3H5XA

Crystal structure of 2'-amino-2'-deoxy-cytidine-5'-triphosphate bound to norovirus gii rna polymerase
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
483
structure length
470
Chain Sequence
GTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAEDFYVPRQEPMFRWMRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of 2'-amino-2'-deoxycytidine-5'-triphosphate to norovirus polymerase induces rearrangement of the active site.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase/rna
molecule keywords RNA dependent RNA polymerase
total genus 149
structure length 470
sequence length 483
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 3h5xA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3h5xA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3h5xA03
5KG6A 3UPFA 4RW6B 3V6KA 5I3UB 1HNIA 1C0UB 1LWFA 1RT2A 2V0NA 3OL6A 2RF2A 5KFYA 4WZQA 1IKWA 1C0TB 1JLCB 3E51A 3OL8A 4KFBB 3MEGB 4EO8A 5J2QB 1C0UA 5F8JA 4RNMA 3DRSA 3BQ0A 3I5CA 1N4LA 3QZ8A 1SH3A 3M9NB 4MFBB 3G86A 2D7SA 3TAMA 3DM2B 5C24B 2R8GA 3BQ2A 4RW7A 2AQ4A 3OSPA 3MFHA 4J9SA 3LAMA 3DI6B 3IRXA 3KHHA 2OPRA 4LSNA 2YNGA 2IM2A 3N6LA 1TKXA 3CWJA 3DYAB 1JKHA 2E9ZA 3CJ2A 2UVUA 2QE5A 3KK3B 4RUAA 1TVRB 4NLYA 4NLRA 1T05A 4IH6A 4ECXA 1VRTB 2R8JA 1D1UA 2VG6B 2XGPA 4PUOA 1HNVB 2QV6A 3T5JA 4K4XA 4ZPCA 3KK3A 3NAIA 2OPPB 3QYYA 5HROB 4O44B 3ICLA 3LP2B 1FKOB 4Q43A 4RW6A 1T3NA 4PQUB 4ID5A 5HBMA 3UDLA 2VG6A 1S0MA 4PUOB 2BANA 4WE1B 4ECRA 3BSNA 4ECZA 3RBDA 2W9AA 1C1BB 2WONA 4TN2A 5KFSA 3T5LA 1JLCA 4KFBA 2OPSB 5KFBA 4PQUA 5J2MB 3FRZA 4WXWA 3HHKA 5KT6A 1LW0A 1S1VB 5K14B 4WFYA 3M8PA 2RKIA 4NLQA 4ZPAA 4KB7A 5J2NB 5C42A 5KG0A 4TQRA 4J9NA 1N6QA 4IR9A 3MECB 4QWBA 4I2PB 2XCPA 3JYTA 1TL3B 5EUHA 4IFYB 3DI6A 1HYSB 3MECA 1UWBA 4NLVA 4YR3A 4HYKA 1VRUB 4FBUA 2YKNB 4TYAA 3OLBA 1TP7A 1RT3B 3D5MA 4O3SA 4O4GB 2RF2B 1S97A 5F8GA 1LWCA 3V6HA 3GIJA 2C2RA 4EO6A 4B3OA 4K4ZA 2ZKUA 1EP4B 4K4SA 4O44A 2R2SA 1HARA 5KFTA 1S9FA 4ED2A 1HQEB 4ID5B 5HBMB 2BQRA 4Y2CA 4KAIA 1T03B 2FVPA 3IGNA 2JEJA 1HNIB 1RT2B 1R0AB 2IJFA 3CDWA 1C1BA 2WONB 3HVTB 4O3RA 1RYRA 5J2QA 2J6UA 4ZMMA 2FLPA 3NKYA 1LW0B 1S1VA 3QO9B 4K50A 3N6NA 3T19A 3DYAA 1MMLA 2RDJA 4DL2A 4G3IA 5L1JA 2ZD1A 2W9BB 4WYLA 2O5DA 3H2LA 3CJ0A 3JYTB 4F4YA 4EBCA 4ECTA 1TKZB 2FLLA 2V9WA 4G1QB 3DOKB 1RTJB 3ITHB 2W9CA 2HNDA 3V81A 3H59A 3FQLA 3H4BA 2BQ3A 3LP1B 4Q0BA 4WFZA 2UVWA 1KLMB 3EZUA 2WRMA 4R0EA 4QW9A 1RT5A 1RTHB 1RYSA 2HNDB 3V81B 1EP4A 2VG7B 4IKAA 4Q0BB 1EETB 3BJYA 2FVCA 5KFEA 1S4FA 1IKVB 5KT4A 1ZETA 3D28A 4EBDA 1JLGA 1S6QA 1IKXA 2IA6A 3QGGA 4LSLB 1S0NA 4I2PA 4QW8A 3MR2A 3EPGA 5DQGA 3V6JA 3KLGB 2HAIA 4ED1A 1JIHA 4DL4A 1LWEB 2CKWA 1RAJA 4QWAA 1KHVA 5KFUA 1RT3A 1CSJA 3MEDB 2OPQB 5EWEA 1JLFB 2R8KA 4WFXA 1DLOA 2I1RA 4H4MB 3QIPB 4M95A 1HPZA 1TL3A 1TQLA 3G6YA 5I42A 4URQU 1HYSA 3H98A 1TVRA 3VQSA 3PVXA 2B5JA 3M9OB 4G1QA 4X2BA 4KKOB 2WCXA 4JUZA 1HNVA 4K4WA 3KK2A 3LP1A 1WNEA 5CYMB 5L9XA 4IFVB 1S49A 4GC6A 1NNDA 2XCAA 2ASJA 4JV1A 1FKPA 1S9GA 3E01A 1S1TB 1RT5B 3KLIB 1C2PA 4I7FB 2OPSA 4ZPDA 2YNHB 2V4RA 1TKTB 1S1TA 1LW2B 3OHAA 1S1WA 4J9PA 2VA3A 3OL9A 1T94A 3M8PB 4O3NA 3SFGA 5C42B 2ASDA 5EWFA 1KHWA 2JEFA 2OH2A 3QIDA 1IKYB 5C25A 1QAIA 1RTIB 3RAQA 3QO9A 2FJWA 3JSMB 2JEIA 5T14A 4NLSA 5DGBA 2IC3B 5KFVA 5EWGA 2W8KA 4EYHB 2AWZA 3KLFB 3SI8A 3I5BA 4M94A 4ZVEA 1Z4UA 2OPPA 4ECVA 3Q8SB 1K1QA 5F9LA 5L1LA 1RT6B 5DQIA 2IC3A 3Q8PB 1S9EA 4RNHA 5DG8A 4J9MA 5F8MA 3UQSA 4IG0A 1TL1B 2D41A 4NYZA 3OL7A 3KNAA 2IBKA 1D0EA 2UVVA 1N56A 4NLUA 4TYBA 4NLXA 1TL1A 1S9GB 3CJ5A 1JLBA 2ZE2A 4RW4A 4ED6A 4GC7A 2WK4A 3BSAA 3PW5A 4Y34A 1S10A 3ISND 2YNHA 2HMIA 4IRKA 3PR4A 1RDRA 3HKWA 5HP1B 4J9RA 1S6PA 4H4OA 4RNNA 4RW7B 4H4MA 5KG3A 2BQUA 5KFPA 1REVB 5HP1A 2B6AA 1SUQB 4YR0A 3BR9A 5DLGA 4YQWA 3OHBA 4R8UB 4NZ0A 2GIQA 2HWHA 2AGQA 4IFVA 2VG5A 1J5OA 4O3OA 1DLOB 4RZRA 4QWDA 1SH2A 3IS9B 2IM3A 2B5JB 1XR7A 3H5SA 4LQ3A 2R2RA 2R2UA 1TV6B 2IM0A 1TKTA 4O3PA 2BE2A 2V4QA 3KK2B 1NHVA 4ED8A 1IM4A 3GV8B 3CO9A 4NLGA 3V4IA 3CJ4A 1RT7A 3KJVB 2JEGA 3GIKA 4EEYA 4MFBA 2BE2B 1XR6A 2ASLA 1S6QB 3T1AA 3KK1B 2AX0A 3PR5B 3ISNC 4QWEA 4KO0B 2R8IA 5KT7A 3C6TB 3M8QB 4IDKB 1XR5A 4NCGB 5J1EA 4DL7A 4Y2AA 5F8HA 2CJQA 1BQNA 3NL0A 4KO0A 4NLOA 5J2PB 2FVSA 4ZHRB 4ZVHA 4DL5A 4KV8A 4XPCA 1T05B 4IG0B 3JSMA 3BSOA 4K4UA 3BREA 3DLGB 3T5KA 5D3GB 4ED0A 5KFMA 3M9MB 4ICLA 3KLFA 3NBPA 2XGQA 4KBIA 4K4YA 2VG5B 4TY8B 1J5OB 1LWCB 2AU0A 4K4VA 1RT6A 4O3QA 4WYWA 3KHGA 2IAJB 5DLFA 4ICLB 2ATLA 3IS9A 1QUVA 2IM1A 4NRTA 3PW2A 1T03A 2HMIB 5KG4A 4MIAA 4TLRA 4URSA 3PW7A 5F8NA 2YNFA 5J2NA 3DRRA 3QGIA 5KT3A 4MK7A 4NRUA 5KFDA 1U09A 1HMVB 1REVA 5DG7A 4Y3CA 2E9RX 4ECWA 1SUQA 4ECUA 1N5YA 4XPEA 3C6TA 3IRXB 3NMAA 1UWBB 4ZP9A 3BGRA 3C6UA 5KT5A 4H4OB 1BQNB 1ZTTA 4ZP7A 2HNZB 2D3ZA 3QGHA 3I0RA 3I5AA 5CYQA 3T5HA 4FS1A 3PHEA 4EYIB 4OL8A 3IG1A 5KG1A 4IRCA 3GQCA 2WOMA 1S9EB 1S0OA 2W7OA 4EBEA 3QLHA 3LP0B 1S1XA 3FQKA 3LP2A 1HQEA 2FJVA 4RW9B 2IAJA 2C2DA 3QLHB 3KMSA 4U7CA 4J9QA 3KK1A 5KFGA 1RTDB 2FJXA 5F8IA 1JLBB 1K1SA 2ZE2B 4RW9A 4TQSA 1HQUB 1RTIA 1JLGB 5K14A 2ALZA 3DLKB 5KFWA 3I0SB 3N6MA 3V4IB 1OS5A 5KG5A 4ZHRA 3HVAA 1LWEA 1RT4A 1SV5A 3CJ3A 