3H5XA

Crystal structure of 2'-amino-2'-deoxy-cytidine-5'-triphosphate bound to norovirus gii rna polymerase
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
483
structure length
470
Chain Sequence
GTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAEDFYVPRQEPMFRWMRFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA dependent RNA polymerase
publication title Binding of 2'-amino-2'-deoxycytidine-5'-triphosphate to norovirus polymerase induces rearrangement of the active site.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase/rna
total genus 149
structure length 470
sequence length 483
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 3h5xA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3h5xA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3h5xA03
2AWZA 1EP4B 3GV5B 3G6VA 3PW5A 3KLIB 3T5JA 4Y34A 1RTHA 3QZ7A 4GC6A 4LSNB 1D1UA 4ECYA 2W9BA 3OLBA 3KMSA 3HVTB 4I2PA 1JLBB 2GC8A 4Q43A 4ECSA 5KFJA 5L1KA 2YKNB 3H5UA 4ECVA 2YKMB 3LP0B 3PVXA 4Q8EA 4PUOB 3IG1B 3PR4A 2W7PA 3RB3A 1S1VB 5J1EB 1N4LA 2J6SA 3ISND 4IR1A 3MEEB 4KHRA 3GIJA 3E01B 3DRRA 3V6HA 1VRUA 4O4GB 4IKAA 4QWAA 3I5AA 1S9EA 2WOMA 3T5HA 3C6TA 4RW9B 1RA7A 3QGIA 5F8HA 1S1TB 3QIPA 3PR5B 2DPIA 4LSLB 1DTTB 3QIDA 5J2MA 2I1RA 1RT4B 3DRPB 3H5SA 3T5KA 4RW6B 4PQUA 3LANA 2ZD1B 2HNDB 2R8HA 4ED8A 2OPSB 4H54A 5T14A 2VA2A 4NCGA 5KFYA 3MEDB 1LWEA 1TKZA 4I7FB 3MR2A 4NLYA 2V4RA 2AU0A 2ZE2A 4J9PA 1FK9A 1VRTB 4J9OA 5JXSA 5L9XA 2BANB 4RNHA 1UWBB 3OL7A 4R8UB 1TL3B 2R8JA 4ED3A 1S6PA 2VG5B 1HQUB 3DRSB 4IDKA 1S0NA 3V4IB 1S0OA 1RTJB 2IAJB 4I2QA 5J2QA 1S1WB 1REVB 4RW7B 4NLQA 1RT7B 4O3OA 1DTQA 2WRMA 4RUAA 1RT2A 1SUQA 1HNIB 4WFYA 4TN2A 3H4DA 2WONA 4ED2A 3V81A 1HYSA 1JKHB 1MU2A 3BSNA 4LQ3A 1JLQA 1T3NA 5KFLA 1RTIA 1LWFA 1J5OA 2AX1A 2XCAA 3JYTA 3V81B 2BQUA 4TY9A 2J6TA 1S9GB 5CYQB 4B3OB 1S6QB 3GV7B 4QWCA 3KLFA 3H5XA 4NLGA 4MKAA 1S4FA 5J2NA 4IG3B 3QO9A 2RF2B 4R5PA 3KLHA 4KB7A 4EBCA 4IR9A 1JLBA 3BREA 5KT7A 2E9ZA 4RZRA 3OSPA 2B5JB 4TXSA 5KFFA 2V0NA 4WXWA 2JLEA 1TQLA 3BJYA 4DL5A 1T05A 2UUWA 1C1BB 5EWFA 5KFUA 4KFBA 4IG0B 5KFMA 2D41A 2OPPA 4URQU 3MECB 3NKYA 4O3SA 1SH3A 1HNVA 3IG1A 2C2DA 4ICLB 1TVRB 3KMQA 4QW8A 3SFUA 2YNHA 3OL9A 2UVWA 3Q8RB 1LW0A 3FQLA 3KJVA 2RKIA 5DG9A 4K4XA 2OPQB 4J9SA 3OL6A 5I42A 1RTDB 1C1CA 4TQRA 3NBPB 2XI2A 4RW8B 3V6JA 3GYNA 5C24B 1RT4A 1WNEA 4ED1A 2BR0A 3UR0A 3Q8PB 4F4XA 4NLWA 2B43A 4O3QA 5D3GB 4TYAA 3PJXA 1FKPA 1VRTA 2IM3A 2YNIA 4IFVB 5KFPA 1SV5B 3I5CA 2R8GA 2W9AA 1RT1A 3DI6B 5EWGA 1JIHA 1JLGB 4H4OB 4Y2AA 1JLAB 2VG5A 1TL1A 3DRSA 3FFIA 2C22A 3CJ3A 1IKXB 3IRXB 5J2PA 4PWDA 2B6AA 1BQNA 4G1QA 5HLFB 4H4MA 3E51A 3T1AA 1JLEA 5KFDA 4J9QA 4F50A 5C42B 3JSMA 2C2RA 3CO9A 4LQ9A 4ZPAA 3IGNA 4Q0BB 1N56A 1RT5B 2QE5A 4KV8B 2XC9A 3KK2B 2I5JA 4KKOA 3MEGA 5KG4A 4ZP9A 2R2SA 3ICLA 4ZHRB 3BGRA 3H98A 1LW2B 1FKOB 2O5DA 3M8PB 5EDWA 2GIRA 2AX0A 4NRTA 5KFVA 3SI8A 3HKWA 2RDIA 4IG3A 5KT3A 4QWDA 1HQEB 2OPRB 5K14B 3MR3A 1W25A 5DGAA 3DM2A 4U7CA 5CYMB 4NLDA 5KG1A 4WE1B 4ZPDA 1RYSA 3M9MB 4OL8A 1C0UB 1RT6A 3OL8A 1LWCB 3KLEB 4MFBB 4KO0A 3GQCA 4FS2A 1IKYA 3I0RB 2XI3A 3FDSA 4TY8B 3C6UA 4XPEA 3ITHB 3KLGB 3H4BA 1IKVB 2YNFB 4ED6A 1R0AA 1EETA 1HPZA 3CVKA 4O44A 1IKWA 1C0TA 1JLFB 2VG6B 4YQWA 5HROB 1TV6B 3IS9B 4RW4B 4EO6A 1ZTTA 2J6UA 3N6LA 1JLCB 1S1UB 4ZPBA 3DDKA 3KHHA 2FVRA 2D3UA 3LAMA 3OSNA 3KK3B 5L1IA 2HMIB 3VQSA 5I3UB 1XR5A 3BSCA 5KG6A 4IRCA 1XR7A 4KAIA 1RT3A 1ZETA 3LALA 3HVWA 1BQMA 3DOLB 4MIBA 2VG7A 1DLOA 2JC1A 1GX6A 3DLKB 3KOAA 1KLMB 2IC3A 3DMJB 5C25A 2OH2A 3LP2A 3DLEA 3DLGA 1N48A 2R8KA 1S1XB 4MKBA 2FJWA 4GC7A 3ISNC 4URSA 3HHKA 5DG8A 2W8KA 2XWYA 3DYAB 5KFHA 2WTFA 4URGA 1HMVA 3LP1B 3H59A 4DG1A 4EYIB 1T03B 2YNGB 5KFTA 4ID5B 1QE1A 4J9NA 3KK1B 4ECRA 2ATLA 4DL2A 4IFYB 3IN5A 3I0SB 1ZTWA 3NAHA 4ECQA 3V6DA 1TKTA 4Y3CA 1N5YB 1N6QB 1EP4A 1KHVA 3GV8B 3TAMB 3KLIA 4NLOA 3CIZA 5KFOA 4LSNA 2FVPA 5F8JA 3QYYA 4K4UA 3M8QB 2HNZB 4K4VA 3BSAA 1S9FA 3HVTA 4J9MA 3GIMA 4KE5A 3OHBA 3PW7A 4WFXA 3QLHB 1RAJA 5KFAA 2BE2B 2YKNA 4XO0A 2EC0A 2V9WA 3EZUA 5KFGA 3GIIA 4EYHB 2ASDA 2YKMA 3LP0A 5KG2A 3TVKA 2UVUA 4PUOA 5F8MA 1S97A 4NRUA 1S1VA 5J1EA 1KHWA 4EBEA 3CWJA 3RB4A 2FLLA 3MEEA 1TKXB 3CJ0A 3E01A 4WZMA 1S0MA 4O4GA 4ZVHA 3M9OB 1QAJA 3DOKB 1RYRA 2FJVA 4Q44A 1RA6A 3MTKA 4RW9A 4ZPCA 5KFSA 2C28A 1S1TA 1JXLA 4O3RA 1RTHB 4LSLA 1DTTA 4F4YA 3CJ5A 5L1JA 3DRPA 2W9BB 1XR6A 2BQ3A 4RW6A 2IMWP 2IBKA 5F8NA 2ZD1A 2HNDA 4I2PB 4KHMA 1GX5A 3MR5A 2OPSA 4XPCA 2ALZA 3GILA 3MEDA 5KG3A 4I7FA 2IM2A 2HNYB 5KFIA 3Q8QB 5KFRA 4K4SA 3DOLA 3T19A 3H2LA 5F8IA 3NGDA 2BANA 4O4RA 1U09A 4IRDA 2R2TA 1UWBA 3H40A 4NLPA 1KLMA 2IA6A 4R8UA 1TL3A 2ILYA 1VRUB 4NLSA 3D28A 4ECXA 2ASJA 4IOBA 1HQUA 1S9EB 3OHAA 2D7SA 2BRKA 2WOMB 3V4IA 1RTJA 2IAJA 4K4WA 3QIPB 4WFZA 1REVA 1S1WA 4RW7A 1RT7A 5J2MB 4J9KA 4PQUB 2D3ZA 4WYLA 2GIQA 5C5JA 5F9LA 3GIKA 1HNIA 2FJXA 1I6JA 3KNAA 2DPJA 5DGBA 1JKHA 4QPXA 1C2PA 4IH6A 4NCGB 3D5MA 2YNGA 4ZVGA 1LWEB 1TKZB 4ED0A 3T5LA 2ZE2B 3UPFA 1FK9B 3G86A 5KFEA 4RNOA 3HVAA 1Z4UA 2ILZA 2R2RA 3TQ1A 1S9GA 4TLRA 4ZP7A 1S6QA 2E9TA 5CYQA 5HP1B 3EPIA 5EWEA 5KFCA 2JEGA 3PW2A 4HKQA 1S6PB 4IDKB 2RF2A 5KFXA 5FDLB 2W9CB 