4NLUA

Poliovirus polymerase - g289a loop mutant
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSASGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
total genus 142
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nluA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nluA02
1N4LA 2WOMB 2HMIA 4NRTA 3RBDA 1RYSA 2YKMA 3DLGB 5KFPA 3GIMA 4YR2A 3IN5A 1TKZA 2OPPA 4KAIA 4FS1A 2UVRA 5DGBA 1S0OA 3FQLA 1VRTA 5KG1A 5KT7A 2BE2A 1JLCB 1HNVA 2UUWA 4IG0B 1D0EA 3MTKA 3OHAA 3G6XA 3UPFA 3CJ4A 3NL0A 3C6TB 2BQRA 1HNIB 3H4DA 1RT6A 2HNYA 4Q0BA 4R8UB 3PW2A 4NLOA 2UVUA 2DPIA 3CDEA 4FS2A 2FVCA 4IH5A 2WTFA 1RT2A 2OPRA 3QO9B 3JSMA 4QWEA 5C24A 5CYQA 2VG6A 3QIPB 1RA6A 3PW0A 1TVRB 4IRKA 2R8GA 2JLEA 1C2PA 4O4GA 3HVTB 4IDKB 4RNOA 5C25A 3MR3A 3PJWA 4YR3A 1HQEA 4NLTA 1JLEB 1JLQB 2VG5A 5DQHA 2D3ZA 3IG1B 1DLOB 5KG2A 2YKNB 3KHHA 5HP1B 2HWHA 2D3UA 2WRMA 2V0NA 3D28A 2IA6A 4MFBB 4MK7A 3BSOA 1RT3A 4H54A 5FDLA 2FVQA 3TVKA 4KFBA 1JLBA 2V4QA 5HROB 3KHRA 1TQLA 4O3PA 4MK9A 5EWFA 2IJFA 4WYLA 3I0SA 3E01B 1IKWB 5HBMB 2R8HA 3CVKA 4TY9A 3IS9A 4B3OA 2W9CB 3C6UB 5KFKA 2JC1A 3DDKA 1N6QB 2B5JA 1NHVA 1IKXA 4WZMA 1EP4B 3DRSA 1TKTB 4GC6A 5J2PA 3BJYA 2ZKUA 2OPQA 3MEEA 1NHUA 2XCPA 4IOBA 3IGNA 3DLGA 2ILZA 3MEDB 3MR5A 4DL2A 1TL3B 4QW8A 3RB4A 2YNIB 2F8EX 1SUQB 1RTIB 5KFZA 5KG5A 3GQCA 4X2BA 4ECTA 1I6JA 1BQNB 1RT5B 3DLEB 3KLFB 4ED1A 1JIHA 1JLCA 3FQKA 3BQ0A 4IG0A 4DL5A 4MIBA 2HNZB 4K4TA 4DG1B 1SH3A 3PJXA 2WCXA 3C6TA 4DEZA 1HNIA 2ASDA 4O44B 1S9EA 1FKOB 1TP7A 1QE1B 3MEGA 5K14B 5KT4A 5EDWA 4IKAA 4NLXA 1IM4A 2HWIA 3H2LA 1HQUB 4QWAA 3QIPA 4K4UA 3SI8A 1C0UA 1TVRA 3PR4A 1S6PB 4LSLB 3KK3B 3HVTA 2RF2A 4I2PB 3UDLA 5L1KA 1D1UA 3QLHB 5L1IA 4F4WA 2YNHB 3NAHA 2JEFA 3V6DB 4ECWA 2I5JB 3IG1A 2W9AA 4H4OB 4Q8FA 4IQXA 1N5YA 1DLOA 4K4VA 2YKNA 2BR0A 3MR2A 1XR6A 3HHKA 4IFYA 5HP1A 3CO9A 4G1QB 4Y2CA 1SV5B 4PUOB 3DMJB 3RAQA 5KFGA 3V4IB 2IAJB 5F9LA 4OL8A 3OL8A 1JLGB 3DRPB 4TYAA 5KFQA 2RDIA 1IKWA 5HBMA 3NKYA 2W9CA 3C6UA 1EETB 4EBEA 2ATLA 5KFJA 2EC0A 2OH2A 3SFUA 1EP4A 2GC8A 4XPEA 3M9OB 4KKOB 1S9GB 5J1EA 1RTDB 1TKXB 4J9RA 3MEDA 4F4YA 4LQ3A 3EPGA 4ID5B 4URQU 5D3GB 1T05B 4PWDB 1RTIA 3BGRB 2YNFB 1BQNA 1RTHB 3DLEA 3I5BA 2AGOA 3QGIA 3CDUA 3UQSA 2ZD1B 5I42B 5HLFB 1S0NA 3I0RA 3DOKB 4K50A 4TYBA 5KFAA 2HNZA 5L9XA 4XPCA 3KLHB 4DG1A 3FDSA 4WYWA 4K4YA 5CYMB 2GIQA 2IMWP 4MIAA 1FKOA 1QE1A 3CWJA 3H5UA 4ZVHA 4NLUA 1BQMB 2IM3A 3RAXA 1SH0A 4K4ZA 4KHRA 2UVWA 1HQUA 3FRZA 3H98A 4ZPCA 1Z4UA 3OL6A 2QV6A 5EUHA 1S6PA 4LSLA 4NLPA 3DI6A 4I7FB 4KHMA 4O3OA 5KFWA 4I2PA 3KK3A 2R2SA 2RDJA 3BQ1A 3QLHA 4KO0B 4J9SA 2YNHA 3FSIA 4ZPBA 4I2QA 2HAIA 2I5JA 1C1CB 3T5LA 4H4OA 1HYSB 2IC3B 3V81B 4JV2A 4RNFA 2C2DA 4G1QA 1JKHB 4QPXA 1N56A 1RT4B 4ZPDA 1SV5A 1S10A 1LWCB 3RB0A 4WFXA 4Y34A 4PUOA 4NCGB 2GIRA 4QWBA 1T03B 5KG4A 1S1UB 3I5AA 1FK9B 5F8LA 3LP2B 3GV8B 5EWGA 3H59A 4K4WA 3V4IA 1JLGA 3DRPA 5F9NA 2ALZA 2C28A 1S1XB 4HYKA 1J5OB 3DM2B 1EETA 4JUZA 4R5PB 2FVPA 3I5CA 5F8NA 2W9BB 3KHLA 4NRUA 4KKOA 4RW6A 3KK2A 5J2NB 1RTDA 1TKXA 2YNGB 2IBKA 1IKVB 4FBUA 2AGQA 2ASJA 1ZTWA 4ID5A 1T05A 1GX6A 2AWZA 3FFIA 5D3GA 4PWDA 5F8IA 3BGRA 3CJ5A 2O5DA 2YNFA 3M8PB 3PZPA 1JLFB 1RTHA 3T19A 3NGDA 2ZD1A 2E9RX 5HLFA 4O3RA 1DTTB 1LW0B 3OL9A 3DOKA 3BSNA 2UVVA 5F8GA 3H4BA 1REVB 4MH8A 3CJ3A 5CYMA 2WHOA 1HPZA 1DTQB 2R8IA 2WOMA 5KFNA 2JEGA 3IGVA 5J2MB 1IKYB 3JYTB 5KFYA 3MEEB 2XC9A 5DG8A 1JLAB 2DPJA 4ECZA 4TY8B 3NBPB 2ILYA 1N48A 4F4ZA 1KHVA 1TL1B 4QWCA 5L1LA 2JEIA 5KFCA 1C1BB 2XGPA 4ZP8A 1W25A 1MU2B 2WONB 3LALA 4I7FA 3GV7B 4HKQA 3T5HA 3GYNA 4KO0A 3NMAA 1SH2A 1S4FA 2UUTA 4IH7A 3LANA 2XCAA 5F8JA 4DL3A 5J2QB 4O3NA 4R8UA 3KHGA 2IC3A 3V81A 1HYSA 1LWEB 5DG9A 4K4XA 2FLLA 1JKHA 3QO9A 3G6YA 1RT4A 2IM0A 5JXSA 4ICLB 1S49A 4NCGA 4XO0A 1T03A 1S1UA 4LQ9A 1FK9A 4URSA 3N6LA 3PR5B 4IDKA 3DLKB 4ZP6A 3ITHB 1HMVB 1S1XA 3HVAA 4DL7A 1JLEA 1JLQA 4NLYA 2FLPA 4ZP7A 3D5MA 4LSNB 4URGA 5I3UB 4R5PA 4EYIB 4RZRA 3DYAB 4ECUA 4WFZA 1KHWA 2BRLA 3ISNC 4KV8B 3VQSA 5KT3A 2W9BA 4NLDA 1JX4A 4JV1A 2BQ3A 2HMIB 2E9ZA 5F8HA 1IKVA 2YNGA 4MFBA 2FJWA 4F50A 3GIKA 3QZ7A 2B43A 4WZQA 1TKZB 3HVWA 5KFFA 5HROA 4O3QA 2W8LA 3TAMB 3M8PA 3E01A 4TLRA 1JLFA 3PHEA 4ED2A 3KLGB 4RUCA 1DTTA 4YP3A 1LW0A 1N6QA 1RTJB 3V6KA 1TKTA 1REVA 3MFIA 1JXLA 4YR0A 5KT5A 5DLGA 4RW8B 3MR6A 2XI3A 5J2MA 1IKYA 1RT2B 3JYTA 2OPRB 1TL3A 2CKWA 1RAJA 5KG3A 3KK1B 2YNIA 1SUQA 2J6TA 1JLAA 1ZTTA 3QZ8A 3ICLA 4RW4B 4WFYA 3MECB 4TY8A 1RT5A 3NBPA 3M9NB 1FKPB 4ED3A 2WB4A 1T94A 3KLFA 1TL1A 3OSPA 1LWFB 2R2TA 2R8KA 4O4GB 1YVFA 4ZVFA 4Q43A 1MU2A 1NNDA 4NLVA 2VG5B 3G86A 4EO8A 4ECVA 1QAJA 4DL6A 1TV6B 5C42B 4O44A 3Q8QB 5KFVA 5J2QA 1S0MA 4IRDA 4RUAA 3E51A 1LWEA 5K14A 1RT1B 2C2RA 1ZETA 4RU9A 1K1SA 3T1AA 3BSCA 4EEYA 3KNAA 1OS5A 2W7OA 3KLEB 3KOAA 3H40A 2C22A 3DLKA 2XGQA 2FJXA 1HMVA 5KFTA 2W8KA 1S6QB 2BANB 3V6DA 2OPSB 3H5YA 1C0TB 4LSNA 3PW7A 3KJVB 5I3UA 2J6SA 2V9WA 3DYAA 1QUVA 1K1QA 4NZ0A 2CJQA 4KV8A 3QYYA 5KT2A 3OHBA 3BSAA 4PQUB 3IRXB 4NLQA 2AX0A 4J9KA 4WE1B 2D7SA 3TQ1A 4Y3CA 3KLVA 4RW7B 1S9FA 4ZPAA 4M95A 4Q8EA 3DMJA 2FJVA 4RW9B 3SFGA 4O3SA 2BQUA 2IAJA 4DL4A 3TAMA 