4NLUA

Poliovirus polymerase - g289a loop mutant
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSASGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
molecule keywords RNA-directed RNA polymerase 3D-POL
total genus 142
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nluA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nluA02
2IJFA 2OPQB 3LANA 4RW6B 5CYMB 3VQSA 3DLEB 5KFUA 5JXSA 4TQSA 3PR5B 3IG1B 2R8KA 3MFHA 4ECXA 3GQCA 4IR1A 3I5AA 1TKXB 3V4IA 3KLGA 1JLGA 5DG9A 1IKXB 2R2TA 5KFTA 2HNZA 4EO8A 2R8JA 2BR0A 3E01A 4J9OA 2WK4A 5KT6A 4I7FB 4B3OA 3GV8B 3RB4A 1FK9B 3ICLA 3MR2A 4YR2A 4DL6A 4K4UA 1RT5A 3DRSA 3JSMB 5DG8A 3V6JA 4LQ3A 4NLXA 1T05B 3KLVA 1C1BB 4URGA 4DL4A 1S97A 1HYSB 2JEIA 1JIHA 1JLEA 3NKYA 2IC3B 1SUQA 3DOKA 4H4MB 5L1LA 3CIZA 3RB6A 4ID5A 3DLGB 4J9SA 1RT6B 3MR5A 4O3SA 2OPSA 2V4QA 3OSPA 2W9CA 5KFZA 2D7SA 2HMIB 2IAJA 1EP4A 1JLQA 1K1QA 3BSAA 1EETA 3DLKA 2HMIA 4NLGA 3DMJA 1IKVB 3LP2A 1EETB 2FVCA 3BQ0A 4XO0A 5F9NA 1C0UA 1TKTA 5C42A 4MIAA 5KFDA 2ALZA 5KFPA 3FQKA 4ECQA 1RYRA 2I5JB 4NLPA 1S49A 4ICLB 4MIBA 2IM3A 1BQNA 3HVTA 4KKOB 5KG1A 3Q8RB 3I0RA 5KFJA 2IM2A 1N6QB 2QE5A 4RW4B 2JC0A 3ISND 3PW2A 1JXLA 3OLBA 2FJXA 2WONA 5KT7A 2YKNB 1JLGB 3BSCA 3PZPA 4OL8A 2HNDA 3Q8QB 2ILZA 1JLCA 1RT1A 4XPCA 3QIPA 1C1CA 3H59A 4LSLB 1S1WB 5CYQA 2WOMB 3N6MA 3H2LA 2IMWP 4MK9A 3GYNA 3LP1A 4EYIB 2WOMA 4IRCA 2CJQA 4RU9A 1TKZA 5DGBA 5KT3A 5HBMB 3RAXA 4ED6A 3OL8A 4IFVA 4RW9A 1JLFB 4NLRA 4QW8A 2IBKA 1S1UB 4ECTA 1ZTTA 1DTQA 4QWBA 4LSNA 3M9OB 1S1XB 2YNFA 3CDWA 5KT5A 4EYHB 1JKHB 3OLAA 1EP4B 2ATLA 3V4IB 2ASLA 4ZVFA 1S9GB 3IRXB 1JX4A 2RF2A 3C6UB 2BQ3A 1N5YB 4H54A 1LW0A 2D3UA 3JYTB 4IRDA 4B3OB 1S6PB 1IKWB 2VG6B 1YVFA 3I0SB 2B5JA 4KAIA 3KHHA 1QAJA 4YR3A 5KFEA 1BQNB 4NRTA 3ITHB 3UDLA 2AGPA 2IJNA 4ZVGA 2UUWA 1U09A 3DYAB 2XWYA 3QLHA 5KG3A 3DOLB 3H98A 1TL1B 1SUQB 2BANA 3FQLA 4H4MA 5KFAA 3Q8PB 5J1EB 4F4YA 4ECRA 2YKNA 5JUMA 4QWEA 4J9MA 4ECYA 4TXSA 2OH2A 2HWHA 4O4GA 1RTIA 1RT4B 1HQEB 3SI8A 3T5LA 1RTDA 2WHOA 2UVRA 5KFFA 3C6TB 4TYAA 3CWJA 1RTIB 3BGRA 1S1WA 3CJ4A 4EO6A 4NLYA 4F4XA 4NRUA 2AWZA 1IKYB 5L1JA 3DRPB 4TN2A 4RZRA 1IKVA 3DI6B 3HVWA 3DRRA 4KHRA 1JLBA 2IM1A 3IS9A 3H5SA 2IC3A 5I42B 4IQXA 3RB3A 1S6QB 2YNGB 4ED3A 4RW6A 3RB0A 5FDLA 4PUOB 5KG0A 5DGAA 1S6QA 2YNGA 3BSNA 2FLNA 1TKXA 1S9FA 3OL6A 4O3OA 4NCGB 4R8UA 4ED8A 3GIJA 1JKHA 2WONB 1C0TA 4RNMA 3OL9A 1S1VB 1OS5A 1C0UB 5KG4A 2WRMA 4IOBA 2BE2B 4RUAA 1BQMB 3H4BA 5KFSA 1T03B 5KFNA 3KHGA 1C1CB 4LSLA 4JUZA 2W9AA 5F8MA 4J9LA 1T03A 2WTFA 1N6QA 2ILYA 3QYYA 4IRKA 4RNFA 4DG1B 4K4VA 2HNZB 4Y3CA 2B43A 4MK7A 4J9KA 3MTKA 3KOAA 3DYAA 4DL5A 3CJ3A 1RT2B 3DM2A 5HBMA 4ECWA 1N48A 1QE1A 4M95A 5F9LA 1TL1A 1NHVA 3G86A 5KT4A 3KLIA 1MMLA 3OHBA 5KFIA 3PJWA 5J2PA 4O4GB 5J2MB 5F8HA 4IH6A 4MH8A 3N6NA 1LWEA 3FDSA 5DQIA 3MR3A 1HYSA 5D3GA 4DEZA 3BGRB 2JLEA 1FKOB 4ZP8A 4F4ZA 3DRPA 2GIQA 3HKWA 4RNHA 4RW9B 4WE1B 2I5JA 4ZPBA 2AX0A 1S1TA 2OPRB 3I0SA 4ZVEA 5DQHA 2IAJB 5HLFB 3NMAA 3MFIA 4ECUA 2HNYA 4DL7A 3I5CA 4MFBA 5KG6A 4WXOA 2C2DA 3DMJB 3KLFB 4WYLA 2RDJA 5KFQA 2J6TA 1N5YA 1RTJA 4R5PA 3PW7A 2AGQA 1LWFB 3KK2B 3FSIA 4WZMA 3KLEB 1RTDB 2EC0A 3I0RB 3V81B 4JV2A 1D1UA 4O3QA 3H5YA 3H40A 2UVVA 3UR0A 3QGGA 3PW5A 3MEDA 1J5OA 2JEGA 3HVAA 4ID5B 1D0EA 1JLBB 2E9TA 4K4ZA 2FJVA 3CJ0A 3MEDB 1SH0A 3SFGA 1RTHA 5C25B 3KK1B 1J5OB 4HKQA 3M8QB 5HP1A 3QIDA 4QPXA 3CDUA 4ECSA 1TVRA 1S1UA 3HHKA 2E9RX 4QWDA 4K4WA 5K14A 5KG5A 5J2PB 4ED1A 4LQ9A 3N6LA 2IM0A 3NBPB 3T5KA 2YNIA 3LAMA 1DTTA 3I5BA 3BR9A 4ZVHA 3V6KA 2HWIA 4Q8EA 1IKWA 3EZUA 4O3NA 2W8KA 5FDLB 3CJ2A 4RW4A 2J6UA 4WXWA 3RAQA 1RT7A 1DLOB 1KLMA 5C5JA 4DL2A 4G3IA 2GC8A 3QLHB 4IDKA 3CDEA 4GC6A 2BANB 2R2UA 1NNDA 1LWCA 2B6AA 3KK3B 3MR6A 2V9WA 4IDKB 4YMEA 3LP0B 2F8EX 1SH2A 2BE2A 5KG2A 1S6PA 1HQEA 3CO9A 1LWCB 3KK3A 4R5PB 4ZPCA 1N56A 4K4XA 1XR5A 2DPIA 1REVB 1VRTA 5J2NB 3PJXA 3T1AA 2XI3A 2ASDA 2FLLA 2JEFA 2XC9A 1TKZB 3V81A 1IM4A 1GX6A 3DI6A 3KLHB 2ZD1A 3MECA 5I42A 4ZP7A 1S4FA 4WFYA 3UQSA 5C25A 1JLQB 4QWAA 5KG7A 3KLIB 2FVSA 1RT4A 4LSNB 3BSOA 4Q8FA 3M8PB 4U7CA 4O44A 3CJ5A 4R8UB 3C6UA 1S0MA 4F50A 2XCPA 4JV1A 1C0TB 5F8GA 4TQRA 5KFXA 4KSEB 2OPPB 2FVPA 1TL3B 4I2PA 4NLQA 1RTJB 4O3RA 4Y2CA 5KFMA 1KHVA 1JLAA 3BJYA 3IN5A 4RW8B 2FJWA 2RKIB 4MK8A 4DG1A 4NCGA 3QGHA 5DLGA 4K4YA 1RT2A 1S48A 3DM2B 3OL7A 2GIRA 1IKXA 1RT1B 1LW2B 2RKIA 3NGDA 3M9NB 1TV6B 1WNEA 4TY8A 4KB7A 2D41A 5EWGA 4ED0A 1T3NA 1R0AA 1TP7A 3QO9B 4FS1A 1S9EA 3D5MA 1RYSA 5KT2A 4O4RA 2XGQA 1FKOA 1XR6A 5F8JA 4H4OA 4M94A 4NLOA 5HROB 4WE1A 4H4OB 1ZTWA 1DTQB 4RNNA 3M8QA 3V6DA 5HP1B 1RT6A 4ECVA 3GIIA 5DLFA 1VRUA 4TYBA 3H4DA 4J9PA 4EBCA 1KLMB 3DLKB 4Q44A 3JYTA 3PVXA 3KLFA 1HNVA 4WFXA 3MEEB 3QZ8A 3UPFA 2YNIB 3PR4A 1BQMA 4URSA 4QWCA 3OSNA 3KK2A 1RT3A 1TL3A 4I2PB 2BQUA 1QAIA 5HLFA 1HNIB 3G6YA 4IH5A 3DLEA 3CVKA 3FFIB 3HVTB 4KKOA 4RNOA 1I6JA 1RDRA 1DLOA 2WB4A 2ZE2B 4F4WA 4WYWA 1S10A 5KFGA 3GILA 2R8GA 3KLGB 3LALA 3ISNC 3E01B 5EDWA 3GV5B 4GC7A 5F8LA 1LWFA 3BQ1A 1FKPB 4J9NA 3PHEA 2ZKUA 4QW9A 4ZP6A 1R0AB 1REVA 1VRTB 5J2NA 4O3PA 2AQ4A 2VG5A 1FKPA 2FVRA 5CYQB 3IS9B 1S9EB 2FLPA 1HPZB 3NBPA 