3H5XA

Crystal structure of 2'-amino-2'-deoxy-cytidine-5'-triphosphate bound to norovirus gii rna polymerase
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
483
structure length
470
Chain Sequence
b'GTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAEDFYVPRQEPMFRWMRFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA dependent RNA polymerase
publication title Binding of 2'-amino-2'-deoxycytidine-5'-triphosphate to norovirus polymerase induces rearrangement of the active site.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase/rna
total genus 149
structure length 470
sequence length 483
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 3h5xA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3h5xA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3h5xA03
3DOLB 1JLEB 5K14A 4RW9B 3KLVA 2XWYA 3OHBA 4GC7A 3V6JA 4MH8A 3Q8RB 3DOKA 4TY9A 3KNAA 1S6QB 1TKTA 4XPEA 3MEGB 1BQNA 3MR6A 5DG7A 1RT1B 2IJNA 2ASJA 5F8NA 5KFHA 1QAIA 3PJXA 3KLEA 1EP4B 3KHHA 4HKQA 3ISNC 3DRPB 5JUMA 4J9MA 4G1QA 3PHEA 1RT3B 5J2PA 2D41A 5KFSA 1LWEB 1HPZA 4IDKB 4YR3A 4MIBA 4GC6A 1D0EA 2JC1A 4WYLA 4Y3CA 2F8EX 3CJ3A 5F9NA 4IFVA 5C25A 5I3UB 4YR2A 3CJ0A 5J2QA 1IKVA 5DGAA 1TKXA 2ILYA 1RTJB 3MEEA 1RTIB 2IMWP 1BQMB 3DLGA 1DTTB 2UUTA 2R8HA 3RB6A 2XC9A 2JEIA 1DTQB 1ZETA 3NL0A 1SUQB 3DM2A 3HVTA 2OPSA 3MTKA 2E9RX 2WHOA 5DQHA 4O3OA 3M8PB 3QLHA 2IBKA 4EYHB 2BE2B 4Y2AA 4ZVGA 5KFIA 1HQUB 1TKZA 5I42A 3NKYA 5KFFA 2CJQA 2C2EA 4Q45A 3KK2B 4ED0A 5DGBA 2YKNB 3SFGA 4Q8EA 5HBMA 5J2MB 4F50A 2FVPA 1FK9A 5DLGA 2IM1A 3C6TB 4NCGB 1C1CA 4XO0A 2B5JA 2IC3A 4ZP9A 1MMLA 3DLKA 3HHKA 2I1RA 4EBDA 2ILZA 4LQ9A 2BQ3A 4URQU 2IM0A 5C24A 1JXLA 2AGOA 2AX1A 1JKHA 1JLQA 3V6DB 4RW6A 4M94A 1RTDA 3DRRB 2YNIA 4I2QB 1S1UB 2R8IA 1J5OA 2JC0A 1SH3A 1RT2B 4KB7A 3GIJA 1S97A 2OPQB 2B43A 1HNVB 1RT6B 4MK8A 1T05B 4ID5B 4O3QA 3LP2A 1JLCA 3PR4A 1HQEB 2AU0A 5CYQB 2BANA 5KG4A 2FJXA 5D3GA 3MEDA 2R2UA 3IGNA 3SI8A 3H5UA 4IG0B 2IM3A 3OL9A 1C1BB 1UWBA 2JEJA 4QWAA 4O4GB 1HNIA 1REVA 2BRKA 3LP1B 3I0SB 2YKMB 2ZD1A 3QYYA 2XCPA 3QGHA 4ZMMA 4R5PA 3Q8QB 2WTFA 1S48A 3H4BA 1FKOB 1S1XB 1T03B 4KBIA 4FBTA 4RZRA 4I7FB 4QW9A 3V4IA 4Q8FA 2I5JB 1IKWB 1S1VB 4WFXA 1NHVA 5KG7A 5JXSA 1S0MA 5F8JA 3IRXA 4ED2A 1N5YA 3N6MA 3RB4A 1TL1B 1S0NA 3M8QA 3KK1A 3LP0B 4RW8B 4ZVFA 2W9CA 4ZP6A 4K4UA 1S6PB 4Q0BA 3GQCA 4ZHRA 4EBEA 3HVAA 3IN5A 2WRMA 4WXWA 1TL3B 4H4OB 4TY8B 3PR5B 3G6XA 1RYSA 2R8GA 3NAIA 3KMSA 5KT4A 1JLGA 1LWFA 1YVFA 2RF2A 4ICLB 3FFIA 1JLAA 5KFUA 3T5LA 4NZ0A 3QIPB 2UVVA 3DLEA 3IS9A 3V81A 4MFBA 5C42A 2XGPA 4DL7A 2WB4A 4TYAA 2ASDA 1I6JA 2C2RA 4O4RA 2YNGA 5KFLA 2E9ZA 1D1UA 3T5KA 2B6AA 3PZPA 2HNZB 4IG3A 1NNDA 4DL2A 3G6YA 3NAHA 4DL6A 2UUWA 4ED8A 3GYNA 4RNMA 3HKWA 4IFYA 5KFDA 4O3RA 3CJ5A 3KHGA 2R2SA 4NLUA 3T19A 3TVKA 2WONB 5KT5A 3Q8SB 2W9AA 2C2DA 2AWZA 5FDLB 1S1WB 4IOBA 3PW4A 3OL7A 1N4LA 4H4MA 1JX4A 4ECYA 5EUHA 1S9FA 4KFBA 1RA7A 1SV5A 3NMAA 1RTHB 5DQIA 3H4DA 2V9WA 1LWCA 2ZE2A 2XCAA 2BQUA 1N56A 4JV1A 2RDJA 4K4ZA 3I0RA 1RT4A 3RAQA 3KLIA 4KHMA 1RT5A 3T1AA 2VA3A 3DOKB 1RDRA 2IJFA 1TKTB 4DL3A 3D5MA 2VG5A 4RW4A 3RB3A 1BQNB 4TXSA 3C6UA 3VQSA 4Q43A 1RYRA 1RT7A 4LSNA 5DQGA 3KLEB 4NLWA 4J9RA 4PQUA 1C0UB 4NLSA 3JSMB 5J2PB 5KFNA 2IM2A 5HROA 1HPZB 1KLMA 1QE1A 5KFTA 3RAXA 4IR9A 4ECUA 5KFVA 2WOMA 4QWBA 3TAMB 2W7PA 1LW0A 1S49A 4KKOA 5C25B 3CIZA 5J2QB 4RW7B 1IKVB 5HLFA 1CSJA 1TKXB 2FJWA 3E51A 4EEYA 3H40A 3CJ2A 3DLGB 5L9XA 3QIDA 4FS1A 2QE5A 4EO8A 2OPRA 3DM2B 3HVTB 1S9EA 2OPSB 4O44A 2DPIA 4RW9A 3QLHB 4IH5A 3MFHA 4LSLA 1T94A 3FQLA 4WFZA 4R8UA 2E9TA 2VG7A 2WK4A 1HMVB 2D3UA 1TKZB 5I42B 3FSIA 4RU9A 2FLPA 3JYTA 1C0TA 1EP4A 5KFQA 4ECTA 1N6QA 5HBMB 2RDIA 2DPJA 2GIQA 1FK9B 4MK9A 5J2NB 3FRZA 2R2TA 1QAJA 4IDKA 3CDWA 1C1CB 4ZPDA 2B5JB 2ATLA 2RKIA 1HYSA 3DLKB 4NLVA 1S4FA 1S10A 5KG2A 5C24B 3PW7A 4J9PA 4NLOA 1S9GA 3DYAA 1JKHB 1JLQB 1BQMA 4RW6B 3GILA 2W8KA 4G3IA 4NRTA 2V4QA 2AQ4A 2YNIB 1J5OB 3GV5B 1FKPA 3M8PA 3BGRA 3MECA 3NBPA 4KO0A 5F9LA 3V6HA 3CO9A 2HWHA 3BSNA 3UPFA 3LP2B 1JLCB 4WYWA 1QUVA 3DMJB 5KFGA 1T3NA 2BANB 4MK7A 5KT6A 5D3GB 3UR0A 3KK3A 4O3PA 4TQRA 3BREA 4IRDA 2UVUA 1UWBB 2VA2A 3NGDA 1VRUB 2W8LA 3V6KA 1REVB 4I2PA 2XI2A 2ZD1B 1IKXA 4R5PB 3SFUA 1JLFA 2OH2A 2YNFA 2BR0A 5KT3A 3BJYA 2HAIA 3V4IB 4ECVA 1W25A 3LAMA 3DDKA 4URSA 4ECSA 1VRTA 3DRSA 3QGGA 5KFEA 4NRUA 1S1TA 4U6PA 3I5CA 3IRXB 3BQ2A 4HYKA 1N5YB 4ED3A 4KV8A 4ZVHA 2JEFA 5KFRA 4Q44A 5EWFA 5J1EA 4Y2CA 3M8QB 3KK1B 1NHUA 5CYQA 4ZPCA 1DLOA 2R2RA 3BQ0A 4ECXA 4QWCA 5CYMB 2W9CB 3OSPA 4IKAA 3CVKA 4EBCA 5F8LA 2HNDA 4F4XA 5DLFA 4Q0BB 2HMIA 4PUOA 3OLAA 4ZHRB 4Y34A 4QW8A 2IAJA 3KLFA 4J9OA 4WE1A 4K4YA 3PJWA 2YKMA 4NLQA 3OL6A 3QZ8A 4ED6A 2VG6B 2XGQA 4YR0A 4K4VA 1LWFB 4IRCA 4B3OA 3KLGA 2RF2B 1GX6A 4RNNA 1TV6A 5C5JA 5KFWA 3FFIB 4WZMA 1JLAB 4DG1A 4XPCA 1TVRA 3DLEB 3IS9B 3V81B 4MFBB 5C42B 4F4ZA 2C28A 5KG1A 2YNGB 5EDWA 3OSNA 5L1IA 4FS2A 1TL1A 4MIAA 1EETB 4IG3B 3ITHA 2GIRA 5KFCA 2OPPA 1R0AA 3BSOA 4NLPA 2D3ZA 4IFYB 2AX0A 3M9OB 2W9BA 3H5XA 2FVSA 3I5AA 3TQ1A 3CJ4A 4J9SA 1RAJA 4H4MB 4WXOA 4DL4A 3QO9A 4JUZA 2HNYA 1SV5B 4NLXA 3MF5A 4KFBB 4ECZA 5HP1A 1LWCB 2ZE2B 2JEGA 3IG1A 