4NLUA

Poliovirus polymerase - g289a loop mutant
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSASGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
molecule keywords RNA-directed RNA polymerase 3D-POL
total genus 142
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nluA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nluA02
3NL0A 3IRXA 3KLHB 2UVRA 3V6KA 4RZRA 3LAKA 1RT5B 2JLEA 1IKWA 1TL1A 2BE2A 4IH5A 4J9SA 2IAJA 2FJWA 5DLGA 4KFBA 3IN5A 3RBDA 1EP4A 4DL6A 3V4IB 2XCPA 1YVFA 4KE5A 3NBPB 5DGBA 3KJVB 1DLOA 4Q44A 3HKWA 2V4QA 4H54A 3EPGA 5KFNA 4KHMA 5KG4A 5KFJA 4ZPAA 2YNHB 1DTTB 1U09A 1RTIB 3DM2A 4MK8A 3E01B 1FK9A 3NKYA 2R8IA 3KK2B 4EEYA 2YKNB 3IS9A 3CDUA 3D28A 3KLFA 2FVCA 3BQ2A 1RYRA 3MECA 2YNFB 1LWFB 2HNZA 4YR3A 3G6XA 4ZPBA 4TQSA 5L1IA 1S9FA 1S1XB 4NLSA 4TQRA 2YNIA 2IC3B 5C24A 2F8EX 2C22A 5DG7A 1WNEA 3KHRA 2BRLA 5KFQA 2FVRA 3M9OB 1RT2B 3DMJB 2YNGB 4O3QA 1HPZB 4G1QB 4RU9A 3CJ2A 3I5BA 5CYMB 2OPPA 2ALZA 2JEGA 5J2NA 3PW5A 1HQEB 3GV7B 3CJ5A 3IGVA 1REVB 5C25A 1S9EA 4K4TA 4IFYA 2R2TA 4ID5B 4MK7A 1XR5A 1DLOB 1JKHA 5KFOA 2OPRA 1S6QB 4YQWA 1DTQA 2RKIB 2BQUA 3KOAA 4RNNA 1N5YB 5J2PB 2FLLA 4ZVFA 3UQSA 5KFYA 1BQMB 1LW0B 4NRUA 3T1AA 2XCAA 3KK2A 5HLFA 1T3NA 3D5MA 5KFIA 1RT4A 1VRTA 3DLGA 4KFBB 1RTDA 2CKWA 2O5DA 3GIKA 4K4VA 1LWFA 2HNZB 1HYSB 3GYNA 4ED0A 3KMQA 2AQ4A 4H4MA 4IQXA 4I2PA 3BJYA 1SV5A 3C6TA 2JC0A 3FQKA 3T5HA 1N4LA 3I0SA 1FK9B 4IR1A 2QV6A 1TKTB 5KG3A 4NLPA 3CDEA 3GIMA 1LWCA 2YKNA 3H98A 5F8IA 2RF2B 4QW8A 3DLKA 2FVPA 1N6QB 1VRUA 1RTJB 3QZ7A 3KHGA 4J9NA 4F4XA 4EYHB 4RW6A 4O3OA 4ECVA 1JKHB 5D3GB 1DTQB 2RKIA 3MEGA 1LWEA 3RB6A 5DG8A 2FLPA 3LP1B 1C2PA 3CVKA 2FVQA 3E51A 2ZE2A 1XR7A 5J2NB 3KHLA 4ECSA 2R8JA 4J9KA 4X2BA 4GC6A 2OPPB 2UUWA 5JXSA 5EWGA 2R8HA 2IMWP 3HVTB 3EZUA 4IFYB 2D41A 4R5PB 5KFFA 1REVA 3CIZA 1S1VA 1SUQA 4WXWA 3M8PA 4QWEA 4URGA 2UUTA 2XGQA 5KT5A 4DL4A 5KT4A 2C28A 2J6UA 5HP1B 1RT3A 2VG5A 3PW2A 1S0NA 5KFBA 4Y2AA 3UDLA 4FBUA 2OPQA 3ITHA 4XO0A 3E01A 2W9CB 1RTDB 3ISND 3MR2A 5KG2A 5FDLA 4LQ3A 4Q8FA 1HYSA 4PQUA 4KHRA 3HVWA 5T14A 4IH6A 5DQGA 2W8KA 3UR0A 3M8QB 4KKOB 4NLQA 4ED7A 3T5KA 2B6AA 1S1XA 3QLHA 5DGAA 1KHWA 3DRSB 4H4OB 4I7FA 2DPJA 5KG7A 4HKQA 2I5JA 3BQ1A 4Q8EA 1D1UA 1T03B 4NLUA 4MK9A 1UWBA 3OHBA 4IG3A 3MR5A 3JSMB 3TAMA 3DMJA 4F4WA 1S0OA 1C1CA 2RF2A 4JV1A 2ZD1A 1T05B 2FLNA 3H4DA 2IJNA 3KHHA 1FKOA 1HARA 4ED1A 2WTFA 3KMSA 3T5JA 2HNDA 3KLGA 5HBMA 4K4YA 3CJ4A 3HVAA 4U7CA 1JLGB 3FSIA 5DLFA 5J2QB 4PWDB 3PW0A 3DDKA 2VA3A 5KFDA 2IM3A 4DL7A 1SH3A 1BQMA 1NHUA 3PZPA 5KFUA 4WE1B 3PW7A 5HLFB 2R8KA 4WFYA 1RT4B 3M8PB 4ECXA 2ASJA 2FJVA 5F8HA 4TN2A 4LSNA 1IKVA 5I42B 3N6LA 4RW7B 4K4UA 3PR4A 1S48A 1FKPB 3GQCA 1TP7A 3DM2B 4NLYA 1JLEB 4TYBA 4ZP9A 4RW8B 1T03A 2FVSA 1C0UA 3ISNC 3JSMA 5KFRA 1TQLA 3DOKA 2D3ZA 4ZHRB 3FFIB 2BRKA 3CO9A 5FDLB 4J9OA 2C2EA 4RUCA 2V9WA 5L1LA 3Q8SB 4Y2CA 1Z4UA 4Q0BA 4K4ZA 4K50A 3MR3A 3PVXA 1N56A 1S6PB 3DYAB 2HMIB 1N6QA 2WB4A 4ECZA 1JLFA 3I0RA 4WXOA 4DEZA 2J6TA 1JLGA 2WRMA 3CJ3A 5L1JA 4K4SA 2WONA 4RNHA 4EBCA 2UVWA 3MEDB 3TAMB 1KHVA 4J9PA 4F4ZA 1S49A 1HNVB 3DI6B 5HROB 4R8UB 2AGQA 3Q8RB 2D3UA 4O3PA 1HNIB 2R2RA 5J1EB 4NCGB 3KLEA 5KFVA 3V4IA 2ASDA 4ZPCA 4WZQA 3JYTB 1IKVB 3RAXA 1RT7B 2HNYA 2ZKUA 1N5YA 3NBPA 1NNDA 1RTIA 3LP2A 5KFEA 3TQ1A 1RT3B 2YNHA 1C0UB 4QWBA 4WE1A 1QAIA 1RT6B 1GX5A 4EBDA 3LP0B 3C6UA 1ZTTA 1TL3B 4KAIA 4ZVGA 1S1UB 4ICLA 4ECQA 3BSAA 4MIBA 1S1WA 3SFGA 5F8NA 2WOMB 5K14A 4FS2A 4KKOA 4URQU 3QIDA 4G3IA 3DRPB 4O4GA 2WCXA 3KK3B 3I5CA 3MR6A 1QUVA 1UWBB 3BR9A 1J5OB 4Q45A 3KLFB 4Q0BB 3PJWA 1VRUB 3QIPA 2YNFA 5F8GA 5KFWA 5KFHA 1JLCB 4GC7A 3QYYA 1MMLA 2IM1A 4IG0A 1RT7A 2HNYB 4LSLA 5L1KA 1LWEB 5KT2A 1IKXB 3OLAA 2OPRB 1S1TB 1IKYB 2C2RA 1MU2A 3CJ0A 1LW0A 4O4RA 4R8UA 5F8MA 3IGNA 1HNVA 3DI6A 5JUMA 2RDIA 5KG6A 3FRZA 3NAHA 1K1SA 5J1EA 5EWFA 3IG1A 1S9EB 2XI2A 4KV8B 1QE1A 3M9NB 3RBEA 2B5JB 1OS5A 2GIQA 5I3UB 4TY9A 4I2PB 2EC0A 4ECTA 1RTHB 4M94A 2OPQB 4RW4B 5C5JA 3KK1B 3V6HA 1TKTA 2XWYA 4RUAA 4ECUA 5F9LA 4RNOA 4RW9B 3BREA 1W25A 1TL3A 3DOKB 4MH8A 1JLQA 3C6UB 4KSEB 3GIJA 1C1BA 3UPFA 4TXSA 4ED8A 3RB4A 5KFGA 5KFKA 4ED3A 3RB0A 3OSPA 3DRSA 1RTJA 4H4OA 4ED6A 4WFZA 4IG0B 4RW6B 4IKAA 4R0EA 1CSJA 2OPSB 4IOBA 4MKAA 4O44B 1IKXA 4HYKA 2ASLA 1S97A 1IKYA 3KK3A 5D3GA 3CWJA 4FBTA 1BQNA 1KLMA 5KT3A 3DOLA 4TY8B 3BSOA 4U6PA 4WYWA 2VA2A 3M9MB 1HQUB 2V4RA 1TKXA 1SH0A 3MEEA 2JEJA 1RT5A 5KFSA 1TVRB 4WZMA 3LANA 4MFBB 3H40A 3QIPB 2YKMA 4R5PA 3KLGB 3KLEB 3GIIA 3V6DB 4KO0B 4QWAA 3BSCA 5KFXA 4IFVB 1I6JA 4NZ0A 3MF5A 3PJXA 2XI3A 5HP1A 1XR6A 3H2LA 3LP1A 3RB3A 1R0AB 5C42B 3BQ0A 2JEIA 4NLXA 1S4FA 2D7SA 3MFIA 2BANB 1RT6A 3KLVA 1EP4B 3OL9A 3IG1B 3NGDA 4QPXA 2E9ZA 3FQLA 5J2MB 3KJVA 1QE1B 1S1UA 4ICLB 4RW7A 4I2QB 5C24B 2R8GA 1SH2A 3M8QA 3ICLA 4KBIA 4RW8A 4I7FB 3T19A 2QE5A 3N6MA 5KG5A 3QZ8A 3OSNA 3KK1A 1RTHA 2AX0A 3QGIA 4EO8A 4QWCA 2W9CA 4QWDA 4WYLA 1HQEA 5DQIA 4WFXA 2ATLA 3BGRA 1C1BB 1TKZB 2IC3A 1S9GA 3EPIA 1JLFB 3I0RB 4NLVA 3KLIA 4KO0A 3Q8PB 5KG0A 4MIAA 4EYIB 4ECWA 3NMAA 4NLTA 2W8LA 4J9QA 1TV6A 2W9BA 1HPZA 4PWDA 3MEDA 3MTKA 2YNGA 5CYQA 1MU2B 1D0EA 4NLGA 