2W9BB 2UVUA 2YKMB 3KLHA 2CKWA 4NLUA 2XGPA 3Q8SB 1TQLA 2OPPA 3DOKB 2JC1A 1UWBA 2OPRA 1W25A 2YKMA 3GV7B 4TLRA 5KFYA 1TVRB 3MEGA 2FVQA 2W9CB 3KHRA 5KFOA 5L9XA 4MKAA 3KMQA 4I2QA 4RW8A 4KFBB 2JEJA 1K1SA 1S1VA 4PUOA 2WCXA 4I2QB 4IKAA 1SH3A 3LP2B 3V6HA 5KFVA 4I7FA 3G6VA 3NL0A 3QGIA 2QV6A 3MEEA 5EWFA 1TKTB 4TY8B 3GIKA 1FK9A 4MKBA 3KHLA 2R8HA 3KLEA 1LW0B 4U6PA 4PWDB 4ZHRB 5T14A 3KNAA 4G1QA 1RT7B 4ZHRA 2B5JB 5KFKA 2YNHA 2BRKA 4HYKA 3ITHA 4ED2A 2C28A 1HARA 4NYZA 3EPGA 1QUVA 4ZPDA 4K50A 2XCAA 3T5HA 1Z4UA 4IG0B 2HNDB 3IGNA 1KHWA 4KBIA 5KFRA 2W7PA 3QZ7A 1JLCB 3DRSB 3JSMA 4X2BA 4IR9A 1T05A 2AU0A 4PQUA 4ZMMA 2V4RA 3PW4A 2IA6A 4Q0BA 1HNVB 3MECB 4J9QA 4PQUB 4KO0A 1RAJA 4YR0A 3OHAA 1HMVA 4IG3B 2RDIA 4URQU 5EUHA 1T94A 1JLFA 1RT3B 4NLVA 4ICLA 3T19A 3IG1A 4ECZA 5J2QB 2AGOA 4MFBB 1HQUB 2C2RA 3M8PA 3RBDA 1HQUA 4IFYA 3H5XA 3TAMA 4FBUA 2J6SA 4Y34A 1CSJA 1RA7A 2B6AB 3EPIA 4K4TA 4RW7B 2RF2B 3SFUA 1TV6A 1SV5B 5KFBA 2UVWA 2VA3A 2O5DA 4ED7A 4J9RA 1N4LA 2OPQA 5CYMA 5F8IA 1MU2B 3TVKA 3NAIA 3G6XA 5L1KA 1HNIA 3M9MB 2E9ZA 3LAKA 2W8LA 4KV8B 3FFIA 4EBEA 3PW0A 3RBEA 2W7OA 2VG7B 3KK1A 3T5JA 2W9BA 4Q45A 4KV8A 3DOLA 2OPSB 4EBDA 2C22A 5J1EA 1UWBB 1RT5B 3NAHA 5F8NA 5K14B 3MEGB 4O44B 1S1XA 2R2RA 2R2SA 1C1BA 3BREA 4PWDA 2HAIA 5J2MA 5I3UB 2VG5B 1S9GA 3IRXA 3LP1B 1JLEB 4Q43A 1IKYA 4IH7A 1S0NA 3DLGA 5I3UA 4Q0BB 3KJVB 5L1IA 2VA2A 1JLAB 3D28A 4Y2AA 4KO0B 5KFHA 2AX1A 5KFWA 3V6DB 3KJVA 3FRZA 4WFZA 4G1QB 1VRUB 1S1TB 2I1RA 3KMSA 4YP3A 2YNFB 2ZE2A 4JV0A 2R8IA 2HNYB 4NLTA 5DQGA 1GX5A 4KFBA 4NZ0A 1LW2A 4DL3A 1NHUA 4IFYB 3LP0A 3TAMB 3IGVA 4KE5A 1XR7A 4RW7A 4IG0A 5KFCA 2UUTA 1RA6A 3QIPB 3QO9A 1C2PA 4EEYA 2VG6A 4KHMA 4TY9A 3E51A 1MU2A 3C6TA 5EWEA 4XPEA 2ZD1B 4FBTA 1HPZA 4RUCA 1S0OA 3TQ1A 2BQRA 2C2EA 2YNHB 2XI2A 3DRRB 5HROA 4ZP9A 2VG7A 5C24B 4WZQA 2BRLA 5KFLA 1QE1B 1HMVB 4IG3A 4YQWA 5C24A 1RTHB 2DPJA 3BQ2A 5J2QA 4NLWA 3H5UA 4FS2A 4NLDA 1ZETA 2D3ZA 3GIMA 1LWEB 4NLSA 5C42B 5D3GB 4R0EA 4K4SA 4IFVB 2V0NA 2ASJA 1SV5A 4ZPAA 5DG7A 3DDKA 1DTTB 3MF5A
chains in the Genus database with same CATH superfamily
2HW3A 5CYMB 2QX0A 2Y1RI 4RW6B 4RUBA 3TWZA 2J6TA 2Y1LB 3UD4P 3PR5B 1KTQA 5A0YB 3MFHA 3CCRS 1FVSA 4E8UA 4EI2A 3I5AA 1TKXB 2DCLA 3KLGA 5CQGA 5DG9A 3UCGA 4ZVTB 1P9QC 2HNZA 3DLJA 5A8WA 2BR0A 2BOPA 3A8IA 2R8JA 2R7OA 2EPIA 3AB4B 1X31C 2VDIA 3CJSA 1RHQB 4KC5A 4NX9A 4WU3A 3M8SA 3GV8B 3ICLA 2QGFB 1CULB 2CA9A 3VZIA 5F41A 1TFYA 1QLNA 2BZ2A 4LQ3A 4I6WA 4NLXA 4OHXA 4FNHA 4OJGA 3G8TA 1S97A 4RL1A 1SQEA 1K44A 2J5AA 3J81j 1RBAA 3D2WA 1PIEA 1JLEA 4USWA 1FDDA 1SUQA 4YB1P 2E5GA 5L1LA 1HBOB 3SSQA 2AD9A 4RUHA 4B3RF 2YH0A 1U6FA 3F41A 5IZHA 3MR5A 2ROEA 1LV5A 2VPZB 4DV0J 1HBOA 1N0UA 4LF7F 4WP9A 2D7SA 1FX2A 2ZZTA 2O1PA 3AOCA 3NRBA 1W26A 2LQ9A 1K1QA 3DLKA 3BSAA 1EETA 3M6VA 3VCDA 4ZKAA 3MPYA 3T6BA 4W90B 2DT9A 1RE1B 1IXKA 4USHA 1XJWB 2ZWPA 2XTEA 1EETB 4J9KA 2EFPA 2GNKA 4PG7A 3MM7A 3CUNA 2MLXA 3QFWA 2PE8A 1S57A 4MIAA 1BWEA 1CJVA 3R7BB 3FQKA 1OY9A 3D0GE 1RYRA 4NLPA 4R0JA 3HHDA 4JB8B 2IM2A 1A7GE 4OI1A 3NGUA 3OTDA 5A8KB 5KFJA 2CIMA 4BS2A 4DSKA 1FXRA 4KY3A 3BN7A 2UU9J 4ZLPA 2WONA 1FFSB 2YKNB 5GAEI 1WF2A 3DNCA 2XQCA 1L5UA 4OL8A 4G65A 3DDIA 3EGWB 4ZVRB 4YFUA 2ILZA 1JLCA 4BBYA 4QIFA 3QIPA 3WZ0A 2FQQB 1C1CA 3H59A 2V8DA 5CYQA 4MYTA 3ZNUA 4IUFA 3K5PA 2M8HA 4I64A 3SQGB 3LP1A 2GW8A 5C7PA 1H73A 1B99A 2CJQA 5T7LA 2DH9A 3BGOP 3D1QA 5HBMB 2X3DA 5DGBA 1PKUA 3P5TL 5LSLA 1JLFB 2R7RA 1FWKA 1CS4B 4ILMA 4EUVA 1T3OA 2ZVSA 3NS7B 1S1UB 4ECTA 4OLOA 1RWOB 2M52A 4QWBA 1QTMA 3AH6A 4PWDB 3CDWA 3OUYA 4EYHB 2ASLA 3OLAA 1EP4B 2D3OR 3AD8C 4RR5A 4OX7A 4AD6A 5D4OA 3G4SS 3C6UB 2VBZA 2MMYA 4ZVSB 2LQ5A 3ZC4A 1N5YB 4H54A 4B3OB 3L3CA 1FTRA 5IV3A 2V6AA 1ZPVA 5CD4H 3LTOA 2DYAA 1H0HB 3M30A 4P9SA 3THTA 4DV7F 1QAJA 3KTQA 5KFEA 1WC4A 3ITHB 1VR6A 2UUWA 1IWAA 4OV1A 2DY9A 3QLHA 2N4CA 3H98A 1TL1B 4U7UK 4DV1F 1KLNA 2MXYA 4ECRA 5JUMA 3W8GA 4WTOB 3CSKA 3D6FB 1GXUA 3EWGA 2DKOB 4MIWA 1XNQJ 1N5SA 5GVQA 3SDEA 3BGRA 2F9DA 3CJ4A 3IMQJ 1NSPA 4OHWA 2G0IA 3BV8A 3TVZA 4DPWA 1IKYB 1NJWA 2AYBA 4TN2A 1AFJA 1IKVA 4N7TA 2W4PA 1JLBA 1YZ7A 4QIVA 3H5SA 3D6TB 1U25A 2E1MC 1FJGF 4IQXA 3VTIA 4DFKA 3RB3A 2YNGB 2W2NP 2H65B 4RW6A 5FDLA 3T6JA 1Y9OA 3R5AA 2W2OP 2ZNYA 2CPJA 2OUGA 5KG0A 5A0YA 5DGAA 4KT0C 2YNGA 1CJTA 3LO3A 2FLNA 1TKXA 4PG6A 2DBBA 1Q16B 2H5EA 2RVJA 2HVEA 4KGMA 3PX4A 2EKNA 3UR3C 2WSCC 1JKHA 1U2FA 2V1TA 3VHQA 1C0TA 1RWKB 3AOAA 3EM1A 4HDGA 1S1VB 1C0UB 3TUPA 1WKLA 4TKTA 2R7SA 1WTBA 3BGFA 5E3PA 1TKDA 5KFNA 4OZ1A 5JVGQ 5BYQA 4LSLA 2OIHA 3VAKA 2VQEF 1NPPA 5F8MA 3K17A 1IJFB 2W9AA 3I6PA 2ILYA 4LVNP 4IRKA 1YITS 2YVSA 5ETRA 3K0JA 3NMRA 5H9EK 1TUWA 3KOAA 2GZOA 3MTKA 2SXLA 1RT2B 4NZ7A 4DL5A 1N48A 2UUCF 2LXIA 3G86A 3CCVS 5KT4A 1FFWB 3TX0A 2KTQA 5J2PA 3H0PA 3BZQA 3H7HB 4MH8A 4DPXA 4N41A 3N6NA 1LWEA 2B4UA 2HS4A 3ILLA 3FDSA 4ZCIA 5JVHQ 3U7JA 4FKYA 3MR3A 4KHPF 3GR0A 5J1NA 4DEZA 5FLXY 1FKOB 3OT9A 3KJNB 5AE2A 5CCMA 2XMMA 4F4ZA 4QU7A 1Q8LA 1XNQF 2RHSB 4RNHA 4RW9B 4WE1B 1S1TA 3ZNJ1 1IM6A 1W2IA 3I0SA 5B0BA 1UP1A 4DU7A 4ECUA 2G13A 1G7CB 2E44A 3A4TA 2MQPA 1O5JA 4DR1F 3SMZA 4ED4A 1T95A 2V9KA 3MMAB 