4NLYA

Poliovirus polymerase - c290e loop mutant
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
458
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGESGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
total genus 140
structure length 458
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nlyA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nlyA02
4YQWA 4WXWA 1S6QA 2BE2B 3M9MB 2BQUA 4R8UA 4NLYA 2HWIA 3EPIA 3RB3A 1S1XA 1JXLA 4ZPBA 4RW4B 3KLVA 2IAJA 4Q8EA 4Y2CA 4PWDB 1RDRA 5CYQB 4Y3CA 4ZHRA 4DL5A 1D1UA 4NLDA 3CDWA 4XPEA 4RW8B 3DLGA 5DLGA 1T05B 1S0MA 4KBIA 1XR6A 4MIBA 3LAKA 4JV1A 3H4BA 4MK9A 5HBMA 4U6PA 4IKAA 1HMVA 3PR5B 3FSIA 4IRDA 4ECWA 4GC7A 1C0UA 4IG0A 4TQRA 4J9QA 4H4MA 1YVFA 3RBDA 1W25A 2VG6A 1RT3B 5KG1A 3KK2A 1S1VA 1HNVA 2IM2A 1ZETA 1RTIB 4K4VA 3NAHA 3IGNA 3IS9B 4RW9A 1JLFA 5L1KA 4K4UA 5KFDA 4EBDA 1UWBA 5JUMA 4EYHB 4ECYA 3TAMA 1K1SA 4ECRA 2IA6A 1LW2B 4NLSA 5L1LA 4JV2A 1KLMB 5KFZA 2IM1A 1N5YA 2CJQA 2BANA 1C2PA 4QWAA 2QE5A 1QUVA 4TLRA 1RTHB 4ED2A 4DL4A 4NLVA 4J9OA 4B3OB 3CJ5A 5J2PB 4RNMA 2J6TA 5KFMA 3Q8PB 4Q0BB 5KFNA 4ECZA 2AQ4A 3KLGA 2JLEA 3ISNC 3G6XA 4FBUA 4IR1A 3CVKA 4QWBA 3N6MA 1RTJA 2ZE2B 4O3OA 3EPGA 5DG7A 4PQUB 5KG7A 3T5HA 5J2MB 5DG8A 1N4LA 4KFBB 1NHVA 1VRUA 1S1WA 4ZP6A 4Q44A 4O44A 2HNYA 2QV6A 3UDLA 2AU0A 5DG9A 3I0RA 4NLPA 3NGDA 5T14A 2HMIB 3GIJA 1RT4A 2JEGA 3KHRA 3JSMB 3DYAB 1SH2A 4MFBA 2CKWA 4MH8A 4IG3A 5KT3A 5K14A 2OH2A 4K4SA 2AGOA 1JLQB 1HQEB 3T1AA 1LWCB 4K4ZA 4DL6A 1EP4B 4MK8A 2R8HA 4MK7A 3BQ0A 3MFHA 3LP0B 4KO0A 1BQNB 1LWFB 4ZPDA 1WNEA 3GILA 2FLLA 1JLAA 1TKTA 1HYSA 4LQ3A 4ECXA 3CO9A 4LSNA 4DG1B 1JIHA 5KFAA 2OPPB 3LALA 5J2NB 3QIPA 1D0EA 4YMEA 2FVQA 3T5JA 1S0NA 4GC6A 3I0SB 4LSLB 4QWDA 3G6YA 5I3UB 3DM2A 1C0TA 3QIDA 5C42A 5F8NA 4F50A 1TKZB 2YNHA 3NAIA 4IDKB 3KLHA 1REVA 4IFVA 4RW6A 4IFYB 4EYIB 4WZMA 5KG5A 3LANA 4JUZA 5KFKA 4O3NA 3CJ2A 1T94A 2J6SA 3JYTA 4IRKA 2BE2A 4O4GB 2XGQA 5KFPA 2O5DA 3H5YA 3E01B 1S9EA 4IH7A 1S1UB 3BSNA 1T3NA 4RW4A 5KT6A 1S0OA 4PWDA 2WRMA 3CJ4A 5F8MA 4J9NA 2FVSA 1N56A 4M94A 5D3GB 3BREA 2OPSB 2YNIA 4O3RA 3FRZA 1R0AB 3DRRB 3QZ7A 1S1TB 3EZUA 1T05A 2FJXA 3H4DA 4ZP9A 3HHKA 1DTQA 4ZVGA 2YKNB 4O3QA 2AWZA 2IM3A 4RZRA 2UUTA 1FKPB 4DL7A 1GX5A 1TL1A 1TVRB 4DL3A 3ICLA 1HPZA 4YR0A 4NLGA 5KFJA 3LP1B 2RF2A 1RTIA 1SV5B 1TP7A 4F4WA 4ED3A 3V6DB 1XR5A 2D3UA 2AX1A 1RTDB 1S9FA 3GV5B 3KLIA 1FK9B 2XI2A 2HWHA 5KT4A 1JLCB 1KLMA 2I5JB 3KLEB 2RDJA 3QO9A 4J9PA 3V81A 2GC8A 1RTHA 4B3OA 3KK3A 3BSOA 2VG5B 4G1QB 4I2QB 4ICLB 5HP1B 1IKWB 5J2PA 5F9LA 2XGPA 2ZD1B 1N6QA 4URQU 4PQUA 1NNDA 2ZE2A 2B43A 5KFRA 2VG7B 2WB4A 4WYWA 2FLNA 3OHBA 5F8GA 1KHVA 4J9SA 4I2PB 3MEEA 3N6LA 2GIQA 5KFGA 4Q8FA 3KHGA 4TN2A 4IR9A 1HQUB 3DYAA 2R8JA 2B5JA 2YNFA 4ZMMA 4J9RA 4Y34A 1RT7A 2HNDA 5KG3A 1RT6B 3M8QB 3HVTB 4O4RA 2XWYA 4NRTA 3NBPA 5KG2A 4F4XA 4J9MA 4RW7B 3DLKB 4QW9A 5F8JA 4ZP7A 2W8KA 2FJWA 1MU2B 2FVPA 1JX4A 2C2EA 4DG1A 1RT2A 4TYAA 3OL7A 2OPPA 1IKXB 2FVRA 5J2NA 4M95A 3MFIA 2WK4A 4K4WA 3QLHB 2R2TA 5CYMB 4ED8A 2W9BB 4LSLA 3BSAA 3RB0A 3BJYA 2RKIA 1QE1B 1FKOA 2HNZB 3D5MA 4RUAA 3PW0A 1JLBA 2WOMA 3LP2B 1S6PA 2R2UA 1IKYB 4KKOB 4IFYA 4TY8B 4QPXA 3DMJB 1LW0B 1HNIB 3FFIB 4YP3A 2JEJA 5I42B 4RNNA 4EBEA 3DRSB 4NCGB 4RUCA 2WCXA 5L1IA 2UUWA 2YKMB 4WFXA 1SUQB 3KLFB 1JLGB 3E01A 3GYNA 3GIMA 2D3ZA 5DQHA 4I7FB 4NYZA 3UPFA 4EBCA 4MKAA 2B6AB 3BQ1A 4NZ0A 5J2QB 4R5PB 2E9TA 1SH0A 3RAQA 4MIAA 3DRRA 4ED6A 4ZVFA 4EEYA 2HMIA 5HROA 3GIIA 3BR9A 5KT2A 4NLXA 3I5BA 5KT5A 3Q8SB 3G6VA 4WZQA 2FJVA 2IJNA 2YKNA 3IG1A 1RT5B 4ID5B 1IKVB 4KB7A 3SFGA 1K1QA 1LWEB 3DLEB 2W9CB 1ZTWA 1QAJA 2VA3A 1TVRA 3MF5A 3MECA 3PW4A 3DOKB 3LP1A 5KFIA 1SV5A 5C24B 1S9GB 2DPJA 4KV8A 4NLWA 1JKHA 3V6DA 3GV8B 2C22A 1IM4A 1RTDA 1EETB 3IRXB 3E51A 1FK9A 4QW8A 3D28A 4Q45A 2I5JA 3C6UB 3G86A 5KFXA 5DGBA 3KLEA 4ECSA 3MEDB 1S6QB 1JLEB 1TV6B 2VG5A 1VRTA 3BSCA 4G1QA 4ICLA 4R8UB 1IKWA 1S1XB 3KNAA 5L1JA 3PW5A 2W7OA 3PJXA 2ZD1A 5JXSA 5J1EB 4YR3A 4ZVEA 3KJVB 3MTKA 4PUOA 2R8IA 2UVUA 4Q43A 2UVRA 3DRPB 2VG7A 3C6TA 3ITHB 5KFOA 4XO0A 2R8KA 3IGVA 3KMQA 4ED1A 4I2PA 3GV7B 4NLUA 5KFYA 4H4MB 4WE1B 3H5SA 3H5UA 1HNVB 3M8PB 4IRCA 3PJWA 5CYQA 1JLFB 3M8QA 1DTTB 3HVTA 3I5CA 4RNOA 1UWBB 3ISND 3LAMA 2YNGB 4RW8A 3TAMB 4QWCA 4IH6A 2HAIA 1N5YB 4HKQA 2BANB 4K4XA 1MU2A 2ILYA 4HYKA 4O3SA 1IKXA 1RT3A 3MR6A 2V4QA 3QZ8A 3QLHA 4WFYA 4H4OB 5CYMA 4QWEA 2XCPA 3PHEA 2W9BA 2W9AA 2JEFA 3IS9A 3FQKA 4FBTA 5FDLB 1QE1A 1RTJB 3DOLB 2BR0A 3QYYA 1LW2A 2JC1A 3OSNA 1TL3B 5EWFA 3OL6A 4K4YA 1VRUB 2V0NA 5DLFA 2OPRB 4KKOA 5DGAA 2V9WA 3FFIA 2HNYB 1LW0A 5HLFB 5KG4A 2WHOA 3T19A 3DRSA 4NCGA 3PW7A 3KLFA 1SUQA 3KK1B 1S10A 4Q0BA 3FDSA 1JLGA 5K14B 5KFCA 4K50A 3NL0A 4RNFA 5EUHA 2J6UA 2B6AA 2R2RA 5J2MA 4KFBA 4R5PA 1J5OB 3OHAA 2RDIA 1JLAB 5F8HA 1S4FA 2AX0A 4Y2AA 5KT7A 5KFQA 3CDEA 4ZVHA 4WFZA 4EO6A 2W7PA 5L9XA 3V4IB 4KE5A 3JSMA 4RNHA 1I6JA 2ASJA 4ID5A 1IKVA 2ZKUA 3DLEA 1LWEA 4F4YA 1JLQA 1HQEA 1LWCA 3DM2B 4U7CA 1EP4A 2JC0A 3CDUA 3Q8RB 4DL2A 1MMLA 3H5XA 1RT1B 3LP0A 2BQ3A 1BQNA 1LWFA 1S9GA 5C24A 1REVB 4IFVB 5C25B 1C1CB 1EETA 2WONB 5KFVA 3C6UA 1BQMB 3JYTB 3MEDA 1JLEA 