3H5XA

Crystal structure of 2'-amino-2'-deoxy-cytidine-5'-triphosphate bound to norovirus gii rna polymerase
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
483
structure length
470
Chain Sequence
GTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAEDFYVPRQEPMFRWMRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords RNA dependent RNA polymerase
publication title Binding of 2'-amino-2'-deoxycytidine-5'-triphosphate to norovirus polymerase induces rearrangement of the active site.
pubmed doi rcsb
source organism Norwalk virus
total genus 149
structure length 470
sequence length 483
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 3h5xA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3h5xA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3h5xA03
4KHRA 2F8EX 3NMAA 5C24A 1TKZB 2V0NA 1S1TB 3C6TB 3H2LA 1S0NA 4IR9A 1LWEB 4PUOA 2HNDA 3FFIA 4RNOA 4Q44A 2IBKA 1D0EA 5KFMA 3JYTA 1T94A 2OPQB 1RTJA 1TL3B 1LWFB 1S1WA 1S1VA 2UVUA 3H98A 4YMEA 2R8GA 5KT3A 2XWYA 4O4RA 3QIDA 3DOKB 1WNEA 1HNIA 4IG3A 1JIHA 3PW5A 4TXSA 2EC0A 3BSNA 1XR5A 1RA6A 5KG6A 2B6AA 4ZVFA 3T5HA 1TV6B 5I42B 2E9TA 5DLGA 1JLFB 5KFNA 4J9QA 2OPPA 3PR4A 5C42A 4KBIA 4WFYA 5F9LA 5KFKA 1TKTB 3IGVA 4RUCA 1HNVA 4ZP9A 1JLCB 1VRUA 4H54A 5KFEA 2HWIA 4IG0A 1IKWA 4ECQA 2FLPA 3T5KA 5CYMA 3KNAA 3I5BA 4IRKA 2UUWA 3QYYA 4Q0BB 1S1XB 3DLEB 3H59A 3ISND 5KG4A 4PWDB 3NGDA 4KO0A 3OSNA 4DL3A 3QGGA 2JC0A 1K1QA 1J5OB 4IQXA 1S10A 3BSOA 3HVTB 4ED3A 4DG1A 1S4FA 4EO8A 1T03B 3GIMA 2FJWA 3E01B 5KFIA 3KLEB 4TY9A 2ZE2B 2JEIA 3PR5B 2AGQA 2D3ZA 5KFBA 4NYZA 3ISNC 1LW0B 5KFGA 3I0SB 4EEYA 5KFRA 2HNZA 3PW7A 3CJ0A 3N6MA 4TLRA 2AU0A 2J6TA 2VG6A 2HWHA 4XPEA 2YNGA 4ED0A 4IFVB 4DL7A 2BQRA 2BANB 4RW7B 4RNMA 3BREA 2V4QA 1Z4UA 4JV0A 1UWBB 4Q43A 2VG7B 4EBCA 3EZUA 5KG5A 1DLOA 4I2PB 5KFUA 5KFAA 3MR6A 4R0EA 4ECRA 4TQSA 4K4VA 5F8MA 4H4MA 4QWBA 3MEGB 2W9CA 2R2UA 5I3UB 3MR2A 3I0RB 3UR0A 2ASJA 2GC8A 3DRSB 2I5JA 1R0AA 3KMQA 1KLMA 5KT6A 2BE2B 2DPIA 3LP1A 3V6KA 2IA6A 5HLFB 1W25A 3QGIA 4IH6A 3KK3B 1SUQB 3IGNA 1JLBB 2RKIA 2HMIA 4ECYA 3DOLB 4Y2CA 4B3OB 1JLQA 2YNIB 1MU2B 1S1UB 5K14B 5F9NA 1JLAA 4TQRA 1RTIB 3UPFA 3DYAA 4ZP7A 5KFDA 3Q8SB 1RDRA 4EYIB 5J1EA 2XC9A 4ZPAA 1HYSA 1RT5B 1D1UA 1TL1B 1FK9A 1C1CA 5DQHA 4NRTA 4JUZA 4F4YA 1BQNB 5KFYA 4IH7A 4EBDA 2ZD1B 5DQIA 4RW4A 3MEDB 4URGA 4J9MA 3ITHB 4R5PB 1S6QB 3EPIA 3PZPA 4RW6A 2E9ZA 5KFWA 5DLFA 2IJNA 3G6VA 2B5JB 4IDKB 4YP3A 4O4GB 3JSMB 3H4DA 3V6DA 1CSJA 5EUHA 1RTHA 2OH2A 4EO6A 2BR0A 3CDEA 1REVA 3KK2A 1LWCA 1DTQB 4IRDA 2ZKUA 1QAIA 1N5YA 2RDJA 3G6XA 2C28A 5EWEA 3GV8B 1SV5A 4I7FA 4RW9B 5HP1B 5L1IA 2WB4A 3FSIA 1TKXA 4QWAA 4ICLB 3DLGB 3PW2A 4J9OA 2XGQA 4J9LA 5J2MA 3CDWA 1QE1A 3PJXA 1S1TA 2WONA 3DLKA 5KFOA 1HPZA 5KFVA 3PJWA 1S97A 3GQCA 3M8QA 5J2QB 2VG5B 5KFLA 3Q8QB 4IFYB 4H4OA 1JKHA 3GIKA 1N56A 4NLGA 3NBPB 5J2NB 3IRXB 1HQEB 2BRLA 3DI6B 3SFUA 3LAKA 4LQ9A 2WRMA 4TYAA 5L1JA 4WYWA 1S48A 3C6UA 4KKOA 2HAIA 1TV6A 3KLHB 1YVFA 2J6SA 3KJVB 4Q45A 1T05A 4KV8A 2XGPA 5L9XA 4JV2A 1RYRA 3PW4A 2IM2A 5F8HA 1SH2A 3CDUA 3LP0A 4URSA 4RW8A 5KFCA 2WHOA 4HYKA 1N48A 2I1RA 3GYNA 2WOMA 1IKYB 4NLTA 4WFZA 2RDIA 4ID5B 4MIAA 3T5JA 5DGAA 4MFBB 3RB6A 1QUVA 1JLEA 3CIZA 3QLHA 5FDLA 4ECWA 3KLFB 4QPXA 4Q8FA 4K4WA 4EYHB 1ZETA 3DRRB 2R8IA 4DL2A 2XI2A 2YKNB 1C0TB 1MMLA 3OL9A 1RT7A 4FS1A 5L1LA 1C1BB 1S9EA 3RB3A 3RB4A 1RT2B 4LQ3A 4IOBA 5EWGA 4J9NA 2JEGA 1VRTB 5JUMA 1EP4A 3V6JA 1RYSA 4ZMMA 1N6QB 3I0SA 4TN2A 4G1QB 3H4BA 2HNYA 1S9GB 3DM2A 2ALZA 5HROB 3DRPB 2IM3A 1ZTWA 3VQSA 4NLQA 5KFHA 5C24B 3HVWA 3KLIA 3BR9A 2C2EA 3V4IA 1SH0A 3OHBA 2HNDB 1RT6A 3FFIB 4ECVA 2ILYA 4K4XA 2JC1A 1HMVA 1TP7A 3JYTB 4J9RA 3V81A 4M94A 4ZPBA 1RTJB 1S1VB 1JLGA 1S1WB 3NKYA 4NCGA 2OPRA 1FKOA 4Y2AA 4ZVHA 3KLGA 1RT3A 4WE1A 3T1AA 4ECTA 2D7SA 4F50A 1XR6A 1S9FA 4R8UA 1JX4A 2IAJA 2W9BA 4JV1A 2ILZA 3RAXA 2B6AB 3LALA 4MK9A 5CYQA 1NHVA 1I6JA 3IS9A 4PQUA 2OPPB 2R8KA 1C2PA 2QV6A 3TAMA 5C42B 1NHUA 4J9KA 2YKMA 1EETA 1C0UA 3DMJA 1HNVB 3OL8A 1VRUB 4FBTA 2IM1A 2YNHA 3TVKA 4IG0B 1IKWB 2R2SA 5D3GA 1TQLA 4O3PA 1TL1A 5CYMB 4WZQA 4O44A 3NL0A 4KAIA 3M8PA 4WXWA 2YNFA 4NLSA 4ZPDA 3H5SA 3I5CA 5KFFA 4K4TA 1N4LA 5C5JA 4NLDA 5KFTA 5KFXA 4K4SA 4ZHRA 1FKPA 3RBDA 1BQMA 3QO9A 2JEFA 3H5UA 4U6PA 2OPSA 1HQUA 4NLUA 3Q8PB 4DG1B 2FVSA 5KG3A 4LSLB 1SH3A 4F4ZA 3UDLA 4I2QA 1GX6A 4XO0A 2CJQA 5EWFA 3H40A 2XCAA 4TY8A 3M9OB 3MECA 1TVRA 5HBMA 2HNZB 2BRKA 4QWEA 1JXLA 1RTDB 4QWDA 3IG1A 4LSNA 2VG6B 2C2RA 5KFJA 3KK1A 5HP1A 3FQKA 1DTTA 3MEEA 3KLVA 5J2PA 4ZP6A 4QW9A 3NAIA 1DLOB 3LP2A 4IH5A 4KFBA 4ZVEA 3KHGA 2UVRA 4H4MB 2W9CB 2C2DA 4Q8EA 4NLPA 2D41A 2RF2A 4ECXA 3M9NB 5J2QA 1LW2B 2I5JB 3H5XA 1KLMB 1R0AB 2FVPA 4HKQA 3LP1B 3MTKA 4IKAA 2VA3A 3QIPA 4RNNA 3MFIA 1KHWA 2IC3A 3BGRA 5EDWA 1IKVA 2HMIB 2RKIB 1N6QA 2V4RA 3BQ2A 3QZ8A 1JLAB 2FLNA 1TKZA 3DYAB 3C6TA 1LWEA 5J1EB 2XCPA 2OPQA 3CJ3A 1QAJA 1TL3A 1HYSB 1FK9B 1LWFA 3D5MA 1C1CB 4Y34A 4WYLA 4G3IA 3DOKA 3KMSA 4ED8A 4QWCA 2FJVA 4U7CA 4RNHA 4RW4B 5DGBA 2R2RA 3V6HA 3SFGA 2FVQA 3HKWA 2O5DA 3KLFA 4FS2A 3FDSA 5I42A 4RW6B 2BQ3A 3PW0A 1JLFA 2IM0A 1RT1B 3KHHA 3GIJA 4NLWA 5F8GA 4RNFA 4DL5A 2AX0A 1TKTA 4GC7A 