4NLVA

Poliovirus polymerase - g289a/c290f loop mutant
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
461
structure length
458
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSAFSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
total genus 142
structure length 458
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nlvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nlvA02
4XPEA 4K4VA 5HLFB 4K4ZA 2HNZA 3VQSA 2W9BA 3CJ0A 3TAMA 4NLGA 1JKHA 5HBMA 1HARA 3UQSA 3M9OB 4IOBA 5KFBA 4Q0BA 3CJ5A 1JLAA 1JLBB 2B43A 3CVKA 2XI2A 2WOMB 5C5JA 3V6DB 1RTJA 4LQ3A 2R2TA 4Q8EA 2ILYA 5DQGA 5J2MA 2HNYA 2V4RA 1LWCA 4ECSA 4ED3A 5KT6A 4MFBB 4RU9A 2UVVA 2YKNA 5J2NB 4ECVA 4QW8A 3H4BA 3LP1B 3PR5B 4TQRA 5KG2A 2YNHA 5CYQB 3OLAA 1DTTA 4IRCA 3RB6A 3GIKA 3BSAA 1HQUB 1JLQA 1TP7A 2W9BB 5L9XA 1JKHB 2IM0A 5KFIA 3KK3A 2R8KA 4Q0BB 2IJNA 1LW2A 1JLAB 4WYWA 2HAIA 4H4MA 1RT7A 4XO0A 3GIIA 2BE2A 3Q8QB 4ZPCA 2FVPA 2JEIA 1HYSA 1RAJA 1RTJB 4IG3A 5KFEA 4KO0A 3V4IB 2HNYB 1HNVA 4WFXA 1S6QA 3NAHA 3G86A 3JSMA 2BANA 2YKNB 3ICLA 2IA6A 3I0SA 3UPFA 4O3QA 1EP4B 4URGA 3PVXA 3QLHA 4J9QA 1RT5A 2YNHB 3NBPA 4ED6A 5L1KA 3E01A 1DTTB 4NLYA 4I2PA 2OPSA 5DG9A 3GIJA 1JLQB 3KK3B 3LP0A 1SH0A 3H5XA 3OLBA 2R8GA 2RDIA 1S0OA 5EWEA 2WK4A 3MF5A 3BSOA 1UWBA 4RW8A 1S6QB 4ZVFA 1TL1A 5KT4A 3HVAA 3JSMB 3V6JA 2OPRA 2BRLA 3I0SB 1NHVA 4WFYA 3C6TA 4EO8A 5C42A 2D3UA 4R8UA 5KFJA 3KLGA 1GX5A 1RT5B 3QGIA 3NBPB 1Z4UA 5FDLA 5EWFA 3E01B 3MEGB 4ICLB 4I2PB 4RW7A 2OPSB 3PZPA 5D3GB 1S9EA 3LAKA 5KG7A 4H54A 4H4OA 3KK2A 4ECWA 5KFOA 3I0RB 4O4RA 4KHRA 1RT6A 5I3UA 3KK1A 2ATLA 3IRXA 1C0TA 2HWIA 3LAMA 1SV5A 5HP1B 2AX1A 4KHMA 4NYZA 4TY8A 2QV6A 3DM2A 4MKAA 4QWEA 1S6PA 1UWBB 1S49A 2OPQA 4ZP9A 4YR3A 1TL1B 5J2PA 5JXSA 1DLOB 3D28A 1U09A 2ALZA 2W9AA 3GV7B 4QWBA 1XR6A 3C6TB 5C42B 4R8UB 4I2QA 4KKOA 4MH8A 1HMVA 5FDLB 2W7OA 4PWDB 5L1IA 4O3NA 1MU2A 4RW7B 1S9EB 1ZTWA 3T5HA 4IH6A 4DL3A 2R2UA 3KK2B 2C2DA 4EEYA 4DG1B 4NCGA 5I3UB 1RT6B 2UVUA 1VRTA 2HNDA 3KK1B 3IRXB 1C0TB 1S9FA 4DL2A 3T19A 1SV5B 5F8IA 3EZUA 3KLHB 1IKXA 3HHKA 2C22A 4I7FA 3BQ0A 4RUAA 3DM2B 3DOKB 2HWHA 1S6PB 3UR0A 2OPQB 5J2PB 1LW0B 1MMLA 2JLEA 3QO9A 3BQ1A 4O3PA 2ZD1A 3DOLA 3KMQA 2R8HA 5KFQA 3BGRA 4I2QB 4KKOB 4PQUA 1EETA 1HMVB 2OPPB 2VG6B 3MEDA 1MU2B 1BQMA 3M8PA 3NGDA 3QGGA 3E51A 4J9RA 4IG0A 1DTQA 4RNOA 1VRTB 2D3ZA 2HNDB 3FSIA 5KFTA 3D5MA 1REVA 4O3SA 4NLXA 4I7FB 5KG4A 3H4DA 2AWZA 1RTHA 3V6KA 4YR2A 1I6JA 1TV6A 3PW0A 3QO9B 1FKOA 1RTIB 3SI8A 4R5PA 3DOLB 4QWCA 3CWJA 4PQUB 3FQLA 1S1VA 1JIHA 3MEEA 5K14A 5J2NA 3H59A 3H5UA 3MEDB 1BQMB 3DYAA 3LP1A 1T05A 4ZPBA 3NKYA 4URSA 2R8IA 2WHOA 2UUWA 1DTQB 4MIBA 5DQIA 1NNDA 3Q8PB 3KLEA 4DL5A 3RB0A 1FK9A 1HQUA 1HNIA 3RB4A 3GV5B 1REVB 2XWYA 1N6QA 1RTHB 4NLPA 2IAJB 4KV8B 5KFKA 1TV6B 1FKOB 4R5PB 4RUCA 5DG8A 2RKIA 3V4IA 4NLWA 3BREA 5KFVA 4M94A 1S1VB 3MEEB 5K14B 2ASLA 1T05B 3DYAB 2EC0A 3PHEA 1JXLA 1EP4A 3BSNA 1HPZA 4NLRA 3PJXA 2IJFA 3KLEB 4X2BA 3GQCA 2XI3A 3GILA 4JV1A 1SH3A 1FK9B 4PUOB 1HNIB 5CYMA 2ILZA 4ZMMA 5KT3A 1N6QB 5F8GA 3CDEA 2IM1A 2DPJA 5C24A 1QE1B 4YMEA 4K4YA 4RW4A 3KLFB 4RW9B 2IM3A 4J9LA 2RKIB 2JC1A 3G6XA 4ZVHA 4G3IA 4Q45A 3SFUA 5KFWA 4NRTA 3KNAA 1RT2B 4ZP6A 1HPZB 2WONA 1RT3A 3HKWA 3CDWA 3MEGA 4ICLA 4IDKA 5C25A 3T5KA 3RAQA 5D3GA 3N6NA 2XC9A 5CYMB 1IKVA 5KG3A 3KHHA 4OL8A 3I0RA 3CDUA 3BR9A 4YP3A 3MTKA 5C24B 4EO6A 3MR2A 3OL6A 5HP1A 2ZE2A 4RW4B 3Q8SB 4FS2A 4TY9A 2O5DA 1RYSA 1SUQA 1ZTTA 5KT5A 3RBEA 1C0UA 1S1WA 1DLOA 2ZKUA 2XGQA 3PJWA 1JLGB 3GIMA 2WONB 1RT3B 3DMJA 5L1LA 4J9PA 4Q8FA 4PWDA 5C25B 3BSCA 4IDKB 3OL7A 2CJQA 3DLKA 3H40A 4F4ZA 4Q44A 3RB3A 4O44B 1IKVB 4DG1A 1TQLA 3LP2A 1C2PA 3FRZA 2R2RA 3TVKA 3KLVA 4K4XA 2ZE2B 3KLHA 4NLUA 3Q8RB 3DOKA 1RT1A 1C1BA 2WCXA 1SUQB 1D1UA 2OH2A 4EBCA 2FJWA 1LW0A 1C0UB 1S1WB 5I42B 4F50A 1ZETA 1BQNA 5L1JA 2XCAA 1S4FA 5KFMA 3DMJB 4IQXA 2OPPA 3EPIA 2VG6A 5KFYA 5J2QA 3OL9A 4K4UA 3DLKB 5KFPA 4G1QA 1S48A 1TVRA 3C6UA 4WE1A 4DEZA 3KHRA 1S97A 3IGNA 3LP2B 3KHLA 2FJXA 1TKZB 2I5JA 2HMIA 4M95A 1JLEA 4KSEB 3KLIB 4TYAA 2AGOA 2VA2A 1HQEA 4MKBA 1RT1B 1C1BB 4QW9A 4R0EA 3NMAA 2GIQA 5DQHA 1S10A 1RTIA 1BQNB 3CJ4A 4J9KA 3KMSA 1W25A 1JX4A 5EDWA 5EWGA 4LQ9A 2AX0A 5J2QB 3OHAA 2JEFA 4G1QB 4IFYB 1R0AA 1TVRB 1JLCA 3C6UB 4WE1B 3G6YA 4ED7A 4TN2A 2R2SA 5DG7A 2I5JB 2HMIB 1JLEB 3OL8A 2GC8A 4F4XA 3OSPA 1HQEB 1T03A 4Q43A 1KHVA 2IAJA 4KV8A 1TKTA 5KFUA 1IM4A 1YVFA 2VG7A 3LALA 4ZVEA 3ITHA 4KFBA 4ZHRA 1S1UA 2C28A 3UDLA 4Y2AA 2AGQA 5F8NA 4U7CA 3DRSB 5DGBA 1RDRA 3NL0A 2GIRA 1RYRA 4RZRA 3LANA 3FFIA 5KG1A 4WXWA 4J9MA 4FBTA 4EBDA 4NLSA 2E9TA 1JLCB 1R0AB 1T94A 4LSNA 3T1AA 3HVWA 2AQ4A 3DRRA 4IFVA 4U6PA 3QIDA 3MECB 4RNHA 3RBDA 5F8LA 1LWEA 2IBKA 4MK7A 4PUOA 4B3OA 5KFLA 5F9LA 1T03B 4K50A 4XPCA 1QE1A 4EYIB 1TKTB 3I5AA 1C1CA 1KLMA 5DLGA 4TQSA 2XGPA 5J1EB 2VG7B 3KLFA 4RW9A 1N48A 3ITHB 2W8KA 4KFBB 4ZHRB 2J6TA 1S1UB 4NLOA 3HVTA 4ED0A 1T3NA 3DI6A 3JYTA 3DDKA 4MK8A 3FFIB 4ED2A 3M9MB 1RT2A 4O3OA 3CJ2A 2JC0A 4LSNB 5F8HA 3DRRB 4IFVB 4F4WA 3PW2A 1D0EA 2BQRA 2V9WA 3G6VA 1LWEB 2IC3A 1S1XA 4B3OB 4NLVA 4TXSA 3MR6A 2FVQA 3BJYA 1C1CB 1KLMB 4YR0A 4ECUA 2JEGA 4ECTA 4GC7A 