2RDIA 2XWYA 3I0SA 4NLDA 1JKHB 3GV5B 4URGA 4R5PB 3M8QA 4IDKA 5J1EB 3MR3A 4F4WA 4Q8EA 1RT4B 3NAHA 1SV5B 1JLFA 3DOKA 1GX5A 4MK9A 3MEEA 4IH5A 1HPZB 4YP3A 3I0RB 5CYQB 4MK8A 4O4GA 5HROA 4RNFA 4I2QA 3H40A 3DLGA 5D3GA 1S48A 4KHMA 3KLHA 4LQ9A 5HLFA 4B3OB 4ZPBA 4TY9A 5CYMA 1EETA 4J9OA 2YNFB 3PW0A 3FFIA 5J2MA 3DOLB 3KLEA 5HLFB 3H5XA 2HWIA 4WZMA 4LSLA 3QZ7A 3RAXA 4ED3A 4K4TA 1DTTA 3FFIB 5F9NA 3DRSB 4KE5A 1FK9B 2WHOA 4DL6A 5FDLA 3PJWA 5KFAA 5KFIA 1C1CA 5KG7A 4ZP8A 5JXSA 3GIMA 3V6DA 5C25B 1DTQB 2OPQA 1MU2B 1RA7A 2I5JA 2HNYA 1S1UB 5FDLB 3EPIA 4Q44A 3QIPA 3IG1B 2F8EX 4R5PA 5J2PA 3KHRA 3RB4A 1N5YB 1JLAB 1MU2A 1TKZA 1JXLA 3PZPA 2YNGB 1JX4A 2C2EA 1S1XB 3BGRB 1TKXB 3C6UB 4KHRA 5DGAA 2AGOA 4IG3A 2HNZA 2J6TA 4PWDA 1JLAA 2IJNA 2W9CB 3Q8RB 4IRDA 2GIRA 4MH8A 3PJXA 5KFRA 3NGDA 3KHLA 3MR6A 3MFIA 1IKWB 1C0TA 3CIZA 4IG3B 4RNOA 1RTHA 3CDUA 3HVWA 1JLQA 4QPXA 3LP0A 3Q8QB 1JLEB 4RW4B 1IKVA 1LW2A 4IQXA 2BANB 4WE1A 3RB6A 4ZVFA 2UVRA 1I6JA 2B43A 4ZP6A 3DM2A 3H5UA 5C24A 1QE1B 4XO0A 4FBTA 4DL3A 5DQHA 4O4RA 3GV7B 2YKMB 2OPRB 4LSNB 2RKIB 3TQ1A 1S6PB 5KFFA 2UUTA 2AX1A 3FSIA 4DG1B 2EC0A 4MKBA 1DTQA 2W7PA 2IMWP 3RB3A 3NBPB 4J9KA 5KG2A 2JLEA 5I3UA 1RTJA 3ITHA 5KFXA 2C22A 3GYNA 4ZVGA 2VA2A 4IR1A 4J9LA 1VRUA 4JV2A 3UR0A 3LALA 3MEGA 3MF5A 1SH0A 4WXOA 5KFKA 4MKAA 4RUCA 3BSCA 3DMJA 4MIBA 4RW8A 4F50A 1NHUA 3GIIA 2R8HA 1DTTB 2J6SA 5KFNA 5KFLA 2AGPA 2FVQA 4TXSA 2BRKA 1ZTWA 5KFZA 3DMJB 3KLIA 4RW8B 4RU9A 4ED7A 5L1KA 3KMQA 3MTKA 1RA6A 4U6PA 4IH7A 5KFCA 1RT7B 3KJVA 2ILYA 3KLEB 1HQUA 3OSNA 1N6QB 5KFOA 3G6XA 2DPJA 3OLAA 2HNYB 2JC1A 3HVTA 4QWCA 2GC8A 4YR2A 4ECQA 1IKYA 3MEDA 4NLWA 3TAMB 2B6AB 3BQ1A 4FS2A 2W8LA 2XI2A 3KOAA 4Q45A 1BQMB 5KFHA 3V6DB 3SFUA 4IOBA 4R8UA 5I42B 4PWDB 2WOMB 2ZD1B 3LANA 4KV8B 2W9BA 4DEZA 2FVRA 3RB0A 1S1UA 2I5JB 2BR0A 3GILA 4KKOA 5L1IA 3DDKA 4Q8FA 3FDSA 1N48A 2E9TA 2UUWA 1RT1B 3CDEA 1RTDA 1VRTA 4TY8A 1TV6A 1FKPB 3E01B 4H54A 5EDWA 3KLHB 3RBEA 1QAJA 3H4DA 1R0AA 3H5YA 3KLVA 1RT1A 4I7FA 1QE1A 3DLKA 1KLMA 1FKOA 3TVKA 5DG9A 3G6VA 3DRPA 2XI3A 3DOLA 2WTFA 1S1WB 2DPIA 2VG7A 2YNIB 1JLQB 2FLNA 2BRLA 2JC0A 3DRRB 1GX6A 4JV0A 3DRPB 1JLEA 4ECSA 4F4XA 4IFYA 2D3UA 5KFQA 4NCGA 3MR5A 1IKXB 1FK9A 1HMVA 3DLEB 2YNIA 3PW4A 1C1CB 1YVFA 2XC9A 2YKNA 2R2TA 5F8LA 2ILZA 4HKQA 4NLTA 3MEEB 5JUMA 1W25A 3KLGA 4KSEB 4YMEA 3IN5A 2YKMA 4ECYA 3DLEA 5C5JA 1BQMA 5KFJA 2WB4A 3IGVA 4I2QB 3LAKA 2C28A 4DG1A 4F4ZA 4NLPA 1LWFB 3CVKA 5KT2A
chains in the Genus database with same CATH superfamily
2F4FA 4PCQA 4GO5X 3TR5A 2GVZA 1HNIA 1RT2A 2V0NA 1RAOA 2HHQA 1WOPA 1VC5A 1IWAA 3E8OA 3S6EA 2HVIA 4C0HA 1C0TB 2DGWA 1JLCB 2IVMA 1QM9A 1XN9A 2LQ9A 2OELA 4AYBD 2MKKA 1FF2A 3C46A 2YKPA 5F8JA 3P5BP 3CC2S 3MDFA 3BQ0A 3K5OA 4F7VA 4NMXA 1UVIA 1V3RA 1KVIA 4ZIVA 2QL9B 2XS2A 4BC9A 2H4WB 5JJBA 1GXLA 4RX6A 1VQKS 3R6GB 5C24B 4PR6A 3HPOA 2R8GA 2WSFC 1MN9A 2RBFA 2HS4A 4J5OA 4OX9F 4FKYA 1ZZFA 3MAQA 2XHWA 1V5VA 3KHHA 5HMWA 3FBFA 1HD0A 2BOAA 2L41A 5J1PA 1AB8A 3EDRB 4C8LA 4LF8J 3OFHA 2Z56B 2E9ZA 4WU3A 3FEZA 3S1TA 2QE5A 2UVUA 2ROEA 2AYBA 3GLJA 4Y0FA 4A8FA 3Q86A 4NCAA 1O6XA 3SV4A 2Z2ZA 3EVWA 2C2OB 3OQ2A 1K47A 2F9DA 2XSJB 1D1UA 1NM2A 2QV6A 4K4XA 2A6MA 2BKNA 2FZGB 3DLJA 3NAIA 2OPPB 3E3XA 5B0EA 4O44B 3LPYA 3CJKA 2CPJA 5HROB 4RW6A 3H25A 3A4TA 5HBMA 1TUVA 1VQSA 3G9CA 4F02A 4NI2B 4UY8T 3PIPQ 3IWXA 1N36J 4FNHA 1NPKA 2XYGB 3MPVA 5AE2A 4ECZA 3I56S 2W9AA 1VC0A 5KFSA 4C0OC 5DM7Q 3PY8A 4I56A 2OPSB 3A8JA 1RHRB 3MWBA 3MAAB 1LW0A 2LXUA 5K14B 2V6AA 1MN7A 3M8PA 2RKIA 4NLQA 1TL7A 2RU9A 3QATA 1T9YA 2XHCA 5D0EA 3MPYA 2XM3A 1QSLA 5IT9U 1I3OB 3K5LA 4CM2A 1N6QA 1HNXF 4JI6J 5GMDA 4KPCA 4A48A 1SL0A 1VLOA 2GJIA 3X1LB 3JYTA 1ULRA 3C19A 1E6VB 2V63A 3IO1A 4KGVB 5EUHA 3HD1A 2YWFA 5F3TA 4HDGA 2DGQA 4ZVPB 5M2UA 4YR3A 2J0QD 3DRXA 4OJ3A 1R0CB 3OLBA 2LXIA 3KFWX 4O3SA 1AROP 4BBYA 4DV5F 1OQ3A 1VQMS 1BUXA 3LOUA 1CJTB 3NG8A 3VAHA 3W7BA 2RSQA 1UFKA 1RWUA 4B3OA 1SJRA 5EN1A 1EP4B 1UAWA 3HI9A 1O0PA 5DETA 1S9FA 1RZMA 4ED2A 2R7XA 4LBHA 4PG8A 4Y2CA 4KAIA 1S59A 1T03B 3IGNA 1KFDA 1R0AB 3TRGA 1E6YB 2O01C 4F04B 5LSLA 2PI4A 2XTDA 5J2QA 4FPRA 5LMUF 2P5VA 3PV8A 3NKYA 1S1VA 3AD7C 4P6QA 3SCJE 1L3UA 4DDFA 1MWYA 2ZHAA 1S76D 1HBOB 5CABA 4YB5A 2N3OA 4OV1A 1MMLA 4G3IA 4OYMA 4PWUA 5HANA 2K1RB 1FTCA 2W9BB 2YBVA 3OD2A 3GJTB 4GMKA 4W4MA 1J27A 4LF7F 4LREA 3H2LA 1SBRA 4WP8A 4HI2A 8AT1B 2R9LA 4F4YA 4EBCA 1ARRA 2KFZA 4KH1B 4QIEA 3MM8B 2F4VJ 2QN6B 2KRBA 3ETMA 3OUYA 1DY3A 2UUBF 1NLAA 1NKBA 2DCLA 3BO3A 2KO1A 1RTJB 2NQPA 2W9CA 2HNDA 1SC6A 3H59A 4JP8A 3I87A 3H4BA 2AP6A 1TK8A 4Q0BA 1KD1T 2MY8A 2UVWA 1KLMB 5CD4A 4N56A 1B7FA 1R8PA 2EFPA 2WRMA 4M5KA 3IM8A 4QIVA 1YDLA 2YX4A 2Z4PA 2E1CA 2E1PA 4G1IA 4Y2IA 3G96A 1LV5A 1WOOA 4LRVA 3GCXP 4DI6A 3B6BA 4KT0C 1F6TA 1WG4A 2UUCJ 2A2DA 2BUNA 2PT0A 4EBDA 1IKXA 3US5A 4OZ1A 4QW8A 2OIHA 1D8ZA 1FFWB 2L3MA 1KQSR 1LWEB 2RRBA 2AV5A 4PAAA 3O44A 2BX6A 4DPOA 1TL7B 3MMCA 1RAJA 4QWAA 1NK9A 4EZ9A 4DR4F 3K8VA 1RT3A 2OPQB 4N76A 4ZK7M 2C2MB 3ILOA 2MXYA 1U8WA 2CPZA 1RAAB 1HNZJ 4DF8A 1HW8A 2DHXA 2J0WA 4H4MB 2IVFB 3RTVA 4M95A 4B3TJ 1SIWA 1KS2A 2H65B 4PPDA 3R5GA 7FDRA 1P94A 2D69A 2E7WA 2YH0A 1UZDA 1WHXA 4G1QA 2V5HG 3IAM9 3TEGA 