1RT7B 1S1WB 2IM2A 3KLGA 4G3IA 5EWEA 2ZE2B 3QIDA 3EZUA 4YMEA 1RTJA 1S9GA 3V6HA 1S9EB 4KSEB 4WXWA 3N6NA 3QGGA 4RW8A 4ZHRB 1S1TB 3Q8RB 4ED8A 3MEGB 4J9NA 2RKIB 3DRRB 4J9QA 2AQ4A 5C5JA 2VA2A 2R8JA 4IR9A 2HNDB 3KK1A 4Q45A 4IRCA 3H5XA 1S1VB 3M8QB 2WK4A 1RA7A 3MECA 4RW4A 1C0UB 4K4SA 3Q8SB 1FKPA 1R0AB 2VG7B 2I1RA 1LW2B 5I42A 3RB3A 4J9MA 1LWFA 3PW5A 2FVSA 2J6UA 3MFHA 2RF2B 4ED6A 4IFVB 1XR7A 4RNNA 1S48A 3KLHA 2AGPA 1TV6A 2B6AB 2QE5A 5C42A 1N5YB 1WNEA 2E9TA 1MMLA 2D41A 3Q8PB 1UWBB 3G6VA 1BQMA 4IFYB 4QW9A 1RT1A 4TXSA 5KFSA 3UR0A 5KFLA 3GV5B 2R2UA 3DOLB 1GX5A 1T3NA 2FLNA 1RDRA 3OLAA 4H4MB 4F4XA 2VA3A 3LP1B 4KE5A 1S97A 1VRUB 3CIZA 3KLEA 5DLFA 4ECXA 4EYHB 1KLMB 1CSJA 2BRKA 3GIJA 1S6QA 2BANA 2OPSA 2ASLA 5JUMA 1C1CA 1C0TA 5KFBA 3KMSA 3KJVA 5J1EB 3H5SA 4KB7A 4FBTA 4NLSA 3OLBA 3IRXA 4MKBA 5DQIA 4PQUA 4WE1A 1LWCA 4RW7A 4NLGA 3PVXA 3KMQA 4ZP9A 2JC0A 5KFIA 4RW9A 4YQWA 3LP2A 4WXOA 3KLIB 1RT7A 1S1WA 3M9MB 5KFDA 5KFMA 4J9PA 1J5OA 4IG3B 3DM2A 3I0RB 5DG7A 2ZE2A 4EO6A 3LP0B 3EPIA 2XI2A 2C2EA 2FVRA 5KG6A 5J2NA 4JV0A 4ZHRA 4Q44A 1S1TA 2YKMB 5DQGA 4ECQA 2RKIA 3DRRA 5KT6A 4ECRA 5L1JA 2OPPB 4QWDA 3OL7A 2HNDA 4RNHA 4U6PA 4Y2AA 3T5KA 1S1VA 1VRTB 3M8QA 4ZVGA 1R0AA 2BE2B 1HNVB 2VG7A 1LW2A 4NLWA 4ED0A 3DI6B 4ED7A 5KFXA 3QGHA 5DGAA 4IFVA 4MKAA 4I2QB 3CJ2A 1RT6B 2B6AA 2HNYB 5KFOA 2JEJA 4Q0BB 1XR5A 1DTQA 3BQ2A 4ZMMA 3HKWA 5F8MA 3BREA 5T14A 4KBIA 1U09A 1UWBA 5KFEA 4TQRA 4ECSA 4TQSA 3JSMB 5KG7A 5C24B 5CYQB 3RBEA 2XWYA 2VG6B 3BR9A 3DOLA 3V6JA 2V4RA 1QAIA 3NAIA 4H4MA 3N6MA 2W7PA 4GC7A 3LP1A 3RB6A 5KFHA 4J9LA 4NLRA 1C1BA 3LAKA 1VRUA 4TN2A 5C25B 5KFRA 2WONA 3CDWA 4EBCA 1HQEB 1KLMA 4IR1A 3GILA 4IH6A 4NYZA 4ECYA 4RW6B 3KK2B 3CJ0A 2R2RA 2IJNA 1RYRA 3MF5A 1RT3B 5FDLB 2AU0A 3OSNA 4ICLA 1JLBB 3ISND 4KFBB 3FFIB 4J9OA 4EBDA 4RNMA 2AX1A 3I0SB 3T5JA 4ZVEA 3KLIA 3ITHA 4MK8A 4U7CA 4B3OB 3IS9B 1HARA 4M94A 4IG3A 2B5JB 5KFUA 1IKXB 2IM1A 3DRSB 3LP0A 5J2PB 4R0EA 3GIIA 5KG0A 2OPQB 3PW4A 4O4RA 1HPZB 3LAMA
chains in the Genus database with same CATH superfamily
2QT7A 4LFCJ 2FC8A 1EX8A 3T6JA 1RLCL 3GFXA 2WZ1A 2AD9A 1Q82T 3BO4A 4R8UB 5HQMA 2ZBQA 2VIHA 3MTJA 2QSWA 3LGNA 5EN1A 2XTEA 2EKYA 3LUYA 2D3ZA 1DLOB 2Q6BA 1N52B 1SJ4P 4ANEA 1EQMA 5LJ3Y 2V34A 4MK7A 1RT3A 4H54A 4RLEA 1SIWB 2YY3A 2R4FA 4CLLA 5EWFA 3KNGA 2IJFA 4DUTA 1RTZA 3HXMA 3LW5C 2B5JA 4G65A 4KPCA 1EP4B 4A48A 1F9FA 2BYCA 3PYDA 2LCWA 3GQCA 1BQNB 3UNGC 1UA0A 1JIHA 2WCXA 3C6TA 4K2JA 3D2WA 3UDVA 1PKUA 1NAQA 1MW7A 1H72C 1C0UA 4F7VA 3IR5B 1WEYA 2XQCA 1T9UA 2DGVA 2YKNA 2AJFE 2YQ0A 3VAIA 1R8HA 3OJSA 1TUWA 2FQQB 4LRDA 3WDOA 2ZH6A 5MAOA 4J5OA 2HG4A 4OV6A 9RUBA 4JI6J 3HSZA 2UV8A 1FNMA 3DLEA 3ENWA 4C11B 2FJBB 2QA1A 4LF2A 1CJKB 2PA3A 4F67A 1Q8LA 2NZCA 1G6BA 4NLUA 1IBLJ 4HTIA 3OFFA 4NLPA 4CP5A 2R2SA 2HQ3A 1CC7A 4P75A 1IN0A 3IO1A 1Q8KA 2VFSA 2RQMA 1J2VA 4USHA 3CJRA 3DRPA 1R0BG 2I38A 3BN7A 3FVYA 2H48B 1TKXA 3BDEA 5DETA 2GMJA 3BGRA 3JB9k 2M8DB 3UVJB 1DTTB 3S6EA 4NXMJ 3K5MA 3AAWB 3MPWA 5E3QA 5KFYA 3G8TA 4RUBA 2HBYB 2DD8S 5HSPA 2FIUA 2AT1B 2IC3A 1VC6A 4NCGA 2RQCA 3KFWX 2VOPA 3MAAB 1JLQA 3TWZA 5I3UB 2OEJA 4JV1A 1UPPA 5F8HA 2UUCF 5GVQA 5CXTA 3CD6S 5CQGA 4E2FB 2V9KA 4RUCA 4NCAA 2VHGA 2EFPA 3ZC4A 5DLGA 2GX8A 3ILOA 1RAJA 2MJNA 2NZ4A 4WFYA 2M2BA 3BR8A 2ZEJA 2E1RA 1MU2A 3E8OA 4IO1A 2ZC4A 3MXHP 2PMHA 3GFZA 3SXLA 4PG4A 5K9FA 3MWBA 3KLEB 2J9CA 1T9WA 2BANB 2Q1LA 4FP9A 3PW7A 1PJ6A 5K8PA 2PT0A 5CH7B 3I4HX 4WP9A 3OVSA 2EFGA 2PC6A 3W2VA 1S9GA 3NS5A 3IM8A 4J9NA 1VOMA 4DHVA 5C5JA 2F40A 5A6PA 4WTOB 3O3LA 1S99A 2J6UA 3H8YA 4RL1A 2CNNB 2BOAA 1W2BR 1EKRA 3G6VA 4W4MA 3PTWA 2R2UA 5GAEI 1GXUA 2IYGA 6AT1B 2QSFA 3T41A 1ACMB 1QJHA 4OJGA 4PG5A 4PQUA 4NLSA 3M1VB 5AXNA 3O44A 1Q86T 2J7WA 3OR1A 1NK8A 3B8HA 3A3PB 5J2NA 1R27B 2A2CA 1OPIA 2BKPA 2EPIA 5EHHA 5KT6A 5AXKA 2BA9A 1QY7A 4OX6A 2FZKB 2HNYB 1R6VA 4TQSA 1SKUB 3RBEA 4W98A 4ETZA 2COLA 2WONA 1QSYA 1G2EA 4ZVOB 1Y3KA 3MEKA 2MB0B 3FFIB 4P10A 2A2DA 3OV7A 4KQZA 1P8GA 3PO4A 2VC0A 3LP0A 3Q0AA 4NEYA 4O4RA 4A8WA 1IBCB 3GIMA 2P2CB 2CQDA 1Q5YA 1I5OB 4JI1F 4QR0A 3OHAA 3O6QA 1RAIB 2ALYB 3FEXB 3TX8A 2GHWA 2FVCA 1FJGJ 1VQMS 3VHQA 5B0BA 1ZM4A 2R8GA 1JNRB 3V5RA 4A8OA 2JNJA 3DHWC 3OW2R 4QPTA 3T1HF 4KH0B 3AOBA 1AFIA 4KYZA 4DV3F 2DTJA 1XMOF 1NHVA 1FD2A 2BJ9A 2Y1IA 3DLGA 2HVEA 2F8EX 4A8KA 4UTGA 4IQMA 4FZVA 3PIOQ 4U7UD 4AD6A 3A13A 1WTFA 4DR7F 4CZCA 5FJ4A 3UDEA 1SCJB 3IG1A 4RBTA 2ADBA 4IFYA 1SV5B 2VV5A 1FEEA 3DGVA 1U1RA 1FVQA 3BYRA 1U2FA 3WQPA 4FYYB 4NX9A 2HBQB 3M32A 3M2RB 4LR7A 1MROB 3QAEA 1EJ7L 3WX4A 2ZUGA 4L76A 3CMQA 4F4KA 3PG9A 3HCXA 4K0KF 1S79A 3HFZB 3AH6A 2GVZA 2JFDA 1YJTA 3FRZA 4C7QA 3OL6A 3KK3A 3T5LA 2WW4A 4ITSA 2MEWA 1JKHB 2FUG9 3D7SB 1GH8A 3GJSB 4PR6A 5F9NA 3PCOB 2XNRA 3PRVA 2IA0A 2XMKA 4OX8A 1M5VC 4RW6A 3KK2A 3SCKE 2YNGB 1JLFB 2MKCA 1IWGA 1BLUA 3TJ9A 5D4NA 1UZHA 3TQEA 5DM6Q 3DXBA 1HPZA 1R8PA 2J9EA 1NDKA 4JI8J 2OJ3A 4NPOA 3MUTP 3VF0B 5T7LB 4WF9Q 4DV6F 2DEJA 5ETOA 1PYSB 3I31A 2KZMA 1KQSR 1X4BA 3KHGA 3B78A 3GLJA 3CO0P 1S1XA 4BLGA 3LH2S 3UW1A 3ISZA 3VQSA 4L72B 4JI2F 3HPOA 4TLRA 5GAHU 4M5GA 4DV5J 1YG0A 5F3TA 3MAQA 1TL3A 5HVGA 2CKWA 