1IKWA 5KFZA 2B5JA 3HVTB 2DPIA 1S9GA 3N6MA 4WZQA 3DI6B 3PW4A 4NZ0A 1N5YA 1J5OA 2F8EX 3JYTB 2AU0A 2WB4A 5T14A 2R8JA 3QZ8A 1JLGA 2BR0A 4IR1A 2ASJA 1FKPA 1TKXB 5KFFA 4QWDA 4RNMA 3QIPA 3QZ7A 2UVRA 2HNZB 1S1XB 2IC3B 3OHBA 4O44A 3TAMB 2B6AA 2YNFA 4KE5A 4KBIA 2C2EA 5HBMB 1S0NA 1QAIA 2E9ZA 4Y3CA 2VA3A 3TQ1A 1WNEA 2FLLA 4DL6A 1QUVA 2BRKA 5DLFA 1IKWB 2FJVA 2B5JB 1S9GB 5J2MB 1N5YB 2JEJA 1LWCB 4K4SA 3FDSA 3I5CA 5I42A 1N56A 1J5OB 3V81A 2UVWA 4RW6A 3QGHA 1NHUA 1S1TA 5F8MA 2YKMA 3MFIA 2J6UA 4NRUA 1XR7A 5KT2A 3PW7A 5F9NA 1SH2A 1FKPB 2RF2A 4J9SA 3IS9A 3QIPB 4ZPDA 3DRPA 3I5BA 2W7PA 4GC6A 4FBUA 1RT4A 3H2LA 2VG5A 2B6AB 4Y2CA 2YNFB 4RNFA 3IN5A 4WXOA 3M9NB 5HROA 4IKAA 3KHGA 4IRDA 1TKZA 1LW2B 4H4MB 5HLFA 1RT7B 3KJVA 2BE2B 1HYSB 4EYHB 3KLIA 4IG3B 3MR3A 4KO0B 2I1RA 4JV0A 4JV2A 3GV8B 1HNVB 4KAIA 1VRUA 3DLGA 3BQ2A 1RTDA 1LWFA 3CJ3A 4IRKA 2RDJA 2BANB 3V81B 4RW6B 4J9OA 5JUMA 2D7SA 1S1TB 2YKMB 4TLRA 2FVSA 4NLQA 4TYBA 3H5SA 3QLHB 2RF2B 5KFRA 3IS9B 2V4QA 2C2RA 3DRPB 1CSJA 4EBEA 3MR5A 3IG1A 4NLTA 4ECQA 1RT4B 4IFYA 4QWAA 2VG5B 2WTFA 4IH5A 3LP0B 3OSNA 5HROB 4ZP8A 2XCPA 2UUTA 4WZMA 3CIZA 4KB7A 5KG0A 3MFHA 3KJVB 4FS1A 4IH7A 3T5LA 5KFNA 2AGPA 2YNGA 2FLPA 5KFHA 2D41A 3RAXA 2FLNA 4RW8B 2BQ3A 5KG5A 1RTDB 1VRUB 4K4TA 4QPXA 3DLGB 1LWFB 2WRMA 4NLDA 2OPRB 4HKQA 4J9NA 3KLGB 4ECYA 3EPGA 3GYNA 4ZP7A 4ZVGA 2BQUA 1RA6A 3DRSA 1K1QA 4LSLA 2W9CA 4DL7A 2ASDA 1N4LA 2IM2A 3IG1B 2CKWA 4HYKA 2QE5A 4ID5A 3KOAA 5KFDA 4RNNA 4H4OB 5KFSA 2YNIA 2IMWP 3DLEA 4O4GA 5KFXA 3H5YA 3MECA 2FVCA 3ISNC 4ED8A 4YQWA 4TY8B 3FQKA 4ED1A 2YNGB 1RA7A 5KG6A 5F8JA 4F4YA 4ECZA 4O3RA 3NAIA 1IKYA 2E9RX 5J1EA 3PR4A 2J6SA 1TL3A 1JLFA 5KFGA 1S0MA 4LSLB 4WYLA 4WFZA 4JUZA 2W9CB 3M8QA 4MK9A 3CO9A 4MIAA 4ZPAA 1K1SA 4ID5B 4URQU 3T5JA 2YNIB 3DLEB 3QYYA 4NCGB 4O4GB 1KHWA 3IGVA 5EUHA 3SFGA 5KFCA 2W8LA 1IKXB 3PW5A 4DL4A 1OS5A 1JLBA 1IKYB 2WOMA 1GX6A 5KFAA 2V0NA 3ISND 4ECXA 3V6DA 2ZD1B 3V6HA 3BGRB 3H98A 1TL3B 1XR5A 4K4WA 4Y34A 1JLFB 1EETB 5KT7A 4MFBA 3N6LA 4IR9A 3M8QB 3M8PB 5DGAA 1QAJA 4ECRA 1TKXA 2FVRA 4IG0B 5CYQA
chains in the Genus database with same CATH superfamily
4NXNF 2OAUA 2ADCA 1HARA 3UQSA 2XI2A 1VJWA 3P96A 4WIIA 1VQYA 4JI2F 4RU9A 2ACMA 1GMVA 3THVA 1VQMS 4YFUA 1N34F 1R6YA 2IIHA 1HQUB 3EICA 4DSEA 3GIIA 3N0VA 3Q8QB 1HYSA 3Q8YA 1A7GE 3QAEA 1PG5B 3MM9B 1S76D 1WOSA 1HW9A 2HIYA 3NBPA 1YBTA 1U47A 3OTOF 4H4KC 2QO3A 4R8UA 3AOCA 1Z4UA 4WP3A 4RW7A 4OZ1A 4H54A 3NS5A 2CQ1A 1FWKA 2FGCA 2AX1A 3CCTA 3R5AA 1UWBB 1DLOB 3GV7B 1S6OA 4HT7A 3P6YC 4X4TA 1SQFA 4B9UA 2Q3PA 1VRTA 2HGNA 2ZH1A 4JI8F 1X5SA 2DNHA 3NGTA 5J2PB 1IR0A 3KMQA 2A2DA 1GFWB 2B9YA 1AZSA 3E51A 4OX9F 4CZCA 4NOHA 1ZZFA 4NLXA 3V6KA 2Z30B 3HHNB 5AJ3J 5K8OA 1S1VA 1YJWS 5K14A 1VQKS 1WJ9A 5H9FJ 2DGUA 4U9RA 2VU5A 3ADAC 3CCWA 1UKUA 4NMXA 2DH7A 2HS3A 2PFDA 3MCMA 3UCGA 3PHEA 2VASA 3QATA 1HPZA 4NLRA 1UFKA 1UVJA 1HNIB 5CYMA 4B17A 2UP1A 2LXIA 1Q7LB 4DDFA 3KLFB 1RBOB 4C8NA 3WHIA 2DJWA 2FZKB 4GKJJ 2UUCJ 2DEIA 1RT3A 4NA1A 1XEZA 3MMJA 4IDKA 3QSIA 3OL6A 4NWBA 1D3WA 2HQCA 2WAQD 4WK3A 4KGZB 4ZVPB 3TUZC 2EK6A 4DN9A 4B3SJ 2DNOA 1RQ0A 3BO3A 1VQ7S 3HKZD 2ZUAA 2CA9A 2HHHJ 5D6GA 4EU0A 2ZE2B 1PSDA 1F3VA 2KN4A 5I42B 2QL9B 3O8WA 2H1YA 4BLGA 5LT5A 3EPIA 2ZOGA 1RLDA 3KHRA 1ZA1B 2GGPA 3D0GE 3G4SS 4UUXA 5B7WA 1W25A 2MKIA 4IO1A 4U8VA 2ROPA 4AUKA 2ZH7A 2CQ3A 1JLEB 1OYEA 5F8NA 1FVSA 3LANA 2B51A 2V68A 1R43A 4DUYJ 3C46A 2HLTA 3W2VB 2PDAA 4AD6A 4I4BA 4ZHRB 1S1UB 2RRAA 5HATA 2MKCA 5I4MA 3I32A 2UXCJ 4Z7YA 3HHLA 3ETOA 3GFYA 5KFZA 1D8YA 2DPIA 1J5EJ 1BD6A 2UXDF 2VJVA 4ANEA 4CO5A 1JLGA 2Q6CA 1RLCL 2OELA 5KFFA 2B6AA 2LA6A 5HANA 5LSRA 1WNEA 1JXEA 4CDIA 1WOPA 2JLGA 2PEBA 1NDLA 2B7CB 2A6OA 5KOWA 2YKMA 2XM3A 5HROA 3MOJB 4IKAA 4NI2A 5HLFA 1XNQF 4YUDA 4IG3B 4QYZK 1YRTA 3DLGA 1RHKB 4TYBA 2P6SA 3UCZP 1UUJA 1N32F 1ZAVA 2WTFA 3KTQA 4IH5A 3T6BA 3BKTA 4NEYA 1VRQC 2E66A 3SDEB 2MZRA 4DV0J 2BQ3A 1U25A 2D3OR 3G9CA 4LR8A 2CAJA 4Q2MA 1S0VA 2IYGA 2V8PA 1FD8A 3ZTOA 2K7JA 2NSCA 1O5JA 4KHPF 1RACB 2G0JA 2JJ4D 4K0KJ 4JV5J 2CJXB 2AJ2A 1SC6A 1GT8A 1MMDA 4N8NA 4NCGB 4OLPA 3WQPA 3Q23A 1PYTA 4LF5F 5A8WA 4LF9F 1NUEA 4K4WA 1CS4B 3IAS9 3BV8A 4LVOP 1RXOB 3EGZA 2QT7A 1WC4A 3U1LA 3BO4A 3M9OB 3ZZUA 4Q8EA 1OPIA 2LQJA 1F5AA 1S57A 3NGUA 1N8RT 3F41A 1XMOF 4X64F 4ALZA 1NH8A 3IRWP 1RTJB 1P1LA 4NEZA 2V4JA 1QD1A 1E6YA 1U1KA 3ILLA 1S79A 3EMTA 4HH1A 3P49B 3GIJA 2HZCA 2R8GA 1S0OA 2WK4A 3VVTA 1TL7B 3FNNA 1P6TA 3C6TA 4FBUA 3P5BP 4OZ5A 2MZJA 2GO9A 4ZCKA 1RHMB 3RAMA 4KHMA 4NYZA 3BH6B 4JI4J 2NQPA 4PXEA 2GMLA 3CDAA 3MD1A 3VAFA 4WK1A 4PCQA 4QWBA 1XR6A 2PC6A 1X4DA 3CJSA 3MM5B 2PI4A 4DPOA 2LEAA 5T41A 5IC6B 2HWHA 1S6PB 4QIFA 3MCSA 3IAM9 1FXLA 4CO0A 1Q86T 3I55S 5D0EA 1UA0A 4F3OA 4HLBA 1FRLA 1H2UX 3D5MA 2HQFA 3VR1A 1TV6A 3UN3A 4PAAA 3CCUS 1NNDA 1QTNB 4JI5J 3RB4A 1N5VA 1YJNS 3CPWR 3J81Y 1RAGB 3DYAB 1CULB 3VTIA 1DJ0A 3GQCA 2RDDA 3L3CA 1QE1B 4EUVA 1YTYA 2IM3A 3CCSS 2ZH4A 2PGCA 1KSPA 2VF3A 4JI7J 2P9GA 1M5VC 3MR2A 3DOMA 5A2QU 2ZKUA 5RUBA 3MDFA 5L1LA 4X62F 1SL0A 3MAAA 2NUUG 1V3SA 3VAJA 1FRIA 3EX7B 2CPZA 5LSLA 2KU7A 1S1WB 1BQNA 2VQEF 4LRAA 3A8KA 2M8DB 1XERA 4LF4J 4ENOA 3BGOP 