4NLYA

Poliovirus polymerase - c290e loop mutant
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
458
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGESGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
total genus 140
structure length 458
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nlyA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nlyA02
4ECUA 2ILYA 4U7CA 3RBEA 4QWCA 5J2MB 3KK2A 1LWEA 4PQUB 5KFYA 4LQ9A 3NL0A 1C0UA 4H4MA 3NGDA 1RT3B 3DYAB 3I0RA 5KFZA 3NAIA 2OPQA 4ECRA 5FDLB 2B43A 4ED7A 1TKTA 4RW9B 1UWBA 4URQU 4QWAA 3TAMA 4MKBA 2FJXA 5KFHA 1IKYB 3PHEA 3SI8A 2FVPA 4ECZA 4K4UA 5KT2A 5T14A 4ECSA 4HYKA 3PW4A 4TQRA 1HQUA 4KE5A 2ATLA 2HNYA 4FBUA 4I2PB 1TKXB 4EBEA 3KLHA 4KO0B 4Y34A 4NLPA 1JLEB 1HYSA 3QLHA 1KLMB 3TVKA 1RT2B 3G6XA 3DOLA 1N4LA 4NRTA 1EETA 3QIDA 3NAHA 4RW8A 5C42A 5F8HA 3PW5A 2XCAA 5DLGA 4RW7B 4U6PA 2W8KA 1T03B 4H4OB 4NLTA 1S9GA 1S6QA 3FFIB 4ZP8A 5DG9A 4IG0A 5DLFA 1RYSA 1IKVB 1JIHA 3KLEB 1TL3A 3N6LA 4NLVA 4NYZA 2B6AA 4DG1B 3SFUA 4EEYA 1N48A 2E9RX 5F8JA 2I5JA 3IGVA 2J6TA 1TL1B 4EO8A 1FKOA 4IFYB 5J2QA 4MKAA 4R0EA 1SUQB 3MEDA 4LSLA 3PR5B 3KK3A 3BGRA 3GILA 1NNDA 3I0SA 5CYMA 3KLFA 2UUWA 3D5MA 3BSAA 3DI6B 2VG6A 4KFBB 1RTHB 1TP7A 1LW2B 2AX0A 3KK1A 4DL3A 1S1TA 3EPIA 4WZMA 4ZP7A 2WRMA 3IS9A 1QE1B 5KT4A 2ALZA 3GYNA 5DG8A 2C2RA 4WFXA 3ITHB 4KHMA 2V9WA 3N6MA 3OHBA 3BQ1A 2O5DA 4DL6A 1T94A 3C6TB 3GQCA 3KJVA 3BQ2A 3IG1A 5C5JA 3FRZA 4KB7A 3MR5A 4H4MB 2RF2A 3JSMA 4PWDA 2R2RA 3Q8RB 4ECXA 3I0RB 4ECVA 1RTIB 5J2PA 1RA7A 3QGHA 5KG3A 1YVFA 4F4XA 1LWFA 1SV5A 1UWBB 3HVTA 2IM1A 5KG6A 4RW6A 4IDKA 4MH8A 2BRLA 2YNHB 5JXSA 3CDUA 3JYTA 1TVRA 2XWYA 3KLGB 3DLGB 1TKZA 1HQUB 3IGNA 4RNFA 2HNYB 3LP1B 4I7FB 5KFIA 4NLYA 5I42B 2WTFA 4J9OA 1S1UA 3DLKA 5CYQA 1HMVA 4O44A 1HYSB 3MEEB 3QLHB 3FSIA 2YNGA 3V81A 5L9XA 1EETB 3BR9A 5F9LA 4XPCA 4ED1A 1WNEA 1S97A 3CJ4A 3UPFA 2IBKA 1J5OB 4QWEA 2UVVA 1JLQA 3BSOA 3H5SA 3MTKA 5HP1B 3QO9A 1S9GB 1W25A 1S6QB 3MR2A 4FS2A 4MK9A 4O4RA 1XR7A 5KFMA 3M8PA 3H5XA 2OPPA 3FQLA 2AGPA 3H5YA 2IM3A 2FLPA 3PZPA 2XI2A 4ZHRA 4Q45A 1S1WA 5KFFA 1LW0A 5F8NA 4RW4B 1DTTA 5J2QB 1C0TA 3KK3B 1RT6A 1RT1B 3BGRB 3KLFB 3I0SB 5CYMB 2YNFA 4ZVGA 2IM2A 3QZ8A 4Y2CA 1NHVA 4ECQA 2JEFA 3QIPA 4IR1A 4I2QA 5KG5A 4ED0A 1ZTTA 4HKQA 3N6NA 1HPZB 4K4VA 4ZPDA 3M8QB 1S1TB 1KHVA 3BSCA 3DLEA 3DRSB 3IS9B 4DEZA 4MFBB 3GIMA 1SH3A 1HNVA 5L1KA 1QAJA 2ZE2A 3GIJA 4TN2A 5I3UA 4QW9A 3UQSA 1REVA 2W9CA 1GX5A 3MECB 5D3GA 2VA3A 5KFXA 1LWCA 3GIIA 5DG7A 4G1QA 3CO9A 1RYRA 5KFKA 2HMIB 2IAJB 4M95A 4Q8FA 3CJ3A 4RNOA 3BQ0A 2D41A 4MK7A 3OLBA 1GX6A 3HVWA 5J2NA 2WK4A 4KHRA 4LSNB 1RT7A 2BQ3A 2VG7A 2R8JA 5KT5A 4ZPAA 3V6JA 1JLFB 2HNDB 3LALA 2WONA 3V6KA 4KKOA 4ECTA 3KHGA 3PW7A 3DLKB 1TV6B 2C2DA 3KHHA 2YKNB 3QYYA 4O44B 3Q8SB 2IA6A 1DTQB 4IG3B 1EP4B 2ZD1A 4NLDA 2YNIB 2V4QA 1RAJA 3T5JA 4MK8A 3KK1B 3G6YA 2OPSB 3RB4A 1RDRA 5KFAA 5EWFA 4JV2A 3OSPA 2R2SA 3NBPA 2V4RA 4B3OA 4NLRA 3I5BA 4NZ0A 1HQEA 1BQNA 4WE1B 1N5YB 2YKMA 1JLGA 4JUZA 3T5LA 3VQSA 3BJYA 4IQXA 2XCPA 2XGPA 4K4XA 1S9EA 3LP0A 2R2TA 4J9RA 4RNNA 2J6SA 3G86A 1JLCA 1JLAA 2HWHA 4QWBA 4O3OA 5HROB 2UVUA 1C1CB 4M94A 2AGOA 4ZP9A 3KLVA 2WB4A 3DMJB 4ICLA 5L1IA 3PVXA 4O3RA 4DL5A 2IC3A 2BR0A 5HBMA 5KFWA 4IKAA 3PW2A 1S6PA 3V6HA 5D3GB 3LP2A 2BANA 3OLAA 3EPGA 2VG5B 1HNIA 1BQMA 4QW8A 3T5HA 2OPRA 1RTDA 1CSJA 4O4GA 2GIQA 4ID5B 2HNZA 3QGIA 4WYWA 4J9MA 3DM2B 3V6DB 4J9NA 2UVWA 4Q0BB 4NCGB 4H54A 5K14A 2VG7B 1NHUA 3H40A 4XO0A 3CJ0A 4XPEA 3RAQA 1S1XA 3KK2B 1MMLA 1LWEB 4GC6A 2WONB 4YQWA 4TY8A 3M9NB 1C0UB 1RT4A 1RT5A 3DRRA 2F8EX 2I1RA 2OPQB 3T19A 2WOMA 3IN5A 3DOKA 1TKTB 2D3UA 2W9BA 3CJ2A 4DL4A 3TAMB 2ILZA 3SFGA 4EO6A 5HLFA 3RAXA 5C24A 2R2UA 4IRCA 5J1EA 1S1VA 4EYHB 4KV8A 4ZPCA 2R8HA 4TLRA 4J9QA 4ECYA 2IMWP 5EWEA 3KLHB 2RKIA 3C6UA 3RB3A 4K4WA 2BRKA 3LANA 1KHWA 1C1BA 1RTJA 1MU2A 4RUCA 3NBPB 2B5JA 1JKHA 1IKXA 4IH6A 2DPJA 3DOLB 2FLNA 3MR6A 3MFIA 4Q8EA 1BQNB 1FKPA 2YKMB 1JLGB 3KLIA 3CVKA 4RW8B 5C42B 5KFPA 3OHAA 1N6QA 4K4SA 4IRDA 3LP0B 2FVSA 1R0AA 2JEGA 3E01A 3G6VA 3E51A 4IG0B 4F50A 2BE2A 4ED6A 4TYBA 5DQGA 3CIZA 2C22A 1TL3B 2B6AB 5J2MA 4RNHA 4WXWA 4PQUA 4JV0A 4ICLB 2I5JB 4O3SA 2CJQA 1FKOB 5KFEA 4NLQA 3CDEA 3DYAA 3MEDB 4LSLB 3DRPA 2BANB 3FQKA 1IKYA 3PJXA 2VG6B 5F8MA 2C2EA 4IR9A 4DL7A 4KBIA 4WXOA 2OPRB 1RTDB 2R8GA 1VRUA 3UDLA 4I2PA 1TKXA 2W8LA 4KO0A 3NMAA 4ED8A 2AGQA 4PUOA 1JLEA 5KFRA 4TY9A 2JEJA 5F9NA 3KJVB 3IG1B 4Q44A 2AWZA 2GC8A 4RU9A 3M9MB 2RF2B 3JSMB 1S48A 4IH7A 4KSEB 4PWDB 4H4OA 1K1SA 5J2PB 2E9ZA 1LWFB 1SV5B 3HVTB 3M9OB 1T3NA 4RW6B 4IDKB 1DLOA 3KLEA 3MFHA 4URSA 4DG1A 1S4FA 2WHOA 3LAKA 4KV8B 1TL1A 3KMSA 1TVRB 2QV6A 1TKZB 4IFYA 5EDWA 3JYTB 4JV1A 1SUQA 5KFLA 4ZPBA 1RA6A 5KT6A 4ED2A 3QGGA 2OH2A 2RKIB 2GIRA 1S1UB 5CYQB 1HMVB 4YP3A 2ASJA 4FBTA 1MU2B 5KFDA 2W7OA 3HVAA 2YNGB 3DI6A 3V81B 4KFBA 1FKPB 4YR0A 1RTHA 4O3NA 5KFUA 1QAIA 1JLQB 1QE1A 4NLWA 3KHRA 4WYLA 3ITHA 3QO9B 4FS1A 4QPXA 5L1LA 1I6JA 4TQSA 2BE2B 2RDJA 3M8PB 4R5PA 1SH0A 3C6TA 2OPPB 2XGQA 4WFYA 3T1AA 2JEIA 4IOBA 2XC9A 4ZHRB 1XR6A 1S1WB 2RDIA 3MR3A 1LW0B 4MIBA 4MIAA 1QUVA 1DTTB 5KFGA 1C0TB 1RTIA 