5L1JA 4NLGA 1JLBA 3I0RB 3H5SA 5KFMA 1RT4B 3H59A 5KG6A 1LW2A 3UDLA 3KLIB 5DG8A 1RT5B 4EYIB 2AGPA 5K14B 4PWDA 4K4XA 3IGVA 3KHLA 2FVQA 2VG5B 5KG5A 3C6UB 4PQUB 2FVRA 4LSNB 3KLHA 1Z4UA 3KJVA 1WNEA 5HROB 3EZUA 4QPXA 3BSCA 1KLMB 1QE1B 4G1QB 3T5JA 3DI6A 4QWDA 3UQSA 2WOMB 5F8HA 3E01A 1LW0B 1IKYA 1ZTTA 2YNHA 5HLFB 4IFVB 5F8MA 5DG9A 3OLBA 4ECRA 4ZVEA 3MEEB 2R8JA 1RTHA 2ALZA 2OPRB 1S9EB 5F8GA 2CKWA 1MU2A 1IM4A 4R0EA 4LQ3A 4LSLB 4ECWA 3DOLA 1JLEA 5KFOA 4R8UB 3ICLA 4F4YA 2W7OA 2VG7B 1XR7A 1S6QA 3MEGA 5KFZA 3OHAA 1N48A 4MKBA 3JYTB 1C0TB 1RT1A 3CDEA 2FLLA 1N6QB 4OL8A 1C0UA 3H5YA 3JSMA 5F8IA 4H54A 3LANA 3DRPA 1RT3A 1LWEA 1HYSB 2RKIB 4URGA 3TAMA 3EPGA 4M95A 2XI3A 4WZQA 2IC3B 4RW7A 3KHRA 4DL5A 1S9GB 3G6VA 3DYAB 3ISND 4JV0A 5I3UA 1SH2A 4J9LA 3CDUA 1RTJA 3G86A 4ZP8A 1RTIA 1C2PA 1DTTA 1TQLA 5KFPA 1KHVA 1DTQA 5T14A 1FKPB 3D28A 3BGRB 3MECB 1SUQA 3NBPB 4KO0B 4YP3A 3BR9A 2J6UA 2BE2A 1HMVA 3GIKA 4QWEA 2EC0A 2O5DA 5KG3A 1HQUA 3KK3B 3MR5A 3EPIA 2ZKUA 3RB0A 3MEDB 4ZPBA 2WCXA 3GIMA 3KK2A 3HVWA 4I2PB 2YKNA 1JIHA 5J2NA 3RBEA 5J2MA 1IKXB 3KMQA 1HARA 1HNIB 3I5BA 1JLFB 3GV7B 4MKAA 3C6TA 2YNFB 3T5HA 4NCGA 2C22A 2J6TA 4FBUA 2HWIA 3GIIA 2ASLA 1VRTB 3DRSB 1S1TB 2UVRA 5L1KA 2BRLA 3V6DA 4K50A 4KV8B 3DRRA 4I2QA 3KOAA 1S1UA 5KFJA 2FVCA 2V4RA 2UVWA 1RT2A 5J1EB 2BQRA 3H2LA 2GC8A 2OPQA 1KHWA 1HNVA 1RT6A 3DMJA 4KSEB 4EO6A 1T05A 1DLOB 4ID5A 4RNFA 5EWGA 1OS5A 1XR6A 1HQEA 2R8KA 4NLRA 4RNHA 3FDSA 3RBDA 3LALA 4IR1A 2HNDB 4ZPAA 1VRUA 2HMIB 4PUOB 4IG0A 4YMEA 2IAJB 3KLFB 1C1BA 4WE1B 3PW2A 4O4GA 3LP1A 4RUAA 3PW5A 3I0SA 4B3OB 3KLGB 3OL8A 4NLTA 3QGIA 4ECQA 1TV6B 1TP7A 1JLGB 1FKOA 4KE5A 1S1XA 4DG1B 3N6LA 1XR5A 4IH7A 4TYBA 3BQ1A 1TVRB 1T03A 4IRKA 4I7FA 2I5JA 1IKWA 1S1VA 2J6SA 5KFBA 3FQKA 2V0NA 4ED7A 4IH6A 1RTDB 4J9KA 4TQSA 4RNOA 3ITHB 4NLYA 4X2BA 2B6AB 2OPPB 2D7SA 4ZP7A 5EWEA 1R0AB 4O3SA 5CYMA 4RUCA 3LP0A 2W9BB 4RW8A 5KFAA 3MR2A 3N6NA 1RA6A 1S6PA 3LAKA 1GX5A 4KHRA 3M9NB 3PVXA 4O3NA 4U7CA 1U09A 4K4WA 3GV8B 3QO9B 1TL3A 2VG6A 2HNYB 2QV6A 4H4OA 4TY8A 5KFXA 4J9NA 5L1LA 4YQWA 5HP1B 3IG1B 4TN2A 2JLEA 1JLBB 5KG0A 1SH0A 1LW2B 4ED1A 4ICLA 2AGQA 2FJVA 5KFYA 2FLNA 4PWDB 3QIPA 4NYZA 4JV2A 3M9MB 4RW4B 1K1SA 3KLHB 4WFYA 3MR3A 3Q8PB 1EETA 3KJVB 1RT7B 4J9QA 5KFKA 2HNZA 4K4SA 5KT2A 3PW0A 1K1QA 3DI6B 2IA6A 3E01B 1IKYB 2YNHB 3H98A 3BSAA 4KKOB 4TLRA 4KAIA 1ZTWA 2WONA 5FDLA 1S1WA 4DEZA 3MFIA 5KT7A 1S0OA 4F4WA 4K4TA 4IQXA 3QZ7A 1MU2B 4NLDA 3CWJA 4O44B
chains in the Genus database with same CATH superfamily
3I9V9 4CM0A 3ZNUA 2GHVC 3V5RA 2QTWA 2GS8A 1QAIA 3DN9A 1MLAA 3GCWP 2F8EX 2CQCA 3AJDA 4S0MA 1SC6A 1X4EA 4OYAA 2IMWP 2KG0A 4EYHB 4FP9A 3AA8A 2FDNA 1PBAA 1H38A 5MLCV 2YKNB 4P6QA 1NK5A 2BVZA 2ACMA 4YHHJ 2CAXA 4XO0A 2IC3A 3DRYA 3GMGA 4ZOSA 2OFHX 2MZRA 4DFPA 3JXOA 1U26A 2Q43A 1OY9A 2KT5A 2QLXA 3IGNA 5A0YA 3WX8A 3RJMB 3TAQA 3IWLA 2Z4PA 2ZD1A 4OV6A 2KM8C 1RP5A 3BPSP 3AB2B 2BJ1A 2GNKA 2B4VA 2MKHA 4LIRA 3N6MA 1TL1B 2V5HG 1F2GA 4TY8B 4NPOA 5C2CA 3B54A 5C42A 1NJWA 5KFLA 5IWAJ 2VJUA 4ILRA 3QQCD 4ILMA 2MHNA 5EUHA 1S9FA 3RAQA 5GMKa 4CO5A 3OXFA 3O3LA 4LRCA 1HNXF 1P1LA 3TW0A 3TAMB 4FYVB 4OI4A 4RW7B 4DV1F 4UQGA 3E51A 4C8KA 1NDPA 3M6UA 1XWLA 4QR2A 3DM2B 4JI1J 2BNWA 4C9DA 2VG7A 1HMVB 1FO1A 4PWUA 5LM7E 3DGPB 1C1CB 2KVIA 2ATLA 3PYEA 5C24B 3DFEA 4RW6B 3G8SA 2AQ4A 2IIHA 1HNWJ 5F9LA 1JLCB 2DCLA 4TQRA 4NZ7A 5ETTA 4UOGA 5THWA 5C7PA 1J5EF 2JZ5A 2BR0A 3EZOA 1PC4A 3CF5Q 2DISA 5H9EK 2C3YA 1BWVA 3A4TA 1NH8A 1WELA 1RTZA 2HMIA 4NWBA 2HZVA 4DSEA 3WIUA 3CPWR 2CPDA 1TL1A 1ZAWA 4MIAA 2UV8A 4FXDA 1SJ1A 1FJCA 4NLPA 2AX0A 1WACA 4U9RA 4HR2A 2EBEA 4J9SA 2CVEA 2HNYA 3DU6A 3MEKA 1M90T 3I0RB 4M94A 5BYQA 2HVDA 3SZ2A 4OX7A 1GTHA 2DR7A 3UD5A 4OYMA 2KT2A 2I6WA 5E41A 1FRMA 1KLMB 2EVZA 2JVRA 2J0XA 5F8HA 3E01A 1P9QC 1ZTTA 5DM6Q 3H90A 4MKYA 5DG9A 1YKWA 5LMNJ 4F04B 3NWGA 2BJDA 2ZM6J 3BPDA 1RT1A 3CDEA 3H8YA 2FLLA 2X1BA 3R6LB 1WC1A 2AEJA 3TAMA 4RW7A 2R7WA 4OI1A 4FYYB 4JV0A 2F63A 1C2PA 2V50A 1U1PA 2R7XA 1L3VA 1HMVA 2Y3YA 3GIMA 1K0TA 1T7PA 3M2UA 1EB0A 3VGSA 2C22A 1YJTA 1TMMA 3M6WA 4WPAA 1VISA 3MD3A 2UVRA 1WC5A 5AXNA 2FVCA 1UCNA 1UEUA 2BJ8A 4CO0A 1FDBA 4J9VA 1IBKJ 1J27A 4I7FA 1YGYA 2ROGA 1H0HB 3ITHB 4NLYA 1TKDA 4CO4A 4KGVB 2KT3A 2RMLA 3ET6A 1TK5A 3KG1A 2N7CA 2OGUA 3ZTOA 1CJTB 5DJBA 1WG5A 1QJHA 2AYGA 4I6WA 3DI6B 3JSRA 1MN9A 4XIUA 4GVBB 4FVMA 5H1SV 4PXCA 3OTCA 3RR8A 2XWYA 3ZZZA 1HBOB 3HSZA 2Q79A 2FD2A 1SQFA 1VQNS 1N0VC 2K1RB 2UXCJ 1R27B 4YR3A 4LMZA 2XTEA 1K47A 1VFJA 5C25A 5I3UB 2HVHA 3PX0A 1BQMB 2YH1A 2JEIA 3NL0A 2J7UA 4DV2F 4KR0B 1SUQB 4UW2A 4LF4J 2W4PA 2EFQA 3MCSA 2C2EA 1IBCB 3KK2B 3HLUA 2VC0A 3SFGA 4EI2A 4B08A 3HP6A 1Y4ZB 3GB0A 2I8EA 3W65A 2IDLA 2AX1A 4DFMA 2HPUA 5BR8J 4J7CA 3VGVA 4LBPA 1JJ4A 3S7RA 4U8VA 4NOHA 2R2UA 1WOOA 3TUIC 2XCPA 4RPFA 3VV2B 4OQJA 1T03B 3M8RA 2BV3A 2YVSA 1ZOTA 3NGRA 4ED2A 4PG8A 1VJWA 2CWKA 2U2FA 2CZVC 3OFEA 3I4PA 3SQGA 1VQLS 4DPOA 3IO1A 2GCFA 4HH1A 1L5UA 1IM6A 3GQCA 3P4UB 4A4JA 4C98A 1VYAA 4C3KA 1Q5VA 2R8GA 3CULA 2XNRA 2Q1LA 2EPIA 3PJ9A 3FFIA 3QIPB 2UVVA 3UN3A 4ZS6A 4CH0S 1D1UA 3OXLA 2CPIA 3I55S 2G0IA 4RU2A 3RU0A 3UW1A 1P6TA 1E6YA 3EDQB 1Y00A 1OSDA 4YB1P 3KLIA 1OM2A 3QSIA 2CJXB 