1VIXA 3DMJB 2DITA 4P2XA 4XK8C 3W2WB 2YWKA 1KVKA 2DHGA 4K7QA 4C11A 4RWWA 4DPTA 1B7FA 3PX6A 3LOUA 2CQ2A 4LRCA 4ETXA 4JI5J 1RTJA 3M6XA 2KH9A 3N5BA 3MHYA 3KK2B 2XZWA 1S4EA 4R25A 2XM3A 3KLEB 2GMHA 2CPXA 4DCOB 3BDPA 4N56A 2JOQA 3VAFA 3QGGA 2MQLA 5IQQA 1SIWB 1J5OA 2OKQA 3PY8A 1CG2A 3HVAA 4ID5B 1HNXJ 4LF4F 1BE4A 1ICEB 3CJ0A 2EG1A 1SH0A 1FEEA 2DB1A 3IR6B 4L72B 4HH1A 4HH0A 3J7YI 4P74A 2HRTA 3KK1B 3LPYA 2I2YA 3QIDA 4ECSA 1S1UA 2PC6A 2D9PA 1F5AA 3CC2S 4OX8A 2V4JA 4IO9Q 2HPUA 4LQ9A 3N6LA 2G0JA 2FZKB 3P4UB 3AODA 2XMUA 4PPDA 4FPIA 2P6TA 4K2JA 3V6KA 2Y8YA 1N52B 4A8WA 2CJBA 3EZUA 4A8FA 1YJ7A 1CC8A 4C4WA 3CJ2A 4HHHA 2CYYA 3L7PA 1DLOB 1GT8A 5AJ3F 1NB2A 3QLHB 2RE1A 1LXJA 1HW9A 4OZ5A 1RGVA 4JI2J 2WSFC 2D69A 2HVIA 4HTIA 2KO1A 1N5QA 2V9WA 4EWTA 2CPIA 4YMEA 5KG2A 3EDQB 3M6WA 2Y0SD 1N56A 3MR7A 1GXLA 1VMBA 1REVB 3TP2A 2M70A 2PA8D 2AJ4A 4KGVB 4CI0B 4LF6F 2XC9A 1DZ5A 3BB5A 3V81A 4DLEA 1ZS6A 1MN9A 2ZD1A 4B3MJ 3MECA 4DV6J 1UW9A 4ZP7A 1S4FA 3BO3A 3L09A 3SCKE 2QC3A 2IJRA 4ZPVR 2EK6A 3KLIB 1RT4A 5KG7A 2FVSA 1UPMB 2ERRA 4B3TF 2HLTA 3CEDA 3M8PB 3LGHA 2MEWA 3LH2S 2MY7A 1KNZA 4LT6A 4I0WA 2ROPA 2HVZA 2XCPA 2APOA 1C0TB 2MHNA 4FYYB 2HQFA 1RAAB 4TQRA 1OJ4A 1UMJA 5KFXA 3F73A 5E0OA 4KPYA 1FD8A 3X1LB 2JL9A 2R7XA 1HBUB 3MMCB 4ZK7M 2C3MA 3OTBA 3S1TA 2KM8B 2FY8A 4QCLA 2EKYA 4OYXA 2ZM6J 3TANA 4OYAA 1KR4A 2HWTA 1VQOS 1Q4RA 3G71S 2J0XA 3MCSA 3IN5A 2FJWA 2G0CA 2RKIB 2L08A 3MI7X 1P6TA 1RBLA 2DD8S 3J80U 3VR1A 1H2TZ 1KVIA 1RT2A 2MYFA 3OL7A 2GIRA 2RKIA 3KDOA 2OFHX 2XZTB 2XTJP 3W66A 2QL7B 3UDVA 1T3NA 3S01A 4B02A 3DLBA 3IR7B 1CPZA 2MQ8A 1RYSA 3CCES 3CCZA 4RBTA 4UZBA 4OYIA 3UI3A 4O4RA 1F1BB 4ZIWA 2IYGA 5KT2A 1FKOA 3EVOA 4OYBA 1H7XA 3TUZC 2RHQB 5ITHA 1HHSA 2CZ9A 4WIIA 5HROB 1HI1A 4WE1A 3MUTP 1T11A 4CQ1A 4RNNA 1XMQJ 3M8QA 2JLGA 1I5OB 3B6BA 5IT0A 3PEJA 5DLFA 3CCWA 2JHEA 4CLSA 3IP0A 3EGVA 4DV6F 2RIJA 4Q2MA 1RU2A 2GHVC 3PVXA 1GTHA 2XMWA 1XMOJ 1HNVA 4WFXA 1VLOA 3QZ8A 2HFVA 4FXVA 1PJ7A 1BHNA 1BQMA 2HHPA 3D0HE 4URSA 2H4WB 4X4QA 3CMQA 1FWLA 3KK2A 3UDEA 1TL3A 4KQZA 3Q22A 1N34F 1QAIA 1IBMJ 4ZN1A 1Y10A 3G6YA 1NZ8A 4Y00A 2C1EB 1YX2A 2GO8A 1H98A 3G8QA 2LDYA 4N5SA 1SKSA 4OI6A 1RDRA 2WB4A 2ZC4A 2ZE2B 4JI2F 1S10A 2R8GA 5KFGA 1HI8A 3KLGB 1EHWA 4YEAA 4D3HA 1UJ4A 1LOUA 1UFLA 3PYDA 4KHPJ 2BMBA 2OD6A 1LWFA 4JBCA 1FKPB 1YRTA 2YBVA 2NUHA 3IFEA 3LF0A 4MTPA 1Q7YT 2E1PA 3MUVP 2AEJA 4DR3F 4KR0B 4DR3J 1FKPA 4DQQA 2AQ4A 3EZOA 1RAGB 4Y2MA 3EE3A 4RBUA 1RWMB 4L74A 3VF0B 2FLPA 4JI8J 1R0BG 2P9GA 1VQ6S 3QAUA 4C8YA 2DGQA 4LFCJ 1TQLA 2CDQA 2KYZA 2QEXS 3B78A 1ULRA 3GFXA 1M5OC 1W25A 3D4JA 2Y9HA 3HULA 5KFYA 3MCNA 1V3SA 3IRWP 2CJXB 3MEGA 2VONA 2RQKA 4CTAB 1UETA 3KMQA 4I2QA 3CDBA 2Q66A 1XTZA 1F60B 4ZA1A 3HT0A 4C2MA 2WCXA 4I2QB 4B08A 4IKAA 3C15A 1JNRB 2NSCA 1L3KA 4O0IA 2QV6A 4GKJJ 1YKWA 3MM7B 2DEIA 3N5FA 1FK9A 2DHSA 4AFFA 2DVIA 3OFHA 1LW0B 2FJAB 1ZPWX 4HHJA 4ZHRB 2ADCA 1VHIA 4DQSA 2XYGB 4QR1A 4G1QA 2ZDOA 1PYOB 1HKAA 4CT9A 2K06A 3PM9A 4G6VB 5M2RA 4PG4A 4ZHRA 3HPOA 1U1LA 4JI0F 5DM7Q 3MM8B 1ZBTA 2BABA 2BRKA 3W9HA 4HYKA 2DRBA 2R7VA 1RXOB 2M4MA 2CPHA 3OBIA 1B64A 3W1YC 2JJ4D 1VRQC 1SC1B 4QOTA 5LOQA 5CH7B 4EK2A 3MPDA 3LA0A 2MSTA 1F2HA 2XTCA 1G3OA 1RADB 1JLCB 3JSMA 1FJCA 4CLTA 4OFZA 1UZHA 1F5CA 2DNYA 1AFIA 3HK2A 2HQDA 4HVZA 4Q0BA 1FKAF 4PYAA 5HMYA 1F6TA 4ZLNA 4QU6A 4I67A 2EK1A 1U0SA 2YKAA 1HMVA 3PYEA 2RDIA 4LR9A 1JLFA 3T19A 4ICLA 2EC2A 2CPYA 3NXZA 1PCAA 2EBGA 2C2RA 2UUCJ 2K3KA 6FDRA 1LEOA 3AJ1A 4HDHA 3VGTA 4A8MP 3OUYB 1CSJA 2GMJA 1RA7A 3GJQB 1U0HA 1YBTA 2YQ1A 4LFBJ 1WTFA 1CJUA 3EGZA 3FK4A 1SV5B 2ZJQQ 2VA3A 4ED7A 3OV7A 3M8WA 2OPQA 4U9RA 5F8IA 1RBOB 3TVKA 4LF8F 3W5YA 3TAQA 3RYLA 2E66A 2DGXA 2HIQA 4C8NA 1HNIA 1R27B 4USMA 3FFIA 4EBEA 2QZ8A 2W7OA 3T5JA 2FZCB 4LRBA 4Q45A 2V2QA 4EBDA 2VF3A 1MWQA 3UN5A 3ZTRA 1UWBB 4M5DA 1S7IA 2AJ2A 2W25A 2ZVIA 2VFUA 1NU4A 4U8YA 5AE1A 3KWMA 3CW2C 1S1XA 2R2SA 4OJHA 4LF5F 4X65F 2HAIA 1RAFB 3D1OA 2MJUA 1S9GA 2VG5B 3F44A 3DLLQ 4K5RA 2P2CB 1IKYA 4IH7A 3THVA 3U1MA 3DLGA 2E1CA 2Y0BB 2XEXA 3KJVB 1JLAB 5E3RA 4CYUB 3DRYA 1Q8IA 3KJVA 3FRZA 1E6YA 2LLZA 1YGYA 4V19J 2QG9B 2ZE2A 3MMJA 2R8IA 2FLOA 2HNYB 2B7BB 5DQGA 1GX5A 1FE0A 4KFBA 2VV5A 4IFYB 1IBLJ 2PN6A 1OQ3A 2K7JA 1JK9B 3IGVA 2W2QP 2HQCA 2WVBA 3M32A 2ZDPA 1EIYB 5FJ4A 3QO9A 4EEYA 1CVJA 2CQ3A 3AAWB 3M32B 3E51A 1MU2A 2FJEB 2O01C 1REGX 3FUYA 3OPKA 2WSEC 2PMZD 1X4BA 5LXRA 1RKIA 3DRXA 4OYOA 1NEEA 1Y4ZB 1S0OA 1I94F 3T41A 3BBBA 3OR1A 2DO0A 3UNGC 1U1OA 3CTRA 2CVIA 2BRLA 3R5DA 1KEKA 1ZOTA 4AL5A 4NI2A 1L3UA 3JTPA 2RU3A 1RHRB 3UCZP 1RTHB 3V4MA 4M63A 8RUCA 3OTOJ 2UXCJ 4PWWA 4CTAA 4DUZF 4FS2A 1VQKS 1B0PA 1MROA 2CAJA 3VV2B 1K0TA 1LWEB 2UXBF 2J0QD 3A8EA 1MROB 3PO4A 3KYLA 2CQ1A 4NOHA 2V0NA 4S0MA 1JMTA 2AZ1A 1FDNA 3DDKA 4JV2A 3TI0A 5CD4A 3VQSA 3DLEB 5KFUA 4TQSA 2DIUA 3AQOA 3G87A 4U95A 3DGVA 4LFAJ 3IBCB 1N36J 2HBZB 3Q0AA 4N76A 1TAQA 1Y7PA 2R2TA 4PG5A 1HD1A 4J9OA 2H9ZA 5D0GA 3JQMA 5F0WA 4I7FB 2F5GA 4IYQA 4USVA 4DQPA 4DV4J 3M1VA 3U27A 2AKWB 2HYIB 4YR2A 2WW8A 1RT5A 4HT5A 3JSMB 2CPFA 1H2VZ 2J8AA 3KLVA 2XG8A 4URGA 2JEIA 5E3QA 1IJEB 3HSJA 3NKYA 1FFGB 2IC3B 1ZAXA 3C16B 4H4MB 