5AE1A 1RYSA 4JUZA 2AJ1A 3N5BA 4KHPF 3LP1A 1U6ZA 2MZ1A 5GAEU 4YHHF 1DURA 3DLLQ 1RAIB 3VTIA 1FKPA 1UETA 1PSDA 2R7QA 3JSYA 5G0RA 2GQCA 2A3JA 2RVJA 4DUYF 1KSPA 1XK8A 1RWMB 4LF5F 2DIVA 3KLIB 3TWZA 2BZ2A 2UZAA 3OXLA 2HBQB 1HWUA 4DR4J 4LF9F 2OPSA 4DUTA 3OHAA 1TUWA 1NK8A 1SKRA 3ULHA 2CPEA 2VA3A 3M2RA 3OL9A 4O3NA 3S7RA 2ASDA 2BSQE 4FVMA 2OH2A 4ZVTB 4CH0S 7AT1B 4KH0B 2IIHA 1QAIA 4FYDA 4USIA 2XMAA 3CMAS 4Q7AA 3RAQA 4DV7J 2FJWA 1RBAA 1VQ4S 4JV1A 4Y2MA 3QSYB 4EGLA 2VBWA 2IC3B 5IV3A 5KFVA 3SI8A 3MPWA 4B9VA 4UZCA 2MZRA 3BH7B 1VGYA 1TL5A 4EI2A 3P49B 1S5ZA 2A2BA 5F9LA 3WHIA 3CSKA 5L46A 1RT6B 5DQIA 1UA1A 1X60A 3Q8PB 1S9EA 4RNHA 4DPWA 5DG8A 2XO7A 2M5YA 3UQSA 3BV8A 3GJQB 2W2PP 1HWIA 5EX3A 4DV4F 3UCUP 1TZ0A 3OL7A 3KNAA 3WBZA 2OMLA 4CLKA 4NXMF 1D0EA 2DNPA 4LF5J 1ZAXA 1N56A 5IC6B 4NLUA 3MAHA 1NXIA 4NLXA 2PEHA 1TL1A 4WWSA 3UCGA 3LA0A 2ZE2A 3HF5A 5K8PA 2OTJS 1ZM3A 2Z58B 2NLWA 2ZBRA 3FCHA 5FIIA 4L3NA 3A8IA 3PW5A 2XYPB 1YJUA 3A3PB 2GMJA 2J0XA 4E98A 2YNHA 4DL0C 2HMIA 2OMOA 2RS8A 2PDAA 3HKWA 4J9RA 1MWQA 1S6PA 1AW0A 4RNNA 4CLTA 3OTOF 1CJKB 2WZ1A 4H4MA 4M5LA 5KG3A 3TX0A 2DNYA 2JRSA 4PG6A 4X4OA 2LECA 1DZ5A 2MJUA 2XZDB 1VQNS 2GO9A 2R7VA 2ZBPA 5HP1A 1VS3A 3VEBA 1WKJA 1FEHA 1BC6A 3J81U 1SIZA 2KHCA 5DLGA 4R8UB 4Z2XA 5C2CA 4Q44A 3K0JA 4QU7A 1GK8A 1ZOTA 2ZHOA 3PFOA 4PKDB 2VDIA 3PYDA 2X1GA 3THPA 3PYFA 3FT7A 2AZ1A 3H5SA 4DBQA 2P8IA 1TV6B 3R1HA 4O3PA 5GAGI 2K8GA 1X9MA 2OP5A 4ED8A 3GV8B 4NLGA 3CJ4A 1RT7A 2JSXA 3GCWP 2IY5B 3D6HB 3MEKA 4MFBA 1XR6A 2BE2B 3C15A 4EEYA 4DV1J 4LBIA 2JNJA 4M5DB 2AX0A 2ASLA 1N34J 3IAS9 3P3DA 1QAYA 3TOQA 1AYEA 1GFWB 2GQ2A 3ILIA 2R8IA 3C6TB 4IDKB 4MIWA 2UUBJ 4NCGB 4DL7A 2E44A 1KTVA 2IVYA 1Q8BA 5F8HA 2CJQA 4N7TA 4X4UA 1BQNA 4A8OA 4IO1A 4WP3A 1LEOA 2IDLA 3VR1A 3X3UA 3JSMA 2MHEA 1BQXA 2FZCB 2W4CA 3DLGB 3FGVA 2OUGA 3QSIA 4ED0A 1Z2LA 5KFMA 2ROPA 4ICLA 2CVIA 5C7PA 3N79A 3FMBA 2HHSA 1VR6A 4Q2MA 5B0AA 2BW7A 5LMUJ 2N4DA 1JJ4A 1CS4B 1FEEA 1VBZA 2BA9A 3MUTP 2CQPA 3D9BA 1RT6A 4QJVA 4WYWA 1Y5LB 2P9EA 3P45B 1H2VZ 1NKEA 3IS9A 2EFGA 2V8GA 4WIIA 3W2WB 3VAFA 4A8QA 1FNOA 1WTBA 3FKBA 2HMIB 3CDAA 5KG4A 2MSSA 4W92B 4MIAA 2CPHA 1FD2A 1MMDA 2YNFA 5J2NA 2HVEA 4KJIA 1X4BA 2GJFA 1VFJA 3ETOA 5E3CA 1EQMA 1B99A 1FE0A 2NXCA 4N47A 2FPHX 4OJGA 3QT6A 4ECUA 1N5YA 4XDCA 4XPEA 2QLFB 5GAGU 3ZZTA 4YY3J 1NKCA 3NMAA 1UWBB 4ME7E 4ZP9A 1UZHA 2NPIA 3GJRB 2IDEA 1SQGA 3C6UA 2D9PA 3D6MB 3JSBA 4HL9A 4ZP7A 4PG4A 5KT5A 4BWMA 2K7JA 3R8YA 4K0KJ 4LF4F 4F4KA 3T5HA 1FXDA 2HEKA 4FS1A 5K5MA 3PHEA 1TR0A 5KG1A 4FF3A 4ER8A 1KDNA 4I4BA 1S9EB 2D68A 3GQCA 1S0OA 3QLHA 3SXLA 2Y9HA 1WORA 2DK2A 4DCJB 2KKEA 4NL5A 3T1YJ 4OHVA 2IAJA 2ZH8A 1SJFA 5HJYA 3SSSA 2X1FA 1FRXA 1NUEA 2QYCA 3PEHA 4LT6A 3W5YA 5K8OA 4DSIA 4GKJJ 3D0HE 2ZE2B 2W2OP 4RW9A 1RUSA 1FWPA 1FRJA 1WHWA 5K14A 1MMNA 4ZLJA 1VHFA 1WHYA 1M5KC 3UDCA 2W4DA 3NOGA 3IWNC 5B08A 8ATCB 4ZHRA 4BS2A 1L3VA 2M88A 1SL2A 3OVAA 4DFJA 2V50A 3I0SA 4NLDA 3CJTA 3TA2A 2ADLA 2CG4A 4R5PB 2KI2A 2WB1D 3M8QA 4ALZA 4F4WA 1ZPWX 1RT4B 4FXEA 2IA0A 4ZVOB 4DN0A 4YP3A 1HPZB 2CJXB 1SC1B 2V68A 1UVJA 1F60B 1S7IA 2EC2A 4WCEQ 2CRLA 5K9FA 5GMEA 4B9MA 1B7YB 1PIEA 2OEMA 3DLGA 4NWBA 4C11A 1D3WA 4KHMA 3H40A 4OQJA 4ZCLA 4TY9A 5CYMA 4PZVA 1TU0B 2YNFB 5T7LA 3T9ZA 2HPUA 3ZTRA 4C7QA 2AYGA 2FIUA 1RKIA 1CS4A 2VC1A 3FFIA 1R0BG 3MGJA 3NNCA 1O51A 3I82A 2C1EB 2COLA 3TW0A 3ZZZA 2WSCC 2E5JA 2GA7A 2E5LF 4RWXA 3QZ7A 3EXCX 4Y28C 3RAXA 2M52A 2BJ3A 4JI0J 1HKAA 4DSLA 4U96A 1XNQJ 2ZZNA 2HG4A 2J7KA 3J7AN 2KL8A 1RU2A 2LA6A 4P2FA 2CJAA 2V94A 4DQQA 2WHOA 1TL4A 4QBUA 1C1CA 2GJ2A 3FZBA 4DR1F 2CAXA 3V6DA 3UVJB 4PG7A 2IRYA 1AXQA 3FMWA 5C25B 5KOWA 3F41A 3NY0A 2CQDA 4AD6A 2I5JA 2F5GA 1Q8LA 3OJUA 1N5YB 3G87A 3Q2SC 3HHLD 3KHRA 3NCQA 5A2QY 5FD1A 1JXLA 2B8QA 4QR0A 3OUYB 1S1XB 1S6OA 4M5GA 2UUAJ 4KGKA 3HSGA 1Y0HA 1EHWA 1JLAA 2LQJA 1Q8IA 3K8WA 4OIXA 4OYZA 4MH8A 3PJXA 2W9CB 3KHLA 4IRDA 4JI0F 1KR4A 3NP5A 1QY7A 1IKWB 2QYGA 2BE9B 3CIZA 3R5DA 4IG3B 3ZFVA 2BKPA 2CJKA 1GH8A 4F2SA 2J9EA 2VD3A 2HZVA 3CDUA 3W2WA 1TFWA 3LP0A 4RW4B 1KQKA 1LW2A 3EICA 3VVTA 1BHNA 2BANB 3RB6A 1HBNA 4ZVFA 2VL1A 4ZJLA 2B43A 1UMJA 2NYHA 3H5UA 2UVRA 4NA2A 2W1BA 1HBOA 1WSRA 2HLTA 2E7XA 4X65J 2DRAA 3ET6A 4L3KA 3GV7B 3N4WA 1H7WA 2RKIB 3R5JB 3R7BB 2AX1A 2HFZA 3G82B 3FBCA 1DTQA 3CT9A 4MKBA 3PACA 4RLEA 3MM8A 2F8MA 3RB3A 1BDVA 4DQSA 1V6HA 3W8PA 1BXNA 2B9XA 2JLFA 2BXJA 2PGCA 2RRAA 3MM9A 3M8WA 1N34F 2DR5A 2VA2A 4IR1A 3V4MA 4F0KA 1UPPA 2EFVA 2W2QP 2I0XA 2APOA 3SYZA 1CC7A 1OY9A 4L74A 4A8YA 2JXGA 2WVFA 4OJ1A 3S01A 2QT7A 3NMRA 1D9FA 4P7TA 4WTOB 2V8VA 4K5SA 2OSRA 1WOSA 2HIYA 3L7OA 1YJNS 5KFNA 2G4BA 1QAXA 2YPZA 3A1YG 2FVQA 4XTTA 1SJQA 4LF6F 2JHEA 5KFZA 3KLIA 4RU9A 4ED7A 3R2DJ 4NYPA 5J1NA 1DQAA 3BGLA 3D3BJ 3DU5A 4KC5A 3KJVA 2VONA 3L9ZA 3OVBA 3G6XA 2MLXA 4ZN3A 2AIRB 4D8JA 3WIVA 4FZVA 1ZAVA 1F9FA 5BJRA 3MEDA 2CNOB 1RWOB 3H7HB 3LTOA 4HACA 1TTHB 2W8LA 4LFBF 4CO2A 4QYRA 2FJDB 3V6DB 3MCOA 3NCPA 2CQCA 2OEKA 3QRPA 4EMDA 1PYTA 4YY3F 2XZWA 4NA3A 4DV3J 4UW2A 4DEZA 4F8RA 2I5JB 1PARA 1RP5A 2OI2A 3UNYA 1AZSB 1X4DA 1XIQA 4CRJA 2GVZB 3KTQA 3LJPA 3FVYA 3JXOA 1N48A 4Q8FA 1EB0A 1WEZA 3Q8VA 4DUZJ 5D77A 3U02A 1CC8A 1FJGJ 2G13A 1FKPB 1Q78A 