4NLYA

Poliovirus polymerase - c290e loop mutant
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
458
Chain Sequence
b'GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGESGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
total genus 140
structure length 458
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nlyA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nlyA02
3G6VA 4XO0A 1S0MA 4R8UA 5KT4A 3E01A 4NLVA 1MU2B 4ECTA 3VQSA 3NAIA 1SV5A 5KT6A 3C6TB 2ALZA 4KFBB 4NRTA 3JSMB 1S6PA 3BGRB 3I0SB 3M8QB 1RT1A 3BR9A 5JUMA 1IKXA 2HNZB 3DRRA 2GC8A 5EWEA 1WNEA 3H40A 2C2RA 4U7CA 2XGPA 3PHEA 2YNFB 1HNVB 3DLKA 3MFIA 3GILA 3KHRA 2IM3A 5J2MA 4PQUB 3KLFA 4EYHB 3Q8PB 1TKTB 2FLLA 3KLEB 1JLCB 1FKPA 4IR1A 3CVKA 4ICLB 1C0TA 1NHUA 4KHRA 4R8UB 3V4IB 1RTHA 3E01B 4F4ZA 3QYYA 4NLOA 4PWDA 2YKMA 1SV5B 1MMLA 3OHAA 3I5CA 1HQEA 1S6PB 3Q8SB 4F50A 2W8LA 5KFMA 1IKXB 2AX0A 4QW8A 1JLEA 3DRRB 5J2QA 3DYAA 3CDWA 2B5JA 4RNHA 3UDLA 3E51A 4Q43A 2JEFA 2V4QA 3MECB 5C24A 2XWYA 3V4IA 5J2MB 3V6DA 4F4XA 3KLFB 3NMAA 2FVQA 3G86A 1GX5A 4ZVEA 3BSOA 4IRDA 1FKPB 1RA6A 1XR6A 2ATLA 1SUQA 1EETA 1D1UA 1C0TB 1Z4UA 5DLGA 3KK1A 3H5UA 1RTHB 2GIRA 3NBPA 5L1KA 1S97A 3NAHA 3GIKA 4JV1A 1SH0A 1HQEB 3T19A 2OPPA 3N6NA 4J9QA 4ECXA 1JLEB 5J2QB 3DYAB 2B5JB 4IH5A 4J9LA 2UVVA 3MEGA 4TLRA 2J6SA 4NLRA 4MH8A 5C24B 3GV7B 1RT3A 3CJ4A 3V6DB 3MEEA 4J9NA 4O4GA 5K14A 4MK8A 1RAJA 1QAJA 4X2BA 4ZVHA 3KNAA 1BQMB 4RW7A 4YMEA 4ZHRB 5KFVA 1SUQB 4NLQA 1EETB 1RYRA 2AQ4A 3KK1B 4WFXA 4MIAA 3I0RB 2UVRA 3DLEA 3NBPB 4IG3A 3RBEA 1RT5B 2FLPA 4RUCA 4J9MA 3KHHA 4YR2A 2UUTA 3V6HA 4Q45A 2WHOA 4NCGA 2WTFA 4DL6A 3IS9B 5KG4A 1T03A 3MEGB 4URGA 3RB0A 4ZP9A 3DI6A 1JIHA 4IH7A 2V0NA 4RU9A 3T5HA 3MR5A 4FBTA 4K4WA 5KG6A 4Q44A 5KT7A 3GV8B 3M9OB 1RT3B 4ZP7A 2J6UA 1RYSA 3MEDB 3MEEB 3CJ3A 3CDEA 4O4GB 5K14B 3KLGB 3IGNA 3PJXA 3V6JA 3DRPB 2E9RX 2WOMA 1LWCA 4Y3CA 1VRTA 2JC1A 3FFIA 5KFHA 3OSNA 3M8PB 4LQ3A 5HBMA 3KLHA 4DL7A 4J9SA 4IG3B 3CWJA 4EBDA 2UVUA 1DTQB 3PW2A 4O3NA 4TYBA 3RB4A 5KG7A 2OH2A 2VG7A 2BR0A 2FJVA 1C0UB 4IG0A 3PW5A 2DPIA 2R8IA 1T03B 4LQ9A 1JX4A 3NKYA 4WFYA 1K1SA 3DI6B 4KV8A 2R8JA 3OLAA 4WYWA 2IJNA 4M95A 3KLIB 4J9PA 5JXSA 4OL8A 3NL0A 3GQCA 4IDKA 3KMQA 4O3QA 1S6QA 2FJWA 2AX1A 2WOMB 1R0AA 3KMSA 1LWCB 1VRTB 1JLQB 3KHGA 4HYKA 3FFIB 1XR7A 4IR9A 4MK9A 4NLWA 5HBMB 3KLHB 4NLTA 3H98A 3Q8RB 2YNIA 1JLFA 4QPXA 4MFBA 4RW8A 4K4ZA 4URSA 5KFJA 4ED3A 1TP7A 4ZVFA 4ED7A 3LP0A 1S1TA 3GIIA 1S10A 4DL5A 2VG7B 4ZPBA 3MR3A 4IG0B 1IKWA 3V6KA 3TVKA 4EO6A 4JV0A 3GIMA 4RNOA 4KV8B 2FJXA 3LP1B 3H4DA 5L1JA 4ECSA 4EYIB 3H2LA 5KFDA 1DTTA 3DOLA 5EDWA 2IJFA 1EP4A 2D3ZA 2D3UA 4IDKB 5KG1A 5KFSA 1RTIA 1R0AB 2AGPA 1S0OA 4ECVA 4F4YA 2W8KA 1QE1A 3H59A 4J9RA 4DL2A 2E9ZA 2YNIB 5KFYA 1JLFB 4Y2AA 2QV6A 3IRXA 4MFBB 4RW8B 1J5OA 2R8GA 3LP0B 1S1TB 3ISNC 1S4FA 3DDKA 1RT1B 4MKBA 3QIDA 5KFZA 1N5YA 2ZKUA 5F8LA 2IM0A 1JLGA 5DG8A 3OL7A 3DLKB 1TV6A 1T05A 1LW0A 3UQSA 2VG5A 3BSAA 4QWEA 4NLXA 3H5YA 1DTTB 1FK9A 1HARA 3DOLB 1EP4B 4O44A 4TQSA 4Q0BA 2EC0A 3M9MB 1RTIB 3FSIA 5F8IA 4K4SA 4QWAA 1IM4A 2AGQA 4K50A 1C2PA 1RA7A 5KFIA 1NNDA 5D3GA 3TAMA 2IM1A 4WYLA 4WZQA 1QE1B 4RNFA 1JXLA 1JLAA 5EWGA 3KK3A 1S1WA 4RW4A 2XC9A 5FDLA 2FLNA 5F8MA 4PWDB 2HAIA 2YKMB 5C42A 3NGDA 1RTDA 1J5OB 4JV2A 1HNIA 1TL1A 3MFHA 4G3IA 4R5PA 3FQLA 4RNMA 4I7FA 4WE1A 5CYQA 5KFCA 3PW4A 5C5JA 1S9GA 5KFNA 3LP2A 5KG5A 4I2PA 1N5YB 4M94A 4ZPAA 3M9NB 3SFUA 1JLGB 4ID5A 2BANA 4EBEA 4JUZA 1TV6B 3CJ5A 1T05B 1HMVA 2VG5B 4ED1A 4ZP6A 1FK9B 2YNGA 3DOKA 1C1CA 2OPRA 1OS5A 3HVTA 4O44B 5KFXA 5KFOA 5J2PA 2W9CA 2BRLA 2ASJA 3N6LA 4R0EA 2BQUA 5KFEA 5DG7A 3EPIA 2RKIA 4EO8A 4NLUA 5D3GB 5DGAA 3TAMB 3FQKA 4YR3A 1XR5A 2XGQA 4ED0A 2IAJA 1SH3A 1JLAB 3MTKA 4K4TA 1S1WB 4RW4B 4DL4A 5FDLB 4J9KA 4B3OA 4K4UA 5C42B 2J6TA 1RTDB 3KK2A 2FVSA 3BSNA 1HNIB 1LWFA 1RT2A 3H4BA 4ED2A 4Y34A 4R5PB 5DGBA 2OPPB 5CYQB 4WE1B 3HVWA 2O5DA 2UVWA 4ECYA 1TKZA 1S9GB 4TXSA 3LP2B 3GIJA 3N6MA 2R8HA 4I2PB 1JKHA 1ZETA 3LALA 5F8GA 4DG1A 1RTJA 4ID5B 1W25A 2BANB 2QE5A 2WCXA 1N48A 1HMVB 5KG3A 2YNGB 3DOKB 1C1CB 4RW6A 2YNHA 5KFLA 2W9CB 2YKNA 5I42A 4K4VA 3BQ1A 4RW7B 2XCPA 4XPEA 2AGOA 2R2RA 4ZPCA 1LW2A 1S1XA 3DLEB 4I2QA 4YR0A 1TQLA 3BQ2A 4B3OB 2D7SA 3HHKA 2RDIA 3KK2B 4Q8EA 4KKOA 1IKYA 1LWFB 1RT2B 3HVAA 5DLFA 3RAQA 3PVXA 4NRUA 5C25A 2HWHA 3I5BA 4NCGB 4ECUA 5EUHA 1NHVA 2BRKA 1TKZB 3FRZA 3DMJA 3SI8A 1JKHB 3CO9A 4DG1B 1RTJB 2CKWA 4WZMA 4KAIA 4ED8A 3ISND 3GV5B 1N56A 2BQRA 4DL3A 1N6QA 4RW6B 2ZD1A 1ZTTA 2YNHB 5L9XA 2YKNB 1S1VA 2XI3A 5I42B 2RDJA 3H5SA 3DM2A 3JYTA 3BJYA 4ECZA 3Q8QB 4KB7A 3I5AA 1VRUA 1S1XB 4I2QB 3JSMA 4QWCA 1T94A 3QZ8A 4O4RA 2HNDA 2IC3A 3M8QA 5HROA 3KJVA 4KKOB 2BE2A 1GX6A 2DPJA 5KFQA 3KHLA 5HLFA 3CIZA 3H5XA 2I1RA 5KG0A 2W9BB 5J1EA 2GIQA 1QAIA 2YNFA 1HNVA 3QO9A 4GC7A 3KOAA 3DMJB 5F9NA 3RB6A 4PQUA 5KFRA 1C1BA 2R2UA 3BQ0A 1TKTA 4HKQA 4WXWA 2IM2A 1N6QB 3CJ0A 2ZD1B 2JEGA 1S0NA 2B6AA 3CDUA 4URQU 1S6QB 1S1VB 4XPCA 3LANA 5KG2A 5KT3A 4RZRA 3DM2B 3JYTB 5DQGA 3ITHA 5I3UA 1FKOA 4H54A 3PZPA 2JLEA 1UWBA 1VRUB 4O3SA 3QGHA 3UR0A 2HNDB 3KLVA 3T1AA 2IC3B 2D41A 5HROB 2XCAA 3KJVB 2F8EX 4ZPDA 