1CS4A 4NPOA 1R8HA 3PYFA 4ID5A 3M2UB 3QBCA 4FVCA 4DFPA 1YIJS 3MAHA 3X3UA 1RT6B 4DX6A 4O3SA 1FXLA 3OSPA 5HO4A 2PDAA 2W9CA 5KFZA 2Z2LA 1J5EF 4QYZK 3J7Z5 2IAJA 4LF8J 1RB0A 1EP4A 2E5HA 2L9NA 4EO6A 2IPOB 1OM2A 2DNGA 1Y3JA 3IXQA 4DUYF 2V4JB 4JI4F 4NLGA 3HD1A 4P7VA 1FXDA 2FVCA 3W7BA 5A76A 5F9NA 1AB8A 1NHKL 1TKTA 3MWBA 4E2FB 4FP9A 2ALZA 5DZ7A 2XSJA 3CCSS 3MM9B 2I5JB 4U7UD 2F40A 5KG1A 3I0RA 2BE7D 2KI2A 1N6QB 2XSJB 3AFGA 1TK8A 1JXVA 2QE5A 2QMUB 3KJQB 3ISND 3ET6B 4X66J 1SKRA 1JXLA 3HHLC 1S99A 2D1CA 1V5IB 3BSCA 1RAHB 1SC6A 2RJZA 5L38A 3PZPA 4DR7J 2N3OA 2HNDA 4USIA 5CHCB 3Q8QB 2XNRA 4DZDA 3CJQA 2DNMA 3KDNA 3MOZA 5HMZA 2WOMB 4DR1J 2XO6A 3H2LA 3EXYA 2HRUA 1R89A 4UUXA 3PRDA 4MK9A 4EYIB 1K8AT 2HHVA 2RUSA 2VDHA 2WOMA 3MMBA 4GO5X 4RU9A 3T1HF 3QJPA 2M88A 3RAXA 1QVFR 3CJTA 4RJVA 2J7KA 4IFVA 3SBMA 1NH7A 4CP5A 4JV5F 4DWIA 1WOSA 4HLBA 3D6HB 1NSQA 1EKSA 4RPFA 2QYCA 4J7CA 4I69A 7FD1A 1ZTTA 3US5A 2FHMA 2ZBPA 5LJ3Y 1JKHB 1F9EB 4C3MA 2NS1B 3IRXB 3IWXA 2RQCA 1JX4A 4GRSA 2CPZA 1U02A 2MKJA 2Z2MA 2D3UA 1X5PA 2QLJB 3VALA 2FZGB 3UDCA 4ES2A 1YVFA 1B3TA 1WSRA 1HNWF 1TMJA 2B5JA 4WKRA 3KHHA 4YR3A 1URNA 2ZKTA 3A8KA 3B4MA 4NXNF 4ZVGA 3TEGA 4WK1A 1AUDA 1B0VA 2XWYA 1XK8A 3CCLS 2BM1A 1JXEA 1SUQB 2BANA 2ZOMA 3FQLA 3Q8PB 2B3TB 5J1EB 4M5GA 3UCUP 4QWEA 3DGPA 3VAIA 3WC2A 2ROGA 2OH2A 1W2BR 2HWHA 1N88A 4FYVB 1Q86T 1X5OA 4NWBA 2WHOA 2CG8A 1KN6A 5J1PA 3NNCA 3C6TB 2V67A 1MWYA 1N0VC 1KTVA 2LA6A 2QFIA 2V69A 2J7WA 4NLYA 4F4XA 1LXNA 4RZRA 1RAIB 2FC8A 3N9UC 4OHVA 3DI6B 4KHRA 1ZAWA 3DRRA 2IM1A 3W9JA 1Q8BA 3IS9A 4NXMF 1FWPA 3KJFB 3O5TB 5I3PA 4Z37A 1FJGJ 1UKUA 5D0RA 4DV4F 4UF4A 3Q2SC 3RUBL 1UA0A 1B70B 1XN9A 4ZCLA 4DR6F 1TL5A 3OL6A 1DURA 2W2PP 4EGLA 4R8UA 4NCGB 1X9WA 3GJTB 1FDBA 2HGMA 1KC8T 4FF4A 2WONB 3ZZRA 3J7YU 5JMNA 4P7TA 1OS5A 1SIZA 2QIFA 2IHR1 3Q2TC 2QRRA 1P27B 1BQMB 2JRSA 4RX6A 1U1MA 2R7UA 1N5TA 1HNZJ 1C1CB 1RWXB 5ETVA 4J9LA 2WTFA 2VQFF 3GR1A 4B9TA 4B17A 1N54B 6FD1A 3QYYA 4RNFA 4J9VA 1SL0A 2BE9B 2CQ0A 4Y3CA 2B43A 2HNZB 3R9LA 4CO2A 1S12A 3DYAA 4X4TA 3CJ3A 3FSYA 3M2UA 5HBMA 5E3CA 3NNHA 3CGIA 3FRYA 3R6LB 1PO6A 3OHBA 5KOXA 5KFIA 1MSWD 3BO2A 4O4GB 4N77A 5DQIA 3Q86A 1QSYA 4YN3B 4LBHA 4CLPA 4ZP8A 1FTCA 4LRFA 3DRPA 5K5MA 2KJVA 1YTYA 2DJWA 2I5JA 4ZPBA 1X5SA 2CG4A 2GA7A 2YKOA 3D67A 3O6QA 2ZM6F 1FRIA 4XTTA 3EX7B 3NMAA 3TJ8A 3MFIA 3NY0A 1CJKA 2DK2A 3UO0A 4X4PA 1HW8A 4CO4A 2KL8A 4MFBA 3G9CA 5FIIA 4C8LA 2KHCA 2GAGC 2XB2D 1CQMA 1M5SA 4WYLA 1V6HA 2A0FB 2AJFE 2RDJA 1SJ4P 4F4KA 1T9UA 1S72S 1TR0A 1I1GA 2JX2A 2VIHA 1D09B 3NS6A 3FSIA 3VAJA 2OEKA 1A6LA 1FI4A 2L9DA 1TK0A 2AT1B 5M2UA 3V81B 3SDEB 3H5YA 2UVVA 3HHLD 3I96A 3PW5A 3NS5A 1M0SA 2BKNA 3N01A 4EMDA 3LW5C 1JLBB 4K4ZA 1AROP 2OP5A 4OZ2A 2GHWA 3SFGA 1UZDA 2KT5A 5IC4B 5HP1A 3LWLA 4QBUA 3HHKA 2E9RX 2HFOA 3UN2A 1IR1A 4K4WA 1DJ0A 4C0BA 4FYDA 5K14A 4CH1A 3SQGA 4I6AA 4OZJA 4ILRA 2GCFA 2IM0A 3NBPB 3CCQS 3T5KA 2YNIA 2Q1LA 3LAMA 2H3EB 1TMMA 4C8MA 4B3SJ 1HWKA 3K58A 4HKQA 5H9FK 3BR9A 3I9V9 4OYMA 4ZVHA 4HTJA 4Q8EA 4O3NA 3CD0A 3W65A 5GMKa 4ZITA 2BJ1A 3BM7A 4KPCA 4RW4A 2UXDF 1TL7B 2MQNA 4LR7A 3PFOA 1RT7A 4WXWA 5D78A 1KLMA 1X7VA 4GMKA 1WHYA 3POTB 5C5JA 3MUMP 4DL2A 1TL7A 5LMUJ 4DUTA 3T3FA 2RRAA 2G2OA 6AT1B 3IO1A 2BANB 2GHPA 2U1AA 4K8RA 2R2UA 1U0HB 1LWCA 1O6XA 3KK3B 3T9NA 3V5RA 3RBZA 2G2YA 3LP0B 1S6OA 3P8BB 4X4NA 2BE2A 1YBAA 1FA0A 1LWCB 3KK3A 2OMLA 4ZPCA 3AJ2A 4K4XA 1XR5A 1VYAA 2B4PA 3GG0A 2VZ9A 5J2NB 4DU8A 2DPIA 1Q1KA 5K8OA 2FLLA 1K0VA 3NOCA 5HSPA 3I4PA 5BR8J 2DTJA 2PMHA 3DI6A 2CUYA 3JQKA 4UW2A 3KLHB 3JAMY 4CZCA 1VI7A 4E98A 4NE9C 1VC5A 5HVFA 2LFVA 4NZ6A 4OLPA 1UJ5A 2HZCA 2NUUG 1JLQB 1PC4A 2RMLA 4ETZA 1HD0A 4KH1B 3Q8YA 2RU9A 3PJ9A 4FN5A 4LSNB 2J9DE 3BSOA 3TA0A 1KSPA 4Q8FA 1M5VC 3CJKB 1WHVA 1Q78A 1GQEA 4R8UB 4CH0S 3T1HJ 1FT8A 1S0MA 2NR0A 4WP8A 1AW0A 5U47A 3NLCA 1V5VA 2EVZA 2RS2A 2DNLA 1SQFA 2RILA 4KSEB 1F3FA 1TL3B 4NLQA 1RTJB 4W92B 5B0EA 4Y2CA 1XEZA 4BC9A 1RKJA 3PKMA 1JLAA 2OLWA 2M2BA 4CYUA 2DIVA 2VHGA 3ZZYA 2KXHA 4DDFA 1QJHA 1VISA 9ATCB 2U2FA 4I4BA 2X7IA 2J9EA 4MK8A 3DXBA 4W98A 1X4GA 4X64J 2OHDA 1IBKF 1S48A 2Z8QA 3EZ5A 1UJ6A 1RT1B 3AX5A 2XHWA 1SKWA 1TV6B 4KYZA 1AA1B 3L9ZA 3LWMA 3LGNA 4AYBD 2A6MA 3NGTA 2MZSA 3S6EA 2LMIA 1WD6A 5ETPA 4DUYJ 3JXOA 2BM0A 4PYDA 1TP7A 3FBBA 2YKPA 3N0VA 3QO9B 4TU7A 3SZ2A 4CLLA 2NXUA 4CWBA 3I55S 3CPWR 2BDPA 1FO1A 2HQGA 1U8WA 1UTAA 2FHJA 1F2GA 4ZVUB 1UVLA 1FRKA 1VLYA 3IA0A 1UEKA 3CC4S 4N8NA 1GMWD 2CQBA 3LPEA 3GCXP 4PEOA 1DTQB 3HKZD 3NGKA 3V6DA 1VBYA 2HFSA 4ECVA 3MGJA 3PHTA 1KQKA 2DR7A 1VRUA 2DRAA 4B3MF 1FRHA 3H4DA 2HSEB 4CIOA 1U1RA 5AXMA 2DNPA 1U1QA 3NNAA 3DLKB 3JYTA 1RI7A 4W4MA 3UPFA 1FDAA 2CPDA 2VBWA 1SBRA 2KRBA 2ACYA 4CO1A 3ZZPA 2QT7A 4D3GA 2MHEA 3CE8A 3OSNA 3TYTA 3SV4A 2XSFA 4I2PB 4ES3A 4HI2A 2M7SA 2D68A 1IBMF 1OMSA 3DLEA 3GSDA 3UW1A 2KM8C 2HS0A 3BR8A 1IBCB 3MMAA 5AJ3J 3GILA 2NREA 4UOFA 4WCEQ 4WFAQ 3QJJA 2JLFA 3ISNC 4FVMA 4YY3J 1M90T 2F4VF 3AXMA 2D74B 2POKA 4Q5VA 4GC7A 5F8LA 4DFJA 3NWRA 2LP4A 1EQ0A 1WUUA 4F36A 3VQTA 3TARA 2GMLA 1RQ0A 4ZP6A 2G2ZA 2M5YA 1VRTB 3W63A 1RWUA 3IC1A 4O3PA 1PYSB 1XMQF 2FVRA 5CYQB 2JEGA 1S9EB 2KVIA 