1RT6B 2AX1A 2VA2A 2DPIA 2YNFB 3DRPB 4NLXA 1D1UA 4G3IA 4NRUA 4K4ZA 5KG0A 2J6UA 1OS5A 2YNHA 3I5CA 3QIPB 4I2QB 1VRTA 1Z4UA 3QZ7A 5KG2A 2UUTA 4K50A 3KLGA 3DLGA 5DGAA 2AQ4A 1VRUB 3DLEB 5F8LA 3LP1A 4I7FA 3KMQA 4O3QA 4WZQA 5I42A 2FJWA 1HNVB 4YMEA 2JLEA 4YR3A 2ZE2B 4LQ3A 3KHLA 5I3UB 4PUOB 3MEEA 1REVB 2W9CB 3CDWA 4Y3CA 1LWCB 4Y2AA 4G1QB 2R8IA 1J5OA 1S9FA 2XI3A 3ICLA 4KAIA 4IRKA 5C25A 5L1JA 5J2NB 5HP1A 3GIKA 1JLBA 1RT7B 4QWDA 3CJ5A 3MEGA 3EZUA 2FVQA 2WCXA 1DLOB 5KFTA 1D0EA 2W9AA 4K4YA 1FK9A 3BREA 2D3ZA 5KFOA 2JC1A 3GV5B 4RW4A 3KNAA 5KFQA 4KKOB 1RT1A 2ZKUA 4NLGA 3DDKA 2CKWA 3UR0A 4X2BA 5KFVA 2V0NA 3H2LA 4J9SA 4IFVA 5JUMA 5KG4A 4J9LA 3OL9A 3PR4A 5KG7A 2ZD1B 1HPZA 1T05A 3M8QA 4EBDA 3DRSA 1SH2A 4WFZA 4EYIB 3RB0A 4MFBA 5DQHA 3NKYA 4K4TA 4URGA 3GV7B 5F8GA 5KFNA 4ZVEA 4Q43A 3V4IA 4R8UA 3MECA 2AU0A 1S0MA 1IKWA 1S0OA 4R5PB 2IM0A 4J9KA 4IH5A 1HARA 4B3OB 2HMIA 2IAJA 1C2PA 1HQEB 3OL7A 2HWIA 3H98A 2FVCA 3IRXA 5DQIA 3KOAA 2BQRA 2UVRA 1S9EB 3OSNA 4LSNA 4ZVFA 1JLCB 1JLAB 2IJFA 5KT3A 5F8IA 2W7PA 1VRTB 3T5KA 1JLFA 2HNDA 5EUHA 4J9PA 3TQ1A 3RB6A 3BSNA 2IC3B 1RT3A 3Q8QB 1TV6A 5HBMB 3GV8B 3HHKA 3PW0A 2YKNA 5FDLA 2QE5A 1S6PB 4RW9A 1DTQA 3LP2B 5KFCA 4IG3A 3D28A 4F4WA 4ED3A 1EP4A 4OL8A 4NLUA 2EC0A 1BQMB 1HNIB 1K1QA 1U09A 2YNIA 5KT7A 4GC7A 4TXSA 2E9TA 1N56A 4O4GB 3I5AA 2HNZB 5C25B 3LAMA 2OPSA 3Q8PB 1JLBB 1XR5A 4ZVHA 5K14B 5KFSA 3MEGB 4O3PA 1JXLA 1KLMA 1RT2A 3OL6A 2FVRA 1S10A 4YR2A 1FK9B 1S1XB 4WE1A 1N5YA 2FLLA 1ZETA 3HKWA 4TY8B 3OL8A 3FDSA 2JC0A 1RT4B 1RT5B 3DRRB 4TYAA 5KFJA 2HAIA 1IM4A 3PJWA 4RW7A 3H4BA 4NLSA 1ZTWA 1T03A 2WOMB 2IJNA 3FFIA 3MF5A 4ZMMA 3DOKB 4RZRA 5HROA 2W9BB 2C28A 1IKVA 4IFVB 5HLFB 1C1CA 1JX4A 2FJVA 5C24B 4NLOA 3ISNC 5J1EB 1S1VB 2ASLA 1T05B 3DMJA 4DL2A 1TQLA 3C6UB 3V4IB 3H59A 3ISND 4R8UB 2R8KA 1C1BB 1IKWB 1RTJB 5KG1A 5EWGA 4ECWA 2B5JB 1JKHB 1IKXB 1S49A 5DGBA 4RUAA 3H4DA 2VG5A 4EBCA 2BQUA 4RNMA 3CWJA 2ASDA 1LW2A 3KLIB 1N6QB 4F4YA 3IRXB 3H5UA 4ID5A 4Q0BA 3V6DA 3DM2A 5KFBA 4NCGA 3RBDA 4F4ZA 4ZP6A 1S0NA 1R0AB 2D7SA 3E01B
chains in the Genus database with same CATH superfamily
1N34F 3ZZZA 5ETQA 4BCAA 3M2UB 5RUBA 1OJ4A 4BLGA 1V9OA 2Q6BA 1IBKF 2QA2A 2YY3A 4EBEA 1ZYQA 5D4NA 1HYSA 3CCSS 5ADZA 2VL1A 4LRAA 3NS5A 5DLGA 3LGHA 2XMVA 1SCJB 1TL3A 1U0HA 3I4PA 5F8JA 5ETKA 2XEXA 3KK3A 2FZCB 3I0SA 3W5ZA 2IA0A 1ZM9A 4Y28C 5GVQA 4KFBB 1TP7A 1QM9A 3Q22A 3A12A 1LWXA 1R31A 2D68A 2HVIA 2V68A 3HFVA 1SV5A 4M5NA 2MY7A 4DX7A 1LFPA 3BN7A 4YY3F 2EPIA 1W25A 2OD6A 4WTYA 3MR2A 2XBPA 1KN6A 3M8PA 2FLOA 3H8YA 1NPRA 4RW4B 3Q83A 3KLFB 2YNFA 3IMQJ 5K8OA 3KK1B 4MFBB 5L1KA 1M1KT 1I51B 1T0TV 2W9CA 3KKFA 4F04B 2X1AA 1HWJA 1JNZB 3VWSA 2ZH7A 2ATLA 1S79A 3ISZA 3CCES 4ITSA 1BLUA 5HATA 3O8WA 2MJUA 2YWEA 2M5YA 4DV3J 1WC1A 3IXQA 3WBZA 3CCWA 1R7IA 2OFGX 1DBDA 1DQ9A 3H20A 1RDRA 1M5PC 4P71A 1AZSB 3J81U 4OZ5A 2R2SA 2PA3A 4FF3A 1BQNA 1R8HA 1YLXA 2XGPA 2G2OA 3G86A 2C2OB 1R0CB 2GGPB 1K9MT 2QA4G 5SUHA 2C3PA 2DYAA 4ZCLA 2AGOA 1WC4A 2XS7A 1YJUA 2R7SA 2E5JA 5L46A 2NUUG 4LF8F 4NCAA 1WEZA 2MQLA 2UVWA 1XMQJ 2XMWA 1FE4A 4TY8A 2OPQB 2QEXS 2DHAA 2WVEA 3TAMB 5D8HB 4DR1J 2M3DA 1S59A 3RZAA 3C6UA 3EE3A 2W25A 2UV8G 5GAHI 3NBPB 2DPJA 4LFBF 3JTOA 4IRDA 1VI7A 2FVSA 5DQGA 2VFRA 4TLQA 2BJ3A 3DU6A 4YB7A 4MT1A 2MLYA 2MQQA 4M63A 2OPRB 3EGVA 2R8GA 1PJ5A 5B0CA 2NLWA 4KGZB 1JLEA 3J7YU 2M8DB 2CPZA 2HLUA 4IOAQ 4LBIA 3VAJA 4N56A 5LSRA 2BKOA 1JMTA 4HDHA 2V8GA 1TK5A 1PBUA 3WX8A 3LWMA 2KYZA 1WACA 3P49B 4HVZA 2YXLA 2D69A 3TWZA 4DPOA 4C98A 1VBXA 4DV0F 2OPPB 2RIJA 3O2IA 3FCWA 4CH7A 5M2RA 1AUSL 5KFGA 3HHNB 5A8KA 4LMZA 2QLJB 1B0TA 5LJ3Y 1X9SA 4I7FA 4DFKA 1D8ZA 3MMAB 1FX4A 2A3JA 2KFYA 2ZM6F 4C4WA 4GKJJ 4DV2F 2WCXA 2QA4S 2W4PA 3FEYB 3AX5A 5B08A 5C2GA 2KJWA 1KTVA 4WFNQ 2G9OA 3M8QA 3HO1A 3MAAB 3NCPA 2K3KA 3CW2C 2LECA 2Y3YA 3OL7A 1T9UA 4O23A 4ZVFA 1MN7A 1WG5A 4C8YA 2DNMA 1TV6A 1RAOA 4O0IA 3ZXWA 3PX6A 2V50A 2QL7B 3THTA 3MMCB 2YQ1A 3PM9A 4JOUA 1XR5A 2FLLA 1ZETA 2RQMA 1ZZFA 5HROA 1IKVA 4NLOA 3LA0A 4DL2A 3KUHA 1VC5A 3KDNA 1S49A 3G4SS 4JI2F 3A3NB 4QWCA 1VDHA 3F41A 1Q78A 2F65A 1B64A 3QJJA 3ET6B 4PPZA 4CH0S 4I2PB 1U47A 3ADAC 4JI1F 4MYUA 2F4VF 3HFZB 4OI6A 3MM7A 1HD0A 4RW7B 1HI0P 1TL5A 4USIA 4IG0A 1HBOA 4DG1B 5IS2A 3CCRS 3HT3A 3FZBA 5D0HA 3D0GE 3DI6B 2QIFA 2OHDA 4MIWA 3IS9A 2ALZA 5CA5A 2AZ3A 2PMZD 2IPOB 3HSJA 2V67A 3CJSA 2ASYA 2DTJA 1S4EA 1VIOA 3Q8RB 4ECVA 3ZZOA 1KS2A 2OFHX 3I96A 2R8KA 2WTFA 4O44A 2XG8A 3OUYA 1WNEA 3QBCA 4OYAA 4CLLA 2ZNZA 5J2QB 2G1DA 1RT6A 1Q82T 2BZ2A 2MQOA 1MW7A 5KG5A 3THPA 4ZPDA 1FNMA 4A8SA 1GX5A 3JQMA 5DG7A 2JHEA 1RYRA 2ZH9A 3WHIA 4Q8FA 1BD6A 4USWA 2W2PP 3MD1A 3OLBA 3HVWA 1BHNA 2Y8YA 3GSDA 3GIRA 3V6JA 2Y1JA 2KN4A 1X60A 4QOTA 3G9CA 2V6AA 3BS9A 4J9VA 1VJWA 1H3DA 3R5AA 2BE9B 2UVUA 3AJ1A 1GH8A 5L1IA 3GB0A 4DL5A 5IV4A 1ZOTA 2EK6A 1IXKA 3H2VE 1TL7B 5B09A 4Q0BB 2HNZA 3QGIA 2ERRA 4N8NA 2BBEA 1MMLA 3MDFA 3TX8A 3G6ES 4GRSA 2HIQA 2LU1A 1ZZNA 3TP2A 1YJWS 2CJ9A 3SFGA 2QFIA 4YDXA 2R8HA 4J9QA 2X7IA 5EWEA 3M1VA 2QYGA 2HRYA 1HNZJ 2FLNA 1JLGB 1V5IB 2RS8A 4ILLA 1HBMB 3LPYA 4XDCA 1U4BA 4RNHA 4PQUA 3EM1A 3FJ2A 2IMOA 3ZTSA 1GEHA 4KHPJ 1ZAXA 4DV3F 2BANB 