3AXMA 3KJQB 1YJ7A 4PXBA 1RAHB 2CPXA 5DQHA 1VYAA 3WC2A 1NJWA 4WFNQ 3OHAA 1HWJA 1WELA 5H1SV 4QJVA 2GC8A 3FZ2A 3OSPA 4KV8A 3GB0A 1E6VB 4I67A 1OQ6A 1NSPA 5DGBA 2JWNA 2GIRA 4C8KA 1RHJB 3T1AA 4IFVA 3ILJA 3RBDA 5F8LA 5EGYA 4B3MF 2F8HA 1TKTB 3I5AA 3D6FB 4UW2A 4L76A 2QEXS 2AJ0A 2CXEA 1OJ4A 4DFJA 3HHEA 1I94F 4CH7A 3M8RA 3G6VA 3JQMA 4OJHA 4WU3A 3TP2A 5KTQA 3MR6A 3SIPB 4P7TA 4B3RF 2KYXA 1RAEB 1S9GA 4WZQA 1NO8A 5B0GA 1H2TZ 3MOZA 1D9AA 1DZ5A 2BA9A 2HNZB 1IN0A 3FC9A 3FUYA 1GK8A 2QA2A 4QBUA 3TQ1A 2R7QA 1RKIA 3OFEA 4I68A 1FRXA 3PM9A 2W4DA 2UVWA 2J9EA 1S1TA 4NRUA 5A76A 1UFLA 1TMMA 4CYUB 3IN5A 4OYWA 3R7BB 2BE2B 4L75A 4JI0J 4CLUA 2P6TA 3JXOA 1QAYA 2EKYA 3MR5A 3AH6A 3NOGA 4OJ3A 3AB2B 1U1LA 4IH7A 1FJEB 2YNGA 1ZS6A 2VBZA 1RTDB 5CYJA 1LWFB 4C98A 2DGWA 4DQSA 4HKQA 3CF5Q 3BBBA 1HBOA 3GE9A 2CIMA 6FDRA 4O4GA 2CDQA 2YTCA 1VQPS 4AXJA 4ITSA 4D3HA 3FEYB 3WIVA 3MCOA 2PMWA 4CLYA 2KJWA 4M8LA 1FWPA 4F25A 1Q95G 2W8LA 5F3ZA 3UVJB 3A1YG 1FD2A 4ECXA 3V6HA 1SL1A 2WVDA 5F3TA 2YPZA 2H4WB 1R0BG 4MIWA 1GH8A 1Y3JA 3VQSA 3CJ0A 3VVUA 1FRKA 3GU0A 4C97A 1REGX 2DHHA 3OXLA 3CC4S 1I5OB 3KUGA 4QW8A 3LP1B 2CG8A 2HKEA 3N79A 3ENAA 5KG2A 3HJFA 3OLAA 5L9XA 2Z8QA 2GMJA 4K5RA 2AJ1A 3QJJA 2PE8A 2DIUA 2LCWA 4PPZA 1ROFA 3G86A 3UPFA 2DGSA 2QA4G 3I6PA 1JLQB 1N5QA 2E29A 1U4BA 3OLBA 1MG7A 4OI6A 3OFHA 4ES3A 4ZVFA 3HZEA 4WP9A 1RWUA 2I2YA 1RAIB 4OZ2A 5FDLA 2CJBA 1W7WA 3NGKA 2XYGB 1NH7A 4M5DA 5D8HB 3POTA 1Z2LA 2OO4A 4I2QA 4KKOA 1TR0A 4MH8A 5ETRA 4DV7F 2POKA 1ZTWA 1NJZA 2KKHA 3SSSA 1X9WA 5J1NA 3DM2B 2DR6A 1TFYA 3PV8A 3BGRA 2HHPA 5K8PA 2VG6B 3M8PA 1FNMA 1GEHA 1U1RA 3J7ZT 2HQGA 3FSIA 1NJXA 2MQ8A 5KG4A 4B08A 3QO9B 3N01A 2Z2MA 2JX2A 1LXNA 3OJUA 2R8IA 3Q2TC 2LEPA 3PY8A 5DQIA 4DV6F 3DLJA 1HQUA 1M1HA 1SL2A 3QJPA 5DDPC 1Y3KA 1FKOB 1H2VZ 4G65A 2RKIA 3J7YI 3CTRA 3MEEB 4BS2A 4LF7J 4JV1A 2PA3A 3UE2A 2DHGA 5DO2A 3CDEA 3GG0A 2HW3A 3VHQA 1UPPA 2P9EA 4OI3A 4YDDB 3J7AN 1FFWB 1YHQS 5D15A 5C25A 2UXBJ 4DR1J 1U1QA 3I82A 2I38A 3BR9A 4KYZA 3N5FA 2XNRA 3ILOA 1RWKB 4NZ7A 3OVAA 1DLOA 2C3MA 1R27B 2D3O1 4CLZA 2XS2A 4KH0B 4J37A 2FGOA 4U67Q 5IC4B 2MJNA 3GJRB 2BKPA 5G0RA 3M6VA 1BQXA 4CNZA 4A8XA 4CLWA 2MHEA 5KFPA 3Q89A 1WF0A 1RZMA 3KHLA 5EX0A 2IVMA 2HS4A 2JHEA 4QW9A 4N47A 4OZ3A 4OHVA 1U2FA 1CBKA 1X31C 4X65F 4X4RA 2VOOA 1WSVA 2K7KA 3OL8A 4LF2A 4F4XA 2PIIA 1TU0B 1KHVA 5JVGQ 3H2VE 3CCRS 2PFFB 4NCBA 3OR2B 4I64A 3TEGA 4LSNA 1AROP 5HQLA 1NDCA 3R97A 3FMWA 1HHSA 3OV7A 3KLFA 2YQ3A 3CD5A 5IV4A 4ELTA 3FFIB 4RO0A 2M5YA 4F4WA 3W8GA 2IC3A 2FLOA 3PX4A 1H73A 2FVQA 2V34A 4GC7A 1YJRA 1NK0A 3HPOA 4LFCF 1N5YA 4NZ0A 2F8EX 2KG0A 2FJEB 2HEKA 2G2OA 2JLFA 1TUVA 4RNMA 1XK8A 4UOGA 4KE5A 2AIRB 2IBOA 5I42A 1HBUB 4X4PA 5EN1A 3CD7A 3RTVA 1URNA 3I5BA 1KDNA 2RQ4A 4IRDA 2M70A 1ZYQA 3WX4A 1F3FA 1XC9A 3NRBA 3BN4A 1Q8BA 2WVEA 2BJ9A 3MM7A 2CVIA 1G4CA 4MT1A 5KFHA 4GKKF 3TRGA 3W8PA 2VV5A 4LSLA 4DCOB 1OSCA 2D9PA 3PEHA 2GV1A 2XTDA 3W2VA 2DGVA 1L3UA 4YQWA 2XZDB 1NZ8A 2VZ9A 2CPEA 3B6BA 5KAKA 1Q8IA 1SXLA 4WFZA 4HT5A 4OHXA 2RD5C 2H54B 3VAIA 3ZTSA 5HAOA 2XY5A 3JSYA 3E2EA 2XY7A 5HSPA 4K4VA 4NLGA 5KFBA 2LVWA 3D0IE 5LMNJ 3GP9A 3L7OA 2QMWA 3C14B 4M5IA 1LEOA 1F5BA 4ECSA 1KS2A 5IQQA 3LW5C 4RUHA 1YQHA 3UNYA 4MYTA 2YNHA 3HK2A 5CYQB 4IRCA 4LF1A 1TP7A 2W9BB 3J81U 1FNOA 1SJQA 2AJFE 4IG3A 3M1VB 2C3YA 1S6QA 1T11A 3I56S 1FRJA 3E01A 3ENQA 4NXNJ 5AE2A 2IDEA 2WVFA 2XHWA 4M5NA 1WACA 3CCJS 2ZVSA 3JSMB 4JI2J 3I0SB 1NHVA 4WFYA 4OHZA 1QVGR 4OX7A 4F2SA 1NAQA 4TKTA 1N34J 1D9FA 2OPSB 7AT1B 3KK2A 2RNEA 1S49A 3DU5A 2XHCA 1GAOA 4CM0A 4K7QA 1SC1B 3KJFB 1S9EB 5GMEA 4WCEQ 2OUGA 3J7YU 1D9DA 3HX9A 4NCGA 3R7NB 3OTOJ 3JAMY 1X7VA 5HK4A 3QSYB 4I7FA 3PYDA 1LK7A 1R6VA 2OPQB 1LW0B 4O3PA 2CNLB 5KFQA 1YSJA 4IUFA 1Q7YT 2NUHA 3C19A 1BQMA 3NGDA 4OHWA 4RNOA 2BMBA 3EWGA 3EGNA 1B7YB 2CWXA 3RR8A 5GAHU 3NKYA 2XZWA 3PG9A 4DMZA 4JI8J 2YQ0A 4CLSA 1SJ4P 4NLWA 1FEEA 2WB1D 4P73A 4OX9J 2W2MP 3GILA 1SH3A 1FK9B 2LDIA 2CFXA 2ILZA 5C2GA 5C24A 4DV1F 3I87A 1FNXH 5HJYA 1RT2B 2WONA 4YY3F 4DV5F 2XMMA 3HKWA 2XTEA 3KHHA 4CLPA 4WTOB 1C0UA 1SKRA 5GVQA 5DRKA 3DMJA 4LRFA 2AZ3A 3H40A 3RB3A 3K59A 2LMIA 2GQQA 1U48A 5D4LA 3DLKB 1WEZA 2FHOB 4I6WA 3LP2B 1K44A 4WFAQ 4FF4A 1HQEA 3T6JA 2MZSA 4R0EA 3WDOA 3IWXA 3R6GB 4J9KA 2KVIA 1NSQA 5IM0A 4LQ9A 3UD3P 5H9EK 1TVRB 3C6UB 4FNIA 1PBUA 2VUGA 2I5JB 1SQEA 4E2FB 1VBYA 2L9NA 3M8YA 1CJUA 3K5MA 4EBDA 3WIUA 1T94A 2IJRA 4LBPA 5KFLA 2F40A 4XPCA 1QE1A 2XGPA 4KGXB 2CZ4A 3VAHA 3ET6A 1OPZA 4ED0A 5HN0A 2IVYA 3B4MA 3NLCA 3CJ2A 4I6AA 4MJKA 1NZAA 4B3TF 2BQRA 1S1XA 2Y0BB 4KT0C 3KUEA 1C1CB 2E5LF 3DDIA 3HVTB 3PW4A 3UI3A 3AT1B 4ZLJA 1U2RA 2EEYA 2ASJA 2CG4A 4AQYF 4BWMA 3FCHA 1SQGA 1C4CA 3K7RA 2JEJA 3OFFA 3QGHA 2J6UA 1VFJA 1SH2A 2IRUA 4ZPDA 1Y11A 3P3DA 1NKBA 2MKJA 2DITA 2VG5A 1YBUA 1U6FA 4HTIA 1XMBA 2FZGB 2XBPA 3DU6A 2UXDJ 4J9OA 1U0HA 4M5HA 4QYZJ 3THTA 2MHNA 3M05A 2PMHA 4ZP8A 1SJ1A 4O0IA 5M2RA 5BR8F 4RW8B 4NLDA 3CCZA 2EBGA 2NYIA 2X1BA 1WI6A 4CLLA 4V19X 2D1CA 2WVBA 1XNQJ 4TY8B 2DY1A 1RA7A 1PILA 3ZZOA 1YI2S 4QIWD 1VGYA 4GVLA 5KFGA 5GAGI 2W2NP 2YQ1A 2NXJA 1N32J 5IZHA 2HVZA 4LBHA 4L72B 4CH1A 1OS5A 3MM6B 4C8ZA 1P27B 3OFGA 2J7KA 3N6LA 