4MK8A 3V6DB 2B43A 3D28A 1C1BA 1RTHB 5KG0A 1JLCA 4YR0A 4F4XA 4IR1A 3CO9A 3CJ2A 4NLOA 1REVB 1S49A 2GIQA 1LWCB 3RBEA 3KHRA 5DQGA 4Q0BA 1N5YB 2UVVA 1S1XA 1SV5B 3DLEA 4I7FB 2FLLA 4ECZA 4YR3A 4PWDA 1HARA 2FVCA 1TKXB 3DRPA 3UQSA 2C22A 1J5OA 5J2MB 4QW8A 2D3UA 3HVTA 3GILA 1QE1B 3FRZA 4URQU 1T03A 2WONB 1IKXB 3E01A 5KG1A 3KLEA 4ED2A 1RT4B 2ZE2A 1HPZB 3DLKB 1S6PB 3M8QB 2WK4A 4RU9A 4H4OB 1JKHB 4MKBA 1LW0A 5C25B 3OHAA 3OL6A 4KB7A 3KOAA 1S0MA 2VA2A 3BSCA 4Y3CA 5DG9A 3ICLA 3C6UB 4IFVA 4KKOB 5KFPA 2BANA 3OLBA 4RW7A 2IMWP 1NNDA 1UWBA 2VG7A 1T05B 4PUOB 4KV8B 4I2PA 4J9SA 4M95A 3LANA 3LP0B 4NLRA 4O3RA 4XPCA 3MEGA 4RW8B 5I3UA 3I0RA 5F8LA 2WOMB 3DRSA 1HNIB 4IG3B 2W7OA 2BE2A 3G86A 4DL6A 1U09A 1JLEB 3QLHB 5FDLB 5HLFA 1ZTTA 3PHEA 3MR5A 3FQLA 3KK3A 3LAMA 2IJFA 4ZPCA 1SUQA 2ASLA 1JLBA 3HHKA 5KFZA 3DOLA 4B3OA 5F8NA 2YNIA 1MU2A 1KHVA 1S1UA 5K14A 2ASDA 2QE5A 1RTIA 1RT7B 2AX1A 4WFXA 1S9EB 5KT4A 2WTFA 2BQUA 4LSLA 3CWJA 3HVAA 2W8KA 3BQ0A 3RB0A 1RT5A 3KHLA 4EBEA 4NZ0A 4K50A 4F4WA 1EP4B 4NLVA 2JLEA 1BQNA 5KT2A 4ED7A 5KG2A 2ZD1A 5KT5A 2HNYB 4ZP8A 3DM2B 3MEDA 1RTDA 4KO0B 4O3OA 4ECUA 3ITHA 4R5PA 1S6QA 2UUTA 1GX5A 4J9PA 1RA7A 3QGHA 3MF5A 2B5JA 3I5AA 3KLIB 4IDKA 4WZMA 4KE5A 4O4GA 3GV7B 1RAJA 1RT6B 5KG7A 3JSMA 3V4IB 3EPGA 1HMVB 2W7PA 2R2TA 3V81B 1JLGB 4NCGB 1OS5A 2OPRB 1FKOB 1LW2A 3Q8RB 3KLGB 5JXSA 1DTQA 1RT3B 4WE1B 2DPJA 4R8UB 4IRCA 2IAJB 2W9BB 2YNGB 4RW9A 4MIBA 5CYQB 3BQ1A 3CJ4A 4FBUA 1S0OA 3IS9B 4ICLA 3DLGA 4PQUB 5L1KA 3M9MB 4MK7A 3TAMB 4ED6A 2YKMB 1EETB 4YR2A 4KSEB 2AQ4A 1C0UB 3NAHA 3DMJB 4ZVGA 3IN5A 3SI8A 2YNHB 4O3NA 5D3GB 5KFQA 2VG5A 4IFYA 2J6UA 2XI3A 4DEZA 3N6NA 2R8HA 4O44B 4ECSA 4O3SA 3NBPA 5J2NA 3IRXA 1HQEA 3M8PB 3DI6A 5F8IA 1K1SA 2YNFB 3TQ1A 3DDKA 3G6YA 3QZ7A 3N6LA 1JLQB 4GC6A 4ZHRB 1FKPB 3KLHA 3T5LA 4DL4A 1BQMB 3QO9B 2UVWA 3KJVA 3CJ5A 1RT1A 1HQUB 2OPSB 3MFHA 3BJYA 4O3QA 4I2QB 3OL7A 3T19A 4YQWA 2FJXA 2R8JA 3E51A 4TY8B 4ID5A 1IKYA 3MECB 3PVXA 3BSAA 3H5YA 1TVRB 5HBMB 2W9AA 4MFBA 1T3NA 2E9RX 3GIIA 2AWZA 3IG1B 4LSNB 5T14A 2FVRA 3RAQA 3KK1B 2CKWA 1DTTB 4NLYA 2V9WA 4MKAA 3MEEB 2AGOA 3CVKA 3DRRA 5J2PB 1IM4A 5DG7A 2WCXA 2W8LA 2YKNA 1C0TA 3LP2B 4KFBB 4TYBA 4K4YA 5DG8A 4ED1A 5F8JA 5KT7A 2ATLA 1RT2A 1IKXA 4RUAA 4NRUA 4X2BA 1RT4A 2RF2B 2AGPA 5KFSA 3GV5B 1S6PA 1VRTA 4WXOA 3KK2B 4OL8A 3OLAA 4MH8A 1XR7A 4K4ZA 5C25A 4KHMA 4NLXA 3MR3A 4K4UA 3QIPB 2GIRA 4G1QA 3BGRB 2IC3B 1S9GA 2JEJA 1IKVB 5HROA 4RZRA 3OSPA
chains in the Genus database with same CATH superfamily
3T1YF 1U2RA 1S0NA 4PXDA 2VC0A 1U25A 2R8GA 4LF7J 2MQNA 3PFEA 3M8YA 3SSQA 2FY1A 5BYQA 3DGPB 4CLWA 2MGZA 2OSRA 1WELA 3H59A 5DDPC 1BUXA 3DLJA 2F4VJ 1K1QA 1IM6A 3QT6A 4EO8A 4DR6F 5KFGA 1G7CB 2VFVA 2FHJA 4ED0A 1F9HA 3D0GE 1DLOA 1RWOB 2DGTA 3US5A 2ERRA 3K5OA 5KT6A 2ZH1A 1NAQA 1FJGF 3F73A 2J9DE 4ECYA 2J5AA 1RTIB 1GH8A 1UVKA 1GXLA 1UVMA 1C1CA 4NRTA 2QLFB 2CDRB 2JLFA 1NB7A 2J0WA 5KFWA 3G6VA 2B5JB 3EUNA 4LFCJ 3BBFA 1RTHA 2IJRA 3T3FA 2ZZMA 2VASA 4IRDA 1SV5A 3VAGA 4UZBA 3PJXA 3TZZA 4UZCA 6FD1A 1M5PC 4WKRA 3H20A 3GIRA 2MY7A 3QRQA 4HHJA 2XGPA 3R1LA 4DMZA 1KQFB 3OV7A 1M1KT 1HNXF 4QYZK 1YJTA 2E5GA 1RT7A 4OJHA 2UXDJ 3UD3P 3C2PA 4IOAQ 5B0CA 1T95A 2DISA 4G1QB 2AT1B 1S9GB 4NLQA 2JL9A 4FXEA 1H0HB 4HEA9 2F8MA 2AD9A 4ZVUB 2AY0A 1TP7A 2OSQA 4DXLA 2EG1A 2E66A 4NCGA 4QPTA 1SIZA 2ACMA 4X66F 3K7RA 3BGLA 2H5EA 2PI5A 2MGZB 3SCLE 2KFZA 3NL0A 4DR4J 1HBMA 1A6LA 3P5BP 1Q1KA 4DV0J 3HHDA 5HP1A 3EYZA 3R2CJ 2MQMA 1DLOB 5H9FK 4NLPA 4TLQA 4L3KA 3MTKA 4IKAA 4CZCA 3MFIA 5IZHA 3TR5A 1HWUA 3UN3A 4CLLA 3DU5A 3GFZA 4HH1A 2QFJA 3T6JA 2G0JA 3M8SA 1TL3A 2MZQA 1C1CB 3FVYA 1QJHA 3DOKA 3W61A 3KDOA 2CXEA 2W2OP 2IFXA 5BR8J 5D4NA 3RR8A 1RT1B 1BC6A 2JLGA 4M5LA 4GKKF 1RTHB 1JLCA 1FRXA 1VIOA 2DR9A 3IWNC 3HFKA 1HR0F 2UUAJ 2J8AA 2QMXA 3CUNA 2KELA 1SV5B 3CF5Q 4PWDA 2J9DA 2C22A 3MI7X 2ZH9A 1EB0A 1AROP 5A8RB 1S6PB 1TK0A 5LXYA 1UZHA 1V5IB 3DDIA 3NP5A 3RU0A 5F8LA 4P75A 1HNIB 1VLOA 2ZH3A 5FIIA 3AD9C 1JLBA 2YNIA 3R6GB 1HA1A 1RT7B 4WFXA 2EK6A 2WTFA 1FXDA 4LBIA 3RB0A 3KHLA 3TRGA 2Q1LA 2Y9HA 1SL0A 4ATNA 1WC5A 1U1PA 4ZP8A 3FZBA 4PG4A 3UDVA 2KJWA 4TKTA 1FKAF 1RAJA 2CPEA 3D4JA 2XNQA 4NCGB 4OX9J 1XMQJ 5JXSA 3AOCA 3QOQA 5EX0A 2WVEA 2M4MA 3BQ1A 2KM8B 4YR2A 3AD7C 4B17A 4USVA 4J7CA 3IRXA 1CJTA 1D8YA 2UVWA 1HBMB 3IWLA 3MFHA 3H25A 3BJYA 1X7VA 2GVDA 3EVWA 2MJNA 1HKAA 3MMJA 4RWWA 2HURA 4AE5A 1HHSA 1NJIT 3R97A 4ANCA 4X64J 5KT7A 4ETXA 4H4KA 3GV5B 2VC1A 4F0KA 4K4ZA 3OFEA 5FLXY 1Q4RA 2XTCA 4YB7A 1SC4B 2ADCA 3A4TA 1A7GE 1SQFA 2XY5A 4A47A 1TL3B 3DOKB 3PW5A 2N3LA 2V8HA 3BSNA 3BN7A 4IOCQ 1UVLA 4I67A 2E9TA 2CVIA 5KFKA 2HHHJ 1IR2A 2QG9B 1JLCB 1ZM2A 4J91A 1YI2S 4CTAA 4IRKA 2WVBA 4PWDB 2IBOA 4CI0B 8RUCA 4LFBJ 1ZZFA 2MYFA 2V8GA 3GIMA 4DSKA 4TY9A 5K8NA 2AGQA 2BJ3A 2DNHA 4YFUA 1RKJA 1RHMB 3I0SB 2PN6A 5E33A 3R27A 3BREA 3ENVA 5L38A 3O5TB 2GMLA 1S7IA 1JLBB 4DV3F 2YNIB 2C2MB 5ETPA 4JOUA 2V9KA 3J7A1 3VWSA 4ZLNA 4F0MA 3FGVA 3MDFA 4E8UA 1M5KC 2AMCB 2XTEA 4PYAA 4KHPF 2QGFB 3CD6S 2HFVA 4DV5F 4RW4A 8ATCB 3PZPA 2CPDA 3BDEA 1IBLJ 2B3TB 4LF4F 4DV7J 2EFPA 4LRFA 3CCTA 4OYIA 1VQOS 3PIOQ 1FRLA 1N5YA 4OYWA 5ETQA 1N5TA 3FRYA 2IMOA 3AX5A 3IRXB 1CJTB 2H4WB 1S48A 