3D28A 4RNNA 4Q0BB 2BE2B 1YVFA 2FVCA 4O3PA 2JEJA 5HLFB 4QW9A 2FVPA 5J1EB 4KBIA 3QO9B 3TQ1A 4KO0A 3MECA 1IKWB 3V81A 2AU0A 1LWEA 4ZVGA 1REVA 1C1BB 2WONA 4ZMMA 4ECRA 2R2SA 2BQ3A 4G1QA 2W7PA 3PW0A 2B6AB 3MR2A 2OPSA 4YP3A 3BREA 4KE5A 2R2TA 1RDRA 4O3OA 4PUOA 3ITHB 5I3UB 1FKOB 3QZ7A 3DRSA 5HP1A 1UWBB 5J2NA 1DLOA 2W7OA 2VA2A 3IRXB 3PW7A 3RBDA 2UUWA 2ASDA 2RF2A 4O3RA 5F8NA 5DG9A 3CJ2A 2C22A 2XI2A 4K4XA 4MKAA 4U6PA 1S1UA 4KO0B 2E9TA 3V81B 3C6UA 1LWEB 4IRCA 2I5JA 4EBCA 1REVB 2WK4A 4NZ0A 2WONB 4Q8FA 3MR6A 4ECWA 3T5LA 1LW0B 3QGGA 1BQMA 5F8HA 4G1QB 4ZHRA 1D0EA 2AWZA 2OPSB 2IBKA 3T5JA 5KFFA 4IRKA 3I0RA 1QUVA 4MK7A 4PUOB 1RT5A 4Y2CA 4MIBA 5KT2A 4FBUA 3DRSB 1KLMA 5HP1B 5J2NB 1N4LA 4FS2A 1DLOB 3KK3B 1HYSA 4K4YA 1RT4A 4IOBA 3OL6A 1S49A 5KFUA 4J9OA 5KFGA 1U09A 2FVRA 4KSEB 2RF2B 2W9AA 1TL1B 3IS9A 4EEYA 1I6JA 2W9BA 3OHBA 2IMWP 1IKVA 3QIPA 2ZE2A 4I7FB 2C2EA 4NLGA 1T3NA 1S1UB 1KHVA 2V4RA 3T5KA 4GC6A 5KT5A 2HMIA 2V9WA 3C6UB 2ASLA 2I5JB 3OLBA 1HQUA 5KFPA 3IN5A 3MEDA 2CJQA 3BSCA 4LSNA 2R8KA 3KLGA 2OPQA 4KHMA 4LSLA 5DQHA 1BQNA 4YQWA 4ED6A 5F8JA 3DRPA 2C28A 3HVTB 5EWFA 2OPRB 4TY9A 5J2PB 5T14A 1HPZA 5F9LA 2IA6A 3GYNA 3IGVA 3M8PA 3LAMA 2RKIB 3LAKA 4TY8A 3OL8A 3QLHA 3RAXA 1DTQA 4QWBA 5KFBA 4RUAA 4FS1A 1KLMB 3MF5A 2IAJB 1RT7A 1HYSB 4F4WA 4TN2A 2WRMA 3PR5B 1RT4B 4H4OA 2JC0A 1S9FA 1TKXA 4NLSA 3DLGA 4H4MA 1SH2A 1ZTWA 1C0UA 1CSJA 4NLDA 5KFKA 2HNYA 4IKAA 3EZUA 4NYZA 1IKVB 2ZE2B 3QIPB 4RW9A 2WB4A 4WXOA 3IG1A 1S9EA 3G6XA 2HMIB 1TVRA 5CYMA 4IFYA 5KFTA 3KLIA 5DQIA 1HQUB 5L1LA 2JEIA 4LSNB 1TL3A 4IFVA 2OPQB 4LSLB 4WFZA 1BQNB 3G6YA 1JLBA 3FDSA 2ILZA 1KHWA 4IQXA 1JLQA 2VG6A 1HPZB 3QGIA 3OSPA 1RT6A 3SFGA 2C2DA 3OL9A 4NLYA 2B43A 4TY8B 1MU2A 3QLHB 4ECQA 4NLPA 3C6TA 4KFBA 4TYAA 1RT7B 1LW2B 3UPFA 1S48A 4H4OB 1TKXB 3BGRA 3DLGB 3I0SA 4H4MB 1IKYB 2HNZA 3RB3A 1K1QA 4TQRA 3PJWA 2HNYB 5C25B 4RW9B 4DEZA 3HKWA 3EPGA 3IG1B 1S9EB 4QWDA 3PR4A 1TVRB 3LP1A 5CYMB 3D5MA 4IH6A 5L1IA 4IFYB 2VA3A 5KFWA 1TL3B 5KFAA 4IFVB 1JLBB 3KLEA 1JLCA 2HWIA 2VG6B 3ICLA 4ZP8A 1RT6B 4ICLA 2ILYA
chains in the Genus database with same CATH superfamily
2MKJA 1NM2A 2CQBA 5ETVA 3AJDA 1PC5A 3W8GA 5ETNA 2XGPA 2YNFB 1K44A 3EDQB 2QSFA 3HFVA 2OLWA 1C0TA 4KHRA 4R8UB 4F4ZA 4NLOA 3DLBA 3CGIA 1VQNS 5J2QA 2JEFA 2V4QA 4C6AA 4FVCA 4RUHA 2HVIA 1ZPWX 2XSJA 2FYXA 3W2VB 2VC1A 4I4BA 3DOMA 3UNYA 2BJ9A 3VALA 4NXMF 3T19A 2V2VA 2B5JB 4OI3A 4ED5A 4Y2KA 5ETPA 4X2BA 4WFXA 1HWJA 2Y9HA 1UVIA 4LF9J 1ZYQA 1HWKA 2WTFA 5A8WA 3PDNA 2MGZA 1KWMA 4C8KA 4F2RA 1FJEB 3GV8B 1RT3B 1WC6A 1M5SA 2EBEA 3PJXA 3BM7A 4IG3B 4EBDA 4NYOA 2BMBA 4UY85 2HZCA 1FKAF 2CPYA 2CFXA 2G0JA 4J9PA 3ET6A 4CNZA 2LDIA 3KMSA 1JLQB 4OHXA 5CZVA 1RP5A 1S10A 1KSPA 3VCDA 4USVA 3TEHB 4EYIB 1HWUA 2CVIA 2CAJA 2H65B 2FGOA 4PG7A 3AHPA 4PXCA 3J81j 3LP0B 2P2CB 2XM3A 5DG8A 2JFDA 3OL7A 3H5YA 4WF9Q 4K4SA 4K50A 3AB4B 3EX7B 5KFIA 2LU1A 2MQMA 2O67A 3D7SB 5HVHA 2XC9A 1HLWA 3K2YA 2CPZA 5DETA 3GPAA 4DX5A 3CCSS 2KG0A 1U6FA 4DR4F 1W7WA 3M9NB 4N47A 3AX5A 1FK9B 4X66J 2W9CA 3M8RA 2X7IA 3VGTA 1VLYA 1HI1A 1R8PA 3QFHA 1MMDA 4RBVA 4WK1A 2XZTB 1TKZA 2AJ4A 2V8GA 2WCXA 4NOHA 2XS2A 1JJHA 2YKNA 2DR6A 3UN3A 1B4SA 2HIYA 3H20A 3PCOB 4ZPVR 2HHHF 2VD3A 3MUVP 2AZ1A 1KQSR 1JWWA 4WFBQ 2OTJS 3Q8QB 3CJKB 2HQGA 2M8HA 4DX6A 2XS5A 2ZEJA 3PIOQ 1D3WA 4PQUA 1HBOB 4LF1A 4I69A 2MLYA 2ZH8A 5F0UA 3GMGA 3LANA 3BGUA 4WCEQ 4JI2J 2KT3A 3UR0A 3KLVA 2JVRA 3M2VA 3MURP 2P6TA 1FE4A 4N77A 2XLKA 3A12A 3R3TA 1B7YB 2UXBF 4OZ1A 3QZ7A 3DRSA 3NCRA 5DG9A 1XMQJ 5I4MA 3C6UA 4BLGA 5GAEI 1DARA 1WSRA 4UY8T 2XB2D 4N8NA 4Y2CA 2W2OP 1KLMA 5KFGA 1U09A 4KSEB 4EEYA 5JVHQ 1FFWB 4EU0A 1S77D 2ZBRA 2V4RA 1F9EB 3LOUA 2DNKA 3C46A 1FERA 2R8KA 2DH8A 4EK2A 5DQHA 4LSLA 1BQNA 2KJVA 2OPRB 4TY9A 5I3QA 2FZCB 4YFUA 1NK5A 4QWBA 2EXUA 4NCBA 2ZOFA 2UV8A 7FD1A 3KDOA 2KHCA 3OL9A 2CJKA 2E1RA 2M8DB 4I67A 3ILLA 5K8MA 1FRLA 2ATCB 4DPOA 1J5EJ 5KFWA 3W63A 2AEJA 1RQ0A 2GQCA 4F0MA 1SBRA 1AUDA 4NXNJ 3GR1A 4XO0A 4OZNA 5KT4A 1BD6A 4NLVA 4ECTA 2EWHA 3QPIA 4JP8A 3QSYB 3BDEA 2MLZA 1QD1A 2QYGA 4L75A 1WF1A 5J2MA 2QLBB 5T7LB 2AEFA 3JSBA 4L74A 4A47A 2YKMA 2EFPA 2RE1A 4ER8A 3CDWA 1X4AA 1N54B 3Q23A 3V4IA 2B4OA 2B56A 4CLKA 1QLNA 2BACA 4K59A 1R27B 3D1OA 1NJXA 4UZCA 1RTHB 3MPUB 1AUSL 2VC0A 4OX8A 2B3TB 4WBFA 4JYAJ 4TLRA 3HT0A 4QCLA 2H48B 3FSXA 4CLSA 4DR5J 3AWRA 1NBEB 4LFAJ 2XMAA 4B3RJ 4MTPA 1RT5B 3V6HA 1TUVA 2OD4A 4DQPA 3B78A 4ZP9A 3DI6A 2UU9F 3T9ZA 3W8PA 4FBTA 1KN6A 3MEDB 1QVGR 2MZ1A 1QTNB 4ZVPB 2N3OA 4EGLA 1URRA 4C8NA 4CO1A 2NLWA 2Z4PA 2HFNA 4USHA 3RB4A 2QLJB 1T03B 2GAGC 3OLAA 3M7VA 4NEYA 4B3SJ 3M2RB 3HMJG 1RCOB 4ED3A 4ZVTB 1G3OA 4NA1A 5IS2A 1PBUA 1OYEA 2AP6A 2D74B 3PXGa 1YHQS 2HBZB 2CWKA 4JV0A 3G2XA 3BBBA 5K8OA 5B08A 3KJQB 2IJFA 4DV4J 3CCRS 3I32A 1KD1T 1SJFA 2E9ZA 3CCUS 5LMUJ 2X1AA 1BXNA 1QSSA 5D4OA 3MM8B 3U1MA 3J81Y 4O44A 3BN4A 3ILIA 4BWMA 3CCVS 5IQ6A 5D3GA 1NNDA 4WZQA 2CQGA 1ZM3A 3SCKE 2CPEA 3L95X 2JLGA 5C5JA 2ZNZA 1JLGB 1T05B 5IQQA 5IT9Y 3IXQA 1L5UA 3WQPA 2E29A 2CPIA 1SH3A 1JLAB 2MJNA 4J9KA 3AD9C 1M1KT 2NPIA 4KGXB 1JKHA 2PD1A 3M1VB 2CA9A 3DXBA 5GAHU 4K4VA 4RW7B 3I9V9 2V68A 3B4DA 1NU4A 5B0FA 