1JX4A 2UVVA 3N6NA 2CJQA 3CJ4A 4I2QB 4F4ZA 3RBDA 5J2QB 2AGPA 2FVCA 4MIAA 2B5JA 1DTQB 1CSJA 1RT2B 4NLVA 1SUQB 1C1BA 4WZQA 3KHRA 4FBTA 4IG0A 2WONB 2AQ4A 3NL0A 1HYSB 4DL4A 1MU2B 3MECA 2R2UA 4ECTA 5KFQA 5DQIA 1JLQB 4RNMA 1RTIB 1TVRA 4ICLA 1LWFB 1J5OB 4NLTA 4Y2CA 4WYWA 3JYTB 2W8LA 4G3IA 4NZ0A 1NNDA 1RTDA 1K1SA 2OPQA 4QW9A 2XGPA 5HBMB 3KLFB 3PHEA 3KHLA 1MMLA 3NBPA 3CDUA 5J2NB 3PW0A 2UUTA 4RW8A 3V6KA 3QO9B 5C24A 4ED7A 2WK4A 4R5PB 4ZP8A 3H5YA 1HARA 5DLGA 3KLHB 2JEFA 4M94A 4B3OA 2V4QA 4ZP6A 5F8LA 1T05B 4FBUA 5D3GA 4KFBB 3G6XA 5KT4A 2HNYA 2OPPB 4R0EA 3RBEA 4IFVA 1S10A 1HNVB 4IQXA 1SV5A 3NAIA 1T94A 3CJ2A 4ZVFA 2YNHB 3DI6A 5EUHA 4H4OA 1JLGA 1LW0B 4WXOA 3KJVB 2RKIB 4YMEA 1JLAA 4Q45A 4NLXA 3RAXA 5I42B 1C1CB 5L1LA 1IKXA 3IRXA 2E9RX 3LAKA 5HLFA 2AGQA 2HWIA 2JEJA 3Q8SB 4NYZA 4JUZA 5C42A 3BQ2A 3BR9A 3G6YA 2QV6A 3RB6A 5KFWA 4M95A 5DG7A 1OS5A 2XCPA 4Q0BA 2C2EA 3BQ0A 3RB0A 1K1QA 4Q8FA 1RT5A 2BRLA 4KV8A 3QZ8A 1RDRA 3KK2A 1FKPB 2JEIA 2YNIB 4JV2A 4ZHRA 4IH5A 4RNNA 5HP1A 1LW2A 1FKOA 1RT1B 3M8PA 3M9NB 4X2BA 4O3NA 4NLUA 1TL1B 3FFIB 4MK8A 5J2PB 5FDLA 5KG5A 3KHGA 2W9CA 4ECUA 2B6AB 4PWDB 1BQNB 1HQEA 2OPRA 5K14A 3MF5A 5KG7A 4YR0A 4G1QB 4IRKA 4H4MB 4TYBA 4HYKA 1JLEB 1SH2A 2W7OA 4YR2A 4O3PA 3JSMB 2WCXA 4MH8A 4DL3A 1NHVA 4J9RA 5CYMA 2JC0A 3QGGA 3PZPA 3RAQA 4WE1A 3MR6A 2FVSA 2FVQA 4F4WA 1C0UA 1S48A 3BQ1A 4ECWA 3PJWA 5KFZA 2I5JB 1LWCA 3MEGB 4KKOB 4MFBA 4TQSA 3KLEA 3I0RA 3EPGA 3KLGA 4TY8A 3OLAA 3CDWA 3BGRB 3ITHA 4YP3A 5DLFA 1IKVA 2YNFA 4ZVEA 2IJFA 4U6PA 5HBMA 4QWEA 5KT6A 1JLFA 3FQKA 2VG6A 4EEYA 5HROA 5KFBA 1TV6A 3IS9A 4RW4A 5KT5A 1D0EA 1JLCA 1S1UA 2F8EX 4DEZA 5KFKA 3DM2B 3KK3A 2HMIA 4IH7A 5I3UA 2HAIA 5DQGA 2FLNA 1RT6B 2WB4A 3FRZA 1S49A 4KSEB 4FS1A 2IM1A 1SH0A 4KO0B 2ZKUA 4MK9A 1IKYB 5KG0A 3DMJA 3C6UB 3DLKA 3UQSA 4MK7A 3DRRB 5DQHA 1R0AB 1EETB 1HPZB 3SFGA 4O44B 1IKWB 1C0TB 1S1XA 2VA3A 3C6TB 1QAIA 4KBIA 3UDLA 4RU9A 3BSOA 5F9NA 3DYAA 2IM0A 3CDEA 3N6MA 2R8IA 2UVRA 1TP7A 2HWHA 4RUCA 3LP1A 5KFNA 3MFHA 2ASLA 1T03A 4ID5A 1RT3B 3KK1A 4JV1A 4K4TA 1BQMB 4IFYA 3I0SA 4JV0A 3FSIA 2VG7B 1DLOB 4J9LA 5C25B 2IC3B 4EBDA 1N5YA 1N6QA 1IM4A 2BQRA 3LP2B 3DLEB 3TAMA 3DLGB 2RDJA 1QUVA 4K50A 2CKWA 3M8QA 2HNZA 1YVFA 3QGHA 4K4YA 4K4ZA 2FLPA 2IJNA 3MFIA 3PW4A 4ZMMA 3QLHA 1NHUA 3IGVA 2BE2A 4DL6A 4EO8A 4NLRA 4DL7A 5KT2A 1HMVB 4RNFA 5F8GA 4ECZA 4DG1B 2AGOA 4QWBA 1QE1B 3I5BA 2XGQA 4YR3A 1TKXA 5JUMA 2WHOA 3NMAA 3KLVA 3DOKA 3V6DB 1TKTB
chains in the Genus database with same CATH superfamily
3UDCA 2YY3A 3AX3A 3LP0B 3P4UB 5CQGA 2BXJA 2W7PA 5J1EB 5FJ4A 2V50A 4C8MA 3UN2A 2XNQA 1RA7A 3AA9A 1RTZA 3PEHA 2UXCF 4MT1A 2J7KA 4OIXA 3OL7A 4R8UB 4DV1J 4KJIA 5BYRA 1ZM9A 3D0GE 2JJ4D 4ZLLA 4RUAA 1KD1T 4ANCA 4RPFA 5D77A 1KFSA 4WKYA 4FXEA 3RR8A 3HFZB 2MKIA 2RF2B 1NO8A 4DV5F 3OSPA 3MCNA 5KFMA 4G1PA 3MECB 1JNZB 3G2XA 3KJVA 2RKIA 4J9SA 2YKQA 4PCQA 1U48A 3GMGA 2NXJA 1OYEA 1N88A 3GZ7A 2CNLB 4NYPA 1Q5VA 4OZ1A 1HNXJ 1JJHA 2OKQA 1L3VA 4ZCKA 2VG5A 1ZA1B 4CO4A 5CCLA 2JDJA 1WC5A 2AT1B 3CCZA 5BYSA 2P2CB 2KH9A 2QG9B 4OYPA 1SJ1A 2ACYA 2PT0A 2BX6A 5GAHU 3W2VA 5KFVA 3V4MA 1S0VA 3RW6A 2E1MC 1W25A 6FD1A 5DETA 2X51A 2VV5A 2ZC4A 5AXNA 1OMSA 1U1OA 1YK9A 1UA0A 2MQ8A 3I0RB 1SL1A 4OI0A 3J7A1 1WC3A 4EO6A 2CDRB 3HHLC 3LAMA 3OSNA 2B7CB 1RHKB 4XDCA 3NXZA 4X4VA 2GQQA 3CMES 3DOLB 3FJ2A 4DV7J 3AX2A 1S1XB 2FJWA 1AT1B 2HS3A 4J9NA 4L76A 3VZIA 2K29A 4C7QA 1VQKS 2HBRB 2CA9A 2EFOA 2EBEA 4RU2A 1HNXF 2HYIB 3H0PA 4QIFA 2F9DA 2NREA 5D4PA 4CLZA 2UVUA 4C8NA 1S97A 4EBEA 3OJUA 2HRUA 2XY5A 3AOBA 1XNRJ 4O3RA 1UW9A 4F4YA 2V63A 3GU0A 3HF5A 4MKVA 2XY6A 2AJQA 1KLMA 3M32A 2ILYA 4P7VA 4WK3A 2GVZA 3OHAA 4LR9A 5A8WA 1IBLJ 4TU9A 4WYLA 2CQ2A 4FYVB 3OVAA 5DGBA 1TKZB 1HWIA 2N82B 2DPJA 3KUHA 3FMTA 2JEGA 4IDKB 3N6NA 3TNVA 1G1XA 3R3TA 2AQ4A 3NL0A 5DQIA 1YZ7A 2D3O1 4ICLA 3US5A 5HBMB 3QT6A 3Q22A 2BJDA 2LA4A 1NJZA 3LGHA 1FRHA 4F3OA 2HGMA 2BABA 4H4OA 1KOOA 3IRXA 3GE9A 1S12A 1X0FA 4KH1B 1SIWB 2GMJA 2AV5A 2RDDA 3QZ8A 2IFXA 1XNRF 1CJTB 3DLBA 4IH5A 1R8AA 3FFIB 8AT1B 3D66A 4IRKA 2O67A 1JLEB 3BR8A 1SVDA 1SQFA 2Z8QA 3CC2S 4X4PA 1YBTA 3BO4A 4J90A 1KVIA 1IBLF 4XK8C 1V9OA 5KT6A 1ZM3A 1AFJA 5E33A 1TU0B 4RW4A 5DDOC 2D9PA 4USVA 2FC9A 3RR7A 2MKSA 3D6TB 5K8NA 4HH1A 1X4GA 1X4FA 3QT7A 2M4MA 2W1BA 1RT3B 4JV1A 1BQMB 4IFYA 1S79A 4J9LA 1OQ3A 3TAMA 2AJ1A 3QFHA 2IJNA 1ZA2B 4PZVA 4DL6A 4ZCLA 3I5BA 3W9HA 1L5UA 5E3PA 2C3UA 2NYIA 4EUVA 2CQIA 2MY8A 1KDNA 1XWLA 2GJIA 4DR4J 3MMCB 4USUA 3RTVA 3K7RA 4RW9B 3K5MA 4K5RA 2I1RA 4ZVOB 3CSKA 4TNOA 3KG0A 1U26A 2KTQA 3M4XA 3PX6A 1U1QA 1UAWA 2PEHA 1DTQA 3CUNA 4WFYA 1MU2A 1BGXT 4LQ3A 2CUYA 1JLQA 1RTIA 1LWFA 5AE3A 4B3OB 4WFBQ 3H5XA 3KTQA 4OZLA 1O6XA 3GCWP 3THTA 2MGZB 4RZRA 2B5JB 3M2VA 3BJYA 5EWFA 3TVZA 2BJ9A 2JLGA 2R7TA 2O01C 1XEZA 4Q2LA 2OPQB 3OL6A 4RX6A 5GAGU 3FCHA 2XBPA 3V6JA 1AZSB 4I68A 3TJ9A 3Q8PB 3UW1A 4NLWA 2OAUA 1VRTA 1WD6A 5IQ6A 1UFWA 3RYLA 2CAXA 4H4KA 5AXKA 4DR4F 2KYXA 2V8GA 1YDLA 4P10A 4ID8A 2AHOB 5BR8J 3O44A 3IWNC 5EX3A 2OPRB 5BJRA 2A3JA 1GXTA 1BWEA 3VV2B 3UVJA 1C0UB 1R6VA 3KLEB 1U2CA 3FDSA 3MPUB 3CVKA 3UD4P 3M2RB 4QQBA 4ETXA 1ZTTA 2NR0A 5HVGA 3CCWA 3EVOA 4A8KA 4M5JA 3GFYA 3VAIA 3QRPA 2XSJA 