4HACA 2HAIA 4Q45A 1S72S 2J76E 3Q89A 2GVDB 1SKUB 2NR0A 2F3JA 1U2FA 2MEWA 1JLEA 3AA8A 3H7HB 4I4BA 1OWXA 3CJKA 5E7OB 3C19A 3KKFA 2JEGA 1UETA 1YSJA 3QFWA 3PO4A 4DBQA 4PABA 3HMJG 3HVWA 4WIIA 4JYAF 2W01A 4M94A 5ETNA 4L74A 1U1KA 4Y2AA 4B3TF 3LALA 4MK9A 2V1TA 2R7VA 4O0NA 1UUJA 4QIEA 2YKAA 3R9LA 4CTAB 1H6KX 2YNFA 5C5JA 1URRA 1EA4A 1FJCA 4I2QA 1CPZA 4CLTA 5GVQA 3D66A 1UWAA 2BRKA 3IG1A 2LP4A 4DX5A 1WEZA 5AE3A 3MD1A 2XYGB 1FX2A 4DR2J 2YWKA 4BLGA 3W1YC 3M9NB 3CD5A 2CJYB 3JXOA 4P72A 1KHWA 3B4DA 1LWEA 2RHSB 3Q2TC 3MMBA 1T9TA 3EGWB 1KC8T 2K9IA 4RW4B 5DGBA 2Y1JA 1X4AA 4KC5A 1JLFA 3KXDA 4JI7F 4KQZA 3D28A 1HI1A 2CWKA 3O8WA 4LRBA 1S49A 3L4BC 3T1HF 1RAIB 1N5YB 3BKTA 2ADBA 2HLTA 4JI3F 3KLEA 4X65J 2PMZD 5DS7A 5C25B 2DITA 1KQKA 2RBFA 3CJRA 5KFPA 4HACB 3OTCA 2N7YA 3OLBA 4ZVQB 2VQEF 3T41A 3HKZD 3TUPA 4KPYA 3O3LA 2UU9F 1JLEB 2ASLA 1FRMA 1RWMB 2ZOFA 1Q8BA 2QX0A 2AX1A 3DU6A 1RT5A 4NZ0A 5LMNF 4OZLA 2RNEA 3RAMA 4ED7A 1QVGR 4KO0B 4NXNJ 3LPEA 2VBYA 3P49B 2LQ9A 3K58A 3FUYA 5A8WA 3CJ4A 1D9DA 2ZWPA 1AT1B 4OYOA 1N32F 1U24A 5HQLA 4PXCA 1Q86T 1YZ6A 5J2NA 2YNFB 1JJCB 1YWXA 3CTRA 2AF6A 4M5KA 5EN1A 3QAUA 4I2QB 1PYSB 2FC9A 2PFFB 1SJQA 3IG1B 1NB2A 3N5FA 3DRRA 2W8LA 4K4YA 3GJRB 4N56A 1U45A 1YG0A 2MQ8A 1N33F 4KHMA 1B3TA 4CH7A 2LU2A 2BW7A 1LWEB 3MMBB 2H4YB 5HMYA 5GAGU 1ARQA 2VONA 1NPRA 1X4BA 1VQYA 1RA6A 2HRYA 2ZKTA 4WCEQ 1JLFB 5DDRC 3IGVA 3I6PA 4H54A 1WEXA 2AIRB 4P6QA 3CCMS 4C98A 5AXMA 3B6BA 2MDAA 4C8MA 2OEJA 2DCUB 2IVYA 3KLEB 2PD1A 3GJQB 4F26A 3PW7A 4CH1A 1PIEA 4U7UK 4ECRA 1R0AA 2WSCC 3FCWA 2MKKA 2DPIA 2DHAA 4B3SF 2JDJA 1W25A 1ACMB 4GO5X 4OIXA 5KFDA 3R7BB 1RQ0A 4YB5A 1RT5B 4JUZA 2ZHBA 4F4YA 3VAMA 2NZ4A 4URGA 2KT5A 4RW6A 1RHUB 1NSPA 3OD2A 3SSSA 3ETMA 2BW2A 1QAYA 1MYLA 3OQ2A 4J5OA 1VGYA 3GV8B 2C2OB 3HM9A 3AOAA 5A8WB 1ICEB 2BSQE 4LF9J 4JI5F 1B99A 3LO3A 3Q8QB 3OJUA 4NLGA 1RAFB 1M5OC 3ENWA 1WC4A 5J2NB 3GE9A 4LQ9A 2WRMA 3SEOA 1TV6A 4ZVRB 1VC0A 3HD1A 5E5NA 2I1RA 3PJ9A 4NLTA 1VQ8S 1GQEA 4R25A 3ZO7A 4LREA 4LJMA 3DRRB 4O0IA 3EGZA 4DL2A 3NNAA 2XI2A 4ILMA 4IOBA 2Y1IA 4AL5A 3ZC4A 2DO4A 2X1GA 3MXHP 1N0VC 4DFPA 1QSLA 4JP8A 4HV0A 3QBCA 3KLGA 2Z2LA 1RT3A 4LFAJ 3G82A 1GTEA 3BB5A 4USIA 3TVKA 2ZUGA 4KAIA 3BKFA 2CQGA 3MD3A 2OLWA 2V2QA 2XMKA 2JEFA 2EBEA 4NLUA 5KG3A 3OTOF 2Y1RI 4QWEA 5DDQC 3MUTP 2DTJA 3E2EA 4A8SA 3X1LB 2DXDA 1KFDA 1R0AB 4USMA 1O51A 3K57A 1KS2A 2IC3A 1HW9A 5GAHU 2R7OA 1BE4A 3FBCA 2KB2A 4QWCA 3C15A 4RW6B 2BQ3A 3PW0A 1FX4A 3FMBA 2DEIA 5KG0A 4USHA 3WIVA 2DY1A 2BDPA 1G6BA 4P52A 3UQSA 3GILA 1FFWB 3E01A 2XZ2A 4WF9Q 2G0IA 2JXGA 1DZ5A 4ITSA 3Q0AA 4WTYA 4CWBA 4KB7A 2GAHC 1GAOA 3D3CJ 4NMXA 2VG7A 4NLRA 1H2TZ 3OT9A 1WWHA 3I0RA 3A8IA 1SKRA 3MHYA 2HGMA 1SUQA 4LT6A 5K14A 2C42A 1UZDA 2QA2A 1NLAA 4LSLA 3ENAA 1VJWA 4NLVA 3NS7B 3TZXA 5KT2A 5E3QA 3W8PA 1MLAA 3QRRA 4ZN1A 3I96A 3QGHA 4WZMA 3R3TA 1JQGA 3KLGB 1RT3B 4FNIA 2AP6A 2KKEA 4DUYF 2YNGB 2Q6BA 4JI4J 1X4DA 4ZIWA 3PRBA 2G4BA 1XNRF 3DLLQ 3QNWB 3POTA 1X4HA 3HHLA 1RAGB 4DL4A 2FJXA 3SXLA 3I32A 4ZVOB 1RXOB 1ITPA 5IT9U 2KM8C 2DK2A 3TAPA 2WCXA 4ED1A 5DDOC 1VK8A 2IHR1 2X1FA 1VMBA 4OL8A 2VPZB 2IC3B 3OSPA 2VFRA 3SBMA 4DSJA 4ZS6A 4QCLA 3FFIA 4HTJA 4NWBA 1FTCA 2BKOA 1OYEA 4TVAB 1CULA 5F0UA 4DCPB 3C15B 2BJ1A 2OELA 5KFNA 5JVGQ 4TU9A 4BC7A 4IG0A 1VQ6S 1SB6A 3PFOA 4DV2J 3I4HX 5HL7Q 3GFYA 4DUTA 2V1SA 1Q7YT 1Q0NA 4DL3A 4L6V3 3ZTRA 3LTOA 2P9CA 3E01B 1OQ6A 4K5SA 1HWIA 5JVHQ 1HHTP 1RBOB 4WP9A 4A48A 2VG7B 2QMWA 3MR6A 1KEKA 1RU1A 2JNJA 3PCOB 2XZWA 3KG0A 3I0RB 3JQMA 2I5JA 2CQBA 3HP6A 1LK5A 3D6HB 2CQIA 2JVRA 1SUQB 3BKUA 4W90B 5K14B 1V3RA 2MSSA 3G96A 5B0DA 1M5VC 2YTCA 3CCQS 3UNGC 1HYSA 4ES2A 2J7KA 4IH7A 4EBDA 3MM6A 2K3IA 4ELTA 2KG1A 2HQFA 1XK8A 1N52B 4IO9Q 2HSEB 1LXNA 2NLWA 1VQKS 2UUCF 2B4VA 1KOHA 3V2UC 3ZTSA 2XGQA 3BM7A 4J9LA 3MMAA 1PBUA 3OJSA 4AT1B 1HPZA 2FYXA 3POTB 4XK8C 1Q78A 3W7BA 4X4RA 1YKWA 2BE9B 5KAKA 1X31C 1KQGB 1TK8A 5F8HA 2GJFA 1SH2A 3M6XA 1S4EA 4HYKA 2M8DB 2F9DA 1RLCL 2BE7D 4WFZA 4ECWA 3QLHA 3KLFB 2A6OA 1ZETA 1TL5A 2N7CA 4C3LA 2ROGA 4FS1A 1C1BB 5AT1B 4X4QA 4QIWD 3BF4A 3HHNB 1UW4A 5GMDA 1U8WA 1WC0A 3VV2B 2ALZA 1U2CA 3I4PA 2BMBA 3FFIB 3MCOA 1NSQA 5HMZA 1YITS 2RAQA 1CULB 1X8DA 4OI0A 4H4KC 3TEGA 4FBTA 2YNHA 4IG0B 3C3LA 5CABA 1X60A 3NWGA 4O44A 5IM0B 1B7YB 1YJUA 1N4LA 2OPSA 1HI0P 5B08A 2M7SA 2DR8A 5F3ZA 3FMTA 2NYHA 4QWDA 1HNZJ 2CQ4A 2ZBPA 5BYRA 1NSKL 3UVJA 3FNNA 3EMTA 1X5PA 4DHVA 5J2QA 2I5JB 1GFWB 2GS8A 5A6WA 2Y3YA 2F1FA 5T7LA 5IWAF 1LOUA 2FLNA 3QGPA 2RHQB 4U8YA 2GMJA 1HYSB 3EGNA 4G3IA 3MM6B 3BDPA 3HPOA 5F8GA 4L3NA 5B0EA 2GVZA 2WW8A 2C3OA 4CQ1A 1KBRA 2LA4A 4DV6F 1UW9A 3VVTA 2YKOA 4DR5J 4UOHA 2CJAA 4MMOA 2DNLA 1HPZB 2ZUAA 2XM3A 1YHQS 3WX4A 4QBUA 4FXDA 2V34A 2FUG9 2MLXA 2L3MA 3R5JB 2DNQA 4XPCA 2P2CB 5JJBA 2Z58B 1FRHA 3QLHB 3PHEA 4A8OA 2BQUA 2DR5A 1WOSA 2WSFC 3FC9A 2C3UA 3A3PB 3S01A 1FE4A 2E5LJ 5KG7A 2Z2ZA 3K8WA 1L3KA 1S76D 2QSWA 4X4OA 4DN0A 2ZJPQ 2PDAA 2VFTA 3SI8A 1RWNB 2YNHB 4ZKAA 5LMUJ 5LSLA 2Z56B 4USKA 1K8AT 4O44B 4O3SA 2BA3A 2MQQA 2DJWA 2EFVA 2OPSB 1UEUA 1O0PA 1X0PA 2MMYA 4O3QA 4ZITA 4YQWA 2B7CB 2BJEA 3IRWP 2BJ8A 4Y2KA 1Y4ZB 2AWZA 1TR0A 3FEXB 3UVJB 4TYBA 2KI2A 2CG4A 3KK2B 3OLAA 4MH8A 4K8RA 3MUVP 