4UQGA 3OVAA 2BKPA 1L3KA 3NMAA 3TZXA 2HVDA 4TY9A 2YQ3A 3KJVB 3NGKA 2AWZA 4U8VA 3CD7A 3QT6A 1H98A 1NH7A 2PE8A 1T3NA 1DLOA 1YGYA 4RBTA 4NEYA 2IRYA 2W7OA 4JI4J 4O3NA 3QO9B 1ACMB 1SH0A 1XMQF 1CLFA 1LW0B 2V2KA 1DTTB 2N7CA 2GVZB 4DR4J 2CVIA 2UZAA 3Q8YA 1TAQA 4DR1F 4K50A 3KLGA 3HHLB 1UW4A 4MAKA 3NRBA 1GMUA 3RJMB 4Y3CA 2HS0A 2H5IB 1HKAA 5D0RA 1IN0A 4ZVPB 1PYSB 2DHSA 1CQMA 1BC6A 4OZJA 4QIVA 1SL0A 2Q1LA 2D3ZA 1WG1A 2WSFC 4WP3A 3DHWC 4NLGA 4X2BA 2F7VA 3BGLA 2VQEJ 4IFVA 5CH7B 4EBDA 1SH2A 3GSIA 3UVJA 1YKWA 3OBIA 3OXLA 1H38A 2J0XA 1F9EB 5HVFA 2IVFB 1X5PA 2IJFA 1T9XA 1WKJA 2DNPA 1JLFA 4LRFA 1RAHB 4QIEA 1FF2A 1X4BA 4YOEA 2UUBJ 2NCKL 3FC9A 1KP6A 4IG3A 4F4WA 1H73A 2FIUA 1AYEA 3OV7A 2LQ5A 1M5SA 2DRAA 4I68A 6AT1B 2ALYB 5ETTA 2RSQA 2ZBPA 2KL8A 3FFIA 1M0SA 5EGYA 2E7XA 3NNAA 3H7HB 5HLFB 4UZCA 3AH6A 4UOGA 3GJSB 4NPOA 2EFPA 2CNNB 2ASDA 4EFAC 4GKJF 3DM2A 4NCGA 3IBWA 2LA4A 1A9NB 1NSAA 6FD1A 4A8FA 3NS7B 3VHQA 3HPOA 1VQMS 1TKTA 3I56S 3SI8A 4Z2XA 4FYDA 1HHTP 1RLCL 1EQMA 2L08A 4NLPA 4DPUA 2FPHX 3S6EA 1KVKA 5K9FA 2XCAA 3JXOA 2OTLS 3J81j 1VQ6S 3KLEB 1KDNA 2B6AA 1FKOA 3TJAA 2V2VA 3R5DA 1YBUA 2G0IA 4K5SA 2DNYA 1X8DA 4ZIWA 5A2QU 1S1TA 4CLYA 3KTQA 2VQFJ 4IO9Q 3UO0A 1V3RA 1JXEA 4RBVA 3FRZA 3ZZUA 2EWHA 2N7YA 3FEZA 2GIFA 4ECXA 1NPKA 1L3UA 2PA8D 1LK7A 2ATCB 2YX7A 1U02A 2Z0GA 2RU3A 5LM7E 3ETOA 3UCGA 1HMVA 1WSVA 1HYSB 2V4JB 2F8MA 5A8RB 1QSYA 1J5OB 3H5SA 1QDUB 4O4RA 2CG4A 3PZPA 4ZHRA 3K5PA 3KK3B 1RT1B 1OSCA 3I0SB 4KJIA 2HGNA 3D6FB 1XIQA 2JNJA 3QIPA 4QJVA 3CCJS 3HP6A 4HKQA 3N6NA 1IR1A 1ZBTA 5BYSA 3UD4P 3UQSA 4DSLA 3IWNC 1KR4A 1LWCA 2E7WA 5DZ7A 4FKXA 4RNOA 1S5ZA 2WK4A 4KHRA 3VF0B 2XO6A 3QAEA 4BDPA 4OHWA 2ZZNA 1BWVA 5DDQC 4X4QA 2L41A 3HJVA 4UQTA 2V4RA 4NZ0A 1UFWA 1F6TA 1WJ9A 2CQCA 2HWHA 4DUZF 1VQ7S 1I3OB 3LGNA 4AFFA 5E33A 2BR0A 2FC8A 4PG7A 4MMOA 2HKEA 1OO0B 2VG5B 4HTIA 4W90B 2IYGA 1PAUB 4XO0A 1XMBA 3AQOA 1LWEB 3W64A 1RT5A 1QSSA 2CG8A 3B54A 1QAXA 4USMA 4LSZB 4IRCA 1Y11A 3IO1A 4TLRA 4HH1A 1UL3A 1BQNB 3V2UC 2DGOA 1XC9A 4CO0A 1NK8A 3D6TB 1E6YA 5DDRC 3M6UA 2U1AA 1YDLA 2NXJA 3PJXA 1VQ9S 2ZH2A 4V19X 2I9SA 2A6OA 1RJJA 1OQ3A 3MGJA 1L3VA 1VQLS 2CDQA 3J81Y 1HBUA 1SC4B 5F9NA 3IG1B 1YX2A 2ZVIA 3IA0A 4JI3J 2RF2B 4IH7A 5IZHA 2P6TA 4JB8B 1WTBA 2HQDA 1K1SA 5J2PB 3UDCA 5CYQB 1U45A 4LF7F 3V81B 1W26A 3TQEA 3IR6B 1SJ1A 2A1BA 1FRHA 4QPXA 4P2XA 3CCZA 1FRKA 4F2RA 1NSKL 3PRDA 3MM5B 1RTIA 2GA7A 3D68A 2B7BB 1WSRA 2R9LA 4NRUA 1QAYA 1K8AT 2YNHA 4RUHA 2FDNA 3DLGA 1TUWA 1D9DA 3GYGA 2G13A 2L9WA 1HNZF 1ZA1B 4G1QB 1X9MA 2MKIA 4NZ7A 3K57A 2R4FA 4KHPF 1Q8KA 2Q79A 3H2LA 1U0SA 3T1HF 2VIHA 1YWXA 3SCIE 1M5OC 2XMMA 1CPZA 2RU9A 2D1CA 1JLAB 2EXUA 1FXRA 3IAS9 2AYBA 1YJ9S 2ZH8A 3VTIA 1NXIA 1U09A 2CPDA 2HW3A 3SYZA 3W65A 1ICEB 5KFSA 4F02A 4O3PA 5K8MA 1S10A 1SL1A 5IOLA 2B9WA 4NA2A 5D78A 4ZITA 2MDAA 3DDIA 1RT4B 4ETZA 1ZTWA 3MF5A 1KONA 4F0KA 2EW9A 4OZ2A 3SSSA 5C24B 4Y00A 2RVJA 5GAHU 2PMWA 4RKUC 1NK0A 4IUFA 1OY8A 1W2IA 1G2EA 5T7LB 4F4YA 1RU2A 5GADI 3W7BA 3V6DA 1PILA 1R0AB 2ILYA 4U7CA 2HHXA 4H4MA 4OJGA 3TZWA 2VBYA 2BX6A 3OD2A 4PXEA 1Q8LA 2VQEF 2DHHA 1H2UX 5D15A 4C2MA 4ALZA 4I6AA 3KJFB 3NG8A 3QLHA 3UE2A 5F8HA 2BKNA 3PCOB 1S9GA 2BDPA 3ONQA 3MURP 5DLFA 1IKVB 4B9NA 4D3HA 4NYZA 4NLVA 2HVEA 2ZJPQ 3OFEA 2E9RX 3IM9A 3IAM9 2JZ5A 2F9JA 4MKAA 4CLUA 2UUBF 3D5MA 1GFWB 3DGPB 1QE1B 1F3VA 3E8OA 3BBCA 3ITHB 4WFAQ 1MN9A 2GNKA 1HBNA 2YPZA 2KJVA 1XBWA 3SCKE 1YVFA 1GTEA 1QSLA 3OQ2A 2LEAA 1AFIA 4NLYA 4JI8F 1P8GA 3Q89A 3PACA 5L9XA 5HP1B 3DLLQ 2OKQA 2CZ9A 3FVYA 1HBOB 2ZJQQ 2BJ7A 2YWKA 2DBBA 4AL6A 1U8SA 3IS9B 2XTCA 2BV3A 4ZVQB 2VKZG 1YJ7A 1U1RA 3GIIA 3CCTA 4JI7J 3CJ3A 1ULRA 3GR0A 3T1YJ 2KHDA 4DV7J 1WEXA 1U49A 3KJQB 1SJQA 1H2TZ 2HNDB 3Q24A 2D9OA 4QR2A 2YKNB 4O44B 3Q8SB 3ZZTA 1CJTA 2GVDA 2DJWA 2YNIB 4KGMA 3D1OA 3OR1A 4RO0A 2VQFF 5EWFA 3NOCA 2YX1A 3AT1B 1RP5A 4DR2J 1F60B 3A8EA 2RHQB 3U27A 2APOA 1MMDA 4NA1A 2D74B 5IXUA 1U8WA 2CPHA 3T5HA 1NK5A 4WYWA 2ZC3A 1VC0A 4X84A 4DQRA 3N5FA 4WKRA 1FXLA 5EX3A 2CJXB 2G1HA 2E5GA 2GX8A 4C8ZA 1C0UB 2C2NA 1X9WA 4DL4A 2JX2A 4ZJQA 2XSJA 1S1VA 3M2RA 1A6LA 2F8HA 1F9FA 1I5OB 1YQHA 2AT1B 4Q8EA 2KI2A 3QRRA 3WIUA 3CVKA 3I32A 1W7WA 3EDQB 3CMAS 1T9WA 3PIOQ 5J2MA 2CADA 4LSLB 1RWKB 5K8NA 3FZ2A 2HHWA 6FDRA 2XZDB 1QJHA 1MROA 3HCXA 3IM8A 2VICA 3R6GB 3U1NA 4KO0A 4ED8A 2AGQA 4FPRA 2HURA 3MUMP 1T9YA 1X4CA 2DH7A 2MKKA 4M5LA 3P45B 2E9ZA 3HVTB 4HACB 4URSA 5K8PA 4NL5A 5LXRA 2EFQA 4LJMA 4QIWD 1MNEA 1TFYA 1CC7A 4FYVB 4QZVB 1TUVA 4UF4A 1KC8T 2KB2A 3L7OA 3R5JB 2JEIA 2HQ3A 1B7FA 4NLXA 3FEXB 1YTYA 3QZ7A 1Q8BA 1VRTA 4NE9C 1FI4A 2DR7A 3W66A 2YH1A 2K06A 1T9TA 1REVB 3ENVA 5AXLA 3MM9A 1EX8A 1FA0A 1OWXA 1JLBA 2UP1A 1DLOB 2D3OR 1D0EA 1EQ0A 3M8RA 2V8DA 1EHWA 2GZOA 2K1RB 2I0XA 2KM8C 3OL9A 2ZD1B 3ZTPA 1CC8A 4USUA 2HZCA 1RCXB 2RQKA 2AJ2A 1FKAF 2BW7A 2IVMA 3IR5B 4J5OA 2IFXA 2FZGB 4JI3F 3JTPA 3AHPA 1CS4B 5G4DA 3CJKA 2MXYA 2HS3A 2XY5A 4YHHJ 2C1EB 3RR7A 4LF9F 3GYXB 3Q8QB 1N5TA 2QE5A 1DTQA 3BKFA 2KTQA 4ED3A 1EP4A 4NLUA 2HK3A 2LQ8A 2CJBA 2HHPA 4WP9A 3LUYA 3VVUA 2CQPA 2L9DA 2ZDPA 3OL8A 4TYAA 4NLSA 5IWAJ 4ZA1A 3W3SA 3W60A 4IFVB 4DUTA 4J90A 2LP4A 2W2MP 2ZHOA 