3VQSA 4O3SA 1TVRA 1HQUA 1VRTB 3DLGB 2YKMB 4ZPDA 5L9XA 4PUOB 1RT1A 4J9RA 5J2MA 2IA6A 3QGHA 4MKBA 1S6QA 4YR0A 3V6DA 4ZVEA 2I1RA 2IJFA 2HWHA 4LSNB 5J2PA 1N48A 2AX1A 3LP2B 3H5YA 1FKPA 1RDRA 4XPCA 1S10A 1JLBB 2AGPA 5C42A 2E9TA 4NLDA 4RW4A 1LWCB 2E9RX 1ZETA 2VG6B 4RW9A 3DLKB 2DPIA 2GIRA 3GILA 4B3OA 2IBKA 4K4WA 2IM0A 2HWIA 4H4MB 2YNIB 4JV0A 1QAJA 2VG7B 3DRRB 5KFTA 3I5AA 4O4GB 4F4YA 2UVVA 2ILYA 1TV6B 3I0SB 2W9BB 1JXLA 4Y3CA 5KT7A 1BQNB 1KLMB 5KFLA 3OL7A 3KNAA 3DLEA 3V81A 3HVTA 4NLWA 1TKXB 3MEEB 4RNFA 1S9GB 4YP3A 2BQ3A 3BGRB 3V6JA 4IDKB 4MFBA 3QO9B 1HNIA 5DG9A 4Y34A 1LW2A 4NCGA 3OHAA 1HMVA 1RA6A 3JYTA 3T5LA 2XC9A 4DL5A 3MEGB 5KFCA 1JLBA 3KLHA 3QGGA 2ZE2B 4DG1B 5KFMA 2FJXA 4TLRA 4ZP6A 4F50A 1NHVA 4DL2A 1RT1B 2RDJA 4PQUB 4NLOA 1S1VB 1SUQB 2B5JA 2J6SA 1JLAA 4IRCA 1RYSA 1S1WB 2VG5B 2WOMA 2VG7A 3OL6A 1EETA 3DRRA 1SV5B 3C6TB 1C0TB 4ZP7A 3FDSA 3DRPA 4YR2A 3IS9B 5KFAA 1RAJA 1J5OA 2AWZA 3PR5B 1RA7A 3LP0A 2XGPA 2R2SA 5KFPA 3OLBA 2W7PA 4OL8A 3H5SA 1JLCA 2W9AA 4LQ9A 1LW2B 4IRKA 5K14B 3H4BA 2B6AB 3QLHB 3Q8QB 4LSLB 4DL3A 2I5JB 2UVUA 3BSNA 2WK4A 1S1TA 4IG3B 2ZD1B 1T05A 5CYQB 1ZTWA 1C1CB 3G86A 3V81B 3GV5B 3IRXB 3HHKA 3PHEA 1IKWB 2BE2B 4ECYA 4Q43A 3RAQA 4M95A 5F8LA 2GC8A 2IAJB 3GV8B 1TL1B 1FKOB 4ID5A 3QO9A 5KFZA 4K4XA 1HMVB 3OL8A 4KV8A 5J2QA 4PUOA 2JC1A 5KG1A 2HNDB 2HAIA 1EETB 5I3UA 3PW4A 2CJQA 3TVKA 3N6NA 2AGOA 4NYZA 4J9MA 3H59A 4DG1A 4NRTA 2BANA 4ZHRA 3ITHB 3FFIA 3G6YA 4EO6A 4ED2A 2C2DA 2VG6A 5EDWA 3MECB 1JLAB 4ZP8A 4I2QA 3SFUA 3LALA 2OH2A 4B3OB 4ZMMA 4IR9A 2B43A 4YMEA 2R2UA 4EBEA 5I42A 1JIHA 1GX6A 2OPSA 4O44A 4JUZA 4RNMA 3MFHA 3H5UA 5DQHA 1DTTA 1JLEA 1C0TA 1RT2A 5EWEA 2AU0A 1JX4A 3H5XA 3DOLB 4TY8A 2WONB 4QW9A 4TYAA 5F8JA 2WHOA 2V0NA 4KB7A 4FS1A 5CYMA 4IH7A 5KT6A 5HROA 4ZVHA 4NLRA 4G1QA 2BQRA 1JLQB 1T94A 2JEFA 3CDWA 1K1QA 3DLEB 1TKZA 5C25B 4ECRA 4URSA 4J9LA 4O3RA 1S0MA 4O3NA 4IRDA 3KLIB 1S6PA 3DYAA 4IDKA 2HMIA 3SI8A 1IM4A 2ILZA 3NAIA 3LAMA 5HBMB 2IM2A 4IFVA 4XPEA 2W7OA 4JV2A 5F9NA 2BR0A 3G6VA 5EUHA 1R0AA
chains in the Genus database with same CATH superfamily
3RU0A 3VTIA 4PQAA 1RU1A 1RT5B 2MSTA 2J76E 4LJMA 5H9FJ 1MN9A 4CO2A 4Y65A 2FJWA 1WACA 3HHLD 3RAMA 5DLGA 5IM0B 3PG9A 4HH0A 4DV4J 2E1RA 3V4IB 1X4FA 3DLHA 3H2VE 1E6YB 1VGYA 3TRGA 4Q44A 3D0HE 4ZLLA 2DGWA 2W2QP 3QT7A 4H54A 5KG4A 1U0SA 1ZAWA 2VFSA 3CJ8A 4ZPAA 1MN7A 3UVJB 1WC1A 2YNHB 3NGRA 4NWBA 3LWMA 4DQSA 1RTIB 1D3WA 4O23A 4MK8A 2MXYA 4GKKF 3MI7X 4LF5F 2M8DB 4DUTA 1X8DA 3HZEA 2B4PA 2XO7A 3IS9A 1EX8A 5H9FK 2HVZA 3T1HJ 4KPCA 2Z2YB 2FVCA 3DXBA 4I1TA 2A6MA 4GVBB 3EICA 4S0MA 4R0JA 2GQ2A 2J7KA 2C2ZB 2PE8A 4TVAB 5IT4A 4TQSA 1CLFA 1S1XB 2H9ZA 3QRQA 4X4QA 4DV6F 1F9FA 4P72A 4WTOB 1WNEA 1E6VA 3KHRA 3ZC4A 4X4NA 2BRLA 2RD5C 2FVRA 1V3RA 3M9OB 1NB7A 1RT2B 1GXUA 2YNGB 2PMZD 2H48B 1HPZB 2KL8A 2V9KA 2OELA 1FNOA 1EB0A 2GA7A 4G1QB 3PX4A 2EI5A 3ZTQA 5J2NA 3HXMA 3PW5A 3DCAA 3GV7B 1ZPVA 2DH8A 1PYSB 5HAOA 3PX6A 2FYXA 3HDSA 2AJ1A 3MAAA 5B0AA 2HQCA 4NEZA 4C8MA 1IQTA 4PEOA 3Q23A 2XZWA 4YQWA 4OHZA 3CCUS 1DTQA 4MYUA 3BBFA 2N7CA 3CCLS 4KTQA 5HVFA 1Q0NA 2FLLA 2ATCB 4ZVFA 3SEOA 3UQSA 4AE5A 1HKAA 4F0MA 1UZHA 4DV6J 1LW0B 3T1AA 1CQNA 2KRRA 3CW2C 1PC5A 3HD1A 1T3NA 3NNAA 1FJGJ 2CNNB 2WAQD 1O8BA 1RTDA 1NPRA 1SIZA 3SQGA 1LWFA 1E6YA 2MY7A 3VAMA 3GYNA 2COLA 3OR2A 1HYSB 1R6VA 3KJNB 5HJYA 4IQXA 4I2PA 3T5HA 1S76D 4LR9A 2GO8A 3MAHA 3I0SA 4U7UK 4DI6A 2X3GA 3HT3A 2Y8YA 4C0BA 4NLPA 2PEHA 1XNQF 2XY5A 2VICA 2KKHA 2JVRA 3G71S 1WD6A 5F8IA 1XN9A 2DXDA 1H73A 2DHGA 3DLKA 1URNA 4X65F 4ZJQA 4AUKA 1M5PC 1SKWA 3BGUA 5D4OA 2HRTA 1VRUA 2MGZA 1N6QB 3GYXB 2LECA 1I94J 3PO5A 3IM8A 2KN4A 2HZAA 2CQCA 3CMQA 3TP2A 2AZ3A 2GMHA 2LU2A 2IVMA 5E3AA 1ULRA 4C8NA 3K58A 1UETA 1C2PA 3CVKA 3GJQB 3SCKE 3SV3A 2F4VJ 1WHVA 3W7BA 3D6HB 2EG2A 2OPPB 3A8JA 4OZJA 4X4PA 1GK8A 2YKQA 3R5GA 2D41A 3FNNA 4R5PB 1U26A 3ENQA 1REVA 3I96A 4CLWA 5AXLA 5GAHU 2XGQA 4ZCKA 4URGA 4CLYA 4QWEA 4DFKA 2DNKA 5KT4A 5GAEI 3TQEA 2QLFB 3R2CJ 1UKUA 2RQCA 2J6UA 3PRDA 4DCPB 3FK4A 2VG5A 4B17A 1ZA1B 4Y2AA 3UDLA 2NZ4A 4N8OA 5FLXU 3JSBA 4LF6F 1RKJA 1RTDB 4USMA 3ZZOA 3ISND 5J1NA 2VC0A 2JRSA 2XZDB 1PAUB 1WEXA 5A6PA 1AFJA 2HGMA 4KHRA 1NM2A 3HVWA 3Q86A 5T14A 1LFWA 3RBXA 4CT9A 3RW7A 4C8OA 3UR0A 1R8BA 1V3SA 1T9VA 4KKOB 4ED7A 4ILMA 3QLHA 3Q83A 4NX9A 3DRYA 4I7FA 5LL6d 3DFEA 4YY3F 2V34A 2NUUG 4DV2J 1YTYA 1KDNA 3MCOA 2IRUA 2JFDA 4JB8B 1UWBA 1Y0HA 2L3MA 3LPEA 1DQAA 2MQQA 4N5SA 4ZJLA 3OHBA 1C1CA 2RF2A 2MKSA 3D9BA 1S0OA 2YQ3A 4H4KC 1FFWB 1X9MA 2JH3A 2RQ4A 1DAXA 1FRHA 1WWHA 4OI3A 3H7HB 3P8BB 5ETPA 5THWA 2MZ1A 2NR0A 4C7QA 2FPHX 2W2OP 5KAKA 3T5JA 2HNDA 3KLGA 1IBMJ 1KSPA 4Q2LA 4U7CA 2DT9A 3UO0A 4N76A 3VAFA 1KONA 3G6ES 4QYZK 1ITPA 3AOBA 1SQEA 1VISA 3NS7B 4CLUA 4CCHA 2MB0B 4BDPA 2PI5A 3TUPA 2BJEA 5F41A 2AYMA 3M6XA 4DV2F 2R3VA 1U8SA 2K7KA 3KDOA 1HHTP 2XMAA 1UZDA 4KY3A 1L5UA 1RT4B 1NDPA 1ZS6A 1VQMS 2FJVA 2KYZA 3MMJA 2QN6B 3K17A 5F8HA 4HT7A 4TN2A 3O1LA 2V8VA 3TW0A 4LF8J 4K4UA 5I4MA 2FJBB 4HHJA 3EGVA 1FESA 3PYGA 4NLYA 3PDNA 2FUG9 4ZP9A 1HWUA 4TYBA 3OJSA 1T03A 2X1GA 2CRLA 1AFIA 3R27A 1RISA 2ZUGA 3BKUA 4WFAQ 4U7UD 4ZHRB 5GAEU 