3I0SA 1XR7A 2FLPA 5KFLA 3KHHA 1S9EB 1TV6A 5I3UA 2OPQB 4IOBA 3CIZA 3T5KA 4LQ9A 1TKXB 3PVXA 1TKZA 5J1EA 5EWEA 2ASLA 4IDKA 4IH5A 3CJ3A 3KJVA 2ASDA 3H59A 2VA2A 1RYSA 2YNIB 3H98A 3KHLA 3DRPA 3QGHA 4TQSA 3BGRB 3ITHA 4ED0A 1T03B 3OLBA 4XPCA 1CSJA 1DTQB 2IBKA 3RBEA 2D7SA 4O4GA 4O3PA 3GQCA 2IMWP 3MR5A 2C2RA 5KFHA 4ECVA 1S1UA 4WE1A 3V6JA 1TL1B 3N6NA 2DPIA 1HPZB 3M8PA 3RB6A 3QGGA 1C1BB 2RF2B 3OSPA 5D3GA 1DTTA 2OPSA 1R0AA 2ILZA 2E9ZA 2YNGA 3PZPA 1S1TA 3TVKA 4J9LA 2IC3B 2IJFA 3KLIB 1SH3A 5F8LA 1DLOB 3V6HA 3QO9B 5F9NA 4URGA 3V81B 2XCAA 3DI6B 3I5AA 3KK3B 1FKPA 1Z4UA 3BQ2A 3H40A 4KHMA 4H4OA 4MKBA 1N6QB 3MEGB 5FDLA 2R2SA 3DOLA 3HVWA 4RU9A 2R8GA 1S97A 1TL3A 1JLCA 2OPRA 3UR0A 2XC9A 3IN5A 3OLAA 2C2DA 4ECUA 3DDKA 5HLFA 4ZPAA 5C5JA 3MEEB 4R0EA 2JEIA 4X2BA 5HP1A 4I2QA 3T5LA 2B5JB 2FVCA 2YNFB 3MR3A 4NRUA 3KK1A 1N48A 2IAJB 1RT7B 4YR2A 2HNDB 5KFBA 4H54A 4ZHRB 3HVAA 4FS1A 3M9NB 3DLGB 4JV0A 4ZPCA 3NBPB 1J5OA 2UVWA 3V6KA 4KHRA 3MR2A 5HBMB 5KFWA 1HMVB 3CJ0A 3RB4A 1C0UB 4WYLA 2D41A 4IG0B 1RT2B 4FS2A 3V4IA 2VG6B 1HQUA 2AGPA 3KK2B 1S1VB 4J9KA 4ED7A 4URSA 5DQGA 4F4ZA 4RW9B 1RT6A 2F8EX 2GIRA 3KMSA 2RKIB 4TXSA 1U09A 4ZP8A 3OL9A 1FKOB 3SI8A 2C28A 4DEZA 3OL8A 3NKYA 1RT1A 2BRLA 1ZTTA 2IM0A 1JLBB 2WOMB 3DLKA 4RW7A 1S6PB 5C25A 1C1CA 4TY9A 1RA6A 3Q8QB 2WONA 2V4RA 1S48A 4ECQA 2ALZA 1BQMA 1KHWA 4NLTA 3PW2A 3UQSA 3KLGB 4K4TA 2OPQA 5KFFA 2HNZA 1TKXA 5EWGA 3H2LA 4OL8A 1S1WB 3FQLA 4NLRA 3LP2A 1IKYA 4TY8A 4WXOA 3DMJA 4O44B 5KFUA 1HNIA 1RA7A 3CWJA 3I0RB 5I42A 5HROB 4TYBA 4EO8A 2BQRA 1QAIA 4NLOA 3BGRA 3GIKA 1RT4B 2YKMA 1RAJA 3HKWA 1T03A 2I1RA 2W8LA 4MFBB 3IG1B 4KSEB 4IG3B 5F8IA 5KG0A 5EDWA 4IQXA 1OS5A 2BRKA 2E9RX 3QGIA 4I7FA 3MECB 4KAIA 3SFUA 5KFSA 1RYRA 1C1BA 5J2QA 4KO0B 4KV8B 1JKHB 1TKTB 3M9OB 5KFTA 4G3IA 1HYSB 1TQLA 4LSNB 2IC3A 1DLOA 3QIPB 3TQ1A 1S49A 2AGQA 1RT5A 3KOAA 2W9CA 2XI3A 3VQSA 3DI6A 4ECTA 1C0TB 1VRTB 1GX6A 5C42B 3DOKA 3PR4A 3NMAA 2YNHB 2ATLA 1NHUA 5DQIA 3MEGA 3KLHB 2EC0A 4RW6B 4NLQA 1HARA 3RAXA 5KG6A 2UVVA 4PUOB 5KFEA 3IRXA 3C6TB 2WTFA
chains in the Genus database with same CATH superfamily
2ZDPA 2W2MP 1FEEA 1S1XA 4OLPA 2NYIA 5E3CA 1MWQA 3JSYA 1UFLA 5HBMA 4U6PA 3PR5B 3GU0A 4TQRA 1TFYA 3KJFB 1CS4B 3RRHA 2IM1A 4HTIA 4B3OB 4TLRA 1F2HA 1UEVA 4J9OA 5D4PA 3OR1B 4ECZA 3G6XA 1RTJA 2CDQA 3ENAA 4NA2A 5LMNJ 2V4JB 3D0GE 4OIXA 3GR1A 4MFBA 4KPCA 5KT3A 5HVFA 3LP0B 2PFFB 1HNZF 4QYZJ 3QNWB 2CWKA 1X5PA 3PTWA 5J1NA 5KOXA 4JUZA 2J6SA 3JYTA 2MZQA 4NWBA 2ZWOA 3PX0A 2DIUA 5C2GA 1VQSA 2XLJA 4RW4A 2W01A 2H5IB 3M05A 2DNNA 5D3GB 4ZN3A 1S1TB 3W9JA 3W2WB 4P10A 1H73A 4DQIA 1RP5A 2W4DA 3MI7X 3IM8A 4C98A 1X0FA 4AQYF 4PCQA 2ZE2A 3VCDA 3OHBA 4C8KA 2LEPA 2Y9HA 1B0TA 3HT0A 4CLSA 2R8JA 3DGPA 1FWPA 2C42A 2BJ1A 2XWXA 4ZVSB 1MWZA 2BJDA 4OYZA 3BDPA 2XLKA 2RKIA 2Q3PA 4MAKA 5K5MA 2Y0BB 1RZMA 4WIQA 2W4CA 2IRUA 3BM7A 2WZ1A 2KXFA 3GYGA 2PMWA 2D3ZA 5DQHA 3UPFA 4ILMA 2BW2A 2ASYA 4ITSA 3C46A 4P74A 1RKIA 2YKNA 4ID5B 1SQEA 3ZZ0A 1TVRA 5M2PA 2CG8A 1ZA2B 2DGOA 4B3SF 3V6DA 2CQ0A 3NGKA 3NWRA 3AX2A 1JLEB 4XAKA 5GAGI 1E6YB 5LM7E 4JI6F 2B9YA 4PUOA 3HMJG 2R8IA 3VVTA 3OQ2A 2OD6A 4XO0A 2NR0A 2B4UA 4OYPA 2BE7D 4WE1B 3EVMA 1U8SA 2IDEA 3VHQA 1EARA 1X4CA 1CQMA 1AT1B 2G1DA 2ZUAA 1IKXA 4NI2A 4KHPJ 2HHHJ 5IC4B 5AE1A 3VZHA 4CT8A 1KWMA 1GAOA 2E1PA 2DHSA 2UP1A 1F1BB 3MEKA 3EJMA 4JI4J 3QATA 1HFEL 3ZFVA 1FJCA 2RIJA 2WONB 2ACMA 2NPFA 2VFTA 2CPFA 2DGWA 1EZZB 3C2PA 4UOGA 3CIZA 4RL1A 2R7WA 3PO5A 1KKHA 4IH5A 4CO0A 2VA2A 2YNIB 4ID8A 1UJ4A 2H65B 5EHHA 2IBKA 2HFVA 2DTJA 4KRWA 5IXUA 5BJRA 5JVHQ 4A8KA 3M8PA 3QGGA 2RF2B 1ZZFA 1DTTA 3JQJA 3POTA 3M4XA 2DITA 2KO1A 3Q89A 4CIOA 3ZZTA 3V81B 4GKKJ 3PX6A 4QYRA 4QZVB 2RHQB 5LXYA 1FRXA 4RU9A 3NLCA 3LQVA 3DDKA 4DR5J 3K5NA 4OLOA 4NXNF 1P1TA 1Q5YA 3C14B 1QY7A 1SKUB 4M5GA 4WYLA 3KDOA 9RUBA 3OR2A 3EGVA 2PEBA 1DY3A 1RT1A 2BRLA 3J80Y 3J7A1 1FDDA 4A8YA 3TWZA 3LGHA 2JLGA 3KLGB 3E8OA 4NZ7A 4X4RA 1VFJA 3H2LA 4RR5A 4LF6F 2QEXS 3ZNJ1 3LP2A 4NLRA 1IKYA 4KGVB 4O44B 4FYYB 3I0RB 2HMIB 5HROB 4TYBA 3L4BC 5FLXU 2E9RX 3IC1A 2EFVA 5EX0A 1TKTB 4RBUA 3MM7A 1APSA 4F02A 3Q2TC 1NEEA 1RT5A 2W9CA 1HA1A 4DR2F 3TQEA 4DV1F 2ZOFA 4F2SA 2WTFA 2BE2B 2KYZA 4C0HA 3V5RA 2IAJA 2PC6A 3D0HE 1RDRA 2QG9B 3VGVA 3TA1A 1TTHB 2YWGA 4J9QA 3DKDA 4AQYJ 2DHGA 3D2WA 1ZETA 2FLOA 1FVSA 1JLFA 4Y2KA 2E5HA 5JUMA 5D4LA 3WBZA 3D0IE 3CC7S 1RTHB 2MKJA 2FJBB 3CJ5A 2VQFF 1RISA 2EFGA 2MHEA 5J2MB 2VIHA 1QTNB 3UDLA 2HNYA 1WC3A 3FVYA 4I1TA 3DXBA 2OH2A 1LWCB 1EP4B 3MAAB 2ZOGA 1JLAA 2LMIA 3RTVA 4LSNA 1JIHA 4I67A 2K7JA 4MJKA 1JK9B 3T5JA 3A1YG 5SUHA 5DZ7A 2HLUA 3DM2A 2XY6A 4L73A 1VQ8S 1TKZB 5L46A 3R2DJ 2HGMA 4EYIB 3LANA 4O3NA 1UJ6A 5KFPA 1QAYA 3H5YA 4DR6J 4IH7A 4UQTA 3BSNA 4QIGA 5F8MA 3QMQA 4CDIA 3HI9A 2VBXA 2J7KA 4F0MA 5ADZA 3QSIA 3ZC4A 1K44A 4DFKA 4JI6J 2HBZB 4GKJJ 4WK1A 2GQ2A 4DU7A 1MMDA 1WC0A 1ZM2A 2V1TA 4N8NA 4UZBA 1SKSA 3PV8A 3TVYA 4PQUA 1TR0A 2MY8A 1WHWA 4DSJA 4ETZA 3KG4A 1IBMF 4OZ1A 2WVCA 2GMLA 2ZEJA 4ZMMA 4J9RA 3G82B 1PYSB 1SIWB 5KG3A 1YZ6A 1K8AT 1M5SA 3N01A 3OUYA 3HF5A 3HSGA 5M2UA 3DDIA 3CJQA 2V67A 4M5DB 3IXQA 1QAXA 2FTRA 4DOZA 4KY3A 2ZVSA 2HLTA 3DHWC 3CCSS 2F4FA 