1Q4RA 4KHPJ 1S7IA 2HNZA 1WORA 1AFIA 3PTWA 4YB1P 1QM9A 1FX4A 4WPAA 4UQTA 5D78A 4LF6F 5J2NB 2HBYB 1H6KX 5L39A 5KOXA 5KFIA 3N4WA 4Q0BB 2NREA 4OZLA 1Q16B 4XO0A 4LF5J 2BE2A 1T95A 1W2IA 4LF9J 5KFEA 2VH7A 2CQHA 3NAHA 3W62A 1X60A 2QG9B 3JSRA 1FDNA 1KFSA 4YOEA 2D3UA 1BUXA 5D3GB 4C11B 1XMOJ 4X64J 4A8QA 1H72C 2ATLA 3IRXA 4UTGA 2FY8A 3OTBA 1TL1B 3D28A 1Q8LA 2GQ2A 5CH7B 2LP4A 2E1AA 2R7RA 2C2DA 4DG1B 4ETZA 1RT6B 2GHVC 3QRRA 1C0TB 5F8IA 3DOKB 4F3QA 1JXVA 1KR4A 2R8HA 2DHAA 5HVFA 4PQUA 1HMVB 5K9FA 2D9OA 3HI9A 3MEDA 1MU2B 2VJUA 5DETA 2ZC3A 4N5SA 4P72A 3AD7C 1J27A 1GNKA 5AT1B 3D3BJ 2IHR1 4FP9A 2XEXA 1Y10A 2J9DA 3LP1A 2ZOFA 2IPOB 1DAXA 2SXLA 4DL5A 1TL5A 4ZJOA 4JI1F 4MAKA 4ELVA 3GYXB 4R5PB 1HBNA 2VBYA 1VK8A 1HR0F 3TR5A 1YX2A 1L3VA 1IJEB 4U7UK 3OUYB 4NPOA 2IM1A 4K4YA 4RW9B 4F26A 2CVEA 1K9MT 2JZ5A 3VWSA 5KG3A 1AB8A 3TOQA 1CLFA 1FA0A 2MSTA 3GONA 1AUDA 1LFPA 2HPUA 2UUAF 2DR8A 1F5CA 1F1BB 1NB7A 3VGSA 5IT4A 1B0PA 4LMZA 1SUQB 4NA2A 1MWYA 1Y7PA 1LKZA 3E8OA 5I3PA 4OI4A 3TAPA 2VG6A 3OR1B 4OYMA 4WP8A 4KSEB 2RS8A 3U02A 2M52A 2K1RB 2CNNB 4UOHA 4DJBA 3KYLA 4X62J 2J7UA 1ZH5A 3SYZA 2HMIB 3HO1A 2YKOA 1T03A 4XK8C 2HG4A 3I9ZA 2H5JB 2VQEJ 3T9ZA 2AQ4A 2IBKA 1WTFA 4MK7A 5DJBA 5E5NA 1WF1A 4NA3A 1KC8T 1FX2A 1JNZB 1FEHA 3HHLC 4ED2A 4O3OA 3K58A 4YDXA 4B3OB 1JMTA 3SEOA 1UZHA 2YKAA 2ZBPA 4FYYB 2L48A 2GJFA 4KTQA 1FKPA 4EWTA 1NPPA 3LOUA 2ZH9A 1S0NA 4B3MJ 4WBFA 2YX1A 2JL9A 5ITHA 2FLLA 1IKWB 2O66A 3TUIC 1N56A 3CEDA 1NHUA 1IWGA 1XR7A 2RF2A 5K8MA 1XWLA 3D1HA 3H42A 3L7PA 1I94J 4DX5A 1YZ6A 3FVYA 4OX8A 4H4MB 1RP5A 2WVCA 3UFCX 3M4XA 4B3RJ 2NS1B 1EHWA 4KAIA 3D6TB 3H5SA 2MGZB 5DDRC 2EBEA 1FERA 2GVZB 1CSJA 3IG1A 4LRDA 2CJ9A 4L73A 4FS1A 1Q1KA 2LXUA 1VBZA 1IR1A 1NSKL 1VRUB 3CC7S 2OPRB 2CQBA 3KLGB 3OTCA 1RA6A 2J8AA 2CJYB 1N4LA 2CKWA 3M2RA 4H4OB 4KGKA 3SMZA 2JFDA 4BDPA 1SKSA 3FQKA 3HXMA 3H0PA 4ERDA 1CJVA 2DO0A 2W9CB 4N7TA 3FGVA 5T7LB 3UD5A 5SZTA 1HHTP 1NEEA 3AA9A 5IT0A 3JAMU 3DLEB 1MSWD 4OYZA 1YK9A 3DHXA 3A12A 3M8QB 4IYQA 5CZXA 1S4EA 2ZKTA 2AP6A 5DGAA 4ECRA 4EMDA 5EWFA 2OEMA 3QGPA 2ZBRA 2R2TA 2XO6A 2MQQA 2W2QP 4TQRA 4Y65A 4QIGA 4U8YA 2RUSA 4WYWA 1KVKA 4PXCA 4CIOA 2QLBB 3PKMA 4U7UD 1DTTB 4I2PA 7FD1A 3MMAB 4DR5J 4PRFA 3KK3B 4USHA 2HVDA 5CD4H 2DNPA 2U1AA 4QR1A 3ZC4A 4ZN3A 4JOUA 4FF1A 1X4BA 4WWSA 4I69A 5I3UA 3AJ2A 7FDRA 2LQ5A 3NS6A 3DXSX 2QV6A 5EHHA 1I51B 1R8AA 5C42B 4DQPA 5K8NA 3RUBL 1WWHA 3QQCD 3CDBA 5BXIA 2CNKB 4EEYA 1Y5IB 2FD2A 2P2CB 5DM6Q 3UR0A 2XMKA 1SI9A 1MMLA 4LJMA 4O23A 1OIAA 2QLWA 4NL5A 1DTQA 4GO7X 3LWMA 1YWXA 1MW7A 2C3UA 4DPTA 1RI7A 1JWWA 3HJVA 2CPYA 3DOLB 5C7PA 4HEA9 4LR9A 3FQLA 1XNRF 4DV7J 1N0VC 1G6BA 2M9KA 1RTHB 3D4JA 1Y9OA 4LREA 3BREA 5KFVA 2E5HA 1T05B 2V2ZA 3L4BC 3PJXA 2IJFA 2OJ3A 4PWWA 5KT3A 3ENWA 4UOFA 3FBEA 4X4SA 3H8YA 4Z7CA 1JJ2R 4ZVHA 2FJBB 4G3IA 2XYPB 2IA0A 1X9MA 4DV6J 2F7VA 4HL9A 3HZGA 4RW4B 3IR7B 2C3OA 3RBEA 1JJHA 4KPCA 3D3CJ 3B82A 3AA8A 1HHQA 3GIMA 3IM9A 1M0SA 2XY6A 3VAMA 2CPIA 3MMCB 4K4XA 3C8YA 3C3LA 1Q5YA 4B9SA 2FJWA 1LW0A 1FE4A 5J2QA 3VGUA 4CLKA 5M2UA 1TKZB 2V6AA 1X8DA 2L08A 1C1BB 3WBZA 3R6LB 1DHMA 4ED5A 3NCPA 2AEFA 3PRVA 3LQVA 2JEFA 2AKWB 1M90T 2R2SA 4KQZA 2CQ0A 2HSEB 4QU7A 1VQ9S 5AXKA 3WZ0A 2VODA 1HWUA 1V3RA 3GJSB 3DRSB 2Q66A 3NL0A 4NLSA 2OD4A 3R5GA 5D4OA 2VG7B 2OMOA 4DF4A 2QL5B 2OD6A 4S0MA 4AL6A 1RT2A 4X65J 2OP5A 2V9WA 4I6YA 4KGVB 3C2PA 2MZTA 3JYTB 1R8HA 4FYWB 2WB4A 3GJQB 5L9NA 2A1BA 4UOCA 1CJTB 1VOMA 1F9FA 2YNFA 3B54A 3TYTA 3PX0A 3PDNA 4OYXA 4DV4F 4BWJA 5F9NA 3IS9A 1BMQB 4RBTA 1RT4A 4RNFA 4Y2CA 1N5TA 1YJTA 2FY1A 4EYHB 2DXDA 2MSSA 3AX2A 4LFCJ 4DQQA 5CABA 4FXDA 2KXHA 1WHXA 4E98A 3ZXWA 2W4PA 2V4QA 2C2RA 4EBEA 4TVAB 2EG2A 2AGPA 3JS9A 1KQKA 1K0TA 2CPJA 4OV1A 3WX8A 4ID5A 3KOAA 1SC4B 3LGMA 1HWLA 4MKVA 2YH1A 3S8SA 2C2KB 5L46A 5GADU 4OQJA 2DD8S 4UT4A 3J80Y 4RBUA 5B0FA 4MK9A 3BPSP 3WC0A 3B4DA 4OIXA 3IGVA 4PR6A 1ITPA 1AFJA 1IKXB 2N7YA 3CJKB 1SIWB 1JLBA 1H74A 4GKKJ 1FDAA 1GX6A 3V6DA 1KFDA 2B4OA 3CJQA 4F4KA 2FVRA 3S6EA 3IO1A 1MN7A 5A8RB 1JKHA 3Q86A 2DO4A 3HMJG 2WBRA 3GTYX 4KRWA 5DQGA 2KM8C 1KLNA 2H51B 2YKNA 2NPFA 3GIKA 3BGUA 2E1MC 2IM0A 5CCMA 1PJ6A 2KHDA 2L3MA 4CO3A 4DSKA 3QT7A 5L1KA 5A6PA 4J9UE 2D74B 1URRA 4X4NA 4KH1B 2RDIA 2G4BA 3BN7A 4RW8A 2YPYA 3HVAA 5EX3A 1Z1ZA 1S6UA 3DXBA 1GX5A 1RT5B 4QYRA 3LAKA 4RR5A 3K5NA 1OYDA 3I0RB 3KK1A 2M2BA 3LAMA 4E0DA 4TY8A 3ENVA 2L9DA 4FZVA 1RUSA 2UV8G 5FJ4A 1TK5A 3MHYA 2EKNA 2W24A 1SBRA 1SV5B 1QJHA 1UCNA 3MUVP 3MM6A 1SKWA 4A8WA 3Q0AA 2WZ1A 2J9DE 1CJKB 3EVWA 2VFSA 2DY9A 4Y6IA 4DX8H 5KFTA 2V5HG 1BY9A 1I1GA 1VHIA 3FK4A 4BC9A 5J2NA 1WSRA 2MQNA 3FEXB 3K17A 1MNEA 1GMUA 5J1PA 2GW8A 3A8JA 4DR7F 2AYBA 4C3LA 1N6QB 4RKUC 3QPIA 2KZZA 5B0CA 2ALYB 1YKWA 2F5GA 3C16A 2O1PA 1TMJA 3KNAA 3P5TL 3OTDA 5D3GA 3KXDA 3IR5B 3PIPQ 1KVJA 1RYSA 1GQEA 1EARA 2XNQA 1NPKA 1V9OA 3CJTA 2EFVA 1RKJA 1U26A 1U0SA 1IKVB 1HLWA 3S1TA 4A4JA 3HSGA 4DG1A 2R2RA 1D09B 3DOKA 1H7XA 4DV1J 4EBCA 1ZETA 1KONA 2V2QA 4KJIA 2GVDB 1RU2A 2RSQA 3BKFA 4YY3J 3HSDA 4DV5J 1T3OA 3M2VB 3HCXA 4DSIA 3CJ4A 4LF8F 1NK5A 3LGHA 1KTQA 4WE1B 4TLQA 1YJ9S 5H9EJ 4XIUA 5H9FK 4YHHF 3UDLA 3QT5A 3EXCX 1KQFB 4WXWA 5HMZA 