4CO4A 3FFIB 5FDLB 2H51B 4DPOA 2RRAA 3SCLE 3GCWP 5L1LA 1N36J 4USUA 3SSRA 1JJHA 2VFTA 1VBZA 1FDBA 1S6PB 1CEZA 1APSA 1IJEB 2WB4A 4ECZA 3EVMA 1LK5A 4FKXA 1MWZA 4C4WA 2J6TA 4LR8A 2WRMA 4ZPVR 2AIRB 4CLLA 2J7UA 3HHLA 1Y10A 4CO0A 2RMLA 4CQ1A 4I6YA 3QJJA 2WONA 1XIQA 3HSJA 1IN0A 4J9PA 3PO4A 1KHVA 1U1LA 3CC7S 1SBRA 4W4MA 1HNVB 3MCMA 1HBOA 2U1AA 5A6WA 3UFCX 4R8UB 3PIOQ 4OHYA 3DLJA 4O3PA 1YBTA 3BKTA 3K5PA 2FDNA 2UXBJ 3T9ZA 2AJ2A 1HWLA 4JI3F 3LF0A 3V4IA 2ASDA 2DHSA 2DNZA 1VQ5S 2EPIA 4FYDA 2OKQA 2XMMA 2VQEJ 1SB6A 1Y4ZB 5E3PA 2ZKUA 2J9DA 4M5LA 2HHQA 1A0OB 3LH2S 2ZITA 2DYAA 4QCLA 4P9SA 2DO4A 2QMUB 3VCDA 4QWBA 1RT6B 4YHHF 2GJIA 4K2JA 1ELOA 4EBDA 4L72B 1JXVA 2W2PP 3LP0B 3C6UA 3MD1A 1TL3B 2L9WA 4ZVGA 5HJXA 4CLTA 3OT9A 4HDGA 4F4KA 4MIBA 3W9JA 3AD9C 1S1WA 2LXUA 4URQU 3QIDA 4N7TA 4ZLJA 3HHNB 4FYWB 3G8SA 4G3IA 3DRPB 2MKCA 3ILOA 2ZH7A 1FKAF 2VB6A 1RAOA 2BXJA 4HACA 3UWTA 2WCXA 2M2BA 3K2YA 4LR7A 4PWWA 3BR9A 4FP9A 4X4VA 4I4BA 1CJVA 3WBZA 1QAXA 1X4DA 2XHCA 1Q82T 4ZPTR 1Y3JA 5F8GA 4GVBA 3T6JA 3WHIA 1JLCB 1BHNA 3NGSA 4GMKA 4GC7A 1TZ0A 4C8LA 1DJ0A 1FERA 1AB8A 4IG0A 3G96A 4DUZJ 4J9VA 4OMFG 2HBZB 1GFWB 2HQDA 3T3FA 1IKXB 3EYZA 2C2RA 3DOMA 1IKYB 2DRBA 1FD8A 2DD8S 2O1PA 2RSQA 4MIWA 1MU2A 1VQYA 3NRBA 1R3NA 2LQ8A 1MLAA 1TMJA 2WSEC 2RDIA 1YX2A 2XQCA 1N32J 1RLCL 2OFHX 2EK6A 3FRZA 4PG7A 4CO5A 5SZTA 5B08A 4KV8B 2DNRA 2J8AA 2DISA 3M9NB 3RBEA 2VONA 8AT1B 4V19X 3CJKB 1HBNB 4IYQA 2RILA 4LIRA 3IR5B 1B0VA 1ZZFA 4KHPF 2QL5B 4X66J 1BY9A 1OPZA 3N9UC 3IWXA 1YGYA 3M2VA 2ZHOA 5C5JA 2KT3A 1TK0A 3KYLA 1HR0J 5L46A 5F9LA 1ZBTA 2J0XA 3U1NA 1SKUB 2HFNA 1TL3A 3C16A 3VGVA 4MH8A 3GIJA 3M1VB 3CCZA 2MQNA 3CD7A 3TUIC 3UPFA 2P5VA 1UAWA 4MAKA 5HI7A 1GMUA 3SDEA 3CUNA 1S6OA 2KI2A 3RB0A 3FZBA 1RTJA 4QIFA 4RBTA 4WFZA 4ED6A 4RW6B 2J9DE 2OD4A 1FT8A 3GFHA 4O44B 3U7JA 3BYPA 3VAKA 1A7GE 2DIVA 1TAUA 4FBTA 1BQNA 1KLMA 1S57A 1WOPA 2J0QD 2YXLA 4U6PA 4EK2A 4ANEA 1H2VZ 1CBKA 4CH0S 4ES2A 3M9MB 2AEJA 3MEEA 2YWWA 4ED4A 4LF6J 1FE4A 1S12A 3SV4A 3QIPB 3IWNC 2GVZB 2YKMA 4KIAA 2GHPA 1L3UA 1GTEA 1S72S 4CIOA 2CQ1A 3CO0P 1Q1KA 4B9MA 3BSCA 2N7YA 4IFVB 4NZ0A 3PJXA 2DEIA 1V9OA 3UDCA 4KGVB 4DR3F 5DDPC 4ALZA 3BQ0A 4JI8F 1Q79A 1T02A 4NLXA 1YITS 1VQSA 2R7SA 2E5LJ 2BEFA 3KLVA 4W92B 4J91A 1NK7A 4DLEA 2E9ZA 1NK6A 2QRRA 4GRSA 4OX9F 1RGVA 2CQIA 3CJQA 4HH1A 4RW7A 4ERDA 2OI2A 4CYUA 2GV1A 3M7VA 4OI1A 1YJNS 4B3MJ 4RW8A 3OSNA 1R89A 3B54A 2XSJA 2MQ8A 2C42A 2NYIA 5BJRA 5K8OA 1HA1A 4A46A 4CWBA 3QGIA 5IT9U 1KWMA 1NPKA 4CT8A 2XMKA 3D68A 5E0OA 4ENOA 4QWDA 4DV1F 4KJIA 4DV3F 4K0KF 2GNKA 2C2OB 2NXUA 3MCSA 1R7IA 1S9GA 3S8SA 3GYGA 4JI2F 1JLFB 2OSQA 3Q8PB 4KO0A 1WC4A 2DHAA 2JZ5A 4ANCA 2YWFA 2GQCA 4J9QA 1U49A 4Z7CA 5CABA 4DFPA 2R7UA 2ZH8A 3EUNA 1BWVA 1N5TA 1ZPWX 3CJSA 4NLGA 4BC9A 4CRJA 1NO8A 2YKMB 2CJYB 2L9NA 5L9XA 2F40A 7FD1A 4O3RA 4Y2IA 3PCOB 5J2MA 1N36F 4MKBA 2ADBA 4P10A 2IJFA 1YBUA 5D4LA 4RUHA 5J2PA 3DLBA 2DGSA 4ZVOB 1RDRA 2WBMA 2E29A 1H74A 1HW9A 1VOMA 2RAQA 1P6TA 4PYDA 1RI7A 2Z0GA 2VFUA 3ILIA 4OJ1A 1CS4B 2ROEA 4RW4A 1LWCB 2RHQB 3M2RB 1ZETA 4EZ9A 2VG6B 3MM8B 3QWUA 1YWXA 2UZAA 2RH3A 1RWWB 2U2FA 4OQJA 3GILA 2ZOGA 5ADZA 3EZOA 4N8NA 2IBKA 4K4WA 2E44A 2GJ2A 1VBXA 1PJ7A 3JB9k 4EI2A 1U02A 2W25A 3QATA 4NASA 1GAOA 4HDHA 5KFTA 4F4YA 2GHWA 2W9BB 2OO4A 1UVJA 4LFAF 2DBBA 2J7WA 1OYDA 3IO1A 4DUYJ 2FJDB 1Q78A 3FEYB 2MKHA 5KFLA 2IIHA 1IBLJ 3OL7A 1RBOB 1AA1B 2EKYA 1S9GB 2M52A 3W8PA 1XMOJ 2RNEA 4IO1A 2HWTA 4F02A 4C48A 3CCMS 4Y34A 1YJWS 4XPEA 1HMVA 5AXKA 1KVIA 1RA6A 3JYTA 3QT8A 1RBLA 3MGJA 4ZN3A 1NBEB 3BDEA 4QIWD 1RWMB 4U67Q 3LA0A 4JOUA 3SQOP 2ZFHA 3PHTA 4ZP6A 2XMWA 4F50A 1FXRA 1L3TA 2HVIA 2QZ8A 2MQPA 1RT1B 4LRDA 2B56A 4Y2KA 2YH1A 1GEHA 3LUYA 4Q7AA 3W63A 1SUQB 1XNRJ 2J6SA 1IXKA 2D9PA 2UV8A 2KM8C 3OUYB 2CQ0A 2IY5B 1VLOA 2ZZNA 1SC6A 2VG7A 1RWXB 2WOMA 2Y0SD 3DRRA 3KWMA 3MEKA 4RJVA 1RTZA 4HACB 4LF9J 1BWEA 4ZP7A 4RX6A 5B7WA 4F25A 2QYGA 4M5KA 3PFOA 1VR6A 1UUJA 5C7PA 2AWZA 2Q3PA 1K47A 3PR5B 2HVEA 2POKA 3EJMA 2R2SA 5KFPA 4B3OB 5HL7Q 3CXCR 3LQVA 4A8SA 3VAGA 4DR7F 5F3ZA 1CULA 3C3LA 2KTQA 4RWWA 3AX5A 1LKZA 3NS5A 1D8ZA 5G0RA 9ATCB 4CH7A 2KG1A 1J2VA 4DL3A 2I5JB 4F3MA 3R2DJ 4UUWA 4HEA9 4PPZA 2QMWA 2QO3A 3GR1A 2GMLA 5CYQB 1ZTWA 4DR4J 5IS2A 1MROA 1RWKB 2NS1B 3SSQA 2IPOB 3V81B 4LFBF 4CNZA 2FTRA 3OXFA 5AXNA 1NSAA 3LPYA 3GV8B 2KG0A 1R8CA 1GMWA 1FKOB 4JI5F 1ZAVA 2WSCC 3QO9A 3NS6A 1F3VA 1HMVB 3OL8A 2VBYA 3TEHB 1TUVA 4P2FA 4YB6A 5I3UA 1IVZA 3TZWA 2B4VA 2YVSA 3ZZ0A 4J9MA 1B4SA 4NRTA 2BANA 4CLKA 4ZHRA 1LEOA 1X0PA 2KZZA 2QMXA 2MY8A 4ED2A 3SQGB 3PM9A 2GO9A 1RAHB 1JLAB 1YRUA 1PJ6A 4I2QA 3BEGB 2DVIA 5IZHA 2LYVA 4IR9A 2B43A 2M3DA 3CCTA 2XLKA 1WI8A 1JIHA 2J8SA 1GX6A 4JI5J 4O44A 2V1TA 4U9RA 3TA1A 3H5UA 1RQ0A 3HZGA 2JJ4D 1JLEA 1C0TA 1XERA 2ZOFA 3K7RA 3QFHA 4B9UA 4BWJA 1S77D 1G1XA 4W90B 2LMIA 1MWYA 2O67A 2WHOA 4KB7A 4FXVA 4L73A 3VAHA 2DR5A 2A2CA 5EX0A 4ZVHA 2LXIA 4OI4A 2AYBA 3M8ZA 3W2VB 1NJYA 4F2RA 2MGZB 1KOHA 4MKVA 1H98A 1GXLA 4PG6A 4PWUA 4A48A 1RKIA 3KLIB 4YB7A 2HURA 2I9SA 4IDKA 2LA6A 3SI8A 2HMIA 2UP1A 2BKOA 2KHDA 3KUHA 4LREA 2CYYA 5HBMB 3J80Y 4JV2A 4BC7A 1OY6A 3TX0A 2MMYA 