4USUA 2XZ2A 2DNOA 3AA9A 3NBPA 2ZZMA 1T9VA 2C2OB 2KT2A 4AL7A 2UUAF 4B9VA 3RR7A 2CKWA 3ZZUA 4Z7CA 4P2MA 3Q8SB 2RSQA 3C16A 3J7ZT 3U02A 2BJEA 3TA2A 3CCUS 2HHUA 3MAQA 1FCAA 1HBMA 1LFWA 2FC9A 3QPIA 3ETMA 4GVBB 2UUAJ 3SCJE 2W9CB 3W5ZA 3DFEA 1BLUA 5KFOA 1HBMB 2R3VA 1SCJB 4HL9A 2DR6A 2VPWB 1QTNB 4B9MA 1K1SA 2DNKA 1S7HA 1WOOA 3KG1A 5B0AA 5KFVA 2ZBQA 4C8KA 1AYEA 3QGIA 2W24A 1TFWA 3MEEA 3GIKA 1TKTB 2WVFA 3D54A 4K5SA 4MKBA 2R8HA 5LMUF 4U6PA 1TU0B 4X62J 3KNAA 4M5HA 1S79A 2LCWA 3JSBA 4C98A 1RAEB 3PX0A 1K9MT 4DR4F 2IVMA 2AW0A 2FUG9 2YWHA 3IR5B 5KFKA 2ZBIA 3ITHA 3FCWA 2HS3A 2VD3A 5A6PA 2GVDB 2MPUA 3EPGA 2DO4A 4FDFA 4IG0B 1WDTA 1U8SA 2HNDB 3IGNA 5KFRA 3UN3A 2W7PA 3QZ7A 1RP5A 1DRZA 1MMNA 3R7NB 3K8WA 2NPIA 3NG8A 2B8PA 2HFUA 1F0XA 3QFHA 4KGXB 3FVYA 2LYVA 1KQFB 1M5HA 2MQMA 3OJUA 3BDEA 1VOMA 4LBPA 1QM9A 3D3CJ 2E5IA 1HNVB 5B0DA 1QDUB 3MECB 3QSIA 5EX0A 1NXIA 5LSOA 3BF4A 3OHAA 2DNHA 1L3SA 4IG3B 1HA1A 4URQU 4CLYA 2C3OA 3FKBA 4NLVA 4M5LA 4UOGA 5J2QB 2AGOA 3J7A1 4ZVQB 1HQUB 2JWNA 2Z56B 1N32F 3M8PA 4QZVB 5ETQA 4V19X 3WIVA 3CCJS 5A8WB 1HQUA 3NEKA 4IFYA 4WU2A 3RBDA 2J6SA 2KJWA 2ZHAA 1APSA 3J80Y 2B6AB 3DC2A 1VQYA 4K0KJ 5DETA 3SFUA 1TV6A 2ZOFA 3S8SA 1HHTP 2UVWA 2B9EA 4Z7YA 1UVIA 1HBUA 2L9WA 1N33J 2RRNA 4JI1F 1MU2B 2WBRA 3G6XA 1IN0A 2FYXA 2O67A 4F8RA 2PD1A 2ZFHA 2V34A 5DDOC 3M9MB 1OPZA 3RBEA 4PKDB 1E6VA 4FF1A 1NCLA 3CJRA 2DGTA 3RBXA 5DM6Q 3OVAA 1X0PA 1TUGB 1Y00A 2A1BA 3HSGA 3ILOA 3K57A 2VJUA 5I3QA 2EFOA 2XHCA 2F63A 5J1EA 1LNQA 1R31A 3NAHA 2XS7A 3RW6A 3MEGB 3R5JB 5LMNJ 1VK3A 2AZ3A 2W1BA 4O44B 5IT4A 1NK9A 3M2RB 4RU2A 4ILLA 1C1BA 1FESA 2XBPA 2XYPB 3KKFA 1RSCA 5CCLA 4Q43A 4LF7J 1WF0A 3M2RA 5HJYA 2CNNB 4MJKA 3A13A 1KD1T 1K47A 1T9YA 4QPTA 4L3KA 1D9DA 2Y1IA 2VA2A 1A9NB 1ZM9A 4L3NA 4Y2AA 5ETMA 3J7AN 2JFDA 2AX1A 2WZ1A 3K2YA 4NA2A 4ZIVA 2MQQA 1RCXB 4EU0A 4AE5A 1Q82T 4G1QB 4KGKA 2KN4A 3G8SA 5IT9U 2GX8A 3NCQA 1S1TB 3HFVA 4DV5F 4AQYJ 3DN9A 1KP6A 2YNFB 4AQYF 2BXJA 1NB7A 4E0DA 4LF1A 2LQBA 2DH7A 3ELHA 3MM8A 2Y3YA 4A8QA 4NZ0A 1LW2A 4DR2F 4PQAA 1YSJA 2W2MP 3UNYA 3ZZTA 4KE5A 2VFSA 2OTJS 3EVMA 1WG1A 2AF6A 2Z4PA 4RW7A 3SIPB 5KFCA 1RA6A 3D6MB 3QIPB 1ZZFA 4DF4A 1VQNS 2HFNA 1X9SA 2VG6A 3PDNA 4KHMA 3R7SB 1GMWA 1C4AA 4OI0A 2QJ3A 5EWEA 4XPEA 3OD2A 5HN0A 5HQMA 2LXUA 3QRRA 4I1TA 1G4CA 5D6GA 3TQ1A 2MTLA 1PJ5A 2YNHB 4ZJLA 2BQRA 2C2EA 4J90A 4DFMA 5C24B 2KZZA 1MG7A 2BJ9A 2GIFA 2GJIA 1HMVB 5ETKA 3G6ES 4RBVA 4A46A 5C24A 1XNRJ 4JYAF 1VJQA 4NLWA 3H5UA 4NLDA 3ZTQA 2ZBCA 1WJ9A 1V3RA 4NLSA 2I9SA 1J5EJ 1RWWB 2DGVA 4K4SA 1KQGB 3OQ2A 4FZVA 1SV5A 2D9OA 2W4DA 5KFSA 5AXNA 1T02A 2J8SA 5DG7A 2A2DA 2I8EA 2IJFA 2OPQB 3LANA 4YDXA 3IG1B 2BKOA 3NGRA 4BWJA 2ZH7A 3PRBA 2IFXA 2VL1A 3N28A 4HHUA 2XNQA 3V2UC 4WTYA 3GQCA 4IR1A 3V4IA 2Y8WA 9RUBA 3R2CJ 4C8ZA 1IKXB 3OTEA 1NAQA 5KFTA 3HJFA 3ULHA 4F0HA 3E01A 1SC4B 2WK4A 2CJ9A 2J9CA 3H20A 3FNNA 2ZHOA 3K5NA 3RB4A 2ALYB 1FK9B 3G96A 2NLWA 5C2CA 3MR2A 4DL6A 1N34J 3TO8A 3QWPA 4DR2J 1SJ3P 4OX9F 4UZCA 3V6JA 3E8OA 1TUVA 3MMBB 1N8RT 4ZPTR 3E2EA 5BJRA 4DL4A 1HYSB 2HHTA 2CQDA 3NCRA 5FLXU 1YJWS 3DOKA 4F02A 3CIZA 3O44A 3DLGB 2Q43A 2OAUA 3D1HA 1FX4A 4LSZB 4DL0C 2HGNA 2MZJA 2OPSA 4DV0F 5B09A 2ZJRQ 1WHXA 3AD7C 2XTDA 2BOAA 2C2ZB 3MAAA 5IV4A 2HMIB 3BBCA 3VVUA 3G82A 1R7IA 4A8XA 1RCOB 3C46A 2CRLA 2IIHA 2HMIA 2HBQB 5B08A 3CMAS 3LP2A 3G82B 5D0EA 5BR8F 3UVJB 4XO0A 2E7VA 1C0UA 2JSXA 2PIIA 2RT3A 3HCXA 4L73A 4X84A 5AT1B 4AT1B 2BKPA 3QMQA 3TZXA 3QSYB 4YS2A 1NKBA 1D8YA 2V68A 4ICLB 3HVTA 2CPEA 2GQ2A 4KKOB 3W62A 2Z2ZA 4F3QA 1F5BA 4K2XA 4RW4B 1NPKA 3PW2A 2HHWA 1YDLA 2FJXA 4C8OA 1NMEB 1JLGB 2M0GB 1Z1ZA 4G1IA 1GEHA 2V8HA 2Z30B 3AHPA 3VZHA 1OY6A 3I9ZA 3J81Y 3HT3A 3VAHA 4XPCA 3OR2B 1UVNA 5DO2A 1BC6A 2H54B 4B3TJ 3N6MA 1NJZA 3OR2A 2IMWP 1RHUB 2ZZNA 1EX8A 3RU0A 3WHIA 2YXLA 1HWJA 2OO4A 3AX2A 1KWMA 3TA1A 4A48A 1HL6A 2MJNA 4QJVA 5KT3A 2RRBA 2YH1A 2J0SD 4ED6A 3CC7S 3RRHA 3MPVA 3CCMS 3HHNB 2CZ4A 3I82A 3CB4A 4RW9A 4P10A 4NLRA 2P9CA 2IBOA 4DR6J 3OFEA 4QW8A 2MKKA 1IBKJ 3N79A 4OHYA 3ZFVA 4LSNA 1Y5LB 3HP6A 3M9OB 1S1XB 2YNFA 4GKKJ 2MKYA 1IUJA 4OZ0A 4JI3F 4ZVFA 1HQ2A 1S9GB 1VIOA 1YJTA 2RF2A 3W2WA 2P5VA 1P9YA 3MCMA 2BQ3A 4LF6J 1AZSA 3FEYB 3K89A 2WBMA 5CZVA 2XY7A 4IRDA 1WSVA 2CNKB 4C6AA 1WG4A 1PILA 4X4RA 2HHQA 1S6PB 2VH7A 2VG6B 3MCOA 2EFQA 3GONA 2CQGA 3ENWA 3K59A 3GTYX 2QA4G 4KH0B 3FBFA 5CAAA 1BQNB 1SVDA 1VCTA 2EXUA 2FTRA 1YJVA 5HJXA 1U09A 3DYAB 2CJKA 1YWXA 2BJ7A 3WX8A 1J27A 3DOLB 2WVEA 4QR0A 4A8OA 2N82B 4H4MA 3HZEA 4F4YA 2QMXA 1WEYA 4F04B 3FZBA 4J9MA 1QSLA 4PWUA 4TXSA 4O4GA 2KXFA 1RTIA 1D8ZA 3THPA 1HQEB 3SI8A 1RTDA 2AP6A 2UVRA 1NM2A 2MLZA 4TYAA 3CWJA 1RTIB 1Q5YA 1S1WA 2AEMA 4OI4A 2AWZA 5L1JA 3DRPB 3B8HA 3TW0A 2CNOB 1WELA 5I4MA 2CVEA 4DPYA 2QTWA 2V8PA 2QFJA 3BGLA 3BO4A 3IAS9 2CQHA 3HI9A 3RB0A 3M8RA 3PNIA 3OVBA 1ZA1B 3O1LA 3BSNA 2BUNA 2XYHB 1X4CA 3ENQA 3ET6A 1QY7A 2VBYA 4IOCQ 1EJ7L 2IDLA 3GFZA 2F1FA 4YB7A 4DS5A 4CO5A 1UUJA 2KKHA 2F4VJ 3H4BA 1HNZF 2J0WA 1L3VA 2DH8A 2NPFA 4PXCA 3HLUA 3KHGA 2XY5A 5E5NA 4YUDA 4JUZA 4YDDB 4JI5F 1BD6A 4DSFA 1P8GA 2YKQA 5A8KA 2OELA 1ACMB 4DR5J 2ADBA 2DISA 4DG1B 4K4VA 1NDPA 2HZAA 4MK7A 