1KDNA 1RHQB 2NZCA 3IMQJ 2K3IA 1KN6A 1HPZB 3I82A 2YX7A 3SEOA 4C8LA 3CIMA 1LW0A 1S49A 2R7RA 1IKVB 2FJWA 2RAQA 2H1OE 4ELUA 1PARA 3PACA 3J7AN 3QIDA 2PC6A 3OUYB 3GYXB 3I6PA 4B3MF 3MFHA 3EX7B 4GVLA 2F5GA 2ZHBA 3CDWA 3DLKB 3NCQA 5KG2A 3DYAA 1BQMA 3D2WA 3OTEA 3OJSA 4CCHA 3UPFA 3LP2B 4WYWA 4K5SA 2BANB 4AD6A 2LQ5A 4F2SA 2CQDA 2ZH5A 2DGXA 4R5PB 1L3KA 3D3CJ 5M2UA 4LJMA 1IR2A 4UOCA 4D3GA 2QX0A 3Q8YA 1S6OA 3CCES 3EYZA 4PXEA 3CXCR 4W4MA 4YHHF 1RCXB 4WTOB 4Q0BB 3QGPA 3KLFA 2VG6B 4BS2A 2Y0BB 5C5JA 4X62J 1Q82T 4MYTA 4F4ZA 2QLBB 2BACA 4DV0F 2YWEA 1EA4A 5KFCA 4YUDA 1M1GA 1Y3KA 3QO9A 2ZE2B 4LT6A 1S99A 3MZIA 2H5IB 4Z7YA 2VD3A 3RRGA 3EZUA 1P1TA 5IV4A 3D68A 1IKYA 2I2YA 1RI7A 3IWNC 5D0RA 4ECRA 1WDDA 4XTTA 4F3MA 1S9EB 4DCJB 4IOCQ 2MQPA 1IM4A 1KEKA 4LQ3A 4ECWA 2W7OA 5KFZA 1TFYA 1KFDA 4D3HA 3W62A 1NK6A 3TRGA 2DNLA 3JSBA 2A0FB 1SH2A 1R3NA 5D4PA 4CLPA 5ETVA 2VUGA 1F5CA 2L3MA 4QWEA 2ABYA 1RAFB 1HARA 2GMHA 4JI1F 3T6BA 4FBUA 4OLOA 2Z56B 2N3OA 1XMOJ 4USHA 5L46A 4OV1A 2DXEA 4NLRA 2D1CA 5AXKA 4O4GA 1VQYA 2QT7A 4HHJA 3AHPA 3ZXWA 4DV5J 4DJBA 4M5IA 3LOUA 1IKWA 2F4FA 2J6SA 2QJ3A 2MMYA 3JTPA 2YKQA 1KQFB 4RW8A 4DCPB 2Z2MA 5EHHA 4KTQA 4OX9J 2VG6A 1M0SA 4TN2A 2JLEA 4ZPWR 2B8PA 1I5OB 3HVRA 3FCWA 2OAUA 4C8OA 3AWRA 1XMBA 3PW0A 4DX7A 3OFFA 4K59A 3CCMS 1Z2LA 5LT5A 1RABB 4O44B 3V6JA 1APSA 2XEXA 1TKTA 2MSSA 2ASJA 3VAKA 4DXLA 1SC4B 3KHHA 4J9MA 2Y1JA 1ARRA 5IM0B 4LF7J 2HG4A 1QSLA 1CULA 1QLNA 3OTBA 4FF3A 2MJUA 4XK8C 1YJVA 2RRNA 2QN6B 1S5ZA 2DITA 2IBKA 3H7HB 4Y2AA 1SXLA 4LF8J 1PGZA 4Q45A 4ED0A 5J2MB 5AXMA 4EK2A 1D9FA 1NZAA 2HQFA 4EBDA 5LMNF 2ZM6F 1WJ9A 3MM9A 3U1MA 1J5OA 4DSLA 5IT9Y 2B43A 5H9FJ 1WC6A 4ID5B 2AU0A 1GFWB 5D3GA 3MCOA 4ZMMA 1NSKL 1R8PA 1S1VB 2GQ2A 5KG7A 5F8JA 5E33A 3TARA 1RCOB 2A6MA 4ZVFA 3GJRB 1F60B 4DF8A 3KMSA 3EUNA 2M8HA 4QBUA 3V81A 1B3TA 1FVSA 2ZJPQ 1I6JA 2WSCC 4O4RA 1ICEB 3PV8A 1IBKF 4C8YA 1T9YA 4ED8A 1Y5NB 4KGXB 1V5VA 1O0PA 4L74A 4NLUA 2WONB 2AWZA 4PG5A 5LMUJ 2IJFA 3FEYB 1MWYA 3MUMP 1OPIA 1FEEA 4PQUA 4J9RA 2RQKA 3O6QA 5HROA 2BYCA 3UVJA 5KFVA 1W2BR 3G82B 4O44A 1N54B 2DPIA 1TL5A 4IH5A 4JP8A 2ROPA 2WK4A 4RX6A 2RKIA 1X9SA 4QYZJ 4GO5X 3TZZA 3GP9A 2HURA 3CD0A 1F6TA 2YNIB 3W2WA 9ATCB 3BSNA 2UXCF 2DNZA 2H9ZA 2LXIA 1FXRA 1X0FA 1WC4A 1JLFA 4HTIA 3N01A 3H2UB 4LF4F 4U6PA 1N5YB 2JEFA 1NHUA 2BSQE 3OSPA 1IWAA 4A47A 4F4XA 3TZYA 2UUBJ 5BR8F 4OMFG 3H42A 3CGIA 3ZZPA 5I3QA 1HHTP 2G2ZA 1EETB 4DSJA 4UUWA 2A10A 5AT1B 2XG8A 1G4CA 2KL8A 3H59A 2OP5A 3SXLA 3LGNA 4DMZA 1HIYA 2MKCA 2X3DA 2FVQA 1QVFR 2FVRA 4GKJJ 4LRVA 4FNIA 2AYBA 3I9ZA 4YB5A 2HRUA 3Q83A 4IFVB 5F8MA 1BUXA 3TVZA 1GMUA 3ILJA 3EM1A 3FZBA 3CCJS 2F1FA 4DWIA 4B3TJ 1FT8A 5AE2A 1NM2A 4GKKF 5HK4A 2LU2A 4H54A 3NNHA 4ZVUB 3LANA 4Q7AA 5DETA 4DL5A 2OO4A 4PWWA 4I4BA 4J9LA 3EMTA 1DQAA 3G82A 3VAGA 2JVOA 3DNCA 1VC6A 4OHVA 2KELA 3C16A 2VKRA 3T5HA 1CC7A 3PX4A 3MMCB 2ASLA 1VRTB 2HEKA 1ULRA 3UD3P 5HAOA 4BWMA 4A8WA 2V4RA 5KFJA 2OPQA 1T05A 4X66J 1Q8IA 2XYPB 2HNDB 2OEMA 2PFFB 2OHDA 4TYBA 5G4DA 2GGPB 1OQ3A 2YQ1A 2AF6A 1NDCA 4LIWA 3AD7C 1SJFA 3QNWB 4P72A 2MLYA 3C15B 3F44A 4F25A 3MR2A 2VQEJ 2GIFA 1MYKA 3PVXA 4DN9A 3P6YC 3UN2A 3GFZA 2Q66A 4OHXA 3M05A 1TL4A 1EETA 3G6ES 4X62F 5B09A 4K7QA 1CJUB 1RHMB 4OYBA 1FXLA 3F56A 4USKA 2BA9A 3P49B 3MD1A 4TKTA 2CPYA 3PJXA 4A8QA 2V2VA 2D9PA 4IFVA 4KPYA 2ZDOA 2UUTA 2XC9A 2V2KA 2PT0A 4NXNF 5HL7Q 2KYZA 2AEFA 3K7RA 3VAJA 1SJRA 4DU8A 2JHEA 3T1YF 2B5JA 4CLFA 1JB0C 4LQ9A 4URQU 1Q16A 1V3RA 4PG4A 1F9HA 2JC0A 4NMXA 2JFKA 3M7VA 3PR4A 1HQEB 5D4OA 4AT1B 1P94A 3AA9A 3CMQA 5H9EJ 4QWAA 3Q8QB 1S48A 1PC5A 3MM8B 2DNGA 5A2QU 1NHVA 5C2GA 2MQLA 1X5TA 2J8AA 3HHLA 3PO4A 1FRIA 2DXDA 2GVZB 3E8OA 2FJDB 3R5BA 4P7VA 1WKKA 1XMOF 1A9NB 3NAIA 3UI3A 2DXFA 1UW9A 3O8WA 2MYFA 4RBUA 3BEGB 2DR9A 1HA1A 1PCAA 3C15A 3GYNA 5D0EA 4DV5F 1YITS 2HRTA 3TVKA 3OL7A 2HRYA 3CSKA 1RTHB 2P9GA 3F41A 1N56A 1HWLA 4B9NA 2W4DA 2MSTA 5KTQA 1RYRA 3KLEB 4OX9F 1C0UB 1TL7B 3N9UC 1AW0A 2CJKA 3IXQA 2CWXA 2PO4A 1Z1ZA 1CJUA 4WP8A 2LLZA 2XS5A 4EO8A 2JH3A 3QLHB 4LSLA 3LJPA 2P6TA 3M32B 3FQLA 4WFZA 2FTRA 3NGTA 2E9TA 4YOEA 5J2NB 1YRXA 4LF5F 2QC3A 2DK2A 4ZA1A 4NLVA 2B51A 2HHTA 1MNEA 1JLQB 2A3JA 4OZJA 1RADB 3BZQA 1RKJA 1Q8LA 3VTIA 4DFKA 2MKIA 1ZA1B 2XMAA 4ZCMA 4F4AA 1NK0A 1U48A 3V4IB 4KYZA 1W25A 2A2BA 4CLLA 3NRBA 4URSA 4ECSA 2HGNA 3HULA 4GO7X 3VAIA 5A2QY 1S1TA 4UUXA 1BAZA 3M8QB 5HQLA 2MTLA 3D6FB 3AOCA 3J80U 4QPTA 4WE1A 2D3OR 3MM8A 1GX6A 1JLAB 4OHWA 2P8IA 5DDPC 2C28A 3OSNA 2GVZA 3PCOB 3BSOA 4HHHA 1T9VA 3BN7A 2UXDJ 3FSXA 3BYPA 2JOQA 5KFMA 4FPIA 2CNNB 5B0DA 4DR7J 3BB5A 3P8BB 2D3O1 3T9ZA 1UL3A 2L48A 5B0GA 3MM6B 3R3TA 1AROP 1OPZA 1RTHA 4OZ5A 2J7KA 1XR7A 4DS4A 3G8TA 1N88A 3RW7A 1C0UA 3H5YA 1CS4A 2GAHC 4DV3J 3HK2A 2CADA 4M5LA 2KZZA 1VQ6S 3J7YU 1RTDB 4AAIA 2EC0A 3MI7X 2DR6A 1HR0J 5J2NA 2MPUA 1URNA 1UPMB 2VDIA 2J6TA 4DR5J 4TU7A 3V6DA 2BRLA 4USMA 1F9FA 1YJRA 5D15A 3I96A 1KHWA 1OS5A 1XR6A 2KYXA 3BGFA 4DN0A 4AXJA 4YMEA 2IAJB 3PW5A 4C11B 1QD1A 4B9SA 1L3TA 4IRKA 2I38A 2L9WA 5RUBA 1RAHB 2D7SA 1S7HA 1S6PA 4JI7J 5EGYA 3D54A 1TL3A 4J9NA 5HP1B 4P10A 3BH6B 2IMOA 1SQEA 3HJVA 4TLQA 2JRSA 1WEYA 1UFLA 3IAM9 3M9MB 4NA1A 4J9QA 5KFKA 2HNZA 2QSFA 2YY3A 