2WB1D 3OTCA 4IUFA 2UV8G 1S0VA 5GVQA 2V94A 3V81A 3TX8A 2UVRA 2HVHA 3QMQA 3L7UA 3LAKA 4RZRA 2MZRA 2JLEA 1IKWA 1R8HA 4PYAA 2VZ9A 3EXYA 4MTPA 4I68A 4CH1A 3LWLA 1L3KA 1RBAA 2CZ9A 4TNOA 5B0BA 2R7RA 4DV1J 2IVFB 4DV3J 4FXDA 1DRZA 4KE5A 1K0TA 4PCQA 1DLOA 3GONA 4C0HA 3EPGA 4KHMA 4OI0A 2DNQA 2LQJA 1DTTB 1YJTA 2GVDA 1OWXA 4ZVPB 1FK9A 3JAMY 5K8MA 1X7VA 2CQHA 2D69A 4EEYA 3MHYA 3WDOA 2ZBCA 5ETTA 3KLFA 1RAFB 3BQ2A 1RYRA 2Q1LA 4F0HA 2BABA 1WOOA 2HNZA 1LK7A 1KC8T 2LQ5A 4C97A 4NLSA 1YZ6A 2YNIA 2IC3B 4QR1A 3BO4A 2C22A 2RUGA 5DG7A 2XM3A 1I94F 1FI4A 5G4DA 5IOLA 5B0EA 2CVEA 2DGUA 5KFQA 4OLOA 1NJZA 2B7CB 1X9WA 3DMJB 3HHLB 1GMWD 1RU2A 2ZWOA 2WVFA 4JV5J 2H65B 4WU3A 1MMNA 5EHHA 2ALZA 1U6BA 2CQ3A 2PMHA 4ILLA 2D74B 1VC5A 1NXIA 3IGVA 2GIFA 1GMVA 3VALA 2A0FB 3C14B 1K44A 2R2TA 4MK7A 4NYOA 3ZZPA 4DWIA 2OPRA 2RKIB 3D1QA 3W2WA 2BQUA 3S01A 2ZJRQ 1QTMA 4RNNA 2C3MA 3M2VB 5KFYA 4ZCIA 3JS9A 3O44A 2RUSA 4RLEA 2DR8A 1R8PA 4NXNJ 5GAGU 4B3RF 1P9QC 2Q43A 2VC1A 3IBFB 4LIWA 4OYZA 3OFFA 4BLGA 3GSIA 5HQ8A 2HS4A 3BM7A 4KFBB 4OYMA 2RRBA 2O5DA 4EMDA 4K4VA 3GP9A 1UEKA 2KXFA 1BUXA 1G3OA 1RJJA 2Z57B 1S59A 3H2UB 3K89A 4G65A 4DMZA 3MCNA 2AQ4A 2B9YA 2H3EB 2HG4A 3ADAC 4B9TA 2FIUA 4DFJA 1FK9B 2V2ZA 1TKTB 1REGX 1DURA 2DGOA 4E8UA 3J7YI 1AUDA 2M7SA 2YPZA 1YK9A 3FMBA 1LWCA 4OYXA 2FHOB 2YKNA 2B0GA 2RF2B 1JB0C 2NZCA 1RP5A 2HK3A 3R5DA 2P9GA 3TAPA 1F9HA 5ETOA 1O6XA 1F5BA 2DRDA 3M8WA 4O3OA 8RUCA 4ECVA 2LEPA 5D3GB 2VKRA 3TZYA 2ZM6J 1YJ9S 4YOEA 6FD1A 3LP1B 3RW6A 2OHDA 2EFGA 4DOZA 2FVQA 4DR6J 3A8KA 5HMYA 2ZE2A 1NK4A 3W9IA 4GC6A 3PY8A 3TANA 3EZUA 2Y1IA 1WC6A 4DHVA 1SL2A 1S1VA 4ELUA 2F8MA 5E7OB 2X51A 5KT5A 4DL4A 4QYRA 3EZ5A 4U8YA 4B3TF 4DSLA 2GGPA 1ZA2B 3IM9A 1Q8KA 2GS8A 2NXNA 3POTB 3EXCX 4HI1A 3E2EA 5ETMA 5IQQA 2YH0A 1BQXA 1T7PA 2HHUA 3E01A 2MKJA 3QQCD 2NSBA 3FGVA 1VC6A 3NMRA 2Q66A 1NKCA 5FDLA 1AROP 3UCUP 1F0XA 2RT3A 2F9JA 3R6GB 3M8QB 4DR1F 5LXYA 2XY6A 3O3LA 4HHUA 4AFFA 3HVRA 3GWCA 1FO1A 1V6HA 1KHWA 2CJXB 3ZFVA 1S5ZA 1S7HA 7AT1B 4JP8A 4ZLPA 3MAQA 1UVKA 1P1LA 1SL0A 4OV1A 3S7RA 1WI6A 1RCOB 1NJIT 4DZ6A 3W61A 2B51A 2DGQA 1T05B 1B3TA 4CLPA 2VH7A 3CC4S 4AXJA 4ER8A 3VVUA 4P7TA 4PG4A 1FKOA 2V8DA 4ED1A 1CULB 1VK8A 2BE7D 2W4DA 3B4DA 2V4QA 3KMSA 3UE2A 4DX8H 1VYAA 5HBMA 1FRIA 5GADU 3T6BA 1KFDA 2EFOA 2WBRA 2YX7A 5J2QB 2BBEA 2M9KA 4UY8T 4PWDB 1GXTA 4JI6J 2VA3A 3WIVA 1JMTA 2MZSA 1BQMA 1IQZA 2ZBQA 3M05A 2HIQA 3PZPA 1L3VA 1MROB 1U0HA 1HL6A 3EE3A 5HLFB 4WFYA 4ECXA 3KUGA 2ASJA 1T9UA 4OX7A 4V1Ak 2QX0A 4LSNA 4NI2B 1IKVA 2ZDOA 5I42B 1UW4A 4USIA 2HFZA 4RW7B 3D1OA 1S48A 3NLCA 3PR4A 3R9LA 3GFYA 2VJUA 1TP7A 3DM2B 1U6FA 2FHMA 2QTWA 4RW8B 4RU2A 2P6SA 1CPZA 1C0UA 4ZVRB 1KVJA 4HR2A 2V8GA 2XYPB 3DOKA 1JK9B 3CO9A 2C2EA 4F26A 2H4YB 2V9WA 4Q0BA 4CO3A 4R25A 1U48A 4ZVUB 1QM9A 3CB4A 3BGFA 3R7BB 4YDDB 3PVXA 5BXIA 2F7VA 2HMIB 3JQJA 4PPDA 2X1FA 2JHEA 5D15A 4EUVA 1JLFA 4DEZA 3B8HA 5KTQA 3CJ3A 4A8KA 1FXDA 4PABA 1HBMA 1TUGB 4B08A 4RNHA 2UVWA 3TAMB 5KOWA 3VZIA 4ES1A 1S49A 3DI6B 1FCAA 2F9DA 2VPXB 3CNQP 1MMDA 1NJXA 2GVZA 3BGOP 3HLUA 5ITHA 5HMZA 1EQMA 2CNOB 2XHWA 3M4XA 2BOPA 3W60A 1OIAA 2H5JB 5KFVA 4ETZA 3KLEA 4ZPCA 1RWVB 2C3UA 4WZQA 2HFUA 4RPFA 4CTAA 1RT7B 2CFXA 2CDQA 1T8EA 3TEGA 4OLPA 5T41A 1QSLA 3QWPA 3UN2A 1RTIA 2BKPA 3NY0A 2RU9A 1RT3B 4CLFA 2YNHA 4DU8A 5KFEA 3TQ1A 2UUAF 4IQMA 3IA0A 1IR2A 3K5OA 4P74A 2AJQA 4X4TA 1DBDA 2PDAA 2NPIA 5JVHQ 4KAIA 1VJWA 3M1VA 2B8QA 1G4CA 1IR0A 2V4JB 3RYLA 3TO8A 1HBNA 4WJBA 2JL9A 4FS2A 3I32A 1E6VB 3HHEA 5AE3A 2O01C 4Z2XA 2KT5A 1U25A 2UUCF 2CPDA 4QQBA 1CJUB 1QTNB 3SYZA 4AYBD 4F4WA 4ZCMA 1WKLA 4Q45A 3JSMB 1TU0B 2PO4A 1XQIA 3KLFB 5I3PA 5LSLA 4KT0C 1VCTA 2F3JA 2DXEA 3GE9A 2LXFA 3C14A 3RRKA 1MMLA 2IM1A 4C0OC 2YPYA 2HNYB 4LSLA 1LWEB 3NOGA 5KT2A 3OLAA 2MPUA 3G82A 4WPAA 3ZO7A 5K8NA 1SQGA 2HW3A 2WW4A 2ZH5A 3VF0B 4G1PA 1LW0A 1J27A 3FEZA 4KC5A 5A8WA 3CCES 2DTJA 2FGCA 3IGNA 3R5AA 3Q8YA 4NPOA 4ELTA 3GFZA 2C2NA 3Q2SC 4DR3J 2FY1A 2QSFA 1QLNA 1YDLA 1KBRA 3NAHA 1UW9A 5J1EA 4G6VB 1YJ7A 2A18A 2AJFE 3IG1A 2UXCJ 2R7OA 1F5CA 4A8FA 1QE1A 2CWXA 2MJUA 2MDAA 3DC2A 2IJRA 2DNNA 2CQ2A 3MM6A 4I2PB 3F73A 2EC0A 1P27B 4ECTA 5A0YB 1RTHB 1D8YA 4K7QA 4WU2A 5DM7Q 1KD1T 2W7OA 3MM8A 1O51A 3HMJG 3HO1A 1RUSA 1N5VA 2KJWA 4K59A 5DDRC 1Y5IB 4Y6IA 4ED8A 5B0FA 2QFJA 4F3OA 1HWIA 5KFKA 4ED3A 3U1LA 3OJUA 2UXCF 1CSJA 1X4GA 4MKAA 2NREA 2XG8A 3FSXA 4HYKA 3IFEA 2ASLA 3QJPA 1CJUA 1WDDA 2ZDPA 1F3FA 4X64J 4FKYA 1HHQA 3DU5A 1VMBA 1U4BA 1XTZA 1FDNA 3JTPA 3PTWA 2V4RA 1HQUB 4LUBA 2PGCA 1SH0A 2UU9J 1H3DA 3JQMA 4I0WA 1IR1A 2JDJA 3PFEA 2K8GA 2DNLA 1O0PA 3GIIA 1FRKA 4UUXA 3UN3A 4KH1B 2KXNB 1UVMA 1IM6A 2AD9A 4MKYA 3H20A 1J5EF 1XR6A 2PIIA 3H2LA 3LP1A 1R0AB 4K5SA 4LRFA 5CAAA 5C42B 2AV5A 2YY3A 2JEIA 2GZOA 2XS5A 2D7SA 3F56A 3M32A 2BANB 3R5JB 5BR8F 4H4KA 3SMZA 2ZZTA 2MTLA 1N54B 3EVOA 5J2MB 3KJVA 2WSFC 2QEXS 1OPIA 3IAM9 4ICLB 2Z2ZA 4I2QB 2ZHAA 5LSRA 4J7CA 2G1HA 3UVJA 2H5EA 2IYIA 3C15B 4NYPA 2AF6A 4X62J 4DR2F 2XTDA 3T19A 3KK1A 2BQ3A 1M5KC 3R6LB 2K7JA 3GIRA 2KB2A 1WC0A 2P9CA 3AJ1A 3BYRA 4A8OA 2H54B 2HPUA 2DHHA 2LQBA 5B0DA 4JI1J 4C8YA 3GZ7A 2GX8A 4JI6F 4WYLA 3Q2TC 