3D1QA 4AE5A 1D8YA 3GMGA 2MHEA 4P74A 4FZVA 2BQUA 4RNMA 1N6QB 2JSXA 3H5UA 1IR0A 2B4UA 5HMZA 3DU5A 3HFKA 2VC1A 4LQ9A 5D6GA 2MZSA 2RE1A 2LMIA 4URQU 2LEPA 2FJXA 4K4UA 1SVDA 4CYUB 2MLZA 2FUG9 1AT1B 2DK2A 2ZH1A 4RW8A 4OV1A 4V19J 3D1HA 2E5HA 3FFIB 5A0YA 5DG9A 4ZJLA 4DLGA 1RHUB 3BEGB 1N48A 3H90A 3PIPQ 4ELVA 4USJC 3VCDA 5A6WA 5E3RA 5IM0A 3VGVA 5DG8A 3MCNA 1WI6A 3DN9A 1MWQA 3R5BA 3JSMA 2R2RA 3HMJG 3BB5A 4IDKA 2YWHA 3SDEA 4RX6A 3LP1B 1UETA 3DLKA 3MEEB 2YNGA 5L38A 4ED1A 3A3PB 1JLQA 1VHFA 1N52B 1SC3B 2B8PA 1K44A 2AGPA 3QT8A 3N4WA 4ID8A 4P9SA 2CNKB 1HPZB 2QLFB 1S1TB 1KHVA 1HNVA 4PYAA 2IJRA 2HMIB 3P96A 3EXCX 4B3RJ 2D41A 4MK7A 5J2NA 1OQ6A 1VMBA 2ACMA 2WONA 2CQGA 4CP5A 4DQSA 2CA9A 1X4HA 5A2QY 4OV6A 2QL5B 2Y0BB 2VJUA 2N4DA 2CJKA 4OJ1A 3QSIA 3P8BB 2W7AA 4NA3A 4JUZA 1JLCA 3O3LA 2ZOGA 4O3OA 1HR0J 2BVZA 1KTQA 3V5RA 2RUGA 4MYTA 4X66J 3AJ2A 3TZYA 5E3CA 4UTGA 1HNIA 1PYTA 4ID5B 4ANCA 3C15B 5K14A 2GQ2A 2WOMA 3HX9A 3DOKA 3FBCA 3Q86A 3HJFA 1N5VA 2L48A 4KV8A 1VQ5S 3TA1A 3KLHB 2J9DA 1C1BA 4FYYB 1T8EA 1IKXA 3MFIA 1NK4A 5HI7A 3MM6B 4B02A 3O6QA 3E01A 3ZC4A 4DV7F 4TYBA 4WXWA 2OIHA 2XLKA 2I5JB 4O3SA 2FHJD 1GMVA 3G71S 3TOQA 4P52A 3WZ0A 2ZH6A 4CH1A 2DHXA 3TARA 1OY9A 1RWVB 5JJBA 5KFDA 4HDGA 4LF4F 4KFBA 1WOOA 1R8CA 1WC3A 2HSEB 4ELUA 5DDPC 4FKYA 1TMJA 2M88A 1E6YB 2XS2A 4HTJA 4ZDNA 1N33J 3RRGA 1WI8A 3O44A 4M95A 3TYTA 1U2RA 2H4WB 2CPIA 2VPZB 3HM9A 4Y2AA 4P10A 3F56A 4IRKA 1Q16B 2W9AA 1GTHA 4RW4A 1UJ6A 1KVJA 4F3OA 3R2DJ 3W2VB 3TUPA 5KG7A 1TL4A 1YJTA 4MFBA 4CDIA 4URGA 4DR5F 3L3CA 4ZVEA 1S0OA 4B3OB 2NQPA 4ENOA 2DNZA 4WPAA 4FXDA 2CQDA 2AIRB 3J80U 5HQ8A 2VD3A 3EMTA 3PW0A 2E1PA 1S6PB 3MOZA 4XIUA 3HLUA 1RGVA 1I94J 3Q8PB 1AZSA 3EXYA 1VCTA 4PXDA 3FDSA 2JLGA 4DR6F 4FVCA 1IBCB 1R0BG 1T03A 2GGPA 2HFNA 1SIWB 3ISNC 4QPTA 5HK4A 2QMUB 1N5SA 5DM7Q 1RTJB 1KQFB 3AD9C 5D77A 2D7SA 2B7CB 4KYZA 3AOCA 2HFOA 1UEVA 2X51A 3W5XA 3CULA 4UUWA 2XQCA 3NL0A 4E8UA 2OPQA 1UWBA 3M8ZA 3TAMA 4ECZA 4M5DB 3DXBA 4F4KA 3AA8A 2WVBA 4KY3A 2UUAJ 4GKKF 2CQ4A 4DLEA 4NASA 4U6PA 2J0SD 2OSRA 3VGSA 1S6QA 2MZJA 4HH0A 4YHHF 4EEYA 3IGVA 2VPWB 2KXHA 1I6JA 1UJ5A 1FWPA 3BGOP 3TAQA 1MWZA 2VV5A 2MYFA 3QJLA 4WFXA 4KHMA 1EIYB 1Q7LB 4H4MB 2YKPA 5KG3A 5IWAF 2G4BA 1JB0C 3PO5A 4OYWA 5GMKa 3QLHB 1VQ4S 2DIUA 2GMJA 2VFSA 2P5VA 4MJKA 2PO4A 2DR5A 1S9GB 2Q3PA 4FS2A 2AJ0A 4F8RA 2AP6A 2OPPA 4ZVGA 1FRJA 2KDOA 4Y2CA 4ZKAA 3BYRA 1WEYA 1QAJA 2AJ1A 3MMAA 1FDBA 3V4MA 4QW9A 2QMXA 2J0WA 5KFXA 5I3PA 1C4CA 1NB2A 4HI1A 5KTQA 1YI2S 2OUGA 2ZVSA 3V6KA 5MLCV 2E5LJ 2IA6A 2PD1A 1CJUA 1VQKS 3QT5A 3SMZA 3MAAA 2OPSB 2XSFA 3I5BA 1RHJB 2OJ3A 5E41A 2BA9A 2FHMA 2R2TA 5E5NA 4ZLJA 3VGTA 4QWBA 4CLSA 3PX0A 3UN3A 1V5VA 4F7VA 1HNXJ 2VFVA 4V1Ak 1Q86T 2V5HG 3G8TA 5GADU 3MMCA 3BZQA 2GIQA 4J9MA 4N7TA 4K8RA 2PFDA 2ZH4A 4XPEA 1N34J 4CLKA 4KGXB 3DHXA 4EO6A 1CJTB 2VODA 1RHKB 2RH3A 3S7RA 2XTDA 2OD4A 1MU2A 1TTHB 1RBLA 3OHAA 2VBWA 4B3RF 1N32J 2PDAA 2DRDA 1PBAA 2BE2A 3CIZA 2N4CA 1PJ7A 3PDNA 2HQGA 3HHDA 4CLFA 2VG6B 3ET6A 5CABA 3D7SB 4I2PA 3AQPA 3PX4A 5KFRA 2V1TA 4KIAA 2XZWA 3GPAA 2MKHA 3K8WA 3UCUP 1HR0F 4DG1A 2C3MA 3ELHA 2P9EA 1WHVA 2IBOA 4ED2A 5KT6A 5L9NA 2GIRA 1RB0A 4X66F 3MPYA 4FBTA 3DI6A 5B0AA 5B0FA 3W5YA 3NNCA 5DM6Q 3MHYA 4WYLA 3B4DA 1WWHA 1AB8A 3K5MA 2C3UA 4LFAF 3TEHB 2VBZA 2EI5A 2XNQA 4EWTA 3W62A 1BMQB 3TUJC 1MROB 1YZ7A 2JLEA 4A8OA 4PG5A 2HS4A 4LVNP 4HHHA 1RT7B 3BH7B 3UD5A 3TUIC 5CZXA 3J7ZT 1KSPA 4DCOB 4DZDA 5A8WB 5FD1A 2BW2A 3UR0A 2CKWA 4C3LA 2LXUA 3CE8A 1ROFA 4OX8A 3RB0A 1WUUA 1BE4A 4R8UA 1HARA 1NEEA 4HEA9 1U1QA 4N76A 3MPWA 3B6BA 1GQEA 2PEHA 5IQQA 3PEHA 1VRTB 1YSJA 3UWTA 4N5SA 4LF6J 2G0JA 1NKBA 3HHKA 1RZMA 2NSCA 3VAGA 1A0OB 3HSZA 2Z4PA 2QGFB 1JLBB 1NKEA 2JC0A 1DURA 3H4BA 3DRRB 1P1TA 1REGX 1OY6A 4WIIA 5ETLA 1S57A 1WC6A 4USKA 4DDFA 3D2WA 1XQIA 2Z8QA 3KLIB 4Q0BA 3P5TL 2ZBCA 4OYXA 4UT4A 3C19A 1ZA2B 4KQZA 4QCLA 1U26A 3FKBA 2COLA 2O1PA 3GFHA 1SJRA 4OHYA 3TVKA 4X4VA 1WORA 5BR8F 1RK8A 3QIDA 2AF6A 2NXNA 1D09B 2AV5A 4EMDA 4DMZA 3FSYA 4OHVA 1TL1B 2GQCA 1SQGA 3NS6A 4ZP7A 1I94F 3N6MA 4CTAB 3KJVA 3JAMU 3LPEA 2IM1A 2UXDJ 3P6YC 3VR1A 5IFMA 3HF5A 3M7VA 5I42B 3DDNA 2ZM6J 4QYZJ 7FDRA 4DU7A 4DV2J 2UU9J 2HWTA 2DT9A 3QO9A 4AYBD 2C3OA 5A0YB 5IT9U 2BE7D 4QIFA 2XI2A 2MQMA 2XLIA 1LW0A 1DTTA 4ZLPA 2GVZA 3DKDA 4DFPA 3O1LA 3HHLA 3PYGA 2BJEA 4NXMJ 1OM2A 3BV8A 2UUAF 4LREA 3TRGA 1KQKA 2QSFA 1S12A 2HRTA 4OI0A 2K8GA 2R8JA 3J7A1 3AA9A 5CHCB 2UUCJ 1RWPB 5KT5A 3GG0A 3SDEB 2OSQA 1PJ6A 4QU7A 3DLKB 4OLPA 4ANEA 1VBYA 3C66A 2YPYA 1BQXA 3GJQB 4JV2A 2PN6A 4WE1B 1UW9A 1N5YB 2I38A 3HT0A 4OI2A 1XNRF 5CD4H 2IHR1 1C1CB 2QLBB 3BN4A 2LQJA 2HK2A 4N8OA 1FJGJ 4C6AA 5ETRA 1M5VC 2UXCJ 1K73T 2JFKA 3EGNA 1FXDA 2O3DA 1B7YB 3CJ0A 3MMBB 2VJVA 2WONB 3IP0A 4CWBA 3A8JA 3IFEA 3FBFA 4RPFA 4IO1A 4M5KA 5HLFA 4CO3A 3RAXA 1FDAA 2PSZA 3OTEA 4ECYA 3CD6S 3IWXA 2FJAB 3DLBA 3E51A 1TELA 1BGXT 2MGZB 2OELA 1S7IA 1X7VA 5ETSA 2MZTA 5HQMA 3MEDB 1KBRA 2LYVA 2E5LF 3C16B 4KBIA 4HT7A 1S7HA 3C14B 1D3WA 4U9RA 1LNQA 4M5HA 2R3VA 4DV1F 3M9MB 4DJBA 1S48A 2OEMA 3KLEA 2K7KA 5AXKA 2OO4A 4OYZA 1S4FA 2WHOA 3LAKA 4KV8B 1HNXF 1GXTA 1WHXA 3DGVA 4UOHA 4XAKA 4FNHA 1QAIA 