1VJWA 3I56S 2W4DA 3GFXA 3SMZA 4IOAQ 4NCGB 2KRRA 3UE2A 4V19X 4I56A 4DG1B 1RTJB 2V2KA 1CQMA 2YH0A 1KFSA 3CEDA 1RAGB 2XEXA 3K0JA 1TUGB 2RDJA 4P6QA 1GMVA 3M2UB 4M1KA 3KXDA 4KKOB 3CIZA 4B9UA 3GZ7A 2GIQA 2V1TA 3MD1A 3LUYA 4OV1A 2KL8A 3IRWP 3OV7A 1LWXA 1U24A 2XG8A 3DM2B 2Z2YB 3KJVB 1CJUB 3MM6A 2GJFA 2LQ8A 3CJRA 1Q5VA 1TZ0A 4DZDA 1P1LA 1E6YB 1QVFR 4C0BA 2BQ3A 4ZIVA 3D6TB 5IM0B 2B6AB 5ADZA 3MR2A 3S8SA 2ZH9A 3NOGA 3PYFA 3IRXB 4CIOA 3RBDA 2EFGA 2ZH7A 2C22A 1UKUA 2AYMA 1X5OA 4IRCA 3T9NA 2FJBB 3QRRA 3RUBL 2KO1A 4QIGA 2KHDA 2OPSB 3TRGA 3I0RA 1Y11A 4PUOB 4MIBA 1UA1A 3RRKA 5HP1B 3FVYA 1EQ0A 3OFGA 2V4JA 2VJVA 1VQSA 1WEYA 1FWKA 2I5JB 1HQUA 2MXYA 2C28A 1AXQA 4C98A 2DYAA 3M8ZA 4DV6J 2FZGB 5HAOA 5CA5A 2OFGX 1G2EA 1GTHA 3PY8A 2R7SA 4USIA 4YB5A 4RW9A 2E44A 2ZE2B 2CUYA 2HMIB 1U48A 3FCVA 2OPQB 3P5TL 4IQXA 1KHWA 3OSPA 3EVOA 3RYLA 2EI5A 2LQJA 1RAAB 1SJ4P 2FY1A 1SJRA 3IG1B 4QWDA 2CQ4A 1LXNA 4IFVB 3EGZA 2C3PA 1SV5A 1P9YA 4KFBB 1X4BA 4DV2J 3M8QB 1FESA 2XNQA 4EWTA 1A7GE 5HSPA 4UTGA 2KZZA 1FKPA 2KVQE 2DNGA 3CC2S 3K57A 1HQEA 1IBKJ 1H7WA 5CAAA 1L3UA 1LK7A 3RR8A 4F4KA 2BW2A 3BKUA 1WJ9A 3W5ZA 4AL6A 3UCGA 2JOQA 2MPUA 3IR6B 4BBYA 2G2YA 3N6NA 3PM9A 2CXEA 2MDAA 2JDJA 2C2OB 5T41A 3BO3A 4X65J 3V6DB 2NS1B 3KNAA 3ZNJ1 3NGKA 3C14A 2XMUA 5GMEA 1CQNA 2PI4A 2GMHA 3KHHA 4YR2A 2APOA 4Q5VA 2WHOA 2MQNA 4WKRA 4ZP7A 3M6XA 5KFHA 3OSNA 2Z58B 5HBMA 2LVWA 3MOJB 3JTNA 1VQMS 1X4HA 1FDAA 2K8GA 4WFYA 1RZMA 1S6UA 3KTQA 4DQIA 4OL8A 3GQCA 1KDNA 4LRAA 1VRTB 1KEKA 3UNGC 2H4YB 2X3DA 1R0CB 1S1TA 2JVOA 2UXDF 2VG7B 1B7FA 5H9EJ 3MXHP 1FJCA 4NEZA 3RU0A 4DV3F 2Q6BA 1CC8A 1JNZB 1WDDA 1KBRA 1WOOA 4DN0A 4JI3J 3D2WA 2GA7A 2HBQB 2W2PP 3K5LA 2VBZA 3NCQA 4LF4J 3RGIA 1AT1B 4A8XA 1JB0C 2DGSA 1SL0A 3ZC4A 1F1BB 2IM1A 4LRFA 3O6QA 5EWGA 3I9ZA 4PWDB 4R5PA 4WE1A 2C1EB 3D0IE 4ED1A 3DOKA 2ASJA 3QAUA 1B0VA 3CE8A 1C4AA 4UOGA 2HQCA 3FQKA 2FVQA 2VKRA 4CT8A 1HNIB 1KNZA 9ATCB 4DV5F 2WSEC 2ERRA 4GVBB 2F9JA 5GMKa 1IR1A 5KG3A 3RTVA 3LGMA 3MM5A 1SQFA 2DNOA 4XPEA 2LXUA 2M4MA 2YBVA 4RX6A 1IKYA 2A6MA 2H5JB 4P10A 3TZXA 1HHSA 2L9WA 2HHQA 3CO9A 1EKRA 4OI2A 2YNHB 3R2CJ 1UVNA 3I5AA 1H74A 3QFWA 2JZ5A 1F9HA 1LXJA 2DPJA 4A8FA 4QIVA 4USKA 3QQCD 5J1EA 4GC7A 2XY7A 5F9NA 3R97A 4B9NA 4ZPWR 1K0VA 3AAWB 1N6QB 2LA4A 1S6QB 5E3AA 1CJKB 2HVZA 3OTCA 1WC0A 5I3UA 2M7SA 3OD2A 2RNEA 3HK2A 2BE2B 1F60B 5IC6B 3R6LB 2EFVA 3AFGA 1S72S 3M32A 1FKOB 2XBPA 1RCXB 2UUWA 2RF2A 4MKAA 1H2VZ 5D6GA 4X4PA 3V81B 4I0WA 2WONB 5CCMA 4C0HA 4G1QB 3L7OA 1O5JA 1TKDA 2J0SD 5RUBA 2F4VJ 5E5NA 3G87A 3Q0AA 4ITSA 1YRXA 1FWLA 2MKYA 3RBXA 3R5CA 4F02A 2EFQA 4TY8A 1V3SA 2VFRA 1JXVA 2ZWOA 4F4WA 2WRMA 4NLSA 1H6KX 2K1RB 2VH7A 3W64A 2G0IA 2OUGA 1FD2A 3E3XA 1Y10A 4DN9A 2HURA 3VAGA 2UUAJ 3D9BA 1VQ4S 1FRXA 2OD6A 4CWBA 1K9MT 4MMOA 4Q2LA 5C25B 4IUFA 2QLXA 4KT0C 2MKIA 2VPZB 1JLCA 5IFMA 2OEMA 1DFDA 2QN6B 2I6WA 3BB5A 2LMIA 1S6PA 1FVSA 4ZVUB 5JUMA 2GC8A 3L9ZA 3TZWA 3H40A 3MDFA 4UZBA 1RE1B 2N82B 3JSYA 4AXJA 1K73T 3Q22A 1S0VA 2LU2A 1UJ4A 3DLJA 4OJ3A 3OR1A 4LT6A 1ZS6A 3I5CA 3UVJA 3W9IA 1KOOA 2I8EA 1R8BA 3AD7C 2R9LA 1Z2LA 4P2XA 4F4XA 3NMAA 1GX5A 2VL1A 2ATLA 3D0GE 2L41A 3BR8A 1UJ6A 2OPPA 3POTA 4ECXA 4J9LA 3KWMA 2GJ2A 3TA0A 1MWQA 2DK2A 3AH6A 1Q8IA 1FD8A 1NSQA 4NLQA 3HHLB 1N5VA 4MIAA 2UVRA 2DGUA 1GMWD 4FN5A 5HI7A 2D9PA 3IA0A 3BH7B 5KG4A 5CYJA 5H9EK 3MR5A 1J27A 1B99A 3HJVA 1KFDA 4O4GB 1IQTA 3FFIA 3LQVA 1NDPA 1OIAA 2IIHA 4J9SA 4O3NA 1AROP 2Z2MA 2DGXA 1C0UB 3JS9A 1HR0J 2WVFA 2PT0A 3OXLA 2GCFA 1TR0A 3TJ8A 4NLTA 4OHVA 4M5LA 3TJ9A 3PEJA 4UOHA 4DL5A 3N01A 2E1PA 2HVEA 4OI4A 4OV6A 5A76A 5F3TA 3DNCA 3H4DA 2OO4A 2KXFA 1DTTA 2D3ZA 4NCAA 2CJAA 3RBZA 4KTQA 2QJ3A 1JLFB 4OJHA 1SQEA 4RPFA 4B3MJ 2RRAA 2CDRB 2FTRA 4PKDB 3RR7A 4QWEA 2VG5A 3DOLB 2E5GA 2LQBA 2Z56B 2CQ2A 3SXLA 5D8HB 2EBGA 1XMOF 3KK3A 3LWLA 1YITS 5C42A 1TL1A 2BJDA 5CYQA 4L3KA 3LPEA 3NGUA 3WIVA 3MM9A 3HXMA 1N5YB 3HZGA 3RJMB 1HMVA 1C1CA 3B8HA 3DOMB 1X4CA 2ZJQQ 4WWSA 4PXBA 4ECYA 1S9GB 3OTOJ 2KXNB 3SDEA 4LF8J 5E3RA 2LDYA 1N33F 5DO2A 2MKHA 1S1XA 2FHKA 4B3OB 5D0EA 1WF2A 3ZZPA 4JI4F 3RAQA 3JQJA 3FRZA 3ZZOA 5A8WB 2MGZB 4WZMA 1FT8A 2V8VA 2VKZG 3MPVA 5GADI 3JSMA 1XBWA 4Y2IA 1UFLA 2JEGA 4JB8B 1S0NA 3CDUA 4URQU 1U0HB 3NP5A 4NA3A 1WHXA 2GZOA 4H54A 4LBPA 1UWBA 1VRUB 5DZ6A 4CH0S 4YS2A 5HROB 2QTWA 2R7XA 4YHHF 2HAFA 1JQGA 4ZVGA 3PW0A 3DGPA 3UCZP 1RWVB 2Y0SD 5F8NA 2EKYA 3CJ2A 2VUGA 3OVBA 1MNEA 2DH7A 2WK4A 3TI0A 1HD0A 3L3CA 1A9NB 4AL5A 3U1NA 3KJFB 4ZHRA 4F3MA 3QNWB 2HRYA 3CDAA 3OL6A 2GO8A 3VVTA 3M30A 4DR3F 3AJ2A 1XMBA 1EIYB 4LSNA 4YQWA 3EM1A 1GK8A 3BBCA 2DNPA 1FDNA 3OL8A 3WBZA 2VFSA 2ZDPA 3MF5A 3IAS9 6FDRA 1ZTWA 4ZN1A 4ALZA 4NI2A 2ZUGA 1H98A 1U1PA 1RACB 4MKYA 3FDSA 3BPDA 2D9OA 2VBWA 3QLHB 2J0QD 3MAQA 3BGRA 1QY7A 2JLFA 2D3OR 2PFDA 1W2IA 1CULA 2VA3A 3MPDA 3SCJE 5E0OA 1TL3B 1JLBB 3AA8A 3G6VA 2DEIA 2HSEB 5KT6A 2Q66A 1X4EA 3UW1A 2COLA 3LA0A 4RKUC 1NLKL 5B0AA 4U9RA 3GILA 4PQUB 2HQ3A 3C3LA 1N0UA 2J7KA 2AT1B 3J80Y 1F0XA 1N52B 2IBOA 4LIRA 3THPA 4DLEA 2C2KB 2NZ4A 1KKHA 2DNQA 2XWYA 2RQMA 2Q1LA 4OYZA 2LXIA 1SUQA 3QT7A 5M2UA 4N56A 4QBUA 4Q2MA 1PSDA 4J9QA 1JLEB 3DYAB 2VONA 5ETMA 3MEGA 2M3DA 