4DV4F 2W7AA 3OV7A 4DUYF 4QZVB 1C1BB 1IBLF 1YKWA 1TKZB 2XTEA 3EPIA 1DARA 1PAEX 2XY7A 1SJQA 2KYXA 3KLIA 4NLVA 4A47A 3UNGC 3J7ZT 3MOJB 4MIAA 4WP3A 4DU7A 2BUNA 4I56A 5CCMA 4NLTA 1QY7A 3GG1A 3L7PA 3K59A 4ECWA 3PKYA 2W9BA 1N34F 3OTEA 2YWKA 5ETLA 5CYQA 5HATA 4KGKA 1D0EA 3A1YG 4QR2A 2NXJA 3MTJA 4ID8A 1KTQA 3RRGA 2XSFA 3TZXA 4ZPDA 3HCXA 3FCHA 2ZH4A 2OTJS 4DCOB 4PUOB 1RT1A 2EFVA 2IA6A 4DQPA 1S6QA 3BO3A 2RRNA 3IC1A 4N56A 1UVIA 2AX1A 3H90A 5KOXA 2YX4A 1FKPA 3L7OA 1NB2A 2OEKA 2NPFA 1Y5LB 1S10A 1JLBB 2AGPA 4FYXB 4YB1P 1PJ5A 2HGLA 2Z30B 3X3UA 1SQFA 2NCKL 4LFCJ 2V6AA 3E8OA 4ZA1A 4KQZA 2G0IA 3I31A 1Q7YT 3PEJA 2CQGA 1R0BG 2OD6A 3NGUA 1GQEA 4B3OA 3OVSA 3G2XA 2ZUAA 3DGPB 2HIYA 1PKUA 4H4MB 4JI7J 2YNIB 1QAJA 3RRHA 1WTFA 2VFRA 2ILYA 1TV6B 3A13A 4OHVA 4E98A 1JXLA 4LBHA 3ZTOA 2OMOA 4DPTA 1P8GA 3DLEA 3CD0A 2BOAA 4YP3A 4RNFA 5AT1B 1WF2A 2LP4A 4UQGA 1U1MA 4IDKB 1G7CB 4MFBA 1M5VC 3ONQA 1HBUB 5DG9A 5LMNJ 4NCGA 3OHAA 4B9NA 1UJ5A 3ZNUA 4QOTA 4WCEQ 3PIPQ 4IOCQ 2RQKA 2CUYA 2XC9A 3MUVP 3MEGB 5GMEA 2F63A 3UDVA 1UVNA 1WKJA 1QDUB 2NLWA 3CTRA 4TLRA 5D4PA 3FUYA 1WF0A 1DQ9A 1KTVA 1SC3B 2MEWA 4DL2A 2UUBJ 1NAQA 3A8IA 5HANA 1NK9A 2RDJA 1EHWA 5IV3A 2HHHJ 1WELA 4LT6A 5A8KB 1DFDA 1JLAA 1YJUA 4IRCA 4DQIA 1WSVA 3QNWB 1RZMA 2L48A 4QBUA 1EETA 2R7TA 2HBRB 3BV8A 3J7A1 3HD2A 2OTLS 1B7FA 3GCXP 4YR2A 5FIIA 1FDDA 3J81U 3IS9B 4AQYJ 5KFAA 2LLZA 3TI0A 3R3TA 1XC9A 4OJGA 5L38A 2XZTB 3B4MA 2ZNYA 5ETRA 1S4EA 2DRAA 3H5SA 1JLCA 2W9AA 3A3PB 4DPUA 1LW2B 3BPDA 4IRKA 2RB7A 5F0WA 3PKMA 4WBFA 4LFAJ 2B6AB 1HD1A 2CQPA 1TUWA 5M2PA 3Q8QB 2IMOA 1CJTA 2OFGX 1U24A 3TJ8A 2UVUA 2K06A 2WK4A 1SPBP 1S1TA 4DQQA 3DN9A 3MOZA 1UTAA 4L6V3 2ZD1B 3W64A 3O6QA 3C66A 3J81j 1XMOF 3G86A 2V68A 3GV5B 2ZC3A 4C8KA 2BE2B 3RAQA 2DH7A 4NMXA 1SJ1A 2ABYA 4M95A 2C2KB 4ZIVA 1PCAA 1YJRA 1M0SA 4K4XA 2A2DA 2WZ1A 4KV8A 4UOFA 2A6OA 1W2IA 3PYEA 2DHXA 2JC1A 5KG1A 2Y9HA 1UCNA 1VK3A 1WEYA 1KN6A 2BVZA 4M5DB 2ZHBA 3AB2B 4NE9C 1K9MT 2KU7A 5D0HA 2AGOA 4NYZA 3GJSB 1HQ2A 3VWSA 4DG1A 2D68A 3EVWA 1PYTA 3W66A 3CMAS 4EO6A 2RS2A 2HKEA 2OAUA 2XYHB 4DQRA 2XMTA 3THPA 3QSYB 4YUDA 2B9WA 4ZP8A 3HJVA 4M5GA 2APOA 1WHXA 4F2SA 4LF9F 3NEKA 2E66A 3K5NA 4EBEA 3OTBA 1BLUA 2CIMA 4ILRA 1TL7B 4RNMA 3MFHA 5LMUF 3FVYA 2AJ0A 2HVDA 2EFPA 2AU0A 1I3OB 3H5XA 3W5XA 3EM1A 5F8JA 4TYAA 4UF4A 2EBGA 2B7BB 1KEKA 4FS1A 1J5EJ 5KT6A 1HI0P 5HVHA 3ZTSA 3CDWA 4FYVB 2J0WA 1TKZA 4CM0A 5E5NA 5C25B 1TL4A 4O3NA 5BR8J 3MM5A 4WKYA 2P8IA 4IRDA 2N4CA 5D0EA 2AMCB 4WK3A 3UR3C 3RUBL 3NAIA 3LAMA 3TVYA 3HULA 3BN4A 2VBXA 3CT9A 3E3XA 4OHWA 2J0SD 3TUJC 4X4UA 3KG0A 5EUHA 1UA0A 5LMUJ 3KLHB 1RWUA 3V6KA 1WHYA 3N79A 4J9SA 4XIUA 2G9OA 4IH5A 2IAJA 3KG1A 4TLQA 3EMTA 4KFBA 4BCAA 1EP4A 4A8XA 2ZH2A 2XCPA 3P3DA 4YN3B 3NBPB 2Z2MA 1VJQA 2O66A 1RXOB 3HKWA 4OYOA 5DGBA 2K3KA 2QA4S 1FDAA 4D3HA 3C15A 3R1HA 3LW5C 2VOPA 4JI0F 3DM2A 3E01B 4X4RA 2HS3A 3MM9B 5HK4A 2R8IA 2VDIA 1M5SA 1JNZB 4NA1A 2V8PA 4M63A 4JI3J 1U7LA 4NZ6A 3D28A 1YZ7A 3K57A 2HHXA 3LTOA 1LWXA 3PYDA 4F7VA 1NK8A 3CMES 1T3OA 2YNFB 3MECA 1LWFB 2VQEF 2NUHA 2B9EA 4FYYB 4ZPBA 1N5QA 4LF2A 4EU0A 3G6XA 4M5IA 4TQRA 3DHXA 2FZGB 6AT1B 1RSCA 2F8EX 2MSSA 1N52B 4DR7J 1TK8A 2IA0A 2LDIA 3TA2A 1ZM9A 1B64A 1HD0A 4A4JA 2EC2A 3L9ZA 2BM1A 4DXLA 3KDNA 4E0DA 3MMBB 4K2XA 3DGVA 3I5BA 2OPPA 3FC9A 5CYMB 9RUBA 3CPWR 1LV5A 1WJ9A 4LF5J 1X4HA 4OYAA 4DR4F 3CJ5A 3CCQS 2DITA 4DV7F 3US5A 1T9TA 1G2EA 2CZ4A 1B70B 3T1HF 2WVEA 3PJ9A 1UPMB 2W1BA 3VAIA 1XR5A 5KFOA 1HNZF 2YX1A 1ICEB 2HEKA 3T9NA 2ROPA 3KOAA 2BMBA 1N5YB 2OP5A 1N0UA 5A0YA 3D4JA 2V1SA 2J9EA 1SXLA 4NOHA 4AL5A 3BF4A 2IVYA 2M70A 3KK2A 3AFGA 3D5MA 5HLFA 1RT4A 4M5HA 1VRTA 3DLGA 5K5MA 4OV6A 3L3CA 4B9LA 1AXQA 2I38A 2V2QA 4DUZF 1N33J 3VR1A 4N47A 3CJKA 4AXIA 4ED0A 2JX2A 1NK0A 2B4OA 2HBQB 4I69A 3EGNA 4ZVQB 2N3LA 2D9OA 3C6TA 1R8AA 2JC0A 3FQKA 5AXMA 4DR1J 1H72C 4UZCA 2ZJPQ 4IR1A 1HNZJ 4YS2A 3N5BA 3WQPA 1FRMA 5DZ6A 2MHNA 1RAEB 2D3O1 3CDEA 1PIEA 1B0PA 3ETMA 2KT2A 3H98A 2K2PA 4BHQA 2P9EA 3OD2A 1NKBA 4C3LA 2FVPA 4F4XA 3QZ7A 5U47A 4J9NA 4A8QA 2XS7A 1FJGF 4RW6A 2LKZA 4RUBA 1JKHB 1CQMA 2G0CA 4C11A 2Y8WA 1DTQB 1HWKA 2DNHA 4WWSA 1A9NB 1LWEA 4LF4F 3RB6A 5DG8A 1U1PA 2FLPA 1OQ3A 1Z1ZA 4Z37A 2E1PA 3E51A 3M2UA 4LF7F 1A6LA 3T1YJ 4B02A 2H1YA 2OSRA 2VPYB 4ZJOA 3W1YC 3KHLA 4J9KA 2R8JA 2XLIA 5JXSA 5EWGA 2V2KA 2R8HA 3OFHA 3HVTB 5CZVA 5CZXA 4IFYB 5E41A 3Q24A 4V19J 5KFFA 2HBYB 5I3QA 1VQOS 1NH8A 1SUQA 3KJQB 4WXWA 1FXLA 2ACYA 2MLYA 4XAKA 2E1MC 4X65J 1X4BA 2KVQE 4F36A 2PSZA 4J37A 5HP1B 2NXCA 2UUAJ 2ZC4A 5H1SV 1RT3A 1S0NA 4OJHA 4DPWA 3PW2A 1TFWA 4B3RJ 4ELVA 1X4CA 1JJCB 1RHQB 3MPWA 1SVDA 3VGSA 2F1FA 4FBUA 3FBCA 3HX9A 4PAAA 5JVGQ 1K73T 1CG2A 4B9SA 4USJC 2GAHC 4CI0B 3R7SB 4LF7J 3H0PA 5C2CA 3MR2A 3BH6B 4LQ3A 4Q8FA 2XWXA 3SDEB 3J80U 1L3SA 1OY9A 2PD1A 2XMJA 4NLQA 2B6AA 1S1XA 2ZH9A 5DGAA 4KR0B 3ET6A 1OM2A 1Q4RA 1X9SA 5KG7A 5L9NA 4HKQA 4OX8A 2Z56B 1SI9A 2I5JA 1S79A 3BQ1A 1T03B 4Q8EA 4NLUA 3AXMA 4MK9A 2NSCA 2R7WA 3N4WA 4WK1A 5D8HB 2HHVA 3OR1B 2FC9A 1FHTA 1BE4A 3CC2S 3GJTB 3H4DA 4NXMF 3J81Y 2M8HA 3TOQA 4LF8F 2V50A 2ZVIA 2KJVA 4B3MF 1LOUA 5LJ5Y 3ZZZA 4K4YA 5B09A 5DLFA 1M1KT 