1SUQA 2NXUA 4DV7J 2WB4A 1UW9A 3LGMA 1ZZNA 4DV1F 3B82A 2LA6A 1TMMA 2GIFA 3Q8QB 1C4AA 3EGZA 3JSRA 5B7WA 4EEYA 4DFPA 1SJ1A 3NMRA 1OS5A 2H51B 1T0TV 1S76D 5C2CA 1ZPVA 2BM1A 1GAOA 4KV8A 1HW9A 3MM8B 2CQPA 1NJIT 1HI0P 2U2FA 4RW9B 4DR6J 4I1TA 1CJUA 3AA9A 2RKIB 3R7SB 3Q8SB 3M8QB 3MECA 1C0UB 5ETKA 4N8OA 1HBOA 1AFJA 3MFHA 4ED6A 5BR8J 2XS5A 2B6AB 2QE5A 5HMXA 4RR5A 3HHLC 4OX9F 1M5SA 4Z7YA 4XK8C 3I96A 3DLLQ 5EX0A 1VC5A 4EYHB 1KLMB 1TU0B 1WC0A 3KJVA 1VDHA 1N36F 4KB7A 4MKBA 1UWAA 1EQ0A 4ZP9A 2HBRB 2HK2A 3LP2A 4KY3A 1RT7A 3MOZA 2WVFA 3JQMA 2HHVA 3RW7A 2RQ4A 3ULHA 3UCZP 3TI0A 3FGVA 5LT5A 4LRCA 1X5PA 4C8OA 2B4PA 2VG7A 1LW2A 4ED0A 4USMA 4NYOA 1KBRA 3CJ2A 2N4CA 2MXYA 5F8MA 4Y65A 2B9EA 2I9SA 2A1BA 5K8MA 3PFOA 2KXFA 3EZ5A 2YKQA 1VBKA 1WF1A 2DGUA 4C3KA 4L6V3 1KD1T 2P6TA 2IJNA 1ZPWX 5KOWA 2UU9F 3I0SB 5E5NA 1NJWA 1PJ5A 2R7RA 1U6FA 3BBCA 1VQ9S 4FS1A 9ATCB 2EBEA 2D9PA 3NOCA 5KG1A 3IWNC 2KJVA 3GR0A 5FD1A 3CJSA 1F3VA 4E0DA 2KTQA 2DPIA 3GONA 7FDRA 2VG6A 4CYUA 1ZA2B 2JLEA 3BDPA 5H9FJ 2E7VA 1JLQB 3AQPA 4ENOA 1FRMA 1VLOA 2HWHA 3UDCA 1BXNA 5IM0A 4I6YA 1R3NA 2V4QA 4QU7A 2DCUB 1VYAA 4PRFA 4J9UE 1FEHA 3I87A 4QW8A 1WOSA 3PRBA 2Z57B 3CCTA 1Q7LB 1S59A 1J27A 2BJ3A 4MIBA 2YH1A 4DG1B 1FKOB 1QE1B 1Q8BA 3ENVA 3D0IE 4N41A 3V4MA 1N8RT 1GXLA 1U1MA 4UUWA 2YNHB 2DHXA 5HAOA 4N47A 5DZ6A 2JFKA 3DNCA 3MCNA 1FJEB 1T9YA 4OL8A 5KFQA 3SFUA 3W2VB 1S9GB 2YTCA 2BEFA 3N5BA 5D3GB 4FYXB 1B7YB 4UQGA 3C8YA 4BWMA 5KFAA 1RUSA 2AEMA 3K5LA 4C4WA 4K4YA 2DYAA 1VQKS 4I68A 4ATNA 4DUZJ 1Z4UA 1S6PA 5KFWA 2ZWOA 4I2PA 2DXFA 2L08A 4AXIA 5EGYA 3D6FB 2HAIA 4TKTA 1URNA 2CWXA 4CM0A 2VDHA 2XMWA 4WFXA 1ZYQA 4JYAJ 1OQ6A 1RCXB 3ZO7A 4JUZA 1ZZFA 4TU7A 2XMTA 4NRUA 5J2NB 1VQ8S 2AGQA 3BKTA 1YRTA 3SCLE 2X51A 1T05A 1VK8A 2YPZA 3GR1A 5EX3A 3AX3A 1VHFA 3I9ZA 3T9ZA 3TZYA 3OL9A 3ADAC 3RG6A 4PYAA 3A4TA 3VGSA 5GAGI 3OJUA 4MYTA 1CS4B 1WORA 2MQPA 3M6VA 4PYDA 1TL1B 1N5SA 2WONB 2Y1LB 4YB5A 4DPXA 1H73A 2KRBA 1SH2A 2UUTA 4USKA 3CCZA 3U27A 1EB0A 2HHQA 4BC9A 2RUGA 1WI8A 4HI2A 3AJDA 4URSA 1KVIA 2PI5A 5A8RB 3HVAA 1HL6A 4BDPA 1IKVA 1VFJA 2D1CA 3SCIE 2QJ3A 2FTRA 1XNRF 2RT3A 2AEFA 1LW0A 1RHMB 2SXLA 2XI3A 3HFVA 4NMLA 1RBLA 2MJUA 2HFZA 1T3OA 1PBAA 1RHRB 1IBMJ 2QMWA 4IRDA 5K14A 1WI6A 3KJNB 3E3XA 1A9NB 2LYVA 1QAXA 3NGUA 1FXDA 3VV2B 2W8KA 1K0TA 1PC4A 4OHVA 4Q8EA 5HATA 4ZPAA 4L73A 2BQUA 1J5EJ 2RS2A 4DFJA 1YIJS 3QIDA 4RW8A 5D15A 5HVFA 3D6TB 2WK4A 2CJXB 4F0MA 2KFYA 3CJKA 4NI2A 3KLHA 2JVRA 4XDCA 4MKYA 1UWBB 4IFYB 2DNLA 1IXKA 5CZVA 3GV5B 2XMJA 2BJ1A 1SQFA 2VA3A 1MMNA 1GT8A 5DLFA 3CCQS 2VFTA 5KFBA 2KYZA 1N5VA 1YWXA 3LPYA 3KLIB 3NGTA 4NZ7A 1J5OA 4X4OA 4DDFA 3VAMA 2DR6A 4LF5F 1NZAA 1U2RA 3DRYA 1R0AA 5KFXA 2E5LJ 2B56A 1VRQC 3BQ2A 3GMGA 4OMFG 3R5CA 1VHIA 4JOUA 3RB6A 3RZAA 4OHXA 4RO0A 1SL1A 3W8PA 5H1SV 4RW6B 3KK2B 2R2RA 3MF5A 2W2NP 1MNEA 2DGWA 1SC1B 4RNMA 1H2VZ 1FF2A 2G2YA 4IG3A 4KGMA 4K5RA 1U48A 2XULA 4R0EA 5KG0A 4P73A 1HPZB 4KIAA 2KI2A 4F2RA 1Z1ZA 2KB2A 4C8YA 3R97A 3FQLA 1S0OA 1FE0A 1HNVA 2UUWA 5AJ3F 2H4WB 1HNIB 1IQTA 2GGPB 1K9MT 2F7VA 2HFSA 2QA4S 1V3ZA 3HMJG 1HWLA 1SKRA 4IYQA 1YHQS 4LIWA 2RS8A 2HYIB 1MN9A 1A7GE 5HP1B 3THPA 4EMDA 3BSOA 4KHPJ 4I64A 2ZKUA 1JQGA 4I67A 3MR7A 4EU0A 1TL3B 1SUQB 3BQ0A 2RNEA 3PRDA 2DHGA 2UXDF 1O8BA 4IOCQ 5KT4A 4ES1A 1HQUB 4H4KA 3UR3C 2HQDA 4LVNP 4PQAA 2GHPA 1D1UA 1N88A 2CADA 4IQXA 2BR0A 3MR2A 4G1QB 1HNZJ 2HSEB 2XMUA 4YOEA 5J1EA 2DNYA 2ZHOA 4U9RA 2QFIA 3GSDA 3VAFA 2KXNB 2YNFB 2ZZNA 2ACYA 1PIEA 3I5BA 4X65J 2AGOA 4K50A 2V69A 4WYWA 3LWLA 3C16B 1B0PA 4OHWA 3H5UA 4K4ZA 1H2TZ 2MKKA 1ZM3A 2V8HA 4DX6A 2NXJA 4UOCA 1FRJA 3MD3A 3A8IA 1IBKJ 4AXJA 2UUBF 2PIIA 4QWBA 3I5AA 3LP2B 2YWWA 3AXMA 4GKJJ 1RAFB 4M5DA 1WKJA 4CH7A 2C3UA 2DIVA 2ZH8A 4J90A 5F8IA 3PZPA 1X4GA 3ZNJ1 1VQPS 2W24A 3GZ7A 2QYGA 3H4BA 4CI0B 1QSSA 1IKYB 2R7OA 2XC9A 2DPJA 1UAWA 4DUYF 1WC6A 3TAQA 3HD1A 1S5ZA 4JI0J 2B8QA 3MUVP 1O0PA 3Q83A 3N9UC 3KUHA 5AT1B 3M8WA 3QSIA 1TL5A 3KYLA 3UN2A 1FNXH 2W4DA 1GXTA 2E9ZA 3W2WA 1L3KA 5B0GA 5LXYA 4ZPVR 5A0YB 2CPZA 4ED2A 3KLGB 4OLPA 2VONA 1FFSB 4YR0A 1AROP 3KK1B 1JLAA 2OSQA 2FHJA 3M9NB 4USVA 3RYLA 3ONQA 4YY3F 1ZA1B 3ILJA 5J2QA 3E51A 1RT1B 2ZH5A 1K1SA 1NXIA 2W7OA 4JI4J 1XEZA 3CMES 2C22A 3G4SS 5ADZA 1WJ9A 3R5AA 1WELA 2MY7A 2IAJA 1GQEA 4O0NA 5ETVA 1HBMA 4USUA 4MT1A 1RTJA 3DCAA 2QL5B 2KHCA 3PM9A 5K8OA 4OHYA 4K4SA 4JV2A 3P45B 2ZITA 3PW5A 2WB1D 3OUYB 5GMEA 3EGNA 3OFGA 4ED5A 2A6MA 3C66A 3NCRA 5IC4B 2R7XA 2KVIA 2CVEA 2BRKA 1F5CA 2HGNA 3OLBA 3KMQA 1R31A 2JC0A 4C98A 2HRUA 1S1WA 4DR2F 2XM3A 1UFKA 1CC8A 1NSKL 3RJMB 3H0PA 2FHOB 1S1TA 1RAGB 2LDYA 2HNDA 2RAQA 4DMZA 4IFVA 2XSJA 2C3OA 2JEJA 3BREA 3PXGa 1U09A 5E2QA 2LU1A 4OJ1A 4UW2A 5C24B 4A8XA 1WSRA 3QWUA 4H4MA 1RHUB 4NLRA 2G0JA 3LAKA 4TN2A 1WG5A 4FPRA 2QTWA 1F0XA 4F04B 4ZLLA 1K44A 1FA0A 2KJWA 2AYEA 1FHTA 3AJ1A 4NMXA 1VQ6S 2A18A 2QLXA 3VAKA 3GIIA 2G2OA 4NRTA 1LK5A 2CZ9A 4NEZA 2DXEA 4C8KA 4WJBA 2ZM6F 3VGUA 1R89A 3MTKA 2HZVA 5ETNA 2WSEC 2R42A 1XIQA 3JSMA 4QWEA 4FF3A 3UD3P 4DQQA 3HVTB 2MZ1A 3PJWA 4OZJA 1UTAA 4DX8H 4LBPA 1HR0F 4KPYA 4MK9A 3QJPA 2WSFC 1IKWB 1SJ3P 1KNZA 4GC6A 2OPQA 2PMZD 3MEEA 