3H25A 1X4FA 2LDIA 4ECWA 4GKJF 3ADAC 1QE1A 4M95A 5F9LA 1NHVA 2FGCA 3ZTOA 3KLIA 1MMLA 2CXEA 4MT1A 1XWLA 4CCHA 1RHKB 3MAAB 3MM6B 5J2MB 5F8HA 4Q2LA 4IH6A 3W61A 3GP9A 3R6GB 4LIRA 4DJBA 3C14B 3FCVA 4FPRA 3L95X 5D3GA 1RISA 1NSKL 2XMVA 3UVJA 1T7PA 2BA9A 4WP3A 3MPUB 4ENOA 2GIQA 1EAYC 5GMEA 2XY6A 1HNXF 2LVWA 3ZZZA 4DI6A 2PEHA 5B0GA 2W01A 2AX0A 1M1GA 8ATCB 1RUSA 5DQHA 4ZVEA 4X4OA 1IR2A 2IA0A 2IAJB 5HLFB 1RTZA 2LU1A 1NLKL 2H1YA 3POTA 4OYZA 2UUBF 4WF9Q 4DL7A 2UZAA 3I5CA 1SL1A 5KG6A 2C2DA 4ZVOB 1KRPA 2B8QA 4DPUA 3W64A 4Y2KA 3LQVA 1HHQA 1X8DA 4N8OA 2ZH3A 1PBUA 4G1PA 2JDJA 1WHWA 4OJ1A 4Y2IA 4DQRA 2B4OA 1N5YA 3W2VA 2F65A 3PW7A 4DSEA 2AGQA 1T0TV 4JYAJ 4WZMA 4DSLA 1WORA 2ZITA 2EC0A 1UAWA 1OWXA 3I0RB 1R8CA 1AXQA 1NUEA 3GE9A 3DOMB 2EBEA 3UR0A 3EXCX 1U2RA 1WC1A 2FGOA 1RHMB 1G2EA 2PA3A 4C48A 2F9JA 5F3TA 4ELVA 1FD2A 2GVDA 5EN1A 4EZ6A 3M8QB 1Q95G 1PBAA 2VICA 2FJBB 5L8RC 1TVRA 5K8PA 4HR2A 4QQBA 4PPZA 4UY8T 4ED1A 2A10A 2HIYA 5A6WA 4PZVA 1WG5A 4OIXA 2V2VA 1HR0F 1DTTA 3I5BA 4H4KC 3CDAA 4YHHJ 2HWIA 4HEA9 4L75A 1UEVA 1J5OB 2W8KA 1TAUA 4PXEA 2GGPB 2N7YA 3QAEA 5FDLB 5GAHI 1CLFA 2QLBB 1UWAA 2B9XA 3ISZA 4KRWA 1S76D 4HACB 4NMXA 1E6YB 3PIOQ 4DZ6A 2XLIA 2ASYA 4C97A 5GADU 2K7KA 3CDEA 1XIQA 2OI2A 4IDKA 4J37A 4GC6A 3M8ZA 4NA3A 5D4NA 1CULA 2B6AA 4P2SA 1U1NA 1M5KC 3MOJB 1R6YA 3BKUA 4IDKB 3MPWA 1SH2A 2VOOA 3SXLA 1HQEA 2EFGA 2K1RA 3CO9A 4R5PB 2C3UA 3ZXWA 3T1AA 3PJXA 5HK4A 2X3GA 5HANA 2JEFA 1S6UA 2LEAA 1TKZB 2LEBA 3MD3A 3QT7A 4XDDA 4JI4J 2G9OA 4O0NA 2K2PA 2BACA 2VB6A 3I87A 4LIWA 4AXJA 4LFCF 1JJ2R 2I6WA 4WFYA 3UQSA 4P52A 5C25A 4QWAA 2AYEA 4U7CA 4OZ3A 3B82A 2R9LA 1U6ZA 2AMCB 4O44A 3IBFB 2CJYB 3CJ5A 5H9FJ 2VQFJ 1D9FA 1KVJA 3HVRA 4WPAA 4JV1A 5F8GA 2QYGA 4ZN3A 2YWEA 1HBNB 3NWGA 2OPPB 3AJDA 3GCWP 4I2PA 5IM0B 4L76A 2K8GA 1SJQA 4PCQA 5KFMA 1MW7A 3FEXB 4YY3F 3A1YG 3BJYA 2DNQA 3DXSX 1IR0A 4RW8B 2VFVA 4JI3J 4GKKF 2HFZA 3F0NA 4NCGA 4DG1A 1GK8A 1U4BA 3QGHA 1CQNA 1HIYA 5DLGA 2OTLS 3L7OA 4K4YA 1Y5IB 3R5BA 1NRKA 3HDSA 1LW2B 2VFRA 4C11B 1FF2A 1JNZB 3JTOA 2CQPA 4KB7A 4TY8A 4A8YA 1VC6A 3L7UA 1NSAA 2XMTA 5EWGA 4ED0A 3CMES 1DARA 4FS1A 2PEBA 1S9EA 3D5MA 1QAXA 4JI6J 2XGQA 3IWLA 1YRUA 2RAQA 4LFBF 4UQTA 1QD1A 4HI1A 5F8JA 2MLYA 3U1NA 2UXBJ 4M94A 3HSZA 3HO1A 1R43A 1G1XA 1DBDA 4ZLJA 5HMXA 4GVBA 1ZTWA 1EARA 1I3OB 2VPYB 3IM9A 1RT6A 1Y5NB 1OPIA 2ABYA 3GIIA 2H4YB 3ZTPA 3Q24A 1JJCB 5AXKA 2C2KB 5BYRA 3MTJA 1KLMB 3BYRA 4AXIA 5AE3A 3JAMU 1VQSA 1P1LA 1FHTA 4J91A 2FD2A 2DGWA 3MEEB 3DLHA 2XS5A 3P6YC 2WVCA 5IWAF 2L3MA 3CJ8A 3W2VB 2DRDA 3NP5A 4LF9F 1RT3A 1H74A 2CNLB 3DHXA 3PRVA 2LQ8A 1HNIB 3EVWA 1WEXA 1XMBA 4Y6IA 1U48A 3FFIB 1DLOA 4WYWA 4QR2A 4ZDNA 2OFGX 4CLKA 1Q5VA 2E7XA 3E01B 3GB0A 5EDWA 3EMTA 1WI6A 2MKCA 3KXDA 3GV5B 1HR0J 1OQ6A 3F56A 4JI0J 4WFBQ 2P6SA 2VC0A 1PYTA 2D3O1 4J9NA 2LXFA 3SV3A 2V1SA 2E5LF 2HHHJ 1R0AB 3TJAA 1REVA 3R2DJ 1VK8A 3BH7B 3O2IA 2VG5A 3OW2R 3D7SB 4FF2A 5E41A 1LKZA 3GWCA 3PYGA 2YWGA 2W9BB 1U6BA 2UVUA 1U2CA 4NLUA 2V8GA 2BW7A 2XGPA 1YG0A 3DOKB 4PXDA 3BPDA 4CLZA 1IQTA 2OPRA 1AT1B 2IVYA 4P2FA 2DNRA 1Q81T 3W9IA 1RABB 2YX1A 3OFFA 1H7WA 4ZJOA 3A12A 5L9XA 5A8RB 5SZTA 1H38A 3PO5A 1H6KX 1WKKA 4FF3A 4Y0FA 4KFBB 2JEJA 2CWXA 1S1VA 1UW4A 2RD5C 3FSXA 3MM5A 2X51A 4UTGA 3R5GA 1SH3A 3LP2B 3O8WA 2J76E 3JS9A 4FXWA 2NXEA 3ZO7A 3NL0A 1GMUA 3G6VA 3V6HA 2C2MB 4DHVA 1ZH5A 2AJ1A 2KZMA 1FEHA 1VS3A 1R6VA 2HGLA 5T14A 2J7UA 2PI5A 2Y1JA 4U96A 3QGPA 1K73T 4ALZA 2ZOGA 1RT7B 4QIEA 5E3AA 5D77A 2B5JB 1RWPB 1X9MA 2CWKA 1DAXA 2PSZA 4NMLA 2IVFB 2VKRA 4ED2A 4Z2XA 2BJDA 1HARA 2FHKA 3ONQA 1QUVA 1UCNA 3PFEA 4ZPDA 3R3TA 4U8VA 5SUHA 2YPYA 4X64F 1RLDA 3SSRA 2XCAA 1ZZNA 1NK5A 2GJFA 1KHWA 1HLWA 3FEZA 1R0CB 2IRUA 3DRSB 4X2BA 4CLUA 4IR9A 3BGUA 1T05A 3FBEA 3M8YA 2NZ4A 2I0XA 2AU0A 3CNQP 4ZMMA 1EB0A 3M7VA 2V4RA 3PTWA 4F4AA 2IA6A 5DZ6A 1HBNA 5IM0A 2ZH9A 4LF4J 1R8BA 1RAJA 3HF5A 2HHHF 2FJDB 1CJVB 1VGYA 2HLUA 5D8HB 4ECZA 4DMZA 4GVLA 1NK7A 2X1AA 2F3JA 3TZZA 1TL4A 2MZTA 3AA8A 4LVOP 3OVSA 1XMOF 4FBUA 4K4TA 4RLEA 4P72A 2B56A 2RF2B 3KUEA 3KG0A 4RW7B 2KB2A 2O5DA 2DR5A 3KFWX 3QT6A 4MMOA 5CYMA 3FMBA 3MD1A 5D15A 1G6BA 3NAIA 3HZGA 2DXFA 7FDRA 2DR8A 1UVJA 2NZCA 2HQIA 4LF2A 3C66A 4M5JA 2E9ZA 1T8EA 3PW0A 5CABA 4X62F 1IWGA 3KK1A 4DUZJ 2DY1A 3CIMA 2DXEA 3UFCX 1FRXA 5GAGU 3DOLA 3FC9A 1X5TA 3OTCA 4XDCA 3O3LA 1U47A 2OSRA 4M5KA 4WJBA 3B54A 1GAOA 2JZ5A 3H2UB 5IWAJ 2C22A 1WC0A 1X4DA 4TNOA 1UL3A 1ZM2A 1A0OB 2HHSA 5LMNF 1MMDA 1H3DA 1UFKA 1ZA2B 2ZC3A 5T41A 4PWDA 2CQ4A 1RU1A 4DQIA 5I3UB 5CA5A 2HK3A 1JLEB 4JI8F 2F8HA 1KKHA 2HVDA 2Z2YB 2C2NA 2WVDA 3GYGA 1FE4A 1GTEA 3P96A 5I3UA 4CH7A 4ATNA 5L1IA 1NZAA 1TZ0A 3D28A 4KO0B 1RK8A 2PFDA 2N4DA 5FD1A 4P75A 4OQJA 3V6DB 1Z2LA 4K0KF 4KGZB 1VRUB 3WQPA 4YP3A 5E7OB 1DQ8A 2JNJA 2LQJA 2B9WA 2QLFB 2QL5B 3BYPA 3FCHA 3KG4A 4NLTA 1CJKB 4JV0A 2UU9F 3GSIA 4DL3A 1NHUA 3TAMB 1HWUA 3G2XA 5CYJA 4ID8A 1WDDA 1HFEL 1XR7A 1PAUB 2J9DA 4IG0A 5G4DA 2VODA 1VFJA 2UUTA 2RNEA 2V63A 2V50A 2YPZA 1BQXA 1C2PA 1H72C 1XBWA 2GVZA 2YX7A 5GMDA 1QVGR 4TY9A 1BXNA 3GLJA 4QIGA 2DGOA 5IC6B 4FBTA 1NDKA 2ZD1B 1KOHA 2E1AA 4FYXB 4RUCA 2KVQE 3I31A 4CT8A 2XULA 