3H42A 2KT2A 2GHWA 2WBRA 4MK8A 2ZBIA 3FKBA 4TU9A 1U8WA 1RHRB 3NBPB 1R8CA 3RBEA 3VAJA 4KR0B 4UOCA 1JIHA 1KQFB 3T5HA 2KT5A 2J6UA 2Q6CA 3HSZA 3L7PA 2JWNA 1Q16B 2PA8D 3AX3A 2KFZA 1FJGJ 1MW7A 2ZNYA 1M0SA 3W1YC 1NH7A 4LBIA 1HW8A 1S59A 3IBFB 1OO0B 1TL7A 3CT9A 4EMDA 3FZBA 4HH0A 4NLWA 3KLHB 2J9EA 4MFBA 4ZVFA 2JX2A 4LF6F 1T9WA 4J7CA 2KI2A 5ITHA 2N3LA 4OYAA 1HBMB 2AJ0A 1CG2A 5EHHA 4QU6A 1U45A 2OGUA 1P1TA 4LR9A 1RTIB 2H54B 4OI6A 2YVSA 1IM4A 3TAMA 5BYQA 4JI1F 2YKMB 1RTDA 2MTLA 4G3IA 3BGLA 3PW4A 2BDPA 3QGPA 3ZTOA 1IBMJ 3V4IB 5AE2A 1O6XA 4R0EA 2QSWA 3W5YA 2NUHA 2XGQA 1LWFA 2HK2A 3HP6A 4TXSA 3N6MA 3R1LA 4WFNQ 4ID5B 1Q0NA 1YK9A 2YNGB 1SIZA 4HDHA 4B9LA 2FGCA 4W4MA 3NXZA 4ANDA 1RWOB 5H1SV 3BQ2A 4Q8EA 2Z8QA 4JI0F 4NRUA 1F9FA 3I5BA 3BKFA 3P4UB 2R7VA 2V2ZA 2RHQB 2ZD1A 3P5BP 2BKOA 2XI3A 3JYTA 3BJYA 3T41A 4FXWA 3TWZA 4FP9A 2IVFB 2XTCA 5KFQA 1SKSA 2I1RA 1IJFB 3BQ0A 1KP6A 1FNOA 3D1QA 3KUHA 5GAGI 3ITHA 3FBEA 2XCAA 1XTZA 2F8EX 2FVCA 1Y3KA 4CLYA 4EZ6A 2VQFJ 3QT5A 2DH9A 5GMDA 4DU8A 5J2NA 1DLOA 2W7OA 4DHVA 1HBNA 5CZXA 2CZ4A 2R4FA 4CTAA 1QM9A 1REVB 4OI0A 2ZZNA 4I64A 2A2DA 4ES3A 1BQMA 3MI7X 1H2UX 3PRDA 4IRKA 3BYRA 3DCAA 2CQDA 5D4LA 5DDQC 1HYSA 4L73A 2F8HA 2W4CA 4OLPA 2W9AA 1I6JA 1RI7A 3GB0A 2C2EA 2PMHA 1KHVA 2GAHC 3T5KA 1UVLA 2BX6A 1R6VA 4Y00A 1NXIA 2QFIA 1HPZA 3TYTA 4ID8A 2MKSA 4ZITA 2VHGA 2CADA 2MKCA 2DIVA 5KFKA 2W9BB 3EZUA 2NZCA 2NPFA 1U2RA 4AUKA 2U1AA 1YKWA 2W7AA 1RWWB 2DR8A 2GVDA 4K2JA 2XO6A 5LXYA 3HULA 4WP8A 2XTDA 1IUJA 2ZH6A 4H4MB 1TK5A 2DGVA 4UF4A 4DMZA 1HD1A 4DCOB 1VIXA 1TVRB 4IH6A 5L1IA 3P49B 2ZHOA 1FO1A 1PIEA 3VGSA 3KLEA 2OIHA 4CO2A 3HJFA 4C11B 1HIYA 3EGWB 5G0RA 3BR9A 2HNZB 3DRRA 4HI1A 2C2RA 3PHEA 1SC6A 4TNOA 4QOTA 1D09B 2O3DA 3GFZA 3ZZ0A 2F4FA 4ETXA 3QYYA 3HDSA 3OHAA 4X4TA 3KJNB 3MTJA 3HD1A 1EJ7L 2Y1IA 3J81U 3UDVA 4ZVEA 1EETA 1KQKA 2CZ9A 5L1KA 1FNXH 1NRKA 3ILOA 1RHJB 2QA2A 4HEA9 4LF2A 1M1GA 5C24B 3U27A 2O66A 4ILRA 2UUCJ 1FI4A 3ZZYA 4YMEA 1NKEA 3MWBA 5CQGA 5IT9U 3I0RB 2IRYA 3OJUA 4DFPA 3GJRB 4ILMA 2ZBQA 4ZCMA 3RB0A 2I2YA 2C3UA 4WFAQ 5K14B 1LWCA 4Y3CA 2JC1A 1L3VA 3J7Z5 2CNKB 1OPZA 2UVUA 3NG8A 1NK7A 3NS7B 3DHWC 4CI0B 3LTOA 4BC9A 4KV8A 4B9VA 3MUTP 4IR9A 1JJCB 3QATA 1DQAA 3H98A 1ZAXA 2X1GA 4URSA 1TP7A 1QAXA 4IG0B 1D8ZA 1F2HA 3EZOA 2XNRA 2RRNA 2DGOA 2GVZB 3D6MB 4FVMA 4PG4A 1VC6A 1QE1A 4Y2AA 4RW8B 1UZDA 3J7A1 4DF4A 4OMFG 4LF7J 3PFOA 1OY8A 4XDCA 3PJ9A 4ZVSB 4ZLPA 5HQ8A 3ZZRA 3SSRA 3ILJA 2ZBCA 4J37A 1J5OB 4RNMA 3K5MA 5A0YA 3FGVA 4I2PA 4XK8C 3TJAA 2PEBA 2AYEA 2MZTA 2DRDA 3EPIA 2Q3PA 4ED0A 4K4UA 2QFJA 5EX0A 1MG7A 4FKYA 3QAEA 2R8HA 5HMXA 4Y2MA 3VAFA 3F0NA 4CCHA 1LW2A 4I2QA 4M63A 3T1YF 4HHHA 1UUJA 1X0PA 2BRKA 4JI7F 4X4VA 3TUZC 2ZOMA 4F67A 3S7RA 2BQRA 3G82A 5HQMA 2CPHA 5K8NA 3R27A 4WKYA 4F26A 1GFWB 1ZH5A 1JK9B 2PGCA 1V3ZA 1F3VA 1M5HA 4LRBA 1N5QA 3NNHA 3O8WA 3V5RA 2IYIA 4P75A 1TKTA 3TAPA 3MR7A 1S1VB 3U02A 3HX9A 2NCKL 2GV1A 2VB6A 2GQ2A 3NWRA 2JEJA 2XS7A 3MMJA 3QSIA 2AU0A 2QGFB 5M2RA 2HHWA 4DUZJ 2MY8A 4KE5A 2R2TA 4HT7A 3CCMS 4ZVRB 4O3RA 4MIWA 5CHCB 1SL2A 3VF0B 4I6YA 3J7YI 2DB1A 5E41A 2RQCA 3J7ZT 1NAQA 2AWZA 3K7RA 4QYRA 2FLOA 3ZTQA 4FBUA 1I1GA 5KFUA 4CO5A 2CG4A 3F44A 3ZZUA 3IS9A 1XNRF 2AF6A 2HFUA 4F7VA 3KLGA 2DBBA 4PXEA 5A8RB 5HO4A 4IO9Q 3R7NB 4FS1A 4CM2A 4O0IA 5ETSA 4IQMA 1TKXA 4DXLA 1BE4A 4NLDA 3QIPB 3DLHA 1IKVB 1S9EA 3GCWP 5HMZA 4N8OA 4X4OA 3G6XA 1SQGA 5ETRA 3OFHA 4DCJB 2GNKA 5L1LA 4OZ5A 4PYDA 2BJ8A 1A0OB 3G6YA 1RLDA 1VQ7S 1GH8A 2ZM6F 2ZKTA 1KC8T 4NA2A 5DDRC 1IKYB 4LFBF 3HZEA 4KC5A 2R7UA 3EPGA 1RWKB 2YTCA 3LP1A 4DR1J 3DC2A 3AD8C 4TU7A 1RT6B 1RAFB 4R8UA 3NOCA 3KDNA 4E98A 3NAIA 2P8IA 4F3OA 2RD5C 5ETKA 2RSQA 1ZZFA 2G9OA 2X3GA 4MYUA 4AQYF 4M5JA 2RU9A 2A1BA 3UDEA 3ZFVA 4DR6J 5C7PA 3W2VA 2XTEA 1QJHA 1MMLA 4R25A 4K5RA 3FUYA 3ADAC 2ZBPA 1H38A 3PEHA 2B5JA 2BA9A 1UW9A 4LR8A 1GMWA 2VIHA 2J8SA 3G86A 4FYYB 2FZKB 3M32B 1OSCA 1SH0A 2ZJRQ 4JV5J 4DR2F 2DITA 3Q2TC 1RT3A 1AW0A 5LJ3Y 1QAJA 3RG6A 3SV4A 4IG3A 2CNLB 3EZ5A 2KFYA 4J9MA 4LF5J 1R89A 3HHLD 3BF4A 4FPIA 2L08A 4URGA 2LEPA 4RU9A 2X1BA 5KG6A 4U8VA 3ENVA 4I1TA 4X84A 4Y0FA 2VF3A 1PC4A 2BE9B 3JTPA 5KG7A 6FD1A 3PG9A 4X62J 3U7JA 4X4NA 2R8JA 3QJPA 4WYWA 2KJWA 5L8RC 3PHTA 1XR7A 2UUBF 4Q7AA 1KVIA 3Q89A 2P5VA 3GSIA 3CW2C 3LP0A 2AEMA 4D3HA 3GIIA 4ZPBA 3MZIA 4F4AA 3JSRA 4J9UE 1VFJA 3CXCR 2D3UA 4B9MA 4FF2A 4FYDA 5B0GA 4LRCA 3G6ES 2VQEF 3WDOA 2YNIB 2QV6A 2K06A 4DCPB 4OYPA 5BR8J 1FX2A 3ENWA 1FTCA 1YJWS 4DV7F 3JXOA 1RU1A 4HYKA 1FK9A 1HARA 3M9MB 1VQ6S 2MQ8A 2AGQA 1HHQA 1RA7A 2OMLA 4RNFA 4OZ3A 2FLNA 1N0VC 3NGDA 4JV2A 1PYOB 1V9OA 4ZDNA 2GJIA 1NPKA 4ZPAA 5AXMA 2VICA 1M90T 3C66A 4YR3A 2B4UA 4P2SA 2G0CA 3SSQA 2CQ1A 2OPPB 3POTB 1IM6A 3HO1A 4GO7X 2FHJA 2YX4A 4AYBD 3PYEA 3DKDA 1XWLA 2W2NP 1BLUA 1X4FA 1Q86T 1XN9A 3CPWR 4DPWA 3G8QA 3CJKA 3HHKA 4HT5A 1DQ9A 4JI6F 3N0VA 1NUEA 5EUHA 3EJMA 3BPSP 2A6OA 1FHTA 5L9XA 2UZAA 4DFJA 5AT1B 1WUUA 1RBLA 5FLXY 3NNCA 3QZ8A 3ENAA 4DV0F 3R7SB 3U1LA 4JI8F 4C3LA 5KG0A 1QAIA 1HNVA 1Y5LB 3JAMY 2KB2A 3R2DJ 2I0XA 1VQOS 1Q4RA 5IWAF 4YY3J 2ADCA 3H2VE 2HGLA 4U95A 3QWUA 2IC3B 5AJ3F 2CPJA 1AA1B 5HLFB 4B17A 3MM7A 3TQ1A 4ELUA 2HWTA 