2L48A 2NXEA 3RB4A 4G6VB 3J7YU 3C15B 4KT0C 3ZNUA 4P72A 3FQKA 3P4UB 3PJXA 3QQCD 3GJRB 5HI7A 4HACB 2F4VJ 5K14B 4MKVA 2BE7D 4ZCKA 2RSQA 2V68A 2MKJA 4LSLB 3TNVA 3PO5A 2CQ2A 2DGTA 3HHKA 2QMXA 4DR1J 1Z2LA 4DR3J 1QTNB 4B9VA 4TYAA 3KG1A 3RBXA 3PYGA 2GC8A 4FNIA 4LF9F 3W64A 1L5UA 2ZOMA 5M2UA 2DR8A 2DB1A 4ID5B 1RWMB 1EKSA 2E7XA 4TYBA 2HNZA 3BGOP 3KLHB 2P9GA 3W9HA 4MIAA 1XMQJ 3F44A 2PI4A 2CG8A 3R2CJ 3HKZD 2RDJA 3QLHA 3I4PA 3IWLA 2I5JA 3EVOA 2XO7A 3M8RA 2CYYA 1Y5LB 4OIXA 1WEXA 4CO0A 4L75A 3CTRA 4ZPDA 3D0HE 3OR2B 1Z2ZA 4R0JA 2GIRA 1SJRA 2LQJA 1S1UB 2CJBA 3H59A 3D54A 3HD2A 4S0MA 1J5OB 4R5PB 2YKAA 2OAUA 3FCVA 1R8AA 4AL6A 2OHDA 1X4EA 3TVZA 4LFBF 3TO8A 4NOHA 1MWQA 2B9XA 3FZ2A 1M0SA 5CYMA 2JEGA 5J2MB 4A8FA 1PAEX 3HHLA 1PG5B 4F4ZA 1FJCA 4OYMA 1MMDA 3L7PA 2QYCA 5F8JA 1HW8A 1D9AA 1Q53A 1GMWD 2FLLA 4ZDNA 2MSTA 3A8KA 1FK9A 1U24A 3MUMP 4URGA 1SC4B 4ECUA 2W9BA 1UP1A 1VJWA 2NYHA 4NYPA 3J7A1 5HROA 2Z0GA 1KSPA 3HZGA 3PHEA 2LECA 1NPKA 2CZ4A 3AHPA 1JXLA 4DV0J 1U0HB 3F0NA 3JYTA 2W25A 3NBPA 2UXBJ 3GU0A 1UEUA 3MCMA 3KDOA 1JJ4A 4A8YA 4OZNA 1UJ4A 1H98A 3G8QA 2YX7A 2XYGB 4XIUA 3K57A 4JI7F 1EZZB 3DLKA 1HMVA 2Y8YA 4DI6A 3QYYA 2Z8QA 5CHCB 4CO1A 3QSYB 3WC2A 2L9DA 3ET6A 4WXWA 3N6NA 4ZHRB 3DRRB 2DNMA 4CH1A 2R8JA 5KAKA 4IR9A 1CBKA 4WU3A 5HJXA 3H5XA 1S1VB 1RA7A 1YITS 1LWFA 2MGZB 4B3SF 1QUPA 4ZVQB 4RNNA 1TV6A 3UI3A 3CCUS 2GCFA 2D41A 2CXEA 4ELVA 2FLNA 4OYWA 3TA1A 2NSCA 3VTIA 5J1EB 3AD7C 4WE1A 2MKSA 4ZIWA 3IBCB 4EGLA 3AB2B 4LVOP 2XLIA 2JX2A 2HIQA 2WBRA 3DKDA 4Z2XA 1IJEB 1RHKB 4CLSA 2OP5A 2OPPB 2AJ2A 3PV8A 3T5KA 1HNXF 4CTAB 4U8VA 1GEHA 4LT6A 2DRDA 5D0EA 1DTQA 2M9KA 2XZ2A 2W7PA 1R6YA 3OTEA 3UD4P 2DH8A 3GILA 2XMAA 4E98A 4NXMF 2C3MA 1RYRA 1KOOA 3H42A 1RAOA 5FDLB 3AY0A 2AEJA 3T5JA 4LFAF 4ZVEA 2BX6A 3HHNB 1KFDA 4YN3B 2IM1A 5J2PB 1L3VA 3H25A 3CDAA 2VDIA 3IN5A 4KAIA 1V3SA 3Q22A 1D0EA 4I56A 1YX2A 2UXCF 1V3RA 2HFNA 3KXDA 2VFRA 3EGVA 3PW2A 1RA6A 2BVZA 1TVRB 2QL7B 2XG8A 3EXCX 3P8BB 5KG2A 2WRMA 3D28A 2MQLA 2JL9A 4UZCA 2IIHA 3OVAA 3IS9A 2WAQD 2DRBA 1TTHB 4HDHA 1JXEA 3POTA 3IGNA 4V19J 3AD8C 5AE3A 1Q79A 3JAMY 4WFAQ 1KONA 4Y2KA 1X5SA 5LSOA 1S6UA 4DJBA 2BXJA 5EDWA 2RDDA 5ITHA 4K4UA 3WIUA 4P6QA 4ILRA 3CB4A 4KGVB 3CC4S 4H4OB 1DLOA 3CO9A 4Y2CA 1LXNA 4PUOB 3PX6A 2IMOA 5IOLA 2IAJB 2F8MA 4RX6A 5DZ7A 1EP4A 2E44A 4DPOA 1G3OA 2WW8A 3SQOP 3CCLS 1WF0A 4PWDB 5E7OB 1BQNA 1S0NA 4ZJLA 2HVHA 4CLYA 1HHQA 3CWJA 2MQNA 4CLTA 1TZ0A 4M5KA 1QD1A 3C14B 3GCWP 4KHMA 2OEMA 4KO0B 1EHWA 2UUCJ 2LQBA 1X4DA 3FC9A 1NB2A 1U4BA 4Q5VA 3I5CA 3MM9B 2AP6A 2DISA 1G1XA 4I4BA 2OGUA 2AWZA 2ZH2A 5LJ5Y 4C11A 3T19A 1AYEA 4QIEA 1CJKA 2WOMA 4WFNQ 4DWIA 3CCSS 4CCHA 1N32F 5D78A 3T5HA 2QC3A 2X1AA 4IH7A 2C2MB 2DKOB 3LA0A 2E66A 2AJ1A 5DG9A 2ZUAA 4FN5A 1OPZA 3NY0A 1NBEB 3A12A 2J0QD 2X1FA 2H1YA 4OJ3A 4EYIB 3S8SA 1KHWA 4JP8A 1A0OB 3C19A 3M8ZA 4F2SA 2IRUA 3BS9A 1N33F 4PXCA 1AZSB 3UVJA 1DTTA 1N6QA 3DFEA 2YKOA 5SZTA 5KT5A 1ZTTA 1NO8A 3H7HB 4ECVA 2C3YA 4DSIA 3M2VB 2B0GA 2D69A 2NUHA 2Y1JA 1QAYA 1AUSL 4B3RF 4J9VA 4O0IA 3MAAA 2XGQA 4DR5J 5I3UA 3OHBA 2ZZMA 1RLDA 2AX0A 1S9FA 1NSAA 4A8SA 2CQCA 5D0RA 2ZH9A 2NLWA 3O5TB 4LRBA 4F3MA 4CDIA 3TUJC 4HT7A 2XYPB 3MGJA 2CQBA 4X4SA 3HF5A 2HFOA 2E9TA 4ZPTR 3MM7B 2D3OR 1T8EA 1X8DA 3DOLB 4CO5A 3KLEA 1ULRA 4Q2MA 2BANA 1KFSA 3THVA 3PEJA 4JI1J 4LF6F 4YB7A 1FWPA 3Q86A 3MMBB 4J9PA 1S6OA 2KDOA 3EPIA 3PDNA 4ZCMA 5L1JA 1D09B 4Y2AA 1WDDA 4NLWA 2YBVA 3SSQA 3T1HJ 2DNGA 4EI2A 3D0GE 5KFOA 8RUCA 2X3DA 3SZ2A 2V1SA 2MQOA 5GMKa 1Y3JA 4HHHA 1FFGB 1XMOJ 3C3LA 2ZVIA 4CNYA 2RILA 3D66A 2O67A 4CM2A 1IUJA 2H5EA 4LSZB 5U47A 3EDRB 2J7KA 3M1VA 2KFNA 4WWSA 1AUDA 1C4CA 3WC0A 1HARA 4UOGA 2JVOA 1IKXB 3DRSB 4OZ5A 1UZDA 4DR7J 4GKKF 1RYSA 5JMNA 5DRKA 3SYZA 5DGBA 2CQHA 3ZZRA 4FYWB 4KJIA 2HNYA 2HS3A 2V1TA 2MY8A 3FK4A 3BKFA 4QIFA 4P52A 3HI9A 2UUAJ 2M88A 3MR3A 1DARA 4CNZA 2GS8A 3VWSA 2D3UA 1BMQB 2EG1A 4PAAA 3MD1A 5HROB 2C2OB 2LEPA 1U49A 4O3PA 4DV7F 4K0KJ 3O8WA 2AYMA 2PDAA 2W9CB 2E1PA 2JC1A 4QYZJ 3MEDB 2K06A 2M0GB 1S4EA 1RTIB 4LIRA 2QN6B 3SI8A 3MPVA 1Q81T 2CPIA 1Y5NB 3QGPA 4USWA 4ERDA 2BABA 1U1QA 4OI4A 3D1OA 3V4IB 1RHJB 1TUVA 1JLGB 2E1CA 1P9QC 3CGIA 1RTDB 4A8QA 2RB7A 4YHHF 4F4YA 2EFQA 4DV6J 2CJYB 2W4CA 4AL7A 4M63A 3QT7A 1RHQB 4LF4F 2GVDB 1XERA 1I3OB 5J1PA 3R6LB 1HI8A 1HA1A 2QLJB 2CPYA 3CD7A 3MPYA 4JI2J 1FFWB 1U26A 4N77A 1SV5A 2R3VA 1T03B 4HI1A 1WHXA 2OFHX 2LXUA 3ZXWA 4U8YA 3KHLA 2VBYA 1U1PA 2KRRA 4WIIA 3M2RA 3EGWB 4M5NA 5MLCV 5HO4A 5IT9U 4DV1J 2VF3A 6FD1A 2BKNA 2ZNZA 4YDDB 1DTQB 5KFNA 1SL0A 2MPUA 2R7TA 2ILYA 4PWWA 4ZP8A 4P2FA 1WOPA 5IV3A 4DL3A 3MM6B 5G0RB 2VKZG 1JKHA 4CLFA 2IM0A 2AJQA 5H9EJ 3ZZTA 1FRLA 4NLYA 5D8HB 4FXWA 3MCOA 2GHVC 1JX4A 3M6XA 2FPHX 2HZCA 3CCRS 5ETTA 3HSDA 2YNGA 1LKZA 4F0HA 1Q1KA 4ER8A 4O3QA 2W8LA 1JLFA 1NCLA 4B08A 1DBDA 2LXIA 2YX1A 5B09A 3R5BA 4OX9J 4Q7AA 1PYOB 4YFUA 3QRPA 1HLWA 1U02A 4OI6A 5T7LA 4OZ2A 4EO8A 4DL6A 3R1LA 1U8WA 1ZETA 1I94F 1TK5A 4BCAA 3HSGA 5IXUA 2ASYA 1IR2A 4MIWA 4ES3A 2R9LA 4NZ0A 3C46A 1U7LA 2BOPA 3POTB 4EFAC 4J9KA 3TQ1A 4YEAA 4M95A 5CCLA 3DHXA 3NOGA 2FJVA 3W3SA 3AXKA 4DL4A 2LDIA 5T41A 3EVMA 4DQIA 3VGTA 