2VKRA 3D1HA 4H54A 4DSFA 1WF2A 2PFDA 3H90A 4UOFA 1QAJA 1UCNA 2BNWA 3JTPA 3KLVA 1QE1A 3DLKA 2DH8A 4C3LA 3DRPA 2ZC3A 2AN7A 4ZITA 2GCFA 2XMKA 4FYWB 3F73A 3CCVS 1TFYA 2QSFA 2YNIB 1JLQB 4JV0A 1Y9OA 2H1YA 5A0YB 3GYXB 3HX9A 2MGZA 1FO1A 5MAOA 1IKXB 1FK9A 1PGZA 1RHUB 3AOCA 2M0GB 3J80Y 3D2WA 3KKFA 4HKQA 2J7WA 3MEEB 3MM9B 5JUMA 5LMNJ 4KSEB 4YMEA 1FNMA 5FLXU 4P9SA 1YBAA 2RQKA 2H54B 3DLEA 5C5JA 1BQMA 4LFAF 4OHZA 3QFHA 3SDEB 2UXBF 2HBRB 4NLPA 2KB2A 4OHXA 5HJXA 4PYAA 2XLJA 2HHUA 3UPFA 3V6KA 3VW4A 2CQ4A 2YWGA 5HK4A 4DMZA 1BDTA 1FRLA 2WVDA 3K89A 3OL6A 1P1LA 2NS1B 2QLBB 1H98A 3E51A 2UXCJ 2M2BA 1M1GA 3OL8A 1RE1B 1UKUA 1UW9A 2H3EB 5DDOC 2DO0A 2Z8QA 4USUA 4RNMA 2C2ZB 1FVQA 4UZBA 3BEGB 1N4LA 2GV1A 3W8GA 1EKRA 1U48A 5L9NA 2I9SA 3M9NB 2KFYA 1EAYC 4FKXA 1GQEA 1A7GE 3BQ2A 4RW7A 2AQ4A 4PWDB 1AUSL 3MFHA 4J9SA 3LAMA 1Q81T 3U1NA 1LXNA 1SVDA 1IBMF 4OZ0A 3IRXA 4O0NA 1PBUA 5CAAA 4P2XA 2H1OE 1ZS6A 1PKUA 2D9OA 2MLZA 2QMWA 3D0GE 3CWJA 2RIJA 3DYAB 4ZDNA 4DFMA 4B3SF 2CQ0A 4I64A 2QMXA 1W2BR 3W65A 4RUAA 1VIOA 2NUUG 1IBMJ 2LEPA 2LEBA 4IH6A 4ECXA 3GZ7A 4PUOA 1VOMA 3EMTA 1HNVB 3T5JA 1N0UA 4ZPCA 1Y00A 3M7VA 4B3TF 1T3NA 4Q43A 4PABA 1R8HA 2KYZA 2XZ2A 5B0FA 4CT9A 3UDLA 2VG6A 3H2VE 4WE1B 3KJNB 3BSNA 4DFKA 6FD1A 2XO6A 3RBDA 5E0OA 4WP9A 3Q8YA 4KFBA 1U1OA 4PXBA 1C4AA 4WXWA 5J2MB 2DNRA 3CXCR 4J9QA 2ZDPA 4A8KA 1S1VB 4WFYA 4FDFA 1WKLA 2GPEA 1OPIA 1NCLA 4KB7A 4Y65A 2AMCB 1F9HA 5IC4B 4ZLPA 4TQRA 1TMMA 4J9NA 1E6VA 2EKNA 1WG5A 4ZPWR 3THVA 1NLKL 4IR9A 4QWBA 2HQ3A 3SQGB 1U8SA 2GAGC 4I2PB 4DXLA 1R8BA 1GEHA 3R9LA 1J5EJ 3TP2A 1TL3B 3OTEA 1F2GA 4IFYB 3DI6A 3TVZA 1K8AT 1UEUA 1H2UX 3G4SS 1VRUB 1NAQA 3PRDA 1XMQJ 1Y5NB 2F3JA 4QIWD 3ZO7A 4ZLLA 1TP7A 3UD5A 3D5MA 3QJJA 2UXDF 1K73T 2F40A 5E3AA 1WELA 2HBYB 1DHMA 4ZVSB 2A2CA 4OZJA 2CQIA 4OYIA 2DHSA 1PYOB 3CJRA 4EO6A 3GIJA 4K4ZA 2HVDA 2MSTA 2UV8G 4C8MA 3M2UB 1E6YA 4K4SA 3WX8A 4O44A 2DISA 4HHHA 5KFTA 5IS2A 3PX0A 1CJTA 1FFSB 1OPZA 4ZN1A 5HBMB 3JSRA 3IC1A 2FVPA 2NXEA 3MOJB 1I51B 1RGVA 3IMQJ 1BD6A 4DJBA 2IJFA 4F2RA 1M0SA 4KYZA 1X5OA 2H5JB 2DR7A 2J6UA 4ZMMA 2EBGA 1VK8A 2A18A 1LW0B 1VHIA 4Y6IA 3JQKA 3QO9B 4K50A 5IQQA 2FLPA 1P9QC 4GVBA 2GFFA 2CNKB 2DNLA 3D1OA 3DYAA 1FXLA 4DR6J 2POKA 1OY6A 1HQ2A 2NZ4A 2ZD1A 2A6OA 4GKJF 4WYLA 3CEDA 4NA1A 2DNGA 3JYTB 4ECTA 3AH6A 3KUEA 2QA2A 1TKZB 3BF4A 5HMXA 3CE8A 4BHQA 2LQ5A 2EK6A 1PCAA 5ETRA 3CPWR 1TK5A 1T8EA 1EQ0A 3ITHB 2ZKTA 2MDAA 3FQLA 2KKHA 3LP1B 4C2MA 5IXUA 2XTJP 5AXNA 1HHSA 4I69A 5AJ3J 4DR5J 1S0VA 1OQ6A 3IBCB 3TUPA 4X64F 3V81B 2RILA 4CIOA 2VG7B 1IQTA 4IKAA 2JEIA 5T7LB 2ZJRQ 2DCUB 3BDEA 5KFEA 1S4FA 2ZM6F 5KT4A 3R2CJ 3CCJS 3A8EA 4MTPA 4C98A 1FRIA 3QOQA 1JMTA 1S0NA 4K2JA 5M2PA 2KTQA 3MR2A 3HULA 3V6JA 4NCBA 5HMZA 4ED1A 1UVKA 1IR2A 3TANA 1SJ1A 2RQMA 2J9DE 4Z7YA 1XNQF 1M1HA 1MROB 2W4PA 2M7SA 2WW4A 5BR8F 1PJ5A 1CSJA 3M30B 2WVEA 4JI2J 3IWLA 1VLYA 4DU8A 2CADA 5EWEA 3NRBA 4PQUB 3PG9A 1JLFB 4RL1A 4WFXA 3O8WA 1HPZA 2DIUA 1TL3A 1TQLA 2XBPA 3GONA 3U27A 4URQU 1RHJB 3HSJA 4OI0A 1TVRA 3VQSA 4A46A 2B5JA 3M9OB 1L3KA 2X7IA 1SC3B 4J7CA 4OFZA 3RGIA 1GMWD 4USHA 1FJEB 1URNA 3GU0A 3UD4P 1G4CA 3R5CA 1R89A 3KK2A 2XS5A 1WNEA 1WEXA 2K6LA 3CJ8A 3ILLA 1Q53A 1S9GA 3T41A 5D8HB 3VAIA 4C3KA 2BE7D 1K0TA 2DD8S 4JI8J 4YDDB 2JH3A 1S12A 4I7FB 4M8LA 2RT3A 5CCLA 3BN7A 1U1NA 4B3MF 4B02A 2V4RA 1G6BA 1LW2B 1R8CA 2BW2A 2EW9A 2MQMA 1S1WA 1T94A 3UNGC 3MMAB 1VIXA 2M9KA 1KHWA 1F3FA 2VASA 2XNQA 5DO2A 4C8YA 3AXMA 1QLNA 3QO9A 1NHKL 2GVDB 2ZWPA 3DXSX 5T14A 2YY3A 3L3CA 5DGBA 4E0DA 1N33F 1VQOS 4J90A 2ABYA 1RWPB 3T1YF 4ZVEA 1YTYA 2FY1A 1Z4UA 1NZ8A 1QD1A 2AJ0A 1K1QA 3JS9A 5C2GA 4OX8A 1RJJA 2GZOA 3AJ1A 4F0MA 5F8MA 3FSYA 2VH7A 1FDDA 3BR8A 2HHXA 4DS4A 1RLCL 3GTYX 1KWMA 4AL7A 1U2RA 2IBKA 2EG1A 1RAGB 1H72C 3N0VA 3I9ZA 2Y1RI 1RCXB 4TYBA 1AFJA 4PYDA 4RW4A 5DS7A 3IBWA 4E8UA 3C15B 4GC7A 4OZ2A 5LL6d 4Y34A 3HO1A 1T9UA 3GG0A 2KM8C 3ISND 2FC8A 2QA1A 3B4DA 2E29A 1VQ7S 3H20A 1R6VA 1U1QA 1JWWA 1RDRA 4HR2A 5HP1B 2FJBB 1P9YA 2H9ZA 2HRUA 4OYOA 2NPFA 2HQDA 4UT4A 4DR2J 1VQLS 5M2RA 2Y1IA 1NMEB 4UOHA 5KFPA 1REVB 2P9GA 2PMHA 5AXMA 1SUQB 4KGZB 5BR8J 3BR9A 2RHSB 1B01A 3BDPA 1AFIA 2YH1A 3SCIE 3UI3A 1FESA 2HWHA 2VG5A 3HLUA 4F3OA 1X4EA 1QUPA 3BS9A 5GADI 2B5JB 4USJC 2R2UA 5CD4H 4DQIA 2EEYA 1PAUB 1KOOA 2V4QA 3KK2B 2VHGA 1NHVA 2LVWA 4MAKA 1HFEL 1VQYA 3KG4A 3L95X 1I5OB 4BDPA 1YSJA 2MPUA 4QIFA 1K9MT 5AT1B 2JEGA 2GX8A 3K5NA 2HRTA 2WVCA 3L7UA 1Q82T 4I6AA 4GKKF 1URRA 1VJQA 2Z2LA 3KK1B 1HI0P 1EJ7L 2DNQA 4ELVA 1F5CA 1YRTA 3POTB 4QOTA 1XR5A 4ZCKA 3T6JA 2IHR1 3OXFA 4YUDA 3HSDA 4X4QA 2MGZB 3LWLA 3G71S 4F3MA 2K3KA 2NUHA 1MROA 2AHOB 4CLWA 2XLIA 4KO0A 4UTGA 2GMLA 1SKWA 4DL5A 4KV8A 1GMWA 2Q43A 3CD0A 1KVJA 2X1AA 1U6BA 2ZBQA 6AT1B 2DXEA 5D3GB 2KU7A 4E2FB 1LFWA 2CPFA 1RWKB 2CWKA 3KLFA 3NBPA 2XGQA 3D68A 3WQPA 4CH1A 4K4YA 3RR7A 1J5OB 2JZ5A 1LWCB 4HI1A 2AU0A 2G2OA 4O3QA 2DNMA 4LUBA 2IAJB 3A8KA 3MM5A 5EHHA 2G0JA 3D66A 3KHGA 2X3DA 1T9WA 5DLFA 2ATLA 3MUVP 2D3O1 3GB0A 3MAAA 1V3SA 5BXIA 2BMBA 4A8XA 2PIIA 2MZJA 2V2VA 3ZNUA 4DV0F 2I8EA 3W63A 4DSKA 2FHJA 2Q79A 1VQ5S 3IA0A 4ZJOA 3HMJG 2BEFA 1DQ8A 5KFDA 3UCZP 5DG7A 1WC4A 4Y3CA 1VBKA 2ACYA 2VPWB 3IXQA 4YOEA 4JI1F 3QAUA 