4X62F 4RZRA 1WI8A 2QYGA 1DURA 1RHKB 4EGLA 5T7LB 4P71A 4RUBA 1ZH5A 4BWMA 2OI2A 2HVIA 4DR3F 4O4RA 3QMQA 4I0WA 1SC6A 4O23A 2B9EA 1K0VA 5C42A 4WFYA 3TUJC 1HNVA 3WIUA 1AUDA 4PPZA 1XTZA 1IKWA 4B9SA 2GVZB 4P73A 4GMKA 3KUGA 2UUWA 4CT8A 3CJSA 5DETA 1RUSA 4YDXA 1S4FA 4G1PA 2RMLA 3MM8B 2B51A 1N5QA 2IIHA 1SKSA 1DJ0A 1SC3B 3VEBA 4AXIA 1UEVA 2HNZA 4TLRA 3AX3A 5KOXA 2BQRA 2DRDA 2V8DA 1XIQA 5KFAA 2E1PA 5H1SV 3VALA 2YX7A 4H4MA 2GC8A 3LP1A 2ABYA 2QA1A 2K1RA 2UUBF 1CLFA 2VKRA 1NZAA 2CZ4A 5K9FA 3IC1A 2NZCA 1H98A 2A0FB 2FZGB 4HLBA 5DQIA 4YY3J 4YS2A 2U2FA 3H4DA 4F67A 5M2PA 2E5HA 1N88A 2WBMA 2AEMA 2ZKUA 2RDJA 4XIUA 5EWEA 1KSPA 4I7FA 4QWAA 4F4KA 4A8YA 5J2MA 4NYOA 1S1TA 1SVDA 1R27B 3JSYA 4M5DA 2XYHB 3DLKA 3PJWA 1NK4A 2B7BB 4TU7A 2R7UA 4A8WA 4LF7F 1RWWB 4UOFA 2ZM6J 2J6SA 2B9YA 2IM2A 3CSKA 2VL1A 2NXCA 3AX2A 2IPOB 2YBVA 1JB0C 1U1RA 3HF5A 2F4VF 1WG1A 1S9EA 3RB3A 1F5CA 2JHEA 4NMLA 2HNYA 4N8OA 3ADAC 5D8HB 2DD8S 4ECVA 2ILYA 3PX6A 1X9MA 3L7UA 1P1TA 3R1HA 3T1AA 1NBEB 3L7PA 2HZCA 4BHQA 5LL6d 4QR0A 5C42B 2OO4A 1HNVB 2R2SA 1IKWB 1REGX 1TL1A 4WZQA 4KY3A 2ZITA 3R5BA 3AXKA 1WDDA 1SJ1A 4K4SA 4CDIA 1FKPA 4LFCF 2LDIA 3D6MB 2HNZB 2KRRA 4CNYA 4ZP6A 5AXNA 3NAIA 3NOGA 1EHWA 1F60B 4H4MB 4C48A 2C2DA 4CLFA 4HKQA 1LW2B 1RLDA 4DN9A 3LP1B 2LKZA 2K1RB 1QDUB 2BABA 3PYGA 4DCOB 1XWLA 3GMGA 1U1MA 2YWWA 5K20B 4LRCA 5CXTA 4FXWA 4RNHA 2KZZA 1U48A 2O5DA 2FJAB 3H0PA 4NLWA 4DL5A 4U95A 2P9EA 2UXDF 3CO9A 1DQ8A 5E3CA 3FJ2A 1NKBA 4I7FB 2BOAA 2A6MA 5J2MB 4NL5A 5CZXA 5KG1A 4M5DB 3DLKB 2ZE2A 1LW0A 4DPXA 3MM7A 3OL6A 2XQCA 3BSCA 5K8OA 3K2YA 2Q6CA 3LGMA 1UTAA 1RABB 3OFFA 2AJ1A 3VZHA 3BS9A 4NI2A 3QSIA 4LF5J 1VQSA 2HBZB 2FHKA 5HLFA 2IJFA 4LUBA 4DR4F 4Y0FA 1U0HB 3DCAA 6AT1B 1S9EB 4HHHA 1TU0B 2Z57B 3IR5B 4DV0F 1OO0B 3M30A 1RCXB 2ZD1A 5KT5A 2HNYB 3ILLA 4LF8J 4WU2A 4QR2A 2GNKA 3UN5A 3Q8VA 3NLCA 5C7PA 4NEZA 2B4UA 1N36J 4WPAA 1F6TA 1ROFA 4CO3A 1F9FA 4MK7A 1IBCB 3NGUA 2WVDA 2R7XA 4OI1A 3CCWA 1OMSA 1DY3A 7FDRA 3H90A 1FRKA 2CVEA 2ZH6A 4LVNP 2Q66A 5BR8F 4RBVA 1SL1A 3AD8C 1FKPB 3T5LA 1WHYA 3WZ0A 2B9XA 2HS0A 2L48A 4U67Q 3BYRA 2DKOB 3PVXA 2BJ7A 4JI6J 2UUAF 2CKWA 4FF4A 1QSYA 5FLXU 3TX0A 2YQ3A 1NRKA 2NXNA 3O2IA 1DQ9A 2F4FA 1NJYA 2XHCA 2DGQA 2QL7B 2IBKA 3JYTA 3QATA 1S1VA 3M2UA 2RRBA 2OFHX 4TXSA 4C8LA 2B6AA 1HNWJ 4ES3A 2BOPA 4NXMJ 4FZVA 3JB9k 3NGTA 4HTIA 5F9LA 2BM0A 3M8RA 4CIOA 3D7SB 3KNAA 2V6AA 5BYSA 3UCUP 1R0BG 3NGDA 1N5VA 2VBXA 3I82A 1LKZA 1OY6A 4OI3A 1YJVA 2ZE2B 2L9DA 1LW0B 3MM7B 4OX9F 1XMQF 3M7VA 2AU0A 2AJ4A 4UUWA 4DL7A 3W5YA 2RIJA 2XY6A 4DUZJ 4X4VA 2IRXA 5F8MA 4NI2B 1FNXH 2IA6A 2CADA 4F25A 5HLFB 1D3WA 3THPA 4L75A 1JLAA 3WBZA 4OYZA 4CCHA 4CLKA 3N5BA 1QAXA 5K5MA 1BMQB 5ETOA 3M30B 2ZD1B 5I4MA 2NPFA 2DNNA 4C0BA 4PG5A 2ZJQQ 2IJNA 3GPAA 4X64F 1K47A 3B82A 3JTOA 3THTA 4OYAA 1HFEL 3PW2A 2KFYA 5HMXA 1T0TV 4DZDA 2VBWA 3HSDA 4CO2A 1TUVA 3FK4A 3SFUA 3HCXA 4A4JA 2MHNA 2A2DA 3P3DA 2V8PA 2YWEA 2HS3A 3NWRA 2HHHF 2JX2A 2RDIA 3MOZA 1DQAA 1FF2A 1X0FA 1XN9A 1RKIA 3CC4S 2G0CA 4OV6A 4LFBF 4EK2A 1FNOA 3HHLC 1VRQC 2HGLA 3MUMP 1FDDA 3DRPB 3I9V9 2FGCA 4V1Ak 4K4XA 3JYTB 1S1VB 4X84A 1WC6A 3FBFA 3M2UB 1AB8A 4ZVHA 3OR2A 3VAFA 2B6AB 3QT8A 2CQ3A 4J9KA 2DNMA 3DMJA 3OL8A 5D3GA 1TQLA 4RBTA 2MKYA 3IR6B 1R8HA 3FT7A 4U6PA 1TUGB 1HQUA 4Z2XA 1VQ7S 4HHUA 1GMUA 4OV1A 1SH3A 1NK5A 1GX6A 4DV7F 1OG7A 2HHWA 4QW9A 4AUKA 4B08A 4U7UD 2POKA 3I9ZA 3M4XA 4M63A 4MTPA 1JLAB 3C6TA 2VPXB 3AOBA 2V94A 2FZCB 2OPQA 1PILA 1QAJA 3D5MA 4Y34A 2V50A 2KFNA 4U7CA 2R2RA 2UP1A 2IY5B 3GYGA 4E98A 2AX0A 4MK8A 4YR0A 2RQKA 4RJVA 1CC8A 3W65A 3A13A 1VQ4S 4CO5A 2BXJA 3CIMA 1CVJA 1UVIA 2MTLA 2SXLA 1I5OB 4M95A 2UV8A 1VQNS 3CXCR 3C66A 4IG3B 3H42A 5E2QA 4ZPCA 3TJ8A 1H3DA 1JWWA 2ZOMA 2PEHA 3LPYA 4KH1B 2YY3A 1RTDA 4ECUA 1S6QA 3AWRA 2VBZA 3UO0A 3I5AA 2KOEA 4KE5A 4DR2F 1M5HA 3MM5A 1YJNS 2AYBA 1VDHA 1DTQA 3OR2B 3NGKA 1W26A 5LSRA 4CP5A 3RYLA 2FVPA 3DMJB 4WK1A 5D3GB 4DQSA 1X93A 3KJNB 2AYGA 2MZTA 1M1HA 2DNZA 2DH8A 3G6YA 3PEHA 2DY9A 4LF6J 1CS4A 4F8RA 4EZ9A 1HQUB 3HLUA 4PWUA 2HIQA 4BBYA 1OJ4A 1IKYA 3F0NA 1T3NA 2V8VA 2J0SD 4PEOA 3ZZPA 3NNEA 3MMCA 1IKXA 4RUAA 4FF2A 4X65F 2ROPA 4WFBQ 1XR7A 4NLXA 3N01A 4K4UA 4QZVB 2B8PA 2EFOA 3C6TB 5J1NA 4OQJA 1Y5LB 4Q44A 2C3PA 2OPQB 1IVZA 3H98A 2XWYA 5GAEU 2ZVIA 2O66A 3IMQJ 3P8BB 4ANDA 2XYPB 3ISZA 2DYAA 1UKUA 1FRIA 4ECQA 3I5BA 3JS9A 1FE0A 1VK3A 4KR0B 5IQ6A 4NXNF 2PIIA 2Q43A 4NOHA 1PC5A 4NASA 3NCPA 4DV1J 4XPEA 1FDNA 3ZZZA 1VQLS 3GWCA 4R0EA 2R2UA 5HO4A 2ASJA 1KFSA 3V6KA 1NH7A 1ZBTA 2LQ8A 4ZCLA 4HH0A 4OZ1A 1C4AA 1YBAA 4KGZB 3J7AN 3AA9A 1AYEA 1IWAA 2ZBIA 1GMWD 2PA3A 2RQ4A 3EM1A 3UCZP 3VQTA 1D1UA 1XNQJ 4I6WA 2IYIA 1L3VA 2KU7A 5T41A 2NS1B 3KUHA 5D4OA 1GMVA 4JI2J 1S6QB 4LR9A 3FZ2A 1IWGA 5IT0A 5EUHA 2OH2A 3CJTA 3CDEA 1DTQB 4B9MA 3ZZTA 4OX6A 4PXBA 2C3MA 4ZCMA 3Q2SC 3K89A 3O1LA 3CCLS 1LEOA 4C9DA 3K5LA 4NCBA 2Z8QA 3LAKA 3KJFB 2CFXA 1CS4B 1VBXA 2E7WA 1VC5A 1IKYB 5D15A 2XBPA 3BR8A 2K7KA 4K4WA 1S5ZA 1WEYA 5L1LA 3MMCB 2X1AA 1YLXA 2A18A 5IC6B 4MYUA 1WF2A 2IM3A 1ZTWA 3VQSA 2KZMA 3OHBA 1T9XA 1FXRA 1AZSA 2OIHA 4WE1A 4ECTA 4F50A 1EX8A 1X9SA 5L46A 3TA0A 3TAMA 2YKMA 4LRAA 4LR7A 2IM1A 4N77A 3NO7A 1NKEA 3QJJA 1KD1T 5KFFA 4QU6A 