4J9MA 3KG0A 4RLEA 2YKPA 3AOBA 4C4WA 3ELHA 4RW9A 1Q78A 2P5VA 2AEJA 1YJVA 3HD1A 2CPHA 1LOUA 1IJFB 3DRRB 2LQ9A 5CAAA 1HBMB 2B5JA 3DI6B 2H65B 2OSQA 2NSBA 4QCLA 1U8WA 2YWHA 3MMBB 4QWDA 2UVRA 4NYOA 2C2EA 3BPDA 2BRKA 1LWCB 3FDSA 1U02A 2DIVA 3FEZA 4PWUA 4ZLLA 2W7PA 4B3TJ 1Z2ZA 3HD2A 1Q81T 3NWRA 2F1FA 2E5LJ 1PO6A 5LSOA 4JV2A 1HNVB 3AQPA 3CJ3A 2BANB 4RW6B 5HVHA 4J5OA 1UEVA 3U27A 1WUUA 3DRPB 5B0DA 4Y0FA 2QFJA 1FT8A 4F8RA 4AQYJ 2OLWA 1CQNA 5KFNA 3GPAA 3NS7B 3B8HA 2NXEA 4ECYA 1BWEA 4DL7A 1GTHA 2M0GB 5KFDA 2YNIA 2XTCA 4Y00A 3SQGA 2BKOA 1T9WA 1IKYA 1NB2A 3AJDA 3TX8A 1Q82T 2F65A 3HT3A 4WTYA 4JUZA 4ZPAA 2C3PA 2YKQA 1FO1A 1HI0P 4I56A 2KHCA 1L3KA 5BR8J 3IR6B 4QR0A 3CCLS 4YEAA 5A8KA 1NDPA 1QVFR 4DU7A 1UEKA 3TI0A 1JLFB 2GAHC 1ICEB 3PACA 5IT9Y 1HA1A 4RWXA 3R27A 4X4VA 1JLAA 2DNKA 2B43A 4JB8B 1X0FA 5A0YA 1IVZA 3DGPA 4QIVA 1UW4A 5E2QA 4ZVRB 4DQIA 2OEJA 3RB6A 3BSAA 2Y9HA 3A4TA 1RBAA 4C0HA 2MMYA 2R8KA 4H4MA 1HD1A 1P1TA 5FIIA 3V4IB 4F7VA 3IBCB 1EP4B 4EFAC 3IFEA 2KT3A 2GNKA 3IP0A 1VC6A 2HHWA 4DSJA 3H5XA 1RBLA 2KJVA 2OPRA 4LF6J 3KLGA 5E3QA 1PCAA 5I3QA 3QGIA 3NBPB 1WI8A 3MPWA 2KG1A 1PYOB 4H4OA 4RPFA 2MZQA 3EM1A 4K59A 2DGOA 2JFKA 4R8UB 2FQQB 2CZVC 2IRYA 4RW7B 1R8BA 2BJEA 2XSJA 1M5HA 1NDKA 3GFXA 3OD2A 2BEFA 2J9CA 1T9TA 2KRRA 3JTOA 2QC3A 1VRTB 4FF3A 1REVA 2MJUA 2DK2A 1V3ZA 3NCRA 3SQOP 4DCJB 3M8SA 4QWCA 1RAOA 1XIQA 3TA0A 1NLKL 4ZPBA 1AZSB 2WHOA 5AE3A 2MTLA 3KLEA 1NPRA 3OTEA 5ETLA 1VQ8S 2XWYA 3C15A 1JJ4A 1UJ4A 4Q5VA 1S1VB 5K14B 3D0HE 1KQGB 3PNIA 1IBCB 2GZOA 3HHDA 4B9VA 1GXTA 2VFTA 1EKRA 1YBAA 1HNWF 1B0VA 2KDOA 4DPUA 2KH9A 1HPZB 3CDWA 4HTJA 3T5KA 2XC9A 2HRUA 1F2GA 1VDHA 5CYMB 3MTKA 4EO6A 4JI1J 2E7XA 4HH0A 2Z57B 1HR0J 1F9EB 2DHXA 1RT3B 4YB5A 4NE9C 4CP5A 4IDKB 1WC5A 2ROEA 2EW9A 3G2XA 4G6VB 2R7WA 2ZDPA 2ZWOA 1RT1A 4ES2A 2XCAA 4DF8A 3OL9A 2E5JA 2NXUA 3VAGA 3FCWA 2GIQA 3NNCA 1UVKA 2CQDA 3JSBA 4XAKA 2UUAJ 2EPIA 1R0AA 4C8OA 4DV3F 4BBYA 4OX6A 1RWNB 4ID8A 2GGPB 3HF5A 4F36A 4PG7A 1ZOTA 3ITHA 1WEXA 4KFBA 2W7AA 3DC2A 4RZRA 4CT9A 5KG1A 2AYMA 1DURA 4FBTA 2JH3A 5ETMA 1FESA 2HWTA 2KZMA 1L3TA 1DARA 3NCQA 1KLMA 1U8SA 2ZZNA 2KYZA 3LA0A 3J80U 4ZLNA 2BOAA 4OZJA 3RZAA 3VQTA 3BM7A 1D0EA 4NLVA 2R9LA 4BHQA 4USTA 2JEGA 1J5OA 4ANCA 4Y2MA 5T14A 1WHWA 5BYSA 2FTRA 3HHLB 4QU6A 3QIPA 4N8OA 3TAMB 2XG8A 4X4UA 4ZVSB 1O51A 5D4NA 3UN5A 3SXLA 1U1OA 3I5CA 4YB6A 3V81A 2MEWA 3MFIA 4C8MA 3CNQP 4ZDNA 1ZZNA 2B6AB 1TKZA 3KJVA 2I1RA 4IRKA 2IY5B 2G2YA 1AXQA 2YKMB 4DS4A 1RGVA 4QWAA 4L6V3 1PYSB 3OSNA 1ELOA 5HROB 6AT1B 2XCPA 4NI2B 4WZMA 3CIZA 3MFHA 5HLFB 1UTAA 2YXLA 3DLGB 2GO8A 1IUJA 5L8RC 3Q2SC 3DRSA 1EZZB 2HRTA 2CQ4A 4C7QA 6FD1A 2NYHA 2E9RX 5DZ7A 2V50A 2PEHA 3M6XA 5DDQC 5JJBA 2XMAA 3PYFA 3SFGA 2W2OP 5ADZA 1X5OA 1PGZA 2WOMA 5DDOC 2B3TB 2HURA 2ZNZA 3KUHA 2CQIA 1EETB 4MFBA 4KPYA 1D8ZA 4IR9A 3OHBA 2HGLA 2OEKA 4K4ZA 4PQAA 2VKZG 5C5JA 1WC1A 1VBKA 5A8WB 1XMQF 3U7JA 2HNYA 2DGXA 3VZHA 5AE1A 1G3OA 2VBXA 4HACA 3M8ZA 3DCAA 3MD3A 4CTAA 5CA5A 3TNVA 3NGRA 3OXFA 5THWA 4L3KA 3IMQJ 5DG9A 4A8MP 3ZZ0A 3DLBA 1PC5A 2YWEA 2V4JB 1E6YB 1NU4A 3PKYA 4EO8A 3ISZA 3MEGB 3JQJA 3T41A 4WIQA 4P10A 3THPA 3OBIA 2NLWA 3C6TB 3MI7X 2KFYA 1P8GA 3NEKA 2W7OA 4PWDB 3CGIA 1EJ7L 2UV8A 2HNDA 2WSFC 3VAKA 2XLJA 3BBFA 1IKXA 3G82A 4ILRA 3ZZYA 1X5TA 2XYHB 3W63A 3M7VA 1NRKA 2VDIA 1J2VA 1T02A 2HRYA 4DZ6A 1I3OB 3D54A 2DNMA 3SI8A 2VHGA 2RHSB 2HHQA 2BXJA 3RG6A 2UUWA 2HQIA 5KFKA 1TV6B 4KIAA 4ZCMA 3AX5A 2KRBA 1SCJB 2OI2A 2Q1LA 3N28A 2ASLA 4ZJQA 4MMOA 2FJDB 3MM8A 2P8IA 1FFSB 1TZ0A 3SFUA 1XNRJ 4F4AA 2FUG9 2DNNA 2VC1A 4I1TA 2Z58B 4PPDA 3I0RA 1V5IB 2DISA 2W2PP 5KT5A 4GVBB 2RQKA 2XMVA 2MPUA 3TA1A 4DPXA 3Q8UA 2V1SA 1SPBP 1HI1A 3TVYA 4A8KA 1K8AT 5DZ6A 3OW2R 1CJKA 4LVNP 3MAAB 4G1QA 2DBBA 2NCKL 2DR5A 4MKBA 5L38A 1BQNB 2FHJA 1N33F 1OY8A 4IFYB 3UN2A 1JLCA 5E3PA 4P74A 3CD6S 2R3VA 3MPVA 2GX8A 2OFGX 3L7UA 1UVNA 2H48B 4DUZF 1TTHB 1RISA 4ANDA 3NMRA 1LWEA 1F6TA 2GCFA 1EKSA 3M9MB 3ULHA 2OTJS 4IFVB 3IXQA 3FZBA 2J0QD 4PG5A 3JTNA 3NY0A 4CO4A 2AU0A 3QZ8A 2BR0A 1Q79A 5JMNA 5U47A 2BOPA 5IT9U 1OMSA 2RJZA 4Y3CA 4DSLA 1QUVA 1S9GB 5J2MB 5HJXA 1RWVB 2J76E 2GVDA 1VQ5S 1RHUB 3PW7A 4UY8T 4L3NA 3M2VA 3KHGA 1TFWA 3F0NA 1P9QC 2LEBA 3SV3A 1TUWA 1VISA 3CJRA 4V19J 1S1TB 2FVSA 2XO7A 1QTMA 3FMBA 4USMA 2UUTA 2XS7A 4R0JA 3AXKA 4USKA 2V9KA 4CLFA 3QRQA 3W9IA 4J9NA 4DV4J 1K1QA 5K20B 5KFXA 3H5YA 1QDUB 3PO4A 1QAXA 4G1IA 2YNGB 4CRJA 5HO4A 3IWLA 1UWAA 2C2NA 3K2YA 1TL3A 4E8UA 3NNHA 1A0OB 1HBOB 2XLKA 2BJ3A 2XMWA 2I8EA 1FRMA 4O4GB 2HIQA 3QYYA 4OYAA 1HBMA 4F0HA 3M2UB 1NCLA 2ZD1B 4JYAF 2R7OA 4ATNA 4DR3F 1B70B 1QAJA 4IG0B 4XPEA 2W1BA 2VFUA 3UO0A 1NSAA 1M5KC 3PO5A 1LWCA 3MM9A 4Y2IA 1YGYA 3US5A 2N3OA 4DOZA 1AT1B 1HNVA 2BANA 4M5GA 2RHQB 2KM8B 4ZIVA 4DPWA 4NLYA 3I96A 5AXLA 4XDCA 1LFWA 2BW2A 2ZVIA 5GAHI 1X0PA 1P9YA 2HFVA 3HP6A 1UWBA 5KT4A 1PBAA 2BRLA 2XQCA 3GSIA 4NYPA 2EFPA 3D6HB 5J2PA 4FXVA 1ULRA 5FDLB 1YDLA 4P52A 3EZUA 4Q2LA 1QY7A 3BQ0A 3POTB 1VCTA 2BW7A 4GRSA 4I2QB 4KKOB 3TARA 2OPPB 3QGGA 1HIYA 3H20A 4O3SA 4QIEA 2HHSA 2RS2A 3VGVA 2X51A 1YG0A 4JI3F 1KEKA 1HNIA 3GV5B 2CQ2A 3FKBA 2LQBA 4RUCA 4CLTA 3V4IA 3RW6A 2F63A 2RRNA 2A3JA 