2CFXA 1XR7A 1RXOB 3N0VA 4K2JA 2IC3A 1XK8A 3HT0A 1PJ5A 4R0JA 4C0HA 4LF9J 4YHHJ 2Y8WA 4NPOA 1NH7A 2DGUA 2K1RA 1UETA 4LSNA 3U7JA 2V5HG 2CYYA 2XTDA 2YKNA 4XO0A 3RUBL 5M2UA 5KG2A 1AFIA 3CWJA 4Y65A 3CJ0A 1S0MA 2J0QD 2JVRA 4USJC 2DGOA 3UN5A 2C28A 2XG8A 2CQ3A 3HULA 2DR7A 5BR8F 3A3NB 2OPSA 3MEDA 5KFRA 2BANA 1VRUB 3MM7A 4JI6J 3UD5A 2QMWA 4C8OA 4F0KA 3MM9A 4QPXA 1FK9B 3V81A 2QSWA 1GXLA 2E7XA 2V34A 5LM7E 5EWEA 1D8YA 3CJ4A 4F4ZA 2ZH2A 2FVCA 1X9MA 3JXOA 2VKRA 3NO7A 4ECTA 1FVSA 2I6WA 2CPDA 2CZ4A 2AEMA 4JI4J 3H5YA 1BMQB 2XS7A 5F8LA 3CD5A 1NB2A 1WELA 2HWIA 4JUZA 4HL9A 3BQ2A 3RB0A 1R8HA 3I55S 4GMKA 2OI2A 3EXYA 1LW2A 1WEXA 3LF0A 4GVLA 1VLOA 4X2BA 1RAFB 3CJRA 3UCZP 4P2XA 5AXLA 5J2PB 5IV4A 2B4UA 2W7OA 2F8MA 1NHVA 1XMOJ 2KYZA 2M52A 4C3MA 4HLBA 4FYDA 1DURA 1VFJA 4CO5A 3VGVA 3DN9A 2ROEA 1JLFA 2ZITA 1FWPA 1G2EA 2QO3A 4F8RA 3WHIA 2MZTA 2C3OA 1RT6B 2GCFA 1SH0A 2RQMA 3DGPA 5DRKA 1XC9A 1LOUA 3BSOA 5F9NA 3DYAA 4NL5A 5LXYA 4J5OA 4QIGA 4JI4F 4JV0A 1GTHA 1N6QA 2MXYA 1IM4A 3BBCA 3RAMA 4F3MA 2B3TB 2QFIA 4CT8A 2XYPB 4IOAQ 2PO4A 4CNYA 1L3UA 3FMBA 2WVFA 3GV5B 4LFCF 2UZAA 1EAYC 4DPTA 1FESA 2XWXA 1NKEA 4KIAA 4FDFA 2YWEA 1SC3B 1S99A 4OJ3A 1CJKA 3MAQA 1QSLA 1XMOF 2R42A 1AXQA 5KOWA 4X4UA 2FB0A 3R5GA 3QIDA 3T5KA 3K17A 4RW6B 4NXNF 4X4OA 2Z2LA 1LWEA 4DCOB 2H3AA 2E5JA 1YJRA 4YDXA 3DRSB 3Q8VA 3LH2S 4RW7B 1MMDA 1Y10A 2DEIA 2KB2A 3OFEA 4XAKA 2DJWA 3BPSP 1ARRA 4DSEA 1SJ4P 4KB7A 3BEGB 1Y3KA 2H54B 5C7PA 1DRZA 2VOPA 2V2VA 4URQU 3R1LA 3NKYA 1SH3A 3D1OA 3WC0A 2FHMA 4W90B 5I42A 3NBPB 5B08A 2M9KA 1WKJA 2EW9A 3PJXA 4IFVB 3ULHA 1SV5B 1V3SA 2HVDA 2BM0A 4B02A 3C14B 1TL1A 1X4DA 4CLFA 3G4SS 3E51A 1S7HA 4H4KC 2WW4A 2DISA 3AAWB 2NXCA 5HMYA 3CCJS 5HQMA 1LXJA 3HK2A 2MKJA 3MMBA 1NH8A 2KFZA 4PPZA 2J8SA 3K8VA 1IKYA 1S5ZA 4F0HA 2RUGA 2IYGA 1HPZA 2J0WA 1P1TA 3GJTB 2HVHA 3VQSA 1XR5A 2DY1A 1PCAA 4KAIA 2AYGA 2W24A 4MIBA 4OI2A 1QTMA 3DLEA 1SJ3P 3EDRB 3EICA 1NK0A 1HMVA 4F4KA 2Y8YA 3NRBA 2L3MA 4QR1A 2KN4A 1ZS6A 5KFOA 3CEDA 1B3TA 1S9FA 4XIUA 1ZYQA 1QUPA 4FPRA 2N3LA 4NE9C 3QLHB 4L72B 4FF4A 1D9AA 3LP0A 4OYAA 2IVMA 4AAIA 5J1EA 1Y7PA 3N9UC 3SQGB 3TARA 2PA3A 2DR6A 3SCKE 1UW4A 4OZ2A 4ZVPB 4I2PB 4RL1A 2QJ3A 4HEA9 3MR5A 2IBOA 3H90A 1IN0A 2VJUA 2P6TA 4K4SA 1L3TA 3H2LA 4ZS6A 4LRFA 5D4NA 3PG9A 4R8UA 5IQQA 5GMKa 1ZBTA 3TW0A 2J5AA 5C5JA 4WKRA 4DPYA 2DEJA 4LF8J 4I67A 4U67Q 2MSTA 3HSDA 2VPYB 2RF2A 1VYAA 3KHRA 3MECA 2LVWA 3HJVA 1U2RA 1TUWA 3GPAA 3KHLA 2IY5B 1ZPVA 3S7RA 3TAQA 4ZP6A 1M1HA 1U6BA 5KT4A 2HNYA 1DBDA 2BKPA 3SCIE 4AL5A 3JQMA 4WXOA 1YJVA 4PKDB 3R5DA 1SQGA 3Q8SB 2A2BA 3ETOA 1QAXA 3BR9A 1ULRA 4M95A 5E5NA 4DR5J 2HQ3A 1KFDA 2JEIA 3QMQA 1FJEB 3OTEA 3DXBA 1X93A 2F7VA 3BH6B 4G1QB 1F6TA 5HO4A 2YKAA 2E1PA 4DL3A 2H5JB 1RK8A 3UNGC 1NMEB 2DO0A 4C8LA 2QT7A 3I0RA 4EZ6A 5DLFA 3OLAA 4ZVEA 4LR8A 3BM7A 4LF8F 2ZJPQ 3DM2B 5DM6Q 4IH7A 4OX6A 4GO5X 1RCOB 3F41A 1S1XA 2EC2A 2EFVA 3CDEA 4DQRA 2Z2YB 3SCLE 2MSSA 3QBCA 5HMWA 2G9OA 4F04B 4X4QA 2GZOA 3BS9A 2V9KA 1PKUA 3MOJB 2OP5A 3W61A 3ILJA 4YR3A 3TZYA 1YG0A 1Q5YA 2JFDA 1TKTB 1FRJA 3G6VA 1V6HA 4DSLA 2BA3A 3QZ7A 1U4BA 4DR5F 2FUG9 2WAQD 3GP9A 1JLBB 1H98A 4Q8EA 4QOTA 1VQOS 2AJ2A 5IV3A 2ZBCA 2J0XA 3DRPB 2MJUA 3NWGA 1VQLS 2C3PA 4H54A 2VA2A 3D1HA 3AB4B 1TKZA 2AU0A 2V4RA 3BYPA 2YTCA 4J9OA 1NBEB 1FRKA 1GH8A 3V5RA 3OQ2A 4IDKA 3V4IB 5HATA 1VK8A 3BKFA 2PIIA 3D0HE 3AOCA 3EYZA 3H4DA 3LGNA 3KXDA 2ZJRQ 2AX1A 3GV7B 2QA2A 4O0IA 4JI0J 2IRYA 2O1PA 3FZ2A 4C98A 4M1KA 1U0SA 4S0MA 1XMQJ 1TQLA 4FYXB 1AROP 1TVRB 1VISA 1RTDB 3EGVA 3V2UC 1R6YA 1HD1A 4LMZA 3K2YA 2EI5A 1R7IA 1SIWA 3CB4A 2B43A 1Q81T 1QY7A 2ZH6A 1CJTA 3NCQA 1JLGB 2OO4A 3B8HA 3FFIA 1IKXB 4NYOA 3T1YF 2J0SD 1ITPA 3VAMA 1JLEA 2K3KA 3CO9A 3D68A 4ZPAA 3M8WA 3FBBA 4I6YA 5CCMA 1S57A 2W25A 4K0KJ 5K8PA 3CCQS 2RMLA 4IG3A 1T02A 2CQGA 4WU3A 3ILOA 4OHXA 2AJFE 3GJQB 5EHHA 1F1BB 2JHEA 3TJAA 2R7XA 3M9MB 2QYGA 3OL8A 2UXDJ 1HNWJ 3ITHB 1TELA 3GFHA 3W64A 1SC1B 5HROB 2JL9A 3IS9B 3ZZYA 2J6UA 4U9RA 2LU2A 2ZOFA 3KK3B 4JI0F 1RT3A 1RAGB 2K3IA 2FJBB 1BQMA 1TFWA 1XMQF 1RADB 1FE0A 3ENWA 1DY3A 2BVZA 3L9ZA 4DX7A 2XTEA 3KWMA 5A8RB 1OG7A 2VFRA 5FD1A 3KK1B 4LFAJ 4A8FA 4DLGA 2ZZNA 4CLPA 1OO0B 5EX0A 3MCMA 3OVSA 4FXVA 3NCRA 5KFAA 5CHCB 4PG4A 3HP6A 2FLLA 3MMCA 4CP5A 1RYRA 4RW9A 2D1CA 2NZCA 4K0KF 4OYXA 4I56A 1NK6A 1PC5A 3NGDA 1U09A 4NLPA 2XSFA 1PBUA 1U24A 2BRKA 2WOMB 4YUDA 3MOZA 3HHLB 2UXDF 2GGPB 1KEKA 2BSQE 2E7VA 3T5LA 4OJ1A 2JEFA 4B3OA 2E9TA 4EFAC 1HHTP 4JI1F 1S6PB 2X1AA 1JX4A 2MGZA 2FGOA 4MIAA 2B5JA 1RT2B 1B28A 1W7WA 3R1HA 1HYSB 2HW3A 3CMAS 2DR8A 4RNMA 4TU8A 2H4YB 2W8LA 2OPQA 3HHLD 4ILRA 3CDUA 3MI7X 1AZSA 1X7VA 1UVLA 4LFAF 1H2UX 4CLYA 1TL7B 2OPPB 1IBMF 1S10A 1P9YA 4NXMF 4WWSA 4DR6F 3MTJA 3G9CA 1C1CB 3AJ2A 5T41A 1NUEA 2DHAA 1MWZA 2HKEA 3L09A 5H9FJ 1JXVA 5IOLA 2JFKA 3WC2A 5MLCV 2KHDA 1RDRA 1RISA 3F0NA 4PXCA 2YKOA 3HSZA 1RT1B 4I64A 1NEEA 1JK9B 2C42A 2QX0A 2OPRA 4TYBA 4O3PA 4MH8A 2CG4A 1C0UA 3KLEA 3ELHA 1RCXB 2RRNA 3M2RA 4MIWA 2JLFA 2DR9A 3G8TA 2GMLA 1S6OA 1NZ8A 3KKFA 3KFWX 3T6BA 3DDIA 4CRJA 1NKBA 4KY3A 1IKWB 4ITSA 2NQPA 1HHQA 1HLWA 3W2WB 3LWMA 3FSXA 2W01A 2DGQA 2VH7A 1TUVA 1CC7A 4PYDA 2UUAJ 1LXNA 1UZHA 5B09A 3P96A 2RD5C 1PARA 