3QO9A 3Q8PB 2FVSA 1XERA 2DGVA 4P2SA 3AY0A 2HQGA 3L09A 3WDOA 4LF9F 1NJXA 4K0KF 1PBAA 1Z2ZA 2Z0GA 2DGSA 5G4DA 4Q2MA 3CULA 2JBVA 4OI6A 3N9UC 3U1MA 3RW6A 2XCPA 4FVMA 2MKJA 1T9WA 1ZM4A 2W25A 4FS2A 4KGVB 5D0EA 2HHXA 4LR8A 5CHCB 3EICA 4NLOA 4F4AA 4Q0BA 4ECZA 4AYBD 1Y9OA 5DZ7A 4LIRA 1ZAXA 2FB0A 3CCSS 2D3UA 3NRBA 4G6VB 2BA9A 4P7VA 3OHAA 2VA2A 2EK1A 4PG6A 1KR4A 4LFAF 4C3MA 3ICLA 2BANA 1FVSA 5IC4B 4I2PA 2G1HA 1FD2A 4HT7A 3CGIA 3OXLA 1ZM9A 2M52A 1WHXA 1P6TA 1Q95G 3C16B 1T9VA 3A8KA 3KK3A 2ASDA 4OZ5A 3HT3A 2F63A 2OP5A 2UU9J 1SJFA 3U1LA 3O6QA 1S7HA 4CO1A 2MB0B 2VHGA 1RBAA 4DPWA 4J9PA 2J9CA 1X4GA 3T5JA 3T9ZA 1Z1ZA 4ZDNA 2X3GA 1EQMA 3GR1A 1AZSB 4WE1B 1NKCA 2K8GA 4KTQA 1DFDA 4FBUA 3AB4B 1PYOB 3TAMB 2YKMB 1Q79A 4O3NA 4IFYA 3BO3A 4J9VA 4ECSA 4RX6A 2ZNZA 1K1SA 3AJ1A 3QZ7A 2ZBRA 1MWQA 1SQGA 3QO9B 3SCKE 1RT1A 2K7JA 1KVIA 2R8JA 4DPTA 1ZPVA 3QQCD 2MHEA 4MFBA 3ULHA 1I3OB 4NLYA 2V9WA 2KXHA 1S57A 2HAFA 3TQEA 2KVQE 5A8RA 1S6PA 5GAGI 1IBKJ 4DPUA 1AXQA 2AJFE 3IAS9 4CNZA 2CUYA 1KWMA 3NMAA 1BXNA 4FNHA 2KRBA 4RNOA 1RB0A 4JV2A 1S1WA 3PG9A 1WNEA 1HNIA 1F9EB 3ETOA 4LF2A 5AXLA 1H74A 2QTWA 2ZBCA 1GMWA 4ZP9A 2DNOA 2MSTA 1VQPS 1BAZA 3I56S 3K5MA 1Q8KA 1NU4A 5E3AA 5CCLA 1RSCA 3TA2A 4Q0BB 3EXCX 3IR7A 2KHCA 2EVZA 1ZYQA 1RWPB 3ZZ0A 2DNGA 1E6VB 5E0OA 1B0PA 2H1OE 3LOUA 1NEEA 2BANB 4JI4F 4JV0A 4Q43A 3UDEA 2XB2D 1PARA 4I2PB 4PCQA 1UPMB 3CCJS 3RTVA 4QWBA 2A10A 1MN7A 1NXIA 1ZAVA 2ASYA 1H72C 4IH6A 3KK3B 3IGNA 2HMIA 3K0JA 3DYAA 1RDRA 4ZPAA 1YDLA 1ZOTA 2HGNA 2GV1A 2FDNA 3IP0A 3M6UA 3EPIA 2E9ZA 4C7QA 2DHSA 2AW0A 4DF4A 1REVA 2ADLA 1UPPA 3ZZOA 4YOEA 2DNPA 1TMMA 4W92B 2CZ9A 2LLZA 3AFGA 3OXGA 3TVYA 2VIHA 4DLEA 2RJZA 2CNLB 4IFYB 2GMHA 3EXYA 4WYWA 4KKOA 4ILRA 1RYRA 1RWUA 3A8EA 1IUJA 1I51B 2JRSA 4URSA 1XMBA 3AAWB 3OFGA 5KFCA 1OPIA 4MFBB 4DV2F 1QUVA 4X4PA 4JB8B 1NM2A 4Q8FA 3A12A 2FLOA 4CH0S 1UL3A 2E5JA 3V4MA 1NO8A 2HHTA 1B4SA 2M8HA 3I0SA 4B3RJ 4TN2A 2DEJA 1UMJA 2W2NP 1WTBA 1S1WB 4ZIVA 1NH8A 2CQPA 1IQTA 4NA2A 2D7SA 3LH2S 1XR6A 1JX4A 3TJAA 4JV1A 3HFZB 2HQ3A 3C8YA 1I6JA 4PQUA 1P9QC 3MPYA 3QAEA 2QV6A 3GCWP 1KLNA 1T02A 5D4LA 4NLSA 3I5CA 3E3XA 3IR7B 2ZHAA 1BQMA 2V4JB 3GP9A 1NDLA 2W7AA 3KYLA 2CDQA 4K2XA 2D74B 4LSNA 1YJWS 2HLUA 3OUYB 3JAMY 3MEEA 2QJ3A 5GAHI 2RB7A 4RO0A 1RI7A 5RUBA 1WC3A 2KXNB 1FFSB 3FEYB 3ZTPA 2HMIB 5ADZA 3W66A 2MZSA 4OI4A 1TKZA 3DYAB 2CPYA 3PY8A 1Q53A 4DDFA 3RRGA 2DH7A 4Q2LA 1JMTA 2HHPA 5I42A 2IM0A 2R9LA 3UE2A 2AYEA 2BNWA 3CJ2A 1REVB 2GIQA 4ENOA 1S1XA 4YN3B 4QW8A 1NPPA 3IA0A 1NK7A 1RT4B 4OYXA 1Y7PA 2J0XA 2ZC4A 8AT1B 4OHXA 4KKOB 4D8JA 2RSQA 4PUOB 2OGUA 4J9SA 1FWLA 3MURP 4F04B 4O3RA 3MEGA 5I3UA 3W5ZA 3G86A 3B54A 4ZPTR 3HHKA 4DU8A 3CC2S 2QT7A 1OY9A 2Y8YA 2RE1A 1EZZB 3I87A 3L3CA 2W8KA 4LBPA 2W4DA 2HW3A 3M8ZA 3A3NB 3MEDA 2H3AA 3FSXA 2BKPA 5M2RA 1H2VZ 3VR1A 4IDKA 3JSMA 1TZ0A 2R2TA 5THWA 2ZWOA 4RL1A 1G2EA 2W4CA 1APSA 3GJTB 4DWIA 4ELUA 2G2ZA 1Y11A 1U6BA 4Y65A 4PQUB 1R43A 1ULRA 1Q81T 2ZC3A 3RJMB 4AL6A 3IO1A 2J6UA 4DUYJ 3W62A 3TP2A 2XWXA 4GVLA 1BQMB 4WP3A 1QD1A 4CM2A 2N3OA 2HFUA 5HK4A 3E51A 2KO1A 4ID5A 3D54A 2PA8D 3BSAA 3CD7A 1KOOA 3RGIA 5U47A 3LW5C 4LSNB 1PO6A 2FVRA 4M5IA 3MEEB 3CVKA 3HVRA 5E3RA 2YKNA 4WFAQ 4DR5F 2OUGA 5C25A 2M3DA 3LGHA 2DCLA 2RT3A 2MPUA 2D1CA 1TKZB 4I69A 1D0EA 5KFMA 1PSDA 1T94A 2UVUA 4F3OA 1RHJB 2ZH5A 4D3HA 2KN4A 3MAQA 2CPXA 5I42B 3NCQA 2OPPA 3PR4A 4PXEA 1TAUA 1X4EA 3JQKA 4V19J 1I1GA 1S1XB 1EKRA 4KO0A 4PZVA 2ZFHA 4EUVA 3LQVA 3NMRA 1YTYA 2JC0A 4B9NA 3BSOA 4ED3A 1I94J 4BCAA 2IVMA 3SSRA 2E5LF 3DRYA 4HR2A 3G8SA 4NYZA 3ISNC 2A3JA 2OTLS 2QLWA 2HWHA 1IBMJ 2E7VA 4RPFA 4TQSA 3MEGB 5I3UB 5LMUF 3UR0A 3M32A 2BVZA 1O8BA 3W2VA 4AXJA 2RDDA 1UA0A 2RKIA 4OFZA 3MPVA 2JWNA 4YHHJ 4ES1A 3BGFA 1FK9A 1YX2A 4QQBA 5KFYA 1FTRA 2XO6A 3MEDB 3KUEA 5A2QY 1RAEB 3G8QA 1P27B 4IDKB 3JSMB 3R2DJ 2CPFA 1PJ6A 3EE3A 3WQPA 2KJVA 1LWCA 1FERA 2FJBB 1R7IA 3FSIA 3W9JA 2LEPA 3ENQA 2HFNA 2CPGA 3UNYA 5HAOA 3MR7A 3M8QA 5CD4H 3BPSP 1VLYA 1JKHA 2LFVA 2L9NA 4TYAA 3C6UA 3NNHA 2XULA 4CO4A 1Y3JA 2YWGA 3PW4A 3W63A 4ID5B 2ALYB 1FEEA 4BWJA 2VPYB 3CIZA 5B0AA 4B9LA 1RHRB 2BV3A 4DQRA 2MKIA 1NSAA 1IJFB 2YKNB 5EX3A 5LM7E 1W2IA 2EFQA 1Q82T 2EEYA 3W9IA 1LXJA 4U8VA 3H4BA 3GYXB 1VI7A 4F3QA 3DN9A 3GB0A 5I3PA 1JLGA 1HD0A 1WG5A 3OFHA 4PPDA 2OHDA 2W24A 3FKBA 1VC6A 3RG6A 1TMJA 1YZ7A 2H65B 3N28A 2OPPB 2H54B 5C2GA 4Y2MA 4O3PA 3HFVA 2QA4G 4FYWB 4UW2A 5K8PA 3K5NA 4WXWA 4YY3F 4DR1J 4DSIA 5FD1A 2XCAA 1GK8A 3M9OB 3DLHA 1UFWA 3SV3A 1PAUB 1JXLA 3QPIA 3CW2C 1Z2LA 3ZNJ1 3SDEA 2CNKB 5L39A 1T7PA 3K8VA 2D41A 2F7VA 2WZ1A 3TAQA 3M32B 2HQDA 3W2VB 2FHJD 2RKIB 9ATCB 2KTQA 3QZ8A 3OW2R 2ZM6F 4ILLA 1FK9B 1FI4A 1H2UX 4ED8A 3LWLA 4DI6A 3SFGA 2JXHA 2L41A 4K2JA 2HBRB 3K17A 2MKSA 1HQ2A 1LWCB 1R6YA 3DLEA 3OXFA 3UFCX 3A8JA 3P6YC 4JBCA 1T03A 4ED2A 3MOJB 3M8QB 4UUXA 2K6LA 4FKYA 2PE8A 1JKHB 3G71S 3DOMA 3M2RA 1TL4A 3C6UB 4IFVA 5IS2A 4RW7A 2A1BA 3PYFA 4WKYA 5J1PA 1K73T 2X51A 4USUA 4F7VA 2BE2A 1U09A 1GEHA 5KFZA 2DR6A 5DRKA 3WC2A 3BQ0A 5B09A 4EBEA 2CPIA 4KYZA 3ITHA 1OYDA 1FDAA 2BYCA 1QSSA 2PC6A 3GV7B 1GXUA 1JLGB 4JI8J 1OS5A 1TTHB 2DPJA 3KDNA 2G9OA 2ZEJA 1M1GA 3LUYA 1TFYA 5F8IA 3TQ1A 3N6LA 1JLQB 1U1NA 