4ECRA 1NPPA 1NCLA 5MLCV 3OW2R 3W60A 2BJ1A 3O2IA 4DWIA 2W4PA 4KO0B 4EI2A 1U25A 2B9WA 2C2NA 2JFKA 2EFOA 3K5PA 4DV1J 4UOFA 3KK3B 1HNZF 1I94J 5E3PA 1HWIA 1TL1B 3WX4A 2JHEA 4NLGA 1S1UB 2DRBA 4DUYF 2U2FA 1G4CA 4Y28C 4J9VA 2YPZA 2DHSA 1Q5YA 5E33A 1RT4B 2KU7A 1WDTA 3CULA 3H8YA 5D77A 4KHPJ 3W7BA 4BWJA 3QGIA 3JQMA 2FDNA 4JOUA 1NO8A 2MSTA 3VVUA 3T6JA 2HQFA 1FWPA 1S7IA 1K8AT 4HACA 1SI9A 1VQKS 5KFAA 2BVZA 1XNQJ 3THVA 4ZP8A 5T7LA 3RW6A 4I6WA 3A8IA 4K0KJ 5LM7E 2NXUA 2QMXA 3N79A 2DGWA 5U47A 3JSMB 4YB6A 4V1Ak 2H9ZA 4E0DA 1NZ8A 4W92B 4U7CA 3D66A 3G9CA 1I51B 4CO3A 4DR7J 3PYGA 3KG0A 1RTHA 2D1CA 2W25A 4PABA 2W8LA 1UFKA 3D1HA 4RNHA 4C8YA 3E51A 1UFWA 4UT4A 3M8YA 4IRDA 3UN2A 4DOZA 1ZA1B 5DLGA 3DGPB 2MQPA 4OX9F 1NK9A 2GIRA 2QC3A 1KS2A 1WG1A 2K3KA 2H5EA 4IH5A 4ED4A 1U2FA 3QMQA 1WWHA 4HL9A 2XWXA 4M5GA 4M5HA 4ZVHA 1LQ9A 4ZHRB 3IBCB 5KFVA 2PO4A 4OZ2A 3DLEA 5LMNF 2FLPA 1REGX 2DKOB 1U49A 5G4DA 1VCTA 1VR6A 1T03A 3BEGB 3F73A 3Q8UA 1SC1B 1FXDA 5B0CA 1WEZA 2DR9A 3M2RA 1IWGA 1H3DA 2DPIA 1RAOA 1IJEB 3UDCA 2R8IA 2E5LJ 3N9UC 1K1SA 2ZUAA 3OPKA 2C2MB 2WOMB 2XO7A 4BC7A 2L9DA 3BGFA 3FZ2A 4QPXA 5AE3A 4DQQA 4DSEA 3MM8A 2E5JA 1PJ7A 2DNNA 1WSVA 1IBLJ 4CM0A 5DDPC 1VK3A 1RBAA 3DDKA 2ZKUA 1JLGA 2CYYA 2J5AA 2J8AA 1T05A 3DU6A 3UQSA 4IOCQ 1G6BA 1JLAA 3B54A 2HAIA 3BO4A 4LFCJ 4U8YA 2BKPA 3S1TA 3M1VA 1X31C 2MQLA 2WW4A 2L3MA 3H7HB 3IAM9 3TZYA 4WP9A 2UP1A 1P6TA 1YZ6A 4GKJJ 2W2QP 2IFXA 2Y1RI 2J6TA 3OFEA 4OZ0A 3IO1A 4O23A 3TQEA 3TW0A 3LP2B 4MYTA 2BUNA 1ZETA 4DG1A 1RTJA 4PPDA 3QRPA 4RUBA 2W24A 3IP0A 3BV8A 3LPYA 1CJVA 1OQ3A 3M2UA 4KKOA 2M52A 2E5IA 1SJ1A 3SI8A 2GGPB 1B3TA 3PX6A 5GAHI 1ZTTA 4WU2A 5I42B 4YUDA 3DM2A 1FCAA 6AT1B 1NKCA 1T94A 3HT3A 3HD2A 3KJVA 1CJUA 1GX6A 2V2QA 1W2BR 4NYPA 2GS8A 3QJLA 1UW4A 1NMEB 3DMJB 2K3IA 5BXIA 1E6YA 3I96A 2IM2A 4FNIA 5IM0A 2B6AA 4XDDA 5DQGA 4LBHA 3G8TA 3QGHA 4CYUB 2NXCA 1NK8A 1FRMA 2KG1A 2C3OA 1Q82T 4RNNA 4LF9F 3G96A 3R1HA 3NRBA 4KBIA 3QO9B 3MECA 1C1BB 3TAQA 1FDBA 5K8PA 2J9DE 2OPSA 3BREA 3F56A 4PUOA 5HP1A 4ZLNA 3J80U 4B3TJ 4A8OA 3EGNA 2JRSA 1RHQB 2XI2A 2QA1A 2YWFA 5L39A 4P74A 4CNYA 3LW5C 4MT1A 1LWEB 4X64J 2I5JA 3S01A 1SJQA 1HBUB 2G1DA 2ZH3A 2IBKA 1ZPVA 2ACMA 1WOSA 1T9UA 1PYTA 4K4YA 4A4JA 1S49A 1RJJA 2ZE2A 2HMIA 2ASLA 2B9XA 1WC1A 3BSCA 1WELA 2OPQA 3V4MA 3GR0A 5D4NA 4HVZA 5KFBA 4DSIA 4KIAA 2CPFA 2P9GA 4NYZA 2WB4A 3IG1A 1CC7A 5ETOA 1N34J 3MOZA 5DQIA 2E7VA 3DDNA 4IFVA 1SKRA 4DX8H 4AFFA 2B43A 2HEKA 4KFBA 1S48A 2VU5A 4H4OB 1VJQA 5E2QA 5CYMB 1SL1A 4IFYB 2IJRA 3L4BC 3VTIA 4CQ1A 1WG5A 1YQHA 4X66F 2BJEA 1MU2B 3VAMA 3C6TB 1U1KA 3I0SB 1RT1A 4EFAC 4WTYA 1XEZA 1I5OB 3DLKA 4GKKJ 3A3OB 3OVSA 1YJVA 1U2CA 3E01B 2LYVA 4RU2A 1IWAA 1D9AA 1IKXB 4MAKA 5THWA 2MZRA 1U47A 1YJUA 2NXNA 4J90A 1VBKA 1KLNA 1LFWA 3V6DA 3EMTA 3BSOA 3UD4P 4V19J 1S97A 3NAHA 2B7CB 2ZH2A 3OQ2A 2DO4A 4C3MA 2HVHA 1T95A 2DEJA 1KOHA 3H2UB 1JXEA 4X4RA 1BQMB 9RUBA 3GYGA 3KK1B 5L46A 2RUGA 5FD1A 4PRFA 4DFKA 2UUTA 5AXKA 4JI2F 4DL6A 1HWLA 1X4DA 4A8MP 3TZZA 1HNXJ 1N32J 1C4CA 1VRTA 1U1NA 2A10A 4DI6A 3SQGB 3MCOA 1XK8A 3IFEA 3R7BB 2OH2A 2VG7A 2HFOA 3GFHA 2DHGA 1XMQF 4OYXA 1RHUB 3OBIA 2PIIA 2DO0A 2AZ3A 2DCUB 4UUWA 2DD8S 3CNQP 2L48A 1T9TA 2DY1A 1RHKB 2HK3A 4HHUA 2CPXA 3TVKA 3RW7A 1U1OA 4RNOA 3AX2A 4LR7A 4IDKB 3GJQB 4L3NA 1R0AB 2N4DA 2LKZA 4J9RA 1DAXA 4PPZA 3CMQA 5G0RB 1N36J 2NQPA 4OYMA 3NEKA 1VDHA 1HW9A 3T1HJ 2WVDA 1EP4B 4HTIA 4RO0A 2UXCJ 3K89A 2EEYA 5DZ7A 3P3DA 1HNIA 2CJXB 3FQLA 4I7FA 1VISA 3M4XA 1TV6B 4GVBA 3CF5Q 1J5EF 4Q0BB 4G1IA 3N6LA 4YN3B 4NXNF 5FDLB 1B0PA 4HTJA 3GIJA 2PMZD 5F8GA 4C8OA 1NDKA 2LECA 2HW3A 2YNHA 4I68A 2LEAA 1YJRA 4YR0A 4QR0A 3NS6A 1RT2B 4Y65A 3C15B 2HRTA 3MAHA 1GXUA 4ED8A 1BY9A 1N6QA 1AZSA 4NMXA 3H5SA 1CJKA 4ECZA 4NXMJ 2HPUA 2BE2A 1DURA 2V94A 4QIEA 1TFWA 3HFZB 2Q43A 3D68A 1Z1ZA 1FE0A 4PWWA 4JYAF 4QR1A 1U02A 1UAWA 1Y7PA 4DR5F 4AD6A 1RADB 1OWXA 5KG2A 2PI5A 4LFAF 1FKOA 4YDDB 3T1AA 2X51A 2MMYA 4B3RF 1YVFA 1TAUA 5LSLA 1X9WA 1CVJA 1HKAA 3V81A 1NJIT 2WONA 2R2SA 3PRVA 4G1QA 4PG8A 4YP3A 4PZVA 3W2WB 3ZO7A 3PW7A 2G4BA 1U8SA 4K5SA 3TA2A 3TARA 4U6PA 4B08A 1S4EA 3MR6A 2QIFA 3LWMA 2V9KA 4B3SF 1OSDA 5D0RA 4DSLA 1TUWA 4ZVOB 4LVNP 5KT5A 4DBQA 2YH1A 4P52A 5F8JA 3EVWA 3M8PA 4DV4F 3RAXA 2A18A 5D4PA 2Z2ZA 1S9FA 5LMUF 4M5DB 2PEHA 3TUPA 2JEIA 2ILZA 5H9FJ 1V3RA 4ATNA 5BYRA 1V5VA 1RT7B 1LW2B 2WW8A 4C3KA 3DLGB 2A0FB 1X0FA 2HNYB 4DR4J 1FFSB 4Y6IA 3ICLA 2KRBA 2VG6B 4J5OA 1Q79A 3EUNA 3Q8YA 1YBUA 3CJTA 3G82B 1WTBA 2V69A 3PACA 4PAAA 2CZVC 1H72C 1FRHA 2E1AA 3TNVA 1QTMA 1TKTB 4OHWA 3G71S 3CVKA 5C2CA 4ICLB 1NHUA 2HFSA 3UD3P 1RUSA 1R7IA 3SSSA 2P9EA 4USMA 2AX0A 3OXFA 1WI8A 2HHHJ 4DJBA 1UVMA 1NB2A 2RQKA 1UETA 5IC4B 3KLFB 1R3NA 1X5SA 4QPTA 2DHHA 4KGVB 3HHLA 2XZWA 1CJTB 4ZCIA 3GIKA 4FF1A 1TMMA 4DU7A 1F5BA 1MROB 4QU7A 3GV7B 3CJ4A 4OHZA 4O4GA 3ISZA 1VS3A 3ULHA 4F2SA 1WHVA 4ZKAA 1LV5A 3C16B 1FRIA 2KYXA 3IS9B 4ZA1A 5HJXA 3MMAB 1DZ5A 3M9OB 2UXBJ 3MEEB 3KLGB 3IGNA 2ZH1A 4UW2A 2B7BB 4LQ3A 2EKNA 3ZTPA 1OYDA 2N7YA 3GFYA 3K59A 2XMKA 3Q24A 1DY3A 3WX8A 4M95A 5JXSA 3NCPA 2HS0A 3NY0A 4O3QA 1BHNA 4A48A 3Q8RB 1YJ7A 1JLFA 5KFJA 4ED7A 1F3FA 5A2QY 1YG0A 1S57A 