4ANDA 2DCLA 4DSFA 1FE0A 3PW0A 4LF1A 3DDKA 1NK5A 3UN5A 3VGUA 4NXNF 4ED5A 4WF9Q 5KFDA 1OJ4A 4ATNA 1SH3A 1NHUA 3QFWA 1NHKL 4WE1B 4F04B 3PW7A 1CJKA 2XNQA 4HT5A 1CC8A 3IMQJ 4JI2J 3MMAA 1AYEA 3AWRA 1I51B 1YRXA 4W98A 3K5MA 1WC3A 3QT5A 3GMGA 1U1QA 2QL7B 3NNCA 3BPSP 4FF2A 2PT0A 2M0GB 3W65A 3W3SA 3AX2A 2HHTA 3CJRA 1OMSA 1VI7A 1JLEB 5ETKA 2FGOA 1IBMF 1CC7A 1LNQA 3ISNC 1FRXA 3NGKA 2D3ZA 4WFNQ 4P2SA 2BRKA 4JYAJ 1PBUA 2QFIA 2FD2A 1VS3A 4Y2CA 1N5SA 3MD3A 5IV4A 3Q8SB 1DHMA 4K4ZA 3NG8A 1RACB 4K50A 3MR3A 4TKTA 1N56A 3MM5B 1HBUA 1R43A 2RVJA 1SCJB 2V4JA 2FHJD 1EJ7L 5MAOA 3A12A 3HPOA 3R97A 3CCRS 1JLGA 2ASYA 1VFJA 3AB4B 3TZZA 5L1JA 1PC4A 3W62A 2ZH3A 4K4SA 3OVAA 1QSSA 4EBCA 4QU6A 3FBFA 5D0RA 5HROB 1Y3KA 2HLTA 4CO1A 5LSOA 3Q8RB 2CJ9A 4KH0B 2YWGA 1HNIB 5J1EB 3UD5A 3P45B 5IM0A 1SJ3P 2ZOMA 3WC2A 4NA3A 1N5YA 3MXHP 4C3KA 2GVDB 1X60A 2OLWA 3BBBA 3LP2A 4B3TJ 2MQMA 3FCWA 3KTQA 3NNHA 4WE1A 2Z8QA 3PV8A 4ETXA 1U1OA 2M5YA 1WUUA 4FPRA 3L4BC 4X4SA 3J7Z5 2XTCA 2LEAA 2F5GA 4ICLA 3OUYA 5F8NA 2E1AA 4DR5F 4P75A 1JWWA 3VQTA 1IBKF 1FNXH 4OFZA 4GKJJ 4OX6A 4P7VA 3OXGA 4U8VA 3BDPA 3KK3B 3I5CA 3MR6A 1MG7A 1J5OB 2HSEB 3KG4A 1WHWA 4USVA 4Q0BB 4HTJA 4MJKA 2NXEA 4YHHJ 1AT1B 2YNFA 3N28A 3CCVS 1RWOB 5D6GA 4X66F 3QYYA 2PMWA 1IWGA 2VV5A 3MAAB 1HW8A 4FPIA 1KQKA 2KXHA 4UOGA 3HI9A 4C2MA 5AE1A 4NCBA 2OPRB 1KVKA 4DSIA 4UZBA 1KNZA 1GH8A 1WC5A 1ACMB 2BJ1A 1HNVA 4YEAA 4F0KA 5KG6A 1KR4A 2QA4G 2MLZA 2XI2A 4TU8A 5L8RC 3CJTA 1R31A 2DIUA 1UEVA 2GIQA 2RE1A 3OR2B 1DY3A 3ZNJ1 1RAIB 1TK5A 4FNIA 4WKRA 3X1LB 1TELA 3FJ2A 4TY9A 1YG0A 4DN9A 4ZVSB 1WORA 1T9YA 1Y11A 4M94A 1CS4A 4RW4B 3KK1B 3K0JA 4X62F 2XWYA 1BXNA 2CQ4A 2VFVA 3NCRA 2IHR1 3BREA 4RNOA 2YWHA 3T1YF 4KSEB 3C6UB 1KRPA 1FX2A 4JI1F 3K5LA 3JTNA 3VAJA 2JSXA 4TXSA 3RB4A 5KFGA 3QT6A 3CE8A 3O8WA 1UWAA 4R0EA 4IOBA 5E3CA 1NUEA 4OHXA 1IKXA 2GMJA 4OZNA 5D3GA 1IKYA 2P6TA 4MT1A 3CWJA 3KK3A 3T41A 1ZH5A 5DO2A 4KHPJ 1R27B 1WG5A 1OSDA 2V8HA 5DDQC 2AYGA 4DX6A 1UJ6A 1WG1A 2K3IA 2QA1A 2LCWA 4WP8A 3PX0A 5EX3A 2I2YA 4WIIA 3H40A 2A1BA 3FBBA 2QJ3A 3G8QA 3GG0A 4F8RA 4R5PA 2HQ3A 2PEBA 4K8RA 5L39A 2QGFB 4F4AA 3V6DB 2H5IB 2JOQA 4KO0B 4QWAA 1I6JA 2HAFA 3MF5A 2QT7A 5HP1A 2XI3A 1Q5YA 3O2IA 3Q8UA 3CGIA 1UFKA 5GADI 3OPKA 3HHDA 3D67A 5CHCB 1G6BA 1RHRB 1S4FA 3RZAA 3M2RA 3UW1A 1WEZA 2IFXA 1HNXJ 4QPXA 1OO0B 3TYTA 2HK2A 2VDHA 2CJBA 3AD8C 3FQLA 1GT8A 1P1TA 1QE1B 1S1UA 2JWNA 2V67A 3GLJA 3N01A 4MYTA 5F0UA 3KXDA 1FX4A 1SH2A 3M8QA 4CDIA 5C24B 2R8GA 1EIYB 2MZTA 1NDKA 3ENAA 3TUZC 2RDDA 4I7FB 2HZCA 2QE5A 3N6MA 4N77A 1M5HA 3QZ8A 1M5OC 1RTHA 1Y00A 3H25A 2PFDA 1FJCA 5CH7B 3HFVA 2W9CA 3MMBA 1NEEA 3OW2R 3H8YA 1HQEA 2DK2A 3CF5Q 3BGRA 3CD5A 2QLWA 2IC3A 1AZSA 3DGPA 1WKKA 2E7WA 4OZ2A 3I0RB 3OTOF 2QYCA 1X31C 5KG0A 5IC6B 2P2CB 4HVZA 2W8LA 2L9DA 4RR5A 5LMNF 1TV6A 2B9XA 1W2BR 1HPZA 2AHOB 2W2MP 1NCLA 3MEDA 3MTKA 2YNGA 2GQQA 4LVNP 3HT0A 4PWDA 1MU2B 3AX3A 4I67A 4XTTA 4O3SA 1OQ6A 1TVRA 1HQUA 5K8PA 2RHSB 1YQHA 1HNWF 1VRTB 3DLGB 1K8AT 1H7XA 2VASA 3ISZA 3ZTPA 1VBKA 1VBYA 2XS2A 1ZOTA 5K20B 4JYAF 3W9HA 2E1CA 2HHSA 2GW8A 2KRBA 3MPUB 3QGHA 3M30B 4YR0A 3MR5A 1KOOA 2UUBF 4ZVEA 3HKZD 4CYUB 2HWHA 2HHHF 4LSNB 4NI2A 1N48A 4LVOP 2BZ2A 2DB1A 1VHIA 3H5YA 3LP2B 1RWNB 3ZZYA 2XSJB 3QGPA 5C42A 3AT1B 3FRYA 2FHJA 2RQMA 4NLDA 1WOSA 2YWEA 2DXFA 2BW7A 2E9RX 2DR6A 2CPIA 2JFKA 3P96A 5CQGA 5M2RA 3V5RA 4RW9A 2HGNA 2MYFA 2PA8D 2AT1B 2DGTA 2DPIA 4AL7A 2W01A 1HNWJ 2XO6A 2IM0A 2E7XA 1U2RA 1UP1A 2HWIA 4P71A 4UOHA 3RBZA 3D66A 3W8GA 3RR7A 2FQQB 2QLXA 2VG7B 3DRRB 4I6AA 3I5AA 3CDBA 3IXQA 2MKIA 3KJFB 2UVVA 2QIFA 3V2UC 1TFYA 2VUGA 4DX5A 1HBMB 1T11A 3KNAA 3OBIA 3HVTA 1TKXB 2R7XA 1RHJB 3MM7A 1AZSB 3AQOA 3V6JA 2KFNA 3RR8A 3PYFA 2MZJA 1U47A 1LW2A 1JQGA 1VIOA 2GHVC 4KGXB 3MUMP 2E5HA 4USWA 1VQ6S 3T5LA 2IRYA 2CG4A 4OYPA 1VQ7S 2E5JA 5KFMA 1NRKA 2EEYA 4J5OA 2FJXA 3AH6A 4P2MA 4UY85 5HQMA 2I6WA 1RAGB 1U8WA 5LXRA 3UNYA 5BYQA 4CM2A 4PQUB 2B5JA 2RS8A 2B4UA 2ZM6F 1EARA 1QVFR 1RYSA 1S1WB 4EZ6A 2VG5B 3IBCB 3C6TB 1WF1A 2W2NP 3D3BJ 3FZ2A 3AOCA 3SIPB 2VPWB 3DRPA 3U02A 3D6TB 3QAUA 4DR2J 1HHSA 4AD6A 1RA7A 2XGPA 4BBYA 1GNKA 1XEZA 3FMWA 3SCJE 2W7PA 2YQ1A 4FXWA 4DN0A 1FNMA 3A3OB 2QLJB 5HQLA 5K14B 1WDTA 1I5OB 5IXUA 2GFFA 2MKKA 3PXGa 3R1LA 3FEXB 1PGZA 4LSLB 3NCQA 2CAJA 4JI4F 3N0VA 3CIMA 3O5TB 3DOMB 3U27A 3S1TA 4IG3B 1NMEB 2RU3A 3MUTP 1C1CB 3NXZA 1ZZNA 3MM7B 1F6TA 3PHEA 5F8LA 2GC8A 3EX7B 3MMAB 1TL1B 2VU5A 2YKOA 1PO6A 2KFZA 2LDYA 3DLLQ 5KFZA 5J2QA 1FD2A 2H4WB 3D1HA 1V5IB 4Y2MA 1KFSA 2HAIA 4I6WA 2G2YA 3A4TA 3DXSX 4HL9A 1H7WA 1B7YB 3PW4A 2CJQA 1U1NA 4Q5VA 3G9CA 2VL1A 1H38A 3MM6B 1ZAXA 3KUEA 4FNHA 1NSPA 4N41A 2Z4PA 3H59A 1X4AA 4L76A 4JI4J 3S6EA 3Q22A 4YFUA 2J9CA 3BZQA 1M1HA 4LRCA 1QJHA 2BJ8A 1LXNA 2VG6A 5EDWA 2IMWP 3SSSA 2G2ZA 3WIUA 3SFUA 2OH2A 1Q53A 2MZQA 1YSJA 2HRYA 4YMEA 2R2UA 3VZHA 4NA2A 1WTBA 2C2MB 1XNQJ 2XYGB 3AD7C 4P2XA 1DTTA 2FHKA 1RT2A 5HMWA 5EWEA 3AA8A 4QW9A 3SZ2A 3D6MB 4OI6A 4M5MA 3ILJA 3M6WA 3EGWB 1RK8A 1KP6A 2G2OA 4NLRA 4IH7A 3ZXWA 5HROA 3ENVA 1JLQB 5FLXY 2AP6A 1K1QA 2BQRA 4ECRA 3LO3A 2JEFA 4JI8J 1U2FA 3GJRB 4URSA 2AZ1A 3TJ9A 4J9LA 4ZKAA 1H2TZ 