4OJ1A 3FRYA 1JXLA 1EP4A 1DBDA 2AV5A 2AW0A 4YMEA 2M7SA 1C4AA 2RKIB 1FTRA 3K89A 2AD9A 2QA1A 2MQOA 3J7A1 1QUPA 2EFOA 4A8YA 1FCAA 4A46A 2ZE2A 1NMEB 4FS2A 2E1RA 2R4FA 3CCVS 2LFVA 4F0KA 1HWIA 5C25B 4DR7J 2XULA 1C2PA 2J0XA 3AJ1A 1VS3A 4ZA1A 2RVJA 1H38A 2M4MA 5KFMA 4DQRA 2BABA 4DX6A 4K4UA 3Q8VA 4DEZA 1S97A 3LWLA 2FJXA 3R2CJ 1F2HA 1JLEA 3UDCA 3KLIB 4TYAA 4U95A 2F9DA 4M1KA 1UA1A 1DQ9A 1T9UA 1JX4A 5G0RB 5EDWA 3W65A 3U1NA 4FN5A 3S7RA 2YVSA 5DG7A 3PJ9A 2QLJB 4KY3A 4ZHRA 1S1UA 2C28A 4JI6F 3QJLA 1BHNA 2DEJA 3HVWA 3MPYA 3MR7A 3TAQA 1FJCA 1N36F 1RWPB 4M5JA 4LF8J 3DDKA 5ETNA 2ZH5A 2JC0A 4LSNB 4EZ9A 4ECTA 4YHHJ 2O3DA 1N5SA 4F67A 2LU1A 3D66A 4QQBA 2IC3B 2XSFA 3OQ2A 2E9ZA 1NJIT 3MAHA 2X1AA 2D68A 1XBWA 1T9VA 4CO1A 2B9XA 1N5YB 4GO5X 2F4VF 1UJ5A 5F8MA 1QSYA 5KT2A 2MLZA 3LH2S 1Y5NB 4GC6A 4PYAA 2ZZMA 1R8PA 2DRDA 3SDEA 4ILLA 3GV8B 1IBLF 4OJGA 1NK6A 5JUMA 1VQ6S 4YN3B 3K57A 5IQ6A 3T5LA 2Y0SD 2B8QA 1X4FA 3RAXA 1VIXA 2A18A 1NK9A 3EDQB 3SZ2A 4A8FA 2ACYA 2K3KA 1VQSA 4O0NA 4USVA 3MM7B 2BUNA 4OFZA 2HVIA 2B9EA 3KDOA 3ZTQA 3PR4A 2QX0A 2CRLA 1CS4A 4LSLB 4PG8A 4USUA 2UZAA 2QZ8A 2EXUA 3F56A 2VQFF 3PW5A 4DHVA 3UWTA 2V0NA 2ZNYA 3DNCA 5M2PA 3D6MB 4FYXB 3QFHA 3HDSA 2YX4A 4LFBF 2XLIA 4P71A 3TAMA 1R31A 2L41A 1RTJA 2V4RA 4LIWA 2CJKA 4Y28C 4FVMA 1VQNS 1KD1T 1YRUA 4QPTA 3EZ5A 4GMKA 1RAJA 4RWWA 1U1NA 1TL7A 2ZWPA 2QRRA 2C2MB 3U1MA 4URGA 2MZ1A 4J9QA 2YNHB 2VFVA 1KVIA 1U49A 2VPZB 2OTLS 1S6QB 2CJAA 3R5BA 2CNOB 3AD9C 4RL1A 2F8MA 3J81j 2KVQE 2GFFA 3E01B 2YBVA 2CADA 3MM5A 2HHVA 3N5BA 3KFWX 2GA7A 2V2VA 1S5ZA 2KL8A 1R89A 5F0UA 1S6PA 4F3MA 4B9TA 2ZJQQ 3QNWB 2G0IA 3DKDA 3X3UA 4UQGA 1RU1A 3QAUA 3KWMA 3T5HA 3KK2B 2J8SA 5D0GA 1KOOA 1RAAB 3CW2C 4FYDA 1EETA 3D67A 1VR6A 2O01C 3MUTP 2PT0A 4I7FB 4QOTA 3V5RA 3AB4B 1M5OC 1TAQA 1JIHA 1KRPA 4OYIA 3H5UA 1BQMB 1CULA 3DYAA 2AYGA 2KT5A 5CD4A 1K47A 5DG8A 3W60A 4BCAA 1LQ9A 3HFKA 1Y4ZB 2RE1A 1M1KT 2UU9F 2HQ3A 1CG2A 4PUOB 1ZAWA 5LJ3Y 4ZVTB 3VCDA 1RK8A 2X1GA 2LYVA 4HHHA 3MEGA 2PD1A 3FBBA 3N6NA 2XTJP 3H7HB 5C24B 2JOQA 2AF6A 1S1WA 2QN6B 2WONB 2AJQA 4PWDA 2W01A 2WW4A 1RTZA 1AW0A 3GCXP 3ETMA 2DH9A 1MMNA 3TVKA 2ATCB 4EZ6A 4F50A 1C0UB 2Z4PA 1HNWJ 5E33A 2W25A 3DMJB 2JNJA 2VPYB 1WG1A 2MKSA 3G8SA 5AXNA 3NWGA 4B9NA 4B02A 3AWRA 1E6VA 2BV3A 2Y1IA 2DCLA 2AX0A 3FBFA 2A0FB 2BDPA 3G6YA 2GMHA 2OIHA 1HQEB 1TKTA 2EFQA 3MAQA 4FF2A 4ZVEA 3VF0B 5IM0B 1O6XA 2K3IA 1WHVA 3EYZA 4U6PA 2CQGA 5LXRA 4FPIA 4OZNA 1CJUB 2E5IA 1H3DA 1YLXA 3BF4A 2RRBA 4K2JA 2HBRB 4DV3J 2IFXA 1B64A 1DQ8A 2MQMA 3PX6A 1F60B 3BJYA 1DFDA 3ET6B 3S01A 3N6MA 5HMYA 3TZZA 5LMUF 4ELUA 4AL5A 2QYGA 4GVBA 3C66A 2V8VA 3PCOB 2ZC4A 1TKXB 2GS8A 4CYUA 1S1XB 1L5UA 2ZHOA 1YITS 2VA3A 3CCMS 2MKKA 2FJVA 3MXHP 1UPMB 1ZM9A 1RWOB 4L74A 2ZDOA 2F4FA 3G6ES 2E44A 3H2LA 1HKAA 3GFZA 2VONA 1RT7B 4YS2A 4ZKAA 4KO0B 2ZH6A 3UDEA 2KXNB 1RTDA 2HFNA 1LWFA 3QLHB 4C3KA 1QSLA 1ACMB 4IFYA 2VG5B 3SSRA 2HBQB 3LP0B 2ZM6F 2ZJRQ 3M6UA 5KG0A 1NK7A 1RADB 2P9CA 4X4OA 3UNGC 3SCLE 3TJAA 1U0HB 3HFZB 3R1HA 2QMUB 2ASDA 2MY7A 2QE5A 2MLYA 3CT9A 1BC6A 2Z2ZA 2DH8A 3UVJA 2M88A 1UEUA 4F4YA 3NAIA 2QJ3A 4USIA 1UAWA 4ZLPA 1ZA2B 4MIAA 1XN9A 1KHWA 2BYCA 2R42A 3HM9A 1CEZA 4TU8A 3ZZRA 2NXCA 4ZPWR 4PXDA 2ZBQA 3TZYA 5MLCV 5IWAF 2BJ7A 3CJ5A 2HGMA 1BXNA 2OHDA 5J2MA 1X4HA 2UUBF 3O44A 2JVOA 2RH3A 5BYQA 1JLQA 4DPYA 1OY9A 2FPHX 1YZ7A 3EVOA 1S59A 4CH0S 2CQPA 4WFXA 4P2MA 2IA6A 4O3QA 2OSRA 2AJ4A 3HLUA 4DUTA 1NBEB 5EWEA 1XMQJ 3X1LB 3HULA 3BSOA 1XTZA 1N88A 5ETPA 2B56A 4ZCIA 3ZTRA 3PVXA 4ICLB 2ROGA 4UZCA 3FSYA 2HYIB 3ZNUA 5HP1B 2Z2YB 2IVFB 1HL6A 1B99A 3DM2A 4QWEA 4ZP9A 5IS2A 5JXSA 3KG4A 1U09A 3LO3A 4CT8A 4DR2F 3D1OA 4O3NA 3BBCA 5JVHQ 2DR7A 1SJFA 2X7IA 3BGLA 4W92B 3IRXB 2R7SA 4DL2A 3T19A 1EQMA 4RUAA 1VQOS 3K5PA 5IXUA 3W66A 1OO0B 3QO9A 2G2ZA 3M2UA 2ZD1A 4FDFA 2XZTB 4ZVOB 3HT0A 3TX0A 2QGFB 3HSJA 3EGWB 3QRPA 1AA1B 4IG0A 2QIFA 3AD8C 1KNZA 4ZVUB 1W2BR 1FKOA 4LSZB 4PQUB 3MEEA 3MEDB 5D0HA 2KFNA 3IBWA 3Q8PB 3RB0A 4DR5F 5IFMA 1WKLA 1Q53A 2IAJB 1SC3B 4FPRA 3NXZA 1HNXF 2D69A 4I0WA 2OGUA 4PG6A 3DRYA 2XI3A 2VL1A 3TW0A 4CI0B 1HBNB 4J9LA 4OYPA 1QLNA 4Q45A 8AT1B 5KFWA 2HFZA 4ZP6A 1L3SA 2HK3A 5LM7E 4DV2F 3RAQA 1U6BA 1KN6A 3KG1A 2I9SA 3MPDA 3V4MA 2N4DA 2RILA 3G96A 2EWHA 3Q8SB 3UCUP 3LUYA 2ZJPQ 9ATCB 1NK8A 3GZ7A 1FKAF 1SIZA 3BSCA 2WSEC 2LKZA 4X4QA 2HZAA 4OYBA 5FLXY 2BM1A 3G8TA 3RRHA 1LV5A 2OH2A 1F0XA 2ZH8A 1T7PA 3BYPA 2APOA 2E5GA 5ETQA 5ETVA 2OPPA 2HFSA 3E3XA 1WG5A 5KFYA 1IBMF 1HNZF 3LPYA 3TVZA 3M8WA 2E7VA 2RIJA 3O3LA 1GXUA 3KMSA 4OV6A 2GHWA 3OR2A 4DFKA 2BBEA 4ZITA 4TN2A 3CJ8A 3CCES 1WTBA 4Q43A 5KFUA 2ZH2A 4HDGA 2AGQA 2FHJD 1RYRA 3NNAA 3FFIA 2MB0B 2E9TA 2XZ2A 5E7OB 3CCQS 3IM8A 3MECB 4LUBA 2XMJA 5F9LA 1T03B 4K50A 2V63A 2G13A 5DLGA 1T3NA 1N33J 1WC0A 5LOQA 4TU7A 3CIMA 3PW2A 3T1HF 3F73A 4TXSA 4CNYA 5E3AA 1OWXA 4YR0A 2V69A 4DI6A 4B9LA 3R5JB 2ZHAA 5CXTA 2ZITA 3EZOA 2CPDA 4DL0C 1HBUA 3AQOA 4IR1A 4DUZJ 3QZ7A 5GADI 2W4CA 3MTJA 5HBMB 2LXFA 5DLFA 1GMWA 2RT3A 4DR6F 1FKPB 2HVHA 3P4UB 2ADBA 3GIRA 1X4GA 3MZIA 1IM6A 1TKDA 1LW2B 1H0HB 3KLIA 3BDPA 2CPFA 2Y8YA 3BKUA 3CMES 1MWZA 2JSXA 1DRZA 2FHMA 2YWGA 2RF2B 3DGVA 1X4EA 2V8GA 