1PILA 3U7JA 5A8RB 3W9JA 4C8OA 4JI5F 2HFUA 2VF3A 1S7HA 2ASYA 5ETQA 4ZCIA 3BGRA 2ZH7A 2G9OA 2B7CB 4H4OB 2DBBA 3MM6A 3UO0A 2HNZB 5H9EK 2UXCF 5HSPA 3SCLE 3VAKA 2V2KA 3G2XA 3TQEA 3G8SA 5CYQA 2XLKA 2H5EA 4C9DA 2CG8A 1X8DA 1VI7A 3J7YU 4EYIB 3CGIA 3GFZA 9RUBA 4YDXA 4EBEA 2GNKA 5E3PA 1RHKB 3FQKA 3LP2A 1HQEA 2HQGA 1D9DA 4RW9B 3RU0A 4RUBA 1FWLA 1H0HB 1U02A 3QLHB 1ZBTA 3VZIA 1IXKA 4MYTA 2UV8A 5KFGA 3KJQB 3KK1A 5F8IA 2DYAA 1B4SA 2VB6A 4TKTA 4ZVQB 5H9FJ 4DZ6A 4U95A 4EK2A 4WFAQ 2RNEA 2MLYA 1HQUB 1RTIA 1UUJA 2ALZA 3DLKB 1NDCA 4L73A 1SXLA 5D0GA 1RK8A 1OS5A 1KP6A 2OHDA 3CD7A 3FK4A 3JAMU 3HVAA 1K0VA 1LWEA 5HAOA 1SV5A 4M94A 3HHLC 1OJ4A 2XWYA 2J0SD 1JKHB 3MR3A 3M4XA 3QT7A 3U1MA 3MZIA 4DFPA 1I94J 2IRUA 1FI4A 2QLWA 4AFFA 3ZZ0A 1VQ9S 4LIWA 4KHPJ 3I0RB 2MKSA 1B3TA 4MK8A 4ZCMA 4CM0A 4WF9Q 3ZTOA 5IT0A 4X4TA 3KLHA 4LQ9A 5HLFA 3EXYA 2GAHC 4DLGA 2DGUA 1CBKA 2DJWA 2H5IB 4J9OA 4A8MP 2QEXS 1X4GA 4ELTA 1NK5A 5J2MA 3KLEA 1RI7A 2HFSA 1ITPA 4FXWA 3EVMA 1MWZA 3SQOP 4TU7A 4USTA 4H4KA 4ED3A 3PRBA 3K17A 2MEWA 2XEXA 5CZXA 3J81j 1FDAA 3UDEA 4NX9A 4DV6J 1NJIT 3ELHA 4PXDA 2YKOA 5GADU 1YJWS 5KG7A 1D09B 5KFAA 3GMGA 1X9SA 1GTEA 3A13A 3FCVA 1ZM2A 1G3OA 3F56A 3GIMA 2CYYA 2ZFHA 2DXFA 1X5PA 1DTQB 1ZA1B 2RE1A 4LRDA 2CJBA 1VRQC 3FC9A 4M5NA 3LGNA 1RADB 4KIAA 3QIPA 1BLUA 2F8EX 4R5PA 2DRBA 4NEZA 1JLAB 4YB7A 3VGVA 1YJ7A 3MM7A 4B3RF 5I4MA 4HT5A 3M6VA 4KHRA 3BGRB 2C2EA 1S72S 2U2FA 4IG3A 3M1VB 5IZHA 3BKUA 2V34A 2EVZA 2C2KB 2PI5A 3Q8RB 1XMOJ 2C3YA 3TJAA 3BYRA 3EX7B 3MFIA 3ISZA 3BKFA 5EGYA 4TLQA 2HFOA 2K2PA 3CJQA 2NR0A 3EGNA 2R7OA 4LF7J 3C16A 2Z0GA 1IKVA 3IR7B 4USVA 4DV6F 2O66A 3BBCA 3DFEA 4OI2A 4WE1A 2HHPA 4ANDA 4FYYB 4IQMA 4OI3A 5C24A 4CO4A 1YG0A 3NLCA 4CWBA 4XO0A 4DL3A 4FBTA 4O4RA 4WKRA 2GO8A 4S0MA 3QRQA 3P8BB 4OX7A 4UQGA 3W3SA 3UFCX 2YKMB 1BGXT 1UJ6A 4CYUA 3RR8A 4DR3F 4ELUA 3TQ1A 1S6PB 1M5SA 2AJFE 3OTBA 2E5HA 5A8RA 1FJ7A 3P96A 3MHYA 1VJWA 2MJNA 1FCAA 2FD2A 3D6FB 4RJVA 2KG0A 4H4KC 2CNLB 1U1KA 2B4PA 3HFVA 4J9KA 2DR8A 2XMJA 4OI1A 2HGMA 2FHKA 2HVZA 2ZITA 3ITHA 5KFXA 3VVUA 4ZVGA 4DN9A 3CCRS 4J9LA 4GRSA 4UUWA 2C22A 1LKZA 3UR0A 2CZ9A 3NS7B 4RUHA 4LF2A 1JNRB 1JK9B 1MG7A 4ZVUB 4RW8A 4MIBA 4RUCA 4F50A 5E3QA 3GIIA 1RCOB 1N33J 3N5FA 2KZMA 2FUG9 2J6SA 2XTEA 3W62A 4UOGA 1KQGB 2KT2A 4P75A 3M6XA 4TXSA 1RSCA 3DMJB 1Q7LB 3QFWA 2ZOMA 1ZZNA 3QWPA 2DGTA 3QRRA 2WSEC 3OTDA 1V5IB 4L72B 3HM9A 1HQUA 2HURA 4AQYJ 1YJTA 1X9WA 3LGMA 3HHLA 3MR7A 3HHNB 1HBUB 2HNYB 3U1LA 1HNWF 4W90B 3V2UC 4G1PA 2GC8A 1QTMA 2KG1A 1IKYA 4X84A 5BYQA 3UDVA 1R8AA 2B6AB 3BQ1A 3D3CJ 1CVJA 4Q45A 1EARA 1T9XA 1BQMB 2CIMA 2LP4A 5KFHA 2ZH2A 3K2YA 1U9PA 3BZQA 2XSJA 3BH6B 1WF1A 4LR9A 1QSYA 2QGFB 1Q4RA 2DPJA 2ZD1B 2FVRA 4JI5J 4HACB 2JFKA 3FNNA 1ICEB 3GFYA 1Q0NA 3GILA 2G0CA 3EZOA 1YBUA 2PA3A 3Q8UA 2P6SA 3VALA 2AZ3A 2VQEF 2IYGA 1YBTA 1B0PA 2HZCA 1VRTA 4DX7A 1MLAA 5F0WA 5D4NA 1R7IA 2QA4G 3H4DA 2UU9F 3A12A 5GVQA 1N5SA 3EWGA 2Q3PA 1YX2A 4JI2F 5GMKa 1FKOA 3TVKA 5KT3A 3TZZA 5DG9A 4A8WA 4ILLA 2Y8YA 4XK8C 4M5HA 1UTAA 2DPIA 3K59A 2AYMA 2JC0A 5D0RA 4FYVB 4F4XA 1SJ3P 1Q5YA 4NCGA 4V19J 2B56A 3CCQS 4LR7A 1U2CA 4FVCA 3PW4A 1YVFA 2IYIA 2YKNA 1W25A 1V9OA 2JOQA 2B7BB 1PJ6A 2YKMA 4CYUB 5LXRA 4N77A 2LQBA 3AB2B 2ZNZA 3CB4A 3GFHA 4I2QB 2H3AA 2ZH1A 3CC7S 4DG1A 3M32B 4ES2A 4DR1J 1LWFB 1IN0A 3CVKA 4PEOA 3MM7B 4JI3F 2V8PA 1NSQA 1IBCB 3HHDA 1X5TA 3OT9A 3BBFA 1NJYA 5KG6A 2G1DA 3CD6S 1G1XA 1HBMA 1FX2A 5I3UB 1C0UB 4YB6A 1WDDA 4JI4J 4U7UK 5KFYA 3PKYA 2G2YA 3FRYA 2YPYA 1NDPA 4KFBB 5ETLA 1S57A 3K5PA 4EO8A 5J2QB 2ROGA 2M4MA 3DRSA 1GXUA 2QIFA 1UFWA 4DR3J 3AJDA 2G1HA 1WD6A 2PE8A 3QZ8A 1XNRF 4ID8A 1SH3A 3ZTPA 3G86A 2D7SA 3TAMA 2B4UA 4YEAA 2DO4A 1Q79A 5CCMA 3EE3A 4DPTA 3I32A 4OYBA 4EWTA 3DI6B 1YRUA 1ARQA 3W5XA 1CULA 3N6LA 3SBMA 3WX4A 3TA1A 2ZBIA 3BM7A 4NLYA 1LQ9A 1CQMA 1VRTB 1Q95G 2HHHF 4WK1A 2VG6B 2XGPA 1FDBA 4X62F 2EBEA 1LK7A 1PYSB 2GHPA 3QYYA 1FKOB 3AX3A 1HA1A 2KT3A 1DBDA 2ZDOA 4ID5A 3R7NB 4M5JA 1DQ9A 2BANA 4PQAA 3VHQA 4PUOB 3JTOA 4NEYA 4OYWA 3OV7A 1OO0B 1ROFA 1WC1A 1C1BB 2EFQA 2ZOGA 2MZQA 4TN2A 4B08A 4CO1A 5KFBA 4KPYA 4FYXB 3R5BA 5KT6A 3ZZYA 5GAEI 3BPDA 4ZVRB 4F0HA 1Q7YT 3OR1B 4N8NA 4V19X 3H8YA 5D4OA 3UWTA 5DDPC 5K8MA 4NE9C 1NJWA 3MECB 2DNNA 2ZVIA 3R5AA 1WG1A 3UW1A 4P52A 5A76A 4CDIA 1UVNA 2XMWA 1SIWB 1N88A 4PPZA 1UWAA 3HT0A 1HYSB 1IR0A 4LRBA 4FBUA 2YKNB 4OYAA 4CLPA 1RT3B 2UP1A 4B9NA 2AY0A 1V3ZA 1T11A 4FXVA 3ONQA 2FQQB 2CQBA 2DH9A 1ZA2B 5F8GA 1R31A 4XAKA 2VUGA 2J7UA 4FNIA 4W98A 2XB2D 1LWCA 2HWTA 3V6HA 1APSA 2HQIA 2OLWA 2ZKUA 2IMOA 5H1SV 1HARA 1UJ4A 3RUBL 2R2SA 3M8YA 1HQEB 1VBXA 4B3MJ 1BWVA 2U1AA 1HNIB 1RT2B 2HKEA 1CJUA 2V67A 3I4PA 2DY1A 4KRWA 2MQLA 2WONB 4OZLA 1HWKA 3T9NA 3P6YC 2V69A 4O3RA 2RDDA 1RYRA 2EPIA 1TMJA 2V1SA 3M8ZA 3RBXA 2KXNB 3KDOA 4DS5A 2R7TA 3SZ2A 1U0HB 3QBCA 3VQTA 4B9LA 5D4PA 3T19A 2RDJA 5K8NA 4PXEA 1IVZA 5L1JA 1F0XA 3AOBA 3M2RB 4I68A 3EGZA 4RO0A 2K1OA 1OYEA 2O5DA 3H42A 3CJ0A 2PEBA 4LVOP 4A4JA 5JVHQ 2IJRA 2M70A 3L09A 1IJFB 4AL6A 3VCDA 1T3OA 4OJHA 3D7SB 4DV4J 1QTNB 1U7LA 3CNQP 3GYGA 3G8QA 3J7ZT 4NXMJ 1ZH5A 2PMWA 3V81A 1D8YA 1FE4A 1LFPA 4FF4A 4WFZA 4TNOA 4L6V3 2DGXA 1RT5A 1RTHB 3KXDA 3R97A 3M2UA 2XMVA 