1KDNA 2GCFA 5LT5A 2YH0A 3K59A 2P6TA 3EDQB 4GVBB 3OL7A 1PC4A 2HEKA 1C4CA 3GIIA 3AQPA 1WHVA 3AHPA 2HQIA 3SDEB 1E6YA 5DG7A 4RR5A 2ATLA 2ZDOA 1VRTA 5AJ3J 3TARA 4PR6A 2D3O1 3KJQB 5CCMA 4YMEA 3CB4A 3QIDA 4X62J 4LF5F 3G4SS 2AV5A 4ZPWR 5KG6A 2JXIA 2RQCA 2H5IB 1U49A 2LVWA 1YBUA 1FCAA 2NSCA 3UCGA 4GRSA 2R7SA 4PRFA 1MNTA 1Y3KA 3DLEB 1GNKA 4LF8F 2G1DA 1T03B 4NZ6A 2NYIA 1N36F 3DOMB 3M2RB 1BWEA 1N8RT 2JZ5A 2YNGA 1J5EF 4IFVB 4RW7B 2DGXA 1EAYC 1PYTA 2XMUA 4ZVTB 2JSXA 2Y1LB 2LQJA 2BE2B 3PX4A 1PGZA 4DF8A 4ZP7A 1CJKA 1RWXB 4OJGA 3Q86A 1VS3A 4DPYA 3CO0P 4ZOSA 3ITHB 2CRLA 4JI6F 2CZVC 3P5TL 1UJ4A 5DZ6A 4BC9A 1FNMA 1UCNA 3DFEA 2BR0A 1S0VA 1QAIA 2C28A 4OYMA 3EGVA 2WB4A 4DX8H 3R7NB 5ETRA 3CDWA 2XMAA 2WONA 2NQPA 4KPCA 3M1VA 1S12A 3V5RA 3U27A 3MCSA 1HNWF 4NXMF 1X5OA 3IBCB 1F3FA 5EHHA 2WHOA 1N48A 5KOWA 4MIAA 4YUDA 4ZPVR 2QN6B 4EYHB 3P45B 2CQ0A 1E6YB 2DIVA 1EQ0A 2MJUA 2VOPA 5I3QA 4CLPA 2KVIA 1VRTB 2YKPA 3D1OA 3DM2A 4B3MJ 2QO3A 3V4IA 1V5VA 4DUZF 2VPWB 2G2OA 4F3MA 3DHXA 4LVOP 3HJFA 5HVFA 5G0RA 3W8GA 1HI8A 3RZAA 1C0UA 4JI0J 2CQHA 3OPKA 5CQGA 3I55S 3JSRA 3NNCA 1CC7A 4I56A 4K4TA 4JI1J 3TUIC 3H5UA 4DV4J 2ZBQA 4TY8A 3G2XA 3MECA 1ZAWA 1T9YA 2V2ZA 4PAAA 3O44A 2HG4A 2VQFJ 4WK3A 1WUUA 1RACB 3LP2A 4V19X 2XTDA 2LECA 4ECXA 1NCLA 2NXUA 2A2BA 4RNNA 1IR0A 4DFMA 2V4RA 3PDNA 5ETMA 1RHQB 1CJKB 9RUBA 3GG0A 2WAQD 1R8AA 2CNOB 3AJDA 2EPIA 3KLFA 3FDSA 1JXEA 4ZJQA 2OMOA 1F2GA 1C1BA 4B9UA 2V2KA 2R7RA 1RWKB 2BJ9A 3DKDA 4YR3A 2MZRA 3J7YU 2WONB 4N41A 2B8QA 4Y2IA 2YX1A 4ZA1A 3M1VB 1MN9A 1T8EA 4DR7J 1KNZA 1QTGA 3PXGa 1QM9A 3ZTQA 4C3KA 1YJRA 4HVZA 2N4DA 2W2MP 2EC2A 3NS5A 4F0HA 1ZTTA 1IJEB 4N8NA 5IM0A 3QWPA 3DOLA 2PMWA 2VJUA 1G1XA 1SJRA 3QWUA 5D4PA 4CLYA 3F56A 1FO1A 2X1BA 3ELHA 3JQJA 2JLEA 1YRUA 2W1BA 3VGUA 5KG2A 1UFKA 2OMLA 3DM2B 4CYUA 3C46A 1OM2A 4LIWA 1ZPWX 2FQQB 4XDDA 1RA7A 2CYYA 1HWKA 4N5SA 3V4IB 1U1LA 3J81Y 4FYVB 1OQ3A 4PKDB 2Y0BB 5G0RB 1R89A 4IRCA 4IUFA 2FY8A 4ICLA 3ZZRA 3PYEA 3IBWA 1C0UB 4DX6A 2VFSA 2XS5A 5L9NA 3KLHA 3KJVA 5HJXA 2GO9A 3T19A 5D0GA 4TY8B 1B0VA 3MECB 3H5YA 1B0TA 4A8QA 2W9AA 4ZCKA 4R0JA 3ZFVA 2XG8A 2ZZTA 4ETZA 3LF0A 3LP2B 1X4FA 3HZEA 5HATA 4C6AA 4NYPA 4GKJJ 2FHMA 3HZGA 2XNRA 1G4CA 1MMNA 7FD1A 5F3TA 2GIFA 2JVOA 1VIXA 5IT4A 1URNA 2X3DA 2WBRA 3CCRS 5KFEA 2HWIA 2K2PA 1SI9A 3ZZYA 1J2VA 4FVCA 2O01C 4IQXA 1S10A 2FJWA 3GFHA 2OAUA 3E8OA 4OX7A 3S7RA 4FYDA 2W2PP 3CJ0A 3QT7A 3RBZA 2I0XA 3FMWA 3KFWX 2AYMA 1T11A 3MR2A 3ILIA 4L76A 2WVCA 3GG1A 1NDKA 3DOLB 5F9NA 4LF6F 3UPFA 2Q2KA 4CLUA 1UVNA 1VBYA 2I6WA 2APOA 3GSDA 2AEJA 4CYUB 2D9OA 2F8HA 2OJ3A 4C8NA 1V3SA 2KG0A 3KK2A 1CQMA 1R8BA 1WKKA 5HP1B 5L1IA 4ICLB 4J9OA 1XC9A 4YEAA 1K44A 1UJ5A 1VQ9S 4DU7A 5KFOA 1S97A 3GQCA 3EVOA 2MLZA 5SUHA 3RRKA 5L1JA 4JV5J 2RQMA 3NG8A 4EZ6A 3KLHB 1RAOA 4I1TA 3KJVB 1BLUA 3HSZA 2BKNA 3IFEA 3BV8A 5DGAA 2WOMA 4UOGA 3CCVS 1SKWA 4EI2A 3ZNUA 2ZH7A 3FCHA 4KIAA 4NX9A 3D0IE 5EWGA 3MM8A 4BDPA 3B78A 1U8SA 3SQOP 2BJDA 2M2BA 4UQTA 2E1RA 3A1YG 4DV1F 2CAJA 5HI7A 3M2VA 4J9RA 3KNGA 4C8KA 1WDTA 3NKYA 1NK9A 1U1QA 1F2HA 1FKOA 5D78A 4R8UA 2D68A 2IAJA 5A6PA 4ZJLA 3D67A 1FA0A 2AKWB 2DH9A 4OX8A 1UAWA 1EARA 2XLJA 3SV4A 3S1TA 1XNQF 3TI0A 1QY7A 4ZPDA 4JI2F 3TOQA 3KWMA 4K59A 4U9RA 2XS2A 2JJ4D 3AJ2A 3G6ES 2CJQA 5EWFA 1BDTA 5GADU 1R6VA 3M6WA 1WKJA 3CPWR 3FQKA 1F5AA 1DTTA 3KLVA 3S8SA 3M6VA 1EIYB 4IH5A 3R5DA 3W9HA 2HFOA 5IOLA 3CD0A 2NUUG 4ZVSB 3NEKA 2H48B 2L9WA 4MJWA 3TJ9A 2ZHOA 2XLKA 4FP9A 1LWFA 3ONQA 2B4OA 3DXBA 3V6HA 2MLYA 3HKWA 3GIJA 3GJSB 1A0OB 3CMQA 2FLLA 1HARA 3HVTA 3FRZA 4URQU 2VUGA 2DHXA 3HX9A 4ER8A 5MLCV 2PI4A 3KOAA 4ED4A 1XMOJ 5MAOA 2COLA 2YPZA 1V3ZA 1PJ5A 1UWBA 2AHOB 3J80Y 2WOMB 2W7OA 3HHEA 4XTTA 3MR5A 5H9EJ 2VDIA 3TZYA 4DFKA 3LAMA 4B3OA 5F8NA 1KHVA 2GHWA 3VAIA 3DC2A 3BYPA 3SYZA 3VGSA 2GA7A 2E29A 2DR7A 1AA1B 4CO0A 4Y00A 2FGOA 3PKMA 2XMJA 3FCVA 3R8YA 3M2VB 4PG8A 1WI6A 1VHFA 2LXUA 1MMDA 1YRXA 1FKOB 1LW2A 2XSFA 4R8UB 1MSWD 2IAJB 1SCJB 1HLWA 4ZLPA 2O67A 2I8EA 3IN5A 2DXFA 3PM9A 2HZVA 2VG5A 2R8HA 4TNOA 3T6BA 2KT3A 3QRPA 2J8SA 3BH7B 4F36A 3CCES 1FHTA 1AW0A 4FF3A 2QC3A 4DLGA 4OHWA 1UJ6A 2E9RX 1TL7A 4ZLJA 1DTTB 4CRJA 3Q22A 3HJVA 2ZH2A 4B9VA 4ZN3A 4MYTA 1OPZA 5GAEI 2PSZA 2JOQA 1TKDA 4KRWA 2HVEA 1Q5VA 1Q8LA 2VFUA 5C24A 1PAEX 1N54B 3BN4A 3U1NA 1LWFB 3B8HA 1TAQA 1JIHA 2DHHA 2J7WA 3MM9A 1PKUA 5DLGA 2GFFA 1U0HA 2XZTB 2E7XA 1YK9A 2RU9A 2HVHA 1MWYA 3ZXWA 3T5KA 3VCDA 5KG4A 1BDVA 3LA0A 3CJKB 3HVTB 2GJIA 1ZS6A 2UXCJ 1YRTA 1RAHB 2BUNA 2D3ZA 3QT5A 2EWHA 5A8KA 1UWBB 3GONA 5KG5A 2Z4PA 5F41A 1OHNA 2UXBJ 4P9SA 3QGIA 4ZK7M 3DHWC 4B3OB 3JSBA 4KJIA 3QJPA 2BACA 5J1EA 3W60A 5B0BA 1ZA1B 1YQHA 2M0GB 3OR1A 2EBGA 3KTQA 2V67A 1N34J 2VICA 4EO6A 3N4WA 1VQ5S 2VJVA 3NGRA 1IBKF 1XJWB 1SPBP 1MW7A 1TK5A 1QTNB 1CEZA 2Y0SD 4AQYJ 1QE1A 2HHQA 3SQGA 5LXRA 5KFVA 4QIFA 2VG5B 4H4OA 4N7TA 3GIKA 2R7QA 4MAKA 1Y0HA 2BRLA 2HVDA 2LYVA 4FPIA 1T05A 3D9BA 3LP0A 3CDUA 3MPUB 1NJWA 4J9UE 1IR1A 3UW1A 1TL7B 4M5GA 3HHLD 3HD2A 2DB1A 2RD5C 4L72B 1UEKA 5JUMA 4IO1A 1EP4A 3ET6A 4RBUA 1RYSA 1LV5A 3H2VE 1WSVA 3F41A 5C24B 1KN6A 2MQOA 2C2EA 2JC1A 1XEZA 1BD6A 3MM9B 2W9BA 2CQ2A 2ZDPA 3MAAA 2X7IA 2VZ9A 2WB1D 3GFXA 1NHUA 2EKYA 5CD4A 3FBBA 