1VOMA 2XMMA 3VW4A 1YTYA 1UJ6A 5D0GA 4NLDA 3DOLB 4RW9B 3KLVA 1GMVA 4N8NA 1YK9A 1PO6A 3MEGB 1BQNA 5DG7A 3NWRA 4B9VA 2DEJA 1RHJB 5JUMA 5KFSA 1U2RA 4DX6A 3OR1B 4KC5A 1DY3A 1Q78A 2ZBRA 2Y8YA 3RW6A 1DTTB 2ZOGA 3HVTA 3QT7A 5LSRA 1FJEB 3CCSS 2MKYA 1XBWA 2FVPA 1FDNA 1GNKA 3RTVA 2ROEA 3MUTP 2ZVSA 4AQYJ 1X9MA 3A3NB 1XJWB 1JKHA 1YIJS 5LSOA 4X4RA 4B3TF 2F8MA 1RTDA 3DRRB 2AKWB 1RT6B 4O3QA 2XMKA 3G9CA 4CNZA 3OL9A 1C1BB 3D6MB 5JMNA 3QYYA 1RKIA 2VU5A 1WWHA 2DNOA 2FGOA 1SJ3P 2IHR1 5A8KA 1SC3B 3CJSA 1VRQC 4QR1A 5F41A 3A12A 1NK7A 2Q3PA 4GRSA 4A8OA 2ZJRQ 4EBEA 3CCWA 2FHJD 1YHQS 4MJWA 5IZHA 3U27A 2PMWA 4BLGA 2OEKA 4X66F 2J76E 2YNGA 2DYAA 3KKFA 3AX3A 4IG3A 4J37A 3G6YA 2FHOB 4OYXA 2GVDA 5KT5A 2ZH8A 2CQ4A 3NLCA 1SV5A 2KDOA 4QZVB 1Z2ZA 4JV1A 5HJXA 1RT4A 1K44A 4RWXA 3HO1A 4ANCA 2IM2A 1Q95G 1QE1A 2HHVA 2WOMA 2Z2ZA 2OTLS 2JLGA 1U1MA 1V6HA 4RW9A 2M2BA 4R8UA 5I42B 4FDFA 2RDIA 3L4BC 3PNIA 3QRQA 3MM7B 3OR1A 3Q86A 4YDDB 4G3IA 2W8KA 1MYLA 3BGRA 1T3NA 1QUVA 2IPOB 2VFUA 3CC2S 2XQCA 3JSYA 3KK3A 1VQ7S 2FHJA 2J9DE 3CJKA 1IKXA 4IO9Q 2YNFA 5K9FA 4ZVOB 4CLKA 4UOHA 3BBFA 3FZ2A 1H7WA 1PKUA 3HZEA 4ZVHA 2RNEA 1X4BA 5J1EA 4DPUA 3HPOA 2R42A 4C0OC 4QW8A 3PJWA 2OMLA 4FXVA 3VF0B 2VV5A 4DR4J 4C7QA 1MW7A 1G3OA 3DLEB 3IS9B 4OYPA 2Y1IA 2BZ2A 2LEAA 2NLWA 1OY8A 4RBVA 5IT4A 1YJNS 1RHRB 2UXBJ 4X4QA 2CAJA 3QRRA 2B0GA 2F65A 4KHPJ 3MF5A 2A2DA 4NLGA 3RRKA 2NR0A 2VG5B 1UETA 1LNQA 1TUVA 3I32A 1B01A 1VIOA 1PSDA 4ZLJA 3IM9A 4P52A 3BF4A 3MEEB 1U2CA 4QR0A 1N0UA 1MWQA 2XLJA 1KP6A 2YBVA 1KBRA 4KJIA 1EAYC 2OELA 1NLKL 1XK8A 2RB7A 2CZ4A 3DRPA 3CO0P 1BDVA 4RWWA 2DGOA 2IY5B 4A48A 3CDUA 2CIMA 3G86A 1I1GA 3VCDA 3EXCX 2P2CB 2YWFA 1ZBTA 3HD1A 5E7OB 2K06A 3GIKA 1HQUA 2MB0B 3HVWA 4C0HA 2FHMA 2QZ8A 4NYOA 2C3UA 3C6TA 4NCGA 2R4FA 3B78A 3AY0A 4FKYA 1O5JA 5L1KA 2VICA 5F3TA 2UVWA 1HNVA 5EWGA 1U02A 2W2QP 2ZH6A 3A8KA 4DS5A 3TYTA 2GQQA 4DG1B 1XR5A 5HATA 2RH3A 4RKUC 1AZSA 2V0NA 3TA1A 3OJUA 2UP1A 2W2NP 2OPPB 1R0AB 1DARA 3LGMA 1MG7A 4K8RA 5L1LA 4JV2A 3K5NA 1K1SA 1OWXA 1N5VA 4WFYA 3KDOA 5LJ3Y 1KWMA 1HNZJ 2IA6A 1RWVB 4TLRA 4B3SF 3PKMA 1VR6A 3MFIA 4DEZA 4K4TA 1MU2B 3OT9A 8AT1B 3RBXA 1U4BA 1FE0A 3KNAA 1S6QB 2BKOA 5ETLA 2UXDF 3THTA 1WOPA 3K89A 2J8SA 1R8AA 1RT3B 3W2VB 2KFNA 3R7NB 1D0EA 1AXQA 3PFOA 4KY3A 3M2VA 1Q7LB 3MEEA 2WSFC 3BDPA 4C4WA 4DR7F 5DQHA 2RE1A 1VI7A 1OYEA 2P9EA 3M2RB 1E6VB 4NMLA 4USJC 1IUJA 2QMXA 1GAOA 3GFHA 2EK1A 2ILZA 1IRQA 2BQ3A 2Z57B 3MMAA 4P73A 3MR7A 4QYRA 1REGX 2H4WB 3L7OA 3ZZOA 4CLSA 4CH7A 4DV3F 2RQMA 2N4CA 3MM5B 3NEKA 3A8IA 1REVA 2YKMB 3TZWA 1LKZA 1M5KC 2LP4A 4PZVA 1YRTA 3IAS9 1S0MA 4M1KA 4IO1A 2HHWA 4JI3J 1LV5A 4ZJQA 4FXEA 1HHQA 1RBOB 3V2UC 3R1LA 2G9OA 4DR5F 4ZHRA 5CH7B 5L8RC 2IVFB 3Q2TC 2OI2A 4CTAB 4E2FB 1ZAXA 2HVZA 2HKEA 4NI2A 1HBNB 2VFTA 3WZ0A 4OJ3A 2GHPA 1KQKA 3EXYA 1UVIA 2W9AA 5FDLB 2BJ7A 1ZA2B 2VF3A 1LWXA 1RA7A 3ILIA 1CLFA 3O5TB 2ZH4A 3JTOA 4PQAA 1RDRA 1NSAA 4DL3A 2XYHB 3VWSA 4G1IA 4Q43A 1ZM3A 5DQGA 4LFAF 4JI7F 3R6GB 1ARQA 3FEXB 2ADLA 1CBKA 4ALZA 2W7PA 2B9YA 1XN9A 1Q81T 3DLGB 1WD6A 2E29A 2F3JA 3AQOA 3M30B 3SCKE 3CC4S 3S01A 2UUAF 1Q4RA 2HFNA 5HBMB 3HXMA 1QAJA 4H4KC 2PI5A 1KNZA 1H73A 1UJ5A 1CC8A 3CCLS 1S9GA 5M2PA 2HGMA 1WTBA 1FKPA 1WKLA 1VBXA 3CO9A 4OJGA 4JI2J 3PRVA 2XSFA 3M2RA 4CT8A 2OSQA 4O3PA 3TX8A 4ZKAA 3KUHA 1H98A 2E7WA 1KTQA 5G0RA 2G1DA 5CYJA 1XNQF 5ETOA 3SYZA 3POTB 3I5CA 4PXBA 4ZIVA 2B4OA 4Y2CA 1S72S 3KK1B 4AQYF 2LDYA 4EBCA 3GFXA 2YKMA 3OL6A 4B3OA 2RF2B 2OD6A 4I56A 1YLXA 3VGTA 2KRRA 3M1VB 5EDWA 1YDLA 4DQRA 1NDKA 5HVHA 2J0QD 1N34J 2V8PA 3UCZP 5A8RB 3G96A 3TQ1A 4H4MB 2MQNA 3QWPA 2MGZB 2QIFA 2JEGA 5DG8A 4NCAA 4PWDA 4CTAA 3KHLA 2WZ1A 2V9KA 4LUBA 4AUKA 4LFCJ 4J91A 2LEBA 1GMWA 1N52B 1FNXH 3KJVA 4G1QB 4QWDA 4LFBJ 4HDHA 4HL9A 3OLBA 2HQGA 1TFWA 1RBAA 2OEJA 3OVAA 3LW5C 2AZ3A 5KFOA 3OVBA 3KYLA 2E5HA 3HFZB 1C0TB 3N4WA 2VBXA 3P3DA 4AL7A 4JI8F 1S0VA 2Z2YB 2HHHJ 2HBRB 4LBIA 2V68A 3MECB 1HI1A 2RUSA 2H48B 4WFBQ 1FX2A 5T7LB 2YX4A 3EICA 3SBMA 4CH1A 2ZKUA 4DX5A 3MEDB 1B7YB 2DY1A 3GR0A 1SB6A 3CCUS 3KMQA 3I5BA 4M8LA 4X4PA 5IC4B 1WDTA 2HHSA 3W5ZA 1DBDA 3DRSB 6AT1B 3ZZRA 4M63A 4KV8B 4DU7A 3SSQA 2VFVA 4CDIA 1S77D 1VGYA 1OO0B 3H2LA 2M4MA 1O8BA 2HVEA 4RBTA 1MMNA 4IG0A 1IN0A 1Q8BA 3T6JA 2RRBA 1SC1B 4ZCIA 1IBLF 4J9KA 1WHXA 4ID8A 4TQSA 1U6FA 2DRAA 3LP0A 4O23A 3HJFA 1RA6A 1GX5A 1UJ4A 1IXKA 3IG1B 2LMIA 1CVJA 2FLNA 1R0CB 3VAHA 1NUEA 4JV5J 2V69A 2BA3A 4DR4F 3W61A 1JWWA 3HX9A 4UTGA 3AB4B 1S1WA 1I51B 2MGZA 2KXNB 6FDRA 4DUYF 1JLEB 4GC7A 1SKRA 2MZTA 4ZVTB 1L3SA 3LO3A 2W24A 1S12A 1WHWA 3J81j 2L41A 4G1QA 5J2PA 4KHPF 2K8GA 4IDKB 4AFFA 2HWTA 3GR1A 1TKXA 3CJQA 1RTJB 3R2CJ 4IOAQ 3HSJA 3OR2A 3RB6A 1DTQB 1TK0A 3LWLA 7AT1B 3I87A 4CYUA 1SIWA 5GAHU 4YB7A 3B4DA 3DLBA 1TKZA 1ZM9A 3ENVA 1FK9A 1RWMB 2CNOB 2XMJA 3U7JA 2VH7A 1ITPA 1VK8A 1H74A 3R5JB 2IBOA 1T3OA 1ZYQA 2FZGB 2FJXA 3MEDA 1MROB 2KB2A 3K2YA 4F2RA 2DRBA 2BRKA 3M4XA 3LP1B 4J90A 1YRUA 1S1XB 3JQMA 4KBIA 2BE7D 4Y2MA 1CJKB 5KAKA 4DI6A 3RB4A 3QMQA 2DHSA 2GPEA 4X64J 1XC9A 5J1NA 4K4UA 2YQ3A 1O51A 2B4PA 2Y1RI 3HVAA 4AXIA 2QG9B 3EZ5A 3PM9A 1FTRA 5IFMA 1X4FA 4K5RA 2ALYB 4JBCA 1UVNA 2GA7A 4DL6A 5SUHA 2RVJA 1NLAA 1JXVA 5A6PA 2C2DA 