2L9NA 4MYUA 3M6UA 4C0BA 2FVCA 1FA0A 4WU2A 3CW2C 5JVGQ 1ZETA 1S6UA 3D28A 1XWLA 1JLGA 1S6QA 1YJRA 2IA6A 1RISA 2CQ2A 2VU5A 4G65A 1UL3A 2N7CA 3EPGA 5DQGA 4OZ5A 5LXYA 3KLGB 2HAIA 1IBKF 1JIHA 4C6AA 4ILMA 4DPUA 3DXBA 2CKWA 1UFLA 3M6WA 4RR5A 3QPIA 1N32F 5KFUA 2EI5A 3J81Y 3QAEA 3HFKA 3MEDB 2OFHX 1JNZB 4YFUA 3CJSA 1F3VA 2N7YA 3DOMB 2R8KA 1DLOA 4NZ6A 3QIPB 1LXJA 3OTOJ 2BJ8A 3G6YA 2DGVA 2GQQA 4LSZB 1HYSA 3C8YA 4AT1B 2JXIA 1XERA 2H51B 4P2MA 3PVXA 2AD9A 1YZ7A 1FRHA 2OFGX 1Y11A 2WCXA 3CCZA 4KKOB 5SZTA 1YHQS 4K4WA 1BY9A 4M5IA 2OSQA 4KR0B 2ADBA 1S49A 2XY6A 2LKZA 2EWHA 3M8SA 3E01A 5ETMA 3N28A 3PYEA 2GHWA 1C2PA 2BVZA 1Y4ZB 5GAHI 5D15A 4X66F 1SKUB 4QR1A 1FNXH 4ZPDA 1WC0A 2BV3A 1JB0C 1S1TA 2AT1B 5DJBA 4O23A 1XMOF 4J9PA 2Q6CA 2HS3A 2W25A 2VFUA 2MQ8A 3M8PB 3SFGA 3AA9A 4CLFA 1NSKL 3DHXA 1ACMB 3ENAA 3HD2A 2DITA 4C3MA 1FERA 2I6WA 2UXDJ 1RTIB 4B17A 4U8YA 4LFAJ 2XY5A 3JSMB 1EZZB 3MMAA 2CJYB 4CLYA 4NLSA 2ZOFA 1XMQF 2UUCF 4LF9J 3R7SB 2BBEA 4AQYF 1VMBA 2MHNA 4ETZA 1W26A 2Z57B 3LH2S 3UE2A 3I5BA 5L38A 5EWGA 4EYHB 2D3OR 2EXUA 2QFIA 3B82A 3IR6B 4FN5A 4ECVA 3OW2R 2XNRA 1RLDA 5L1LA 3VWSA 4P73A 4AUKA 2JJ4D 2MZTA 3MMBB 2RQCA 2HK3A 4J9MA 1NB7A 1RB0A 3TVYA 4N5SA 3NGSA 2ZEJA 2GIFA 2V8DA 4NYZA 2LDIA 3MD3A 1NU4A 3C14B 2K7KA 4ZOSA 2UVVA 2B8PA 3THTA 2B51A 2VKZG 2M8HA 1N6QB 2V1TA 1S9GB 1JLBA 3HP6A 3D67A 1CJUB 1GXTA 2V4JB 3PEJA 2AJ2A 3BSAA 4ATNA 1HW9A 1S10A 4JI1J 5LM7E 1FFGB 4YS2A 5K20B 3PR4A 2VZ9A 1KBRA 2E7VA 2IBOA 1HR0J 1KEKA 4AL5A 4JB8B 1U0SA 4RW7B 4UY85 2BQUA 1UJ5A 4U67Q 4B9SA 2QX0A 3KUHA 4LFCJ 1QTGA 2B6AA 1RAHB 5GAHU 3CCES 2KOEA 4YR0A 3G6ES 2VBXA 1N32J 1T0TV 3LO3A 1T9TA 4YQWA 3OHBA 1KN6A 4NZ0A 2AGQA 3JAMY 5BYRA 5A8KB 3K5MA 2Q1LA 1J5OA 1DLOB 2AYEA 4X4SA 5ADZA 4QWDA 2ZH5A 3T1HJ 2OO4A 1Z2ZA 3Q23A 4EZ6A 2GHVC 3EUNA 5A2QU 2P9CA 1XR7A 5LOQA 4LF6J 2HGLA 5IWAF 4R25A 1U1RA 5DDRC 1A9NB 1NDLA 2V2QA 3DDIA 2O1PA 4OHYA 3UR3C 3CO9A 2CXEA 2IPOB 2OAUA 3M05A 3NO7A 4R0JA 1W7WA 5KOXA 1S6QB 2QLJB 3T1AA 4FF1A 3TNVA 4I6YA 3C16B 2LYVA 2R7RA 1IQZA 4KO0B 5CA5A 2VC0A 1Y7PA 1OWXA 3TX8A 3M8QB 4DPYA 5KT7A 2MB0B 4NXNF 4C4WA 4OMFG 2E5LJ 1CJVB 2KM8B 4DUYJ 3MMCB 4XDDA 3NL0A 3EGWB 1FXRA 3OPKA 2IFXA 4NLOA 2J9DA 3Q83A 4HHJA 4ZHRB 5J2PB 1YQHA 3FZ2A 1YKWA 2RJZA 3BYPA 1JJ2R 4XPCA 1T05B 3CMES 3BSOA 4K4UA 3LQVA 3AX5A 1Y3KA 3BREA 1Q5VA 2B9WA 3PXGa 1MYKA 1HI8A 1R3NA 3GR1A 3M9MB 4DQPA 3BO2A 2YVSA 3PJ9A 2VG5B 4TY8B 4A47A 2X3GA 4K4VA 4DV0J 1NK0A 3AWRA 1FKAF 2PD1A 3TJ8A 3PM9A 4RBUA 2FLOA 2KRRA 3QGPA 1FHTA 5HATA 3C3LA 2R7WA 4M1KA 4CZCA 3MM5B 4URSA 3PW7A 5F8NA 4TVAB 3TA0A 1RKJA 2AJQA 4OX9J 3QGIA 2VQFJ 1NPRA 4V1Ak 4ZPVR 5DDQC 4MK7A 2BJ7A 4NRUA 1S4EA 1X4AA 4N8OA 4F67A 2VIHA 1U09A 2LQ8A 2E9RX 2ZH4A 3OBIA 1U26A 4CO3A 2JLGA 3POTA 2ZM6J 3SCKE 1W2IA 3NOCA 3JQMA 2MQQA 1GMUA 1NPPA 2DHGA 1PBAA 3TZYA 1ZTTA 2VOOA 2FYXA 3DKDA 4HH0A 3O3LA 4CLZA 4X64J 2D3ZA 2VFSA 3GSIA 2PMZD 3I0RA 3I5AA 3DCAA 4JI6F 3MCSA 2FHOB 3FSXA 4OI6A 1HNXJ 1BWEA 3IG1A 1T95A 2HBZB 3OFEA 1KKHA 1R27B 2J76E 2WOMA 2X51A 4XIUA 2W7OA 1XMBA 3D1QA 4N41A 1YZ6A 1S1XA 2E1AA 3LP0B 4K0KF 1X0FA 1Q16A 2FJVA 1NK6A 3ZZPA 1WJ9A 2RMLA 3CCWA 2MY7A 2GGPB 3CCSS 2ZBCA 4K2XA 4M5DA 1N36F 1RTDB 2FJXA 5MLCV 2HHVA 1JLBB 1G7CB 5CZVA 5HVHA 2BACA 3QJLA 4TQSA 5CH7B 3VAMA 2QRRA 4UQTA 4X62J 5THWA 2EK1A 1O5JA 2V8HA 1XQIA 3N6MA 2YKAA 3AA8A 1IR1A 3CDBA 4K8RA 2HHHJ 4DX5A 4JOUA 3I55S 1R6YA 1G2EA 3MD1A 5ITHA 2BJEA 2XMMA 3ET6B 2JEFA 3HZEA 3IRWP 1RAFB 2CQHA 4IDKA 2OTLS 1EX8A 1LNQA 3BB5A 1SV5B 3OTCA 3PIOQ 4Q8EA 1WEYA 3EYZA 4ETXA 1JLFA 3DOKA 1GX5A 4MK9A 3J7A1 4MKVA 4NZ7A 3CD5A 3NS5A 3P4UB 4J9VA 5CYQB 3UN3A 2F8HA 2J5AA 3NGKA 3CUNA 5HROA 1NH8A 4I2QA 1QDUB 5U47A 1P8GA 2LEAA 2VPYB 4B3OB 2A1BA 1IBLJ 2ZNYA 2VBYA 1EETA 2VPZB 2YKQA 3MURP 1F1BB 4NMLA 2Q2KA 3BGFA 5ETKA 3DOLB 2YTCA 5HLFB 3H5XA 1GTHA 4K7QA 4WZMA 4FP9A 4LSLA 1MYLA 4CH7A 3C2PA 3HJFA 3HK2A 2Y8WA 1DTTA 5B7WA 5IT4A 5RUBA 3T5KA 2B3TB 3LF0A 2HS0A 1NSPA 3DRSB 3HKZD 1FK9B 2E66A 2GMHA 4KE5A 5FDLA 3PJWA 5KFIA 1WC6A 3KDNA 2XQCA 4ZP8A 5JXSA 4OX6A 4LF4J 4U9RA 2VV5A 1OY8A 4PRFA 1TAUA 3CMQA 1MU2B 2CFXA 4LRAA 1RA7A 4ZS6A 1M5HA 1S1UB 5D6GA 4DQRA 1HL6A 4D3GA 4ED4A 1NZAA 2K3IA 2ZUGA 2KJWA 3D0IE 3DDNA 3FEXB 3IG1B 3MPDA 4NPOA 1NEEA 3QT8A 2EFNA 4QIGA 4DOZA 5J2PA 3RB4A 4DV2J 3PZPA 1JX4A 2Z2YB 2J9CA 2G2ZA 3C6UB 1X0PA 3O1LA 4DR5F 1DJ0A 5DGAA 2AGOA 2L08A 2VFRA 4F3QA 5D78A 2VQFF 4ZLNA 1F5BA 1N5QA 2GIRA 3CCTA 5KFRA 3NGDA 2KN4A 1SI9A 2C3MA 2Y0SD 3AXKA 2C42A 2I2YA 4B3SJ 4BC7A 3VEAA 2RUSA 1RTHA 4JI8F 1Q86T 1EIYB 2QLXA 1JLQA 2VDHA 3W5ZA 1JJHA 2UU9J 3Q8QB 2HGNA 2MQNA 2N82B 2W2MP 4DSJA 4IQXA 1X5SA 2DEJA 4NI2A 3RG6A 3W66A 1I6JA 2AW0A 4DR6F 3DM2A 3CTRA 1QE1B 3OR2A 2MTLA 1WI6A 2FY8A 3LUYA 2WAQD 5A6WA 2B4VA 3W9IA 1ELOA 2JVOA 2OPRB 2YWWA 2YQ1A 4LSNB 4CP5A 2RQ4A 3LPEA 5KFFA 2UUTA 1RWWB 3VF0B 2EC0A 3EJMA 3CCMS 3AAWB 3VZHA 1FVSA 1NO8A 1YWXA 3NBPB 2DT9A 2Y1LB 2YX1A 4USKA 2JLEA 2F7VA 2FGOA 4L76A 2MQPA 3DRYA 1RTJA 2I38A 5B0CA 1H3DA 3TI0A 3PNIA 1WWHA 3MPUB 2IRXA 1GAOA 4UF4A 4AE5A 2ALYB 1BMQB 3MEGA 2VPXB 4WXOA 5HMYA 2QC3A 2VJUA 2UXBJ 5L39A 1VK3A 3BSCA 3DMJA 1NHUA 3CIMA 2DXDA 2BM0A 4CTAA 2R8HA 2QTWA 1DTTB 1Q1KA 1WC3A 2CQ1A 3NWRA 