2R9LA 2E5LF 3DYAA 3K8VA 3QSIA 3D7SB 3UD3P 4UQTA 1IM4A 4XK8C 1YI2S 2F4VF 3M6UA 2ILZA 1YHQS 3HK2A 1LFPA 3KKFA 4IFVA 4QIGA 1Q8LA 4USKA 5CYJA 5F9NA 1Z2LA 2BYCA 2KZMA 3MDFA 2FY8A 2BR0A 1PG5B 1FVSA 1NPPA 2LQ9A 2R4FA 3MMCB 3NL0A 3IRXA 4TU9A 2KFYA 5IWAJ 3R7NB 3D3CJ 1PYOB 3W5ZA 3SBMA 3VVTA 1DZ5A 2BE2A 1TL1A 2Q6BA 3KNGA 3D6FB 3I55S 2F8HA 4C98A 3IN5A 3RBDA 4DL6A 4X84A 4USHA 1X5PA 1YVFA 4L75A 3KJVB 4A8YA 5KFNA 3TVZA 3WX4A 5LT5A 1RHUB 4OYWA 4RO0A 1FRLA 1VHFA 5KFJA 3OTOJ 1X0FA 3J7AN 2FZKB 1U09A 3BN7A 2BJ7A 3NKYA 1TL5A 5D0GA 2KH9A 3KK2B 2VQFJ 2YKNB 4LSZB 3CDUA 4XDCA 3MPVA 1YIJS 1RADB 1VIXA 5IWAF 2BV3A 3FSYA 4FZVA 4KRWA 2ACMA 2R7QA 5F3TA 1KKHA 2DH9A 4YR3A 5L1IA 1S9FA 4DSJA 5C24A 1LQ9A 1OY8A 1TAQA 3HSDA 1V3ZA 5IT9Y 2Y3YA 2R42A 5GAHI 4QR0A 3ZZTA 2CQBA 3DNCA 1D9FA 3TR5A 3G87A 4OZ1A 4C6AA 4O3QA 2MQOA 5K9FA 3M2UB 3CJ2A 1NSQA 4RU9A 3AHPA 3HSGA 2JEGA 1HQEB 2OEMA 1IBCB 2D1CA 3OFGA 4KYZA 2QSWA 5C25A 1REVB 4Y0FA 2UXDJ 1S9EA 1MSWD 4K4TA 4IFYA 2DNGA 2OJ3A 3M30A 2LFVA 4ID5B 1SKSA 2XZ2A 2XB2D 1JKHA 1DLOB 2UUCJ 1S6QB 1NZAA 2JLFA 2XLJA 3IR6B 4I64A 1VC0A 1FVQA 5J2PB 5FJ4A 1Q7LB 2HHPA 1BQMB 1W26A 2CZVC 2HFSA 2IRXA 3TWZA 4NRUA 1XWLA 2XCAA 2JLGA 5HN0A 1U2CA 4C8ZA 5KFIA 1TTHB 2W4CA 5AJ3F 1Q8BA 1O5JA 2M88A 3VGTA 2CKWA 2VKZG 2CNKB 3G8TA 3GIKA 4LBPA 2HNZB 2CQDA 2HQIA 3KMQA 3B82A 1VQ4S 2BA9A 4H4MA 4GKKJ 2A3JA 3BJYA 2DGXA 3FKBA 1SV5A 2GGPB 3P49B 4A8WA 1N4LA 1QSYA 2F65A 3I4HX 2QV6A 4FDFA 1ZYQA 2MLXA 5KG3A 2EK1A 3MM9A 1SL1A 5H9EJ 5T7LB 3IBWA 3GIMA 4DS4A 3RG6A 3ZTRA 4QW8A 2BW2A 3OR1A 3ZZUA 3G4SS 5A8RB 2VIHA 2DY1A 3KHGA 1RTJB 1HI8A 4EYHB 4QU7A 1NDLA 1SC1B 1X5OA 3B6BA 4PG8A 4NXMJ 3BH7B 4ZN1A 2FLOA 3I4PA 2O3DA 3ET6B 2RIJA 2RKIA 3W2WB 3MEGA 5IFMA 2Q6CA 4NCAA 3LOUA 4WP9A 1YBAA 2DNOA 3W5YA 1B0TA 2XNRA 1U1RA 1XR7A 5J2NB 4ECSA 4X2BA 1EQ0A 3BR8A 1IUJA 2UUWA 5HVGA 1Q86T 2XBPA 4DJBA 3AOAA 4L3KA 5ETQA 3SXLA 3CIZA 2K1RA 3M8PA 4RBUA 2UUTA 1S7IA 4A8MP 4QIVA 1FA0A 2VJVA 2C28A 2BM0A 1Q81T 1ZM3A 4ZIWA 5E3RA 2D3OR 2FZCB 2DKOB 2F4FA 1EAYC 3JTOA 5IQ6A 3BB5A 5KFBA 2PC6A 1HNXF 2ZBPA 3LGMA 2V2VA 2OPQA 3ITHA 4XO0A 3UCZP 2W9CB 1NJWA 2GAGC 2CPFA 4DR6F 3D0IE 2ADCA 2DJWA 2VBZA 5KG2A 4CZCA 1HYSA 3CEDA 4PQUA 1VDHA 1QUPA 3U1MA 3ILLA 4IH6A 5DQGA 2W8KA 2G13A 4EFAC 5DS7A 3T5KA 2CJAA 2HS0A 1KQFB 5B0CA 4DF4A 3DRSB 1NLKL 2EFNA 4H4OB 4NZ7A 4FVMA 3VHQA 2DPJA 1YLXA 4DX7A 4UT4A 1D1UA 3JQKA 2EVZA 2YQ0A 5T7LA 1U45A 2ZZMA 4F3QA 4IG3A 3JSRA 4OZLA 3TAMA 3DMJA 4JV1A 2MHEA 4FVCA 4PG5A 1N33F 2DR9A 2ZD1A 5D77A 2FLNA 4K5RA 3I87A 2IJNA 3KHHA 1FWLA 3QJLA 2KDOA 1HARA 3I6PA 4UW2A 4DV5J 1FF2A 2WTFA 2Z58B 4LF4J 4DV7J 1MW7A 2VHGA 3LGHA 3CJ4A 1GTHA 1JXEA 3HVAA 1JLGB 3GR0A 1XK8A 2LA4A 3FSIA 2CJKA 1CVJA 3AXKA 3POTA 1T9XA 4YB5A 3ELHA 4FF4A 3BGLA 2IM3A 1H2UX 5DZ7A 2XULA 4ZK7M 4DL7A 1D9DA 1N32F 5E2QA 1K0VA 5KFUA 1TR0A 1FTRA 2EW9A 3ZZRA 5CCLA 3PNIA 2R8KA 1F5AA 1RLDA 3M8PB 2BE9B 2N3OA 1F60B 2M4MA 1ROFA 3C19A 1UMJA 3MR7A 3RGIA 3P4UB 4O0NA 1N34J 4CTAB 4DV0J 3N6LA 4PZVA 1FKPB 1SIWB 3GSDA 5A2QU 3GQCA 2WVDA 2NYHA 2GJFA 4DLGA 2FVSA 2I8EA 3L95X 2YTCA 4DPYA 3JSMA 2VOOA 4P52A 5KFRA 1TQLA 2EKNA 3NWGA 4D3GA 3A8EA 2DR7A 1BMQB 4J9OA 1UL3A 2ZNZA 4OYIA 3V4MA 3D2WA 4RUCA 3TNVA 1Z4UA 2KHCA 1NDCA 1Q5VA 2VD3A 2BJ9A 3DYAB 4YY3J 1N6QA 3I9V9 3WC0A 3M8YA 3NOCA 3I0RA 4WXOA 2CPZA 3CD6S 2KM8B 2MJNA 1AUSL 2SXLA 2WW8A 4CNYA 3CCJS 4DV0F 5H9EK 1NH7A 4LFCF 1BGXT 3QRRA 4QYZJ 3R8YA 3MEDB 4O0IA 4F4ZA 3SCIE 1NKEA 3M8SA 5HO4A 2AGQA 3NP5A 4ZOSA 1UJ4A 4AL6A 4DZDA 1YRTA 2D3UA 1UFWA 1LXJA 2ZBRA 2R2RA 3K8WA 4AT1B 2HZVA 4NCGB 1QD1A 3DDNA 1QVGR 2BDPA 2OUGA 3JYTB 1IKVB 1U6ZA 2HNYA 2HQGA 4GVLA 3RAXA 5JMNA 4DL0C 3NBPA 1NNDA 3F44A 1X5TA 3OXLA 4XDDA 2QLBB 1C0UB 1VRQC 1OSCA 2QC3A 1VLYA 3AJ2A 2V69A 5A8WB 1QAIA 1GX5A 1RE1B 2EBEA 3EDRB 3HM9A 1CJKB 4OIXA 1ZTTA 4JV5F 2XMUA 1S1UB 3BBCA 1N0VC 4ECQA 3BSAA 2FC8A 3AAWB 2CPYA 5EGYA 4TU7A 3SFGA 2WOMB 2CPXA 2QL9B 3OQ2A 5K14A 4KKOA 4OJ3A 2KO1A 4CP5A 1SC4B 5E3QA 2AYEA 1KLNA 2R7VA 2MKYA 2LU1A 2CNLB 2LEBA 4LBIA 4O4GA 4ZDNA 3JXOA 2LVWA 8ATCB 1QUVA 1UWBB 2XEXA 3Q0AA 3J7YU 2ZBIA 2OIHA 4HLBA 3PJWA 4DS5A 1VRUB 3CULA 3QIPA 5KFWA 3THVA 1JJ2R 2AJ4A 5KFHA 1T95A 5DM6Q 1RT7A 1FJ7A 5L1KA 2EG1A 5G0RB 4OYBA 1S1TB 4MMOA 2I0XA 1IBKJ 3RTVA 3CJ0A 4O4RA 4JBCA 1HBOB 4R8UA 3OVBA 5F8MA 2IYGA 2DY9A 5CA5A 2UXBF 2EFQA 3DI6A 5JUMA 2N82B 5J1PA 1M90T 1SJFA 2ZEJA 5FD1A 3QPIA 1K1SA 1U0HB 5EWFA 2X1AA 2J5AA 1OYEA 1S9EB 3TA0A 5A76A 2PI4A 5E33A 1VQNS 3C8YA 1EKSA 1OS5A 1T0TV 2B5JB 2MQLA 4ZS6A 4ZITA 5M2UA 4M5DA 1R0CB 4X64F 5I3UB 5DRKA 4OX9J 3DDIA 3MPYA 3Q8VA 3MURP 1FFGB 2CWKA 4QIEA 1XMBA 4QPTA 1Q16B 3WZ0A 2OPQB 2DNPA 2JVOA 3V6HA 4RKUC 1TKTA 4RUAA 4ECUA 4L3NA 5C2GA 4OZ0A 4RW9B 1W25A 1Y5NB 3DOKB 3JSYA 3QBCA 5DETA 1JLQA 3B78A 1NU4A 1C1BA 2WVBA 3UD4P 1FWKA 1KS2A 2Z2LA 3OTDA 2CPJA 4WFBQ 2HRUA 3OSPA 3DRSA 4H4OA 4IG0B 4ITSA 1TMMA 4DDFA 4OZ5A 4IKAA 4M5NA 1IJFB 2OPSB 4FN5A 1S97A 1VQLS 3PRBA 4C11B 3M6VA 3TJAA 1UFLA 2GCFA 1PSDA 2DCUB 2YKPA 2V5HG 5GMKa 3DOLA 4TY8B 3BSOA 4UTGA 3MMCA 4WYWA 5KT3A 1CJVB 1FEEA 2CPHA 2FJEB 3PRVA 5MLCV 3IRWP 2IDEA 1C4CA 1TKXA 2JEJA 2VA2A 4GKJF 4LRAA 