2MKSA 4P71A 1N4LA 1Y0HA 1ZPWX 2IYGA 2XCAA 3K5LA 4K4ZA 5GMDA 2P6SA 2EFVA 2HSEB 1NKBA 2AY0A 3TA0A 2GJ2A 3LA0A 2XTCA 3CIZA 1CSJA 1GH8A 2DGVA 4NXMF 2QE5A 2O1PA 3CMES 3PYGA 3H2VE 3W63A 3IR5B 2D3UA 2ZBIA 4ZN1A 2LA6A 2DPJA 4CLTA 2V2QA 4IDKA 3N0VA 2BDPA 1HYSA 2HW3A 3J7Z5 1IBMJ 1SJQA 2V94A 3FT7A 2GFFA 3NBPA 2XTDA 4DV6F 4MK7A 1U1OA 5A0YB 2WVFA 4R25A 2VBYA 3R9LA 2ZD1B 2CJBA 2MZQA 4DLEA 1T02A 5KFEA 4BC7A 5BYSA 3BQ2A 3NG8A 1FNOA 5DLFA 4Y34A 3LPYA 4K4YA 1NPRA 4F4KA 4RUBA 1H72C 3IA0A 1ZS6A 2VKZG 1M1KT 4I6YA 2OKQA 5C42B 3DOMA 1AUSL 1DRZA 4FS2A 3NXZA 2E1MC 1XNRJ 2CPHA 1VQOS 2D3ZA 3C8YA 1URRA 2IRUA 2DTJA 2ZC4A 2OJ3A 2SXLA 4DL4A 1M5PC 4NLXA 4ECZA 5L1JA 4JI3F 5FJ4A 1LW2A 2G13A 3FBFA 5GADI 5LXYA 2KXHA 2V63A 3J7ZT 1RAEB 3UQSA 3PG9A 2YNHA 4DV4J 3ZO7A 3C66A 1B0PA 1NSQA 2LXFA 2FJEB 5F8GA 2HBYB 2VG7B 4MKBA 2NZ4A 1YQHA 1SKWA 4ELTA 4CLZA 1LWEA 4M95A 3KHRA 4X4NA 3MURP 3OW2R 2HHXA 4EU0A 1RSCA 4YP3A 4P9SA 2XNQA 1BGXT 2QMWA 3GLJA 3UDVA 3RB0A 3H87C 3UDEA 1QSYA 3GWCA 3SDEB 3QT5A 4Q5VA 2FUG9 3GYGA 4XAKA 4ZN3A 3K8WA 4K50A 4I2QA 3QJJA 1RT2A 4RLEA 4A46A 2NXUA 1U24A 4LR8A 4ZPAA 2EEYA 2HMIB 2CPGA 3I0SA 3WC2A 4OJ1A 2AD9A 1JLGB 3ZZYA 4IH7A 4JI2F 1Q53A 2CQGA 4LRDA 3OVSA 5KFBA 3Q8VA 3BM7A 4LRAA 5FLXU 4WCEQ 1VJQA 2EC2A 1U8SA 1NZ8A 3JQKA 4O3NA 4K4WA 3A1YG 2BQRA 2HNYB 5KFXA 1HWIA 4ICLA 3U1NA 4WTYA 1D9AA 1U1RA 1KTVA 3MR3A 3CCQS 1RAOA 5B0BA 4K4SA 3E01B 4I1TA 1QTMA 1R6YA 1S0OA 2ZBQA 3MPVA 4C8ZA 3CWJA 2PIIA 3P5TL 2H1YA 3MR6A 1RT1B 2K3KA 5KFHA 2Z8QA 2NYHA 3PHEA 1HBMA 2WVDA 4C6AA 2DNPA 2JC1A 1U49A 5A8WB 2VOOA 1M5SA 4ZLNA 4TVAB 1ZETA 4LFCF 2MXYA 2FGCA 2OPSA 5CABA 4ZVGA 4LFBF 2K29A 2XZTB 5DGBA 3M2UB 4Q8EA 5IV3A 2NXEA 4F67A 2HQIA 3U02A 1IWGA 2QRRA 2R8IA 4K2XA 2AZ1A 1FERA 2GQCA 4ZDNA 5CYQB 3K58A 1OYDA 2CG4A 2LEPA 2HHHF 3SDEA 2L9NA 2WTFA 4FBTA 1CJVB 4I7FB 3ZTQA 4U67Q 4PR6A 1Y11A 1RGVA 1FESA 3N79A 4R0JA 2HZCA 3QT6A 5FLXY 5GADU 2WVEA 2W9CA 1FEHA 4DR6J 1U2FA 1S59A 3ET6B 1X4AA 1JLGA 1LWFA 3IBWA 2J5AA 4LF2A 3FCHA 3T5LA 2ZH3A 1SL0A 2WB4A 2GHWA 1UVLA 1XQIA 5AJ3J 2XM3A 2Y1LB 3ETOA 4IFYA 2CJYB 4NEYA 4X84A 4WF9Q 4X4TA 3GPAA 1JJCB 8RUCA 4NZ6A 3VHQA 4LSNA 2ZOMA 3IR7A 3FMBA 3CD7A 1UP1A 1UA1A 4IYQA 5C25B 4H4KA 2KJVA 5F3ZA 1NK8A 4FS1A 1XMQJ 2ZZTA 3C14A 1LFPA 4JV5F 3BGOP 4FF2A 3D0IE 1FE4A 2YWGA 2MKJA 2FLPA 3JYTA 2ZKTA 1N6QA 5DO2A 2CPXA 2ZZNA 1S4FA 5A8WA 3PW7A 1X5OA 4OIXA 3B8HA 4NX9A 4ZITA 1NH7A 1XIQA 1FDAA 3T1HJ 3TWZA 2FC9A 2W8LA 3V6KA 4J5OA 2B4UA 2IRYA 2WB1D 5E3RA 2KHDA 5HO4A 2D68A 4DR1J 1FWLA 3ZTPA 2BOPA 1EJ7L 3I4HX 3SQGB 3I31A 5CYQA 1DLOA 5ITHA 3OFGA 1U8WA 3W8PA 2RQCA 5KOWA 3K0JA 1R89A 2RILA 4YR0A 1FJGJ 3KLGA 2RT3A 2ZDPA 5EX3A 1CJVA 1TV6A 2O67A 3FFIB 2CG8A 3OTOJ 4N7TA 2HHUA 1NEEA 4ZK7M 2Q6CA 4DR2J 2XS7A 5CAAA 3KUGA 1HD0A 2OLWA 2W7AA 2CDRB 3DLJA 1E6YB 3KG0A 1X7VA 2RS8A 4DPWA 3D9BA 1KKHA 3KLIB 1UFWA 3IGVA 4LF9F 4X64F 3PY8A 1V9OA 2WAQD 2CZ9A 3KLHA 2KXFA 4JI4J 4DUZJ 1X8DA 4LR7A 1A0OB 4OJHA 5ETSA 1LW0B 1NHKL 3VZIA 2DHAA 4DPYA 3TA2A 2AEMA 1D3WA 3LF0A 3PYFA 3WIVA 4CP5A 3ISZA 2J0WA 1GQEA 2QLJB 3T9NA 2XI3A 3DYAB 2M70A 4NCBA 1I94J 2XSJB 2IVYA 4DQSA 3TANA 2BE2A 4WP9A 4B3RJ 4HT7A 5HANA 3K17A 4L6V3 4ZPBA 3AJ1A 4LF6F 3EGWB 3DLLQ 1BC6A 3GV7B 2VFRA 5F0UA 2HWIA 2XY5A 1R8BA 2DCUB 4D8JA 3LTOA 1S1UA 3RG6A 5EX0A 4B17A 3QRPA 3FDSA 5GAEU 1NJXA 1KD1T 3KLFB 2VPYB 4C8NA 1IBMF 4ENOA 5BXIA 3PRDA 1FKOA 4KE5A 2I5JA 4FPRA 3R1HA 3DDNA 1FA0A 2KFYA 4K0KJ 3UCUP 2ZOFA 1VHIA 2Z58B 3QO9B 4FF4A 3CEDA 3I56S 1IQZA 2I0XA 3A13A 3X3UA 1B4SA 1D9DA 4PPDA 1IKYB 4G65A 3H98A 2J0SD 3DXBA 3RRHA 4F4WA 1TUGB 5B08A 4OZ3A 2XHWA 3QZ7A 2HIYA 1XNRF 3Q8RB 3DOKA 1CQMA 1UZDA 2A6OA 4GC6A 2FY8A 4OI6A 3TUJC 2HK2A 2R8HA 5HVFA 1RWPB 3D1HA 1VQKS 2E9RX 3JAMY 3U1LA 1Q7YT 2JXGA 2WSEC 4LBHA 2HLTA 3NKYA 3QJPA 5KFFA 1FD8A 3G87A 2GMJA 4KH0B 3CNQP 3R8YA 3R97A 2ZEJA 4WK1A 2XSJA 3B82A 4OZLA 4KB7A 2EG2A 1TAQA 3BBBA 5KG4A 2DGSA 3SI8A 3H5UA 4O4GB 3QGHA 4P2XA 4QOTA 2L08A 1W2IA 4QW9A 2PN6A 4Q8FA 2V34A 1IKWB 4WFXA 1QTGA 4PG6A 2ADBA 4RW8B 5HI7A 1C4AA 3FRYA 1HD1A 2XZWA 3WBZA 4WXWA 3PR5B 3ILOA 2AJ4A 1NSPA 1HNXJ 4CNYA 4DV1J 1Q86T 3JTNA 2ASYA 5JJBA 1RWOB 2DY9A 3MAAA 4OHYA 2G0JA 1Q1KA 2QO3A 3LWMA 3KJNB 4KFBA 2DNYA 1U25A 4EMDA 3L09A 2RDJA 1RT5A 1TKTB 3D5MA 3RB3A 2HQCA 3TJAA 3KUEA 3VQSA 1HBUB 4NLWA 3D67A 1K9MT 3MAHA 3JS9A 2M8DB 2AJ1A 4HTJA 3NGSA 1M5OC 2MKKA 5HLFA 4P74A 2YPZA 3SIPB 3R5AA 1CULB 4ATNA 1YBAA 5IWAF 1C4CA 2OPRA 3OBIA 1Y9OA 3HT0A 2BJEA 2NREA 4FXWA 1YBTA 4Y2IA 1OSCA 3SCLE 4J9PA 3Q89A 5T41A 2FIUA 3S1TA 3MM9B 5B0AA 1J5OB 4KO0A 1RAIB 5DRKA 4CM2A 5KFGA 1XTZA 5D3GB 4QCLA 4PPZA 1VRUB 2FQQB 4DL0C 5L39A 3S6EA 2AYEA 5AXLA 2HAIA 3RUBL 3D3BJ 1WG1A 4NRUA 4X4OA 5IT9U 4HYKA 2X1AA 5EWFA 2ERRA 3NS6A 2HFOA 3A3PB 4ER8A 3CVKA 4LSZB 4J9OA 2CA9A 2R3VA 1HNWF 1M5HA 4DLGA 4ES3A 2MQMA 3V81B 2LCWA 1DZ5A 4MAKA 1R43A 2M52A 2W9BA 4CI0B 3I5AA 4CLUA 4UOFA 3W3SA 1EX8A 4ETZA 2AIRB 3AJ2A 4PQUB 3D7SB 5HROB 4CLYA 4WKRA 4CT9A 3UVJB 3T5JA 3NNCA 3EJMA 1VC5A 2HBZB 4DFJA 3T3FA 3PDNA 1UFKA 2GMLA 1HBUA 2RKIB 4NA3A 1FRKA 2HS4A 4I64A 1RTIA 3BO4A 3W2WB 4WK3A 3W5YA 2O3DA 3HHEA 2NS1B 2HFZA 2PMZD 1JLFB 1X60A 2QL9B 1XMQF 1WUUA 1N5TA 2UU9J 3DDIA 4LVOP 5H9FK 