2B51A 2JZ5A 2YX4A 2DO0A 4X64F 2XBPA 1NMEB 2AGPA 1U45A 1WNEA 2G2ZA 2N3LA 1WUUA 5KFSA 1M1KT 2UU9J 1WKKA 3OLAA 1NJYA 2DCLA 4DU7A 4N8NA 3ZZYA 4YB6A 1F5BA 3Q24A 1C1CA 2FZGB 1F2GA 3MM8A 2VC1A 5KFIA 4RW9A 4YQWA 2AJ0A 1UMJA 4EO6A 1T7PA 3DDIA 2VH7A 2YKMB 3LQVA 2RKIA 4U6PA 3M8QA 3QFWA 2MQMA 2LKZA 4ED7A 1WG4A 2DHHA 3IR7B 4MKAA 2B6AA 1KQKA 3ZTRA 1MN7A 1BQXA 3CDBA 1NDCA 5LSLA 2JOQA 1KLMA 4FKYA 3LGHA 4ECYA 2IVFB 3CJ0A 1NSQA 2M70A 3MOJB 4KFBB 1JLBB 2HQIA 2P5VA 1K8AT 2PFFB 4B3OB 3NGKA 2ZHBA 2WOMB 3QJJA 1NK0A 1TKZA 3AFGA 1JB0C 2CPXA 2MZSA 2Q43A 1L3SA 3PJ9A 4LF8F 3H4DA 3HSJA 4NLOA 1VIOA 4IH5A 3GG1A 2OSRA 5CYJA 5LMNF 3AD9C 1BHNA 4G1IA 3PEHA 4ZLJA 3D6MB 3MURP 1CQMA 2G4BA 3UCGA 1CQNA 1SQEA 4M5HA 2QA4G 2EK1A 2PFDA 3I0SA 2ZH7A 5HBMB 2Z56B 4PG6A 1Q78A 1N6QB 4F3OA 1HIYA 3US5A 1FRHA 2RU3A 2CRLA 2RUSA 3CPWR 4ZVPB 3FEZA 4DEZA 2DT9A 3OTBA 3W66A 3CC2S 5JVGQ 4EWTA 1VC0A 1J5EF 1CULB 3DU5A 3NAHA 4ECWA 1N5YA 2MZJA 4K4VA 3BZQA 3ZZZA 1PSDA 2CPFA 2XMVA 4DLGA 4EBEA 1B70B 4XPEA 2XY6A 3JTOA 2IHR1 2GQCA 3GE9A 4GMKA 2WBMA 4FXVA 2F9DA 3U7JA 2H9ZA 5IZHA 3QGIA 3UQSA 2ZD1B 2K1RB 3DOKB 4DG1A 3FUYA 1FKOA 1QE1A 1NJXA 1O5JA 3GPAA 4HVZA 1U6BA 2YNHA 3M05A 5GADU 4ZPWR 1DFDA 1HYSB 2VASA 2W2MP 1OSDA 3SQGB 1IQZA 1RWOB 1XNRJ 4Y34A 4OYIA 1F3FA 5IQQA 4K4WA 1DY3A 1YJVA 2ATCB 2N4DA 5BYSA 4DS5A 4FBUA 2KL8A 4QOTA 3W9JA 4J7CA 3I56S 2AJ4A 4ZITA 5D3GA 3CJ5A 2E9RX 5DM7Q 3Q8VA 5E33A 1LWXA 2HPUA 2QIFA 2YWKA 2ZJRQ 3WZ0A 3CE8A 4QWCA 2HK3A 4FYDA 2GMHA 3NMAA 1P9YA 4LF1A 3BBFA 3LANA 3MMCA 2I6WA 2EXUA 1T95A 3D3CJ 1X0FA 4PPDA 1V5IB 1DJ0A 4U95A 5KT3A 1ZS6A 2VU5A 2E7WA 1FWKA 1FJ7A 1QDUB 1TKTA 1Q7YT 1CS4A 4OQJA 2YPYA 1TL1A 2R2TA 2IRYA 1YVFA 1YI2S 1Q8IA 3KG4A 3Q2SC 1D8ZA 5HQ8A 2ZDPA 1KVKA 4RU9A 5B0DA 3T1AA 3KKFA 4PABA 3KNAA 4JI3F 4DCPB 3K58A 2J7UA 5A76A 3KOAA 5A8RA 2OPSB 1TK0A 1QUVA 4LF5J 5KT2A 3KLVA 3ELHA 1RACB 4DV4J 4ZJQA 1Q4RA 4ZKAA 3CSKA 4OJHA 3RRHA 2E5JA 4ED8A 2AQ4A 2DNQA 2CAJA 2L41A 3R27A 3OTDA 5LM7E 2FVSA 2LQ5A 2MLXA 3K89A 1Y00A 4FF4A 2XSFA 3UR0A 3L3CA 2HLTA 3NNHA 1S97A 1CVJA 2ABYA 3K17A 3BF4A 1S7IA 2ASLA 2V2KA 2Q66A 3WBZA 4X4UA 4F3QA 4C8LA 4DF4A 4USTA 2OTLS 1DQ8A 1RP5A 4P9SA 1SI9A 3DM2A 1RWUA 1T11A 5HANA 2Q6CA 4NL5A 4FNHA 3Q23A 2HHHF 3HJVA 1GFWB 4ED4A 2BE2B 4YB1P 4C0HA 1XC9A 2J9DA 4Y2IA 2P9EA 4EK2A 1XR5A 1WKLA 3TOQA 2M3DA 1UWBA 3M4XA 5H9FK 1FDDA 4UF4A 2V4RA 4GC7A 2XHCA 1C1BA 4C3MA 1HQEB 2NSBA 4DQPA 4IH6A 4DPYA 3AA8A 3R6GB 4J9OA 1RAHB 4CQ1A 4EBDA 1FXRA 4CLUA 3KLIA 1B64A 2UXDJ 2F3JA 2MYFA 3M6UA 2AZ3A 4JI0F 3RBDA 1UL3A 4OI1A 3LOUA 3FKBA 4NZ6A 2OO4A 2WTFA 5BYRA 3E2EA 1RT2A 2HKEA 3SSSA 4W90B 5L38A 3PW0A 2HHTA 2VODA 3R3TA 3NCPA 2VG5A 1MWZA 1X7VA 2Z30B 3PHTA 3G87A 3RRKA 2V0NA 1EIYB 3C2PA 1FDBA 3KHRA 3R7BB 2OD4A 5IV4A 2FY8A 2XCPA 2ILZA 1X4HA 2CNLB 1I6JA 2ZH4A 4ALZA 4WP3A 1AT1B 1HNIA 2GGPA 3A8EA 2UUBJ 2JDJA 5LSRA 2QEXS 4IKAA 2B4OA 4X4QA 5BYQA 3KJQB 5CA5A 3MDFA 5L1KA 2W9AA 3FZBA 4WKYA 4P7VA 5HP1A 4J37A 3BYPA 4QIWD 3QT5A 5ETQA 2XZTB 1PO6A 3L4BC 4WBFA 5KOXA 3RAMA 4DUYJ 3ZZPA 5F0UA 5M2PA 1RTHB 2DBBA 2H4YB 3L7OA 2H5JB 1M5OC 3GFYA 4ZCIA 1HQUA 3RRGA 4ZPCA 4HDGA 1PGZA 2QA2A 3M2UB 2NPIA 5JVHQ 1C1CB 3V81B 3IP0A 3TJAA 2KT2A 3WX8A 4G1QA 1RISA 1LOUA 2DNZA 1DAXA 2C28A 2M52A 3CD0A 3ILLA 2P6SA 4LF7F 4GRSA 1Q0NA 2CJ9A 1ZTWA 2YNFA 3HHEA 2YWFA 2CQ0A 1VS3A 5E0OA 2H65B 5KTQA 1K73T 2RVJA 2WHOA 3C16A 1FD8A 2ROEA 5DG8A 2BJEA 5G4DA 1PBUA 5KFCA 2QLFB 2JHEA 4HKQA 2ROGA 3GYNA 1VBZA 2QO3A 2ZKTA 3CXCR 1RCOB 4HT5A 3P6YC 3CCWA 2IBOA 2A6OA 1FO1A 3QATA 4NXNJ 4A46A 3B4MA 2YVSA 4ZP6A 1RAEB 4LSNB 5IWAF 1TL4A 3R8YA 2PO4A 3GP9A 2DRAA 1HKAA 3AX5A 1TKZB 3HVWA 2B7CB 1KTVA 3DLJA 2ZWPA 1W7WA 1NKEA 1RI7A 3BGLA 2EG2A 2AIRB 1IKYA 3KUEA 5KG3A 3QZ8A 5K20B 4RW4B 1OQ3A 5CD4A 4ZVFA 5K8NA 5C42B 3BGUA 4O44A 4IOAQ 2MLYA 1VCTA 4DR2J 4AE5A 2DK2A 5B0AA 1DHMA 1S6QB 4DPWA 3EUNA 2KT3A 1OM2A 4PG7A 5FIIA 5FLXY 4NLQA 4DN9A 5IC6B 2W2OP 3NEKA 2GMLA 1REGX 5A0YA 3JSYA 3KLGA 4DS4A 4G3IA 5L46A 5CD4H 3W5ZA 2KFZA 3V6HA 2FLOA 3Q8RB 4J9QA 3KK1A 4OZ1A 1HBNA 3K5PA 2LU2A 1FVSA 4LMZA 2CDRB 3JAMU 4DF8A 4AYBD 2YQ3A 2K7KA 1RADB 1KVJA 3SDEB 1N5YB 2UZAA 1N34F 1RT1A 1XNQF 2HS0A 1X5TA 5A8KB 1HNWF 1VRUB 4ECXA 1NM2A 3HT0A 3EYZA 3N0VA 1B7FA 2ZM6J 2VBWA 2M7SA 3HHDA 4DN0A 1NU4A 1CJVB 4M5JA 4A47A 2VPXB 1VRTB 3CMAS 3OUYA 4V19X 4B3TF 1RU2A 3OD2A 4DCOB 3SV3A 3G82A 2XWXA 1HR0J 2R7VA 3FSXA 3N6MA 1L3UA 4J9LA 5KFRA 2XLJA 2G1DA 2BW7A 2FGOA 2ROPA 2RH3A 3TUIC 4B3MF 1VQOS 3ISND 2CQ1A 1CG2A 1UUJA 2I2YA 2J8SA 2V8PA 5DDQC 3G6ES 2M8HA 1TKDA 4QJVA 3FNNA 3TAPA 3G6XA 1BWVA 3MMCB 4DSEA 1IJFB 5C24A 2LEAA 3QIPB 4C9DA 4YR3A 4LF9J 4DPUA 5F0WA 2KXHA 1KEKA 1TL7B 4JB8B 2R8HA 4TY9A 2EFOA 3C6UB 5KFKA 3MM5B 1TKTB 3GJQB 1NHUA 1R7IA 4DL2A 4ELUA 2AW0A 2UP1A 2Y1RI 3TUZC 1KDNA 1P6TA 4K4TA 1RJJA 3R5GA 2ASDA 3IMQJ 1S9EA 4KGZB 2HEKA 1TP7A 2VQEF 1UA1A 4QWAA 2RHSB 1FE4A 3HVTA 2V8VA 3VAGA 1YZ7A 4DV2J 2JEFA 4Q8FA 3F41A 4F25A 3RAQA 4M1KA 3SMZA 3OL8A 3ILIA 2OIHA 2RDIA 1IKWA 4OZ3A 2QL9B 4DFMA 5KFJA 1M5PC 1YJNS 3M9OB 2D74B 1MG7A 5J1NA 1D9FA 2OMOA 3C15A 2CFXA 3CDUA 4RBVA 2X1GA 1TK8A 4HACA 3CCVS 2Y0SD 1CLFA 4TLQA 