2E5IA 2F65A 1HBNA 4I68A 3CE8A 3SCJE 5B0FA 1W2BR 1D09B 3JAMU 4GO7X 3GXQA 2Q79A 3GU0A 2RU3A 3QSYB 2VF3A 4UQGA 2DRBA 2GW8A 3U7JA 2GQ2A 5A8KB 3Q8YA 4KFBA 4QOTA 4KGMA 3GCXP 3K5PA 1O6XA 3BGRA 2ATCB 3PRVA 1RAAB 3CC7S 1NDPA 2FPHX 5J1EB 1S99A 2LCWA 4K0KJ 3TVZA 3RBXA 2QLBB 4WYLA 5IV3A 3D1HA 2FJVA 3NCRA 3OR1B 3L7OA 3U02A 2HKEA 2C2NA 3GSIA 2P5VA 3G5OA 4F4XA 5L8RC 1SJ3P 3EZOA 2NSBA 3KHRA 2HRUA 4EMDA 5DQGA 1S79A 1X9WA 4B3RF 1FT8A 3DRPA 2XHWA 3NOCA 1AUSL 1QE1B 3SQGB 3Q24A 1KTVA 2FZKB 2CQCA 4H4OB 2PEBA 1R31A 1QUPA 3PX0A 1OSDA 3T1YJ 2IMWP 1NNDA 1T05B 3AQOA 3LP0B 2RRAA 3BGUA 2ZNYA 2C1EB 2I9SA 1B64A 2XLIA 2CQ1A 1S1UA 3HULA 2AZ1A 2QE5A 3TX8A 4F2SA 2BNZA 4M1KA 3D3BJ 1EP4B 3ET6B 1BQNA 1M90T 1GTHA 3AODA 3HT0A 3MWBA 4DSLA 4TU8A 2YH1A 1GX5A 2VH7A 3MF5A 1DARA 2NUHA 2QRRA 3EPGA 1YJ9S 4DR6J 2J9EA 3CDBA 3M8WA 4DQQA 3VGVA 4L73A 3EWGA 2CIMA 2OEMA 2W9BB 4J37A 3MAAB 3L95X 4DSFA 1Y5NB 2L08A 2IDLA 4ZVPB 2KT2A 6FDRA 4HI1A 1HHQA 1HBNB 1FJGJ 4ID8A 1RK8A 4KGXB 2IDEA 2I38A 4GC6A 3TYTA 4OLPA 1V9OA 3HK2A 1W7WA 2WSEC 4C0OC 2I2YA 2RH3A 5T14A 4ME7E 1C0TA 4KFBB 4ED5A 5KFSA 1IXKA 3VTIA 1X5SA 2XMWA 4MT1A 2CQDA 3QJLA 3PACA 2GIRA 3BGRB 5HROA 4KHRA 2F8EX 4RU2A 5ETLA 2HNDA 4KGKA 1RP5A 3J7Z5 2FHOB 4Z7YA 2UV8G 1S6OA 4IG3A 3HDSA 4FXVA 1XR5A 3NY0A 4ZVFA 3T5HA 1TV6B 5ETTA 5IXUA 1KTQA 1VRUA 3Q8UA 4QIGA 4CT9A 5HQ8A 1T3OA 4CLZA 5CYMA 3THVA 1HNXJ 2DNRA 1NDCA 4Q7AA 4WU3A 1S77D 4P2XA 2RRNA 4RLEA 4FYXB 2JEIA 3VEAA 5KFBA 3UN2A 5DJBA 1NLKL 3J7ZT 1R8PA 4RNMA 1WF0A 1JJHA 2MZ1A 2W9CA 4X66J 3KMQA 1KLMA 4QIVA 3G82B 4Y2CA 1S1UB 1R0CB 5A2QU 3Q8SB 4EYIB 1IBLF 2V68A 3ILOA 3DGVA 1RU2A 1BQNB 3QFHA 2K06A 3OVSA 2XEXA 1Q8IA 3G8TA 3V6DA 4Y28C 4FN5A 2KKHA 3PTWA 2ZJRQ 1WG4A 1M5SA 3G6XA 1SC1B 1BGXT 1TFWA 2YQ1A 2IRUA 3D2WA 3HXMA 1Y00A 1WD6A 5KFLA 4DX7A 1N56A 3T9NA 1FD8A 2J0QD 4RW8A 4UF4A 3NS6A 2R8IA 4GKKJ 4A8MP 1C0TB 1I94F 4X4TA 1WKLA 2QL5B 3NXZA 1HR0J 4A8XA 1B7FA 1L3SA 2K3KA 4NEYA 5A76A 5HVGA 1KRPA 5HROB 2HHUA 1IBMF 1L3TA 3BR9A 2HNDB 1RT6A 5GMEA 2HFSA 1HMVA 4DQIA 3V81A 2EKNA 4LMZA 1MG7A 4USTA 3TZWA 3IAM9 3EX7B 2MQLA 5AE1A 5CYQA 3IS9A 2R8KA 1C2PA 3G9CA 1EETA 1HBOA 1VRUB 4YHHF 1A9NB 5CYMB 2LA6A 5CZVA 4LF1A 2H5JB 4P10A 4LSLB 3D1QA 2K29A 1LWXA 3H40A 1ARRA 1HBUA 1CJUA 2LU1A 1D9AA 5KFJA 3KK1A 5J2PA 4UOCA 2GGPA 3CMES 3PO5A 2W9CB 2A2CA 5CAAA 1KLMB 1HD1A 3WHIA 2VA3A 1N6QA 4WBFA 2OFGX 1FJEB 3BH6B 1L3UA 2QMUB 1RJJA 3VF0B 3CJ3A 2ZZNA 4Y6IA 1UFLA 4FF1A 3HHLB 3VAHA 4HDHA 2H9ZA 3KHHA 1JNRB 4RNFA 1QLNA 1TKTA 3V6DB 2AJQA 4P2FA 3GTYX 4IR1A 4OZ2A 4N76A 5AXKA 1KKHA 1J5OA 2NXEA 1HW8A 2LXFA 2VODA 3HSGA 3TWZA 3W2WA 1JJ4A 4Y3CA 4NPOA 3JTNA 1S6UA 2C2KB 3DRXA 3LANA 4RW8B 1BWVA 3DRSA 1WOPA 1YIJS 3PYDA 1TUWA 2W2QP 2RS2A 1WJ9A 3TO8A 3TNVA 1FRJA 3HVAA 4DR1F 1U7LA 1MNEA 4K50A 3C14A 4I6AA 4O3OA 4EU0A 2UUTA 2XS7A 3J81j 4OZ0A 1RT6B 1HMVB 3V81B 3MGJA 2DO0A 1X4CA 3SZ2A 5CYQB 3WX8A 5HANA 3IS9B 3MPWA 3HSJA 4QU7A 1EETB 1HBOB 3NAHA 1FEHA 4XAKA 5KFQA 2MZJA 3UD5A 4NA3A 3WC0A 4K7QA 1D8ZA 4DV3J 4OJ3A 3DXSX 3CJ5A 1SIWA 4MJKA 3CT9A 1D9FA 2CJBA 2F9JA 1WHWA 1HBUB 4KHPJ 1CJUB 4DV5J 3RAQA 3KK1B 5J2PB 4AD6A 2HYIB 2E44A 2GGPB 1RT2A 4LF4J 4MKYA 2ROEA 3PV8A 1VR6A 4E2FB 1N6QB 3MMAB 2V0NA 3H2LA 3BGOP 4DQPA 1RTJA 2PFDA 1NK6A 3C16A 2EC0A 4CM0A 3MPDA 1JK9B 1TKTB 3FSYA 2FLPA 2EI5A 1U6FA 4LBHA 2HFZA 2PT0A 1J5OB 4RWXA 4DG1A 4QYZJ 3RR7A 3BO4A 5EGYA 3W2WB 4JI8F 2K1OA 1UVJA 3N6MA 1FWPA 2V4QA 1Z4UA 4JYAJ 3EZUA 5HQMA 2ZVSA 2QL9B 1QTMA 3DRSB 1WF1A 5SZTA 1NHKL 3W3SA 4B3TJ 5M2UA 4WTOB 4NA1A 2H1YA 4DZ6A 4D3GA 1F3VA 5DO2A 2XC9A 1B01A 1JXVA 4W4MA 3IWXA 2EXUA 3C14B 1P94A 3G87A 4P74A 5ETKA 3TEHB 2GX8A 2QA4S 3Q83A 3UR3C 1VCTA 4RUHA 2GQCA 4ANEA 2HS4A 1VQMS 5C2CA 3R7SB 2UZAA 3H2UB 5AJ3F 5J2QB 2LXIA 3JTPA 5H9FJ 2CA9A 4HL9A 3EZ5A 1HWJA 1YVFA 2Z2MA 4KV8A 1SIWB 4ZLLA 3AH6A 2DBBA 3P4UB 3GYNA 2DVIA 2BBEA 3RB6A 4DFJA 4QPXA 1FWKA 3IXQA 4JI7J 2HQCA 3RB4A 1RT2B 4LQ3A 1VISA 1VYAA 3D0HE 4LRVA 1E6VA 2B4PA 3T1HJ 4ZMMA 3VGTA 1DAXA 4UT4A 4JI3J 2FD2A 2QYCA 1BHNA 1RTJB 2QLJB 3CDAA 2FJDB 1P9YA 2VQEJ 3UD4P 3LJPA 3M8PA 5CH7B 4FPRA 1SL2A 4M5MA 4C8ZA 3A3OB 5KFTA 5KFXA 4ZHRA 3RBDA 3DLBA 2RS8A 2QIFA 3UDCA 4DG1B 4DJBA 5LMNJ 3UDLA 2XMMA 1ELOA 2D69A 5HBMA 1J27A 2HWTA 4P2MA 2FJEB 1OSCA 2JH3A 4AAIA 1NJZA 2RF2A 2CJ9A 1K0TA 3AT1B 3MCMA 3VHQA 5ITHA 3BQ2A 1KVJA 3OTBA 4HDGA 1N32J 2LMIA 4PWWA 4USJC 3B4MA 4MKVA 2DNYA 1KP6A 2E1MC 4A8FA 2CPZA 2KL8A 3EVMA 3LWMA 4HT5A 5ETVA 3MEKA 2DGUA 3IM8A 1H73A 2M70A 2V63A 2UVVA 2XTJP 2FVCA 4B3MF 2LDYA 2V2VA 2DHGA 3VW4A 1N33J 2WVFA 3MZIA 2H3EB 2AJ2A 4OHZA 4EFAC 4KV8B 4AL7A 2P6SA 1VBZA 4JI0F 4A46A 1OIAA 4C97A 3CCUS 1LFPA 3OBIA 1HWLA 2RILA 4YB1P 4JI1F 2V4JA 2O1PA 4FYYB 5KT4A 3CWJA 4DV4F 2XO7A 1N0UA 3J81U 2IYGA 3BBCA 1WTFA 3OUYA 4HI2A 1ZA2B 2VQFF 2XY7A 2GHVC 3S6EA 4E0DA 1SBRA 1RISA 4RW9A 3DLGA 2YXLA 4OYPA 4KSEB 2AQ4A 4ZVGA 5CA5A 3CJQA 3OTEA 2ACYA 4B3SJ 3IM9A 2GPEA 2KXFA 2OKQA 3M8PB 3DI6A 1RBLA 4ZHRB 1HIYA 5IFMA 1XQIA 1JJ2R 2PO4A 4UTGA 2R42A 3EDRB 5E3PA 2YKQA 5HBMB 4KH0B 5IV4A 2OEKA 4DCJB 1U0SA 1RT4A 2RF2B 5HJYA 1RE1B 3N79A 4DR7F 2V69A 4JI5J 4C8OA 2M5YA 1S1TB 4PUOA 4J90A 3RUBL 5H9EK 3AXMA 1MROA 1YGYA 2Z30B 2B9WA 3W5XA 2HHVA 