1DAXA 2DCUB 4F0HA 4WCEQ 1S1WB 3RW6A 3A3OB 1ZM3A 1YRXA 1HWLA 3UD3P 2CJAA 2J6UA 4I2QB 5KG2A 2DGXA 1B4SA 1JNRB 1KFDA 5H9EJ 2V4JA 5H9FJ 2NYIA 2ZWPA 3B4MA 5A8RA 4BBYA 1J5OA 3G82B 3DCAA 3ICLA 4KAIA 2DH8A 1IJEB 5H9EK 5H9FK 3LTOA 1Q1KA 1YRTA 2MEWA 1N32F 1EKSA 1RLDA 4Z7CA 3QWPA 1RT1A 3DDKA 2V0NA 2J76E 4YB5A 4J9LA 1MMNA 3MCMA 3HHLC 2QJ3A 4C9DA 4DSEA 1SXLA 2MJNA 1HIYA 3NGRA 1XERA 2GMLA 2I8EA 5KT3A 5E2QA 4BS2A 4J9PA 2RHSB 3K2YA 3NNHA 3A8KA 2K7JA 4B3MJ 3LP2B 1NLKL 2QN6B 2Z2YB 4O4GB 2WB1D 3GJTB 2FVRA 8AT1B 2H51B 3TJ9A 2PEBA 2YQ0A 1JJCB 1O0PA 2VH7A 3D66A 5A6PA 3BBBA 2VG5A 4LR7A 3QFHA 4C8MA 3HDSA 2Z58B 1T11A 1T9VA 1B0PA 1LWEA 2L3MA 1YHQS 1U6ZA 2BYCA 4ER8A 4UY8T 3NWRA 2E1CA 1J5EF 5CAAA 2ROGA 2JL9A 4HL9A 4KE5A 4K7QA 2MQPA 1AA1B 3G6XA 3D0IE 3T6JA 3CD0A 1T03B 1N88A 2M70A 3ULHA 3J80Y 1RYSA 3PFOA 2HHVA 4DUYJ 4LF6F 1PC5A 1U2CA 5M2UA 1LXJA 3P3DA 1RTHB 4WK3A 2KVQE 1BXNA 4WZMA 2C2RA 2JDJA 2DXFA 4KC5A 5E3AA 3IG1A 2RF2A 5J2PA 3QGHA 1UWBB 3EICA 1S0VA 5J1NA 4MH8A 4DPWA 1SPBP 4RNFA 3HZEA 3I9ZA 5CYQA 1EARA 3V81A 3HD1A 1VLYA 3L4BC 1RKJA 2DEJA 1FX2A 1S6QB 4MK9A 4ZVOB 4X4NA 1FJEB 5LT5A 5FLXU 2KVIA 3MM5A 4WTOB 1U1KA 4L6V3 1TFWA 1N5QA 4F67A 3K0JA 1DFDA 1GMWD 2DY9A 3LGMA 4G1QA 3CO9A 1R6YA 4Z7YA 4RWXA 2RILA 2GS8A 4A48A 5DZ6A 4A8QA 4R0JA 3MOJB 5EX0A 3LALA 4C48A 4F4AA 1UJ4A 4FF2A 3RB4A 5KFAA 1WKLA 3SXLA 1U24A 3CD5A 3HKZD 1M90T 1JLAA 4C0BA 3N28A 2UXDF 4ICLA 3DMJB 3PW2A 1R89A 5ETVA 4QR0A 4BHQA 1FFSB 4CLPA 3MXHP 2UU9F 2WBMA 4J9NA 2HVZA 1PG5B 1O51A 1N54B 1K0VA 1VRQC 1RT4A 3N01A 4ETXA 1RWNB 1WHYA 4XTTA 1CJUB 5C24A 3A8IA 5AXMA 4ZPCA 5HMYA 4DCPB 3D3CJ 9ATCB 4NXMF 2XS5A 1FKPA 3LW5C 5C42B 5T7LA 2VZ9A 1R0AA 1HQ2A 5THWA 2UUCF 2FTRA 4NLQA 2E7VA 3TVYA 2ADCA 3BDEA 2RAQA 5F8MA 4IR9A 4DL7A 2WW4A 4I6WA 3PKYA 3CMES 2X3DA 3L7PA 4ZS6A 2DITA 4LFCJ 2HFVA 4TU8A 4RW6B 1FVQA 3CXCR 5AJ3J 1TKZB 5EDWA 4DN9A 2YKAA 1FJGF 1RA6A 4MTPA 4JP8A 2YKQA 3KUGA 4YP3A 2QA1A 1MU2B 3VZHA 3HVAA 1AFJA 3T9NA 3DGPA 2UXCF 1QE1A 2IY5B 3ITHA 5L1LA 4QR1A 2BE2B 3MAHA 1UCNA 1NUEA 4P75A 3CO0P 4IOBA 1XR6A 1NPPA 1XTZA 4MIAA 4DZ6A 3VVTA 1V3SA 3G2XA 4G3IA 8RUCA 8ATCB 5KG0A 4RL1A 3DLEB 1VIXA 2X1BA 4YB1P 4ZJOA 1U6FA 1TR0A 3ZZPA 5HP1A 1RABB 2QT7A 2DNRA 1XMOF 5KFOA 1SI9A 3CJTA 3GP9A 3H0PA 1CJKB 2GQQA 4YFUA 3W8GA 1VQOS 1HL6A 2Y1LB 3K8VA 1ITPA 4F25A 3NCQA 1HQEB 1JXVA 3H98A 5DQIA 4GVBB 3X3UA 1JQGA 4DUZJ 1OYEA 2BEFA 1SC6A 2BACA 2HNDA 1RAAB 1UPPA 2EFNA 4DL0C 2YKNA 3AAWB 2YNIA 1X4EA 1FJ7A 2DGWA 1VQSA 1S1XB 1BY9A 2C42A 3CB4A 1IM4A 3CCQS 2W9BB 4C0HA 4UY85 1VR6A 1TQLA 1WELA 4R8UB 4NX9A 5KG1A 4ZCIA 5HN0A 1GXLA 1WOSA 2VFTA 3ENWA 1MLAA 4F4ZA 1Y10A 5A76A 2VF3A 1URNA 4LRCA 3LO3A 2LCWA 1C0UA 3NGDA 3SBMA 2QZ8A 3DYAB 4TQRA 3DLJA 3CMQA 3OVBA 3SQOP 4LBPA 2W4DA 4F3QA 3J7AN 4TU7A 2J6TA 1SUQB 4LSLA 4LF7J 1MG7A 3M32B 4B3MF 4EZ6A 2N3LA 3T9ZA 2O5DA 1FEHA 3C6TB 4CCHA 4L3KA 3MR5A 5D0GA 4CM2A 3VQTA 3ZTQA 2AYGA 3HVTA 4HACA 2WW8A 5JXSA 2DNOA 1R6VA 3VAFA 2JVOA 4DCJB 5IV3A 2Y8WA 2BM1A 4AT1B 2J9CA 3ETMA 2Y1IA 4FVMA 1O5JA 3PG9A 1RWWB 2IIHA 1H2VZ 2HZVA 4I6YA 2AKWB 4J91A 1QD1A 4ECQA 2JEFA 1Y9OA 1WF2A 1Y3KA 3T1HJ 2VASA 4F2SA 3ZTRA 1IM6A 1REVA 2Z2LA 3MECB 1UTAA 1F5AA 5B7WA 2HPUA 3TR5A 2BQ3A 2VG7A 3UN5A 3UNGC 3LH2S 3MEKA 3GCWP 1SJ4P 1TZ0A 3PW7A 4DUYF 3QYYA 2WVDA 2K1RA 2OAUA 2ZD1A 4NLDA 2V4QA 3ZNUA 1FNOA 3IC1A 4I1TA 2ZHAA 3JSRA 1Q79A 3JAMY 3HVRA 4K4XA 1RCOB 1CS4A 2E5IA 3N5BA 4MKVA 3PVXA 2JJ4D 1Y3JA 3V6HA 1K0TA 4ED5A 3W9JA 3GONA 3OFGA 5IT9Y 3CT9A 5HJYA 3RTVA 1FO1A 3KK2B 1Z2ZA 1U1LA 1DRZA 2FY1A 2VFUA 3R1LA 4EYHB 1CULA 1D9FA 2RKIA 3U1LA 3LANA 1N36J 4AD6A 5KFPA 1N6QA 2B8QA 1X0PA 1NKCA 4I69A 1X5TA 2P9CA 3CDEA 3RBXA 3CDAA 3DRPA 1ZAWA 1K47A 3HD2A 2KKHA 4CYUA 3MUTP 3ZO7A 4RU9A 4PWDB 3MTJA 1DZ5A 2V1SA 1PAEX 3CEDA 2KH9A 4JI8J 2DNQA 3TZZA 3PEJA 3I9V9 1YG0A 1VBZA 4TQSA 2RDJA 2GHVC 1F2GA 1G6BA 2FD2A 4JV5J 4YN3B 3ILOA 1C0TB 2XULA 2YBVA 1IBLJ 1OS5A 1WF1A 3I5CA 1HD1A 3WC2A 2UUTA 2PGCA 5DGAA 3LP1A 1RAFB 2FJWA 3T3FA 3OTDA 3Q8VA 3KNGA 3ILLA 3MEEA 4DPYA 1F5BA 2KZZA 3VAHA 5L1JA 5D0EA 4DV4F 4K2JA 2FYXA 1HLWA 3RG6A 1WC0A 1DQAA 3THVA 2J7WA 1HPZA 2VPYB 5HANA 1PCAA 3VALA 4Q2MA 2HMIA 3IR7B 3IRXA 5GAEI 3RYLA 3MR7A 1VBKA 3H42A 3I87A 2ABYA 4LFCF 4NWBA 2H65B 1UFLA 4OYMA 2DIVA 2H54B 5AJ3F 1RT3A 1U7LA 3PNIA 1LK5A 4NCBA 5E7OB 3T6BA 4JI5F 4ZPVR 1RHMB 1KLMA 1GNKA 1PSDA 2M0GB 4B3TJ 1VOMA 4OMFG 4ZMMA 3D9BA 2C28A 4PR6A 4WIQA 3UFCX 1OPIA 3EGWB 3SQGA 4UOCA 4RUAA 1X0FA 4WJBA 4ID5A 2HFUA 3C15A 5GMEA 3ILJA 4B9SA 3KWMA 1SB6A 1S77D 3M8YA 3KFWX 5E0OA 3I0RA 3W9IA 1G1XA 4QWAA 1IKYB 2FVPA 1NHKL 3K5LA 2XMTA 3A13A 3KLHA 2YTCA 4FP9A 3MM6A 1RU1A 2XTEA 1KOHA 4WP8A 4FF4A 3PFEA 2KT3A 3BKTA 1PO6A 2I5JA 4IFYB 2F1FA 4HI2A 5CYMA 1T95A 2AX0A 3EPIA 2LKZA 2E29A 3QATA 2DH9A 4DL6A 3AFGA 3HHLD 3EJMA 3TI0A 3N79A 4EZ9A 2DNLA 3FRYA 2XMUA 3IGNA 2UV8A 3AD7C 5F9LA 2VDIA 3QRPA 4BC9A 4M5MA 2FLPA 2NXCA 4Q45A 5LMUF 2W1BA 1NHVA 1RTZA 2F40A 1ZTTA 5IT0A 3QPIA 2ASJA 4DEZA 1RAIB 1SH3A 3PJ9A 4RWWA 2HBYB 5KFKA 2IAJB 4IQMA 2A2DA 1WHWA 2IVYA 3GTYX 2MSSA 3W2WA 3F73A 4LF9J 2VOPA 3VAMA 2P6SA 4RU2A 3W2VA 4KTQA 1G3OA 2EG2A 3CJQA 2XMAA 1R27B 2W2OP 