1RT5A 5KFSA 1TVRB 4WZMA 1X5SA 3LANA 4MFBB 2K1RB 2PA3A 2L41A 4ZLNA 4PXDA 3KLGB 3KLEB 4KGMA 1RB0A 2CADA 2QA2A 5D78A 5KFXA 2HLUA 3TARA 4B3SF 2FB0A 3DHWC 1RCXB 4X4OA 1YJVA 3RB3A 4RWXA 2HYIB 2HHWA 2V63A 5BYRA 1RHKB 5DDOC 5IC4B 1XMQF 3I82A 1Q8IA 1UVLA 3MFIA 3HHLC 1RT6A 1XNRF 2E5IA 1EP4B 3CCSS 3OL9A 3FCVA 3IG1B 2RJZA 4CLZA 3NGDA 2UU9F 2Y0BB 2CXEA 3MPDA 4WTYA 3P6YC 1BD6A 2IBOA 4DV5F 3ICLA 3GB0A 4KBIA 1HR0F 2C1EB 5KG5A 1FFSB 2B3TB 1M1GA 4ZVTB 4PR6A 4DR5J 5LOQA 1Q95G 4U96A 2AX0A 3CDAA 4EO8A 1RWPB 3H42A 5BYSA 3C16B 2VF3A 2Q79A 4QWCA 3HJFA 4WIQA 1HWJA 1NZ8A 2G0JA 3TAQA 5GAGI 2E5GA 1XBWA 4DSKA 4DSEA 5DQIA 1BC6A 4WFXA 1D09B 2WVCA 2ATLA 2HFOA 4HHHA 3AA9A 1KQGB 1F2HA 7FDRA 5HMXA 1EKRA 1SJ4P 3QAEA 4EYIB 3NMAA 1SKRA 5HSPA 3EWGA 2BX6A 3PEHA 4LMZA 1FRJA 4OZ3A 3IAS9 1NSKL 3WX8A 2A10A 1URRA 4GO5X 1WSRA 4J90A 1N8RT 4DF8A 3VQSA 2EWHA 4M8LA 3UI3A 1I1GA 4ZCLA 1MNEA 3GTYX 4RL1A 2DEJA 4JI7F 5A8KA 2AKWB 2ZH1A 4J9RA 2HFVA 3V6DA 4Q2MA 2I1RA 4FF3A 3MWBA 4GO7X 4L74A 3GPAA 3M8RA 4B9VA 2ROGA 5LJ3Y 2HQFA 1ZM2A 3HFKA 4ZPWR 4XPCA 1QAYA 1VQ9S 1X4EA 2E9TA 3QRPA 1DQ8A 1JJ4A 2PFFB 3FBEA 1Z2ZA 2DNYA 4BS2A 4DFMA 3BS9A 3DLKB 4G1IA 3HP6A 2GIRA 1PILA 4RBVA 5JJBA 1HFEL 3DRXA 2ZWPA 1IWAA 1N88A 3UDEA 1MWQA 2BACA 1W7WA 4JV0A 3R5CA 5ETVA 1D9AA 4O4GB 1RABB 3I0SB 3OFEA 2X3DA 3EDQB 2BJDA 2G4BA 1UEUA 4Y3CA 5KT7A 4OI2A 1BQNB 1KLMB 4CLSA 5A2QY 1Y9OA 2OMLA 4J9UE 2CG8A 5IT0A 2YBVA 3I9ZA 3CSKA 4NLWA 1H6KX 3MEEB 1VQ8S 1FEHA 5CD4H 1Y7PA 3BGRB 4HTIA 2G1DA 4HI2A 4Y00A 2ERRA 3QO9B 1FJEB 1HNIA 4DCJB 1WG4A 4DPXA 4PXCA 2CA9A 2VPZB 4DL5A 2EXUA 1S99A 5B0GA 2KVIA 5KFCA 2X7IA 3KFWX 3BKFA 1VQPS 1JLBA 3KLHA 3QGGA 2ZE2B 4DG1B 3D0GE 2ZH6A 2CVIA 4NMLA 2AW0A 3RJMB 2Y1RI 1NHVA 3F0NA 3MZIA 2BKNA 3P5BP 3M32B 1F1BB 4PKDB 5D4NA 4NLOA 1FTCA 4PXBA 1S1VB 1H0HB 3GU0A 2C3YA 2E7VA 2ALYB 3VV2B 2W24A 1B99A 1R6YA 2AEFA 2FJAB 6FDRA 3OL6A 2JNJA 1SV5B 4QJVA 2VQFF 1C0TB 3FDSA 2DGVA 2B8PA 3NWRA 1J5OA 1RAJA 3L09A 2IDLA 3JAMU 5SUHA 3LP0A 3W2VA 3C46A 3IWLA 2N4DA 3AJDA 3NGTA 3Q89A 4PXEA 3OLBA 4Z7YA 4OL8A 3P5TL 4LRBA 5A8RA 2PN6A 5RUBA 4LQ9A 1U1KA 4K0KJ 2QG9B 3H4BA 3PACA 3QLHB 4UOCA 1TL7A 2ZJQQ 3BSNA 3IR7B 1KQSR 3G82B 5ETNA 4AQYF 1RAAB 1V5VA 1T05A 2CDRB 2XTJP 2ZKTA 2XMVA 1AW0A 4IO9Q 2ZVSA 3A3NB 1RHMB 3IRXB 3HHKA 1S6UA 1IKWB 2C3PA 3AODA 4Q43A 4ECYA 4IOAQ 2IAJB 2OEJA 4E2FB 2CPEA 3IP0A 4ID5A 4YDXA 4PUOA 3UCGA 1UPPA 4F67A 3R5BA 4M1KA 2HNDB 1PBAA 4EGLA 5AE2A 4NL5A 5ETSA 3I56S 1EETB 3BO2A 5DJBA 2C3OA 3TVKA 1UA1A 3N6NA 3DU6A 2DO0A 2NQPA 4U95A 5CD4A 4P73A 3DKDA 5AJ3J 3HSZA 3ITHB 3FFIA 1T9WA 3HF5A 3G6YA 4M5JA 1FWPA 1VQKS 2C2DA 3D54A 3MECB 1C4AA 2L08A 2OGUA 1F9EB 3N5FA 5EN1A 2BJ3A 3LALA 3NCPA 4ZMMA 1ZM4A 4USTA 5I42A 1F2GA 2OPSA 4JUZA 1CJTB 3GFXA 1HIYA 5DQHA 4ES3A 1JNRB 1JX4A 2W4PA 3LGNA 4DBQA 3DOLB 4TY8A 4Y28C 2WONB 4P6QA 5GMDA 1HI1A 3THTA 2V0NA 4KGZB 3ULHA 4B3SJ 1XJWB 3F41A 5CYMA 3C2PA 4C9DA 3ETOA 4G1QA 2Y1JA 1TKDA 3CCWA 4BWMA 1T94A 1XMQJ 3DLEB 4FF1A 2X1BA 4PRFA 4NEYA 2YKAA 1S0MA 2Y1LB 1P9YA 4EWTA 1S6PA 2AEMA 2VBWA 5CXTA 3AQPA 1SJRA 1EZZB 4C3MA 2UXDF 3ENWA 4JI0J 2VODA 2IM2A 3AY0A 3EGZA 1HLWA 3HFZB 4LFBJ 5LM7E 2DNMA 3G6VA 4KPYA 1R0AA
chains in the Genus database with same CATH topology
3RU0A 3VTIA 4PQAA 1RT5B 4LJMA 2MSTA 2J76E 5H9FJ 4CO2A 4Y65A 2FJWA 1WACA 3HHLD 3RAMA 5DLGA 5IM0B 4HH0A 3DLHA 2E1RA 3V4IB 1X4FA 3H2VE 1E6YB 1VGYA 3TRGA 4Q44A 3D0HE 2DGWA 4H54A 3UW1A 5KG4A 1ZAWA 2VFSA 3LWMA 4ZPAA 2YNHB 4NWBA 4DQSA 1RTIB 1D3WA 4O23A 4MK8A 2MXYA 4GKKF 3MI7X 4LF5F 2M8DB 1X8DA 3HZEA 2B4PA 2XO7A 3IS9A 2HVZA 3DXBA 2FVCA 4I1TA 4R0JA 2GQ2A 2J7KA 2PE8A 5IT4A 4TQSA 1CLFA 1S1XB 2H9ZA 4X4QA 4DV6F 1F9FA 1WNEA 1E6VA 3KHRA 3ZC4A 4X4NA 2BRLA 2RD5C 2FVRA 1V3RA 3M9OB 1NB7A 1RT2B 1GXUA 2YNGB 2PMZD 1HPZB 3PX4A 2V9KA 4G1QB 1FNOA 2GA7A 2EI5A 5J2NA 3HXMA 3PW5A 3DCAA 3GV7B 1ZPVA 2DH8A 3PX6A 3HDSA 2AJ1A 5B0AA 4C8MA 1IQTA 3Q23A 2XZWA 4YQWA 4OHZA 3CCUS 1DTQA 4MYUA 2N7CA 3CCLS 4KTQA 2FLLA 4ZVFA 3SEOA 4AE5A 3UQSA 1LW0B 3T1AA 1CQNA 2KRRA 1T3NA 1PC5A 3NNAA 2WAQD 1O8BA 1RTDA 1SIZA 3SQGA 1LWFA 1E6YA 2MY7A 3VAMA 3GYNA 2COLA 3OR2A 1HYSB 4IQXA 4I2PA 3T5HA 1S76D 2GO8A 3MAHA 3I0SA 4U7UK 2X3GA 3HT3A 4C0BA 4NLPA 2PEHA 1XNQF 2XY5A 2KKHA 2JVRA 3G71S 1WD6A 5F8IA 1XN9A 2DHGA 3DLKA 1URNA 4X65F 1M5PC 4AUKA 4DQPA 1SKWA 3BGUA 5D4OA 2MGZA 1VRUA 1N6QB 1QVFR 3GYXB 2LECA 3PO5A 2KN4A 2CQCA 3TP2A 2GMHA 2LU2A 2IVMA 5E3AA 1ULRA 4C8NA 3K58A 1UETA 1C2PA 3CVKA 3SV3A 3SCKE 1WHVA 3W7BA 2EG2A 2OPPB 4OZJA 4X4PA 4AQYF 2YKQA 2D41A 3FNNA 4R5PB 1U26A 3ENQA 1REVA 3I96A 5GAHU 5AXLA 2XGQA 1SL1A 4ZCKA 4URGA 4QWEA 4DFKA 2DNKA 5KT4A 5GAEI 1UKUA 2RQCA 2J6UA 3PRDA 2VG5A 4B17A 4Y2AA 3UDLA 2NZ4A 4N8OA 4LF6F 3JSBA 1RKJA 1RTDB 3ZZOA 3ISND 5J1NA 2VC0A 2JRSA 1WEXA 5A6PA 2HGMA 4KHRA 3HVWA 5T14A 1LFWA 4CT9A 3RW7A 4C8OA 3UR0A 1R8BA 1V3SA 4KKOB 4ED7A 4ILMA 3QLHA 4NX9A 3DRYA 4I7FA 5LL6d 3DFEA 4YY3F 2NUUG 1YTYA 2IRUA 2JFDA 2MQQA 1UWBA 1Y0HA 2L3MA 3OHBA 1DQAA 4N5SA 3MR5A 3JSMB 4F4WA 1C1CA 2RF2A 2MKSA 1S0OA 2YQ3A 4H4KC 1X9MA 2JH3A 2RQ4A 1DAXA 1FRHA 1WWHA 4OI3A 5THWA 2MZ1A 2NR0A 4C7QA 2FPHX 5KAKA 3T5JA 2HNDA 3KLGA