2WCXA 2H9ZA 2UUWA 3KLFB 1QD1A 1TUWA 4DCPB 2K7KA 4USHA 3CD0A 2WBRA 3DRRA 3F44A 3LF0A 1FNXH 2IJNA 1LWEB 3F56A 2NXNA 1FT8A 3MECA 3FSXA 3PYFA 1O0PA 2CPZA 4IYQA 3MAHA 3IR5B 4G1QA 3GTYX 1UVKA 4X4UA 4U9RA 3QFWA 3K5LA 4JB8B 2YH1A 1NK0A 2EVZA 4AXIA 2RQKA 2HYIB 4EUVA 4USWA 3H90A 2YNGB 1Q8LA 2W4PA 1S6UA 4YB6A 2Z2ZA 4H4OB 1LFWA 3DLJA 3RYLA 4FBTA 2UXDJ 1LW2A 3OL6A 2PSZA 3DU5A 1JLGA 1UW9A 1MMNA 5IOLA 4AE5A 3PYEA 3BO3A 1N33J 3I6PA 2BM1A 3LWLA 4KE5A 3ILJA 3C19A 3RR7A 3CDUA 3D6MB 4FF2A 2DR5A 4OFZA 2ZKTA 3QAEA 3MEDA 3ILLA 2J0WA 2FLPA 5J1PA 1NJYA 2OPQB 4IQMA 3HHLA 4CWBA 3CJ3A 5HK4A 1HWJA 3VAHA 3RB6A 1C1BB 2LQ5A 3QJLA 2J8AA 4DN0A 3H8YA 2HVDA 2IC3B 1SH3A 5MAOA 4L3NA 3R1LA 1QM9A 2VQEF 3GIRA 3MEGB 4B02A 1BGXT 1A6LA 2HHSA 4ECUA 2A6OA 1I94F 2M88A 4Y65A 2M3DA 4OHZA 2HNDB 4H54A 3P96A 3G8QA 2AJFE 4CH1A 1LEOA 4PQAA 1P1LA 2GIFA 5IM0B 4YB1P 2VG6B 2W2PP 4TU8A 2EBGA 3KMSA 1ZTTA 1GMVA 2GVDB 3CCJS 1UAWA 1WOSA 2B7BB 4UOHA 4LIRA 4PRFA 1XTZA 2EW9A 1BC6A 1SJ4P 3G6ES 4V19X 1RT4B 1PSDA 2EC2A 4KSEB 1D9AA 3T6BA 5F8IA 5KG0A 1OS5A 2XZ2A 3QPIA 3A3PB 3QGIA 1NZ8A 3OXGA 4CYUB 1VRTB 2CPEA 2YNHB 4I56A 2ATLA 3RAXA 3EGZA 2KHCA 2DVIA 1WDDA 2BA9A 2HWIA 3KLVA 4DV0J 1S0MA 1M5HA 1TL7A 4CTAB 3M32B 4U95A 1QVGR 1UWBA 1MN7A 2QRRA 4ECRA 5HN0A 2IA6A 1KLMB 2X3GA 2OSQA 4NX9A 4WTOB 3Q8PB 5A8RA 4O3OA 4K0KJ 2BABA 4EGLA 5DG9A 3D6FB 1YBTA 5THWA 2RSQA 4P2FA 4DU8A 1LWFB 2C2ZB 3QIPA 1D0EA 4NZ6A 1H2VZ 4DUTA 4LSLB 1SPBP 1YJWS 3B78A 2IPOB 4CO2A 3ZZRA 5I3UB 1F0XA 1S59A 2DNGA 1V5IB 1S7IA 2H5EA 2M4MA 4DR1F 2HZCA 1QTMA 2XGQA 3AD9C 2RD5C 3BKFA 5C7PA 5B0EA 1BWEA 3EZUA 2KFZA 3AJ2A 2Q43A 4O3QA 2G9OA 4RZRA 1TK5A 3FMBA 1YTYA 2MGZB 1IR0A 4X4QA 2HFNA 1U0SA 1SV5B 1TP7A 2Y8WA 2X1FA 2OAUA 4NXMJ 1WELA 2HWHA 1NKCA 4ZLPA 1O8BA 2MTLA 5HP1B 4I2QB 5J2PA 4F2RA 1HHTP 2C3UA 4C0BA 3M6VA 2CPDA 2OLWA 3DOMB 1WI6A 4J9SA 1R8HA 3MMJA 2AEFA 2XWYA 3NBPA 4J9MA 5B7WA 1NKEA 4ZP7A 4B9SA 1TFWA 2FVRA 2R2TA 5CYMB 5LT5A 1TK8A 1UVJA 2MKHA 4F25A 5AJ3J 1FE0A 1VBKA 4RNNA 3HK2A 4OX9F 4MMOA 3FZ2A 3CD6S 1T9YA 3ZNUA 1ZH5A 2AKWB 2QLXA 2E9TA 2VL1A 4ZVFA 1X4EA 5KT5A 3BH6B 4U8VA 1ZTWA 4QPTA 4OHWA 4ES1A 2LLZA 4C7QA 1U2CA 2DGSA 1FK9A 4QW8A 2PT0A 1FWKA 3BSCA 3EMTA 3O3LA 4OYXA 4NPOA 2VG7A 2RDDA 3M2VA 1U1KA 2B51A 2MLYA 3KXDA 1UA0A 1HNVB 5KTQA 4DSFA 4OYIA 1N5YB 1I94J 1NPPA 3R8YA 3RUBL 1VR6A 2B0GA 5K8NA 3KG1A 3ZO7A 2BR0A 2F40A 2HBYB 3NGUA 5DGAA 1SL1A 1LW0A 4JV5J 3WIUA 2E29A 2RB7A 4KFBA 4DLGA 3CDEA 5CD4H 1LXJA 5L9XA 1IKVA 3LA0A 2EK1A 4ZCLA 1GMWD 2E5JA 2KU7A 3KHHA 5EGYA 2Y1RI 4DX6A 4LQ9A 3CC4S 4O4GA 4LF5F 4LBPA 1FI4A 1HNWF 9ATCB 2VD3A 2FHKA 3GFYA 7FD1A 4P73A 3OTOF 3M1VB 3KLIB 3R97A 1U26A 1N6QB 1VQ6S 4N76A 1TL3A 2XC9A 3IN5A 1AROP 1M90T 1NDPA 2DNLA 1WTFA 1FD2A 4RJVA 3UCZP 1HMVB 1C0UB 2H51B 3EGNA 4D3GA 4X65F 2AT1B 1U09A 1WG1A 2CWXA 1PYOB 1KFSA 5AE2A 3L09A 4QCLA 3W63A 3PYGA 1Y4ZB 1T9VA 2IY5B 2UZAA 1G7CB 2JOQA 1RHMB 2HHTA 4LFBJ 5EWGA 4WXOA 4ZPWR 4TY8A 2VONA 5HL7Q 2HS3A 1AFJA 4J91A 3VAMA 5DJBA 4ELUA 1WF1A 3GPAA 3EZ5A 1JKHB 2UUCJ 1TQLA 4CLFA 2BKOA 2Z8QA 1SQGA 2XI3A 3VQSA 1OJ4A 4G65A 3AA9A 1WHXA 2V2KA 3C6TB 2JFDA 2AYEA 3M9MB 3EPIA 3SZ2A 2HHWA 4C11A 4Y3CA 4NLDA 3HZEA 1XR6A 2MQPA 1HNXJ 3ILIA 2GNKA 3T9NA 3VTIA 1RT3B 3C8YA 2CRLA 5IT9Y 2X3DA 2BANA 3TVZA 4CNYA 1XMQJ 1QUVA 5KFMA 3HSJA 1AZSA 4USVA 1M0SA 1F6TA 1FXRA 3VF0B 1BUXA 1RWNB 2VB6A 2Q6CA 4JI3F 1RWWB 4MK7A 3EYZA 1WC1A 3NY0A 3LALA 2P9GA 2YQ3A 1U48A 4QWDA 1Q82T 4UQGA 4F7VA 4RW6A 5A8KB 3CJ2A 4P2MA 4DV4F 1S9EA 1T3NA 2OO4A 5CABA 1R0AB 1B0PA 2GO9A 1SBRA 3T6JA 2C3YA 4F4WA 4ED3A 2SXLA 4OI3A 2FPHX 3KLEB 2QTWA 1IJEB 1Q5VA 3QJPA 4FNIA 4TVAB 1B7YB 1T8EA 1Q4RA 2WB4A 3C16B 2FLNA 4DCOB 1XNRF 1N32F 4Q8FA 4Y34A 3SIPB 3SEOA 1IR1A 1J5EJ 4QW9A 1IBLJ 5J2NA 3EX7B 2HNZB 1RAOA 1HNIB 4CH7A 1V9OA 1Q79A 1OQ3A 3GYNA 1FDNA 4I7FB 4NYZA 3VZIA 4LF4J 1NLKL 3HLUA 5DS7A 4X64F 2FJVA 3M8YA 3DLEB 1QAJA 5KFIA 5C24B 3W60A 4KV8A 3UI3A 3HD2A 2CIMA 4Q45A 3SQGA 2F8HA 1AYEA 1KBRA 3P49B 3KJVB 1SKRA 3QT7A 2WBMA 2DNZA 4RWXA 1Z2ZA 2A3JA 1B3TA 4AL6A 2C3PA 2RHSB 4DFPA 3BN4A 4RX6A 4DFJA 2W25A 3K5MA 1N36F 2OMLA 3T1HF 3ISND 4RW8A 2E44A 1H0HB 3CDAA 1VIOA 2JX2A 2JEFA 1IBKJ 2VOOA 3HHLD 1AB8A 1Q95G 2QLBB 2B4PA 3G96A 4OI6A 2U1AA 1JQGA 2B6AA 4MTPA 5E33A 4ANEA 4YY3F 2RDIA 1HBUA 2XMUA 2LKZA 1CJUB 1GEHA 1FESA 5C25B 2FD2A 3FK4A 2ZHOA 3N28A 1WEXA 2CQIA 5ETSA 3QT5A 2FC8A 2OKQA 2NREA 5H9EK 3H98A 3X1LB 1FTCA 3AWRA 2EI5A 1S1UA 4YHHF 2DR6A 2CNLB 1ZAVA 2DIVA 2OEJA 2OPSA 2ILZA 3BKTA 4J9LA 5F8LA 3PHTA 5F9NA 3N9UC 4KIAA 1H3DA 3BGUA 5GMEA 3OXFA 3UW1A 3ETOA 2E5IA 1TZ0A 4R0JA 1B99A 3OLAA 3PX4A 3MEEB 1LXNA 4GO7X 3KK1A 4JI0J 2YY3A 1X9SA 3DLGB 2M70A 3CJ0A 3M2RB 4FYDA 1F60B 3PJ9A 2BJ7A 4LFAJ 2DJWA 4MYUA 1RT6A 1NB2A 2B9XA 4I68A 4ZCIA 1AFIA 2IM0A 3DLKA 4Z7YA 1Y5IB 3DLLQ 3HZGA 2GA7A 4X66F 1FJ7A 8ATCB 1RA7A 4C8ZA 4J37A 3DCAA 2P6TA 4IG3B 3OFEA 3QSYB 4KAIA 5J2QA 4WIIA 3S8SA 3ET6A 4DV4J 4ZLJA 2FJDB 1YJ9S 2HZAA 3RRKA 3P5BP 4C8OA 4WFBQ 3V4MA 1HARA 3CJRA 1S76D 4DPYA 4HI2A 3OVBA 2OFGX 4CCHA 1MSWD 1GTEA 4XK8C 4Q8EA 2A2CA 1U1QA 2KXNB 1ULRA 4ZOSA 2DGUA 2KZZA 2X7IA 4IRDA 2GGPB 1W25A 3IO1A 4LFCF 2IM2A 1D09B 