3GIMA 3LP1B 4ECSA 2BE7D 3DOLA 4MJKA 3CCTA 1NSKL 1HI8A 2AGPA 5F41A 2E66A 4DV6F 4CP5A 1ZAVA 3JQKA 5HK4A 2R8GA 1CBKA 5M2PA 5IV4A 1N5YA 1SKUB 3FCHA 4ZS6A 4KH1B 4RWXA 3VWSA 1JNRB 2E7XA 4LJMA 4DPUA 1JXLA 5F8MA 1FXRA 3W9JA 4A8WA 5AE1A 3HM9A 5KFCA 1S9GA 2Z57B 2DCLA 2F40A 2GHVC 5HN0A 2JH3A 4EBEA 1HNWF 5KFXA 1FTRA 2DIUA 5CABA 1XR5A 1S1WB 4RW4B 4B3OA 3M8SA 1J2VA 3BSNA 2EK6A 1HHTP 3LO3A 3WC0A 1ICEB 4DV2F 2GX8A 3LALA 4WIQA 2BANB 1N48A 1UJ5A 3W9HA 1H2TZ 4LREA 3IWLA 1TQLA 2MLXA 3KK2B 5F0WA 5DLFA 2HHSA 4Z7CA 3HCXA 1IBKF 1R8AA 3HSJA 2CKWA 4F0HA 2YWWA 4RW6B 2HS4A 4OJ1A 1VBYA 1U0HA 2P6SA 3AT1B 4KQZA 1VRUA 3L09A 5HROA 1AYEA 4OI1A 3FEYB 4P71A 3DRYA 2NUUG 2AJ2A 4ENOA 3GG1A 3N28A 4WXWA 3CJ0A 4X65F 2BABA 3HHLC 2Y0BB 4XPCA 2DNRA 4RZRA 2FJEB 3MMBA 1GXTA 2HNDB 4QR2A 2HYIB 4ZPDA 3KUGA 3K5NA 3AODA 1FF2A 2UU9J 2FVPA 4I6AA 1IVZA 4C4WA 1CLFA 2W7PA 2LEBA 3TX8A 3KG1A 1YLXA 5CCLA 1WC4A 3T5LA 5J1NA 1Q81T 4N41A 4FZVA 5H9FK 2PFFB 1NB7A 2AW0A 2KFNA 4TVAB 2V34A 4YEAA 4LUBA 4J9OA 1M5VC 2IPOB 2XMTA 3IMQJ 3OHBA 2AKWB 2HZVA 4HLBA 4PXDA 3LAMA 3LAKA 1XIQA 3QLHA 1DTQA 4JI3F 1IQZA 2KDOA 1CSJA 2FB0A 4IKAA 2POKA 3CCWA 3Q8VA 2CQIA 5KFTA 4LF4F 1TL3A 1Y3JA 1JLBA 2DVIA 1OMSA 3B4MA 4NLPA 2HHTA 1SC4B 2F9DA 1VHFA 2LXFA 3PJWA 3R6GB 4ZOSA 1YJTA 3K17A 4CO0A 3PTWA 2VZ9A 2M70A 2E5HA 2DNYA 3O3LA 2ILYA 2MKKA 2K7KA 4ES2A 1NSAA 3PO5A 4F36A 1E6VA 1ITPA 1F5AA 1RABB 1T8EA 1ULRA 3HHEA 3WZ0A 5HL7Q 1IXKA 1HNVB 3W66A 3MFIA 4PYAA 3OUYB 1M1HA 1EX8A 2LP4A 2ZC3A 2R7RA 3VGUA 4F50A 1JLEA 3DYAA 4Q43A 3MM7B 5HVGA 3H90A 2YWKA 1SPBP 1T02A 2FC8A 2HLTA 5K20B 1C0TB 1L3SA 1Q7LB 2KXHA 3NBPA 4ZJQA 1F2GA 1AFIA 3QWPA 5J2QB 3MMCA 1GQEA 2J6SA 2V8DA 3X1LB 1R8HA 2XSJB 1RLCL 2RILA 1GEHA 1FRJA 2AQ4A 3OXGA 5LJ5Y 3UFCX 3ZTRA 1RYSA 2OEJA 3H0PA 1YRUA 2E9RX 1JJ4A 3KLHA 4TYBA 1JMTA 5IOLA 5J1PA 2XLIA 4DSKA 4A8YA 3GG0A 3KMQA 1LKZA 3KHGA 2FHJD 2MY7A 2R3VA 4OQJA 1YRTA 3I6PA 5FLXU 1HBMA 1YSJA 2CG8A 2C2ZB 2F4VF 3GWCA 4JI5F 3QBCA 2K2PA 1IKWA 4DPXA 4KY3A 2V8PA 4HACB 3JAMU 3UN5A 2HHVA 3H2LA 5KFDA 2XYHB 3ET6B 1RTIA 1S0OA 1D8YA 3EYZA 3EE3A 1Y9OA 1O51A 2HVDA 1PKUA 4ZCKA 1YDLA 1RAEB 4C0OC 3DDIA 4TQSA 4B9SA 2KYZA 3IR5B 1VQYA 2VJUA 2UUAF 4U7UD 4C8ZA 2J7WA 4OYIA 4ID5A 2RS2A 2YNGA 3PX4A 2BRLA 5DG7A 2RKIA 2M5YA 2ZDOA 1SXLA 3A13A 4Y34A 2MB0B 1LFPA 2GO9A 2O5DA 4ZN3A 1Q95G 4W98A 2IVYA 4K2XA 5DM7Q 3RRHA 2MJUA 4RLEA 2W9CB 1RHMB 3F41A 4YDXA 1OM2A 2AV5A 2R2RA 3DLEB 2CNNB 4F3QA 3R5DA 4FNHA 3HVAA 4J91A 1N5SA 1TKZB 5JVGQ 2BKNA 1NJZA 3ZZZA 5LT5A 2YKNB 3LGNA 3CCJS 2C42A 2PC6A 2RUSA 4O4RA 3FEXB 3DHXA 5ETLA 1WKJA 3KHLA 3H5XA 3DRXA 2DTJA 2DXDA 1QAYA 1P9QC 3FBBA 4CZCA 1BMQB 1IBCB 2R7TA 2JLEA 1MN7A 4NL5A 1EKSA 2XY6A 3IC1A 1KR4A 2PE8A 5DRKA 2AJFE 1Q78A 4F25A 1REVA 4CLZA 2MZSA 1U6BA 1TK0A 1RAHB 4CH7A 3CSKA 5GAEU 1F6TA 2IDEA 4O3OA 2B4PA 4FF4A 2YKAA 1MSWD 3M2VB 3THTA 1HI0P 2Y8WA 2AYGA 1HR0F 1YWXA 3R5GA 2ZOGA 3PIPQ 4Q8FA 2G13A 5EX3A 2IMOA 5KFFA 4CLWA 1VQ5S 2DJWA 4L76A 5D78A 2ADBA 3D6FB 3DRSB 2FPHX 3BBFA 2CQ0A 4DS5A 2UXDJ 2RHSB 2W9BA 4WTOB 3AXMA 2RDDA 4DV3J 2LQ9A 4GC6A 5IV3A 3C6UB 4NASA 5KFPA 2CJQA 1GMUA 2QL7B 2XYGB 3W65A 3DRPA 5EWFA 5T14A 4DL0C 3EVMA 4NMLA 1NKBA 1T9YA 1KLMB 1UPPA 2QMUB 5LL6d 4H4MA 2RVJA 4ZVQB 5HMYA 4WXOA 1U1RA 3PKMA 4RL1A 1BGXT 4M5IA 4B3MF 1TVRA 2J76E 3KLIA 4LSLB 5IXUA 1BQNB 1WKKA 5E3CA 4NX9A 4U96A 2VASA 1CJVB 4C11A 4ELVA 2VPXB 4TYAA 1WORA 3HSGA 2HNZA 2ZZTA 1K1QA 2KZMA 4FF3A 4UQGA 2KM8C 3PR4A 4KYZA 2Y1LB 3D5MA 1WC3A 3BS9A 4DZ6A 1ZOTA 2FD2A 1GAOA 2ALZA 4DV5J 4P7VA 1KTQA 1N88A 3OTOF 4LF8F 1PAEX 1RSCA 4MKVA 5KFMA 3B82A 5FJ4A 3GLJA 2XQCA 2ABYA 3OVAA 3GJSB 3MECB 5C24A 5J2MB 2R42A 2VBXA 2IVMA 1OY9A 2BJ7A 3DFEA 2QL5B 4ANEA 4EZ9A 4C48A 3TX0A 2UVVA 3FRYA 4J9NA 5K14A 1RYRA 3NS5A 4Q45A 1Z2ZA 4OX7A 4OYOA 3A8EA 2V0NA 2J9DA 5E3QA 3CD5A 3FC9A 3AJ1A 2JJ4D 5HVFA 3CWJA 3ZZTA 1FJ7A 3BZQA 4IG0A 4A8SA 1JX4A 3DI6B 1QDUB 1HNWJ 2Y3YA 3IBWA 3CCQS 1BUXA 2A3JA 2GVZA 2QL9B 4XAKA 1X5PA 3RAMA 4RW8A 1UEUA 1S12A 3PV8A 2FJXA 2W01A 2WB1D 2ZJPQ 2R7WA 3CTRA 2VFUA 1KQGB 1URNA 4DQSA 2YKPA 2W8KA 2PMWA 1J5OA 3HHNB 3ISNC 2F65A 2G2ZA 1RT1B 3DXSX 4MKBA 2J9CA 1X60A 3MPYA 2IM0A 3DLKB 1KRPA 4KJIA 1LW0A 3R5BA 3HF5A 1LNQA 5F8IA 1U4BA 2OI2A 1WEXA 1X5TA 1WKLA 2OJ3A 2HHPA 5KG5A 4M94A 1UEKA 3CJ5A 3CJ8A 4O44B 4QYZJ 1TK8A 4EO8A 4LVOP 5D3GB 4K4TA 1RWUA 2BYCA 1RKIA 3H4BA 5DGBA 3N4WA 2YWHA 3UO0A 1OPIA 3RRGA 1UVKA 4ZLJA 3FJ2A 3GONA 2DT9A 1BWVA 3GP9A 4ZPCA 3ZNUA 3TR5A 4DDFA 4CDIA 1LOUA 1UA0A 3ETOA 1FEEA 2OKQA 3FMWA 1JKHB 4P7TA 4KAIA 3GV5B 2BZ2A 3LH2S 1S1VA 4LSZB 4OIXA 5SZTA 2RT3A 3OT9A 1VGYA 3PO4A 1YZ7A 1NSPA 3EXYA 1ACMB 3KG4A 2OSQA 2YPYA 2VFTA 1W26A 4Z2XA 3VZIA 5KT3A 1PGZA 8RUCA 3FK4A 2W2MP 4OX6A 3D28A 4O3PA 3SV3A 1G7CB 2NSCA 4CLPA 3C19A 2B0GA 1R31A 2DISA 3SCLE 2F5GA 2V5HG 2VA2A 2P9CA 2WSCC 2WZ1A 1FJGF 2VPWB 3MM6B 3TA1A 5BYSA 1RISA 2E9TA 4EBCA 2ZITA 1PCAA 4ECWA 4M5MA 3OR2A 3CC4S 2LQ5A 5A8RA 3M05A 3CJQA 5AXLA 2XHWA 5KT2A 1SC3B 5KOWA 3HSDA 2KH9A 1IKVA 3QIPA 4I7FB 4N5SA 3CCES 2V9WA 4ANCA 4USTA 1KTVA 1VQLS 1YI2S 4NZ7A 3MCSA 1CS4A 3IGVA 1FFGB 1H0HB 5AXNA 4RUAA 3KKFA 4GMKA 2EPIA 3TUIC 2JSXA 4A8KA 2VDHA 2V4JB 