3CJRA 3UO0A 3TR5A 3D66A 2PA3A 3P96A 4ANEA 3KG4A 2H4YB 3GTYX 3K5OA 3UCGA 3MMBB 1VRUA 1M1HA 3HCXA 3GXQA 3QJLA 4ECQA 3N6LA 2MLXA 1VQ4S 1RWKB 4F02A 3FQKA 1NXIA 4ZPVR 1IR0A 1R8HA 4PEOA 4RNOA 1G6BA 4RUCA 3K59A 4KHRA 4DR1F 4H4OA 2QV6A 1RWNB 1YJ9S 1V3ZA 2BKNA 1RZMA 1O6XA 4C0BA 3KJQB 1QAYA 4AE5A 1OMSA 4ME7E 2R7OA 4DV2J 3CT9A 1RU1A 1FJGF 2MQ8A 1HWUA 1UPPA 1RWUA 3OTOF 1ELOA 1NRKA 2RBFA 2DGUA 2DJWA 1KQGB 4XPEA 2IYIA 1FF2A 2H65B 2E7VA 3D0HE 5F9NA 4YR2A 5J2QA 1N36J 4PYAA 4DUZF 1FFGB 2QA4S 1UTAA 4V1Ak 1B70B 2NUUG 3C16B 4ZVSB 4M5DA 3UR3C 1ZM2A 2FY1A 2OPQB 1T05B 2D9OA 4DSFA 2ZWPA 2IM3A 1UWBA 4ZVPB 3SV4A 2AJ0A 1I94F 2Q2KA 5DZ7A 3J7A1 2CDQA 4B3RF 1KVKA 2ZWOA 1UVJA 3IRXA 1T9TA 2QFIA 4FF1A 3MMBA 2JXHA 4ZP6A 4WIIA 4CWBA 2X3GA 3IFEA 4MKVA 5LSLA 1Y5IB 3BKUA 2V4JB 1YVFA 3HSGA 2HGLA 1RHUB 2XMWA 2CQPA 1H7XA 4DPTA 4YY3J 4MFBA 4OYZA 2XGPA 4MMOA 3SMZA 4RNMA 2OFGX 2LECA 3H4DA 1LWCA 3T1AA 3Q2SC 2E1AA 1QAXA 3C6UA 2QL5B 3GJTB 1KVIA 2H5EA 3D6TB 3AQPA 3EGNA 3QT8A 4EEYA 4RO0A 2W4CA 1Q5YA 1FWKA 1FFSB 4ECTA 1X4DA 5LL6d 3FRZA 2B5JB 1SVDA 1S10A 1Q16B 2AT1B 4UF4A 3AX2A 4NRTA 3V6HA 5LXRA 2LA4A 3N5BA 4C3MA 3WDOA 3N5FA 1BHNA 1VIXA 2PA8D 4DV0J 4I2PA 1FWPA 3FEZA 4B9TA 4HT5A 3UWTA 3TEHB 3HHLB 3AH6A 1IVZA 2R2RA 1VMBA 4A8YA 4PUOA 3OLAA 3TUZC 2WBMA 5GAGU 4KT0C 2XGQA 3BGUA 5KFWA 4XPCA 1EHWA 1TVRA 5SZTA 2B7BB 2H5JB 3TAPA 1JNZB 3QPIA 1UA0A 1NJZA 2YPYA 3D6HB 3FC9A 1FCAA 4WXOA 2YXLA 1T9UA 2C2OB 2V4JA 4P2FA 1JLBA 3H5SA 4CLWA 2E66A 2EW9A 4K4XA 3K8VA 4EUVA 2QFJA 3G4SS 2YWHA 3RZAA 1WNEA 3DHXA 4QPXA 2WVBA 3CJ8A 1AT1B 1T9XA 2Y8WA 1FFWB 3D1OA 2NPIA 2R8JA 4M5NA 3TZXA 4OI2A 1YG0A 4R0EA 3CTRA 4J9UE 4LSLB 3ICLA 2MY7A 3BS9A 1U1LA 4OL8A 2HFUA 2ZH9A 2CXEA 1QDUB 2VIHA 2CQ2A 1TQLA 2MQOA 5BJRA 5T14A 3D28A 1WG4A 5D8HB 2ZUAA 5KG3A 2PEBA 4E8UA 2CQ3A 1X4HA 2YKNA 2ADCA 1UEVA 1T9WA 3MPUB 3VEBA 2V67A 4USUA 1S1TB 4HI2A 4KSEB 1KOHA 2GO8A 4LR9A 4QIWD 4WE1B 3J7YI 2VBZA 4WIQA 2OD4A 4XDDA 1LFWA 2AJQA 2B9XA 4YS2A 3T41A 4P75A 2B6AB 3PEHA 5AE3A 5EWEA 1FI4A 2MQQA 3NNAA 3LAKA 2VASA 1U09A 4TY8A 1JK9B 3K5MA 4G6VB 5KFYA 3D1QA 3K57A 4RW4B 3L9ZA 1RT7B 2CUYA 1R8CA 2V2ZA 2W01A 2BQUA 5CD4A 4RUHA 3D4JA 2APOA 2IJNA 3MOZA 4DR3J 1CS4B 1EP4B 1XEZA 4A8SA 2K5JA 4WYLA 4Y3CA 1S57A 3CJ3A 2HQDA 2PGCA 4UT4A 2RHQB 3DM2A 2BW7A 3MTKA 2R7SA 3AX5A 1AFIA 4C3LA 2J7WA 4XDCA 2KN4A 5DLGA 3R7SB 3DGPA 1C1CA 2QLWA 3HHKA 1RISA 2PEHA 5C24A 3V6DB 1VS3A 4RW6A 2VL1A 1N32J 1HI8A 5E3CA 3GIJA 5K8NA 1JLCA 2HYIB 4LF7F 4HDGA 2RRAA 2JEJA 3GG0A 1S7IA 3C2PA 2E5IA 4LF8F 5JXSA 1L3UA 3A8JA 2DNNA 2CNKB 3PX6A 3MHYA 2UU9F 1S6PB 4F3QA 3ADAC 2WRMA 1TL3B 3CUNA 4ZJLA 2F9DA 1R31A 2RDDA 5BYRA 2ASDA 4TYAA 1BXNA 1TMJA 1FRHA 1CG2A 2B6AA 3PZPA 2HNZB 2UUWA 3KFWX 4CO1A 4I6AA 1RHKB 2NSBA 5KFDA 2A1BA 1VDHA 3CJ5A 3A8EA 3T19A 2DGWA 4IOBA 3QWUA 4ECYA 3HSDA 2PFDA 3I0RA 4KHMA 4CQ1A 1RAAB 2YWWA 4RW4A 1YSJA 1BQNB 2C2NA 1RT7A 2MHEA 4IQMA 2DHHA 2ZHOA 1KLMA 5KFTA 2DEIA 1RB0A 4W90B 2HFVA 4ECUA 5D0HA 3L95X 2YH0A 4O0NA 1MNTA 2YX1A 3HVTB 1BQXA 4F8RA 4CRJA 4HH0A 1F3FA 3RYLA 1EP4A 4ZVRB 2FZCB 4ZPDA 5LMUF 2EI5A 4HV0A 1JKHB 3CMAS 4ZCLA 4N47A 2DVIA 2K7KA 4V19X 3HFVA 1RBLA 2QYGA 1N36F 2XI2A 5DDOC 8ATCB 4B9UA 4N77A 1ACMB 3BJYA 1LQ9A 1S4EA 3W8GA 5K20B 3QGGA 2N82B 5A8KB 3O2IA 3DHWC 4ECXA 1YJWS 4IKAA 1U7LA 4OLPA 3M8SA 4ES2A 4PAAA 1HI0P 1PBUA 3HHNB 3RBZA 1V5IB 4YB6A 3HHLC 3W1YC 3OFHA 2YNGB 1Y3JA 4IG3B 3ITHA 3ETMA 3MPDA 2GVDB 4GKKJ 2ZH7A 1SV5B 2IDEA 1RT4B 3UDLA 3FBCA 1CJTA 4YN3B 2PE8A 3ILLA 1Z4UA 3TP2A 2UUBF 1QE1B 3DI6A 2WOMB 3TJ8A 1FDDA 2FJAB 3W5XA 4YY3F 4GVBA 4N8OA 2W25A 1NJYA 3MPWA 2DHGA 4R8UB 2HVIA 4MT1A 3PIOQ 1HBOA 1W7WA 2FLOA 1NMEB 4LF1A 2K1RA 2XBPA 3OTDA 2JLFA 2CQBA 4YFUA 3QFHA 5I3UA 2DB1A 3WHIA 1TUWA 2Z2LA 2ZBCA 5HSPA 1RWXB 3HMJG 3BGRB 1SUQA 4GKJF 5HMXA 3GIRA 3KK3B 4RL1A 2JBVA 3KK2A 3OPKA 3CJKB 1IKXB 3THVA 1T11A 4MKAA 2YNFB 2VFSA 3MCMA 4MTPA 2GZOA 5J1EB 2Q6BA 4L3KA 2WVCA 2GC8A 2ZBPA 2XMTA 4UQTA 2R8KA 4JYAJ 1GEHA 4RUAA 1T03A 3IWXA 1ZPVA 1X9WA 2YTCA 4KGZB 3VVTA 1GXUA 4BHQA 1QUPA 1Q8KA 2KTQA 2BM1A 5ETKA 5KFAA 3N6NA 3Q0AA 4TU9A 3FCVA 3GV8B 4QQBA 3R2DJ 5KG0A 2ZHAA 1SJ4P 4CO2A 2ZJQQ 3QIPA 3KWMA 4OFZA 2P9CA 1LOUA 1P9YA 1U1KA 4NXNJ 2EFNA 3LPEA 2YQ0A 3W64A 4PYDA 4IQXA 3T1YJ 4I69A 3LGHA 2VQEF 1UUJA 3FNNA 3ELHA 3TO8A 5F8NA 1NB2A 2XTJP 2DNQA 1KONA 3DRPB 4Y0FA 4B02A 1HPZA 1SL2A 3CJ0A 1IKVA 2ILYA 3OUYA 3DXSX 2KZMA 3FJ2A 3M8PB 1YJ7A 5KFIA 2C1EB 1HQUB 2LQJA 1QY7A 1F9EB 3C6TB 1BDTA 4NCGB 2HK3A 1MMLA 3DLKA 2IM0A 2CPFA 2G2OA 4BCAA 1PIEA 3ZTRA 1SH3A 1HNVB 2PMHA 1FTCA 3LP2A 3IR6B 2BANA 2X1FA 3HI9A 3UFCX 4R5PA 3H4BA 3CD5A 4RZRA 2XMVA 1AZSB 1LK7A 1IQTA 3VAFA 2E1PA 1JQGA 2AJFE 4Q0BA 2E7XA 2IFXA 3IN5A 1VCTA 4B9MA 2AP6A 3CCRS 1RYSA 2KH9A 4ILLA 4DQIA 4DL2A 4DUTA 4ZJOA 3NAHA 2OUGA 3Q8SB 1FKAF 4LF5J 3NNEA 2ZE2A 2VA3A 4TXSA 4DQPA 2EFGA 4E98A 3RAXA 3FUYA 1X4GA 4QWBA 3B6BA 3M2VB 3CDAA 2R7UA 2VQFJ 1S9EA 1WI6A 3NY0A 2BM0A 3N28A 2GV1A 5KFQA 1SIZA 4KPCA 2F7VA 4N5SA 4JB8B 3MMAB 4N41A 4PABA 5B0CA 4DR3F 3M8PA 3VVUA 2HWHA 2B9EA 3S8SA 3DMJB 3EDRB 3JB9k 5DZ6A 3UR0A 3FSYA 1REVB 4OZNA 1KC8T 2OH2A 4ES1A 1K73T 1NU4A 2JSXA 1UVMA 4ZHRB 2OTJS 2BOAA 4JI5J 2JXIA 4YEAA 1N32F 1VQSA 