2AGPA 1Y10A 2BRKA 3TAQA 1ZTWA 4RW8B 5I3QA 3ZTQA 2WBMA 5L1KA 2EFOA 3KMQA 1OMSA 1F5AA 2ZWOA 4IH7A 4P2SA 1RHQB 4LVNP 5KFCA 4J91A 2ILYA 3OVSA 1YJ9S 3OSNA 3OLAA 1SKSA 2JC1A 4HH1A 4JI7J 1WKKA 4QPTA 2CPYA 2CAJA 2JVRA 3F44A 3D54A 4ECQA 1CLFA 3VAJA 2KYXA 5F41A 2LLZA 2NSCA 3BO4A 2XI2A 4FS2A 1BAZA 1H38A 4I67A 4K59A 2DY9A 3SFUA 3UN5A 4MJWA 2W8KA 1U45A 3NNHA 2O3DA 1VISA 1T9VA 4IOBA 4PXCA 3I96A 4KV8B 4L75A 2W9BA 1S1UA 2BR0A 3KNGA 5KFJA 4KKOA 2ZJPQ 5L1IA 3DDKA 2QL7B 1WF0A 4CNZA 3HSZA 4OL8A 1RT1B 2N4CA 1JJCB 3CDEA 3F0NA 3QJPA 3E01B 4DLEA 2FHJD 4IRCA 7FD1A 2E1MC 1HNZF 3H5YA 3FUYA 4DX6A 1KLMA 4KQZA 3SIPB 6FDRA 2XI3A 3DOLA 2CPGA 3W2VA 3ZC4A 3E2EA 2WTFA 3OFFA 2FLNA 3DRRB 1YITS 1GX6A 4ECSA 2KXFA 3QNWB 2XMUA 2YWKA 4IFYA 4J9UE 1EA4A 1HMVA 3DU6A 4C8NA 5A8WA 5L8RC 1C1CB 1CULB 2CPXA 3BPSP 5F8LA 1CJKA 2NXJA 2DHHA 4NLTA 3KJFB 5SUHA 1LK5A 3I31A 3KLGA 3SMZA 3M8RA 1YJVA 4ECYA 1IWGA 2XG8A 1IUJA 3MM6B 2HQCA 2C28A 5HVGA 3S8SA 4F4ZA 4OHWA 4JV5F 2AJ4A 2NZCA 1U47A 2KJVA 4RU2A 2A0FB 2JBVA 4RW6B 1KRPA 4DV1F 4P74A 2MKIA 2HYIB 4DU7A 1LWFA 4KY3A 5BYSA 3GSDA 3D4JA 2RF2A 3LWMA 4WZQA 4IO9Q 2XS7A 2LXFA 1IKWA 1ZPVA 2LCWA 5F3ZA 3MEGB 4DSEA 3MXHP 1C0UA 2FC9A 3PKMA 1L5UA 3GR0A 3I5CA 3SV3A 4YN3B 3T6BA 3AQPA 2OD4A 2N3LA 1NRKA 2BJ9A 4MFBB 3Q24A 3DM2B 2LU1A 4P72A 5HQ8A 1NH7A 3R6LB 3WDOA 4CO0A 5E33A 4DPXA 4Q5VA 3OSPA 1VQ6S 3ILJA 3KG1A 2OPRA 3NGTA 2YNGA 4LSNA 2R42A 4P71A 4ZKAA 5HN0A 2IM2A 4LRCA 1TKXA 4KTQA 1DFDA 1JKHA 2W2NP 3CJ2A 3VGSA 4BCAA 4OYXA 3KK3B 1TVRB 4NLRA 1VQPS 1T05A 4JV2A 2R8JA 4FXDA 2CDQA 2Z30B 2Z2MA 3R3TA 4M5MA 1NJZA 2VJVA 1YIJS 3DGPA 4DV2F 3ICLA 3LP2B 4Z7CA 3MI7X 1RABB 2ATCB 3A3OB 5ETPA 1S0MA 3DLBA 4IUFA 4ECRA 1LOUA 5DRKA 3TJ9A 3T5LA 2WONA 4PQUA 1JLCA 2C3UA 3FRZA 3HHKA 1MW7A 3DC2A 2QJ3A 4Q2LA 4U7UD 5C42A 2BA3A 4ZPAA 1H7XA 3B54A 5J2NB 5KG0A 4ANCA 3QWUA 2CPDA 5F0UA 1L3SA 3H2UB 1SQEA 1CJVA 1XEZA 2F4VF 2XCPA 2GS8A 3EM1A 3CC4S 5E7OB 1U2FA 1WC5A 2JL9A 3TARA 1X31C 2MKYA 2OGUA 4HHUA 3MECA 1UWBA 4NLVA 4OV6A 2XZTB 4WFBQ 3KK3A 4HYKA 3GJSB 4JV5J 4TYAA 2L9WA 3RJMB 1WHVA 1TAQA 2HHTA 4O4GB 2RF2B 5HVFA 1S97A 2MMYA 3FBEA 4K5RA 3AFGA 3ZNJ1 3SDEA 2RAQA 4RBVA 2F9JA 2P6TA 3AT1B 2YWEA 4RKUC 3W64A 2C2RA 4ZJQA 3M2VB 2HRYA 3ZZRA 5IM0B 4X66J 1N54B 2W24A 4ID5B 2BQRA 4LF8F 2CJ9A 2MKCA 3ENWA 2JEJA 2SXLA 2DTJA 5LT5A 3CDWA 1C1BA 3T3FA 3HVTB 4BWJA 1RHMB 4YHHJ 4CCHA 1FJGF 2QL5B 3G5OA 2K06A 5LSOA 4DUZF 1LWXA 2W7AA 3UD3P 2ZH9A 4DV5J 2VOPA 1VDHA 2ACMA 3N6NA 3MMJA 2VFTA 4MMOA 4Y2KA 4DL2A 3GWCA 1P6TA 5H9FK 1PC4A 2R7SA 2ZH3A 1UA0A 2RD5C 1CPZA 2NREA 3RBZA 3ZXWA 2NXNA 2FLLA 1H6KX 2MKJA 1SQFA 1X4CA 3RYLA 2V9WA 1WDTA 2EKYA 4G1QB 3FMTA 1FWKA 2QZ8A 1YK9A 3DOKB 5ETVA 2F1FA 1KC8T 2CPIA 1AUDA 1IBKJ 4IOCQ 4C8KA 2KH9A 2BQ3A 2K29A 3HDSA 2QG9B 3EZUA 3GPAA 3OXGA 2UUAF 1S79A 2R7UA 3H87C 4LBPA 3V5RA 2HSEB 4R0EA 3HCXA 1MNEA 4UUXA 4HDHA 2HNDB 4QW9A 1EP4A 1WUUA 1A0OB 1FDNA 2VBZA 3K57A 2BOPA 1EETB 3BJYA 2QA4S 3J7YI 4Q0BB 3HZGA 1ZM4A 4DCPB 3IR7A 1IKVB 1X4HA 4P10A 1FRMA 1WI8A 4D3HA 3QGGA 2FDNA 4LSLB 2FJEB 4I2PA 1Y5IB 1VCTA 3IM9A 1S77D 3GFXA 5E41A 4OI4A 4LMZA 3ENVA 4DL4A 3TZWA 1RU1A 4F36A 1JXEA 1KHVA 3UVJA 2NXUA 1QJHA 3VV2B 3M32A 4NASA 1GNKA 2L9DA 2GW8A 4F25A 4USMA 1F9EB 2DR6A 2KVIA 2OKQA 4DR7J 3BGUA 4PWWA 3TUJC 2I1RA 2YQ0A 4MKYA 1HHTP 3PX4A 5I42A 2H48B 3H98A 2YWHA 1VQ8S 4X2BA 4TU9A 1SJ4P 1HNVA 2MYFA 3JQJA 5CYMB 2DEIA 2KHDA 4IFVB 5L9XA 5HL7Q 4GC6A 4C8ZA 1NNDA 2XCAA 2ASJA 1T02A 1S1TB 2HHWA 1KTQA 1RT5B 1RAEB 5EX0A 2FJAB 4OLPA 4X4PA 3O6QA 4JYAF 2JWNA 5LJ5Y 1REGX 2LFVA 4ES3A 5IM0A 3TAPA 3RW6A 2YNHB 3JTNA 1TKTB 1B0TA 1RTZA 2BABA 4A8SA 2KELA 3HHLB 4Y00A 5C42B 1Q8KA 1NB2A 3GP9A 2C3PA 5EWFA 3QIDA 2XMTA 2RRNA 4HV0A 1IKYB 5C25A 2ZJQQ 1VC6A 3WC0A 1JQGA 2JX2A 4KGXB 5AXKA 3BN4A 1T7PA 1IJEB 2DH7A 1HI1A 2AEJA 1M5VC 2AWZA 3KLFB 3FEYB 1YRXA 3DOMA 2OPPA 5DZ7A 2J8AA 3CJKB 3Q8SB 2QO3A 2NCKL 2IC3A 5HO4A 1F2HA 1M1KT 4OZNA 2ZUAA 2HFVA 2BDPA 3RZAA 4IG0A 1TL1B 1ZM9A 2D41A 3ZTSA 2KFNA 1U1LA 2MZSA 1QVFR 1UP1A 4JYAJ 2JFDA 4LFCF 3CULA 4ZPTR 5ETNA 4ILRA 1K44A 5G0RB 3CJ5A 2XWXA 2CQ3A 2DNHA 3VGUA 4ANEA 4ZIWA 1I1GA 3NCRA 1AT1B 4CT8A 2FHMA 2WK4A 1N52B 2XULA 3UN2A 5B0DA 5HQMA 2VQEJ 4ED6A 4QU6A 4C48A 1FRKA 2A10A 4FPIA 1NSAA 4MJKA 2HZAA 2RHQB 3M30A 4IRKA 4FF2A 3GXQA 2KZZA 4EUVA 2ZC4A 3A3NB 4H4OA 4CO5A 3PYGA 1U1PA 3R1LA 5CXTA 2RU3A 1NJXA 1HD1A 3NGRA 3K7RA 2LDYA 5AE3A 2VICA 4CLUA 4YB1P 2E1RA 4AAIA 1NBEB 3RRKA 1KQFB 1HNWJ 2GIQA 1WACA 3EVOA 4IFVA 4DF4A 3O2IA 4HTJA 4O3OA 1KNZA 3KWMA 1P1TA 4RZRA 1RWXB 1SH2A 3AHPA 1OG7A 3IS9B 5A8KA 2IM3A 4HEA9 4LQ3A 2R2RA 1B64A 5IOLA 2IM0A 2KT5A 1TKTA 2HAFA 3DGVA 2DR9A 1TKDA 2BE2A 3SSRA 4OLOA 5D0HA 1IM4A 8RUCA 9ATCB 3ADAC 3V4IA 4DHVA 3KJVB 1B28A 3NNAA 4CQ1A 3GIKA 5AJ3F 1M5OC 2M3DA 2V4JA 3TYTA 1UVMA 4MT1A 4IOAQ 5E3RA 1N0VC 3AD9C 2DGSA 3PR5B 3ISNC 1RBOB 3OR1A 4P7VA 5ETOA 3LW5C 4QWEA 3CCLS 1FT8A 5J1EA 2NSBA 1UVLA 4Y2AA 1FD8A 1DRZA 3AB4B 3NXZA 3B8HA 2ERRA 2FVSA 4X4VA 4ZVHA 2CZVC 2NYIA 1X4FA 2X1BA 4IG0B 5IWAJ 1KVKA 3T1HF 1S99A 1R43A 4KBIA 2BYCA 2CWXA 3IBFB 1TUGB 4QCLA 2BM1A 2HQFA 4DZDA 5B0BA 1I94F 4GVLA 4U8VA 3FBBA 1OM2A 4ICLB 2DKOB 1QUVA 2IM1A 4NRTA 3PW2A 4HLBA 1T03A 3FJ2A 