4OI0A 3LF0A 3SV4A 1UW9A 4KB7A 1G7CB 4NX9A 9RUBA 4K4TA 1U6ZA 3CE8A 3DRXA 3IG1B 4ETXA 4RNNA 1PJ5A 2IYIA 5ETOA 4CM2A 2IMOA 1FJ7A 2I0XA 1GTEA 1WKJA 3EDRB 5F8JA 2YWWA 1ZBTA 5BJRA 1F9HA 3NGSA 4Z2XA 3L09A 1NM2A 3M2RB 4URQU 3D9BA 1IQTA 4DL4A 2DNGA 1CJVB 3CB4A 3C14A 4Y34A 3A13A 1RCOB 2KT2A 2ZBIA 4X84A 5CYQA 4CCHA 2W9BA 1KP6A 4IQMA 3RW7A 1BGXT 1V5VA 3M1VA 3CC2S 4ECVA 2DRAA 1KTVA 3CD0A 2N4CA 5IOLA 3QMQA 1IXKA 4HI2A 4P7VA 2IJNA 1R8CA 3ZTPA 4DWIA 2K2PA 2FVPA 4C2MA 2H5EA 4JYAJ 3JSMA 3ICLA 3I0SA 5LL6d 1KBRA 2V67A 4DR3J 2OPSA 3BZQA 1JQGA 2BZ2A 5D0RA 1O0PA 5CQGA 3FCVA 3MF5A 2B8PA 2MQPA 1MN9A 2A2CA 3QBCA 3EVMA 5HQMA 4H4KA 4I2PB 3PZPA 1S9EA 5KG7A 2VOPA 1JNRB 4K5SA 2C1EB 2OPQA 3W5ZA 2XMTA 2QTWA 3PEJA 3DLHA 1CPZA 3PFEA 4NXMF 3K8WA 2GQCA 2AHOB 5I3UB 4DR4F 2VKRA 2WW8A 3BR8A 4FVCA 3BQ1A 2QSWA 2RMLA 3TANA 4F0MA 4J9RA 1FDBA 1U24A 2H9ZA 4NMLA 3H4DA 5CZVA 3CMQA 1TELA 1EB0A 4KR0B 2AMCB 2A10A 3AFGA 2AT1B 1FI4A 1DTQB 2VDHA 2Z2LA 4DSFA 1FK9A 2JVRA 1UJ6A 1ZPWX 3G71S 2F9JA 2E1CA 1T0TV 2EC0A 4DFMA 3BSNA 1FFGB 4A8OA 2DNRA 4XDDA 1MROB 1U2CA 3RRGA 2EVZA 2OMLA 3K5LA 3RYLA 4NRTA 4JI3J 4DXLA 4OL8A 1FE0A 4YP3A 2OKQA 1T8EA 2HFOA 4X66F 2FYXA 1ZTTA 1K0VA 2Y3YA 5HMXA 4Q8FA 4PKDB 1CVJA 3TQEA 3OL7A 3DLKA 4M5LA 3LTOA 1UL3A 3LP2A 3FRZA 3EJMA 1VQ4S 3PHTA 1HW8A 1YJUA 1PIEA 1M1GA 3TO8A 1S48A 1TVRA 3C6UA 1NKEA 2I5JA 4M5MA 2AGOA 1CQMA 3NG8A 1CC8A 2C42A 1VIOA 5ETTA 5J2QB 3OVSA 1B0TA 2GIFA 3BH7B 3LALA 4U7CA 2HVEA 1RDRA 2EI5A 2RB7A 2QFIA 1RE1B 4PUOA 2CUYA 4EYIB 1C1CA 4USWA 3HVTA 4ZK7M 1TAUA 4C8LA 5F8HA 3FSXA 4LFAF 4J7CA 3SBMA 1UVIA 2K8GA 4JI6J 5BYRA 1IBKF 2DXEA 5B09A 3UR3C 4C48A 1N52B 3GWCA 1N36J 2MLXA 2FB0A 2ZZTA 2G1DA 2C2ZB 3ZNJ1 4C0OC 4ES1A 1GXLA 2YNFB 4WXOA 4TNOA 3G87A 3T3FA 2VB6A 3P8BB 2QA4S 3AOAA 3R1LA 4ZVQB 2RDJA 3NP5A 2WBMA 4TLRA 4NLQA 4USJC 3IS9B 2YX7A 1FJGF 2DNZA 4ECQA 1RT4B 3MPUB 5ETKA 3BGFA 3T1YF 5E0OA 4LT6A 2KO1A 2FLPA 2D41A 2WRMA 2F4VJ 3GYNA 4ZVGA 1UZDA 4W98A 5KFSA 2AYEA 1RCXB 2MXYA 1A9NB 4ED1A 3RJMB 1IBLJ 5CCLA 1VLOA 2EFNA 4ID5B 3T5JA 3IC1A 2BE7D 3R5CA 3M30B 2C2OB 3QWPA 4FXWA 3W1YC 2DGTA 2DNQA 5KT7A 1HD0A 3I4PA 1TKXA 3PRDA 1FRHA 4ZPTR 4DU8A 3L95X 4Q0BA 1JLBB 3Q83A 1RJJA 3V6DB 2R7XA 3HFVA 2PA8D 4F04B 2HHTA 3H4BA 2MY8A 3OT9A 1U7LA 2Z56B 4FNHA 3HHLD 2V1TA 2ZEJA 4HR2A 1JKHB 1RB0A 2VQFJ 1RT7A 4LBIA 4PEOA 2JEIA 5GAEI 4KO0A 2VICA 3V2UC 3IA0A 1NHKL 2YKNB 4LFBJ 2V8HA 5E41A 3QLHA 2DTJA 4ED6A 4C11A 2B4UA 3M32B 3LP0A 1WHYA 4HHJA 2ZBCA 4WJBA 1TK0A 2Y1RI 3SCJE 1TL1A 1TK8A 5KFJA 1JJCB 2J5AA 3OPKA 1UFWA 2G1HA 2H5IB 1RT6A 1C0TA 3OXGA 1JB0C 4MKAA 5B0EA 1VBXA 2ALZA 3SCKE 5AJ3F 2W9AA 4QZVB 2VBWA 1HMVA 4HDHA 1MU2A 4OLOA 5FLXU 2NZCA 3KK1B 1S9FA 3KLHB 1VK3A 4LIRA 2JLEA 2J0SD 2ABYA 1FXDA 4C0BA 2HHXA 4N41A 1ZM2A 2GJ2A 2VD3A 1H98A 4KGMA 5DS7A 3W9JA 1JK9B 3A8IA 4M63A 4YR2A 1RTIB 4R5PA 2QLXA 3ZZPA 1WG4A 3CWJA 3BYRA 3H59A 4GKJF 2HBZB 2UUCF 2MKHA 4ILMA 4MIBA 4DFPA 1RHRB 2B7BB 3OUYA 4DLEA 1RWWB 3W2WB 4NLPA 3Q22A 1B4SA 1VC0A 3OVBA 4B3SF 3VALA 1X4AA 1HI8A 3ILIA 1R7IA 4ZIWA 5F8GA 2HHHF 4A47A 1KQSR 1UMJA 4ICLA 1SVDA 1LK5A 2ZHBA 4ZPVR 1NJYA 5HP1A 3B78A 1SJRA 4Y2KA 1SUQA 2OFHX 3W61A 2LA4A 2XGQA 3C16B 3PJWA 3DLLQ 4AFFA 4P2SA 4J9PA 2UU9J 2CWKA 4F4ZA 3OR1A 2B9WA 2E1PA 4V1Ak 4O44B 4Q44A 1TQLA 3KLVA 2DGQA 3K0JA 2FIUA 2DXFA 2K1RA 5L1JA 2HAFA 4W90B 4IQXA 5GMKa 4FKXA 4DUYF 3IGNA 3TUJC 3UDVA 3K5OA 5HQ8A 1M5PC 2HMIA 4M95A 4CWBA 3RR7A 3TJ8A 3ZZTA 1S10A 5B0BA 2UXCF 3SCIE 3SSQA 5B08A 3TZWA 2IAJA 1IM4A 4DCPB 3TUPA 1J5EF 2BM0A 4ZN1A 4WKRA 2MKYA 5LJ5Y 3MURP 4RNHA 4B3OA 3JQKA 2Q6BA 5HI7A 5J1EB 2ZFHA 4OI1A 4P75A 2BKNA 3R7SB 2BE9B 3H90A 2FJAB 3TZXA 3LPEA 3AX3A 4IOAQ 1IKWA 3I4HX 5E3CA 1WC6A 2R8JA 3O2IA 1ZAXA 1MLAA 3BS9A 2XB2D 4ZOSA 5B0AA 1BWVA 4AXIA 3M6WA 4EK2A 4IO9Q 4DV0F 2FZCB 3R3TA 2B5JB 4K4SA 4ZJLA 2ZOMA 3GLJA 2BJ8A 2MGZA 4J9SA 1WOOA 4P2XA 2GVZA 4RJVA 1EIYB 3GFHA 4PG4A 3P45B 4K0KF 1DQAA 1HYSB 4Q7AA 3MR3A 5IV3A 4JV5F 1VRUA 3QT6A 5LMUJ 4HHUA 2D7SA 1RABB 5C2CA 3Q24A 5KFRA 3BDEA 2Q79A 4AT1B 3LGNA 3R5DA 3D7SB 3EGVA 4EGLA 3GG1A 4D3GA 5KG5A 1UVLA 2O67A 4FKYA 1U45A 3MGJA 2W9CA 5T7LA 1VHFA 1W26A 2FDNA 3DLEA 3MECA 2CZ9A 5KG6A 4O3RA 2CYYA 2DCUB 5GAEU 3M8QA 3CO9A 1K1SA 2IRXA 4N56A 4J90A 2YNIB 1Y00A 2ZM6J 5EUHA 2NPIA 3L9ZA 3SQGB 1IKYB 5SUHA 3ISND 1G2EA 2Y1JA 3D2WA 3I31A 4LR7A 1OY6A 1FWLA 3ZZZA 1PJ7A 3GCWP 1HQ2A 5HBMA 4ZCLA 3DFEA 4IOBA 1AYEA 2HK2A 3CVKA 5A8KB 2E7WA 1SB6A 1EQ0A 1OSDA 1CC7A 2UVVA 5E3RA 2QLFB 1DTTA 3MMAA 4M5KA 2PO4A 3KK3A 4U96A 1LW2A 1JLAB 4ZPCA 3GJTB 4JI4F 3BB5A 5A0YB 3DGPB 3DDNA 3R8YA 4N76A 5F41A 3OJSA 8RUCA 5GAGU 3QFWA 5IWAJ 2HLUA 3TJ9A 1U1MA 1S7HA 4DN0A 3PRBA 2QYCA 3V6JA 2UUBJ 4RUBA 1BE4A 2FC9A 5C42A 3GMGA 2DYAA 1LWXA 4ECWA 4O4RA 4KHRA 2HWIA 1NXIA 3RBXA 5AXMA 2DVIA 1X9SA 2XMUA 4YR3A 4OHYA 1B3TA 4F02A 1ZM4A 4DL3A 2R2UA 4J9VA 4JI5F 2R7VA 4DS5A 2C22A 3HHKA 2M8HA 1Y5LB 4AE5A 2L9WA 4R25A 2X3DA 3DOLA 3PYGA 2FC8A 1NKCA 1S99A 1OQ3A 2EFGA 3ZO7A 2XSJB 2AWZA 1RTHA 3PW0A 1G1XA 5DM7Q 3TWZA 8ATCB 4DR2J 1T05A 4WU2A 1R0CB 4CO2A 4NCAA 5MAOA 4JI7F 1REVB 5GMDA 3A3NB 1FDDA 3MUMP 1IWAA 1IR2A 2G9OA 2RQCA 2RAQA 3MWBA 2MQLA 2DRBA 1X5PA 