2FPHX 4NI2B 4ZPTR 1D8YA 2B56A 1HFEL 1B64A 1UAWA 2RU9A 3BGLA 3CJ4A 1BY9A 3M6XA 1PYOB 1NBEB 3MTJA 3HF5A 4OZ2A 1FX4A 3EWGA 5CZVA 1VC0A 4QU6A 2VBWA 2MLZA 3ONQA 4A8MP 5B0FA 4ZVEA 2B3TB 4DZ6A 2K7JA 1B0VA 3R5CA 1NKCA 5F8IA 5ETMA 1Y7PA 5IM0A 4NE9C 1S9GB 2KKEA 1UZHA 4USIA 1WC3A 4ZIWA 1FKPB 4M5MA 2M88A 4U96A 1GT8A 4OZ0A 1KRPA 2G0CA 2KO1A 1EZZB 2O5DA 2W1BA 3KNGA 2JWNA 5J2MA 5G0RB 1HNIB 4Y2KA 1CEZA 3GIIA 3GG1A 1D09B 1B0TA 2CQ0A 2VPWB 2M5YA 4EO6A 3DMJA 4ID5A 2WW8A 3RBDA 4ELVA 3R27A 4I0WA 1SI9A 4B3OB 1BLUA 3OL8A 3BQ1A 3FKBA 4Y65A 2MEWA 1S1VA 4HVZA 1HR0F 5DM7Q 4P2SA 2J9DA 4O3SA 4X4SA 1LXJA 2DT9A 1U1QA 1RQ0A 3V4MA 4L75A 4FKXA 4ED1A 2AGQA 4PWDB 2V1SA 1Q0NA 5EN1A 3VQTA 3Q8PB 3KJVB 2BJ9A 5CQGA 3GJQB 5KT2A 1NDLA 1K1QA 1VLOA 4A8FA 2A2CA 1SPBP 1IJFB 2DGTA 2VB6A 5IT0A 2WONA 1NKEA 1EQMA 4MYUA 3H0PA 1NK4A 1X4CA 4F0MA 3OHBA 4MH8A 4DV7J 2PD1A 1DURA 2MY8A 4ZLLA 5IXUA 2ACYA 3ISNC 3BN4A 2LU1A 1HKAA 1ZAVA 2ZFHA 1QVGR 4MIBA 3HKZD 1FNMA 1JJHA 1NCLA 3LUYA 5E5NA 1KVJA 2FYXA 2WHOA 2L9DA 1J2VA 3OV7A 2AJ2A 2LVWA 3FGVA 3AAWB 4QIFA 3AOBA 4OX8A 1WOSA 2YNIA 1S97A 3VZHA 4IG0B 4EZ9A 1HNIA 2VPXB 4CIOA 2K2PA 1AYEA 5GAHI 1TR0A 2WW4A 1N5YA 4M5HA 2QA1A 5L9NA 2DO4A 3LP0B 1FRJA 2ZC3A 3IP0A 2XLIA 3TNVA 3SCIE 5KT4A 4E0DA 3KDNA 1S6UA 4OI0A 3R5DA 4NZ0A 4NL5A 4JYAF 1NPPA 2E9ZA 3HHLD 4BWJA 4U8YA 1PJ6A 2R2SA 1B28A 2NUHA 1S1WB 3DGVA 2GO9A 1JX4A 3CDBA 2LDIA 1MMDA 3ULHA 2Z0GA 1VQMS 3SSSA 2JL9A 2HHPA 2XLKA 3UNGC 1DFDA 2RJZA 4NLSA 3HHDA 5J2PB 4L73A 3EVWA 2JNJA 3NOCA 3QAUA 2BMBA 1TKXB 1SQGA 4A8KA 5FD1A 2M3DA 3OR2B 3J81U 3LH2S 4MIWA 4CYUB 1SIWB 1T94A 2NCKL 2GX8A 3DCAA 5K5MA 1TKZB 3W9HA 2Y9HA 3FSIA 2E44A 3MXHP 3SSRA 1FK9B 1W26A 4DDFA 2HZAA 2BW2A 4NLOA 5E2QA 2HHQA 5D6GA 2V4QA 1HL6A 2V8HA 1U9PA 1WTFA 4YDXA 2ZNYA 1KSPA 2C3OA 1R0BG 2E5GA 2R7QA 2VA2A 3SV3A 1RAGB 1NB7A 2DBBA 3MMCA 3LAMA 3PFEA 1VRTA 4P2MA 1F3VA 2DIUA 4Q44A 5IQ6A 2C3PA 3BQ0A 4QWCA 2HNDA 4N56A 5LJ5Y 1OQ6A 1M5VC 4NLQA 2DIVA 2F4VJ 4IRCA 3ZC4A 2GGPA 2AHOB 5KG1A 2GW8A 1NAQA 3AOAA 2GIRA 2O66A 5ETRA 3M9OB 4QIEA 4OYWA 4JUZA 4KRWA 4PKDB 5KG6A 1YX2A 3CW2C 5AE1A 1SKUB 4F36A 3E2EA 2ZITA 3BSCA 1QSSA 3W60A 4MJKA 4F0KA 1OHNA 3J81Y 5HMYA 2UXBF 3L3CA 1RLCL 4F3OA 1JXEA 1N48A 3Q22A 2QLFB 3CJTA 3KJFB 4NYPA 1HYSB 2X1GA 2J9CA 3G6VA 2G1HA 2UV8G 2F40A 4ZP8A 1VBKA 3AXKA 3NBPB 3TOQA 3BR9A 3HM9A 1WKJA 5U47A 5D77A 3MR5A 3EGZA 3EPIA 1DQ9A 3UN5A 2VQFF 4A8XA 2DH9A 2WBRA 3PYDA 2NYIA 1IJEB 2P5VA 1NO8A 3AXMA 2XY6A 2W2OP 3G71S 1HQEA 3LALA 5CXTA 3SCJE 2ZZMA 1YZ6A 4HI1A 4IUFA 2KJWA 2KU7A 3VR1A 2CPZA 3OD2A 1TP7A 1FHTA 3HT3A 2CRLA 4BDPA 3ENQA 1KOOA 3DOMB 3P45B 4B3SJ 4IH6A 3HFKA 1WSVA 4X2BA 3HDSA 3PHTA 5LOQA 2HBQB 5FIIA 1LW2B 4LREA 5IOLA 1G1XA 2YKOA 1NK9A 4JI5F 2GAGC 2HAFA 2YNHB 3BSAA 5KT7A 4BBYA 1X0PA 2ATCB 2CNLB 5CCLA 4EGLA 3LQVA 3K5PA 1T0TV 3KLEA 1T8EA 1TL7A 2D41A 5CCMA 1LWEB 3A3OB 3QATA 1FD2A 4EZ6A 2VPZB 1R6VA 3O44A 1QM9A 2KOEA 4G1PA 1KLNA 5ADZA 1HNZF 3QLHA 3M32A 2XULA 2PDAA 1BE4A 2DNHA 4KGMA 4ANDA 4F50A 2YKAA 4USTA 1TZ0A 5HQMA 3JQJA 2I1RA 2AGOA 2EG1A 1JLQA 4V19J 4I2QB 4QIGA 1RT2B 1WSRA 2CJAA 3J80Y 3I0SB 4LRBA 2V1TA 4QIVA 2CVIA 3V4IA 4OX6A 2BJ3A 1H2VZ 3BKTA 3KXDA 3UE2A 3M8QA 2DHXA 5CA5A 1A6LA 2H51B 4UZBA 4LFAJ 3GCXP 3CCZA 3BO3A 4ICLB 1JLAA 5E3PA 5KFUA 2HIQA 1A7GE 4DHVA 5I3PA 1HW8A 1YBUA 3HZGA 1NNDA 1SKSA 2A18A 2UUAJ 3UD4P 1K8AT 4O3RA 1DHMA 3RAMA 1B7FA 2ZH2A 2E5JA 3NMAA 1MN7A 1JNRB 3TEGA 2JJ4D 2CQ1A 4X65J 4Y00A 3SQOP 2IRXA 2RSQA 2ZUGA 4N76A 4DOZA 2MZJA 2QA2A 1G2EA 5CZXA 1HBMB 4HHUA 2LXUA 3MM6A 2XYGB 5L9XA 3FK4A 2OSRA 5KOXA 2OPSB 2CFXA 2FC8A 1XNQJ 1NJIT 5HMZA 4USWA 4C97A 2DNRA 4MK9A 1CQNA 2KG1A 2JDJA 3NCPA 4WKYA 4UZCA 4DV7F 2EFPA 1Y10A 4PCQA 2VONA 4PXDA 3GV5B 2XHCA 1WEXA 3GZ7A 2R7VA 2DO0A 3IC1A 5MAOA 2C2MB 2KVQE 1GK8A 1UWAA 5E0OA 1FRXA 4ERDA 2E5LJ 1UVKA 4ED3A 5KFRA 2FB0A 1G7CB 2ZH1A 4DCOB 2W9CB 2QGFB 3FVYA 2AMCB 4HEA9 2IAJA 3EVOA 3MAQA 4KH1B 4K4VA 1LWFB 4C11A 3C19A 4RNNA 2C2KB 4UY85 1YJUA 3AFGA 1TAUA 3DRXA 4IFYB 2RD5C 1YI2S 2FVSA 1RAJA 3MCNA 1GXLA 5HP1A 2V8DA 1VBZA 1LEOA 4EYIB 4JI8J 3DKDA 4RJVA 3CCTA 1BMQB 4LRFA 4LSNB 2K6LA 3IR7B 1BWEA 3WC0A 2N3LA 2R9LA 1X5SA 3W9IA 2ALZA 3C14B 3GSIA 1N34F 3DOLA 3GFYA 2G4BA 2DH8A 4ITSA 3MEGA 3OHAA 3QBCA 3JYTB 1N6QB 1T95A 2MZSA 3EPGA 3ISND 3BR8A 4USVA 4OYIA 1P8GA 1DTTA 2J6UA 1U47A 2MDAA 3X1LB 3VEAA 5J1PA 4UY8T 1IBLJ 2HQ3A 2M9KA 1UMJA 2YWKA 1OJ4A 3NCRA 4WJBA 3UDCA 2EWHA 3DRRA 1FRLA 5ETNA 1RT6A 3W66A 3C3LA 1DLOB 1RACB 1S76D 4RNHA 4IR1A 2OMOA 1X93A 1JJ2R 1C1BA 3PW2A 4FYDA 1H2UX 3VGUA 3KLGB 4NLTA 3QGIA 1TV6B 1N33J 5JVHQ 2JX2A 4OI3A 4ETXA 3BKFA 4DUYJ 1KR4A 3M9NB 4DZDA 3OXGA 4YQWA 1SH0A 2FJVA 1OIAA 5GAEI 5HMWA 2DGQA 5D4NA 3KLHB 3KTQA 3AD8C 2XMUA 2F4VF 3WQPA 4PRFA 1AFJA 5D78A 1RU2A 4U7CA 3TUPA 4M5KA 5JVGQ 4TU8A 2C42A 2FHKA 3ZZ0A 1PAEX 2R7TA 4HKQA 1KQSR 2NXJA 3FMWA 3MWBA 2ZVIA 5IS2A 4O3OA 3CC7S 2BE2B 2MJNA 4NA2A 3W7BA 2H3AA 4L76A 4DSIA 2HFSA 1F1BB 5I42A 3ZFVA 2CJQA 3PXGa 2V8GA 2BE9B 4P7TA 3MM7A 4ZP9A 1ZZFA 3QSYB 1X5PA 1F2HA 3P5BP 2X7IA 2DNKA 1S1UB 5E3QA 3O1LA 4MK8A 3VAMA 2AW0A 1YWXA 1FKOB 2VDHA 1PYTA 2I5JB 3G8QA 1U1NA 4ZCKA 2W2PP 4WP3A 1S0NA 1KS2A 5CD4H 1BD6A 2EK6A 3VALA 3G6XA 