1JJHA 2CZVC 3H98A 2BMBA 2MZRA 4LSLA 4J9SA 5LMUF 3FBBA 2FD2A 1KQGB 1RT4B 4OYPA 3RB0A 1U0SA 4JV5F 3TW0A 4DR4J 1X9SA 2OMLA 3DM2B 5F8NA 4XAKA 1WC1A 2V8GA 3FCWA 4ID5A 1GX6A 4N76A 3N5FA 3HK2A 1U2CA 4O3RA 2J9DE 2BV3A 2MTLA 1REVB 3DGPB 4ILMA 4ZN3A 4B9UA 3D1HA 4AQYF 5B0CA 3AT1B 4JI7J 4TY8B 1C1BB 4Y2MA 2EW9A 3J7AN 4AL5A 2ZC3A 1HBUB 2F63A 2V2ZA 4PXBA 5IT9Y 3G6YA 3OR2A 4DXLA 1GTHA 4UOFA 1F1BB 1S1UA 2XNQA 4HH1A 1N0UA 2FY1A 4C0OC 2Z4PA 2ERRA 2BJDA 4TU9A 4DL7A 4R5PA 3RR8A 3DYAB 4NLDA 2HHSA 2ZBRA 4MFBA 3HJFA 2WVDA 1NLKL 4WZQA 3TAMB 3VZIA 4B3SJ 3LWMA 2XZWA 2VPZB 3EJMA 1VMBA 3V6KA 2Z2YB 3BM7A 4UUXA 5J2MA 1RT2B 2V67A 4DSLA 3OSPA 2R8KA 2P8IA 1UFWA 2VG5B 3F73A 1S0MA 2MKHA 3DLHA 1Q5VA 2VL1A 2BDPA 1NSPA 3QJLA 3H40A 1X5OA 1OJ4A 2CPDA 1RK8A 1C0TB 1SVDA 4DFKA 3IRXB 1HNXJ 4Y3CA 4RW7B 3DMJA 1SC6A 5IFMA 5IQ6A 1NK6A 2ZE2B 2HAFA 4YMEA 1U0HA 3JTPA 4QR2A 3T3FA 4Q45A 4ANCA 4K5SA 4TNOA 5I42A 3P49B 3K8VA 3MMJA 1FI4A 4USIA 1SC3B 1MMLA 4LFAJ 1GX5A 1RDRA 4F4XA 3LP1B 2ZH1A 3FMWA 4BHQA 2QG9B 3HT3A 1VGYA 3H5SA 2HRTA 1LWCA 2DY9A 1SIZA 4H4KC 4GO7X 3AODA 2UXCJ 4LREA 4J91A 1WEZA 5KG6A 5GADI 3GIRA 4QQBA 4ZHRA 3Q8YA 1R8CA 3DRRA 4XTTA 4P2MA 1S0VA 4KR0B 1S1VA 1AXQA 2ZOGA 3A3NB 5DGAA 2VPWB 2ZBPA 2MGZA 3EVWA 3PKMA 2NCKL 1RWKB 1RT6B 4R25A 1SBRA 3VCDA 4Q0BB 4ZMMA 4OI2A 2L9WA 4TQRA 1B0VA 5CYQB 4RUHA 5ETRA 4FDFA 5C25B 2F8HA 1CJTA 3H90A 4IR1A 1HWKA 2RQKA 1KLNA 4P7TA 1QVGR 4LR9A 1TELA 2XO6A 2VUGA 4MK8A 3HFKA 4PCQA 1BC6A 1WTBA 4AFFA 2J5AA 1WDTA 2F5GA 2OPPA 2UVRA 3KUGA 2QGFB 1JLCB 4CTAA 4IG0B 3UPFA 1M5KC 1YK9A 3PYFA 2UVUA 3CDEA 3CCES 1PC5A 2OPRA 3HZEA 3RGIA 4IRKA 2QLBB 2JLGA 3M6WA 3QT6A 3K2YA 2C1EB 3IXQA 4JBCA 3KHHA 2G0IA 4OV1A 2GZOA 2CNKB 2QZ8A 2VJVA 5JJBA 5FDLA 2FVQA 2OFGX 4QZVB 4GVBB 2O3DA 4WYLA 3T1YF 3DDKA 5J2PA 3BJYA 3DLBA 1YDLA 2HFUA 3QT8A 2LQ8A 3IAS9 5KG5A 3V2UC 2YQ1A 2CA9A 4ED1A 3KG0A 4DR5F 4UT4A 4O44B 3OBIA 2K7JA 1TVRA 3PR4A 3UDLA 3VQTA 1WHVA 2GJFA 2OUGA 1P27B 1FX2A 1X4AA 1WC3A 5I3QA 1WHWA 1EETB 2ATLA 2OH2A 2D68A 4KKOB 4DL0C 2FC9A 4LQ3A 1DURA 1N32J 1HBNB 4RBUA 3QMQA 2R7WA 5HLFB 3OXFA 4WTYA 4XPCA 1YSJA 2GIQA 4ZVHA 4X4RA 1JXVA 2HQGA 2V2VA 2Z2MA 2VJUA 4I7FB 2D3O1 3FSIA 4ZPBA 2FHJD 4MYUA 4H4OA 4PZVA 4B9LA 3BEGB 1S10A 1N33J 1RWXB 1LV5A 4PUOA 4C6AA 5F8LA 1KOHA 4RKUC 3TX0A 2IVYA 3SBMA 3W9IA 2RRNA 3VALA 2FVPA 1RWPB 2FYXA 1WACA 2G13A 4HR2A 4PWDA 1BWEA 3M8PB 3KJFB 1GK8A 3W61A 2HQFA 4JI5F 3TVYA 4TVAB 3ZFVA 2DGQA 4CO4A 4B3RJ 3G82B 2PA8D 2N82B 1U1NA 2DNOA 2MQ8A 1KHVA 3DOMB 1RGVA 4OI0A 3C14A 2PE8A 4KO0A 1EAYC 1LWEB 4K4XA 1S49A 2V2QA 4LQ9A 4IDKA 2VQFF 1JLEA 2DXDA 3MM9A 3QRRA 3CT9A 2GQQA 1LK7A 4LBHA 3RU0A 2BQ3A 2IFXA 3E01A 2LMIA 3TR5A 2UUAF 1ELOA 4CH0S 2PEBA 4GVLA 2KM8C 3R9LA 1M1HA 1KTQA 4ED3A 1RT5A 3TJ8A 3W1YC 1FKPB 2PSZA 2JWNA 1NNDA 5DDRC 3ZZ0A 3FSYA 4ZLPA 4LF6J 4C2MA 2HRYA 4DX7A 2NQPA 1YJRA 5D4LA 2IY5B 2DNRA 1HHTP 1B3TA 2MSSA 2DR9A 5RUBA 1E6VA 2B9WA 1AZSA 4HHUA 3D4JA 2VZ9A 1S9EB 3HVRA 4FKXA 3QGGA 3TARA 4X4VA 3JQKA 1TMJA 4HH0A 3SIPB 4IRCA 3BPDA 2CUYA 2XMMA 1UFLA 3RUBL 1HFEL 3HM9A 3PY8A 2DEIA 3M2VA 1RKIA 1BQMA 5HMWA 2J0WA 4LBIA 2DHSA 2MKIA 1NK4A 3CIZA 3CC7S 4GKKJ 2CQGA 3G96A 2YWEA 3OTOF 5A2QY 1U6ZA 2E5IA 3IFEA 3CNQP 1F2HA 5KFDA 1QM9A 1RAAB 5DG7A 2DO4A 3CULA 2XI2A 2FVRA 2V63A 4ECQA 5DQGA 3UO0A 3N01A 4BS2A 2DJWA 4PWUA 1L3TA 2EFVA 1WHYA 4MTPA 2GQ2A 5KFEA 4X66F 3FEYB 3MM7A 2XWYA 3DOLA 2AF6A 2CG4A 1K47A 2RIJA 3UN3A 3I9V9 3GWCA 4QU6A 4LJMA 2IDLA 4PG8A 1RT3B 2IDEA 2AU0A 2DGOA 3BO3A 3MMBA 1AA1B 2B5JB 5THWA 5SUHA 1G4CA 3LAMA 3R5DA 3NS7B 2I0XA 2FHMA 5L9NA 1OYEA 2ZDOA 3C6TB 4ZVTB 1QSLA 2L3MA 3TZXA 3F56A 2DVIA 4ELTA 5HQLA 2ZHAA 3L09A 4FF2A 1C2PA 4O4GA 3TZZA 3J81j 4RWWA 1MLAA 4YHHJ 3W63A 2YKNB 2KKHA 3P96A 2MHEA 4MFBB 1YZ6A 1YKWA 2A10A 2XTCA 4LF4J 4HHJA 1SXLA 2Q3PA 3M8YA 4X62F 1IKXA 3DRSA 2NXCA 5AXLA 3DLEB 3CD5A 3ZTQA 4DL5A 1OWXA 4KC5A 4LFCF 4Q2LA 1KP6A 3H2UB 1JK9B 3HHLD 2E1MC 1E6YA 2KO1A 1TFYA 5E3PA 3HP6A 1SL2A 3MZIA 4CLPA 3DMJB 5KFGA 3FBFA 5F9LA 3DRPB 1HHSA 2W9CA 1ZOTA 1VIXA 1TKXB 3MI7X 5HMZA 3MEDA 1WSVA 2BKOA 4URQU 2XZDB 3VR1A 1RTIA 3BGRB 3U1MA 3CIMA 5I42B 2Y9HA 3X3UA 1Q95G 2DNPA 5F41A 2APOA 2N7CA 5L9XA 3FDSA 2IMWP 1OO0B 1SH0A 3KDNA 3RW6A 3D68A 4FF1A 4O3OA 3QBCA 2YKPA 2OEKA 3BGFA 2QLWA 4UZBA 4I2QA 1BE4A 2IC3B 3OPKA 4OLOA 3IR6B 2X7IA 4RNFA 2DR7A 1LWCB 2Z2ZA 4NCGB 1KR4A 3A8JA 3V4IA 6FDRA 5EWGA 2U1AA 1JLGA 2ALZA 1NK9A 1UVKA 5C7PA 1RTDA 1WOOA 3NNCA 1YGYA 2NUUG 3IAM9 1PAUB 2HIYA 3CJ8A 1U47A 5A8WA 4ES2A 2GVDA 4MH8A 3CJ3A 1I94J 2LLZA 1TUGB 1UEVA 4K59A 4JI6F 1NK7A 2RD5C 5L1LA 2JEIA 1MU2B 1FNOA 1CJTB 1S4FA 5IS2A 2C2KB 2DH9A 3QO9A 2XY7A 4C0BA 1YJ9S 1IBLF 1T03A 1Y11A 3N6LA 3PR5B 3GB0A 2WVCA 1HWUA 4ZP7A 1U8SA 3D5MA 4OFZA 4DLEA 2O66A 3JXOA 4X64J 4LRFA 3KWMA 2PGCA 2W4PA 2FGCA 3G8SA 2OPRB 4A4JA 2YNIA 3EICA 1BD6A 1P1TA 4NLVA 3G86A 4FVCA 5KFVA 5K5MA 1VLYA 3MM6A 2C2RA 5G0RA 5AXMA 1W2IA 2MKYA 4DZDA 1IR1A 5KFTA 2F1FA 2V5HG 3A3OB 3U1LA 2CJQA 2HVZA 3BSAA 4PQUB 2D7SA 3QNWB 2D9OA 4O3SA 2LA4A 4TU8A 3OR1B 2K2PA 2CWKA 4K2XA 4OI3A 3W7BA 4M5MA 4I0WA 1U1KA 1UVJA 2VBZA 2I1RA 4QR1A 2H5IB 2HHPA 1TAQA 3IWXA 