3VAGA 2QLWA 2XI2A 5IOLA 2ZJPQ 4ZP9A 2VG7A 3KUHA 3PXGa 1GMVA 5ETLA 3R1HA 1O51A 2UP1A 1VQPS 1QE1B 1U26A 4IG3A 4LF5J 4CLWA 2DPJA 1YJNS 3CO0P 4RKUC 5J2QA 2V94A 3C2PA 2KFZA 1Q53A 3DU5A 3IBWA 1WACA 1B4SA 2D3ZA 3D0IE 5DJBA 3GIMA 3RRGA 1RZMA 2LEPA 3MM5B 1UVKA 3KNGA 2AYMA 5D3GB 1U45A 3MZIA 2ASJA 4ZPAA 2OEJA 5K9FA 4DV7J 4PUOA 5L46A 2CDRB 5JXSA 3J81U 2R8KA 1J2VA 4ECXA 1SPBP 2BX6A 4NCBA 3AOBA 2ZEJA 2XO7A 1JLGA 3VGSA 2NSBA 1SL2A 3QT5A 3DDNA 4BHQA 4EO8A 1OIAA 2A3JA 2R42A 4OJ3A 2XLJA 4WWSA 1HWLA 4J9UE 5KT6A 3DGPB 4B3OA 3P3DA 4Y65A 4K4UA 1DHMA 3DRSA 1Q8KA 1MN7A 3GU0A 1O0PA 2B7CB 2YX4A 2ZUAA 2BW2A 4FYWB 4ZCKA 4F3MA 4WKYA 5DG8A 1T05B 1GH8A 1OSDA 5IT9Y 2C3PA 1C1BB 4DX5A 5KAKA 3K8VA 1DQAA 1JIHA 2MKIA 4F2RA 4ANCA 2DNNA 1NK8A 1MLAA 3RB6A 2R7TA 3TAPA 4ZCMA 1VBZA 4J9SA 4QYZJ 3TRGA 2MY8A 4P71A 2V4QA 3RAMA 2XMJA 1JB0C 5G0RA 2BVZA 1JLQA 4CRJA 1FRLA 4X65J 2VUGA 5G0RB 2HBRB 2IDEA 3DMJA 1DQ9A 3RGIA 1IKVB 3BQ0A 4YOEA 1F3VA 2X1GA 3Q89A 2BJ3A 5C42A 2P9EA 4EZ9A 5KFDA 3A3NB 3M4XA 3HHLB 4USTA 5KFPA 5IFMA 4ECQA 2VU5A 1S49A 2CJAA 2IM3A 1BQNA 4MIBA 3Q8RB 3PV8A 2O66A 4HT7A 1S5ZA 1CJTB 1XC9A 1SB6A 2JC0A 2NXJA 2OSQA 3A3OB 5ETSA 2MZ1A 4X66F 3OLBA 2GJ2A 2XS2A 5KT7A 5GAHU 1OYDA 2CQCA 3LGMA 4C3KA 2B9YA 2GV1A 2LA4A 4LREA 1TK5A 1RT1A 4I6YA 4YB6A 3VGVA 5GADI 4LSLB 1S1WB 2QA4S 1FERA 2K1RB 2MDAA 4GO7X 4B3SF 4AL6A 2EG2A 2DEJA 3L4BC 1XQIA 2V5HG 3W8PA 4CO0A 1FRMA 8AT1B 1SC3B 3GYNA 4IRCA 1TKZA 3VVTA 4NYPA 2E5JA 4QIWD 2HURA 3CULA 4ERDA 3OL8A 2A2CA 2G1DA 2HKEA 3TZWA 4OV6A 2NYHA 3M2VA 5BYSA 5A2QY 4C0HA 5HVHA 2IBKA 1Y3KA 4B9NA 1RWNB 2K3IA 1DTQA 4KIAA 3FMWA 2VOPA 3Q8UA 4CNZA 5KT5A 1OYEA 5HI7A 1WC5A 3UD3P 2DGUA 2EEYA 3OXFA 4U67Q 3V4IB 2KU7A 2EFVA 2ATLA 1C4CA 2LU2A 3CD7A 4CO3A 3HM9A 1JWWA 4DN9A 3JYTB 1LW0A 3WC0A 1NK0A 1NKCA 2W4CA 2RQ4A 3LUYA 1IKWB 4PABA 3I0SB 4ITSA 3WIUA 1U24A 3PACA 2QMWA 3D9BA 2UV8G 4KAIA 4H4KA 5THWA 4LFAF 1AUSL 3UDLA 4NRTA 4NYOA 2OEMA 2AGPA 1YRXA 2IJNA 1IVZA 2AV5A 2A6OA 3HFKA 2F7VA 2PGCA 4EFAC 5KG3A 2ZHBA 4DV1J 2HAFA 3TQEA 2AHOB 5EX3A 5KFAA 3TEHB 4DCJB 4ECYA 2H51B 2MKHA 2YKNA 3EUNA 3BBFA 2KXNB 3MM6A 1JJ4A 1RT4B 3GMGA 3T5LA 4DV5J 3C14A 5KFFA 3BH6B 1T9XA 3ILJA 5LT5A 3ILIA 4DV3J 2X1BA 1XNRF 3QRQA 3C3LA 4NRUA 4F67A 4C9DA 4F25A 2JVOA 2C42A 3BS9A 3HVWA 4OI2A 3AD9C 5T7LB 2IC3A 4LBIA 5I42B 2P8IA 4BC7A 3UE2A 1S6QB 1VBXA 3MMCA 3SEOA 4ED3A 4PUOB 3AY0A 1HWIA 4O23A 1R3NA 1S6QA 1LWXA 3K7RA 3Q8VA 2R7WA 1U1KA 4X4VA 1S9FA 4O3OA 5LJ5Y 4ED8A 2AEFA 3GIJA 4Y28C 5DDPC 4DF8A 4DSJA 4RNMA 3OL9A 2EWHA 5KG4A 4PAAA 2WRMA 4IOBA 2BE2B 4DBQA 4RUAA 1UFWA 3A8JA 1T03B 4NA1A 4P73A 2M9KA 2HQ3A 3HFZB 4M8LA 5CXTA 1RACB 1T03A 2DHAA 3SCIE 1FRJA 1TELA 1N6QA 4LJMA 1NJIT 4WFNQ 1PGZA 1NBEB 3HHEA 3D68A 1WKJA 3NOGA 2BBEA 2OD4A 3DM2A 5DS7A 1B0TA 1N32J 1TL1A 1NK4A 3R1LA 2IRYA 4DOZA 1Q0NA 3PJWA 2F8MA 1LK7A 2GAHC 4NL5A 4DXLA 3BN4A 3OXLA 2EI5A 4ZVPB 2FY1A 2ZH8A 2MGZB 1HYSA 2AJQA 3BGRB 2JLEA 4BLGA 4OX9J 3TUJC 1AZSB 3HKWA 2GFFA 1VQMS 2R7QA 1WF1A 2GGPA 1XERA 3MEKA 2XZDB 2YTCA 4M5NA 3GJRB 2OPRB 2CQIA 3I4HX 3H2VE 2HNYA 3NGSA 3GYXB 3TVYA 1BY9A 2BJ8A 4WXOA 5A8RA 4B3RJ 3D66A 4N47A 4CM2A 3KLFB 2GQQA 1QUPA 2VC1A 4TVAB 4CLFA 5KFQA 3EICA 1NJXA 2OJ3A 4DPOA 2MKSA 1FJEB 1KBRA 2YWWA 4R5PA 4B9UA 1HNWJ 1LWFB 5KTQA 3OTOF 4ZLLA 4UQGA 2WB1D 3VWSA 1RTDB 3QRPA 4NXNJ 1Q7LB 1SJ1A 1D1UA 2HHXA 4O3QA 4Q7AA 3H40A 1NJYA 2PI4A 3MEDA 4XIUA 4OYPA 4DX7A 5C2GA 5HL7Q 4ELUA 1D0EA 2YQ3A 4NI2B 4RWXA 4FKXA 3TR5A 2E9TA 3TUIC 2FJVA 3MEDB 4F7VA 5C25B 1RTHA 3SQOP 4F26A 2JH3A 3A3PB 3M2VB 3M6UA 4M1KA 4KTQA 3GJSB 1X4EA 2DXDA 3CDUA 4QPXA 2RQMA 2VASA 2VKZG 4TU9A 4QWDA 4ER8A 1VQLS 1YJUA 4WK3A 1CC7A 2W7AA 1IQZA 3RJMB 5J2PB 1R8PA 2FDNA 5KG5A 5KOWA 4IQMA 1V9OA 3IM8A 3I56S 3GFYA 1KFDA 3R8YA 2UV8A 2XMKA 1DFDA 2BV3A 2VBXA 2COLA 3W5XA 4WBFA 1IKWA 3CD6S 1CEZA 2AIRB 5E2QA 5LM7E 2Z58B 1VHFA 1WWHA 2YQ0A 4MKVA 3RAQA 2J6UA 2NQPA 4IOAQ 4K59A 4KJIA 1CBKA 4G3IA 3K5LA 2PFFB 1SI9A 2L41A 2GC8A 5B0FA 2AYGA 4DSIA 3CD5A 1YHQS 3RR8A 1SJFA 4OYWA 5DDQC 2PMWA 1NNDA 3BKTA 4CDIA 2H5IB 2O3DA 3RZAA 3MR6A 3AWRA 2F8EX 1S6PA 2G4BA 4UY85 2NXCA 4P6QA 4ANEA 1PG5B 1VDHA 1D3WA 1VRTA 1VQ7S 2HG4A 2XI3A 2ASDA 1X60A 2RS8A 2DNZA 2LKZA 2FHJD 1IM4A 1GX6A 2QSFA 3JSYA 2DHXA 5HQ8A 3GIRA 3QT8A 4J5OA 5I42A 3HJVA 1FNXH 3AQPA 2NXNA 3C19A 4M5MA 1V3ZA 2KDOA 3AT1B 2V8VA 2CADA 4C3LA 1ROFA 5H9EJ 1H2UX 2GO9A 2NYIA 2KRRA 2YY3A 4LMZA 2YWFA 5GAGI 1NH8A 4AUKA 3GZ7A 1KDNA 2L48A 3H90A 3DHWC 4MAKA 4QYRA 4RO0A 3C6UA 5EGYA 4F50A 1S77D 4LRAA 4NEZA 1PAEX 1JQGA 2JFKA 2FVPA 3SYZA 4DCPB 4C7QA 1F9FA 2WAQD 3M30B 5L9NA 4O3RA 1KHVA 1WOPA 1RHJB 1N5VA 2ZWOA 1ITPA 1T9WA 1UVMA 1D9AA 3CCTA 4PG8A 4DV2J 3T1YJ 2JVRA 4UOHA 3OFGA 2H48B 4OI3A 3DM2B 3C15B 3NGDA 3NCPA 1IKXA 3M9NB 4DR5F 1WNEA 1YQHA 3BPSP 1LFPA 2OMOA 2D41A 4M5DB 5MAOA 1R0AA 4X4UA 7AT1B 1YLXA 2C3YA 3T9ZA 2N7CA 3MURP 2QSWA 1OSCA 1N36F 4USJC 2HBYB 3VGUA 2BEFA 4FXDA 4JI7F 1XR6A 3K5MA 4H4OA 2HEKA 5AXLA 2Q6CA 4NLOA 2X1FA 5IS2A 3FZ2A 3N4WA 2XMAA 1RLCL 1BUXA 1Y0HA 3PG9A 4H4OB 4IO1A 1EKRA 4JP8A 5HP1B 3R27A 2KYXA 4ZPWR 4DR7F 1M1HA 3PEHA 1X4HA 4TYBA 4J9PA 3RG6A 1WI8A 2FHOB 4EBCA 