2UUCJ 2JFDA 1EQ0A 3M6VA 2B9WA 4NEZA 4WFAQ 3DLEA 3IS9A 2CQHA 4NXMJ 5IC6B 1WF1A 3T5KA 1WORA 1YZ7A 3TX0A 3BYRA 5CHCB 4DX8H 2XO6A 4OHZA 3KHGA 2DD8S 2K9IA 3NO7A 4Q2LA 1WI8A 2V9WA 2X51A 2HS0A 2MZ1A 3FBBA 3DOKB 2VG5A 2BEFA 2BBEA 2CYYA 4AL6A 2C2ZB 4U7UK 4PG7A 5B0EA 3JSMB 5HQ8A 3EE3A 4DV6J 1VQ8S 2QEXS 1HW9A 3ZZTA 1EARA 2VJVA 4WFNQ 4EFAC 1SL1A 3PTWA 3ZTSA 4RU9A 2R2TA 2M7SA 2XZDB 2FZKB 3ENWA 1QTNB 3GILA 2LKZA 3JAMU 2XO7A 4FYXB 2E1RA 2E1CA 5F0WA 5M2RA 5KT6A 4W98A 3M8YA 4AYBD 2UVUA 4JI0J 1V3SA 1JMTA 4QJVA 1H6KX 5KT3A 3CD6S 3PEJA 4HLBA 1B99A 2GJIA 3BDEA 1PYSB 1AUDA 1WHVA 2V6AA 2VC1A 4U7UD 3CE8A 2LQBA 4ZPCA 2IJRA 1AA1B 4JOUA 1PJ7A 5I4MA 4WU3A 2KKHA 4JI6J 5ETPA 3BO2A 1U0SA 4DG1A 4X4VA 3TJ9A 2KRBA 3RGIA 5E3AA 5L1IA 1WEZA 3BBCA 3MAAB 2OPPA 1R0AA 3B4MA 1U6ZA 4F0HA 2NXNA 2RUGA 4C2MA 3E3XA 4KFBB 1GTEA 2CQIA 1RT5B 5K14B 2B7CB 5HN0A 5KG5A 1WF0A 3MUVP 3CB4A 3M8ZA 2LQ9A 4F26A 2Y0SD 2NSCA 9RUBA 3QAEA 4BC9A 5HLFB 3GE9A 5DDQC 4QU7A 2LQ8A 3RR7A 2OPRB 4M5JA 5D4LA 1MU2A 1H3DA 2OIHA 3IM8A 2H3EB 1S6QA 4Z37A 3NOGA 3JSMA 4X4UA 3PRBA 5GVQA 1RT3A 1GMWD 3H20A 3W2VA 2N4DA 4URGA 4DPXA 2NPFA 2DR8A 3Q8UA 4X65F 2KHCA 2XB2D 5KFPA 1KHVA 4KO0B 3TQEA 2PI4A 3G5OA 2QA4G 3H25A 1FJ7A 2D74B 3MOJB 4DV4F 1MWZA 4AL5A 1E6VA 2H54B 1ZM4A 3NGUA 4FZVA 2Z30B 3AODA 1WHYA 2POKA 2COLA 2RIJA 3BV8A 4KGKA 4NASA 1Y5LB 3MM5A 2CJ9A 2XS2A 4Z2XA 1VQPS 4CO3A 1S79A 1HWKA 2XWXA 2QYCA 1SBRA 4Y28C 4ED7A 2RQ4A 1R7IA 2BX6A 3IRWP 3EGVA 1VK3A 2DRDA 1F5BA 2W9BB 1F0XA 1N5QA 1K0VA 2E5LF 1PILA 4F7VA 3US5A 2B8QA 1RUSA 1RXOB 1HBNA 1TELA 1WF2A 1TK8A 2N7YA 3AT1B 1EIYB 1TTHB 4KKOB 1ZTWA 2U1AA 3NGKA 5FDLA 4B9LA 1AB8A 3L7UA 2EFOA 2BNZA 1OY6A 5K14A 2DKOB 4TY9A 2F9JA 5K8OA 1FXDA 2LYVA 3Q23A 3PO5A 3GONA 2UZAA 5DGAA 4C8MA 1RTIB 3DLGA 3WX4A 1J5EJ 1U6BA 3M30A 4ZVQB 3DC2A 4FYWB 3DLHA 2RU3A 2DR5A 5HBMA 1Q79A 2IM1A 5ETQA 2NXCA 1N5SA 1HQ2A 3FBEA 2KI2A 1JXLA 2KM8B 1P27B 2EBGA 7FD1A 2W2MP 3IBFB 3NS5A 1EKSA 3D0GE 2BXJA 2XZ2A 2O01C 1VQ9S 3POTA 3EVMA 2J9EA 3KK1A 2KFZA 3QFWA 3F73A 1U0HB 2HLUA 3G2XA 5A76A 4H4OB 4DSKA 3GU0A 2VHGA 2RHSB 2RF2A 2I9SA 3FMTA 4WWSA 2PSZA 2DNMA 4DL7A 3M1VA 2C2RA 1DJ0A 1VHFA 4ED5A 4I67A 3HKWA 1N33F 2HS3A 5A8RA 3PW4A 1N8RT 4H4MA 3NP5A 5DQIA 1H2TZ 2IVMA 1RLDA 2VODA 2CPEA 2C3MA 4DR6F 2AV5A 2QL7B 1UKUA 2LFVA 5KFNA 4ED4A 1CPZA 1MSWD 3L7PA 4IR9A 1FVQA 4KKOA 5J2QB 1VLYA 4I68A 3H40A 3CJ2A 5DDRC 5AJ3F 4ZLPA 5HVGA 1UW4A 1RJJA 1C0TA 2GIQA 3MGJA 1TU0B 4DQQA 4M5DB 4W92B 1IR1A 1SCJB 4OYOA 3MECA 5A6WA 4L72B 5T7LA 4IRDA 1HWJA 2EXUA 2GJFA 3BREA 1UWBB 3NGDA 7FDRA 1RWWB 3SFUA 3DU5A 5IQQA 4ECVA 3DDKA 3DRSA 5DS7A 4CZCA 3IRXB 3GSDA 3W9JA 4KV8A 1XERA 1D8ZA 2ZNZA 3TI0A 4DF4A 3PIPQ 5CYMB 4LF9J 4GMKA 4L3NA 5F8LA 2VOPA 1ZZNA 4HACB 3QZ8A 4ED6A 3ZZUA 4WZMA 4WU2A 1HLWA 1LK5A 4M5GA 3Q24A 1HHSA 4MFBB 3MPYA 3T1HF 4LVNP 3IBCB 3NS7B 1RK8A 3BH7B 4OZ1A 3H5XA 2FJBB 4WBFA 2XY7A 2V8VA 1U0HA 2IA0A 5GMEA 3R7BB 1LWCB 3IG1A 3UNYA 3CCVS 2AGPA 4Z7CA 3R5GA 2BKPA 2F8HA 3ENAA 3C6UB 3PKYA 3M8WA 1I3OB 5GAGI 4KQZA 2UUCF 1DAXA 2M0GB 2QMUB 1VQ5S 4TNOA 1PG5B 3C46A 4LF6J 1NPKA 1ROFA 2AN7A 1LXNA 1OG7A 2CKWA 4DR2F 1JLEA 4F4YA 4FNHA 3QOQA 5L38A 1PJ5A 2QSWA 1PAUB 4WZQA 2IC3B 3THPA 3F0NA 1RTJA 4FN5A 2DH7A 4U95A 4JI4F 1U45A 1DTQA 1VBYA 1GXTA 1ZH5A 4RR5A 1UEKA 4QYZK 1F5AA 2WCXA 4I2PB 2EKNA 1JIHA 3RBEA 2BABA 3KOAA 2EKYA 2RS2A 2NQPA 4RNFA 5HJYA 1X31C 4PUOB 2AYMA 1MROA 1EKRA 3TVYA 3LP1A 3OQ2A 3NMRA 1S1XA 3GJSB 1TVRB 1DQ8A 4DBQA 5B7WA 4Y6IA 1CJKA 3MDFA 4JI0F 5K8PA 4ZP7A 1KFSA 5CYMA 2BUNA 2YKPA 3MMJA 4EWTA 2VZ9A 4HACA 4C48A 1JLBB 2D69A 2K1OA 4NYZA 4KIAA 2CPJA 4FVCA 6FD1A 4B3MJ 4K2JA 4Q2MA 1WC0A 4JI6F 3AD9C 3ZNJ1 4O0IA 2G2YA 4KAIA 3HD2A 5K8MA 1RE1B 4K0KF
chains in the Genus database with same CATH topology
3I9V9 3DOLB 4RW9B 3KLVA 1XNRF 3OHBA 2GHVC 4N8NA 4MH8A 3V5RA 3Q8RB 3DOKA 2PD1A 1PO6A 1DURA 3MEGB 1BQNA 5DG7A 2MY8A 4B9VA 1QAIA 3DN9A 5IXUA 2ACYA 3ISNC 5JUMA 5KFSA 3BN4A 1U2RA 2LU1A 1ZAVA 2ZFHA 1CQMA 1QVGR 4MIBA 4GC6A 2F8EX 2CQCA 3OR1B 4KC5A 1Q78A 3HKZD 1SC6A 1X4EA 4OI6A 3RW6A 1FNMA 3TUJC 1JJHA 2R8HA 1DTTB 2IMWP 2ZOGA 3LUYA 5E5NA 1KVJA 3D1HA 3HVTA 2KG0A 2E9RX 2WHOA 1VQKS 3JAMY 3U1LA 1Q7YT 2L9DA 4EYHB 4FP9A 5LSRA 1J2VA 2WSEC 3AA8A 3OV7A 1FJEB 2FDNA 3CCSS 2HLTA 1XBWA 1H38A 3NKYA 5MLCV 5KFFA 3QJPA 1FD8A 2LVWA 2YKNB 4P6QA 2FVPA 1FDNA 1NK5A 2BVZA 1GNKA 3RTVA 3FGVA 2ROEA 3MUTP 4XO0A 2IC3A 2ZVSA 3DRYA 2GMJA 3AAWB 3GMGA 4QIFA 1X9MA 1JKHA 4OX8A 1YIJS 5LSOA 4X4RA 4WK1A 2XSJA 2F8MA 4ZOSA 1RTDA 3DRRB 2YNIA 3B82A 2OFHX 4OZLA 2MZRA 4DFPA 4KB7A 1S97A 1RT6B 1U26A 2EG2A 2Q43A 2XMKA 1TAQA 2KT5A 4O3QA 3VZHA 3G9CA 5KG4A 2QLXA 2DGSA 3SI8A 3IGNA 3H5UA 4IG0B 5A0YA 4EZ9A 4CNZA 3OL9A 1C1BB 4O4GB 3TAQA 1HNIA 3IWLA 2Z4PA 2VPXB 2ZD1A 3QYYA 3QGHA 4QOTA 2L08A 4CIOA 2K2PA 2KM8C 1W2IA 1RKIA 5GAHI 1RP5A 1WWHA 4QW9A 2PN6A 4Q8FA 3AB2B 1IKWB 4WFXA 2DNOA 1TR0A 2FGOA 2GNKA 2B4VA 2MKHA 1SJ3P 2IHR1 1N5YA 4LIRA 3N6MA 1TL1B 5A8KA 2QA1A 5L9NA 4PG6A 2DO4A 2ADBA 4QR1A 3LP0B 1FRJA 5F41A 4RW8B 1NK7A 2ZC3A 5HI7A 1C4AA 3FRYA 1HD1A 2Q3PA 2ZJRQ 4A8OA 2XZWA 4EBEA 3WBZA 2V5HG 2XLIA 4WXWA 3TNVA 3PR5B 3CCWA 4TY8B 1F2GA 2FHJD 4NPOA 3SCIE 5KT4A 1YHQS 4MJWA 4E0DA