3UNYA 3Q8PB 1UVIA 4QW9A 4IUFA 3J81Y 5KFLA 2ADCA 1T3NA 4NE9C 1HD0A 3IM9A 1FXLA 2CQ3A 4PEOA 1HWIA 3GIJA 3OFHA 5JUMA 3OTCA 2W1BA 3I6PA 1AW0A 3PVXA 4X84A 1XK8A 2QFJA 1FRXA 1SPBP 4LF8J 2EI5A 1BUXA 2YWGA 3D3BJ 3LP0B 2C2EA 4OYOA 4JV0A 4Q44A 3NS6A 1R8BA 5LMNJ 1GNKA 4RNHA 4UY85 1FESA 4ZVGA 3D9BA 4E8UA 3GYXB 2NYIA 3QWPA 3HKWA 1X9MA 4P74A 4AUKA 3NAIA 1SB6A 5ETSA 1FCAA 4F0KA 3ENQA 3DRXA 4YS2A 2V94A 4WIQA 4U96A 4QYZK 4WK3A 3P5TL 2BJ8A 4HEA9 1T9VA 3PKYA 3TZWA 2HMIA 1KRPA 2YKMA 3DLGB 2XY5A 5KFPA 3LO3A 4WCEQ 3VAJA 2HQCA 3CJ4A 3NL0A 1YTYA 2GW8A 7AT1B 1H6KX 3K59A 1JJ2R 3UWTA 1MSWD 1NEEA 4IDKB 5E3RA 1JLEB 3RR7A 1NB7A 1JJCB 1V9OA 3IG1B 1RB0A 3RTVA 1NH8A 4KFBA 1JLBA 3NNAA 4ZVRB 3E01B 2DGXA 5CAAA 4B3OA 4WPAA 1UW4A 4WK1A 3M32B 1A6LA 1VQYA 1RT5B 4MMOA 3IA0A 1D3WA 4KGXB 1SH3A 3T9NA 4RJVA 4DZ6A 2B4UA 2GVZB 2HGLA 3H2LA 2GAHC 1OY6A 2HWTA 3KK3B 4DV4F 3L9ZA 4DU8A 3PX4A 2DNKA 4PXEA 1XR6A 1RWNB 3P5BP 2A0FB 4EZ6A 3FBCA 1EARA 1H0HB 2KVQE 1T02A 3TANA 1FJGF 1E6VB 5HBMA 3AOCA 1U1LA 1S7HA 3EPGA 5FLXU 3MAHA 3JQJA 5B0EA 3W62A 3FBEA 3JTNA 1VJQA 3I0RA 5L8RC 1H3DA 2FHKA 3MPDA 1BQMB 3WHIA 3VVUA 7FD1A 4Y0FA 2QV6A 5E41A 1UEKA 2XB2D 4F4AA 3DI6A 1H38A 2BACA 2HHXA 1CULA 4CLKA 1UETA 5H9EK 4I6WA 1N56A 4KH1B 1SJQA 2EVZA 1S1XB 3PACA 2HHUA 4G1PA 3T6BA 1RWVB 8AT1B 3UCUP 1FT8A 2O5DA 5D4OA 3NGDA 2ZD1A 2R7UA 1YJUA 2K1RA 2N7YA 3DOKA 3O2IA 2UVVA 3RBZA 2EK6A 4JI3J 2ZJPQ 2P9CA 2V8DA 2CJAA 2XCAA 4O3NA 1HYSA 3UE2A 3SQGA 5HK4A 3U02A 4XO0A 1S72S 4LUBA 1PCAA 2MZTA 5DJBA 2BRLA 4KV8B 3CEDA 2OTJS 2FJWA 3GIKA 3QZ7A 2X1BA 5ETMA 3J80U 2EKNA 2BW2A 4YP3A 3JSBA 1CJUB 5D0GA 1QTMA 4DV3J 3AQOA 2W7AA 3ENAA 2J8AA 3MECB 1AB8A 1HBOB 1T94A 4O4GB 2CPJA 3B54A 2E5GA 1FDNA 2QRRA 2MDAA 5BXIA 1QAJA 3L7UA 3EM1A 2ACMA 4C3LA 1H74A 4QIVA 1FRKA 4JI8F 2CDQA 2FJAB 3V6DA 2J6SA 3ZTOA 3KJVB 2HHHJ 1D8YA 1K1QA 4UY8T 4L3NA 1X9WA 1IVZA 4OYBA 1RT7B 2FJDB 5HL7Q 1FRIA 2VG7B 1LW2B 3EXYA 3RB3A 4J9MA 3GJTB 1E6YB 2WVEA 2CNOB 2B7BB 3S1TA 4DV5F 4KE5A 2W01A 3TRGA 2LXFA 1ZAXA 2CJKA 2HZAA 2OPSA 1UKUA 4FBTA 5DO2A 1PYTA 3M9MB 5KFMA 1LFWA 4ZIVA 2HLUA 3W8GA 1S77D 2IJRA 2HGMA 3TP2A 2NR0A 2IPOB 4K8RA 2F9JA 4NASA 3OVBA 4DR6F 3NWGA 1G7CB 5B08A 4D3HA 2PD1A 4I2QB 4QYRA 5T14A 2GNKA 2DHAA 5KG7A 2VG6B 4CYUB 3QAUA 3W60A 4X4NA 4EBCA 2IRXA 2ZZTA 5BR8F 1H2UX 1QLNA 1O51A 5IM0B 5A6WA 2IVMA 4ZLNA 3ITHA 2K3IA 2OD6A 4U7CA 5A8WB 3PX0A 1S12A 4M94A 4ETXA 3HULA 3CCMS 4NXNF 1WF2A 3EDQB 2BE2A 1FWLA 2BQRA 1WC4A 1PILA 4FS2A 2I8EA 1YBTA 3QO9B 1V6HA 4RNOA 1HQEA 4P2XA 5DQHA 3IBWA 1S57A 3BO2A 3S01A 2HFVA 2DGSA 2VOOA 1NPPA 5E3AA 3TVKA 4YUDA 4N7TA 4OZ0A 3GSIA 3NG8A 3MMAA 4KGKA 5HMYA 1VQ4S 1VQ5S 3MR5A 3NLCA 2YNIB 2NREA 4Y00A 3NCQA 2C42A 4X4TA 2HW3A 4CRJA 3PYEA 4DX5A 4NLXA 1IM4A 2KN4A 3UD5A 1DZ5A 1OY8A 4LF7J 1S6PB 2RF2A 4I2PB 2R7QA 2CIMA 4LR8A 5CABA 3NGSA 3G2XA 3J7Z5 2OKQA 2L9NA 3FMBA 3TEGA 4FVMA 4BBYA 3H20A 1JNZB 2V4JA 1T05B 2AV5A 1FDAA 1N36J 2HBZB 1WC5A 3ZZUA 1ZM9A 1KWMA 4CT9A 5GMDA 4KHRA 1YJ7A 2GJ2A 2PEHA 1M5HA 5IWAJ 2JH3A 3UFCX 2Y3YA 3TYTA 5HN0A 4C97A 3CJTA 2VKRA 3FCHA 3GV8B 4Z37A 1NDLA 1KKHA 5GAHI 1RBOB 4WP8A 1IKVB 2ASJA 1IM6A 2XTJP 1RBAA 3IBFB 2LQ9A 3TEHB 1RTHA 1VK3A 3VVTA 1WG1A 1QVFR 3TA0A 1LW0B 2FJEB 2DITA 1NH7A 1U25A 2XTDA 1VR6A 2JJ4D 3M30A 4ECZA 3SCJE 4DBQA 1N48A 1UVMA 1W25A 3ZTPA 3M2UA 3LALA 1VQ7S 2KU7A 3BPSP 1N0VC 3V81A 2N3OA 3W65A 4M5IA 1ICEB 4DUZF 1TR0A 1Y0HA 1NK5A 2RU9A 3EX7B 2AMCB 4RZRA 4WFZA 2RRBA 3HLUA 3OFEA 2HMIB 2B43A 2H3EB 1RSCA 2ZOFA 5KFFA 2GAGC 3WIVA 4JYAF 1KN6A 1N34J 1XNQJ 5B0FA 4RW8B 4BC7A 2XYHB 2HURA 4DCJB 1Y4ZB 2BBEA 1APSA 1HNWJ 3EWGA 3KLFA 1NKCA 3CJKB 3QFHA 4NI2B 2BUNA 4PKDB 1B99A 2MLZA 1P1LA 3Q89A 4RUAA 2DNNA 5I3PA 2MZQA 1GMVA 4M5LA 3BSCA 4HLBA 3ETOA 2FJXA 2LVWA 2DR5A 4LSNA 3QPIA 4F02A 2KG0A 5DS7A 2AZ1A 3CJQA 4U67Q 3SFGA 1I51B 3BBBA 2GJIA 1SKSA 3R1HA 4B3TJ 1JWWA 3HO1A 4DV2F 5HJYA 2V6AA 1RABB 1LQ9A 2KZZA 4RW4A 2CPHA 1R0AB 2OI2A 1XR7A 1GMWA 1N54B 2ZH3A 5C42A 4C8MA 4C8ZA 3ETMA 2E29A 4B3MJ 4TXSA 5ETPA 3BH7B 2HS4A 1UCNA 4OYZA 1CSJA 1S6QA 1RXOB 4KTQA 4LRAA 3DDNA 1IBMF 2J76E 1VBYA 1OY9A 2G1HA 4QBUA 2CPEA 4FXDA 3AWRA 4DSFA 4IO9Q 3NXZA 4IG3B 3I0RB 3LPEA 1XMBA 3CW2C 3OL7A 2VBXA 1SKWA 1HNVB 2ZBIA 3DI6B 4DR4F 2E1AA 3M7VA 3SDEA 4ECSA 5A8KA 4CWBA 1VRUA 3LTOA 3CDWA 4HL9A 1XWLA 3X1LB 4NYZA 2J0SD 4L3KA 3MHYA 3AJ2A 4NA3A 2C2ZB 4CO2A 4ICLA 3S7RA 2ZVSA 1Y10A 2AX1A 3K8WA 1X60A 4CLZA 3PW4A 2VQEJ 1CJVA 4YR2A 4MJKA 2GO8A 1VRTA 3KTQA 2AYBA 1IWAA 3J7ZT 2CQ4A 3Q2TC 1H7XA 2RRAA 3D6HB 1NPRA 2PN6A 3OQ2A 3BB5A 5M2RA 2MHNA 1XQIA 3CUNA 4NLTA 3ZTSA 2QX0A 3G71S 2E5LF 4KRWA 4UQTA 1TQLA 4ZN1A 4B9NA 3CVKA 5IT4A 4WZMA 2W2QP 1MWYA 1YQHA 3M8SA 1Y5IB 4Z7CA 4ECTA 1URRA 3DC2A 1F9EB 3BV8A 1SQGA 1I1GA 2Z2LA 3NRBA 5LMUJ 4DSKA 4JV5J 3MEGA 2G9OA 1D9DA 4RPFA 3QIPA 1RKJA 3W5YA 5L1IA 3V6DB 2OELA 4P2SA 5ETLA 3MCSA 1TL7A 1TAUA 4ZVSB 2K8GA 2IYIA 2XLKA 3NKYA 3C6UA 1NDPA 1XN9A 4AQYJ 2EC0A 3MM5A 4M5DB 5GAEU 4J9RA 2BM0A 3SSRA 4KHPF 1N5TA 2G0CA 2C3PA 2Q79A 2UVWA 4DQSA 2JLFA 1N5QA 3K5NA 4C48A 1LEOA 3BQ1A 4PPZA 2LP4A 2C2DA 4HTJA 3R2DJ 1NRKA 5KG4A 1VISA 1XJWB 1ITPA 4ID8A 4CO3A 2IBKA 