5F41A 4F36A 4B3OA 4NLRA 2RS2A 1TK8A 2X1GA 2MQNA 3EVOA 1FRIA 3OTBA 4CNZA 1S6PA 3OVSA 1HWUA 4X64J 3R2CJ 1FTCA 3R5CA 3ZFVA 3H40A 1IJFB 2YH0A 4L75A 5FLXY 4WK1A 1D9AA 2KRRA 3R27A 1RAGB 1VGYA 2D3UA 2E44A 1H6KX 4NI2A 2FJBB 2IMWP 2LQBA 4OJ3A 1KKHA 1RTJA 3DOLB 3BGUA 2CPJA 5EN1A 1LXNA 4ZVSB 5ITHA 1P1LA 2C22A 4PKDB 2E1AA 3KUEA 4ICLB 3I6PA 2CJQA 4DWIA 3PV8A 4M5DA 1VRUA 4ZLNA 1YJVA 1RWUA 2DNGA 2EK1A 3BPDA 1UFKA 3M05A 4EGLA 2L9NA 1UKUA 4NMXA 4KSEB 5M2PA 4FF1A 4C11B 2HYIB 4RBUA 3C46A 3JYTB 2MZRA 2JFDA 2OH2A 1CJVB 1FKPB 2JRSA 3QFWA 3M6WA 1JJ2R 2DR9A 3UR3C 1Q5YA 2BJ8A 3TEGA 2HHQA 1F9HA 1PYOB 2FJDB 3KHLA 4F26A 2CYYA 2ZBIA 4RR5A 3CDWA 2FHKA 1WC5A 4DN0A 2HHSA 1N36F 4E98A 2G0CA 3GIKA 2PFFB 3MEGA 2LXIA 3ZZRA 3OTCA 1VHIA 1Y4ZB 1FJCA 4KKOB 2R7QA 3MM8B 1X5SA 5D4OA 5D4LA 2AU0A 2IM0A 4J9KA 1Y5LB 2DKOB 3OR2B 2MQ8A 3KOAA 1SKSA 2BQRA 2HVHA 1S9EB 4N41A 2CNLB 3NGUA 3GR1A 3T5KA 3P4UB 9RUBA 1M1HA 4J7CA 5HBMB 2CPEA 4CRJA 4NOHA 2AD9A 5KT7A 2EC2A 4CI0B 4CM0A 5LL6d 2OPSA 2H4YB 4ZVHA 4RJVA 3OL6A 3K5OA 3HKWA 4JV5F 2XMJA 3PYDA 2QG9B 1YITS 2LVWA 1IBLF 4LVOP 3TX0A 5J1EB 3IBCB 2W01A 4OZLA 1NAQA 2A6MA 3H4DA 4DPXA 2PT0A 1LW2A 2DNHA 1H72C 1FESA 5G0RB 1X4FA 1R8PA 5L39A 1YRUA 1I1GA 1Z1ZA 2EBGA 2CWKA 2M2BA 2RD5C 2B0GA 4N77A 4DXLA 2HBZB 1SQEA 1NMEB 3AWRA 1TKXB 5LXYA 4ANDA 4BWJA 2Z2MA 2ZDOA 3NEKA 2QC3A 1AXQA 5HL7Q 4B9LA 3Q23A 4H4OB 4NLTA 1G7CB 4ZP8A 2MSTA 5D4PA 2MKCA 1YBAA 1SKWA 2M4MA 4U96A 4L72B 1HW8A 1NSQA 2EKYA 4LF4J 2C2KB 2VG6A 5F3ZA 1VLOA 1S76D 3G96A 2WRMA 1WDDA 4KPYA 1U2FA 3GYNA 3BQ1A 4C0OC 2HHHF 2NXUA 4B3TF 1HI1A 5I4MA 2F5GA 2MZQA 5KG6A 5HAOA 3FCHA 2MY8A 2XWYA 4TU9A 1NU4A 3CJ4A 1RADB 4AL7A 2R42A 2P2CB 2Z56B 4A8YA 2QX0A 4A46A 2DVIA 1AUDA 3BGFA 4ED0A 5B0GA 1XWLA 1HHSA 2VBXA 4DR5J 4I0WA 2H3EB 3GIJA 3RGIA 2J9EA 2H5EA 4GMKA 3G8QA 3WC0A 3C3LA 1GX6A 1RT7A 4P7VA 2QSWA 4OJHA 1TK0A 2WAQD 5A8WA 2BMBA 2V94A 2M52A 3CCUS 2GFFA 2CJYB 5F3TA 4DR3F 4AQYF 4U7UD 2ZOFA 3GFYA 2XO7A 4DR6J 1FEEA 3Q8UA 4J9RA 4RUBA 4Y65A 3DOMB 2NSBA 3MAQA 2WB4A 4O3RA 3BO2A 3VAKA 2ZZTA 3AXMA 3OLAA 3FGVA 3TA0A 2BM0A 3G8SA 1FE0A 1RTDA 2XYGB 4H54A 3BO4A 1QVGR 2B4VA 2VG7B 4W4MA 1B70B 5B0EA 2B9YA 3WDOA 3GFXA 1E6VB 4YQWA 3DRRA 5HQLA 2WSEC 3IN5A 2R2UA 1RKIA 3M2VB 1KNZA 1ZM4A 4LF5J 4IH6A 4YS2A 5C2CA 3MR6A 4GKKJ 3KLIA 4Y2KA 1WDTA 4MKYA 4F50A 2FZKB 4LF1A 1RHQB 1ZPWX 2QYCA 3FSXA 4PAAA 2CQ2A 3JSYA 3KYLA 1FWKA 5AE2A 2W8LA 4K5RA 4C8KA 4PPDA 2R7UA 2BJDA 2KRBA 3OFFA 5ETPA 3UDVA 1LWFB 2AMCB 5F0WA 2GJFA 1TL1A 1TVRB 2QV6A 1CULB 4ZPBA 2RKIB 1S1UB 1NDKA 1UA1A 4P6QA 4X64F 4CTAA 4R5PA 4WFYA 2WSCC 4OHZA 3DRPB 2HFZA 4B3SJ 2F63A 3K5NA 2JVRA 3E3XA 1HFEL 4O3QA 5I42A 3MCOA 2ZE2B 5I3UB 2Z57B 4ZOSA 3B82A 4B9MA 3C2PA 3OXGA 2CUYA 1WKKA 1H74A 3EZUA 4PWWA 5KFTA 1FK9A 4C8NA 2JC1A 2NUHA 2AYMA 1NDCA 2EG1A 4J9SA 4BC7A 5KG4A 1VYAA 2IDEA 2VUGA 4OYBA 5KFNA 2YX4A 1DHMA 2C2MB 2HWIA 1IVZA 2DXEA 3POTB 3BO3A 2LLZA 2W7PA 2YWFA 2RNEA 5EUHA 1GAOA 3KG4A 2DEIA 4YEAA 2IC3B 4PRFA 5FDLA 4PEOA 3QJPA 1OYDA 1BQMB 4TXSA 2E9TA 1NDLA 1HW9A 4YR2A 4WE1A 1N5YA 5HMXA 2HAIA 2ZFHA 4QYRA 5BYQA 1C1CA 1JX4A 2RUSA 1VQ8S 2R7VA 1VQNS 5EWGA 2B5JB 1JKHB 3IRXB 5KFBA 2CZVC 5GAGI 2FHJA 3MMBA 1Q95G 1RT3B 4ECRA 2V8VA 4ED7A 2KT2A 2V9KA 5AXNA 3LWLA 2H5JB 2NZCA 2AEMA 2HNYA 4DQIA 1V6HA 3GWCA 1KLMB 2DGQA 2Q66A 1NO8A 3PW5A 4UOFA 5DRKA 1EKRA 4HT5A 1JIHA 2CQ1A 2MGZA 1RHRB 1OPZA 2BOAA 2OP5A 3MEDA 3SQGB 1NJWA 1Y5IB 3C16A 2K3IA 2DGSA 3G87A 2FGOA 3C14A 4FPIA 4LFAJ 3BM7A 4NXNJ 4ZN3A 3BQ2A 3OW2R 1UVIA 1TMMA 3I0RB 4DV5J 4DQQA 1RA7A 3EVMA 4F4XA 3Q2TC 2A2CA 2CWXA 5K20B 2CQHA 1UWAA 3HSDA 4J9OA 4S0MA 1S97A 2IBKA 4OYIA 1SQFA 1RBAA 3BSOA 4ZPWR 2BJ1A 1W2BR 3W1YC 2A0FB 3FQLA 1S1WA 1XEZA 4X4PA 1T7PA 4E0DA 5CYMB 3OJUA 4NZ6A 1LV5A 4I2QA 2J0QD 3N0VA 3DRSB 2AJFE 4B9VA 1FRMA 5D3GA 2E66A 4OFZA 2Y1RI 5GAEU 4NYOA 4QQBA 3G82A 2ADBA 4X65J 1RE1B 3BQ0A 2ACYA 4LSNB 4B9UA 2JOQA 1FDDA 3OJSA 2AZ1A 3RRKA 2NS1B 3BF4A 5F0UA 3TA2A 4C8LA 3OFHA 4O0NA 3BJYA 3SEOA 4AXJA 2NPFA 5LSOA 1H0HB 4E2FB 1RBOB 2FGCA 1Q4RA 3W61A 2DCLA 2PIIA 3LP2A 1FD2A 3MPVA 3GCXP 2MB0B 3K17A 4O4GA 2XB2D 4GO5X 1Q5VA 1HA1A 1NHUA 3W2WB 3RAQA 4HHJA 4GC6A 3M9NB 4P2FA 1KFSA 2I1RA 1N8RT 3E2EA 3T19A 1V3ZA 2ZUAA 3NMRA 4Z37A 1H7WA 1RSCA 4PQAA 1FCAA 2F3JA 3D6HB 2GO9A 3RB3A 2BRKA 1WTFA 2P9GA 3EUNA 4F0MA 5BR8J 1OIAA 1RWMB 3HXMA 4K4SA 2B51A 1DQ8A 3PKMA 4DSIA 3G6VA 5DJBA 1TL3B 3EYZA 3R7SB 1U0HB 2AJ4A 5H1SV 2J8SA 3UI3A 4CZCA 2R7OA 4UUXA 3B8HA 2XZ2A 3UDLA 2GAGC 4P72A 5SZTA 3B78A 2QLWA 1YIJS 2HAFA 1SV5B 3D6MB 3M6XA 4NI2B 1WD6A 4BWMA 4C3MA 1RTHA 3A1YG 2XYPB 1R3NA 1XNQJ 3KHRA 4K59A 2E1MC 4DPTA 3M8PB 2XGQA 3SV4A 3MR3A 4MIBA 5LMNJ 3FK4A 4QIGA 2AX1A 3LF0A 2YNFB 1LKZA 2CAJA 1Z4UA 3M30A 5LOQA 1VRUB 2XYHB 3U02A 3ZTOA 2B3TB 2W9CB 4LF5F 2I2YA 2EKNA 3GU0A 1S9FA 2QMWA 2JWNA 3K89A 3AX3A 1P9QC 1KRPA 4DS5A 2XHCA 1NCLA 5AE1A 1JK9B 2W24A 3KNAA 5ETMA 3SZ2A 2B9EA 1QUPA 3NKYA 1F2HA 4CO2A 1IKWA 4IH5A 1EAYC 3O5TB 2KXFA 1M1GA 4Q2LA 4ES3A 1XNRJ 2UVRA 2EEYA 2RQ4A 1U1NA 1S6UA 4ATNA 4LF2A 3BSNA 4LT6A 4RW9A 3IWLA 2OGUA 2EC0A 4GC7A 2MZ1A 2WBRA 4DI6A 3MEGB 3SSRA 2ZOMA 1RT2A 1TU0B 2J7UA 2VB6A 2HFSA 4TY8B 3PJWA 