1IN0A 1B70B 1UA1A 4KBIA 1TELA 1MYKA 1NK0A 2E1CA 3ISND 4S0MA 2LEAA 3OSNA 1T9UA 2Y8WA 5K8MA 3QGGA 2CJKA 2F40A 3VVUA 2R7TA 1RCOB 3PR5B 2VD3A 3DDNA 5IQQA 1H38A 2KDOA 4K5RA 2VG6A 4B02A 5KFUA 1R3NA 1EKSA 2BX6A 1J5EJ 2HBYB 2R7WA 2YWHA 2QFIA 2GO8A 4TQRA 1BY9A 2BEFA 1NMEB 2LQ5A 2QZ8A 1TL1B 4ZJOA 2O3DA 1RADB 4F2RA 5B0GA 4J9MA 4I6YA 2MKHA 2HRTA 5DLFA 3OTOJ 4YP3A 2XMTA 4M5HA 2EFNA 5CYJA 1CSJA 4BS2A 2DNKA 1AFJA 1MWZA 4X4SA 2HPUA 2PGCA 3CMAS 2WW4A 4RW9B 4GKJF 4IYQA 2R3VA 2HK2A 3DLGB 3W64A 1Y10A 1AFIA 3DI6B 3GR0A 5BJRA 2PMHA 1S59A 2XZDB 5L9XA 4OHVA 1RTZA 3PNIA 1NPKA 1P1LA 2ZH4A 2M9KA 2Z2YB 2J7UA 5AE2A 5LJ5Y 5GMKa 4U96A 2HVZA 1MMLA 3OL9A 2LEBA 4DSEA 2LQBA 4ALZA 2B0GA 4J9NA 1JNZB 1WACA 4PQAA 2P8IA 3Q23A 2NXJA 3EJMA 1B28A 1FESA 5KFHA 3P96A 4YDDB 4ZPBA 4EWTA 1MROB 1U9PA 1FVQA 2OPRA 1S9FA 3R6LB 2DGWA 1BQXA 2ILZA 3RAXA 2FIUA 2U1AA 2GZOA 3VAJA 2VDHA 3H5SA 3HO1A 3OTDA 1HNZF 1FJ7A 2CPJA 3X3UA 2DRAA 1F0XA 4F4ZA 1CJVA 5BXIA 4CLSA 1TVRA 2NPIA 1M0SA 2VG6B 2AEFA 2CJXB 4ZVEA 2UVRA 2XSJA 1U6ZA 2HZAA 4ELVA 1Q5YA 3QIPA 5EDWA 4JV5F 1CQNA 1K9MT 4M5NA 1Q16A 2YWFA 3F44A 1XNRJ 1LK7A 1U47A 1RWVB 4PYDA 2RVJA 2DGOA 3BBBA 1WOOA 4OZJA 3TA1A 3J7YI 4X4NA 4C2MA 4GC7A 4LRDA 2AJ0A 3ZZUA 4C4WA 1FFGB 3MCNA 3RBEA 2JFKA 1XBWA 4Z37A 4UY85 1EJ7L 1U26A 2WK4A 2DT9A 3RW7A 3TW0A 4RU9A 3J80U 4MKBA 1S0MA 1QVFR 2NCKL 3I31A 5LJ3Y 2OTJS 1NUEA 1DRZA 2MQPA 3OVAA 1IQZA 3KG4A 4DL6A 3CCZA 4DPOA 3FQLA 3CNQP 1MU2A 1N5SA 4UY8T 1YJ7A 4R5PA 2H51B 4FKXA 4O4GA 4M5JA 1V6HA 3AB2B 5ETSA 2F5GA 2OPRB 3Q8RB 4KT0C 5L1KA 3M9MB 3IBFB 4P7TA 4AFFA 1F1BB 3BPDA 2VKZG 3N6NA 1Y5IB 3NBPA 4QJVA 1HQEA 2QSFA 3N0VA 3SIPB 2CWXA 4WFNQ 1RGVA 2Q3PA 1VFJA 1L5UA 1CJVB 2BZ2A 2D9PA 4W98A 1TVRB 1Q7LB 5DM7Q 1GXTA 1VJQA 2M88A 4MKAA 2AGOA 1IM4A 5DG8A 5F8JA 1DHMA 1KVKA 2UUCJ 4X2BA 2QLXA 2XSJB 5IT9Y 4WXOA 3FBEA 3MR3A 3QIPB 4I64A 2CNNB 1WORA 1XMOF 4IR9A 1Q16B 3D6TB 2N82B 1HL6A 3GZ7A 5D6GA 5KT3A 2ZH8A 1H7WA 4FDFA 2E1AA 1IRQA 3PHTA 5KTQA 1YBTA 1FXLA 4J9QA 4RUCA 4C11A 1O5JA 1P8GA 3QYYA 2YVSA 3GLJA 1R8CA 5KFIA 2IA0A 5HN0A 2YX4A 2FC8A 1RZMA 4EEYA 5KFRA 5LOQA 2J6TA 4Z7CA 4XDCA 5B7WA 4EBCA 4K4VA 2HBQB 2G13A 2KHDA 1JLQA 1MU2B 3SCIE 2YPYA 4GVBA 3UWTA 5DQHA 2CAXA 4ZCIA 4R5PB 1VOMA 2EW9A 4OZ3A 4DL0C 1SQEA 4O4GB 4G1IA 2IRYA 1CG2A 5D77A 3D68A 4NCAA 2BM1A 2CG8A 1PCAA 1LNQA 1TKXA 1CBKA 3SMZA 1ZM3A 4DS4A 1OY8A 4C8YA 4OJ1A 2DIUA 3PEJA 2AN7A 3NBPB 1HQEB 4QYRA 2AZ3A 2VU5A 5IWAJ 5HVHA 1U02A 3UI3A 2V5HG 2HIYA 4USWA 5FDLA 3ILJA 3L9ZA 3CJ8A 1U4BA 3R5GA 4NE9C 3H8YA 2GHPA 3ZTOA 3TUZC 1SJ4P 4WP8A 2UXCF 4YB6A 3VZIA 5D0HA 4C0HA 3V6JA 4DV6J 1DBDA 2CPHA 1NZ8A 2KH9A 3KLIA 1SH0A 4Q5VA 2P9GA 4F02A 1VHIA 2UXBF 5F0WA 3OVBA 1NHVA 5FJ4A 1LFWA 4NZ7A 5HSPA 3RRHA 4DOZA 4DS5A 3HI9A 4C11B 3PRDA 5GADI 2GQQA 2OD6A 1FDBA 3NGSA 2EG2A 1F5BA 4NLDA 1WSRA 2KYZA 5A0YA 7AT1B 1VBKA 5HMWA 1G3OA 5DM6Q 4XO0A 3BEGB 1N34F 3FEZA 2GJ2A 1RTDB 1X5TA 2C2RA 4MIWA 4AQYF 1GT8A 3KHGA 4Q8EA 3MM5B 4OZNA 2VB6A 3H5XA 2JFDA 1IKVA 1ZZNA 4RKUC 2GAGC 2RUSA 2W4PA 2MKCA 3LGNA 5JMNA 2QEXS 5E41A 2VV5A 3KMSA 4QR1A 2FVQA 2B56A 2B43A 3PKYA 3DGPA 4PG7A 2NREA 1TKXB 2XMVA 5LSOA 2K5JA 4OI2A 3R5AA 2KYXA 1IKXB 1PG5B 4WWSA 4N47A 4B9TA 4LSZB 5DG9A 5D0RA 3BO2A 3M05A 3MTJA 2YQ0A 4DR3J 3H87C 1UP1A 1U1OA 1KQSR 2D3OR 2DXEA 2HK3A 5FDLB 4M8LA 4OHYA 2N4CA 2EFGA 1RTIA 4OLOA 1NK8A 2R4FA 4G65A 2OD4A 4F4WA 4ERDA 2FTRA 2MXYA 2C2ZB 4OYBA 3BZQA 4X4UA 2B5JA 3KLIB 1KONA 4WJBA 3D6FB 2W7PA 3PIPQ 3VAKA 1PJ7A 4MIBA 1S0OA 2C3YA 2RUGA 4ED6A 2MY8A 1SXLA 3R5CA 4OMFG 2XI3A 4DEZA 3KG1A 2UUBJ 3DDKA 1LQ9A 3DNCA 2HHSA 5A0YB 3MAHA 4IQMA 2IVFB 2ZOGA 4A8KA 3CEDA 2G2YA 4NRUA 2AGPA 1WC1A 4G1QA 1S9GA 3TANA 1IKVB 2JEJA 2VOOA 4WIQA 1H7XA
chains in the Genus database with same CATH topology
1DURA 4KHRA 2MPUA 4EGLA 3T1YF 2F8EX 5T7LB 1U2RA 4RU2A 2D1CA 1TKZB 4I69A 1S0NA 2HNDA 4PXDA 1ZH5A 1D0EA 4BWMA 1PSDA 5KFMA 2VC0A 1T94A 1U25A 4KGKA 1RP5A 3J7Z5 2UVUA 2HVIA 4DR3F 2R8GA 4F3OA 2FHOB 4O4RA 2UV8G 1S6OA 3QMQA 4I0WA 4IG3A 3HDSA 1SC6A 2ZH5A 4FXVA 4D3HA 1XR5A 2KN4A 3MAQA 4ZVFA 3T5HA 1TV6B 2CPXA 3NCQA 2MQNA 4O23A 5IXUA 5I42B 3PFEA 1KTQA 2OPPA 1K0VA 3PR4A 5C42A 4PXEA 4WFYA 3TUJC 3SSQA 1HNVA 1VRUA 1AUDA 1TAUA 2FY1A 4PPZA 1XTZA 4QIGA 1IKWA 4CT9A 5HQ8A 5BYQA 1T3OA 1X4EA 2MGZA 4B9SA 2OSRA 5CYMA 3THVA 2DNRA 4GMKA 4V19J 2UUWA 1I1GA 4CT8A 1WELA 4Q7AA 1S1XB 3H59A 5DETA 5DDPC 4WU3A 1S77D 4KO0A 2ZFHA 3DLJA 4EUVA 3LQVA 3NMRA 1YTYA 2JC0A 1K1QA 2RRNA 4YDXA 4B9NA 3BSOA 4ED3A 4RLEA 4BCAA 2IVMA 3SSRA 1S4FA 4G1PA 4EO8A 2E5LF 2RMLA 3DRYA 3MM8B 2B51A 3G8SA 2JEIA 1N5QA 1SKSA 1DJ0A 5KFBA 4NYZA 3ISNC 4DR6F 2A3JA 5KFGA 5DJBA 1G7CB 1UEVA 4AXIA 3J7ZT 2HNZA 2OTLS 1R8PA 2QLWA 4TLRA 2HWHA 2VFVA 2FHJA 5KOXA 4ED0A 2BQRA 4RNMA 1WF0A 3D0GE 1JJHA 1DLOA 2V8DA 5KFAA 2DGTA 5H1SV 4TQSA 3VALA 2YX7A 2MZ1A 4H4MA 3US5A 3MEGB 2W9CA 2ERRA 3K5OA 5I3UB 5LMUF 3UR0A 2GC8A 3M32A 3KMQA 1KLMA 2BVZA 5KT6A 4QIVA 3LP1A 2ZH1A 1O8BA 3W2VA 4AXJA 2ABYA 1NAQA 1FJGF 3F73A 2QA1A 2J9DE 2K1RA 1UA0A 2UUBF 2RKIA 4OFZA 2VKRA 4ECYA 1CLFA 4Y2CA 1NZAA 3MPVA 1S1UB 2CZ4A 5K9FA 2J5AA 2JWNA 1RTIB 1GH8A 3Q8SB 3IC1A 4EYIB 1IBLF 1UVKA 1H98A 4ES1A 1GXLA 1UVMA 3BGFA 1FK9A 1C1CA