4HACA 1WC3A 4DLGA 4F3OA 3HSDA 1YK9A 4Q44A 3SSSA 3DKDA 1GXTA 4LUBA 3KLFA 4PXBA 2OGUA 3HMJG 1S0VA 2HVHA 2YNIB 3PR4A 1NK6A 3QNWB 4LF9J 3E3XA 4QWCA 3FJ2A 1ZAVA 2Q79A 2BQUA 3GPAA 1I94J 4JI1J 5HLFA 2ZNZA 5EHHA 1PJ6A 4IH5A 5MLCV 3I32A 2UXDJ 5IQ6A 1IBLF 1E6VB 2B4VA 3CVKA 3HVTB 4KKOA 4LRDA 4LR8A 5GAEU 1WEZA 4RNOA 5ETTA 4F4WA 1I6JA 4X4SA 5CZXA 3TX8A 1PC5A 1X0FA 3LALA 3JQJA 1CJUB 5HAOA 4A8SA 2VPXB 1KQSR 2N3LA 2Q3PA 1LQ9A 2E29A 3CT9A 2ZH6A 4F2SA 3U1LA 2KHDA 2BYCA 3WBZA 2R4FA 3BQ1A 2PT0A 1L3TA 3PHEA 2EW9A 2ZKUA 4QW9A 1YBUA 2KG0A 4NCAA 4I56A 2E1RA 2B0GA 5J2NA 3QJLA 3DOMA 4DR4J 2ACMA 2IRXA 1BGXT 3IS9B 3EJMA 5F0UA 1HPZB 3AXKA 5BXIA 2YKMB 3KLHA 2XWXA 4L6V3 2G1HA 1ZM3A 2OPPA 4JI6F 2JC1A 1UWBA 1M5PC 2YKMA 3GV7B 2PO4A 4TLRA 4WIQA 1W7WA 3IWNC 1TVRB 2FVQA 3C8YA 3KHRA 3D3BJ 3ZTSA 4F0MA 2I38A 4MKAA 3HXMA 5B7WA 4A8KA 3CJKA 4RW8A 1YJ9S 3RRKA 4USKA 2FIUA 4FNIA 1KOOA 2F4FA 3PIPQ 2ZH4A 4BDPA 5HQLA 1SJRA 4I7FA 3ENVA 3Q23A 5EWFA 3DU6A 3QATA 2MZQA 4TY8B 3SCLE 3KHLA 1VQ4S 3P49B 1GNKA 3KLEA 4OZLA 3HHLA 1U1PA 1PSDA 3M05A 4TU8A 3P5BP 1VJWA 1YZ6A 4CM0A 1BMQB 1F9HA 4F0KA 1YI2S 2HZVA 2MB0B 4NXMJ 5RUBA 4UUWA 4BCAA 3JB9k 2DHHA 2GS8A 2DCUB 2YNHA 2C28A 3KUGA 4YB5A 1VQ8S 3EYZA 4NYZA 2ATCB 2NCKL 1SQGA 2HRYA 4K50A 2QO3A 4JOUA 3VAMA 3T5HA 3W3SA 1Z4UA 1JJHA 2V2ZA 1I51B 2IMOA 5DDRC 1VQ9S 4KBIA 3AB2B 3DCAA 2ZBRA 1TTHB 2MSSA 3BEGB 1EQMA 5DRKA 3QQCD 3QWUA 5ETOA 4ELTA 5HATA 2UXCF 1Z2ZA 2V2KA 3R97A 3WDOA 1NDCA 1UEUA 2EFNA 4PQUA 5D0HA 2RUGA 3BKFA 3OR1B 4OMFG 2VJVA 4M5IA 3RTVA 2WW4A 3PW4A 1NKEA 1DY3A 1Y11A 3WX4A 4MKYA 4J9QA 3HD2A 4KO0A 4PQUB 1U49A 4YR0A 2ZH1A 2DGSA 4OZNA 5E33A 5EUHA 4ZS6A 3OJSA 1T94A 2A18A 1RT3B 3RW7A 4ZOSA 3IG1A 5D4PA 1KS2A 1UPPA 4MFBB 5D4LA 4B9SA 1MNEA 1X4AA 4DX8H 3H8YA 4DV3F 1NDLA 2VFTA 3TAMA 3H5XA 2RDDA 4Y34A 3CXCR 2RH3A 5ETNA 1SKUB 3EPIA 3HX9A 2M3DA 3UWTA 3PCOB 1VQ5S 3JSRA 5L39A 5KFBA 3K5OA 5JJBA 2GVZB 1Q79A 2KG1A 1N4LA 4J9RA 5LL6d 4YHHF 5B0CA 5LSRA 2LECA 1KONA 3ZZOA 5A2QU 5L1KA 4BWMA 1LK5A 5HVGA 4ZJQA 1ZYQA 4JV5J 3EDRB 2QA2A 1RWVB 3LAKA 4KV8B 4ANDA 3JTNA 4ES1A 2W8LA 3Q83A 2QA1A 2VG7B 1OY8A 3CF5Q 1QSSA 2W9BA 3FGVA 1M1KT 4KV8A 3S7RA 1KFSA 2M8DB 2KT3A 2OPSB 3M1VB 3P45B 1WC6A 1UA1A 4DV2F 3W60A 3T1YF 4NEYA 1R8AA 1RT5B 4XAKA 3ENAA 5F8NA 4UOCA 5K14B 4OHZA 3TZYA 4B9LA 5K20B 2ZUGA 1RAOA 2R2RA 3BREA 2QL9B 3PKYA 2Z0GA 2B51A 5J2MA 3IRXA 3LP1B 3FBCA 5H1SV 1MWZA 3MDFA 2KFYA 3OXGA 1ELOA 1S0NA 2KFNA 2MQOA 1NO8A 1BWVA 4Q0BB 5K8NA 2MZRA 5KFHA 2XLKA 1S59A 1O8BA 4DS4A 3R5CA 5M2PA 5KFWA 3MXHP 1FNOA 4C0OC 4WFZA 2VQEJ 5HMWA 2Z57B 2I1RA 3KMSA 1VBKA 1N33F 1SXLA 4TLQA 2HK2A 3TNVA 3EGNA 1FVQA 1VC0A 3LP0A 1EZZB 3TOQA 1HI0P 2FB0A 1OO0B 2AJ0A 5ADZA 4PRFA 3MM9A 1FJ7A 2RB7A 3ETOA 4I68A 5F3ZA 2UUBJ 1B7YB 1U7LA 1GFWB 3C6TA 4V1Ak 4ED5A 1NPRA 3IAM9 3ZZ0A 4UT4A 2CZVC 1HPZA 5K8MA 4NASA 3DRRB 4OX6A 5LXYA 2QN6B 1P1TA 5HROA 3GFHA 2IYIA 1URRA 5IXUA 4WZQA 3B4DA 5KFLA 1T9TA 2E7WA 3TJ9A 4YQWA 1ZM4A 3GG1A 2CFXA 2Q6BA 4PR6A 3BQ2A 1RJJA 1FNMA 4A47A 1ZETA 3H42A 3UD5A 4MYUA 4A4JA 4JI7J 2DR9A 2ZH5A 2ZH2A 5C42B 2IY5B 2QLXA 2MGZA 4R0EA 2H5JB 4IFVB 1QAYA 4DN0A 2FPHX 2E5LJ 3AX3A 4CNYA 1YJRA 2GQCA 1DTTB 3MF5A
chains in the Genus database with same CATH topology
5CYMB 2Y1RI 4RW6B 2J6TA 3UD4P 3PR5B 1KTQA 5A0YB 3MFHA 3CCRS 1FVSA 4E8UA 3I5AA 1TKXB 2DCLA 3KLGA 5CQGA 5DG9A 3UCGA 5A8WA 1P9QC 2HNZA 3DLJA 2BR0A 2BOPA 2R8JA 2R7OA 2EPIA 3AB4B 3M8SA 4KC5A 4NX9A 4WU3A 3GV8B 3ICLA 3VZIA 1QLNA 5F41A 1TFYA 2BZ2A 4LQ3A 4I6WA 4NLXA 4OHXA 4FNHA 4OJGA 3G8TA 1S97A 1SQEA 3D2WA 2J5AA 1JLEA 1FDDA 1SUQA 4YB1P 2E5GA 5L1LA 1HBOB 3SSQA 2AD9A 4RUHA 4B3RF 2YH0A 1U6FA 3F41A 5IZHA 3MR5A 2ROEA 1LV5A 2VPZB 1HBOA 1N0UA 1IQTA 2D7SA 3NRBA 2O1PA 2LQ9A 1K1QA 3DLKA 3BSAA 1EETA 3M6VA 3VCDA 4ZKAA 3MPYA 3T6BA 4W90B 2DT9A 1IXKA 4USHA 2XTEA 1EETB 2EFPA 2GNKA 4PG7A 3MM7A 3CUNA 2PE8A 4MIAA 3FQKA 3D0GE 1RYRA 4NLPA 4R0JA 3HHDA 5KFJA 2IM2A 1A7GE 4OI1A 3OTDA 5A8KB 4BS2A 4DSKA 2CIMA 1FXRA 3BN7A 4ZLPA 2WONA 2YKNB 5GAEI 1WF2A 3DNCA 1L5UA 4OL8A 3EGWB 4YFUA 2ILZA 1JLCA 4BBYA 4QIFA 3QIPA 3WZ0A 1C1CA 3H59A 2V8DA 5CYQA 4MYTA 4IUFA 3K5PA 2M8HA 4I64A 3SQGB 3LP1A 2GW8A 5T7LA 2CJQA 2DH9A 5DGBA 3D1QA 5HBMB 3P5TL 5LSLA 1JLFB 2R7RA 4ILMA 4EUVA 1T3OA 2ZVSA 1S1UB 4ECTA 4OLOA 2M52A 4QWBA 1QTMA 3AH6A 4PWDB 3CDWA 3OUYA 4EYHB 2ASLA 3OLAA 1EP4B 2D3OR 3G4SS 4OX7A 5D4OA 3C6UB 2VBZA 2MMYA 2LQ5A 3ZC4A 1N5YB 4H54A 4B3OB 3L3CA 1FTRA 1ZPVA 5CD4H 4DV7F 1H0HB 3M30A 3THTA 1QAJA 3KTQA 5KFEA 3ITHB 2UUWA 4OV1A 3QLHA 2N4CA 3H98A 1TL1B 4U7UK 4DV1F 1KLNA 2MXYA 4ECRA 5JUMA 3CSKA 1GXUA 4MIWA 1N5SA 5GVQA 3SDEA 3BGRA 2F9DA 3CJ4A 4EO6A 1NJWA 4OHWA 2AYBA 3TVZA 1IKYB 4TN2A 1AFJA 1IKVA 2W4PA 1JLBA 4QIVA 3H5SA 1U25A 2E1MC 1FJGF 4IQXA 3VTIA 4DFKA 3RB3A 2YNGB 4RW6A 3T6JA 5FDLA 1Y9OA 3R5AA 2ZNYA 5KG0A 2CPJA 5A0YA 5DGAA 4KT0C 2YNGA 3LO3A 2FLNA 1TKXA 4PG6A 2DBBA 1Q16B 2H5EA 2RVJA 4KGMA 3PX4A 3UR3C 2WSCC 1JKHA 1U2FA 1C0TA 4HDGA 1S1VB 1C0UB 2R7SA 4TKTA 1WTBA 3BGFA 5E3PA 1TKDA 5KFNA 4OZ1A 5JVGQ 5BYQA 4LSLA 2OIHA 3VAKA 2VQEF 2W9AA 5F8MA 1IJFB 3I6PA 2ILYA 4LVNP 4IRKA 1YITS 2YVSA 3K0JA 3NMRA 3MTKA 3KOAA