1RK8A 1ZBTA 3GCXP 1HQUB 1XMOJ 1RT6A 2FJAB 5IT4A 4G6VB 1AB8A 3AQPA 2AIRB 2M2BA 2Z30B 1P8GA 2ZH5A 4TQRA 4RW9B 3I4PA 4ZJLA 5A6PA 3C8YA 1EHWA 1IBMF 3MAAA 1EQMA 4OYWA 3QRQA 1AZSB 5K5MA 3FMBA 1NEEA 4NRTA 2HZAA 1ZZNA 3C2PA 5HJYA 2LFVA 1ZM9A 2YY3A 1VBZA 1X7VA 1N33J 2K7JA 4EYHB 2QA4S 4WU3A 3M6WA 2YX7A 2LCWA 2QX0A 5FIIA 2D68A 3S6EA 4JI4J 1SV5B 1LK5A 4ZPTR 4KPYA 1VHIA 1OJ4A 1O8BA 2NXEA 4FYWB 3EXCX 1LEOA 4W90B 3I31A 4Z7YA 3V2UC 1FKPB 1D1UA 1U1LA 1DBDA 1HQEB 4JI5J 1HL6A 2VV5A 3DLLQ 1RWPB 5JJBA 4CRJA 5EN1A 4FYXB 5KTQA 4D3GA 2J0WA 3FBFA 5K9FA 2DNLA 1Q53A 1WI6A 3PFEA 4YHHJ 3NGRA 4FXVA 2ZFHA 1MWZA 3C14B 5ETQA 3AY0A 4IO1A 2KVIA 3M8PB 2VQFF 3BH6B 3KFWX 3PW2A 4PCQA 1PG5B 1YBTA 2MHNA 2HGMA 2CJ9A 2IJNA 2EG2A 5D15A 3NL0A 1BC6A 2FJWA 3D3BJ 2ASYA 3KNGA 4MK9A 3ZXWA 5HBMB 2YNIA 2HBRB 4DR3J 2XMVA 4OYBA 3LF0A 1Q8LA 5KG1A 4LRDA 4QYZK 1GXLA 2LLZA 1S1TB 3BGOP 3DN9A 1S4FA 2AYBA 1WHWA 5HQLA 4FYVB 2MEWA 3AOCA 3BSAA 2V1SA 1EARA 5HATA 2EC0A 4ILLA 2J0XA 1YJNS 1C2PA 1NK0A 4F0KA 3MCMA 1YX2A 1OQ6A 3EWGA 3MFHA 2ZWPA 3SEOA 1WOPA 4HHJA 1ZA2B 3E2EA 4DPTA 3SFUA 2G1HA 4JUZA 4ZP6A 3HVTA 5J2PA 1TTHB 2YQ1A 3D4JA 5KFEA 4AT1B 4P72A 3MEKA 2IAJA 3MTKA 3P96A 2OEKA 4R5PB 4WE1B 2UVWA 4KPCA 2QE5A 1WACA 3DOKB 4ZK7M 2J7UA 1H73A 1T9VA 1R0BG 2Z2LA 3G8SA 5A8KA 2GMJA 4NE9C 1NHVA 1UEVA 1U0SA 2AMCB 1X9SA 1ZM4A 1N56A 2EFNA 3HVRA 3MM5B 2F63A 2B8PA 2IC3A 1VIOA 3KUEA 1BWEA 4LIWA 3O44A 5HLFA 2ROGA 2YNFA 3KOAA 3RB6A 2FJDB 4HKQA 1NPRA 1RBOB 3IWNC 4KGKA 4HDGA 1S99A 2UUCF 2V67A 2ZZMA 1S79A 2HFZA 4USJC 1VQ9S 2RRBA 5J1EB 4KO0A 2PSZA 4CLLA 4ETZA 3IWXA 4ZMMA 3BDPA 1UCNA 1N5TA 3R8YA 3CCZA 4EUVA 5I3UB 4RBUA 3TVYA 5CD4H 3NNAA 2ASDA 3PYDA 2YQ0A 2RAQA 1S1UA 2CQ3A 2XLJA 4BCAA 2NREA 3HI9A 5F8HA 2OTLS 1PBAA 4ZLLA 3OFFA 4KH0B 1N4LA 1RT4A 1CPZA 2RF2B 4LF6J 3IN5A 1U7LA 2BEFA 4KHMA 5C2GA 1U1MA 2IA6A 3D67A 3GYNA 4C9DA 2Y8YA 2JC0A 3OTEA 3P8BB 4LF7F 4K8RA 3R5JB 1RGVA 3VV2B 1U6ZA 2F7VA 2ROEA 1JLQA 2EVZA 1VYAA 3SFGA 1FDDA 4JI1J 4TY8B 1TL5A 3HLUA 2HHXA 4PR6A 4F8RA 1UL3A 2CIMA 1GNKA 1MMNA 4DEZA 3HKWA 2WAQD 5JMNA 4ERDA 3VHQA 2XTJP 3K5OA 1VC5A 1NDCA 4AXIA 1FXLA 3UCUP 5A2QU 4U7UK 5EWEA 1WNEA 1K0TA 2IM3A 3PKYA 2IY5B 2H3EB 3Q8PB 1T7PA 2FLLA 2YKOA 1JLCB 4DQRA 1FRKA 2C3YA 2WVBA 3MMBB 4JI0J 4FKXA 1S6PB 3Q8SB 3TP2A 4QW8A 4QQBA 2XMWA 3UDLA 5DJBA 4K7QA 2HKEA 4N7TA 1VQ8S 3OR1B 3E8OA 3UVJB 3D54A 2BJ3A 2BXJA 4F04B 4NLRA 3UD5A 3O1LA 3JB9k 1UP1A 3ONQA 1RAJA 3L7UA 1FA0A 1RU2A 4DX7A 1KVJA 3M6VA 3T3FA 3IM9A 1B70B 4RUCA 2MZQA 2NYIA 2VODA 2JL9A 3GIRA 4K4WA 5MAOA 5KT7A 4TKTA 1N8RT 3CDEA 1UTAA 2WOMA 4M8LA 1L3KA 4RWWA 1M5PC 4DUZF 4DL7A 1DTQB 3MHYA 1RWMB 2NYHA 2FQQB 1HBOA 2V50A 3EICA 3SZ2A 4X4UA 1DQ8A 2RB7A 3SCIE 3FFIB 2IA0A 4CO4A 5SUHA 4WP3A 2CVEA 4DLGA 5D0GA 3MR3A 1JJ2R 5IT0A 4OJGA 3W3SA 4FDFA 2VBYA 5L1JA 4U67Q 1QSYA 1FX4A 5EDWA 3A3NB 4DSJA 2DHAA 4ECVA 1YTYA 3H59A 1WG4A 1Y4ZB 1E6VB 2B4VA 2N7CA 2AJ1A 4C7QA 3VAKA 2RIJA 1DTTB 2E1CA 2CWXA 3FSIA 4QWAA 5LXRA 4WYLA 2ZHAA 1MLAA 3LP2A 1O0PA 5I3PA 2GFFA 3OJSA 2VG5B 5LOQA 4DR1F 2OPRA 1V6HA 2BQUA 4NLUA 2M88A 4ZJOA 1NJYA 2CQPA 2IDLA 5C42B 2KKHA 3AOAA 1PAUB 5CYQB 2XZ2A 1X8DA 3VAIA 3DGVA 2QYCA 3MPWA 3MMCB 3MM9B 2GGPA 4DSFA 3WIUA 1HMVB 1YBAA 1C1CB 1WF0A 5KFLA 5I42A 5GADU 4DR6F 4DF8A 3I55S 3CD7A 8AT1B 3PVXA 2HWHA 1T9XA 3D0HE 4ECUA 2IRUA 3DMJA 2HIQA 1RB0A 3SDEB 4DL3A 2B8QA 4XIUA 1S1XB 4CYUA 1B64A 4M5NA 4JV5F 3A8KA 3QO9A 3ELHA 1C1BA 2R2UA 2ZHBA 4FXDA 3BKTA 2EC2A 3LGHA 1TFYA 1WHYA 3GYXB 1Y5NB 1Y00A 4O3SA 4A46A 1NZAA 3KYLA 4LF5F 2CQHA 1AFJA 1IKWB 1LWEA 1NK6A 2H4WB 1HBUA 4DUTA 4LMZA 1V5IB 1U26A 3HHDA 3BN7A 1UWBB 5A6WA 2RH3A 3UR3C 1D9FA 4X62F 2KM8B 1YIJS 2OAUA 5L9NA 4NZ0A 2F3JA 2N4CA 1YJ9S 4TU8A 2V8HA 2NR0A 3T5JA 4AL7A 2FHOB 4MK7A 2FUG9 1RT5A 3A4TA 2CDQA 2R7OA 3B6BA 2IMWP 4RJVA 2MHEA 2MQQA 3VAHA 2I9SA 1FNMA 1ROFA 3MEDA 3CDBA 2BOPA 4OHYA 4S0MA 4AE5A 2WVEA 1RWNB 2RKIB 1K47A 4BDPA 4H4KA 3MUMP 4TN2A 3PR5B 4H4OA 3R5AA 3M30B 4UQTA 5BR8F 1H7XA 2YKQA 2ACYA 2RJZA 1SKWA 2QG9B 5CYMA 1Q8BA 3US5A 5IZHA 4IFYA 4LSNB 2DGTA 3PNIA 4XTTA 2XHCA 4NLYA 4QIFA 1MU2A 3Q83A 2GIFA 3C6TA 2OSRA 3UPFA 3I0SA 2IYGA 4C8LA 5B7WA 4QJVA 4NI2B 1T11A 3CUNA 1Y0HA 2PDAA 4PG6A 2DXEA 4CLFA 5BJRA 1P27B 2HWIA 4R0JA 4ZCLA 3E01A 1VBXA 3VQSA 5CXTA 2QMWA 2O01C 2RQ4A 4E2FB 5HMWA 1WC5A 3BGRB 1IKXA 4L72B 1CULB 3SIPB 4FPRA 3D6HB 1XQIA 4RR5A 3ETMA 4IR1A 2ROPA 5GVQA 3SQOP 2IHR1 4GO5X 3T1YJ 2WVCA 3HPOA 2QEXS 3K58A 4KGZB 4JI7J 2BM0A 3CD0A 2E1MC 4X4SA 1XR6A 2QT7A 3VZHA 3KK1A 3H5UA 5ETTA 4IYQA 4YB1P 2R7QA 2DGQA 1Y5IB 2M9KA 3CD6S 3GJTB 1RTZA 3UI3A 2QO3A 4RW7A 2B9EA 1SUQB 4YY3F 3H25A 3SQGA 1YGYA 3VQTA 3ZTSA 2IRXA 4OFZA 4NCGA 1XERA 1UWAA 4GRSA 3MEGB 1ZM2A 1HA1A 3V6JA 3DRPB 3NGTA 4USUA 2YX1A 4CH1A 5E7OB 1S5ZA 3HFKA 4B9TA 4OLOA 2FJVA 2V63A 3A3PB 2BM1A 4LQ9A 3GSDA 2FY8A 3I82A 7FDRA 3KLIB 1T0TV 4HR2A 4IDKA 1S6OA 2AX1A 2QA4G 1R0AA 5F3ZA 1Q1KA 4DV1F 5LSRA 1XNRJ 2MYFA 1I94F 2AD9A 3FBCA 1RKJA 1S76D 1VQPS 2QZ8A 3AOBA 3M8WA 1EP4A 1TL7B 2HS3A 3RZAA 3CC7S 5KFSA 2MQOA 4F4YA 2CJBA 4DL2A 3IRXA 4MFBB 2HLUA 3NMRA 2H5IB 1VI7A 1PJ6A 3QIDA 5KFZA 4CT9A 4QIWD 4BHQA 3MD3A 4OZJA 3TEGA 1TV6A 5B0BA 