2XO6A 2O66A 4B9TA 2AEMA 4NLSA 2YWWA 3P3DA 4N41A 2K1RA 4DSIA 1S12A 3ISNC 3NS6A 3U1LA 1PAUB 1EB0A 4LF2A 4FVCA 2VFRA 3JSMB 3DYAB 3HHLC 4K4SA 5A2QU 5D77A 5BYSA 1EIYB 2FLLA 2WVDA 2QLFB 3CO9A 2IDLA 3T3FA 1VK3A 1HI8A 2YWFA 4KH1B 2KN4A 1FDAA 4OI2A 1VQLS 4B9MA 3KYLA 3Q2SC 3D1OA 5KT6A 2C2OB 2WRMA 5HI7A 2GMHA 1R8BA 3ILOA 2FJXA 1VHFA 5L8RC 2CG4A 5D0HA 1QJHA 1P27B 3GYXB 4QIEA 2D3UA 1RTDB 2JWNA 1KLNA 2BJ8A 3GV5B 3O6QA 2XNQA 1C4AA 4PXDA 1WSVA 5F9LA 2DCLA 3T1HJ 3W8PA 1KHVA 4AT1B 3R3TA 1KEKA 3EWGA 3IAM9 1U1OA 4W92B 2QA1A 5GADU 3Q24A 4F36A 4H4KA 2OPPA 5B09A 3R5BA 1UUJA 1EX8A 2DGTA 4J7CA 1FKOA 2IRYA 4DQQA 4YY3J 3CW2C 3J7Z5 1S6PA 2Z30B 1UPMB 1D9FA 2DNOA 4OV1A 1CJVA 3LH2S 5E5NA 3HT3A 3GWCA 5KT2A 3I5BA 2VDHA 3VR1A 2RRAA 1HQ2A 3MF5A 3THTA 1NRKA 3CDBA 4X84A 2H4WB 4DF8A 2GO8A 2C22A 5DGBA 4FYVB 2HFOA 2DNMA 4R25A 2G0IA 4ICLA 3PW5A 2MDAA 2W7OA 4A8WA 4YR3A 3MR7A 4IOAQ 3DN9A 4DCJB 2R7TA 3IR7B 6FD1A 4OZLA 4WK3A 4ZK7M 4I2PA 3H5SA 1WD6A 3VAIA 3ZXWA 3AJ1A 3LAMA 4I0WA 1GTHA 4HKQA 2IA0A 1K9MT 2PI4A 4O3SA 2DISA 2FHOB 3HKZD 2W9BA 4CRJA 3GCWP 1CS4A 3QBCA 3SV3A 1RBAA 4KKOA 5HLFB 5KG4A 3DRSA 2M5YA 4NCGA 5HATA 3OR1A 7FDRA 4XDDA 5D78A 4F26A 2V4JA 4BC7A 4ZVHA 3O8WA 2W7PA 2DEJA 4JP8A 3UD5A 4FZVA 4ES3A 4X66J 3LP0A 1X0PA 1EETA 2DY1A 3C6UA 1BQMB 3IFEA 3T5KA 2EG2A 2N7CA 1MWYA 1C4CA 1LK7A 4DQRA 2AYMA 5KFHA 5LJ3Y 1TL1B 3W5ZA 2YKAA 2DNYA 3FBFA 5D3GA 2GVZA 4QQBA 1S1TA 1YBAA 3MMBA 3BR8A 4G1IA 3W2WA 3BQ2A 1RHJB 4OYAA 2K3KA 3DOLA 2G1HA 2KXHA 3CCWA 2MZJA 4LFCJ 2YNFB 4WFAQ 1SXLA 2BACA 5HBMB 2D1CA 1RT2B 3V4IA 1QSLA 4URSA 4E8UA 4HL9A 1U25A 4P72A 1FRLA 3D67A 2DGVA 1YRUA 4K2JA 4D3HA 1X7VA 1NAQA 4HACB 2ALZA 4O23A 3UQSA 2CQ4A 2VHGA 4OL8A 1UFWA 3EE3A 2L3MA 2BQRA 3QGPA 4MFBB 2KVIA 1N52B 2VFSA 2RAQA 4KPYA 3WIVA 1IQZA 4PG8A 3MAQA 3AD8C 1Q53A 3DI6A 1XMOF 2MQLA 3DGVA 1RE1B 2QLJB 2R7SA 4OZNA 1UCNA 4RUBA 1X4AA 1ZZNA 3PM9A 2Z0GA 2BQUA 3TI0A 1E6YA 1VLYA 2BJEA 4RW4B 4Y2CA 2AMCB 2ZUGA 3MPYA 4DL5A 3SQOP 3VGUA 1VC0A 3H4BA 4IKAA 3FSIA 5L9NA 2KZMA 5LOQA 2PD1A 4LRAA 4OI0A 3NAHA 4EYHB 1J27A 5JVGQ 2FHMA 3MD1A 5KFNA 2W24A 2N82B 2ZE2B 2RQCA 2E7XA 4NOHA 4DR7F 4OZ3A 3KHRA 1Z2LA 2WAQD 3MM6B 4MH8A 1R31A 1HQEB 5BR8F 1IR2A 4K4ZA 1OYDA 4OJGA 5GMKa 1L3UA 2E5GA 1R43A 2CZ4A 4HEA9 3CCTA 3UCGA 5DDOC 1NSAA 3GJQB 3IAS9 3KLHA 1XBWA 3ADAC 5IC6B 2KVQE 1S0OA 4J9NA 3O5TB 4O3RA 2YNIA 4CO4A 1OY9A 2HFZA 2YKNB 1N88A 3R7NB 5E3RA 2BJ9A 4ZVQB 1TVRB 4DL3A 5LMUF 2RF2A 3MTJA 3V6DB 2AX1A 2B56A 5H9FK 1S9FA 5KT4A 3PKMA 4J9PA 2CZ9A 2I8EA 4DZ6A 3V81A 2B7CB 3BSOA 2H48B 2R9LA 2YQ0A 2PI5A 1VCTA 2B43A 1K0TA 4OX7A 4LRFA 3N6LA 3BPSP 3GJSB 2IBOA 3I87A 2CUYA 3CJ8A 4ZVPB 2ROGA 3J7YU 3RRGA 1V6HA 3OJUA 2HEKA 1IKXB 4NI2B 3BSAA 1U2RA 3M6XA 3P8BB 5HQLA 3GCXP 4RUCA 3BGLA 2CPYA 3GFXA 2YKPA 1XJWB 3BQ1A 4ED6A 1U1NA 2HMIA 5HROA 1RAAB 1UKUA 3G6VA 3BBCA 3ZTRA 1FDBA 3PW4A 2UXBJ 2ZH6A 3IRXB 2F8MA 3KNAA 3PY8A 1RLCL 3MM9A 2R42A 4NLUA 2EFNA 1NJWA 5L39A 3EXYA 3M8PB 3KTQA 3OFGA 3M30B 1DTTB 1ZAXA 2POKA 5T7LA 3TAMB 4IH6A 4HYKA 4U96A 2KRRA 3QLHA 2I6WA 1TUVA 3FC9A 1F5BA 2QA4G 1U2FA 2EFPA 2GS8A 5CCLA 5DLFA 2MKSA 3T19A 2FUG9 1GXUA 5KFCA 5J2MA 1NPKA 2HBRB 4DV7J 4LRBA 4EFAC 1NJIT 1LWCA 3TJ9A 1EP4A 1KNZA 1VRQC 1RT1B 1F2GA 4IFVB 3EDQB 1JJHA 3HPOA 1CJTB 2A10A 3HFZB 2QL7B 4QBUA 1NDKA 3A4TA 3PVXA 1TKZA 2HVZA 3BB5A 3TZWA 1QSSA 2J9EA 1UWAA 3OLBA 3EVWA 4XPCA 4OHXA 1HW9A 4B3MJ 1HPZB 3ZTQA 2YWHA 3MM7B 3TVKA 2XO7A 3IBWA 4DI6A 1XK8A 3QO9B 4LSZB 4JYAF 3FMWA 4NL5A 1QVFR 4NMXA 3FBEA 1NH7A 2BE9B 3B6BA 2YPZA 3ISZA 4DR4F 2IAJB 2ZBIA 2VBZA 1NK7A 3M9NB 1PJ7A 2BMBA 5KFWA 2E5LJ 4FS2A 2D69A 3TAPA 3G82A 5DQGA 3SI8A 2BX6A 4USMA 4M5DA 4PXCA 1RA6A 3Q8QB 1FHTA 1S48A 2XTCA 2BJ3A 1NB7A 1VIXA 3H2VE 3UE2A 3NGRA 2QGFB 2QA2A 5E0OA 1HR0J 3PNIA 1T03A 4QJVA 2I1RA 1TELA 1NK9A 1L3VA 1NSPA 4DLEA 4M5JA 4LSNB 3DFEA 2UU9J 2ZM6J 3CCRS 4M1KA 4OX8A 1YRXA 1U24A 4DL0C 1XIQA 4LT6A 4PAAA 2AJQA 3UN2A 1VK8A 2V8DA 2XNRA 1U6BA 4KBIA 4MIBA 2CQHA 3LGMA 5KG1A 3KK2A 1S1VA 5E3QA 4ES2A 5KFDA 4X4OA 2ADBA 2AEJA 1JXEA 3N79A 4DL4A 1FNMA 4IR1A 4LR8A 4PQUB 5KG7A 2ZH3A 1WEZA 5H1SV 2QV6A 2AU0A 5T14A 3GIJA 1KOOA 2VASA 3EICA 2CKWA 1U6ZA 4G6VB 3W2VB 4MK8A 3D1QA 3OUYB 3MFHA 3JQMA 3E3XA 1BQNB 3L7UA 4ECXA 3FRYA 1VQYA 1M5KC 2JRSA 4BWMA 2LU2A 3MM5A 1GXLA 4J9UE 2VDIA 4F50A 1G3OA 3NAIA 4IDKB 3JXOA 2COLA 4DX7A 3V2UC 1G2EA 4X4VA 1H38A 3NGTA 2HGNA 2EFOA 3DU6A 2M2BA 3D3CJ 3DRRB 1UP1A 2EG1A 4ZP9A 3C15A 2AP6A 4DS5A 1X31C 1FKPB 4ELVA 1OO0B 1QSYA 1RTIA 1NPRA 2RH3A 4P52A 2GAGC 3IR6B 4JV2A 4CM2A 4N5SA 2MLZA 4V1Ak 4G1QB 3OBIA 2QSWA 1NNDA 3DC2A 2V8PA 3CO0P 4I4BA 1PILA 2VBWA 4P6QA 2FC9A 2HNDA 4DXLA 3BYRA 4DV3J 4NRTA 1WF0A 4UUWA 1FWLA 4DPOA 1FJEB 4C0OC 4QIWD 2GVDA 4NA3A 5AXKA 2QMWA 3D7SB 4QU7A 1HBNA 1JLGB 1HHQA 2RMLA 5I3PA 4TU7A 1WDTA 1SH0A 1YGYA 3PIPQ 3AAWB 4AYBD 2XYGB 4CI0B 5SZTA 2BYCA 4U7UK 4CLLA 2ZVIA 4Y00A 3SCKE 2I5JA 3MEDB 2ZBQA 3TEHB 1VRTA 4P7TA 1TL5A 1CJKA 3IMQJ 4I6WA 5DRKA 2WSEC 2MJUA 2UXCJ 3BGFA 3PIOQ 4JYAJ 2WW8A 4C3MA 2C1EB 2ZITA 3FUYA 4ETXA 1OPZA 1U8WA 1V5VA 4K59A 2MMYA 1X4FA 4P75A 2R7QA 1MU2A 3W64A 2ILYA 1S79A 4A8OA 3MR6A 3M32A 3S1TA 4WFYA 3MUVP 1LWXA 