMBA 5KG3A 3PACA 3HF5A 3E8OA 3VTIA 1BQNA 2VODA 3M2RB 4HTIA 2VBZA 5JXSA 4O3SA 3OL7A 1RTJA 2J7UA 1JXEA 2FJDB 4X4NA 3R1HA 3HVTB 4YR0A 1JLEB 3QO9A 4DG1A 2J0XA 1NKBA 2UVVA 4DFMA 1QY7A 4MYUA 1B0PA 1FK9B 3TR5A 4W92B 3HXMA 4I67A 4C3MA 4BWMA 3VZHA 3PKYA 4DUZF 2DK2A 1RT5A 2PI5A 2CQCA 3E01B 3HKZD 1MU2A 4DR1F 4KQZA 2FJXA 3NAHA 4QR2A 5HI7A 1HBOA 2J0QD 4MYTA 1U6ZA 4ELUA 2E5JA 1TAQA 1Y9OA 3H2LA 2N4DA 5AXLA 1RT1A 5CYJA 3X1LB 3K8WA 3N9UC 2W4CA 5B09A 4KKOA 5KG6A 1HQUA 1HFEL 2K1RA 3MM6B 3OBIA 2CQHA 4Y00A 2LXIA 1KEKA 4PG6A 2XSFA 2FHOB 5I3UA 4ZPBA 3CCZA 2ZE2B 2DGUA 2R9LA 3IXQA 1TL5A 3UCUP 3J7Z5 1S49A 3Q8PB 3CVKA 5J2PA 3IGVA 2YNGA 3S8SA 1Q53A 3GQCA 1FVQA 4EGLA 1VQKS 5D6GA 1BLUA 3I5BA 1UFLA 2XULA 5KOXA 3O44A 4QBUA 3MMAA 2GIRA 3D1OA 2AJQA 5DRKA 4DL7A 2I5JB 3R3TA 2XY7A 2KXFA 3WC2A 4N76A 1K73T 5A8RB 3I82A 2QMXA 4PG8A 3MR5A 4ES1A 1RAJA 3LGMA 1RP5A 2JWNA 5KG5A 2XO7A 1TK0A 3QWPA 3U02A 2MZQA 4OQJA 2KZZA 1C4CA 3T1HF 3PJXA 2C3MA 4FP9A 2FLLA 1Y5IB 4Y2IA 4ECRA 3ENQA 4TY9A 3MM9B 5IT0A 2JX2A 2DNRA 3NP5A 5C25B 1VQSA 4N47A 2H9ZA 4L3NA 3M9NB 2EFGA 1NZAA 2BM1A 5IS2A 2CQGA 2GMJA 2W4DA 2UV8G 3DYAB 4QJVA 4DV0F 1N5YB 2FLNA 4F2SA 2PO4A 2V8VA 2I8EA 4ED3A 3IBWA 3CCTA 2JEIA 1IR0A 3D1HA 4OV1A 3GB0A 3M6WA 5I4MA 3I0SA 2NXUA 4ERDA 3IG1A 5D3GB 4C8KA 2EG1A 2IC3A 3PIPQ 3CCUS 4JI8F 4C3LA 1ZAXA 4NL5A 4CO1A 2D9PA 4NCGB 1VOMA 4WTYA 2RSQA 3DRRA 2WK4A 1T94A 3H5YA 3I6PA 1TVRA 1WI8A 4LVNP 1KLMB 1VQOS 1NEEA 1HNIB 2VASA 3KLFA