4NLXA 4Q0BA 4KHPF 2ZM6J 4H4KC 5FDLA 4LFBJ 4DPYA 3WHIA 4X4QA 2GHPA 5KFNA 2VFVA 2DR5A 5KFOA 1VRQC 2D69A 2CNOB 2M0GB 1XNQF 3TAMB 4DL4A 8ATCB 1RTDB 2FVSA 4K0KF 3VR1A 1RT2A 1X9MA 3GTYX 3TO8A 3N5FA 2H51B 3TUJC 3C15A 4AQYJ 2QRRA 1TAQA 1W25A 2YQ3A 1MN9A 3TOQA 2GQQA 1NHKL 1UZHA 4DR7F 2DNZA 3BQ1A 2XCPA 2RS8A 2AGOA 1GTEA 2ALYB 2D7SA 2RDIA 1VMBA 1LWFB 2HQIA 1I3OB 4WPAA 4B02A 4BS2A 1WD6A 3ISND 3W61A 4GVLA 1MWYA 5GAGU 4QWCA 3SBMA 2XULA 3M8QA 3BYPA 4DR2J 3OTBA 2X1FA 4E8UA 2YWEA 2RMLA 2VPYB 5KFRA 2ZD1B 1NJWA 2C3MA 3JYTB 3W2WA 3PZPA 2D41A 3SYZA 1RXOB 3NGSA 4QW9A 4G1PA 3UWTA 3Q86A 1M5OC 3N5BA 3X3UA 1RDRA 1UPMB 3ITHB 3AXKA 3JTOA 2OMOA 2XMJA 2HFVA 4WK3A 4C8MA 4K4XA 3PX0A 2W1BA 5L38A 3CMAS 2E5LF 1LW0B 2F8MA 3QGGA 2UV8G 1D0EA 2UUBJ 1XC9A 1QUVA 4OZLA 5J2NB 1DLOB 1U1QA 1HBNB 4M5DA 5DS7A 1OY6A 4CTAB 5D0HA 3OLBA 2BOAA 4ED6A 4PQAA 3PRBA 5F9LA 2VQEJ 4YOEA 1WTFA 1IBLF 4DFMA 2DHXA 1RT7A 1PYSB 1HYSB 3DLGA 1EB0A 2HGNA 2PN6A 2F1FA 3AQOA 2HNYA 1PO6A 4DV7J 3QT6A 2EG1A 4YB7A 1RWXB 4WFZA 1BQXA 2VG6A 2C2DA 1HPZB 1XJWB 2OHDA 4RBTA 2XMMA 2BV3A 2KN4A 4LFCF 1UMJA 1SB6A 1APSA 2GVDB 4ICLA 2XZDB 4GKJF 4ES1A 4PG5A 2OELA 1FEHA 2QLFB 4HI2A 1GT8A 2QLWA 3KHRA 3KLFA 3KLEB 3D3CJ 1CJTA 3CIMA 4PWDA 2LA6A 3IR7B 4JI6J 2GW8A 1MROA 3DRRB 4DS4A 1UVJA 2DNMA 2HRUA 1RA6A 4CLUA 1Z4UA 1TELA 4DV0J 5B0EA 2HHUA 4JI8J 4JV1A 3C16A 3QJJA 2XY5A 3OTDA 2Q79A 3MMAA 4MH8A 5IWAJ 3MEEA 3OR2B 1EETB 2FHMA 2B51A 5AJ3J 5KAKA 2MZJA 4NWBA 4IH7A 1M5KC 4UUXA 4Q44A 3MCNA 2BW7A 3ENQA 5CD4A 3CJ3A 3AA9A 3I4HX 5LSOA 1G1XA 3A8JA 1CS4B 2ZH4A 2BR0A 4B3TF 2ZC4A 3PW5A 5DDOC 3NKYA 1R6YA 2BBEA 1S7HA 4P9SA 4X64F 1S6QA 1DRZA 3CO0P 1LWCB 1T3OA 1HNZJ 4K4ZA 3O5TB 1ZAWA 2VOPA 2HBYB 1KONA 2KTQA 3V6KA 4EO6A 4KV8B 1SCJB 2OFHX 4DUYJ 1IR2A 1FVQA 1A6LA 3MAAB 4HH1A 2CRLA 5B0DA 2E7WA 4M5KA 3VGVA 5KFYA 3QT8A 3TVZA 3CMES 4CLTA 1VC0A 3GU0A 4A8QA 4Z37A 5F8LA 2XSFA 1DJ0A 1N34F 4JBCA 3P45B 1IN0A 4P73A 1VOMA 3FSYA 2FIUA 1QE1B 1QUPA 2PA3A 2AJQA 1S1WA 4RW4A 2DY9A 1Q7YT 2B9YA 3TANA 4PWUA 2AHOB 2BANA 3CCLS 3CJSA 1OS5A 2DR7A 3Q2SC 3IM8A 5DGAA 4O0NA 3KK2A 4ED2A 2G2OA 2CPDA 2K1RA 3HVWA 4P2FA 5A0YB 3P6YC 3WC2A 5EGYA 4I2PB 2EW9A 4WIIA 4RW6A 4GKKF 2EK1A 2OP5A 1VK8A 1SJ3P 4KGMA 2MSSA 1VLOA 1F5CA 5C25A 4P2MA 3DU5A 2D3O1 1IR0A 1NH8A 4WJBA 1R43A 3W5XA 2Y1JA 1HFEL 4OX9J 2A2CA 3K8WA 1TU0B 4KB7A 4I2QB 2HNDA 7AT1B 3G4SS 3W62A 1SIWB 2HQDA 5LMNJ 2CJYB 4C2MA 3NLCA 4ELTA 4NPOA 3T6BA 2L9NA 1HQ2A 4L6V3 3J7YU 2O1PA 2YWGA 2CQCA 1HNXF 1PJ5A 1KVKA 1N32F 1DHMA 1NDLA 2NXJA 5KOXA 4ZIWA 1NK4A 3FNNA 3FEZA 3I87A 2DRAA 2VOOA 1ELOA 5DM6Q 2RU3A 2DNHA 3MGJA 1SVDA 3M6UA 1B0TA 3FCWA 4FS2A 4IOBA 2FVRA 1T3NA 1EZZB 2HG4A 3HKZD 5B09A 3HVTB 2I38A 5J2PB 2GMLA 3NWGA 3EDRB 2VDIA 4G65A 2IAJB 3A1YG 2DXFA 4TLQA 2ZVSA 2H1YA 3AB2B 3CB4A 3J7AN 1SH2A 1C0UA 1S0MA 1QSLA 2JNJA 2WSFC 1N36F 1Q8KA 1L3TA 1PILA 1TMJA 2WBMA 4N76A 2XYPB 4NZ6A 1RAIB 3T1HF 5HANA 3K8VA 4ECQA 2UXCF 2SXLA 2YXLA 4C97A 1TKXB 4PEOA 3RB3A 3EGVA 4QZVB 4USWA 2V6AA 1X4GA 2ZVIA 1EAYC 5A8KB 1S9EB 3R9LA 2NSBA 2Z0GA 1CEZA 1TL4A 2FC9A 3OUYA 1D9DA 3GE9A 4KRWA 3BO2A 5CH7B
chains in the Genus database with same CATH topology
3G6VA 2BJEA 5K5MA 2MKJA 1MU2B 3VAMA 2CQBA 3FMBA 5KT6A 3C6TB 1NEEA 2Q66A 4NRTA 1U1KA 1X4EA 1PC5A 3I0SB 3UW1A 1RT1A 2COLA 4EFAC 1ZZNA 3C2PA 4WTYA 1XEZA 1ZM9A 4RKUC 2XGPA 2YY3A 5B0AA 1X7VA 2YNFB 1VBZA 3DLKA 4U9RA 3OVSA 3GILA 2K7JA 2HQ3A 1YJVA 4EYHB 4PQUB 2QSFA 2QA4S 4WU3A 3M6WA 2YX7A 2LCWA 3C3LA 2OLWA 1C0TA 1N0UA 2J7KA 4KHRA 4R8UB 5FIIA 4F4ZA 3E01B 2D68A 4NLOA 3S6EA 2LYVA 3J80Y 3DLBA 1SV5B 1LK5A 4RU2A 3CGIA 1F0XA 1N52B 2IBOA 4ZPTR 4KPYA 1VQNS 1D9AA 1IKXB 4LIRA 4MAKA 5THWA 5J2QA 3THPA 1O8BA 2MZRA 4DLEA 1U47A 2JEFA 1YJUA 2NZ4A 2V4QA 3EXCX 4FVCA 2DNQA 4RUHA 1KLNA 2XWYA 1LFWA 2RQMA 3V6DA 2HVIA 1ZPWX 2XSJA 4W90B 2Q1LA 3I31A 3V2UC 3BSOA 1FKPB 2LXIA 1SUQA 1D1UA 3W2VB 2VC1A 1U1LA 3UD4P 4I4BA 1DBDA 3DOMA 4V19J 1S97A 5M2UA 3NAHA 4N56A 3VALA 1HQEB 2B7CB 4NXMF 1HL6A 3T19A 2VV5A 4Q2MA 4QBUA 1PSDA 3OQ2A 2ZH2A 4J9QA 3DLLQ 1JLEB 2DO4A 3DYAB 4C3MA 2B5JB 2VONA 2HVHA 4OI3A 3MEGA 5JJBA 2M3DA 4ED5A 1T95A 1KOHA 2KT2A 4Y2KA 2GHWA 5EN1A 2WBRA 3H2UB 1JXEA 4MK8A 4X2BA 2ZBIA 4X4RA 1BQMB 5KTQA 4D3GA 4TU9A 3KK1B 4WFXA 1HWJA 2J0WA 5K9FA 2DNLA 3NBPB 1R8CA 2RUGA 5FD1A 3RBEA 4PRFA 1Q53A 4DFKA 1UVIA 2UUTA 5AXKA 1ZYQA 3VAJA 1WI6A 4JI2F 1HWKA 4KR0B 3PFEA 4UOCA 2WTFA 4DL6A 1HWLA 3PDNA 5A8WA 1X4DA 2MGZA 4A8MP 1JIHA 4FXVA 2ZFHA 1KQFB 4C8KA 4F2RA 3T5HA 1FJEB 2KT5A 3GV8B 1RT3B 2J6UA 1M5SA 2EBEA 2Q6CA 3L7PA 3PJXA 2JWNA 4F3OA 1MWZA 1Q16B 3BM7A 1C4CA 1VRTA 1U1NA 3AY0A 2A10A 2PA8D 2KVIA 3M8PB 4IO1A 2VQFF 3SQGB 3KFWX 4IG3B 2KFZA 4EBDA 3PW2A 1XK8A 4NYOA 4PCQA 4UY85 1MW7A 2HZCA 2MHNA 2ZNYA 3IFEA 2CPYA 1FKAF 2OH2A 2VG7A 1M0SA 2HFOA 3GFHA 1NH7A 2CFXA 2HGMA 2CJ9A 1HW8A 2DHGA 1XMQF 2IJNA 2EG2A 4J9PA 3NL0A 3OBIA 1BC6A 1OO0B 4CNZA 3CT9A 2FJWA 2PIIA 2LDIA 3KMSA 3FZBA 1JLQB 2ASYA 2DO0A 3KNGA 4MK9A 4OHXA 4HH0A 4NLWA 2DCUB 4UUWA 5CZVA 5HBMB 3KLHB 2DD8S 2J9EA 2L48A 2YNIA 4MFBA 1RP5A 4ZVFA 2XMVA 1S10A 1KSPA 3VCDA 2CPXA 2JX2A 4LF6F 3TVKA 3RW7A 1U1OA 4RNOA 3LF0A 4EYIB 1HWUA 1Q8LA