1QE1A 1UZHA 4JI1J 2R3VA 3FFIA 2EWHA 2XM3A 4HT7A 2V50A 2FJAB 4KYZA 3AOBA 4LF7J 2AJ1A 3MZIA 4ZJLA 4N56A 2BV3A 4LF8F 2ZOMA 1LNQA 4RNHA 2UUAF 4UTGA 2QL9B 2CQ3A 3WDOA 4ZVOB 4ZCMA 1KRPA 1VJQA 4C6AA 1IUJA 1LWFA 2R7VA 1A0OB 3J81j 4L76A 4M5KA 2D9OA 2G4BA 5I3UA 3VAFA 2DNQA 3MPUB 1CC8A 2LCWA 1OWXA 1CSJA 1LV5A 2MEWA 4BHQA 2C2RA 2GCFA 3V6JA 3M7VA 3OTBA 5B08A 4X4PA 4MIWA 4PWUA 2MQ8A 1U4BA 3BKUA 3L7PA 3H40A 2PA8D 4KHMA 1NK6A 4JI7J 3GJTB 3GONA 4H4KC 5FDLA 4ZKAA 2VOPA 3HSDA 5AXNA 5HP1A 4I2QA 5AXMA 5FIIA 1N5TA 2AJ0A 4FS1A 1A9NB 3DOMA 2CJAA 2D41A 3L7OA 5CD4A 2V8VA 1HWKA 2XZDB 4QR1A 3CMES 3R7BB 1NMEB 5A8RB 1U0HB 3JAMU 2C3MA 4B3RF 2K06A 2V34A 1NCLA 2J7UA 1EQMA 2AF6A 3CWJA 1N34J 3GIKA 2I38A 5DO2A 5LSLA 1FRHA 4OYMA 4ZVUB 1S7HA 2EK6A 5HMYA 2MB0B 4LVNP 3QIPB 3LOUA 3NMAA 2F7VA 2EC0A 4DX8H 1TMJA 1BQXA 1RK8A 2GJFA 4ANDA 2BBEA 1MROA 4ZPBA 1JJ2R 4EK2A 4KJIA 3LAKA 3I9V9 5MLCV 3N5FA 4ECWA 3J7YI 5B0GA 5HQ8A 3MCNA 1Y3KA 1YVFA 2AHOB 1HNVA 3IBCB 1KQGB 3A3NB 2U2FA 1FXDA 2BKPA 2HQGA 1N5YA 1FF2A 3BPDA 1BMQB 1WC5A 4NLVA 4FXWA 3R2CJ 1WKJA 5J2PB 4DFMA 2YVSA 2AQ4A 3N6MA 2E1AA 1S1WA 2MZTA 4FVMA 1BY9A 5F0WA 1JLQB 2V8GA 3T1YF 4LQ3A 1DARA 2V1SA 3CC2S 2B4VA 1HBOA 2IMOA 4E98A 4JI8J 4JI5J 1WACA 1T95A 3NMRA 3TUZC 2GW8A 4DJBA 1YIJS 4A8XA 1T05A 2FDNA 2DHAA 4DQSA 2YWKA 4DL7A 1B7FA 1GX5A 1HBMA 3U02A 5CZXA 2BM0A 5FD1A 3M1VA 3KLIA 1FK9B 3OVSA 4CT9A 4KGZB 4MT1A 4DR3J 1N6QA 3MD3A 1M1KT 2VG7B 3M2VB 2XMWA 2VODA 4DSKA 4DV6F 3FEYB 5CH7B 5KG2A 2DH7A 4CNZA 1JXVA 2ZBRA 2UV8G 3J7AN 3HJFA 2ABYA 4DUZF 3PW0A 4ZPTR 1AXQA 2BUNA 1LW0B 1S57A 4EBEA 2YKMB 2BOPA 4NZ0A 1YLXA 1HHSA 4YB7A 2V68A 4A8SA 2C2NA 3TJAA 4WZQA 1IKVB 2O1PA 4KB7A 1S77D 2G2ZA 1SIZA 1JKHA 2FGOA 3G86A 2M9KA 3ZZUA 1PG5B 1IWAA 3VVUA 1GMWA 1SJ3P 1HW8A 2VG5A 1G6BA 1KTQA 2XMAA 2VKZG 3C6TA 4DV2F 3FCHA 5G4DA 3D1HA 4LBHA 4H4MB 1KTVA 4IRCA 1M1GA 4RNOA 3I55S 1RT3A 1O5JA 4GVBB 1KFDA 1W2IA 5LXRA 3LW5C 5HO4A 2XSJA 3OSNA 1TL3B 1KQFB 1HNZJ 2JJ4D 1HD1A 3OXLA 2OEKA 5K14B 2G2OA 4ZIWA 2QO3A 2F4VF 4B3TF 3EUNA 1S4FA 1KC8T 1T9TA 3A12A 2YWEA 5HQMA 3RZAA 2V8HA 1KQSR 2YKQA 3Q8RB 4DL2A 1REVB 2HHPA 2FHJD 1UZDA 1LQ9A 2DCUB 3MPDA 3UN3A 5CXTA 2G0JA 4LF9F 2EPIA 2HVEA 5A8KA 4TQSA 3ITHA 4M63A 3GQCA 1CPZA 1R0AA 1LFPA 2EEYA 2XCAA 7AT1B 3B54A 1UVNA 5GAEI 4WKYA 3R5CA 3HVWA 3O1LA 2OPRA 1B4SA 1N0UA 1HIYA 1SJQA 2YXLA 4X2BA 4ZLLA 1DFDA 3ONQA 5IWAF 1KSPA 4C11B 1RT7B 4AFFA 1BE4A 2LP4A 3HVAA 3WX8A 1Y5LB 4ZPCA 2UVWA 5B0DA 4LUBA 4BCAA 4TXSA 5ETLA 2Z2LA 4BWJA 3CGIA 2WVEA 2V4RA 2LA6A 4ECQA 1KHWA 1U1MA 1FRMA 1XN9A 1AZSB 1EAYC 2CQ2A 2PMHA 2HNZA 5KFFA 5ETVA 4B3SJ 4OZ5A 5A2QY 1HNIA 1OSCA 1GNKA 4I7FA 2CZVC 1KDNA 2IVMA 3R27A 4OI1A 1SI9A 2FY8A 1MW7A 1S49A 5CA5A 3EGWB 2ROPA 1T9WA 3CULA 4RW6B 4NLYA 2QN6B 4P9SA 3P5TL 1DZ5A 1ZAWA 3CDWA 3M2UB 3RAMA 4A48A 2DYAA 4XIUA 1ZM4A 4K4VA 4RW9A 4EBDA 3M6WA 1RHRB 1K1SA 5KFZA 5CHCB 1D8YA 4Q0BB 4FBUA 5DG7A 3K8VA 2CNKB 1RWKB 2QSFA 3TEGA 3BEGB 1EQ0A 5A0YB 2QMXA 3HFVA 3KJNB 1M5OC 3LPEA 4ZPDA 2B8QA 1KVJA 5J2NB 3W7BA 1JMTA 1WOPA 1CJUA 4UF4A 3QIDA 5C42A 5HVGA 2HQ3A 4YEAA 2MLXA 1FNOA 3R1HA 2MSSA 1DAXA 2HHQA 1ZOTA 2HQIA 2DBBA 1ELOA 1VBZA 3D66A 3QZ7A 2YX7A 2C2KB 2CJ9A 2MPUA 1XQIA 4NXNJ 4DUYF 1TK0A 3UVJA 1XEZA 4DV2J 3UCUP 1JLCB 1U6FA 2H5JB 2JLFA 4HLBA 2ZJPQ 2OFHX 1P9YA 1UA1A 3AQPA 4A4JA 5F8GA 3MEEA 5DDQC 1S99A 4PG5A 1W26A 5E3AA 2OP5A 4LF6J 3M2RA 3AY0A 2F65A 2FJEB 1AUSL 1JNZB 3CJKB 3IP0A 2F4VJ 3D5MA 3D6HB 1X9MA 5CCMA 4YP3A 4C3LA 4ZVRB 3QWUA 3GIMA 4DR2J 3QRRA 2B6AB 4DV1J 4I6AA 3CF5Q 1YJTA 3AXMA 2ZC4A 4NMLA 3OFFA 4NLWA 2OHDA 2PIIA 4P7VA 2CNNB 4M5LA 3FNNA 3DLBA 4R8UB 1IKWA 3MTKA 2CFXA 4Z2XA 4G1PA 3MURP 4ED1A 3AXKA 1SB6A 3GV7B 3TR5A 2VQFJ 3H5UA 1X4HA 2AYGA 1NUEA 2CPJA 2HAIA 2GGPA 4CLKA 3L9ZA 3QZ8A 4QWEA 2M0GB 2W9AA 2M7SA 1S0VA 4JOUA 2KB2A 5IT9U 4BLGA 1SUQA 3KK1B 4K50A 5ETOA 1IM6A 3U7JA 5AT1B 4Y2AA 2CPIA 1SCJB 3JSMA 2ASJA 1WF2A 1Y10A 4KT0C 4U7CA 1WKLA 4ZIVA 4QR0A 3PYDA 5LMNF 1LKZA 5KFVA 1EKRA 1PGZA 2XSFA 3H59A 1W2BR 1RYSA 1TUGB 2HVHA 1Z1ZA 2DPIA 1J2VA 2X1AA 4FF3A 2MQMA 3Q0AA 1Q7YT 1IBMJ 4I64A 3ET6B 2ZH8A 4URGA 4V19J 2DNRA 3KK3B 1BHNA 4ZCKA 5E3PA 3KUHA 4N8OA 1VISA 1M5VC 4OJ3A 1S97A 1OYEA 2JEIA 1VS3A 1ZM3A 1H2UX 2OI2A 2HHUA 1BLUA 4JV0A 3PFOA 1MN9A 2MY7A 2R4FA 3MUTP 2MXYA 3M8RA 2WOMB 2N4DA 3WQPA 3NCPA 2K1RB 3AHPA 3OT9A 1KVIA 4WP9A 1TKXA 1TMMA 3TP2A 2DH8A 2VPZB 3MPVA 1FO1A 2YH0A 3M6UA 4LR9A 2JHEA 1Q8KA 2VV5A 4IQXA 3I96A 1RYRA 5U47A 3ETMA 3CD5A 2L41A 4JI2F 1UEKA 2AGQA 1QUPA 4YS2A 4QYZK 2XMVA 4DPWA 1TKDA 1NHUA 2VF3A 5KG6A 3TZYA 2XTJP 4USIA 2V2QA 1X8DA 1R8AA 2VBYA 3RB3A 5B0BA 5CYQB 2HRUA 4HR2A 4XTTA 4FKYA 4MK9A 3GG1A 2Z2YB 2W1BA 2E1RA 3H20A 2GJIA 1OY8A 1R6VA 1SQFA 4ECYA 5A8WA 4E0DA 3TANA 2J6TA 4RNMA 5D15A 4AUKA 3DRXA 1NHVA 3QRPA 1WG4A 4B9NA 3ZTSA 4KHPF 2FZKB 3HHDA 4LJMA 2HHHF 2OPPB 4YMEA 1GXTA 2MYFA 4GC6A 2P5VA 1R0BG 1C0TA 2X51A 4JI4F 2PGCA 3EZOA 1L5UA 1GMUA 1WJ9A 4RBTA 3NS7B 2O5DA 2VQEJ 1DURA 1VQMS 2B9EA 4PWDA 1P6TA 3CJ4A 3KFWX 1N56A 1T11A 3UD4P 3TYTA 3OTCA 1CQNA 1R0CB 3MMAB 4FXVA 2BDPA 4NEYA 2JVRA 3TRGA 1P8GA 2MQOA 1TL1A 2LU1A 1K47A 4F4AA 3SBMA 1Y11A 3N4WA 2RDJA 3W9HA 