3NGUA 2B9EA 4TLRA 4KGMA 2V9KA 4CTAB 3QQCD 1Y3JA 3AQOA 3DRRA 4JBCA 2B9YA 1HHQA 3IP0A 1CG2A 1TK0A 2HVHA 5DZ6A 1GT8A 5JMNA 1HMVB 1REVA 2V2ZA 2RH3A 3PDNA 4WTYA 5A8WB 3JB9k 4ECWA 1SUQA 2OJ3A 2MKHA 2WW8A 1MNTA 3C6TA 3BGOP 3IFEA 2K1RA 3IRXB 1H2TZ 3NWGA 3RRGA 3FCWA 2GVDA 4WJBA 1BQNB 2XSFA 2XY7A 3M1VA 1J5EF 4Z37A 3QGHA 3CO0P 3W9HA 1N8RT 3MOZA 2K5JA 4NXNJ 2B4OA 4HT7A 2VFVA 3I4HX 2HLUA 3D6TB 4USWA 1J2VA 2F63A 3MTJA 4C11B 1A6LA 2D1CA 2Q6BA 1UW4A 2QMUB 2W01A 4CLLA 5B09A 2GGPA 3VGTA 4QYZJ 2DHAA 3PO5A 4ES1A 1RXOB 3MCMA 4DR7F 2C2DA 2Y3YA 3CF5Q 3KMSA 4U7CA 1OHNA 3EGVA 2D74B 1PG5B 1B70B 1K1SA 1N5VA 3L7PA 5CQGA 4DV7F 1N5TA 4RWWA 5E2QA 1U1MA 2PFFB 1JLGB 1U0HA 2CVEA 5KFWA 2DVIA 4QYZK 1MSWD 3HT3A 3I0SB 3V4IB 1L3TA 2EG2A 2CUYA 5KG5A 1NDKA 2PC6A 5ETSA 2HIQA 1RT4A 3CJ3A 2RDIA 2R4FA 3GV5B 1UEKA 2G0IA 5A0YA 2KXHA 1WTFA 2PO4A 3WIUA 4URGA 5J1EB 3I9V9 4F4AA 3NAHA 4OZ3A 4CLSA 4QQBA 3BKTA 5LJ3Y 1HWJA 2LA4A 2BKOA 1XTZA 3MEEA 4ITSA 4IH5A 2L48A 1PO6A 2ZZMA 1RQ0A 3QT5A 4O4GA 4AXJA 4RNFA 4JI4F 3GIRA 3SSQA 2ZHBA 5IFMA 1S48A 5D3GA 1M90T 4ZPBA 4DV3F 3M2VA 1HLWA 4UOCA 1B0VA 3PW0A 3P5TL 3KUGA 4WPAA 4LFBJ 3C66A 4DCOB 2PA8D 3HHEA 3NNEA 2HWIA 2ZZTA 3SEOA 3IR5B 4CNYA 3MCNA 2CDRB 4K4TA 3OR2B 3FFIB 3MUMP 2RS2A 5G4DA 4JI7F 1RWNB 5F9NA 3PTWA 4I0WA 4DL6A 4PG5A 4GVBB 2ADCA 4GKKJ 1OIAA 4B3RJ 1Z1ZA 3VAGA 2VODA 3RAMA 2DNKA 2OPQA 1M5PC 3DN9A 1HR0F 2DB1A 5FLXY 4J37A 1HBUA 2CQGA 2HNYA 4HTIA 5FDLB 3EPIA 3DLHA 1OSCA 5LMNF 1U4BA 1YLXA 1RACB 3J80U 5AXLA 1MU2A 1TKZA 1UEVA 3HJVA 1FJCA 2YNGB 5LSRA 1TKXB 4GO7X 2BNZA 1IRQA 1ZAWA 2HNZA 2OD6A 2P2CB 3Q2TC 2J6TA 4PWDA 2IJNA 3EDQB 2DRDA 3N01A 4I1TA 3NS6A 3MR6A 1H73A 1C0TA 1XJWB 4WIQA 4RNOA 2QSWA 1X7VA 3I6PA 2HK2A 3ZZOA 2HFNA 3DGPB 1YI2S 3HVWA 4QPXA 1D9AA 1JXVA 4WK3A 1JLEB 2H4YB 3W61A 5KTQA 1PC5A 1OYDA 4DR2F 1H74A 2AKWB 2M8DB 4LIRA 1EKSA 4IYQA 2CNNB 4ZP6A 4QR2A 5DM6Q 2C3OA 5FJ4A 1ZYQA 1CQNA 5DQHA 4O0IA 1XNRJ 4X65F 3G82A 2MQOA 4X4RA 4ED5A 4DX8H 2JDJA 3PRVA 4EU0A 3PCOB 4I6WA 3OFGA 4LRFA 3WC2A 1CEZA 3KG0A 3FSIA 1NK4A 2RB7A 3DNCA 3RW7A 4DG1B 4TU8A 3HXMA 3OJSA 3EZ5A 3AOAA 5HQLA 3TZXA 3ZZUA 2W7PA 3CCUS 2IMWP 2KVQE 1O8BA 3AODA 4ZA1A 3SQGA 5B0GA 5KG2A 3ENQA 1AZSA 1HBMB 3Q0AA 4EFAC 5I3UA 1IM6A 5E5NA 3WZ0A 3GYNA 3MMBA 1C4CA 3TUIC 1VRUA 1SB6A 2PSZA 4JI3J 3L4BC 1QVGR 1YGYA 3LALA 3MF5A 1SH0A 5KFKA 3C14A 4MKAA 3KYLA 5H9EJ 1U25A 4CI0B 3Q22A 4RBTA 2DNZA 2E5IA 2YXLA 2O67A 3R27A 3TUZC 3W2VB 3O5TB 5KFLA 5KAKA 4WFNQ 2DGOA 4HVZA 3PFEA 1NK7A 2OEJA 2AF6A 3MTKA 4U6PA 1RA6A 3HVRA 4AXIA 1RT7B 2XTCA 1XC9A 3KLEB 1HBNB 3PHTA 3W1YC 1X93A 5KFOA 3J7Z5 2BJ1A 2FGCA 2WBRA 2LU2A 2XYHB 3TEHB 3HVTA 4QWCA 3QMQA 3K58A 5CYJA 4YR2A 3W60A 1UPMB 2CZ4A 4NLWA 5HI7A 3TAMB 2RUGA 3AX2A 3KOAA 2Y0BB 2B0GA 3N9UC 2AEFA 1KOHA 1GMVA 2CA9A 4R8UA 2WOMB 2E5GA 1SCJB 2KDOA 3DHWC 3LANA 5I42B 3RB0A 1IBLF 2JXHA 4LJMA 2QFJA 1VBYA 4NOHA 1KFSA 5IV4A 1Q16B 5IQ6A 3AJ2A 3FDSA 3AY0A 5I3PA 2E9TA 2UUWA 4LR8A 5D4LA 1DARA 2K9IA 2ZH6A 1QSSA 4B9UA 1RTDA 4X4NA 1KONA 1PAEX 3GG1A 1TV6A 2J8SA 4TY8A 2F65A 4C97A 5EDWA 4G6VB 3KLHB 2LMIA 1VYAA 3PX6A 1AA1B 3RBEA 1R0AA 5ETTA 2HW3A 1RT1A 3TO8A 4DWIA 4I7FA 3B4MA 4NYOA 3G6VA 4RPFA 3AD8C 2YX7A 1DAXA 3G8TA 1S1WB 1WSVA 2VG7A 3HFZB 1HWLA 1U6FA 1RWVB 2DNOA 3NEKA 1SL1A 2BRLA 1XBWA 2R3VA 1JLEA 3DRPB 4OYPA 3RRHA 2D3UA 4QZVB 4BLGA 1P27B 5KFQA 2ZVSA 3MR5A 2Q66A 2C2NA 3DLEB 2YNIA 2R2TA 1KLNA 2XC9A 2Y1JA 2ILZA 1RBLA 4B9TA 3LGHA 1FTRA 5T41A 4ENOA 3B78A 2FTRA 1HIYA 2FZKB 4M63A 1TELA 3Q89A 5A6PA 3IN5A 4F26A 1SC4B 4LF1A 4WKYA 2BJDA 2WB4A 3BBBA 2YQ3A 3GE9A 3IGVA 3LAKA 1FX4A 1U49A 3H0PA 4ERDA 2PN6A 1U24A 5CHCB 1PJ7A 2FB0A 2WVBA 3PO4A 1SPBP 1BE4A 4WBFA 5KT2A 5IT9Y 2AEMA 1OSDA
chains in the Genus database with same CATH topology
4PCQA 4GO5X 3TR5A 1HNIA 1RT2A 2V0NA 2HHQA 1VC5A 3E8OA 3S6EA 2HVIA 4C0HA 1C0TB 2DGWA 1JLCB 2IVMA 1QM9A 1XN9A 2LQ9A 4AYBD 2MKKA 2ZHBA 1FF2A 3C46A 2YKPA 5F8JA 3CC2S 3MDFA 3BQ0A 3K5OA 1UVIA 1V3RA 1KVIA 2XS2A 4BC9A 5JJBA 1GXLA 4RX6A 2R8GA 5C24B 4PR6A 3HPOA 2WSFC 2HS4A 4J5OA 4OX9F 1ZZFA 3MAQA 2XHWA 3KHHA 5HMWA 1HD0A 5J1PA 4C8LA 3OFHA 4WU3A 2E9ZA 3S1TA 3FEZA 2UVUA 2QE5A 2ROEA 2AYBA 4Y0FA 4A8FA 4NCAA 3SV4A 3OQ2A 1D1UA 2F9DA 2XSJB 2QV6A 4K4XA 3DLJA 3E3XA 3KK3A 5B0EA 3NAIA 2OPPB 3CJKA 5HROB 4O44B 3LPYA 3H25A 2CPJA 4PQUB 4RW6A 4F02A 5HBMA 1TUVA 1VQSA 3G9CA 4UY8T 3PIPQ 3IWXA 4FNHA 5AE2A 3MPVA 4ECZA 1VC0A 4F3OA 3I56S 2W9AA 5KFSA 4C0OC 5DM7Q 3PY8A 4I56A 2OPSB 3MWBA 1LW0A 2LXUA 5K14B 3M8PA 2RKIA 4NLQA 2RU9A 4DV6F 1QSLA 3MPYA 3K5LA 1N6QA 1HNXF 4A48A 1SL0A 3X1LB 2GJIA 3JYTA 1ULRA 3IO1A 1E6VB 5EUHA 5F3TA 5M2UA 2YWFA 4HDGA 2DGQA 2J0QD 4YR3A 3DRXA 4OJ3A 3OLBA 2LXIA 3KFWX 4O3SA 1AROP 4BBYA 4DV5F 1OQ3A 1VQMS 3LOUA 3NG8A 3VAHA 3W7BA 2RSQA 1RWUA 4B3OA 1SJRA 5EN1A 1EP4B 1UAWA 3HI9A 1O0PA 5DETA 1S9FA 4ED2A 2R7XA 4PG8A 1T03B 4Y2CA 4KAIA 3IGNA 1KFDA 1R0AB 3TRGA 1E6YB 2O01C 5LSLA 2PI4A 2XTDA 5J2QA 4FPRA 5LMUF 2P5VA 3NKYA 1S1VA 4P6QA 1L3UA 3SCJE 1S76D 4DDFA 1MWYA 2ZHAA 1HBOB 2N3OA 4YB5A 4OV1A 1MMLA 4G3IA 4PWUA 2K1RB 1FTCA 2W9BB 4GMKA 4LF7F 3H2LA 1SBRA 4HI2A 4F4YA 2R9LA 4EBCA 2KFZA 4QIEA 3MM8B 3OUYA 2KRBA 2UUBF 1NKBA 2DCLA 3BO3A 2KO1A 1RTJB