2NYHA 2CKWA 4PWWA 1NHUA 5DDQC 4DN0A 4DL7A 2XEXA 2HFOA 1IJEB 1YHQS 2DNYA 5JUMA 4DSFA 4YB1P 4PAAA 3PW5A 2LEPA 1WTFA 1VQ8S 3HVTB 2Q79A 2VHGA 5HSPA 1WHXA 2DNMA 4USIA 4N56A 1AUSL 1WDTA 2LU1A 3CC7S 3V6HA 3DRRA 1VRUA 2AEJA 1UFKA 1G7CB 2DPIA 4LSLB 1DTTB 5D0HA 1F9EB 3LANA 2ZD1B 2M8DB 1F5CA 2WBRA 5KFYA 3HHDA 1FK9A 3HX9A 4KQZA 2HQDA 4J37A 2BNZA 3LOUA 3PV8A 1N54B 1RTJB 2H51B 2R4FA 4B9MA 5HMZA 2Q2KA 2HEKA 2K7JA 1BXNA 3OV7A 3QQCD 2YQ0A 2E9ZA 2KDOA 4WXWA 4X4RA 2B4PA 2C2DA 5L39A 2HHSA 3H20A 4CO1A 5K8OA 3G6ES 3I87A 4ME7E 4IO9Q 2ZZTA 3CJ8A 5DDRC 4F4XA 2XMWA 3D3CJ 5ETPA 5D3GB 2ZVSA 2K9IA 4NZ6A 3DI6B 2B9EA 2ERRA 5J2PA 2BMBA 2E44A 3RRGA 4DR2J 2I38A 5CABA 2FHOB 1DFDA 4Q2MA 3D6MB 4ZHRB 1H7WA 1VIXA 2XNRA 2Y3YA 4DV6J 2F5GA 2JRSA 2RU3A 3HKWA 2J8AA 5DGAA 3SSQA 5E7OB 4P6QA 1RYSA 4OL8A 1RT6A 3GQCA 2QEXS 2XI3A 4XPEA 3GR1A 1U49A 4A8XA 4CTAB 1TV6B 1CS4B 4D8JA 1WF1A 5CZXA 1KOHA 5A0YB 4R25A 1N48A 3BBFA 4MKBA 2HHWA 2V67A 4W92B 4HHJA 3LP1B 2A2CA 3CMQA 3IR7B 2EKYA 5L8RC 2MQNA 3MM8B 5D0EA 4MMOA 1KHVA 2V1SA 2ZBIA 5F8JA 4J9MA 2GMHA 1GTEA 3EE3A 2F4VJ 1WI8A 1NK9A 1T11A 3M9OB 2GAGC 4CIOA 3AXKA 4DR2F 2WZ1A 2GO9A 4KGKA 4GKJJ 4DLEA 5G0RB 4RW6A 3CT9A 4LUBA 4DV6F 4MJKA 1QAYA 3FEXB 2KFYA 1URRA 3TUJC 2M2BA 4IOBA 3W8PA 5ADZA 4B9SA 1NAQA 5THWA 2H48B 1FX4A 4RW7A 3HO1A 3NNCA 3AWRA 4DV2J 1BUXA 1IQZA 4V1Ak 5KFCA 2DO4A 1U1KA 3JYTB 4NZ0A 1F9FA 1UFLA 4QW9A 5D15A 3NBPA 4I4BA 3QO9B 2WK4A 3KLHB 2W2QP 4IFVA 1SV5A 3NAIA 2R7SA 1JMTA 2BJ1A 2Z0GA 5AE1A 3RAXA 3C14A 1K47A 2F4VF 2DGVA 1QTGA 1UMJA 2GIFA 3TVYA 4M5MA 5G4DA 5K8MA 2XCPA 1UVNA 5KAKA 1K1QA 1EA4A 2FPHX 3AT1B 3EWGA 2MHEA 4WU2A 4GKJF 3N5BA 4DQPA 3ZNJ1 3LJPA 4H4MB 4YR2A 2DT9A 3IM9A 8RUCA 4QYRA 4YS2A 3NEKA 3AHPA 3EJMA 4KKOB 2ZWPA 2QIFA 1Y5LB 5D0RA 2MEWA 2E7WA 2OFHX 3DOMB 2DTJA 3A3PB 3IWLA 4AYBD 3IXQA 3MD1A 1YRUA 3HI9A 2HURA 2DIUA 1APSA 1A7GE 2VG7B 1DLOB 3NY0A 4N5SA 2MHNA 2FLPA 5J1PA 2PN6A 3QLHA 1PGZA 1FWLA 3OTBA 3R9LA 5RUBA 4GVBB 3SQGA 3VEAA 1JB0C 5KFXA 1S72S 3D3BJ 1I51B 4ECYA 4I2PA 2JXIA 5DDPC 3F73A 4CLKA 2HQIA 5D6GA 1KBRA 4ECVA 4B9NA 1N4LA 2DHSA 2Q43A 3MEEB 4KHRA 4O4GB 2H5IB 5B0FA 4E0DA 3DHWC 4MAKA 4Q7AA 3AX5A 1DHMA 4EU0A 3QGPA 2NPIA 5L9XA 1UUJA 2JOQA 2Y1RI 1HQUB 1UJ4A 3WIUA 3HSGA 1SJRA 1DQ9A 3AQPA 4CZCA 2XCAA 2M7SA 1J5EJ 1VK3A 4KH0B 4QWCA 1OSCA 3SZ2A 1F5AA 2EFNA 2H4WB 5KT7A 2B51A 2AJ0A 3SDEA 1C1BB 2R7UA 4P74A 1CULB 2KM8B 4B3TJ 3L95X 3H2VE 2ZBQA 3L4BC 3CD6S 2MZQA 4TQRA 5CZVA 4CM2A 4G6VB 3O5TB 2M5YA 2VQFJ 4I6WA 1FRIA 3GTYX 2COLA 3K5NA 4G1QA 4DXLA 1RJJA 2C2RA 1LK7A 4LQ9A 4QIWD 2CPFA 2GX8A 2N4CA 3RRKA 3HT3A 1QVGR 1ZPWX 1FKOB 3ONQA 5EDWA 2GIRA 2OEJA 3E3XA 3DM2A 2MMYA 4U7CA 5HN0A 2Z4PA 3S6EA 4ZPDA 4G65A 3B4DA 1Y11A 4P2SA 1RWXB 3P49B 2P9CA 4IOCQ 1U6FA 1QSYA 3OFGA 4X62J 1B01A 4ZPBA 1KQSR 5L1IA 1Z1ZA 3LALA 3EVMA 3FBFA 2AF6A 2BZ2A 5LL6d 1GX6A 1SKUB 3QRQA 1RU2A 2NSBA 1HR0J 1G4CA 1I1GA 2VBWA 1TKTA 3M2UB 4PR6A 1YBUA 3QYYA 2JBVA 1I5OB 2R9LA 4M5HA 2N7CA 1RAJA 3MAAB 1Q78A 2HHHJ 4GKKJ 4ZK7M 1RACB 3KNGA 1KHWA 1NSPA 3RB4A 4I69A 3AB2B 1X31C 2DH8A 5ETTA 2ZH4A 3DRPA 5F8NA 2IHR1 4IYQA 1IVZA 5F8IA 3NOGA 2RS8A 3V4IA 4WJBA 2LQ5A 2J9DA 2JNJA 4DV3J 4EZ9A 1GK8A 4HV0A 4J9KA 5F9LA 3R2CJ 3J80U 3QATA 1YJWS 2YNGA 4ED0A 3J80Y 2EFGA 4AFFA 3P45B 1Z4UA 4WK1A 3FVYA 3PJ9A 3NS5A 2HGLA 1Q8IA 1U7LA 3THPA 2W9CB 1X4EA 2CJQA 1R43A 2D68A 4B9VA 4WZQA 4YFUA 4FBTA 5LOQA 1H2TZ 1TVRA 2E1RA 3CJSA 2ZM6J 1NNDA 1RTDA 1K1SA 2JVOA 3KLFB 1Y5IB 3CD0A 3QT8A 1HR0F 3W65A 1XIQA 5IC4B 2ALYB 2KFNA 5FLXU 4O23A 4QBUA 2IYIA 3OTCA 5FLXY 4DL0C 3C66A 1JLGA 2ZUGA 2FY1A 1OPIA 5L1LA 1IKXA 2HHHF 4A8WA 2HQCA 3SEOA 2RH3A 2VBZA 2F3JA 2OMOA 2C2EA 3F44A 4DV4J 2BRLA 2XS5A 1YKWA 1WSRA 1YWXA 1R0CB 3K89A 3W5XA 1RWKB 3VVTA 1X60A 4LRDA 3PFOA 4ECUA 1BQNB 4RO0A 3OBIA 1H3DA 2OD6A 4KPYA 3PZPA 4USKA 2FVQA 1B0TA 3MEGB 3EPGA 4DV3F 3ITHA 2PI4A 2ZNYA 3OXGA 1TMJA 1H72C 5HROA 3IS9A 2AZ1A 1N8RT 3KK3A 5ETRA 5HL7Q 4CNZA 2XYHB 1TMMA 1RAEB 1P8GA 4U8VA 1FERA 1QAIA 3VVUA 4LBIA 5A8RA 2KO1A 4X64J 3MUVP 3KUEA 3KG1A 3PRVA 2CIMA 2W2PP 3KK1A 2CPJA 2ACMA 5JJBA 4C2MA 3JSYA 5D0GA 2X7IA 4FYWB 2LMIA 1NKCA 4K4ZA 4F02A 3WQPA 3I9V9 3B82A 3CDBA 4ZPTR 4C0BA 2NZ4A 1R3NA 2LP4A 1FJGJ 2NLWA 3W60A 5ETSA 4WYWA 1TZ0A 3OVBA 2B4VA 1FJ7A 2J7UA 2YQ3A 2XMVA 2GC8A 3CCRS 1P94A 4CYUB 5F3ZA 2H3EB 3PVXA 3IG1B 2B8QA 1S1VB 4QZVB 3E01B 2HZAA 1YJ7A 2WOMA 5B0BA 1W2IA 3HHLA 4KHPJ 3A8JA 1RT4B 1CEZA 2GGPA 3DLLQ 2CZVC 1H74A 4I7FB 1X4HA 2EFPA 5JXSA 2WSEC 1F2GA 4RNHA 1S6PA 2QL9B 4BDPA 1RT2A 2AP6A 3LPEA 1HYSA 4PG5A 4DUYJ 3R7NB 2U2FA 3UNYA 2BQUA 3PO5A 5CYQB 4X64F 3CCMS 2Q6CA 4QIEA 3TX0A 4Z37A 3BREA 4F3QA 3K8WA 4DL5A 3FUYA 3NNAA 2OPPA 3EUNA 4NMXA 2BA9A 1OM2A 1C1CA 4ZA1A 3PRDA 4ELTA 5AJ3J 5C24B 1WNEA 3W5ZA 4HTIA 3R97A 1VLYA 2XS2A 5CA5A 1RT1A 1N34J 2ZDPA 3TQEA 4ZLNA 3S1TA 1CG2A 1LQ9A 2HIQA 4NMLA 1R8BA 4K59A 1NU4A 4CQ1A 3B78A 3GJRB 3CCES 4U96A 3CJQA 5ETQA 3AY0A 4JYAJ 2O5DA 1ICEB 1B70B 3BGLA 2HFUA 3BN4A 2QA4G 4HR2A 5K14B 3FC9A 3PTWA 5CYMB 4WE1B 2VBXA 2FLOA 4FS2A 2KXFA 4TY8B 2YNFB 3C46A 4D3GA 1IKWA 2VG6B 4DUYF 3W2WA 1M5KC 2W4CA 3A3OB 2DNZA 3JB9k 4B3SJ 3TYTA 1CBKA 3U1MA 4LVOP 2OHDA 1SBRA 1NZAA 2ZH8A 4LFBJ 5AJ3F 3I0SB 3NAHA 