2GC8A 4IO9Q 4ICLB 2XTDA 2G2YA 2QA4S 1R6YA 1IWGA 3AJDA 3MM8A 4OZJA 1FEHA 4HTJA 3QWPA 5BYQA 2QX0A 1NO8A 4I2PB 4GKKF 2YNFA 3ELHA 3SMZA 4O4RA 4CH0S 1REGX 4RW7B 1ROFA 2FVPA 3W8GA 1RT2A 4TYAA 4DR5F 2KYXA 4ED8A 2W9BB 4C2MA 4KKOB 3DMJB 4HACA 4RKUC 1UEUA 3DRSB 4NCGB 2OD4A 4MKAA 3NP5A 4MIAA 1N54B 5DDRC 1X5TA 3OTEA 1FKAF 4Q7AA 2EBEA 2HQFA 3BN7A 1EETB 1XC9A 2P9CA 3D28A 3VGSA 3C6UB 1RHQB 1S6QB 4QR2A 4KGMA 3UFCX 3K5PA 4YOEA 5L1JA 2I9SA 2ZD1A 3VQTA 4KH0B 2VPWB 5K8MA 1PC4A 2AJ4A 2LA4A 4OZ2A 3FBBA 1Y00A 3PJWA 3M8QA 3HVTA 2GVZB 1VQ7S 3HHEA 3M8WA 3MMBB 4PABA 4KQZA 4NE9C 1UJ5A 2XBPA 4TU9A 2XCPA 5ETPA 3DOLB 3OW2R 1RWMB 3QYYA 1VRUB 3PW7A 4OI4A 1U1PA 1XNQF 3NOCA 2QC3A 3FCVA 4NASA 4ZDNA 3M8SA 3ZTOA 3G71S 4DR1J 3V4IB 2HQCA 3MM6A 2CVEA 4M5HA 1HQEA 2WSCC 2H54B 3M8ZA 5F41A 3IWLA 4J5OA 5LSRA 1TV6A 4IOBA 1GK8A 5J1EA 3AB4B 4JI2J 3KHLA 3DRPA 4OV6A 1SKWA 3MCMA 4O3PA 4ZVTB 3O44A 3TARA 2QYCA 2QMUB 2IJFA 1VQ4S 3GFHA 2VPYB 3DI6B 4ZLNA 4C8LA 4DR6F 4HVZA 1VQKS 1I5OB 4NA1A 2DNKA 1VC5A 1T02A 5K20B 2ZJRQ 2B5JB 2FVCA 3MR3A 3PO4A 4GKJF 1PYTA 2XYHB 3UDCA 1J5OA 5AXLA 3RB4A 1MG7A 4HT5A 1I51B 5IQ6A 4OX9J 3GFZA 2AGPA 1ZPWX 1ZA1B 1VLOA 2OGUA 2ZJQQ 3D3BJ 1C1CA 1FA0A 1VYAA 2IFXA 1FVQA 1VJWA 3OVAA 3JSRA 3VWSA 3WC2A 2XYPB 2AW0A 4F04B 1RWPB 1QAIA 1UVMA 3BGRA 1D8ZA 2FQQB 3IG1B 5EDWA 2M8DB 2C2MB 1P9QC 3UR3C 4RWWA 1IVZA 4B9VA 3H25A 2PMZD 4WFNQ 1GX6A 4ATNA 3FCWA 4YFUA 3KWMA 5DQIA 3KLHB 2Y1LB 3IRXA 3JQKA 2NPIA 1OM2A 3PKYA 5A6PA 2Q66A 2HWTA 3PRBA 1JXLA 2N7YA 2ZH2A 4ZHRA 4IG0A 2LDYA 2XMMA 3IS9B 3M30A 3OV7A 3TAMA 4Z37A 5L1LA 4WTYA 3VAJA 4QWBA 3EPGA 2YX1A 1T0TV 2J7WA 1N4LA 2IYGA 4EU0A 3NGDA 2YQ1A 1VQ5S 5DETA 3T1AA 3BO4A 4YDXA 2R8HA 2UXDF 4KO0A 1ACMB 4QIFA 4P71A 2HFSA 3O2IA 4C97A 3G9CA 2GQCA 4LF5J 3K59A 3UD3P 3EM1A 1HNWJ 1N33F 2DNPA 4IFVA 3OTOJ 1YHQS 5KFKA 2RU9A 1IQTA 2XB2D 1S4EA 5LL6d 2GV1A 1CJTA 2FZGB 2DEIA 2MKCA 2FVSA 3RG6A 5HMXA 4ZVGA 3IBFB 2V2VA 2VC0A 1HPZA 1PJ5A 2OSRA 1XR5A 3BBFA 2NCKL 3W61A 2V69A 3QO9A 2ZH5A 3VV2B 4CO3A 4RUHA 4X65J 2HHXA 4F8RA 3LTOA 4ZPVR 4EZ6A 3L3CA 3ZZPA 3MM9B 3DLHA 4YB5A 1HQUB 2MSTA 3JTOA 4DF4A 3PG9A 5T7LB 2LDIA 1F9FA 2C2EA 4DG1A 2ZFHA 4M95A 4PXBA 1CULB 1XNQJ 3QLHB 2XS7A 4L3KA 1CG2A 4RUAA 1B0VA 3KNGA 4IFYA 2JEJA 2BVZA 3MPWA 5F0UA 3JS9A 2HAFA 3E01A 1GT8A 5HJXA 4EBCA 2DXDA 2DXEA 2WB1D 4PXEA 1F3FA 1Y9OA 3NRBA 1CC7A 2ZDOA 4FYXB 3LP1A 2J0SD 2DH9A 4CZCA 2DPJA 3GV8B 3I56S 3E51A 4ECSA 2KT5A 4LRCA 4ZN1A 5HAOA 3WHIA 2UVUA 4Q2MA 5IV3A 2Z56B 2CPXA 2R8KA 3KMQA 4EI2A 4U8YA 4ANCA 4C8NA 4UW2A 4QWCA 3MMCA 2XS5A 3R9LA 1RHKB 5KOWA 4JI3J 3PHEA 1R8PA 4Y28C 4DV0F 2QZ8A 4WF9Q 1ZS6A 3HJVA 4C8YA 1GH8A 4RPFA 1OMSA 1U47A 4RNFA 3HULA 3UWTA 2ZZTA 1RSCA 4R5PA 2L9WA 5F8HA 4Y6IA 3AA8A 2AX0A 4RO0A 2DGXA 2JVOA 3OD2A 3SSQA 1UPPA 2MKKA 3W2VA 2JC0A 4USTA 1PKUA 4DHVA 1U1LA 1BQNA 1S9GA 4K0KF 2HG4A 1YWXA 2V63A 4L72B 3JAMY 2E7WA 5D6GA 1Y0HA 4LVOP 2BZ2A 2AZ3A 4IDKA 2LQBA 2HHVA 2P9EA 1VBYA 1T03B 3CUNA 1DTQB 3RBEA 2R7XA 1FERA 4KR0B 4F4KA 1H72C 2PDAA 3RGIA 5M2RA 2JDJA 1V3SA 1GQEA 1HWLA 3I9ZA 2MKYA 2VPXB 2IVFB 3T9ZA 4LF1A 1SJRA 1XNRJ 1N32J 1FKPA 5G0RB 3X3UA 1Z4UA 1RWXB 5C2CA 4C4WA 2ERRA 5D8HB 3C66A 2FY1A 2CDRB 1NK5A 2HBQB 3IA0A 2CQPA 4TLQA 2BW7A 1CLFA 4NXMF 3LGNA 2H3EB 4WU2A 2QYGA 3MDFA 3KK2B 1S1VB 2KM8C 3H0PA 5KT7A 4B17A 3AB2B 2KT3A 2GX8A 4PWWA 3OL8A 1JLBB 2HS4A 4X64J 2KT2A 3AT1B 2CNOB 1WORA 3FQLA 5H9EJ 4KTQA 1LK5A 3OFHA 2HIQA 2W8LA 4UOFA 1UVLA 3SFUA 4G3IA 5AJ3F 3I82A 1DLOA 3MM5B 2KRBA 1N36J 5K9FA 4NLQA 1XWLA 2HK2A 4ALZA 4WXWA 4YQWA 3RBZA 2P8IA 3A13A 2RUSA 8RUCA 1D1UA 2J9DA 1PBAA 3RJMB 3C15B 2OIHA 3NXZA 1B70B 1RTIB 3S01A 3QJJA 3KUGA 2CQDA 4QWAA 3R6GB 1URRA 4DPXA 2KHDA 2NXJA 1WUUA 2JLEA 4Y2MA 5DG8A 3HO1A 3FSYA 4NLPA 3KG0A 1GFWB 4F67A 3H2UB 1JB0C 4A46A 2AD9A 4TKTA 2A1BA 2MQQA 1E6VA 1HYSA 1U45A 4OJ1A 2LXFA 3TNVA 2FVQA 1S0NA 4JV5F 3I0SB 2LXIA 4YHHJ 1RWUA 5F8NA 1RI7A 4EZ9A 4A47A 3CCUS 1F9EB 1RXOB 1HBNB 4FPIA 4IRKA 3TZXA 3CEDA 1FFGB 3GSDA 1NK8A 4FNHA 5L38A 4Q2LA 1NJZA 2NUHA 2DRBA 4A8QA 4RBVA 1RHUB 3IM9A 4ECVA 4Z7CA 2I5JB 1UL3A 1S5ZA 1W7WA 4B3OA 4YDDB 1G4CA 2Y1JA 3UO0A 2N3OA 4OYWA 1CJKB 3MUMP 3OTDA 2J9DE 5K8OA 5KFGA 2KDOA 1H74A 4F3QA 4LRDA 5DM7Q 3PFEA 4F4XA 2YBVA 3E2EA 1MU2B 3OL7A 2LFVA 3SDEB 2XULA 1QE1B 5DDPC 3Q8UA 3FFIB 5FLXY 5I42B 3ENVA 1ZBTA 1PIEA 1X60A 1U0HA 3PRVA 3Q8VA 4ILRA 4S0MA 2CADA 2KH9A 1FX2A 3SFGA 3DOKB 4LFBF 3D68A 1X4BA 5KFXA 4M8LA 2RQ4A 1S1XB 5JXSA 5HJYA 3CE8A 4ZVEA 4DN9A 1V3ZA 2E7VA 3T41A 5GVQA 1VOMA 2UUCF 2G0CA 5KFOA 3IGVA 1U02A 4DSLA 3TW0A 5FJ4A 3B8HA 4K4XA 2ALYB 1SJFA 2MZSA 1RUSA 2K3IA 5FDLB 1RTJB 3VGTA 1T3OA 5D0RA 4K4YA 2V0NA 1HNXF 1PCAA 4A8MP 1S10A 3PRDA 3NL0A 5EUHA 1BXNA 5IT4A 4HHJA 2VH7A 1X5SA 3CXCR 1XMQF 3FJ2A 2D74B 2QJ3A 4ID5A 4C3KA 3AX3A 4F4YA 1JLQA 1NXIA 2KG0A 3HHNB 4NYPA 2DR7A 1VQPS 3JYTB 1JLEA 3GR0A 2YX4A 3NGSA 1RU1A 4DS4A 3AOCA 2NQPA 2A6MA 4K7QA 1OQ6A 3K2YA 4WE1A 1Q7LB 2AIRB 4M5IA 4FPRA 3OSPA 2CJXB 2LXUA 1SC4B 2N3LA 1DHMA 1T9XA 4HH1A 2DT9A 3TA0A 1WWHA 4QOTA 2HPUA 4CO5A 3CCES 3EVOA 2R2SA 2VUGA 1UW4A 3NCQA 4TNOA 2DHXA 1MROB 4DDFA 1L3TA 3DGPB 4MKVA 1RAIB 4CLUA 3MR2A 2RQMA 2PO4A 4ZITA 