2MPUA 3MI7X 2D9PA 4B3SF 1KD1T 3QGPA 3LQVA 2ASLA 3DMJA 3NOGA 4TNOA 1Q8IA 4G6VB 4TKTA 3C6UB 1O8BA 1NJIT 1U48A 4PZVA 3QWUA 2N82B 2IDLA 3R7BB 4U67Q 1Q81T 3AXKA 4FN5A 2W2NP 3OTOJ 4WWSA 4MKBA 3VGUA 4CLTA 5KT2A 5T14A 3UCZP 2GJIA 1FRLA 4IOCQ 1JLEB 3CIMA 3BH6B 4OX7A 5FIIA 4DV1J 5C42A 1R8AA 5ETNA 4PG8A 1KLNA 2G2YA 2YKOA 4Y6IA 3TANA 1VJQA 2W8KA 4M5IA 3BPSP 4ELTA 1A7GE 3PO4A 2CVEA 5BYRA 5DDOC 3BGRA 2AYEA 2EFOA 2VC0A 3BSAA 2V8PA 1LW2B 1UEUA 3SCJE 1MWYA 2DGVA 7FD1A 1ZPVA 4Y0FA 3OHBA 5C5JA 2IRXA 4WKYA 5A8KB 2R7TA 4RW6A 3CCVS 2DB1A 2QO3A 1TKZA 4I7FB 4USTA 4OZ3A 4XPCA 4JI4F 2XHWA 1G4CA 2HQCA 1C4AA 1XR7A 2GJ2A 1UVMA 2ZZMA 2IM3A 1GK8A 1EB0A 4ES1A 3QZ8A 4DR4F 4X62J 4IR1A 3JQJA 3M8QB 3DLEA 1BWEA 2GMHA 1YJRA 4TN2A 2DHGA 1YZ6A 3BKUA 3DFEA 1OSDA 4P73A 2MKSA 1GXUA 3BYPA 4A8KA 3FCVA 2V2ZA 4ECTA 3WIVA 2KFNA 1TV6B 1UUJA 1CJKA 2FJEB 1FFWB 2RJZA 3U7JA 4DFJA 5LJ5Y 1UZHA 3HULA 3GJRB 2Z30B 4NXNF 1HQEA 4P2SA 1AW0A 5B0DA 4GVBA 1XK8A 3LP0A 3AODA 4DV5F 3W9HA 5HROB 2PC6A 2FHOB 4RLEA 4ZP9A 2KFZA 4CO4A 3KJNB 1RISA 3TVZA 2RT3A 3VZIA 1X5OA 3EPGA 4QW8A 5IC6B 1CSJA 2ROEA 2XZTB 4CNYA 3MWBA 4USVA 1S1XA 3C8YA 4M5GA 1NSPA 2QTWA 1J5EJ 2FY8A 2W9BA 1IQTA 1NJZA 1VC6A 1KHWA 4M8LA 4X65F 3MM7B 2KHCA 4IG0B 1NRKA 1URRA 3W63A 2KO1A 3DYAA 4OIXA 1HHQA 4OI3A 3SCLE 1RTDB 1BUXA 2XMKA 5CXTA 4PUOA 3RRHA 3CSKA 4A47A 4Q44A 1RI7A 2XLJA 3M9OB 2KYXA 1FRXA 3MFHA 2AW0A 3I82A 1FHTA 2OI2A 1SUQA 4LRDA 2WVCA 3Q2SC 4LRBA 3HI9A 3M32A 5CCMA 3OUYB 3K58A 5KFUA 4K2XA 1Q53A 1WOPA 3C6TA 4ES2A 2XC9A 2QL9B 1QUVA 2UXBJ 1RT6B 2GAHC 4LUBA 2NZ4A 2DO4A 5F8LA 1RUSA 2VONA 2ZUGA 5CYJA 1XJWB 2XY7A 2XI3A 2ZC4A 3H2UB 4OZ0A 4K4YA 3L9ZA 2ZBQA 1DARA 4DQPA 2NREA 4KT0C 5JUMA 4WF9Q 3GFZA 1T05A 2ZWOA 4CT9A 4K4TA 3MECA 1APSA 4R5PB 1C2PA 5HO4A 3I4HX 2R7RA 5CCLA 3HK2A 1KVIA 4KGKA 2OMLA 3RB6A 3R97A 3D28A 2M7SA 1U1PA 2OLWA 4W92B 2CQ0A 3JQKA 2V34A 3KG0A 4QYZK 1F0XA 2HNZB 1XNQF 3LAMA 1SJFA 3I31A 4EUVA 1FK9B 2HBQB 4K0KJ 3OXFA 5LMNF 3Q0AA 5KFJA 2DRBA 3PRVA 2VHGA 1MSWD 1ZM2A 4EK2A 3M1VB 3H59A 4ECWA 2R7XA 1RWOB 4OZ1A 2X1FA 3RBDA 1S0NA 4B9TA 1X4GA 4ECUA 1VK3A 3CUNA 2VU5A 3KK2A 4PQUB 1L3TA 3NAIA 5FDLB 2O66A 5KFHA 4ECSA 4U95A 4HYKA 4I4BA 1HQUA 4FBUA 3QQCD 4NRTA 1EETA 2MKJA 4WU2A 3IRWP 2C3YA 2CIMA 1EZZB 3N6LA 2HQFA 3SIPB 1L5UA 3ZZYA 5B0BA 1RWXB 3TUZC 3GQCA 4KB7A 4PWDA 1FD8A 3TJ8A 5KAKA 2LXFA 3CDUA 4L74A 3KLGB 3ZNJ1 2HNYB 1NBEB 4W98A 3FMBA 3FSIA 5IC4B 2X3GA 3RBZA 4QWEA 2RB7A 4ZLLA 3CTRA 1XMOJ 4KGVB 5KFFA 1C0TA 3AX2A 3X1LB 3OTOF 2IM2A 3P5BP 3UVJB 4DS4A 2P8IA 2VA3A 5BJRA 2CZ4A 5J1PA 1JLFB 1M5HA 4ILMA 1HNWJ 3KHGA 4UZBA 3L09A 4LIRA 1SKRA 4IG3B 4X4SA 4DHVA 1UVJA 2A18A 4FXVA 2XTJP 4MK8A 3G6YA 3OSPA 2B56A 1SC1B 2YKMA 3T5LA 2XCPA 3J7Z5 3EZOA 2BJ9A 3CNQP 4M94A 4PABA 2LA6A 1IWAA 4IKAA 3W8PA 3NGSA 4U7UK 5D3GB 4ZCMA 4LR8A 3EWGA 3QT7A 3DM2B 5HMWA 4NCGB 3S8SA 5GAGU 1SKUB 1R43A 4ZVTB 2LDYA 4JI6J 3SV3A 1FVSA 1TKTB 2IRUA 3CJ2A 4X62F 1UA0A 3EDRB 2C2ZB 4Y2IA 5I3QA 1T02A 1J2VA 2H48B 5HVHA 2IYIA 2B6AB 3FNNA 4N47A 1FKOB 2GHWA 2VPXB 1SJ3P 1IKYA 2C2EA 1IWGA 2HZAA 3GZ7A 4GVLA 5IQ6A 2NYHA 2CPFA 4PXBA 2FC9A 4L73A 2DO0A 4PYDA 2JH3A 5DS7A 4IFYA 4JV1A 4ZK7M 4X4RA 1Q7YT 4HR2A 1HMVB 1ZH5A 2B9XA 3VAIA 4YR0A 5CD4A 4NLWA 3MPDA 5KOXA 4DSFA 4ZHRB 4ILRA 1GMWA 2F9DA 4K4ZA 3QIPB 2AQ4A 4LQ3A 1LWCB 5JVHQ 2O67A 4YUDA 5C25A 1U1MA 3EVWA 4FNIA 3BREA 1FWLA 4H4KA 3SSQA 3PR4A 4WFZA 2H1YA 5DQHA 2LEBA 3BR8A 3ENQA 4Q43A 3V4IA 4OYPA 2IAJA 1YK9A 2FVCA 4JI7F 1M5KC 1B0VA 4UW2A 2HBRB 3T1YF 2SXLA 1F1BB 4XDDA 3NWGA 3M30B 4LBHA 3M2UA 3CC2S 1N56A 4CO1A 2CPXA 3R7NB 4A8MP 1UZDA 3LOUA 3R3TA 3UNYA 1RT5B 2UXBF 4DR2F 4RZRA 3D67A 1Y5NB 4DR7J 2CNOB 4TVAB 3ISND 3H25A 5HJXA 3DNCA 4DSJA 1IKWB 1NK6A 5DGBA 2XY6A 2CXEA 3CWJA 3TNVA 3CC7S 1ELOA 3FBEA 1NK7A 1UVLA 4C97A 4XK8C 2NPIA 4RW9B 2NXEA 1RXOB 2RRNA 5BXIA 1EJ7L 2HHTA 1X4AA 2I6WA 1HBUB 1RT2B 4M1KA 3DOLA 1N4LA 5C7PA 4DF8A 3AOBA 4YB6A 3CGIA 2DR6A 4X4UA 3SFUA 1U6BA 4EO8A 4R0EA 2GW8A 3QNWB 3PR5B 5GMDA 3GILA 3KLFA 2HEKA 2UUWA 1F5CA 1RAEB 2POKA 3KK1A 3RR8A 2RDDA 2EFVA 2OTJS 3RAMA 2Z2ZA 3J7YI 3NCRA 2CDRB 2G2ZA 2HGLA 4K0KF 2RRAA 2Y0SD 1RTIB 4C11A 1N0UA 1X4DA 2YNHB 4X4OA 2CRLA 2ZH3A 3JYTA 3GG1A 3DLGB 2Y9HA 3OPKA 4DSKA 1GT8A 2XNRA 1WG4A 2PI4A 4JYAJ 1CJVA 2DD8S 3JS9A 1JJ4A 3UPFA 1LEOA 4P7TA 4WBFA 2UVVA 3WX4A 2QLXA 3MTKA 4DV4J 3H5XA 2CQ3A 2RRBA 1DY3A 2WVFA 3BGRB 5AT1B 4IYQA 5DO2A 1QY7A 3BSCA 3GIMA 4NMLA 4ZVUB 5MAOA 2LFVA 2N3OA 4KH0B 4CLZA 4HHUA 1QLNA 4KKOA 3D54A 2C2DA 3MM8A 4H4KC 2MKYA 1S6OA 4C3KA 2XM3A 1RAJA 3EZ5A 3T5JA 4JI5J 2Q43A 3PYEA 1QVFR 5LSLA 2WZ1A 3PRBA 3NBPA 5L8RC 1SL2A 3CF5Q 3OR2A 3VQSA 4IQXA 2LQ9A 1S9EA 1DJ0A 4RNNA 2J6SA 3TO8A 1VK8A 2AEFA 2PMHA 3MZIA 3KLVA 5HBMA 3UW1A 3M4XA 2BABA 2OPRA 4L76A 1TKDA 3V6DB 1FERA 1NDPA 4OX9J 4DV6J 4KRWA 4WU3A 2F8EX 3AD8C 3PXGa 5J1EA 4B17A 4KR0B 4G1IA 1NZAA 3CCMS 4QU6A 5DETA 1B3TA 1ZAVA 4P2MA 1NZ8A 3CPWR 2OEJA 1UPMB 4B08A 3LP0B 5G0RA 4ED4A 5HSPA 4JI0J 1CEZA 2ROPA 4ED6A 1KWMA 4KH1B 4JV0A 3NXZA 4DU8A 5KFEA 1HNWF 2HIYA 4QBUA 4WXOA 1TKXA 1PC4A 2HRUA 1HBNB 1NJXA 1U1OA 4A8XA 1IBMJ 5IT4A 4JBCA 2BOPA 1S99A 1KQGB 4H4OA 3CJ8A 2LDIA 4DX6A 