4NLOA 1Z2ZA 2HNZB 1UP1A 3HVTA 4WFXA 3MPYA 2V9WA 2QC3A 5AT1B 4DCJB 1HBOB 4BCAA 2FJVA 3KJNB 3K5LA 4LSLA 1DTTA 2F65A 3QAUA 2CJAA 2ZD1A 4L3NA 3W63A 3J81j 2X3DA 4A8QA 5H9EK 4FPIA 3G8SA 3VR1A 1V5IB 4DN9A 3GFZA 3T3FA 1RTJA 4LF4F 4WFZA 1IR2A 5IC6B 2H1OE 3D6HB 4X66J 3GIKA 3BH7B 1NK8A 2ZE2B 5IM0B 4DV5J 2K2PA 4JBCA 5HP1B 5HK4A 5FDLB 5J2QB 2EFQA 1PC4A 2JX2A 1SUQB 2WONB 4WP8A 4Y2CA 3UR3C 3QJPA 1EIYB 3PHEA 3ZZ0A 1SC4B 2C3MA 3BV8A 3Q86A 4LFBF 2PMHA 4FBUA 5D3GA 3VF0B 3UDVA 2CQ1A 1MN9A 2MPUA 2ZEJA 3MMJA 1TUGB 3BB5A 4YB6A 2C2KB 3DI6A 4HHUA 5HAOA 2CNNB 1K44A 2AGQA 2DHXA 1PO6A 1R31A 3MUTP 1HWJA 4DR7J 3BQ0A 2YNIB 4ZHRA 3LTOA 3M9NB 1XNQJ 1SXLA 4MK8A 4HI2A 2IDEA 5KG5A 3KHGA 1GNKA 2KZZA 1I94J 2NSCA 1IJFB 2JC0A 4LSZB 2NS1B 4DZ6A 2VBYA 2YWGA 2HHTA 2QLFB 2OGUA 4X66F 2KELA 2KKHA 4CTAA 1WACA 2XMKA 1TV6A 2HWTA 3IR5B 1CS4A 3CJKB 3AJ1A 3TX8A 2RNEA 5A0YA 1S49A 4KSEB 4FS1A 3R7SB 2YBVA 3MM6B 3UQSA 4M5GA 3SFGA 4O44B 1C0TB 1FXDA 3UDLA 2ATCB 4QR0A 3N6MA 2R8IA 1TP7A 4DPOA 3LP1A 5KFNA 1VJQA 2WSCC 3M8RA 3IR7A 1ZZFA 1LNQA 1H38A 2A2DA 2DNGA 3MM8A 3FSIA 4CO0A 4DS4A 1T9TA 4EBDA 4F2SA 1FDBA 4FF2A 3MUMP 1YVFA 1TKDA 4GRSA 3TA0A 4RNFA 1P6TA 4C9DA 4ECZA 1S77D 1QDUB 1QE1B 2GS8A 2CPEA 2MQMA 1NDPA 4DR7F 1GMWD 2CPGA 5G0RA 2LEBA 3CXCR 3J7ZT 1HL6A 1XNQF 1EKRA 1I3OB 1M5OC 1I94F 3NGUA 3GIJA 3I5AA 3OXLA 3B54A 3ZO7A 1HIYA 3QGIA 3RZAA 3L7UA 4ED8A 2VPXB 4ZIWA 4AL7A 2B7BB 1QM9A 4DQQA 2ZWOA 4ZCMA 4ED3A 2VG5B 3J7YI 3MEKA 4LF1A 2CQCA 2OTJS 5HANA 4ERDA 3VALA 4K8RA 3TOQA 3DCAA 2RQ4A 1UL3A 2HSEB 4B08A 4ED2A 2YXLA 4RKUC 3HVRA 2QZ8A 2CJYB 3JYTA 2AMCB 4L6V3 4DFPA 4M5IA 4NLGA 3IMQJ 2YH1A 3A4TA 3QO9A 1K73T 3KLHA 1X5SA 1ZAVA 2VD3A 2IMOA 2JLEA 4QYZJ 1YRTA 2NXEA 4JP8A 2BKNA 3VQTA 4CLSA 2EG2A 4PQAA 2XYGB 4UOCA 1Z2LA 3PX4A 5HJXA 1JWWA 5IT0A 3BKTA 1F3FA 2LFVA 1JIHA 4B17A 4C8ZA 2OTLS 4IQMA 4H4MA 1U1RA 3PHTA 1M5SA 1N56A 1HWUA 2UXBJ 4KKOA 4ZP9A 1U6ZA 2GHWA 2MTLA 1CJUB 3NLCA 1U1MA 1RAAB 4U7UK 3DOMA 3AD8C 4RBTA 3D6FB 1WF0A 3I31A 4X4NA 4ZCIA 3MPWA 2VL1A 3MPVA 1JLCB 1S1UB 3FEYB 2XMAA 5I3UB 1FXRA 3KJQB 2VG7A 1DLOA 1NPRA 1KLMB 3H7HB 1SJQA 3HHKA 5KFHA 5DJBA 2DXFA 1LV5A 5CXTA 1TL5A 4EYIB 1Q95G 1MROB 4ID5B 4ECRA 3OD2A 4GVBA 1M1KT 1VQ5S 1WOOA 1D09B 5BXIA 4HH0A 3MM5B 1NLKL 3OR2B 1BHNA 4DQSA 3MEEA 4O4GA 1R27B 2PC6A 3R5JB 2F9JA 5KFSA 4ZPCA 3LWLA 2UXBF 2BQ3A 2IMWP 2N4DA 4OYBA 4BWJA 3W9IA 3Q8QB 1W26A 2IA6A 1HQUA 1RBAA 1YZ6A 2GIQA 2AD9A 3GG0A 2F63A 2A6MA 2PFFB 3FK4A 4Y0FA 4IH6A 3D5MA 4QU6A 1HI1A 4X4TA 1U1PA 4HKQA 2Z2MA 3PRBA 4I2QB 1C1BA 4NA2A 5LMNJ 1CULA 3QFWA 4BS2A 1J5OB 3CNQP 2XZWA 4YB7A 2RHSB 4ETZA 3BO2A 3M8ZA 5DLGA 3K5PA 1WI6A 1M5HA 2CPZA 1LEOA 2Y1LB 1B99A 2ZVIA 4HT7A 4RLEA 2E9RX 1F60B 5IT9U 1K0VA 4ER8A 4RUBA 5IT9Y 3TO8A 3W7BA 5CH7B 1KNZA 1D3WA 1FKOA 3P5BP 3RBZA 1UTAA 2KZMA 2X1GA 1SH2A 4M5LA 4J9RA 3RAQA 3MR6A 2LDYA 1IM6A 4OJHA 4TQSA 3HFVA 1U02A 1JNRB 3BGRB 3PKMA 2LQJA 3BF4A 5HVHA 1FO1A 1FKAF 1TTHB 5D4LA 2HAIA 3PX0A 5DQGA 2XULA 3AH6A 2WB4A 1FJCA 1AW0A 2DNRA 3CPWR 4KO0B 4MK9A 1MLAA 1B0VA 2BJ3A 5LMNF 4ED4A 2VC1A 3MDFA 5SZTA 2G1HA 3PYFA 1WC0A 4O0NA 2JH3A 3IWXA 3M2UA 2BQRA 3HM9A 3VAHA 1UJ6A 3MAAA 4C3LA 2ZH1A 1VQ6S 3NGTA 1YSJA 1T95A 2VB6A 2HS4A 3O1LA 5KFJA 3QSYB 4ZOSA 2J6SA 3FT7A 3A8KA 4QIVA 2XHCA 1CJVB 3C6TA 2ZH9A 2Y0SD 4Z7CA 2UUBJ 2UV8G 2HNDB 2R8HA 3VAKA 5T14A 1N32J 3PNIA 3MWBA 1VRTB 1UEKA 1NK7A 2R8JA 2R7VA 1S59A 3KYLA 5A6WA 3Q0AA 1UEUA 1LWXA 2V2QA 4JV5F 2KT3A 2YPYA 4CLTA 2NCKL 2WW8A 4Z2XA 3TI0A 1P9QC 4DI6A 3KLFA 3CF5Q 2DNLA 2HQFA 2KJVA 2FZKB 4QU7A 1KVKA 1U8WA 4IG0B 1RP5A 5D8HB 1O8BA 2HIYA 2H5EA 4N77A 4RW8B 2YX1A 3UI3A 2DB1A 2BR0A 1WKLA 3UR0A 3EZ5A 4TYAA 4HACB 4JOUA 2FGCA 2MZ1A 1JXEA 2HHUA 3OTOJ 1GMUA 1BQNA 2XTJP 5HLFB 4F50A 2BNWA 2DYAA 1TAQA 5JVHQ 5KG4A 3MEGA 1HI0P 3CW2C 2KVIA 1HD0A 5E3AA 2UUBF 3QRRA 4DSJA 1RE1B 5DS7A 4DR1F 1N32F 4NWBA 2CQ4A 4RR5A 4NA1A 2OSRA 4M5KA 5ETOA 1GEHA 2RQCA 1H2VZ 1GAOA 4C8YA 2MZJA 1NJXA 3J7Z5 3DDKA 3KHHA 2QLBB 2MJNA 3NCPA 5KG6A 4Q5VA 4UOGA 1IWGA 1YJUA 3PM9A 2DIVA 2QMXA 4GC7A 4J9VA 4URSA 2DRBA 4DHVA 1N52B 1Q7YT 1RBLA 2YWHA 4LFCJ 1YX2A 1GT8A 1EJ7L 2CQPA 1FE4A 1KSPA 2VU5A 4EMDA 2XLIA 4KE5A 3GIMA 1TK0A 3CJTA 2PFDA 2EC0A 4CYUA 3U1LA 2RHQB 3GIIA 4EYHB 3OTOF 5LJ3Y 1U25A 1S1VA 2B56A 3E01A 4NXNJ 1WTBA 1WHVA 1FNXH 3PDNA 2RIJA 2GQ2A 4KHMA 4B3MF 2P8IA 1L3SA 4I7FA 2RAQA 2SXLA 3A1YG 3UO0A 3NG8A 2VZ9A 2DRDA 3MURP 1FA0A 4LRBA 2A10A 1S9EB 3SXLA 4LBHA 1RWNB 4PQUB 3X1LB 1I6JA 9ATCB 4WFAQ 2HHPA 2XHWA 2G0IA 3HVAA 2NUUG 5CYQA 2DR5A 3HD1A 5K9FA 3EPIA 2RUSA 1WKKA 1OJ4A 4OQJA 3TR5A 4DL4A 2R2UA 1OWXA 9RUBA 4NLTA 1Y4ZB 2KM8C 2XGPA 5C24A 1HARA 4I1TA 2V4QA 1S4EA 2E66A 2YX4A 2N7YA 2CQBA 3ZTSA 1T94A 1EX8A 1CPZA 1PIEA 3J7AN 3CDAA 4UZBA 2L9NA 4Y28C 5I3PA 1BE4A 1C4AA 1SJFA 1XQIA 4XTTA 4LF6J 2PMZD 4DX6A 4ZDNA 4PXBA 1D8ZA 2HHXA 2RT3A 4TKTA 3EM1A 5K14A 1MNEA 2H65B 1S76D 5HI7A 5CYMA 4WE1A 2KHCA 3PJWA 2VODA 2GA7A 3C15B 4TY8A 4YP3A 5C2GA 2YNFA 4QWEA 3BDPA 2VG6A 1RHMB 3RJMB 3DLJA 2F8EX 2VFSA 4CT9A 3VZHA 4X4SA 2WSFC 1EETB 2VA3A 3EZOA 3OR1A 1DAXA 1FEEA 2QTWA 1EKSA 4GO7X 4OHYA 1FFGB 4DUTA 3ZTQA 4KR0B 3I0SA 2Z58B 3IM8A 1ROFA 4RBVA 2FZCB 3NS6A 2DVIA 3P3DA 3DLGB 2RDJA 2ZC3A 