3J81U 1Q16B 1EKSA 2F8EX 2RKIB 1K73T 4ZP8A 3NKYA 2VC1A 2AV5A 2ZH7A 4TY9A 2WONA 1MNEA 3G4SS 3SV4A 1NU4A 4K4TA 5F3ZA 3R6LB 1UTAA 1S1WB 2ZNYA 5CYJA 1RLDA 4L6V3 1J5EF 1HL6A 5E7OB 2YKMA 2J0XA 1IBLF 2NXUA 1URNA 1FJGF 1R89A 4I69A 1U1RA 2H4YB 3PEHA 2VFVA 1PC5A 4OQJA 1CVJA 2A18A 4M5NA 3R7SB 4ECTA 1HBOB 2HURA 1IXKA 1FRKA 3NNHA 4PUOB 4LF4F 1Q1KA 4CLZA 3JB9k 3HFKA 2IIHA 1NSQA 5B0AA 4DX5A 5ETKA 3HP6A 2DXFA 1I1GA 3C14A 4E2FB 3ENWA 4XPEA 2FYXA 3RW7A 1T05B 3G8TA 3K0JA 4H4MA 3AQOA 3THPA 1HBMB 3IGNA 4CQ1A 2HRYA 1KS2A 2L08A 2CJQA 5ETNA 3CJTA 4GVBA 4ZS6A 3KLGA 3BYPA 3CPWR 4UZCA 3HM9A 1UMJA 4O44A 2RS8A 3I0RA 3Q8YA 4N77A 4Q5VA 5K14A 1CBKA 2AGOA 1IBKF 2JZ5A 1S6OA 4B9UA 1OY6A 1TKTA 2Y0SD 5BYRA 1NDCA 1OPIA 3MGJA 1EJ7L 2KI2A 2CAJA 2NUUG 1ZPVA 2YKOA 1REVA 2XMKA 2KJWA 2DHHA 2BE2A 4GRSA 2VU5A 1HWIA 2J5AA 3POTB 3QRQA 3K8WA 4W90B 2AWZA 5ETTA 2HW3A 1L3SA 5EN1A 3QQCD 2BKNA 2YTCA 4CP5A 1RTHA 2QL5B 2VG5B 2F1FA 3BDEA 3D54A 3DXSX 3I4HX 1HI0P 2DNHA 5IV4A 2FIUA 4QU6A 2QFJA 4DPTA 2XTEA 2GIQA 2BEFA 2ZC3A 3GLJA 3OR2B 1YG0A 1RT7A 1F5CA 1NZAA 3HDSA 3MAAA 5LSOA 3RW6A 1FXLA 2Q1LA 4P2SA 2C3OA 1JX4A 3MFIA 4USJC 1RADB 1ZYQA 4JI0F 1KD1T 2XSJB 4EWTA 1RGVA 3LP2B 1IKYB 3BZQA 4F0KA 4WFXA 3CMQA 1XMOJ 4LFAF 1RTZA 1ZM9A 5IS2A 3Q8SB 2V94A 3W65A 2PA3A 2WVBA 5IT0A 1RT5B 2W9CB 1X9WA 2MJNA 5H9FJ 4JBCA 1IM4A 3R5GA 3ZZYA 2FHJA 3K5OA 4OZ0A 1Y7PA 4K5SA 3HVRA 1RBOB 2UVRA 1YSJA 5GAHU 3ITHB 1M1HA 1YJUA 3FBCA 1JLFB 3MWBA 3M2UA 2PN6A 4DR7J 2V4QA 2JFKA 4DWIA 1TL4A 3CD7A 5BR8J 2LEBA 3ZTPA 2JC1A 2OPRB 2EKNA 1H6KX 2HNYB 4EMDA 3NS5A 4B9LA 3KLFA 4Q0BA 4HHHA 1IJFB 2LECA 1YJNS 1JLAB 1YZ7A 4WJBA 4WFZA 3MCOA 5A0YA 2JL9A 1LWEA 2DR8A 3DM2B 4USUA 5HVHA 1H7WA 1PO6A 4F0HA 1FJGJ 3QT8A 5LMUJ 4WBFA 2ASLA 1N5VA 5E41A 5E2QA 1RBLA 3QGHA 4F3MA 4ED0A 4HH0A 5GADI 2IMWP 3B82A 3AODA 3N6NA 4GVLA 3QAUA 2MZ1A 2YNGA 3PZPA 4OHYA 2ZZNA 2GZOA 3V6HA 4H4OA 2MKIA 4MYTA 2VKRA 1Q86T 1JLCA 3Q83A 2ZHBA 2L9NA 4R0EA 3MOZA 3T5LA 1HI1A 1N48A 1WC4A 4UUXA 4L75A 5KFBA 1UETA 1U7LA 3V6KA 1FRIA 2DO4A 4HI1A 1A7GE 1NK4A 4RW9B 4DMZA 5B0CA 3NOGA 2C28A 3FZBA 3LPYA 3PXGa 2QT7A 2RRNA 3PW2A 4L74A 3SCLE 4NCAA 1ICEB 3CJKA 3MHYA 5IZHA 1JWWA 2OPQA 1H7XA 3F0NA 2WVFA 3N0VA 4NLOA 4PG4A 4O0NA 4MKYA 1OSDA 3MECB 1CEZA 1C1BA 1TAQA 1RACB 2D9PA 2RUGA 2K2PA 5D4OA 3SCIE 3K7RA 2IC3A 2Q79A 5D0GA 3TQ1A 3KOAA 3PACA 4X4TA 5C42B 2ZH1A 3MEGA 5KFEA 2OUGA 3KUEA 2LEAA 4FF1A 4R8UA 1BWVA 3GZ7A 2Y1IA 3TX8A 2ZH4A 2XEXA 4DZDA 5DLGA 4JV1A 4CLPA 3W62A 4GC7A 5IM0A 1R7IA 3RBDA 4UY85 1RAEB 2VG6A 2ROEA 2B8PA 3UVJB 1KP6A 5L1KA 4ED4A 1LW2B 6AT1B 3KJQB 3W3SA 1Q78A 4ED2A 1Q0NA 2L48A 2NYHA 3J80U 1AUDA 1DRZA 2J9CA 4ZP6A 2FGCA 3A8JA 5ETRA 1RAGB 1RT4A 4X4NA 2ZHAA 4UOCA 3RBXA 1G1XA 2PE8A 5I3QA 4DL6A 2CQCA 3BQ0A 3G2XA 5KFAA 2XS2A 3FEXB 4CYUA 5CQGA 3KDNA 2NXCA 2XZWA 1YI2S 2YNHA 3HHLB 1L3KA 2K8GA 2MQNA 2V6AA 2P2CB 1QDUB 2KM8B 4M94A 3BREA 4RU2A 1NH8A 3H4DA 2UUBF 2XG8A 4CTAA 1BD6A 4DR4J 3CB4A 4B08A 4YR0A 4J9VA 1KLMA 3KK3A 1VC6A 1PAEX 1IKWB 2ZZMA 2E1CA 5A6WA 2IYIA 4PG6A 2X1GA 1FX4A 3CCZA 2D3O1 2KTQA 3JTPA 3SYZA 5IFMA 1TAUA 3CSKA 2HZVA 4USKA 3VAGA 3BBBA 2WK4A 2XY7A 5BXIA 4K4WA 4LSLA 5ETQA 3TOQA 1DQ8A 1NHKL 3ZZZA 2WOMA 1RJJA 1SVDA 2JH3A 5L1IA 1SUQB 3NNAA 5F3TA 2V5HG 4FDFA 5B0FA 4PYDA 4EEYA 2LYVA 1OIAA 1SC3B 5I4MA 1WG5A 1N8RT 1VGYA 2MGZA 1SV5A 3QFHA 4M5MA 2R7UA 3VALA 1YJVA 2Y8YA 2RT3A 1Y3JA 2X1BA 1KONA 1LOUA 2XLIA 4LREA 2EFQA 3VAKA 5JMNA 1QLNA 1TL7B 1N5SA 5KFYA 2LQJA 3ENQA 5CYQA 3HX9A 3I5CA 4DPUA 1UWBB 3WC0A 3Q22A 5DM6Q 3CIMA 4AL5A 3D9BA 5CYMA 3TUPA 2OTLS 3FQKA 3I32A 3AFGA 1ITPA 2KFNA 3J7ZT 4U7UD 2DR9A 2WHOA 4HDGA 2F9DA 1KR4A 3UN5A 2I2YA 2BOAA 2F5GA 3MXHP 4CLYA 2LQ9A 3DRYA 2CJYB 2XHWA 4ER8A 3TJ8A 2VZ9A 5DZ6A 3CCVS 1FCAA 3I4PA 1TKXB 3Q23A 1SC6A 2KG1A 3ULHA 1VQ9S 1DQAA 4PG7A 2RVJA 4LR7A 3MR5A 4IO1A 1O51A 4IOCQ 1UVIA 1YKWA 4PEOA 1VHIA 3I31A 2GHVC 3CCQS 2Z58B 3MMAA 4ENOA 3W9IA 1YQHA 4OHVA 3H7HB 4MKBA 3UDVA 2NSCA 1FD8A 5KAKA 2R8GA 2DKOB 2J76E 3LUYA 2W2NP 2EKYA 3GP9A 2CVIA 2UV8A 4NRUA 2ZWPA 1SC1B 4BDPA 4FYWB 3FGVA 3NBPB 4LMZA 4KHRA 2B9WA 2OMOA 2RRBA 2RU3A 4ED7A 1X4GA 2GIRA 3OL9A 4RW7A 5A8WB 2DK2A 2HFUA 3G87A 5EX3A 3CJSA 4AL7A 3MCSA 2KKHA 2XHCA 5D4NA 2VICA 3DMJA 3JTNA 2XY5A 1RWVB 2W2OP 5D0EA 2DB1A 5KFSA 3TA2A 2IJRA 4PR6A 1T7PA 3C3LA 5T41A 4C8MA 2OELA 4PPDA 3IWNC 1C0TB 1NKBA 5AE3A 1NJXA 1RB0A 4C9DA 2UUBJ 1NSKL 1S6QA 2HRTA 2F9JA 3TX0A 4PWDB 1R8CA 2UXBF 2V9KA 2ATCB 5GMDA 3P6YC 1HMVA 1C0UA 2CXEA 1RABB 2ZBPA 2OEMA 2B4OA 2QIFA 1VI7A 4DSEA 4K4UA 4LF8J 2ACYA 1YK9A 4OJHA 4FKXA 1C2PA 2QE5A 3A8EA 1TU0B 2UUAJ 4K5RA 2CJKA 2N4CA 1HKAA 3CVKA 3T5HA 4U67Q 3MM8B 4KFBB 2Q6BA 1VRUA 5HANA 4Q44A 4K2XA 2JEGA 3K58A 1SH2A 3HD1A 1RAHB 2ADCA 4BBYA 2IVYA 1AW0A 3S6EA 4ERDA 3G6YA 3HCXA 4BS2A 2DO0A 3BH7B 3B4DA 5KG5A 4PPZA 4DV7F 1T94A 4O4GB 1VBXA 5GAHI 4W4MA 1F5AA 3NNCA 3BS9A 1DQ9A 3QT6A 1WC6A 1VDHA 3HHKA 4WPAA 1WKKA 3ICLA 5KFJA 3SSSA 2W7AA 4W98A 2XI2A 1RCXB 4KC5A 1JNRB 2D3OR 4CM0A 2XGPA 2ZD1B 4B3MF 4N7TA 2AYBA 4URQU 1RWOB 1NM2A 4WYWA 3TO8A 1VMBA 4OX6A 1Q8IA 2E66A 2P6SA 2B5JA 3F73A 2GQQA 3M8QB 4B3RJ 3HVTB 5F8JA 2IHR1 2FJWA 1WI8A 4BC9A 