3W2WB 1OMSA 5A2QU 1Y7PA 4YDXA 1YJWS 2A3JA 2RJZA 1VQLS 1NJZA 1HNZF 4F26A 5AE1A 3BSNA 5F8GA 3MPUB 1NKBA 5D4PA 4WKRA 1JLAB 4QIGA 4B02A 3VAHA 2CVIA 4FYVB 5D0HA 3CCJS 3GV7B 1T9XA 4X65F 1NUEA 5J2QB 4R8UA 2V50A 4DPTA 3OT9A 3TA2A 1FKAF 1RT4A 2MQQA 5JXSA 1B4SA 4A8MP 5IT0A 3O1LA 5AJ3J 4F8RA 2EEYA 3ITHB 2FLPA 2Y8WA 2B4VA 4ZJOA 2F4FA 3BN4A 4F50A 1IBKF 2W2PP 3I32A 3DU6A 3NGRA 1M1GA 2H54B 1HBMB 2EWHA 1RTJB 3GCXP 4GKJF 2XS2A 3MFIA 1REVA 3DGPA 1RWWB 2K3KA 3I82A 3ICLA 4TY8A 1OSCA 3IRWP 1HBUA 1F5AA 4FPIA 1ZBTA 1GMUA 1R0CB 1GTEA 2DH7A 2M4MA 1HI1A 3MMAB 1K0VA 2V9WA 3DYAA 3UN5A 3K0JA 1NZ8A 4QCLA 3TAMA 1S1WB 5C2GA 4I6AA 4NA1A 3EZUA 4V1Ak 2KH9A 1S1TB 2RE1A 2FB0A 2HNDB 5HVHA 2EFNA 3OXLA 1FTRA 2RF2B 4IFVB 2XSJB 1S48A 2HHWA 3BH6B 1M90T 2CQIA 2RMLA 3BKUA 4H4MB 1FX4A 2ZNYA 1U1OA 1HQ2A 2KM8B 1C0TA 3KMSA 4ANDA 2YWHA 5DQIA 3IRXA 4ILLA 4RW7A 1UVNA 4NLGA 2V4JB 2EC2A 4C8NA 4I69A 4WXOA 4JI4F 2LEBA 2ZE2A 3P3DA 4ECRA 4QWDA 2GV1A 2NPFA 1ZAVA 4GO5X 2VPYB 4ZA1A 3R7NB 5DDPC 4KBIA 3CF5Q 3JSMB 3V6JA 1ROFA 1QAIA 4MAKA 3T1YJ 3LP1A 5KFHA 2KG1A 1XTZA 3AX2A 2VD3A 2LFVA 4OYXA 4B17A 1NHKL 1VQNS 2AYGA 2QMUB 1F6TA 1Y9OA 2C2NA 3VZHA 3G9CA 4OX7A 5KFUA 1DRZA 1YRXA 1FERA 2OPQB 4EUVA 3MEEB 1N4LA 3DXSX 3M30B 1OYDA 3GTYX 1TFWA 3W5XA 2UV8G 2YXLA 4W92B 5KT7A 3U1NA 1LXJA 1F60B 1RT6A 4Q0BA 2F65A 5CYQA 2O1PA 1T9TA 5C25A 5D77A 2IA6A 5LL6d 4ZVUB 1X31C 3SV4A 2VB6A 4YY3J 1RZMA 4B9MA 1LFPA 1Q16B 2DNHA 1ZH5A 4CT8A 4IOBA 4N5SA 5KFZA 2VFUA 4X2BA 2HVIA 3KLFB 1JLCA 4IG0A 3EZOA 1JMTA 2HNZB 4F36A 2ZBCA 2GA7A 3NWRA 2GFFA 2HWIA 2NXNA 3EE3A 4RWXA 3QLHB 4F4WA 2EBGA 1W26A 2MMYA 2VFVA 2I5JB 1KS2A 4DOZA 2FDNA 4DSJA 3PFEA 1X0PA 4JI5J 3D67A 4GVBA 2X3GA 1ZM2A 3LF0A 2JSXA 1XBWA 1RQ0A 2B9YA 5CYMB 1R43A 1FTCA 4NWBA 3RAXA 2IM3A 3HHLB 4N56A 1RU1A 4ZS6A 2R7SA 2VQFJ 5EUHA 3AOAA 3N4WA 1YBUA 3I55S 3PNIA 4QPXA 5LXRA 1YLXA 3HDSA 2F4VF 2Y0BB 3J81U 4O23A 2B8PA 3N28A 3NP5A 1FK9B 3EMTA 1OIAA 1DQAA 4HYKA 1EETA 1HWJA 2W9BB 1UVLA 4KKOA 2VICA 2WVBA 2DIUA 3FFIA 4DR1F 4DR3F 2KHDA 5HLFA 4D3GA 5LOQA 3PIPQ 2BZ2A 2R8IA 3GYGA 3IGVA 3JYTB 2XS7A 1CEZA 1WD6A 1YRUA 2WSCC 3NBPB 2BJ7A 2FZCB 3N79A 2XGPA 1WWHA 4I7FA 4EZ9A 2AHOB 3ZZOA 1RE1B 4CLWA 2ZJQQ 4ICLB 1XMQF 1KQFB 1PJ7A 3DLKB 1HMVB 2AKWB 3ISNC 4OHZA 3THTA 2YH0A 1UJ5A 4BWJA 1DQ9A 3M8PA 4OZLA 2ZFHA 4X4PA 3ET6B 3MR6A 4M8LA 4Y6IA 4B9SA 1H7WA 2XHWA 2J6TA 1YBAA 3DN9A 1LWFB 3DOMA 4Q43A 3OTOJ 4P71A 1TV6B 1SJFA 5DDOC 2KT5A 5L39A 1LWEA 4CIOA 2JRSA 4DQRA 3J80Y 3K7RA 3FJ2A 3GG0A 3IC1A 4WU2A 3OXGA 1V5VA 2HVDA 3H5YA 4ZCLA 4ZOSA 4U7UK 1LNQA 4WE1B 2BE9B 1X4FA 3K5OA 4NA2A 2IM2A 4AT1B 5EWEA 5I4MA 4X66J 4KSEB 1UJ6A 1ZAWA 2M5YA 1MROA 3MEGB 2VA2A 5E3CA 3D1QA 1FKPA 4K7QA 2J0XA 2GO9A 3B4DA 3QRQA 1VBXA 4DV0F 1BGXT 1F9HA 2PMWA 3A1YG 3SEOA 4XDDA 3TUPA 2NS1B 3AB4B 2UXBF 1VI7A 1VQSA 4NCBA 1HD1A 1O6XA 5CZXA 1UPMB 2B3TB 2Z58B 2OLWA 2DY1A 4B9TA 2E5HA 4PXDA 2O01C 2POKA 4OYAA 1BY9A 1B0TA 2RHQB 5CCMA 3GFHA 5AE2A 4ZK7M 3HX9A 3QGHA 2XEXA 1KC8T 4WFBQ 4USJC 8ATCB 3BR9A 4RU2A 5F3ZA 4LFBJ 3L95X 3VGVA 4X62J 3R5JB 1X4CA 3JS9A 1CPZA 5GAGU 1IR0A 3FRYA 4UOHA 5BJRA 4L74A 3OSNA 3Q8UA 3B6BA 2KYXA 3J7YI 4Y28C 5D6GA 3IS9B 3H2VE
chains in the Genus database with same CATH topology
2HMIA 4JI0F 4NRTA 1LK5A 3RBDA 2QT7A 2YKMA 3DLGB 2XY5A 5KFPA 2FC8A 3LO3A 1KRPA 4WCEQ 3T6JA 4C8KA 4WJBA 2ZM6F 3GFXA 1UL3A 1R89A 3VAJA 4OI1A 3MTKA 3LOUA 3CJ4A 2WSEC 3NL0A 1YTYA 2AD9A 2GW8A 1Q82T 1H6KX 3K59A 3BO4A 4R8UB 1JJ2R 4NZ6A 2OO4A 2WTFA 3UWTA 5BYRA 3E2EA 1RT2A 3JSMA 4QWEA 4FF3A 3MTJA 2QSWA 3SSSA 1MSWD 4W90B 3UD3P 1NEEA 3LGNA 5L38A 5EN1A 3PW0A 2HHTA 4DQQA 3HVTB 2XTEA 4IDKB 2MZ1A 2VODA 3PJWA 3R3TA 3NCPA 5E3RA 2EKYA 1JLEB 2VG5A 3RR7A 3LUYA 1MWZA 4OZJA 1NB7A 1X7VA 1V9OA 2D3ZA 3IG1B 4DX8H 1DLOB 2Q6BA 3RTVA 1N52B 3RRKA 1NH8A 1SJ4P 2V0NA 5LJ3Y 4MK7A 1RT3A 4H54A 3C2PA 4RLEA 1SIWB 1JLBA 2YY3A 4KFBA 1FDBA 3KHRA 1HR0F 4KPYA 3NNAA 2R4FA 5EWFA 4MK9A 3KNGA 2IJFA 3QJPA 2WSFC 3E01B 1IKWB 3HXMA 2DGXA 4B3OA 1SJ3P 3LW5C 2OD4A 2B5JA 1EP4B 1UW4A 4A48A 1KNZA 4GC6A 4WK1A 2OPQA 3M32B 2PMZD 3MEEA 2L48A 1F9FA 2XCPA 2ILZA 1A6LA 1X4HA 2BYCA 2LCWA 3RB4A 4G6VB 3J7YU 1I6JA 3GQCA 1VQYA 1BQNB 1RT5B 3UNGC 4KT0C 4MMOA 1UA0A 3IA0A 1D3WA 1JIHA 3FQKA 2ZH4A 4ALZA 1SH3A 3PJXA 2WCXA 3C6TA 1HNIA 2GGPA 5HI7A 3A8EA 3T9NA 3D2WA 2JDJA 2B4UA 5LSRA 5K14B 2QEXS 4IKAA 2HGLA 2B4OA 1NAQA 3H2LA 4ZCKA 1MW7A 4X4QA 5BYQA 1C0UA 2RSQA 3IR5B 2HWTA 2MKJA 4LSLB 3TNVA 5CA5A 3KK3B 3MDFA 5L1KA 4DV4F 1WEYA 3PX4A 2DNKA 2W9AA 3PO5A 3FZBA 4WKYA 2CQ2A 2DGVA 2YKNA 2DGTA 4PXEA 1XR6A 3HHKA 4P7VA 5HP1A 4J37A 2QMXA 2AJFE 3VAIA 4EZ6A 4QIWD 1H0HB 1Z2LA 1R8HA 3OJSA 1T02A 3TANA 1FJGF 4B9VA 1E6VB 4TYAA 5HBMA 3WDOA 2ZH6A 5MAOA 3KG1A 1PO6A 4J5OA 2GC8A 4FNIA 4LF9F 5KOXA 1L5UA 2HG4A 1U1LA 2ZOMA 5M2UA 1S7HA 2DB1A 3RAMA 4ID5B 3EPGA 2DR8A 3ZZPA 3MAHA 5F0UA 2UV8A 1FNMA 1RTHB 3DLEA 5B0EA 5M2PA 3ENWA 4C11B 2DBBA 3JTNA 2FJBB 2E7XA 3L7OA 2QA1A 3I0RA 4TYBA 5L8RC 2HNZA 3KLHB 1M5OC 2PA3A 4F67A 3GFYA 1H3DA 2FHKA 2P9GA 4ZCIA 1Q8LA 4MIAA 1G6BA 4NLUA 1BQMB 4HTIA 3F44A 1HQUA 3RRGA 2PI4A 4ZPCA 4HDGA 1PGZA 7FD1A 4Y0FA 2QA2A 2QV6A 3HKZ