2HNZA 4K4YA 1KR4A 3IGVA 1JJ4A 5F8GA 2AGOA 2LXUA 3NOCA 4ZN3A 4PPDA 2IRXA 2CZ9A 1HBOA 3EGNA 3I32A 4A47A 3V6DB 5B0EA 1EP4B 4LF6F 2AY0A 2LQ8A 2BM1A 3ILIA 1T0TV 5GMDA 3NS7B 4AXJA 2PEBA 4QWAA 3PFEA 1FHTA 4DFJA 2XY7A 1LKZA 3I4PA 3UD3P 2BJ8A 1RUSA 4NLYA 2ZE2A 5IM0A 2ZH7A 2HVZA 4F36A 5L38A 2G13A 4ZPVR 2IAJB 2R7RA 5J2QA 1S1WB 2VIHA 2WRMA 1SUQA 1FFWB 2WONA 1WC6A 3BSNA 1UCNA 3Q8YA 1WJ9A 1KC8T 1F5BA 4EBCA 3C19A 4BC7A 3D54A 1RHJB 3ENQA 3PYEA 1NDLA 1KLNA 1Q0NA 3FQLA 5ETVA 5DG9A 1FTCA 3PIPQ 1Q16B 4DU8A 4YB5A 1ZAXA 2YNIA 1IUJA 2DNQA 5MAOA 1RGVA 3VGTA 3CJ3A 4ES3A 8ATCB 1SKSA 5SUHA 2M3DA 4CH0S 2QE5A 2XZ2A 3D2WA 3H98A 5I3QA 4LVNP 1DARA 1B4SA 4M63A 3CJKA 3HD2A 4NLDA 2KU7A 3MD3A 3MM6A 2HHQA 1IKVB 1V3ZA 4O44A 1C0TA 2ADBA 1MSWD 4YQWA 1OY8A 2G2YA 1GMWA 5GAHI 1U9PA 1FCAA 4JI8F 3N79A 1RWMB 2PGCA 5HQ8A 1PJ6A 2OH2A 2XMJA 1F2HA 1CVJA 3BPDA 1SPBP 1F9HA 1QE1A 1RBOB 4D3HA 4UOFA 4M8LA 2UUCJ 4Y3CA 1Y0HA 1GXUA 2OELA 5U47A 1N5SA 5EGYA 1QJHA 3OHBA 3RBXA 2BE2B 3TVKA 2DCLA 3GWCA 2QYCA 5L1JA 2BE7D 1WG4A 3WZ0A 2B9WA 4XPCA 2HNYB 3DOLA 4QR2A 3N4WA 4C4WA 2FY8A 2D3ZA 4ED5A 1RSCA 3T41A 1HW9A 3ZZPA 3MHYA 1RWOB 4TLRA 3LGMA 1PAEX 2MKYA 5I4MA 4UQGA 3I82A 2D9OA 1IBCB 1UVIA 2MZRA 1VS3A 4DV1F 4Y00A 1Q8LA 4TVAB 2CXEA 2G2OA 4BC9A 1VQSA 3H2UB 1D9FA 2UUTA 5DZ7A 2NXUA 2A18A 3T9ZA 3ZXWA 3T1YJ 2UUCF 4KFBB 4UZCA 4R0EA 1Q79A 3S01A 2YNHB 2Y0BB 1LW0B 2KXHA 1AA1B 2OEMA 4UTGA 2RB7A 1NDKA 3B6BA 2K7KA 2VQEJ 1FKPB 2FQQB 3D67A 1SKWA 2GAHC 1KRPA 1CJUA 2LQBA 2XO7A 4V19J 2HAFA 2IA0A 4HT5A 3QGGA 3I96A 1X5TA 2AN7A 3W5YA 4LRCA 1UWAA 4P75A 5HBMA 3AD7C 1Q86T 2BV3A 1JLCA 1S1UA 5I3UA 1FX2A 1R89A 2FLNA 2FZGB 1SQEA 2CADA 4DPUA 1Q53A 4RBUA 2VPZB 3HFKA 1R0AB 2MQPA 4N7TA 3ZNUA 4MTPA 4HI1A 2HWHA 4LF5J 1MROA 4ID5A 2GHVC 4Y2KA 3EX7B 5C25B 2ZH3A 3UE2A 3OT9A 1IR1A 3QGHA 3MFIA 4BWMA 1FXLA 3MM5A 3TZWA 4OHZA 2ADCA 3OR2A 4KRWA 4DV7F 4DG1B 1VQ9S 5GVQA 2XGQA 2W2OP 1WEYA 1LFWA 4IO1A 1ZH5A 2R3VA 3LUYA 3KLVA 2L48A 1D1UA 2VQEF 4P2FA 1RABB 3PIOQ 2QL7B 1P1LA 6AT1B 4IR1A 1TK5A 5B0DA 2VFUA 3QNWB 3GYGA 3ENVA 4JI1J 3DLHA 1T9YA 3PY8A 1WDDA 4HVZA 1TL4A 2NXNA 2DNOA 1O51A 4PG7A 3M6XA 5M2PA 4I2QA 3U1NA 1U0HB 3RG6A 4A8YA 2QFJA 1QLNA 1SIZA 3GCXP 1JKHB 1VQMS 4E8UA 5A76A 1J5OA 4ZJQA 1FT8A 1U1LA 1IBMJ 4LF5F 1S4FA 4IG3B 2K8GA 4NXMJ 2NUHA 4DR6J 2CJBA 4P73A 2DD8S 2KT5A 3IBWA 2W2NP 3CCVS 4KGMA 3GYNA 3TAPA 2W9AA 4ZLPA 3FGVA 1U45A 3TUPA 2B8PA 3THVA 5KFDA 2YVSA 3IGNA 5GAGI 1U1NA 3ZTOA 2FJDB 3KK2B 3BGRA 3HZEA 3M8PB 3DNCA 2AX0A 5KT3A 3DGVA 4DOZA 3I9ZA 4RJVA 2AJ4A 4LIWA 4KO0A 2V4JB 1W2BR 3FSYA 4Y2IA 4YDDB 4IRCA 3TEGA 3SYZA 1X9SA 1N36J 1G6BA 2EG1A 4LIRA 2JC1A 3M6VA 4CH1A 2RRBA 3L7OA 4E98A 3NGRA 3D9BA 3AODA 3TZXA 4F26A 2EK6A 2W8KA 1RHUB 5KFTA 2LCWA 3IR6B 1T7PA 1Y9OA 4F7VA 2MLXA 1S6UA 2V2ZA 3CULA 5KFGA 2FC8A 2MKHA 5F8MA 2FHJA 4NX9A 2VFTA 3QJJA 4WP9A 3ZFVA 1QAJA 1CJVA 2K5JA 2MQLA 4DQIA 3FEZA 4ZPWR 2HLUA 2HNDA 1CC8A 2I8EA 1FNOA 3Q8UA 5FIIA 1FEHA 2YWFA 1NPKA 2ASJA 3LQVA 4DZDA 2HHVA 3QPIA 2LQ9A 2BEFA 2HQGA 4KGXB 3R2DJ 4NCGB 4ZVGA 1FDAA 1GFWB 4PXEA 3CO0P 3HCXA 4B9UA 1N36F 3J81U 1N5VA 1XERA 1CSJA 1ZM4A 3G96A 4IG0A 2DKOB 4G1IA 3J81Y 3AQOA 2VICA 2A6OA 1FRXA 5J2NB 4RW8A 1KP6A 1A0OB 2HBQB 3VCDA 2GJ2A 2W4PA 1N0VC 3RBEA 4HACA 3AJDA 2CQ0A 3CJ2A 4ZVFA 3GJSB 3E2EA 4CDIA 2ADLA 4NLXA 1KN6A 1FDNA 4C8KA 2K06A 5HLFA 4OX7A 3CD7A 1K0TA 3EVWA 3G6YA 2QV6A 5KFWA 4Z7YA 2F1FA 1VQYA 4J7CA 2RRAA 4PWDB 3WX4A 4OYWA 3GG1A 3JSMB 3HKZD 2J9CA 4OZNA 4WTOB 3WBZA 1SL0A 3CDWA 2IJFA 2HRTA 2E5LJ 1HHSA 2EXUA 3AOAA 1PAUB 2BACA 2CAJA 2DNPA 4K2XA 1OHNA 2IM1A 2IRUA 2V69A 2ZKUA 3C2PA 3DRRB 4IUFA 3HSJA 3E8OA 3M8YA 2HRYA 4B9TA 2GO8A 3BKUA 4K4TA 2CWXA 2CNKB 3G71S 1WG1A 4DPWA 2DNKA 1FVQA 3PW4A 2LYVA 1RLCL 5KT2A 2RQKA 1WHYA 4FF1A 2WHOA 3G87A 3R6LB 4N47A 3BGFA 1OY6A 1TAUA 2HBZB 1ARQA 3G5OA 4LF9F 4YHHF 3T5JA 4BLGA 3KMSA 3OFFA 1Y00A 1IWAA 2YKMB 1REGX 4ES1A 4PUOB 3ISND 4F25A 1S9EA 3T5HA 4FF3A 3PR5B 5F8HA 1KQGB 4PQUA 3VW4A 4UQTA 3L7PA 4J9PA 1URNA 4ZJOA 3I56S 3MXHP 2D74B 3G8QA 2E5LF 1A6LA 1HKAA 1TL3B 4FVCA 4L75A 2V68A 2DNHA 4MKYA 1REVB 4JB8B 1HNIB 4TN2A 5ETNA 1Q82T 3FCWA 2LECA 3O8WA 4L74A 5KFLA 4JI6F 4P71A 3UCGA 2UU9J 2RE1A 1T3OA 3VGUA 2ZFHA 4CO2A 4IR9A 3RW7A 4FXWA 2HFVA 1NM2A 3KMQA 4NZ7A 2VDIA 3LPYA 1Q4RA 2A1BA 3HMJG 2E1CA 2UP1A 3DFEA 2XM3A 2QLJB 1RWWB 2EK1A 2XO6A 2W2MP 2JXHA 5KFPA 4OV6A 4JI7J 3DRSA 4AE5A 1JQGA 5C42B 3JS9A 5JVGQ 4Q0BB 1RT5B 2XC9A 5LXRA 2R2SA 3M30B 3C15A 3DHXA 2V2KA 4HDHA 5AE2A 4NRTA 3SI8A 4AUKA 3U02A 1H0HB 3OUYB 5E2QA 2FJAB 1LWCB 3H42A 3H4BA 2CPIA 1EETA 4DBQA 2WB1D 3N6LA 5IXUA 2FVRA 2UU9F 2HMIB 1X4AA 3I4HX 1NSKL 1OIAA 4TLQA 2V8DA 3DLKB 2ZHAA 3DLGA 1RKIA 3D0IE 2K6LA 3NNEA 2DH7A 2AZ3A 2XWYA 4URGA 5LJ5Y 3ZTPA 3HPOA 2DGTA 1BWVA 4QPTA 3P8BB 4ECQA 2QN6B 3V6DA 1N5YB 1XMBA 1EP4A 1Q7LB 2BJ7A 3EDQB 1ZZNA 4K4UA 3PCOB 4M5NA 1X5PA 4WCEQ 1EQ0A 2ASDA 4JI7F 1RHQB 4C97A 4FN5A 4RWWA 1RB0A 3HZGA 1RTHB 1XR6A 1PILA 1Q8BA 2X1FA 1M1GA 1N5TA 4OZ0A 5KG3A 1B64A 1JJCB 2FTRA 2XLKA 1IR0A 2R2TA 1H7XA 4YEAA 1YJ9S 2IAJA 2CJXB 3QIPB 1S1WA 1DQ8A 1XBWA 2RILA 5DZ6A 3A12A 4P52A 3KNAA 1VJWA 2BOPA 3PACA 2ILZA 2R2RA 3M6WA 2GFFA 4ZP7A 3T6JA 3M8SA 1HA1A 3RBDA 4OYOA 