3AOAA 4NYOA 4WKRA 3NWGA 2MZRA 5HMZA 4FF4A 3CCLS 4AXJA 1SJ1A 4O0IA 1X5OA 2RE1A 2XZTB 2PFDA 4TY8B 1F9HA 1RCOB 2E5LF 4X62F 2EXUA 2NZCA 3W1YC 2HIYA 3TUIC 5RUBA 1FFSB 1UFKA 4FXDA 3EXCX 3W5XA 3GIIA 3BR9A 3IG1A 2CPHA 1WTBA 1HWUA 1HR0F 4LBIA 4J90A 3US5A 3KLEA 1H98A 4ZJQA 1TV6B 3IRWP 3RU0A 4AD6A 3RAQA 3PJXA 5J1EB 4PZVA 3DRPB 3C16A 3BO2A 1YITS 2NZ4A 1EHWA 2UU9F 2ZM6F 4PKDB 3G8SA 3D6TB 4WWSA 4FN5A 4YN3B 4A8FA 2V2ZA 4Y2IA 3CNQP 2BANB 3BF4A 2CQGA 1WEYA 3IS9A 3T1YJ 1M5PC 3AX5A 5EWFA 2PEHA 4CLWA 1DJ0A 1J5OB 2DRAA 2CQ1A 3GJRB 2DD8S 2QFIA 5LJ5Y 5CZVA 2ZKUA 3DLEA 4CLTA 1MMLA 2GJ2A 3THVA 5C24A 3MOJB 1C1CB 3PCOB 2IRXA 2GAHC 3UNGC 1XR7A 3R5JB 1D3WA 5KFLA 1S9EB 3KJVA 2RS2A 2ASDA 2I0XA 3BGRB 1HLWA 2E9ZA 4N47A 3PDNA 3AH6A 4DV6J 3ZZOA 3I5AA 2VJUA 1MLAA 1X4DA 5GAGU 3W5YA 2A2DA 3UR0A 4YUDA 5A76A 5C5JA 3TUJC 1WHYA 2L9DA 4YR2A 4DUZJ 4ZHRB 2ZNZA 2HK3A 2M8HA 5CAAA 3OPKA 2RNEA 1YDLA 3B4MA 4F3OA 4IG0B 3BGOP 4OMFG 1HQUA 1WSRA 1RU2A 4KGXB 5C25A 1NDLA 4OYBA 3R5AA 1CULA 3P4UB 2GHWA 5JJBA 4DV3F 1B64A 4EO8A 1XERA 4ZJOA 3HKWA 2B3TB 2BRKA 3PEJA 1RKJA 3IWXA 2XMTA 4PYAA 2GMJA 4KO0B 6FDRA 3K57A 4KV8B 5KFTA 3A3OB 4NCBA 2CQBA 1R3NA 4DV5F 2FZCB 3TZZA 3F41A 3SQGB 1FE4A 1FRJA 2HS0A 1Q81T 2APOA 2Z2MA 3A8IA 2UVVA 3CCMS 8AT1B 4GMKA 3GSIA 1VQNS 2LVWA 3H42A 4WCEQ 3U1NA 2AZ1A 1K0VA 4IUFA 4RW8B 3DLGA 1VQOS 1O6XA 1JJ4A 3NG8A 2D68A 2HGLA 4K8RA 4B3TJ 2KJVA 4KGKA 1S72S 2UXCF 2DGQA 2OJ3A 5HMWA 1KN6A 4ELTA 1HD0A 4P2XA 1SL2A 1HBUB 2NSBA 1D9DA 4IG3A 1T9UA 4LF9J 1IN0A 4JI1F 3TAQA 1RAFB 3GILA 1WNEA 2W2QP 3K89A 4DG1B 4X62J 2JNJA 2WSFC 4LF7F 4IFYB 3WX4A 4WZMA 1JJCB 3HSZA 3E01B 4DQPA 3W66A 1S1UB 3DDNA 3DNCA 2OPSB 3FRZA 2CYYA 3R5DA 1WHVA 3BV8A 1DTQA 2IM3A 4Y0FA 2UUTA 5IQQA 5IWAJ 4NLGA 3LP1B 3NEKA 4FP9A 2ZH9A 1FFWB 3Q86A 4I6YA 2BXJA 5G0RA 3SXLA 5KFRA 3P45B 3KHGA 4TN2A 4IR9A 3DYAA 1RT6B 4JI7F 2R7RA 3MMCB 3DLKB 2FB0A 3HXMA 2W8KA 1I3OB 3WZ0A 1KOHA 4WP3A 3RB0A 3BJYA 4ED5A 3NCRA 1JLBA 2G13A 2R2UA 4QPXA 2O3DA 5GAEU 4UT4A 3DHXA 2MHNA 3FEZA 3GE9A 5J2QB 4R5PB 1YBUA 3UNYA 4NLXA 2XQCA 2M52A 1K1QA 1U49A 2VA3A 2NLWA 2QLWA 1S9GB 2RILA 1RTDA 4C48A 5ITHA 5ETMA 4QIVA 1N34F 1DBDA 2J0QD 2O01C 2OTJS 2DRDA 2O67A 4Q43A 1PJ6A 1YRTA 2WW4A 3GB0A 3N5BA 1V3RA 1F3VA 1H2TZ 3GMGA 1YJ7A 4GO5X 2GFFA 3KKFA 2Z4PA 4UY8T 2VJVA 1N0VC 2V9WA 4X4SA 1IBCB 4OYOA 1PBUA 3CT9A 3FDSA 2CJBA 1XMBA 2J6UA 3GG0A 2R2RA 2A0FB 3OHAA 1SL0A 3J81Y 5KFQA 2J8SA 2HQDA 1R27B 4EO6A 1WOOA 1I6JA 2GHPA 4HDHA 3CTRA 1Y5NB 3RR8A 2Z57B 1RQ0A 2ZBCA 3H5XA 2BQ3A 2LQ8A 3FKBA 3I0SA 4DUYJ 2F3JA 2Y3YA 5EWEA 4ILLA 4ZA1A 3U1MA 4DV5J 2E1MC 4CO1A 3A8KA 2D7SA 5HSPA 2KFYA 4JI8F 4JI5F 2RJZA 1DLOB 3OJSA 4LIWA 4DBQA 2CA9A 2R7OA 2HKEA 1FTRA 3SSRA 2C2DA 5HLFA 4ZPAA 1KVKA 3AD7C 2NS1B 4J9KA 2H1YA 4WP8A 4F4ZA 4DR3F 4RLEA 1FKOB 4DEZA 1S6PB 3EDRB 1YJRA 3SCJE 5K8PA 2AJ2A 1BQMA 4HHUA 4NLTA 3SDEA 3D4JA 2KL8A 1N5QA 3LWMA 1CJVB 1YX2A 5KFUA 2NXEA 5I42A 1Q8BA 2HSEB 1RAJA 3U27A 3JSBA 2XMJA 4NEZA 2JSXA 1NBEB 1E6VB 2DY9A 3M9OB 1HYSB 3CMAS 1AA1B 2HVIA 2VFUA 3L95X 1KQKA 3LO3A 3S7RA 3UDEA 3DOKA 3PR4A 4WU3A 2F63A 4XDCA 3K17A 2YPYA
chains in the Genus database with same CATH topology
2ZDPA 3HFKA 4HI2A 3OVBA 2OFGX 4CCHA 1MSWD 5B0AA 1GTEA 4NLYA 1FEEA 1S1XA 4XK8C 4Q8EA 3HP6A 4OLPA 2A2CA 1U1QA 2KXNB 3P5TL 1I1GA 2NYIA 5E3CA 1ULRA 1ZAWA 1DZ5A 4ZOSA 3CDWA 3ENWA 2DGUA 3M2UB 3RAMA 4XPEA 1T05B 3RW7A 2KZZA 3JSYA 1UFLA 5HBMA 4U6PA 4IRDA 3PR5B 2GGPB 3G8TA 3K0JA 4A48A 4TQRA 4H4MA 3AQOA 3THPA 1W25A 3IO1A 4XIUA 1HBMB 1ZM4A 4LFCF 2IM2A 1TFYA 4K4VA 3IGNA 4RW9A 4CQ1A 4EBDA 3RRHA 2HRYA 3M6WA 2O66A 4B9TA 1KS2A 2L08A 1K1SA 4NLSA 5KFZA 2IM1A 4HTIA 2CJQA 5CHCB 1D8YA 4B3OB 4TLRA 1UEVA 3P3DA 4J9OA 4N41A 2K1RA 4DSIA 5D4PA 4Q0BB 4ZS6A 3OR1B 4ECZA 3KLGA 3ISNC 3G6XA 4FBUA 1RTJA 2CDQA 5DG7A 3K8VA 3NS6A 3CPWR 3U1LA 4NA2A 3HM9A 2V4JB 1UMJA 4O44A 2RS8A 3I0RA 4FVCA 2QSFA 2VFRA 3D0GE 4N77A 3BEGB 4OIXA 3JSMB 3DYAB 3GR1A 4MFBA 5A0YB 2QMXA 5KT3A 4Q5VA 5K14A 3HHLC 4K4SA 2AGOA 1IBKF 5D77A 2JZ5A 1M5OC 5BYSA 1S6OA 4B9UA 3LP0B 4ZPDA 2FLLA 2PFFB 1TKTA 1KVJA 1HNZF 3CO9A 2Y0SD 5BYRA 4QYZJ 5J2NB 1OPIA 3W7BA 3T3FA 3MGJA 1JMTA 1VK3A 2KI2A 3QIDA 1HI8A 1X5PA 2YWFA 5C42A 2NUUG 2KN4A 5J1NA 1ZPVA 2HQ3A 1FDAA 2YKOA 4YEAA 5KOXA 1REVA 4OI2A 2XMKA 4JUZA 2KJWA 1FNOA 1VQLS 2J6SA 3JYTA 2MZQA 4NWBA 4B9MA 3PX0A 2BE2A 3R1HA 2MSSA 3KYLA 2DIUA 1DAXA 1VQSA 3Q2SC 3D1OA 2HHQA 2XLJA 1ZOTA 4RW4A 2HQIA 5KT6A 1HWIA 2DBBA 2WRMA 2J5AA 3M05A 1ELOA 2DNNA 5HI7A 5D3GB 1VBZA 2GMHA 1R8BA 3POTB 3QZ7A 1S1TB 2FJXA 2YX7A 2CJ9A 2MPUA 1VHFA 3K8WA 4W90B 5L8RC 2AWZA 2HW3A 1L3SA 5EN1A 3W2WB 4DUYF 2CG4A 1QJHA 1P27B 1TK0A 1XEZA 3GYXB 2YTCA 4QIEA 1RP5A 2D3UA 4DQIA 1RTDB 2W4DA 2JWNA 1KLNA 3GV5B 3UCUP 3O6QA 3MI7X 1JLCB 1U6FA 2XNQA 2JLFA 4HLBA 1RTHA 2ZJPQ 2VG5B 4C98A 2F1FA 1C4AA 3BDEA 3D54A 4PXDA 1X0FA 5F9LA 2DCLA 3DXSX 3I4HX 2OFHX 4AQYF 4PCQA 1HI0P 1UA1A 2DNHA 2ZE2A 3VCDA 2FIUA 3AQPA 4A4JA 4QU6A 3OHBA 2QFJA 5F8GA 1KHVA 4C8KA 2XTEA 2LEPA 3MEEA 2GIQA 1B0TA 5DDQC 3R3TA 1S99A 1KEKA 2ZC3A 3OR2B 4PG5A 2R8JA 1YG0A 3IAM9 3DGPA 1U1OA 1RT7A 5E3AA 1F5CA 2QA1A 4W92B 1NZAA 2OP5A 3HDSA 5GADU 2C42A 3Q24A