1HWIA 2LU2A 1JJHA 1IR2A 4A4JA 3QGGA 4M5JA 4Q5VA 4FXWA 1Q0NA 3R1HA 2W4CA 4U8YA 1RACB 3UN2A 1CG2A 5AE3A 1CBKA 2OMOA 3PYFA 4KPCA 2ZKTA 1UMJA 3HHEA 3T1AA 2RDIA 3JSBA 1NK9A 4JI6F 2VDHA 5LMUJ 2DPIA 1H7XA 2KM8B 1T3OA 5CQGA 2KG1A 3NP5A 2V2QA 3KMQA 4YMEA 4I56A 4PUOB 3ENAA 3RW7A 2ZJRQ 1XN9A 2CQBA 2R7WA 2CFXA 4QWDA 2FVQA 2DGUA 1UAWA 2H9ZA 1ZS6A 1HI8A 3N9UC 5KFQA 1YJNS 5FJ4A 2ZKUA 1UEKA 2J8AA 1RQ0A 2GVDB 4Y2MA 1IBKJ 4OZNA 3GV7B 4PWUA 5F8GA 3OR1B 4F3MA 3NLCA 2EVZA 1S0MA 2HGMA 2AEJA 4ZIVA 2KT5A 4NEZA 1O6XA 1UP1A 1PIEA 3M8SA 5JMNA 3AY0A 2A10A 1FFGB 3MMJA 3GV8B 4OI4A 3S01A 2ZH5A 3AB2B 2O01C 3F44A 3JB9k 4G1PA 1QTNB 2PI5A 1P27B 3FBBA 2ZITA 1KQSR 1UVKA 4RW7A 4EU0A 2DXDA 3DOMA 4OX6A 2XSJB 5ETOA 2FJVA 1S1VB 1T05B 3M2RB 2KG0A 2F4FA 2U2FA 3DC2A 4YY3J 1SBRA 2VOOA 3AB4B 2D3O1 4USHA 3RBEA 2HQIA 5J2MB 4G65A 1E6VA 5KFYA 1IQZA 3US5A 2YVSA 5KFZA 3D4JA 2B43A 2MLXA 3T41A 2B4OA 3GLJA 3PHEA 3M2VA 3AOAA 3PW4A 4KO0B 4Y34A 3K59A 3NAHA 1LFWA 1U25A 3M6VA 3F0NA 1NM2A 3R9LA 5T41A 5J2QA 4FYXB 1NNDA 4GO7X 2BXJA 3IBFB 4Q7AA 4AXIA 4DL3A 2YWGA 1LQ9A 5KT4A 2DISA 4I67A 3JTNA 2V9WA 1UVNA 1T94A 2KZMA 2M8HA 3MUVP 4OLOA 1LWFA 4LIWA 2FQQB 4LR9A 2KXNB 2BRLA 4DR7F 2V63A 1TVRA 2K2PA 1HQUB 5KFIA 1S1UA 3BDPA 2B4PA 1EETB 3BR9A 1NB7A 3MM9B 4LF8J 4ZPTR 2GCFA 4CT8A 3D0HE 4AUKA 3U1MA 5KFMA 2ZEJA 2ZHBA 3H5YA 1F3FA 1TUGB 4NYPA 4CO5A 5F8NA 4DOZA 1N33F 2QFJA 2HLTA 1KOOA 3VV2B 4K4VA 2CQIA 1FTRA 5CZVA 2DY1A 1QTMA 2ZE2A 4ZN1A 5I3UA 2J7KA 4ZVRB 4LFBJ 4HLBA 1TL7A 3TW0A 3CJKB 4AL5A 4A8WA 3M8WA 4ZPAA 3EX7B 2V8HA 5K5MA 2YWWA 3KHHA 1DTQB 3CC4S 3RU0A 2MTLA 1EP4B 2GV1A 1S72S 5U47A 1JLGA 3QAUA 2ZBRA 3POTA 1VISA 4DFMA 1HBMA 1FDNA 2DGTA 2IC3A 5KFWA 1CQNA 1Y00A 3D3BJ 2AJQA 2BANA 4JYAF 2RMLA 1BQMA 2HG4A 7AT1B 4DV0J 2AHOB 2E1RA 1B99A 4J9UE 2ILZA 3QRQA 1P9YA 1R8BA 5E3QA 4I64A 3DXSX 1YBTA 3KG1A 3KXDA 4PXCA 4K4WA 4RUCA 2B5JA 1JKHA 2EFGA 3CDBA 2YKMB 4RW8B 3L7UA 3K7RA 4C7QA 3ZZ0A 2JLFA 2JEGA 4CLWA 4ERDA 1J27A 4CIOA 2J5AA 2HHUA 1PKUA 1VQPS 1N0VC 3FQKA 1FT8A 3DRYA 5HVGA 4FYWB 2BUNA 5IM0B 3CCLS 2HHHJ 1SIZA 2J9DE 2JEJA 2FB0A 4DF4A 4DX5A 2GC8A 3JSMB 1L3SA 4IDKB 4PG6A 3FMWA 1AROP 3KMSA 3PTWA 2OEKA 2NR0A 5KFLA 1NH8A 3NY0A 2DNNA 3CJRA 3OT9A 3RUBL 4WFBQ 1X31C 2YNGB 3QSYB 3I55S 5JVGQ 4L3NA 1CVJA 1JLQB 3MD3A 3TAPA 4FS1A 4CQ1A 4OX9F 4DBQA 4X4TA 4DV6F 5KOWA 4C8OA 3FUYA 2DNKA 4J37A 4DX8H 2CPYA 2QRRA 3EGZA 3ILIA 2GHPA 2VA2A 1IUJA 1D1UA 1OMSA 1P6TA 1JWWA 1Y0HA 4WZQA 3A4TA 1HNVB 4YR3A 3GE9A 1VQYA 2M9KA 4OHXA 2R8IA 4PG4A 4YDDB 4JI2J 3HSGA 2RQCA 1VS3A 3KDOA 4JI0F 5J2NB 3S1TA 3CJ5A 3NGTA 1PGZA 2XWXA 1VFJA 2W2QP 3GV5B 5KFVA 2MHNA 2VKRA 4EI2A 2Q6CA 4FDFA 3DRSA 1NJYA 4EYIB 4DR3J 4AQYJ 4JI1J 4OQJA 1KEKA 5E3PA 4D3GA 1HWKA 2F4VJ 4PCQA 4R25A 1IBMF 3OSNA 4LSNA 1TAUA 1JLCB 3MCSA 5F8IA 1FNXH 3PY8A 3TQ1A 3AJDA 3PHTA 5KFCA 4ZCKA 3WQPA 4OL8A 1HNIB 3R8YA 1K1QA 1Z2LA 3I5AA 2DR8A 4OI1A 3R5GA 1WF0A 5C25B 3HZGA 5K14B 1JXLA 3BBFA 3R6LB 3MPUB 2V69A 2ZNYA 2MMYA 2WOMB 2IJNA 3DOKB 1LOUA 3DLHA 3UDEA 3DRXA 3L95X 2GO8A 2KU7A 3V4IB 5EHHA 1C1BB 4EBCA 1IKXB 2EBEA 4OYOA 4ZP6A 3QMQA 1Y7PA 3E01B
chains in the Genus database with same CATH topology
3DU5A 4U67Q 1Q81T 3HFKA 3LO3A 2VC1A 4LQ9A 2LCWA 1N34F 1C0UA 4FN5A 3NGDA 5D6GA 2MZSA 2QZ8A 3DYAB 3ZZZA 2RE1A 2LMIA 4URQU 4BCAA 3M2UB 2LEPA 4MKBA 2FJXA 4K4UA 5KT2A 5T14A 1V9OA 3UCZP 2Q6BA 4TQRA 2GJIA 1IBKF 2QA2A 2YY3A 3DLJA 4EBEA 1ZYQA 1FRLA 5D4NA 2FUG9 4IOCQ 1JLEB 3OVBA 1HYSA 3CIMA 5ADZA 3CCSS 2DK2A 2VL1A 4OX7A 5FIIA 2ZH1A 5C42A 1R8AA 4RW8A 4PG8A 1KLNA 2YKOA 4Y6IA 3TANA 3NS5A 4OV1A 5DLGA 2W4DA 2W8KA 4V19J 3D1HA 2XMVA 2E5HA 3FFIB 5A0YA 5DG9A 4F3QA 1TL3A 4DLGA 4ELTA 1A7GE 3BEGB 1N48A 3I4PA 5F8JA 4TU7A 2CVEA 2J6TA 2XEXA 3PO4A 1SUQB 4LSLA 5BYRA 3KK3A 5DDOC 3BGRA 3PIPQ 3I0SA 2AYEA 2EFOA 3M32B 2VC0A 4B3MF 2IA0A 3BSAA 4ELVA 1ZM9A 4EZ6A 4USJC 4Y28C 5GVQA 4KFBB 3VCDA 1TP7A 1LW2B 1QM9A 3Q22A 1UEUA 2N3LA 5A6WA 5E3RA 3SCJE 1MWYA 2DGVA 5IM0A 3T9ZA 5DG8A 7FD1A 1ZPVA 4Y0FA 3OHBA 2O5DA 1R31A 1WI6A 3DN9A 1FEHA 3C6TB 4CCHA 5C5JA 2D68A 3MR5A 2IRXA 2HVIA 3R5BA 3JSMA 2R2RA 4WKYA 5A8KB 3VQTA 2AYGA 1SV5A 3HMJG 3BB5A 3HVTA 2R7TA 4RW6A 4IDKA 2YWHA 3CCVS 2DB1A 2QO3A 2WW8A 3SDEA 5JXSA 1TKZA 4RX6A 2MY7A 3LP1B 1UETA 4I7FB 3DLKA 2DNOA 3MEEB 2YNGA 4XPCA 5L38A 4ED1A 4JI4F 1LFPA 2XHWA 2JVOA 3VAFA 3BN7A 4YY3F 2BM1A 1JLQA 1VHFA 2EPIA 2J9CA 1C4AA 2Y1IA 1W25A 2OD6A 4WTYA 1N52B 3MR2A 2XBPA 4FVMA 1XR7A 2GJ2A 1KN6A 3M8PA 1O5JA 1UVMA 2FLOA 2ZZMA 2AGPA 2IM3A 3H8YA 1H2VZ 3N4WA 4RW4B 4I6YA 4ID8A 3KLFB 2YNFA 4ES1A 3QZ8A 4DR4F 4ECQA 2JEFA 4IR1A 1Y9OA 1WF2A 1HPZB 5K8OA 3M8QB 1Y3KA 1S1TB 1KHVA 3DLEA 3KK1B 2VASA 4MFBB 5L1KA 1M1KT 1HNVA 4F2SA 1BWEA 2GMHA 1YJRA 4TN2A 2Z2LA 1REVA 2W9CA 3KKFA 3MECB 2HMIB 2DHGA 2X1AA 1F5AA 1HWJA 3P96A 1JNZB 3VWSA 3DFEA 1OSDA 3EXCX 5B7WA 2HPUA 2ZH7A 2D41A 4MK7A 3TR5A 1OQ6A 1GXUA 2MKSA 5J2NA 1S79A 2ATLA 2BQ3A 2VG7A 3ISZA 3UNGC 3CCES 4A8KA 1VMBA 4ITSA 1BLUA 3LH2S 3MEKA 2WONA 3O8WA 2CQGA 2MJUA 4ECTA 1SJ4P 1TZ0A 2YWEA 3PW7A 4DUYF 1TV6B 4DQSA 2M5YA 2KFNA 3QYYA 1UUJA 2FJEB 2K1RA 1X4HA 2RJZA 3IXQA 5A2QY 2OAUA 2ZD1A 3U7JA 3WBZA 4DFJA 4NLDA 2V4QA