4UF4A 1YITS 2HVEA 4AT1B 2PD1A 2GV1A 3GSDA 2OD4A 4ZVQB 4CM0A 2RVJA 1VQ7S 5CAAA 1Q16A 3MPDA 5DM7Q 1PSDA 5BYQA 2CDQA 3RU0A 4FNHA 3FKBA 1UZDA 2GW8A 1T9WA 2R7OA 5F3TA 4N8NA 5E3QA 3ZC4A 3CGIA 1Y5NB 2J9DE 2Y1JA 2MZSA 1KQKA 5DG7A 3C3LA 2ROPA 3H25A 4F4AA 1N0UA 4JV2A 5HMXA 4RNNA 2UV8A 1FD8A 2DGWA 1SB6A 1NSQA 2XMTA 2OSQA 4YN3B 2B6AB 4YR0A 1KTVA 1MMNA 4HYKA 1H73A 4ES2A 2WCXA 2QMUB 1X8DA 4DF8A 2QSFA 2FYXA 3MAHA 1IKVA 2FHKA 4W98A 1CQMA 2KJWA 1D0EA 2O66A 3W66A 3HHNB 4UY8T 2E5GA 3FRZA 1KVJA 1EB0A 4MK7A 4F67A 2V8VA 7FDRA 3NNHA 3ISZA 4CLLA 2KT2A 4ZKAA 2UVRA 3MFHA 2GHPA 5E3RA 1KKHA 7AT1B 3LP2B 1YQHA 2QA1A 1WC4A 4HDGA 2BE2A 2GJFA 3BDEA 4LRVA 2RU9A 3ZZOA 2DXEA 2EEYA 3NMAA 4UUWA 3KLIB 4Y34A 4Q43A 5K20B 4UUXA 3SDEB 1JJ2R 2EPIA 1V3RA 3PR4A 4N41A 2MYFA 3AA8A 4NCAA 3TJ8A 2RSQA 3TWZA 1S1TB 4PG8A 2V1TA 1KTQA 4OI3A 3JTOA 3SSRA 4OI6A 4OFZA 5HVFA 2VC0A 4P7TA 2D69A 1WC1A 1WOSA 2XTCA 1FWKA 2DY9A 3QWUA 2MQQA 1S0OA 2CPYA 1KQFB 4X65J 4O3OA 1RT7B 1SL2A 2E5IA 4DV0J 2MKCA 2G0JA 4DUZJ 2J6TA 1S6QB 2ZJQQ 2RBFA 4OZJA 4DF4A 2DCUB 1JLBA 1EARA 3N28A 2J9EA 4TXSA 4DX5A 2V0NA 1NJWA 1R0BG 5F0UA 2UUWA 2YPZA 4KFBA 2ZKTA 3SFUA 2YNHA 4DJBA 1LW0A 3UDEA 3DU5A 4A8SA 3JTNA 2DGXA 1U2FA 4N76A 2GVDB 4NEYA 2DRAA 1FKPA 1FD2A 3W1YC 5EWGA 4TU7A 1C4CA 3DDNA 2C22A 3BGOP 3JQKA 4J9QA 3VAGA 2IVYA 2KXNB 4KV8B 1OPZA 2AYBA 5ETLA 5F0WA 4PYAA 2FJEB 4WIIA 2G2ZA 3W8GA 3DRYA 4QWDA 3MR3A 1E6VB 3SSSA 3B4MA 1NJYA 1E6YB 2D3OR 4MFBB 4X65F 2CNOB 1R0AA 1QD1A 2KOEA 1CLFA 4DV0F 1HWLA 4QCLA 4DUZF 3BSCA 2J76E 1ZETA 1UVMA 2JSXA 3JSRA 5D78A 3HVWA 5H9FK 5C25A 3DMJB 3KOAA 3SV4A 3ZZZA 4DG1A 1T03B 2YNGB 2KKEA 2YWKA 5ETMA 3M8QB 4K4VA 2OMLA 1YI2S 3PW7A 3D4JA 4OV1A 3KUGA 3NWRA 4WFNQ 1TKXB 4ZVHA 4OMFG 3DOKB 4DU7A 4Q44A 3SV3A 2W9BB 1M5VC 1NK5A 1S7IA 2VJVA 3QWPA 2HLTA 1Q1KA 4C48A 4DS5A 1BDTA 1ELOA 4ZVSB 1XJWB 4LRAA 5J2MB 1U0HA 3R8YA 3T9NA 4XDDA 1JKHA 2DH9A 1AYEA 1U8SA 4P9SA 2FD2A 4FKYA 1PG5B 2E1AA 2W7AA 3PEJA 2V6AA 3UFCX 4PABA 1RZMA 5B0GA 4DWIA 4KTQA 1HBUB 5ETKA 1NSAA 4YY3J 3NGSA 3EGZA 2R7WA 1MMLA 2VPWB 4KGZB 3S8SA 4R5PB 2Z30B 3Q83A 4DSKA 2PE8A 3JSBA 1T05B 3A8IA 3G6XA 2IJRA 1HNZJ 2XZTB 1HNVB 2E5HA 4AXIA 4C6AA 4Q45A 2QLXA 1FDDA 3BGUA 2Z2ZA 3RB6A 2KL8A 4NEZA 1RAIB 3KDOA 3KK2A 3GIRA 2M88A 3M8PA 5CD4H 3FBCA 2K1OA 2IIHA 3M05A 4NI2B 2ZNZA 5F41A 2WVEA 2P9EA 4WTYA 5KTQA 5T7LB 3CCTA 1S48A 5CD4A 2BW2A 2I5JB 2V4JA 3O6QA 2AW0A 2F40A 4I0WA 5A6PA 4EEYA 5KFBA 2ZOGA 3TP2A 4DEZA 3K5OA 1TL7A 4N8OA 2Q3PA 1FI4A 2N3OA 2C2NA 3VGSA 2PI5A 5KG0A 3C6UB 4AD6A 5DQHA 2M8HA 4M5DB 3SIPB 3IP0A 1T9VA 1ZOTA 2IM0A 1HNWF 4YY3F 2ASLA 3P5TL 4J9UE 4LT6A 3VEBA 2V8HA 3RGIA 3AD9C 2CVEA 1HNZF 1IXKA 3TUIC 4ZMMA 4ILLA 4NLRA 2AKWB 2C3YA 1VQPS 4QWBA 2DHGA 3R5AA 3I6PA 2BKOA 3C16B 3TA2A 2AWZA 3JTPA 2HBYB 2OLWA 3OLBA 3FZBA 4ENOA 3POTB 4C11B 2F4FA 5L1KA 1VBXA 5A8KB 2DHHA 3G82B 4LF4J 1HBNB 3SQOP 1N5QA 2OIHA 2MB0B 4IKAA 5IWAJ 4FVMA 1IRQA 1GQEA 4J91A 4EGLA 1QTNB 4PG6A 3T1HJ 1ZAWA 4NCGA 2OEKA 1OSDA 2F8HA 1CQNA 2DXDA 1UWBB 2B9XA 1S0NA 3M1VB 4NLQA 4NASA 2JXGA 1UA1A 3O2IA 1MG7A 1T3NA 1HWKA 1S9GB 1WOPA 4EK2A 4P2MA 2KVQE 3MMAB 5LMUJ 3CCSS 5J2NA 5KFUA 3LW5C 1DZ5A 2UVWA 3Q8RB 1NK4A 4LF2A 3NGKA 2XI2A 1F3VA 2CG8A 4UY85 1SKRA 3KG4A 2POKA 3EGWB 3I5CA 1JLAB 2RJZA 4PWDA 3QSIA 3T1AA 2YKPA 3JSMA 4AL6A 5IWAF 2PMWA 3JAMU 1DQAA 3T1HF 3JAMY 1BQXA 1HQEB 2L41A 2CRLA 3D7SB 4KT0C 1QVFR 3ENAA 2B9YA 1R8CA 3KLGB 1HBMB 1WG5A 1VCTA 4ED6A 2XMMA 5LT5A 1FF2A 2CWKA 2BW7A 3EXCX 2AYMA 5LMUF 1RWUA 2G1DA 3R5CA 1MNTA 3ET6B 3PYGA 4UW2A 2U1AA 3ADAC 4DL2A 3TA1A 3IN5A 4NA3A 2I0XA 1KS2A 2WBMA 3CIZA 4A8MP 1YBAA 2UUAF 1BC6A 4ZVRB 2YKMA 3KJFB 4PUOA 4NRUA 4W4MA 1M90T 3LO3A 3PKYA 3DXSX 1RA6A 3GXQA 4KPCA 4L73A 1M0SA 3DU6A 4DX8H 2DITA 4ZITA 1VIOA 3X3UA 3TZZA 1SI9A 4LF7J 5DO2A 4DR3J 5KFIA 2H1YA 3T19A 4X84A 1TL3A 4U8YA 2D7SA 1MWYA 2Q66A 1REVA 2B4OA 3PXGa 1HNIA 1NRKA 2IDLA 3A8EA 3UPFA 3TQ1A 4CLUA 2ZBPA 2UVVA 1FRMA 1UKUA 2HK2A 3R27A 1RAHB 2HS0A 3TUZC 5KFQA 5JMNA 1WEZA 3Q2SC 2Y9HA 3IFEA 2VASA 2OJ3A 4DFKA 4ED7A 4M94A 3CE8A 4IQXA 2HFNA 3BBBA 3KJVB 2RKIB 3GFXA 3Q89A 4YMEA 4ALZA 1VHIA 3Q23A 1HQ2A 3LAKA 4NYZA 5C42A 4BBYA 3ILLA 4Q0BA 1RT5A 1HFEL 1OQ6A 3M30A 2QRRA 1MN7A 3TEHB 4O3NA 4LF7F 4LJMA 4DR3F 3MF5A 3OUYA 2P5VA 4ANEA 1RLDA 2R7QA 2PSZA 3M6UA 3BQ1A 4ECWA 1VOMA 2MDAA 1LWCA 2G4BA 1NDCA 3W2VB 2CPXA 3FQKA 3IBFB 1T9UA 1WF2A 4USTA 3FMWA 2HMIA 4CWBA 3CTRA 4AQYJ 4YOEA 1YTYA 3MCSA 3DLKA 4EWTA 3VHQA 4KBIA 4QJVA 4EI2A 5H9EJ 1OYDA 3R5BA 2CQDA 4A46A 4RUCA 2BE9B 4P72A 1IQTA 1N5YA 3EMTA 1BY9A 1QUVA 4BHQA 1FRLA 3Q2TC 3SMZA 4L3KA 1WHWA 3UCUP 5LSOA 1UPPA 2ZHOA 2ZDOA 1RTHA 1AUDA 1VQ4S 1WSVA 4FNIA 3OFHA 4ECSA 2QGFB 3J7YU 2JWNA 3H5UA 4C0OC 3VWSA 2C2OB 3RB3A 2WVBA 1U47A 1AB8A 3DRXA 3L3CA 3QIPA 4DDFA 1GMVA 1MW7A 2WVCA 3PO4A 3MR2A 3A13A 4UT4A 4NOHA 4DMZA 5E0OA 1UEVA 2WVDA 3M32B 3Q24A 3OXFA 1RQ0A 2GVZB 4AQYF 5A8WB 3C8YA 1WORA 4OYIA 3IC1A 1O5JA 2Q1LA 5B0CA 2EBGA 2CJ9A 2HGNA 1PYTA 1VDHA 2CVIA 5HJYA 4F0MA 3R6GB 3IRWP 4DV2F 2LLZA 3NP5A 5KFFA 2OUGA 2D41A 2MY7A 5AXMA 5K5MA 4O3SA 4ICLB 2QA4S 3RRHA 5A2QU 2XLJA 1VC0A 4WPAA 2ZOMA 5A2QY 4WIQA 4ED1A 2FDNA 2H9ZA 1RAOA 4HHHA 2FIUA 2HG4A 1NHKL 1O0PA 3LA0A 