3EE3A 3CMAS 2RU3A 3KLEB 5LXYA 2DNLA 3PIOQ 3C15B 4RW4A 2PMZD 4HI1A 3G6XA 3W9HA 1WDDA 4LF4F 3MMCA 1YIJS 2YWFA 4MYUA 5HMWA 1HNXJ 1JLGB 1V6HA 3AAWB 1ZPVA 4MKYA 3KJNB 4EI2A 1T9XA 4NLUA 2X1FA 1C1BA 2WCXA 4DBQA 1FXRA 4C3MA 4RX6A 4P2FA 4ER8A 2H3EB 4AL7A 2U2FA 4DV2J 1PAUB 4ED4A 3VZIA 4JP8A 2VA2A 4NZ6A 1RT1B 3NMAA 2DR9A 4YB7A 2HQDA 2LDYA 5EWGA 2PI5A 4ZS6A 1S12A 4HVZA 3VV2B 3F44A 2LQ8A 2WSCC 3RGIA 2VG7A 4WKYA 4Y2AA 1IBMJ 4RU2A 1R0AB 2ASYA 3W64A 4BC7A 1HNZJ 1VJQA 2KXFA 1MROA 1PC4A 4TQSA 1N48A 2ZH3A 3ITHB 2W8KA 4KFBB 3O5TB 3QWUA 2VPXB 3JYTA 4MK8A 3TA2A 1RHQB 4WFBQ 1RSCA 3A3PB 1CJTA 4UF4A 2X3GA 2EG1A 1KLMB 4ECUA 1FF2A 2YWKA 4JI0F 4DX7A 5CHCB 3D68A 3N9UC 2RU9A 4KBIA 1YRXA 4DL6A 1XQIA 3GYGA 2NZ4A 1J5OB 3A3OB 2PSZA 3QIPB 2Y8WA 1PAEX 3T1HJ 2FHKA 1X4CA 4F2RA 4UY85 1GMWD 4TU9A 3BQ2A 2J0WA 3V81B 4FYVB 4K8RA 2N82B 2LU2A 2DHSA 5A6WA 3KJVB 2IDLA 4DR6J 3JB9k 3EPGA 3RBZA 4ZP7A 1Q8KA 3W3SA 2EK1A 2V8DA 2IM2A 4HYKA 3ISNC 2DB1A 3CJKA 1EX8A 4PABA 2AEMA 4ECZA 3IWNC 4WYLA 3FBCA 3CSKA 2Q43A 5HL7Q 4AYBD 2LLZA 5KFCA 1DY3A 2Y1LB 5A8RA 3J7Z5 1RWXB 3DHWC 3H98A 1XR5A 2QMXA 2A6MA 2WOMB 4LQ3A 2ILYA 3KKFA 4ED3A 5KT6A 4MFBB 2N7CA 4UUWA 3PR5B 2KFZA 2DNYA 4A48A 2B4VA 3ONQA 3DN9A 2HAIA 3QT8A 4DZDA 3GR0A 2HNYB 5FD1A 2RUGA 1WF2A 2KB2A 1Y0HA 2QL7B 1HWKA 3R2DJ 1EAYC 5F0WA 1RT5A 4HACB 3W5YA 4CTAB 3G8QA 4OYOA 3KNGA 1SH0A 1VQLS 4LRBA 2H4YB 3TEHB 5D4PA 2NR0A 1IQZA 1WDTA 1N0UA 1UP1A 1VLYA 2CQCA 3O6QA 3EXYA 2XWXA 2DKOB 1FVQA 1VI7A 5KFOA 2VIHA 1KOHA 1SV5A 2JDJA 3DOMB 1BLUA 2ZUGA 5L1IA 4IH6A 1MWQA 2UVUA 1VMBA 3M30A 4UZBA 1S72S 4QR2A 3UW1A 4C6AA 4LF7F 1WKKA 2CDRB 2B0GA 4PZVA 1KWMA 1T9YA 1UETA 2D3ZA 2HNDB 4K2XA 1U1PA 4CQ1A 3G82B 2JRSA 3W5XA 1I6JA 3CO0P 3UD4P 3VGTA 2AZ1A 4NXMJ 4URSA 3HSZA 2BX6A 2UXBF 3T9NA 4DR1F 2GAGC 1M5SA 4DR4J 4NASA 1N6QA 4JBCA 4KV8B 3O1LA 3BO2A 4N77A 3HVRA 2GHPA 4M94A 2M3DA 4RBVA 4X2BA 2COLA 4ZMMA 3M32A 2DPJA 5K5MA 2NXNA 2G0CA 2JC1A 2Z0GA 2RQMA 4B9MA 5D77A 1IKVA 3CDUA 1TL4A 3IBFB 4TY9A 4WF9Q 2O5DA 3MM8B 1SJ3P 3CXCR 2I6WA 5ETSA 1HFEL 2XS5A 2CJQA 2N3LA 3AHPA 1N54B 3I9V9 1B7FA 3KLHA 1H7WA 3CUNA 4LRCA 4A8SA 1D1UA 2YY3A 1S4FA 1WEYA 1WD6A 4C9DA 1VC5A 2PN6A 2VC0A 4Z37A 4WE1A 3AODA 3A8EA 1LXJA 1FTCA 4X66J 1RTIA 2ERRA 1RWMB 2GJIA 4PYDA 1XJWB 4G1QB 4DLGA 4ED7A 1O8BA 1RAFB 3W2WA 3AY0A 3RRKA 2V2KA 2MDAA 1YVFA 2R7TA 2HS0A 3CULA 4KC5A 1FHTA 2HFUA 1JLCB 3DRRA 3QIDA 2J7WA 3MEKA 3FJ2A 4W4MA 2J6TA 4NLOA 3DI6A 2KTQA 3GSDA 1S77D 2VPWB 3MMBA 2R7UA 2B4PA 4P6QA 1LWEB 1R3NA 3EUNA 2KI2A 3K8VA 2BVZA 4MTPA 3H2UB 3JTPA 2HZVA 5A2QY 2BJ1A 1OM2A 1Q5VA 3MCNA 4O44A 1NK4A 1QAIA 4IOCQ 2K06A 2LECA 3PYEA 3NOCA 3BEGB 4RW6A 3KDNA 3W7BA 3DRPA 3PXGa 4LFAJ 3M9NB 1LNQA 1Q0NA 3D1QA 4JV0A 1K73T 1IBKJ 2BJDA 4NLTA 3GR1A 3H25A 1WC3A 2FLNA 4QPXA 3R9LA 2F3JA 5HVGA 2BQUA 1KKHA 1AUSL 2DT9A 2IMWP 4OMFG 1UVMA 2FVCA 2MYFA 4M5DB 2BACA 4ED8A 2QSFA 4OI2A 2VFRA 5LMNF 5J1EA 1A6LA 2J6SA 3PFOA 1JLFA 1S0MA 3ZFVA 1QSSA 1TUGB 1FJGJ 1PKUA 3T1YJ 1ZM3A 4OZ0A 2HHUA 2V94A 3RU0A 2YH0A 5KFAA 5G4DA 3BGRB 1TL3B 1SKUB 3M8PB 1APSA 4XTTA 4G1PA 4C8YA 4P9SA 2EC2A 3Q8RB 4J91A
chains in the Genus database with same CATH topology
4NXNF 4K4ZA 2HNZA 2W9BA 2OAUA 4IQMA 2ADCA 1HARA 3UQSA 3RW7A 1BGXT 4PQAA 1AFIA 2XI2A 2VKZG 5C5JA 5A8WB 1XMQF 4YB1P 1VJWA 3M1VA 3U7JA 3P96A 1QM9A 2HNYA 4WIIA 1VQYA 4UQTA 5D78A 4JI2F 3CC2S 4RU9A 2DGXA 4LF6F 5J2NB 4ECVA 2DRAA 1KTVA 3VZHA 3THVA 5AE1A 1VQMS 4YFUA 3CD0A 1N34F 1G3OA 1H6KX 2VBXA 5L39A 3DCAA 1R6YA 3MD3A 1HQUB 2N4CA 4CTAA 3QMQA 1IXKA 4HI2A 5KOXA 4P7VA 5KFIA 3N4WA 4DSEA 2NREA 4Q0BB 2IJNA 1R8CA 1Q16B 4OZLA 2K2PA 5CA5A 4XO0A 2BE2A 3N0VA 3TNVA 3Q8QB 3GIIA 2FVPA 1T95A 1HYSA 4C2MA 1W2IA 5KFEA 3OXFA 1A7GE 2VH7A 3QAEA 2CQHA 5THWA 2H5EA 3NAHA 3JSMA 3ICLA 3I0SA 5LL6d 3MM9B 1S76D 1HW9A 3NBPA 2OPSA 3JSRA 5DG9A 3BZQA 2BZ2A 4A8MP 1FDNA 1U47A 3OTOF 1O0PA 3ZZ0A 5CQGA 3DLBA 1PC5A 2YWEA 3MF5A 2MQPA 1KFSA 4YOEA 2V4JB 4H4KC 1E6YB 1NU4A 3PKYA 4EO8A 2A2CA 3ISZA 2D3UA 2QO3A 4R8UA 1Z4UA 4H4KA 3MEGB 4I2PB 4RW7A 3PZPA 5D3GB 1S9EA 4C11B 5KG7A 4OZ1A 4H54A 4A8QA 2VOPA 3NS5A 1JNRB 4K5SA 2ATLA 2CQ1A 3IRXA 2FGCA 2AX1A 3CCTA 3THPA 3R5AA 1UWBB 2OPQA 3OTBA 1TL1B 2XMTA 3PEJA 1DLOB 3D28A 3OBIA 2NLWA 3GV7B 1Q8LA 2GQ2A 3C6TB 3DLHA 1CPZA 3MI7X 3PFEA 2KFYA 1P8GA 1S6OA 5CH7B 2W7OA 4PWDB 4NXMF 2E1AA 4HT7A 3CGIA 2R7RA 3P6YC 3K8WA 2GQCA 4X4TA 2C2DA 2UV8A 4DG1B 4ETZA 5I3UB 2Q3PA 1RT6B 1VRTA 2GHVC 2HNDA 2WSFC 1C0TB 4B9UA 3VAKA 2XLJA 4DR4F 5F8IA 2VKRA 1IKXA 2HGNA 4ILRA 2ZH1A 2WW8A 3BR8A 4JI8F 3ZZYA 3DOKB 1X5SA 1X5TA 2DNHA 4F3QA 4FVCA 5J2PB 1NRKA 3BQ1A 1IR0A 1KR4A 3KMQA 2A2DA 2DHAA 2R8HA 2QSWA 2B9YA 4PQUA 2RMLA 1HMVB 4ECSA 5K9FA 2D9OA 3HI9A 3MEDA 1MU2B 3TANA 5DETA 1J2VA 2ZC3A 3E51A 4OX9F 4N5SA 1T02A 4CZCA 4J9RA 4NOHA 1FDBA 1U24A 2H9ZA 2HRYA 1GNKA 1ZZFA 4NMLA 4NLXA 3H4DA 5CZVA 3V6KA 2IHR1 4FP9A 3D54A 2DNMA 4KR0B 3SI8A 2A10A 3HHNB 2XEXA 5K8OA 1S1VA 2J9DA 1YJWS 5K14A 1VQKS 5H9FJ 2DGUA 4U9RA 2HHQA 3LP1A 2BXJA 2ZOFA 2UUWA 2HQIA 1DTQB 1DAXA 2Z2LA 4DSFA 2SXLA 4DL5A 1FK9A 1TL5A 2JVRA 3CCWA 1UJ6A 5KFKA 1UKUA 4JI1F 4MAKA 1TV6B 1ZPWX 4ELVA 4KIAA 4ZCMA 3GYXB 4R5PB 1HBNA