3IAS9 3OPKA 2R8GA 4OHVA 4H4OB 4Y2AA 2HZVA 3IRXB 2B6AA 3VTIA 3K58A 2M0GB 3BO3A 1PJ7A 3ICLA 4A4JA 2JZ5A 1LK5A 2KRRA 2RDIA 4RUHA 2E29A 2M70A 3FBEA 4I6AA 3DKDA 7FD1A 3IA0A 2GPEA 1YIJS 2X3GA 4RW4B 2XQCA 1BLUA 2D3UA 3GSIA 2KI2A 1NLAA 2PDAA 4FYYB 4DSIA 3LP2A 1Y3JA 2R8KA 3VAFA 3ISNC 5M2RA 5DG8A 4K7QA 1PYOB 1QSSA 4PEOA 2ATLA 4B9LA 4IFYB 4OJGA 3R7BB 5B7WA 2ZBRA 3TAMB 3KLIA 1R8PA 2DK2A 1FTRA 3BZQA 3AFGA 4OLOA 3WX8A 4OI1A 3EZUA 2GNKA 4LR7A 3FCVA 2APOA 5GAEI 4FP9A 4WZMA 1JXLA 2V8PA 1S1TA 2VKZG 1WWHA 3CJ5A 1GX5A 4CI0B 1X5OA 2AEFA 3GR0A 1K8AT 2IM2A 4U95A 1VI7A 4O4RA 2L08A 1VC5A 4IRDA 4JV5J 2ZZMA 2VUGA 1FNMA 3M7VA 3D28A 3SCJE 4ECXA 2ZHBA 2LA6A 2MLZA 1SC6A 4K4WA 4V19X 1RT7A 3AXMA 2FJXA 1NJIT 4OLPA 2IBKA 1S6QA 1BD6A 4CLWA 3PW2A 4U7UD 2P9GA 2AGPA 1DTQB 2ZH5A 4NLVA 1MU2B 2EKNA 4E2FB 1JLQB 1RTIB 2KRBA 3QT5A 2YX7A 1LWFB 4UOHA 2EWHA 4ATNA 1F0XA 3V6KA 2GVDA 3W9JA 4MJWA 1K9MT 2VDHA 3M2VB 4ZN1A 1J5EF 5L46A 4WF9Q 4OZ5A 2AIRB 3ETMA 2CPHA 3OTDA 4B3TF 5GAEU 2RS2A 4CH7A 1TFYA 5C2CA 4DR1J 1OS5A 1X4BA 4Q8FA 4KV8A 5GADI 2I2YA 5J1NA 4JI3J 2HK3A 2KG0A 4NLUA 2W9CA 1ZM2A 4DFMA 2NPFA 5KG7A 4KC5A 1E6VA 2OFGX 2VQFF 4F4WA 1E6YA 2FHJD 2HVIA 1KWMA 1L3KA 1VBYA 1TK8A 4MFBA 5E41A 1NB7A 2DBBA 2O3DA 4U6PA 3ZZTA 4ILMA 4C3KA 3GB0A 2Z57B 5EN1A 3OJSA 5KFKA 3N01A 3UVJB 2CQHA 2IPOB 1X4CA 1X9WA 1RU1A 4ZVUB 2V94A 3DMJA 2A0FB 2BDPA 3C6TB 3BYRA 3K59A 2XSJB 5HQLA 1T03A 1VRQC 3HXMA 1EQMA 4X62F 1G3OA 4PXDA 3FNNA 2IC3B 1B7FA 4K50A 3M8QA 1YRXA 3ZZUA 4CO3A 1RI7A 4EO8A 2CJKA 4Y6IA 2HPUA 1NCLA 3KDNA 1TKXA 4B3MJ 2K1RB 3DOKA 4USHA 5GADU 4GC6A 4LSNB 3IAM9 2W9BA 3UN3A 2MKKA 4JI3F 2YKNB 1PYSB 4OX9J 3GONA 2AYEA 3IO1A 1OY9A 5IFMA 4GKKF 1N33J 5J2MA 2LKZA 3H5SA 4LREA 4KGVB 2OPSB 3MCOA 4B3RJ 1BDVA 3MEDB 2BYCA 2IVFB 1NXIA 2BANB 3CCUS 3MM7B 1EZZB 3QJLA 4PWUA 4K5SA 2VOOA 1VR6A 5LSRA 3MM9B 1HBUA 3IBCB 2X1BA 3V81B 4TY9A 3U27A 4MKAA 2BOAA 3HHEA 3MGJA 3SBMA 1UVKA 4R5PA 4Y2MA 1T05A 2L9DA 2Y1IA 1RWPB 1HNVA 3IG1A 1YJTA 4QW8A 3OL9A 4K4XA 1RT4A 5L9NA 4USMA 2B0GA 2ZM6F 4O3QA 3VAJA 2IM3A 1ACMB 5H1SV 2ZUAA 3W3SA 1V5VA 1BAZA 2YQ1A 3WIVA 4NI2A 4JI2J 4OX9F 2J7WA 5T7LA 3BN7A 2LXFA 5LSLA 2I5JA 1N33F 4HTJA 1MYLA 1RHRB 1LW2B 3OW2R 1VGYA 4B3RF 4DV4F 2BUNA 1T8EA 3ZZRA 3HLUA 5KG1A 3K0JA 4ELUA 1B7YB 2P6SA 2ASYA 4ANDA 2GQCA 3C6UA 6FDRA 2ROGA 5B0AA 1JLFB 4M5DA 2MLYA 1XTZA 2LXIA 4PRFA 2KG1A 4MYUA 2VF3A 1D9DA 5IZHA 3DGPB 2HFSA 1J2VA 3DYAB 2WTFA 3H59A 1H6KX 2C1EB 2I9SA 4DPXA 1ZTWA 3C16A 3HDSA 2VFVA 1N6QB 3GV8B 1T9XA 2FVPA 3BSAA 3POTA 3MZIA 4NCBA 4C11A 1KONA 5A8KA 3G82A 4WBFA 1HBNA 4JI2F 4OYZA 1DJ0A 4OHWA 4DCPB 1NPPA 3MTKA 3HJFA 3N5FA 1FJGF 1PBAA 2ALZA 1VHFA 3GILA 3GLJA 2QL5B 3O3LA 1UWBA 3H40A 1CJKB 5ITHA 4NLSA 2Q6BA 4MYTA 3M1VA 2YH0A 3NMRA 1P27B 1C2PA 3MR7A 1FFSB 1LWEB 3G86A 4ZIVA 2DGSA 5KFEA 1RWVB 4RNOA 4KHPF 1S9GA 3JQJA 1YJNS 3MMAA 3TANA 1LFPA 4OYMA 3GYXB 2ABYA 2PA8D 1YLXA 2QLWA 4JI5J 4WP3A 2EVZA 4G3IA 3H87C 3PW0A 5D4OA 1VC6A 2YWWA 1VQNS 3PYDA 4ZP8A 3CIMA 5IT4A 2HFZA 1XN9A 5E3CA 1IBKJ 2C2MB 1VBZA 5EUHA 4KYZA 2DNNA 3QAEA 3QOQA 1JLAA 5I42B 2Z56B 1B0PA 2JEJA 3P6YC 3OR1B 2XMUA 2BBEA 1MWQA 5HP1A 4A8OA 1TL1B 5FDLA 1UPMB 1HQEA 1M5PC 1VBKA 2HZCA 2VONA 1EHWA 1VMBA 1N34F 2FVSA 2C2ZB 1A9NB 5KFZA 4ZLJA 3CCLS 3KLGA 1HBMA 4QYZK 2LDIA 2MQOA 4JI8J 2UXCJ 1WUUA 5KT5A 1J27A 4FXDA 3MMBB 4JYAF 4ELVA 4FKXA 3W62A 4ZJLA 3F56A 1IKYB 2XZDB 4OZ3A 2G0CA 1HPZB 3ET6A 4JI5F 2L9WA 1UVJA 4RU9A 1HW8A 3K57A 1MYKA 1HI8A 4FZVA 4ZVTB 2W4DA 3D1QA 3DC2A 2LEAA 4F2RA 4OX8A 3WDOA 4RWXA 4A48A 3ZTRA 1Q8KA 3DLEB 5KOXA 1SCJB 3CC4S 1IBKF 5GMEA 5CYJA 4CCHA 1UJ5A 1YGYA 2BJEA 3H8YA 4USWA 2XB2D 4OI4A 1HMVB 1TR0A 4B3SF 3UWTA 1X0PA 1RKJA 5IS2A 3FRYA 4LBPA 3TRGA
chains in the Genus database with same CATH topology
3PW5A 2HS4A 2LEPA 3KLIB 4Y34A 3UDCA 1WTFA 1VQ8S 3HVTB 4Q43A 2Q79A 3O1LA 2YY3A 4UUXA 3SDEB 5KFJA 1JJ2R 1WHXA 3LP0B 5CQGA 2DNMA 2EPIA 4USIA 2BXJA 4ZOSA 1V3RA 4N56A 3PR4A 2W7PA 2J6SA 5J1EB 4N41A 2MYFA 5FJ4A 2LU1A 3AA8A 3CC7S 4C8MA 3DRRA 3V6HA 1VRUA 4NCAA 2XNQA 2RSQA 4QIVA 1G7CB 3C6TA 2ZH9A 1RA7A 3AA9A 2DPIA 1S1TB 2Y0SD 4LSLB 4PG8A 1DTTB 1KTQA 4OI3A 2UV8G 3LANA 2ZD1B 2HNDB 2R8HA 2M8DB 4KHPF 3VAKA 1F5CA 3PEHA 2WBRA 3JTOA 3PNIA 4OI6A 4OFZA 3SSRA 3HHDA 5KFYA 3MWBA 2UXCF 2VC0A 1FK9A 4P7TA 1VRTB 3HX9A 2J7KA 4KQZA 4OIXA 1NK7A 2XTCA 3OL7A 4R8UB 4J37A 3LOUA 2R8JA 2R7VA 4KJIA 3PV8A 3KYLA 1N54B 3QWUA 2MQQA 5A6WA 1S0OA 3Q0AA 1RTJB 2CPYA 5BYRA 1UEUA 1ZM9A 3D0GE 1KQFB 2JJ4D 4O3OA 1RT7B 4RUAA 1KD1T 4JV5F 2R4FA 2KT3A 4B9MA 1SL2A 2E5IA 5D77A 2WW8A 5HMZA 2Q2KA 4Z2XA 1KFSA 3TI0A 2K7JA 1P9QC 4WKYA 2MKCA 2J6TA 1S6QB 2ZJQQ 3KLFA 3CF5Q 2DNLA 3RR8A 2MKIA 3OV7A 2RF2B 2KJVA 4QU7A 2KZZA 4OZJA 4DF4A 2DCUB 1JLBA 1NO8A 3N28A 4DV5F 2E9ZA 3OSPA 2J9EA 4TXSA 2KDOA 2V0NA 4WXWA 1NJWA 5F0UA 2UUWA 5KFMA 4KFBA 4IG0B 1RP5A 4G1PA 3MECB 5D8HB 4X4RA 2ZKTA 1O8BA 2B4PA 2C2DA 5L39A 1JNZB 3SFUA 2YNHA 2HHSA 2H5EA 4DJBA 3H20A 1LW0A 4CO1A 3KJVA 2RKIA 5K8OA 4J9SA 3DU5A 4N77A 3G6ES 3JTNA 4A8SA 2DGXA 2YKQA 4PCQA 3I87A 1U2FA 4RW8B 4IO9Q 1U48A 2YX1A 3UI3A 2DB1A 4N76A 2BR0A 2DRAA 3GMGA 3UR0A 5DDRC 4F4XA 1N88A 2XMWA 3EZ5A 3GZ7A 5D3GB 2ZVSA 4NYPA 4TYAA 4OZ1A 1FKPA