1RA7A

Poliovirus polymerase with gtp
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for proteolysis-dependent activation of the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
molecule keywords Genome polyprotein
total genus 144
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1ra7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ra7A02
3MFIA 5KFOA 4NYZA 1S1UA 2B6AB 1DLOA 2I5JA 5CYQA 4JUZA 4NLOA 5KFUA 4Q43A 2DPIA 4ZHRA 3UQSA 3E01A 3MEEB 3BGRB 3IGVA 2FLPA 1TKTB 3GIKA 1IKYA 3MECB 2ILZA 3OL9A 4KKOB 2W7OA 2HWHA 4JV2A 2B43A 3SFGA 2UUWA 2UVVA 2R8IA 3CWJA 3M8QB 4KAIA 3BJYA 4Q8EA 1TV6A 4NLUA 2OPQA 3BSCA 3HVTB 2D7SA 1BQMA 3JYTA 4NCGB 4HKQA 3H98A 1IKXA 3IN5A 3EPIA 4ECZA 3N6MA 3OSPA 1ZETA 4DL6A 2IAJB 2WONB 4RNFA 5L9XA 5FDLA 2O5DA 4LSNB 4Y34A 1S97A 3KOAA 1HPZA 3QIPA 4JV0A 4H4MB 2XI3A 5I42A 4RW8A 4ZVFA 2I1RA 2JLEA 3TVKA 5D3GB 5HP1B 3BQ1A 1HNVB 4Y2CA 3HVTA 2D41A 5L1JA 5CYMB 2BRLA 2HNYB 1S6PB 3KLIB 4EO6A 2FLLA 3QO9B 5HLFA 3EPGA 2J6SA 3RBEA 4Q0BB 4J9SA 1HQEA 4K4ZA 1S9GA 4B3OA 4QWEA 4DL4A 2AX1A 4ID5A 5I3UA 3LP0B 1JKHA 5KFFA 2W9CA 3H4DA 4YP3A 3TQ1A 1RTJB 3UPFA 4WFXA 4O4GB 2R8KA 3MEGB 3V4IB 4NRUA 2YNIA 3PW7A 1KHVA 5KFDA 2VG7A 3V6JA 1TL1A 1TL3B 1RT1A 5J2QB 2YNGB 2C28A 1T94A 3ITHA 2WONA 2XWYA 2RDIA 2VG6B 5DGBA 1XR6A 1QE1B 2WCXA 2IM2A 1MU2B 2YNHB 5F9NA 1TKZB 3DOLB 3KJVB 5J2NB 3GV8B 4WYWA 1TQLA 4ZPCA 2QV6A 4TY8B 3NL0A 1C0TA 4WZQA 1SUQA 3M8QA 5KT5A 1RT7B 1JLAB 5F8IA 1ZTTA 1N48A 3MR6A 3G6VA 4DG1A 4NLPA 3KK1B 5C24B 1VRTB 1S1XB 2FVRA 3MR5A 4ECYA 1DTTB 4RNMA 3MEDB 5J2QA 3QYYA 2FJXA 3CJ4A 2VG7B 5CYQB 1LW0A 4HYKA 4K50A 2JEFA 3TAMB 1S1UB 4I2PB 3RBDA 4WFYA 2HMIA 4QW8A 4FS2A 2IM3A 4NLRA 4IG3B 4ZPDA 1K1QA 2CJQA 3NBPB 5C42B 4YR2A 3RAXA 1RT5B 5DGAA 1JLAA 1N6QB 2BQRA 4RUCA 1LW2A 4RW9A 1REVB 4ZP6A 5DG7A 2AGQA 1S1WA 3DI6B 3H5XA 3BQ2A 1JLFB 5KFNA 2BANA 4R5PA 1N5YA 1QAIA 2ZD1B 1HARA 2ZKUA 5HROB 4PWDA 3V6HA 4PUOA 1J5OB 2JC0A 3I5BA 4I2PA 1RT3B 1EETA 1JLQB 5K14B 3PHEA 3MEDA 2YNGA 5C25A 1DTQB 4IKAA 1TKXB 2WRMA 4H4MA 1TP7A 1JLEA 5I42B 1S1VB 4Q45A 1SH3A 5L1IA 2AQ4A 2D3UA 4J9NA 2IAJA 4ECXA 2R2SA 4WE1B 5K14A 4KFBA 4RW4A 1S48A 3IG1A 5DG9A 1C0UA 1VRUB 3G6XA 4PUOB 3DI6A 5KFYA 4MK7A 3V81A 2ZD1A 5JXSA 1TV6B 3D28A 4IH6A 1S9GB 3GIMA 1JLFA 1HQEB 4YR3A 3KHLA 1N5YB 3MFHA 3GV7B 2FVCA 5KFGA 4NLSA 3BSNA 3VQSA 2WTFA 4NZ0A 3KLEB 3NBPA 4J9KA 3MR2A 3BGRA 1S9FA 1FK9B 3DLEA 4IOBA 3E01B 4YMEA 2V4QA 1IKYB 3MECA 1LWEB 1TL3A 5HBMA 1LW0B 3PW5A 1KLMA 3RB0A 1S1TA 2C2RA 3QGGA 2XC9A 3FSIA 3BREA 1RT4B 2HMIB 4NRTA 1HNIA 4TY9A 2V4RA 2W8LA 4XO0A 4PWDB 1RT2B 4GC6A 4J9MA 2BQ3A 4H4OB 5KFZA 1S9EB 4R8UA 5DQIA 3KLVA 1C0TB 2EC0A 1SUQB 5EWGA 4QWCA 3IS9A 4IR9A 4TN2A 4OL8A 4K4SA 3FQLA 4RNHA 1SH0A 3G6YA 3DOLA 4MH8A 1LWFA 2R2UA 3PW2A 1HYSA 1JLBB 1RT6A 2ATLA 2E9RX 4RZRA 3CJ5A 4NLQA 3GIIA 3Q8SB 1HMVB 4NLGA 4K4UA 4TLRA 4KFBB 4QPXA 3QGHA 5EDWA 3NGDA 4IR1A 2HWIA 4I2QB 3IRXB 1YVFA 1S1VA 5EWFA 3CDWA 3H5UA 2XCPA 2W8KA 1SH2A 4M95A 1FKPA 3I0RA 3MEEA 4RW7B 3LP1B 3PW0A 1N56A 3OHAA 3T5LA 4O4GA 5C5JA 1JLQA 1R0AA 2WOMA 4NLVA 3PVXA 4LQ3A 2B5JB 2YNIB 4MIBA 3KLGA 4K4XA 3OHBA 3MEGA 4EYHB 3LP0A 4KBIA 1IM4A 3QZ7A 1LWEA 4WYLA 4URQU 2XGPA 2ASJA 3KHHA 3IGNA 5F8JA 4G1QB 4ZPAA 1W25A 4WZMA 5F8MA 4ZP8A 3C6UB 4O44A 2RDJA 2UVUA 2HAIA 3ISND 3JSMA 5DQHA 4IG0A 3OL6A 1QAJA 5D3GA 1JIHA 5CYMA 3ISNC 2V0NA 4Y2AA 5HP1A 1R0AB 4NLYA 2WK4A 3PR5B 2IBKA 3PZPA 4XPEA 2B5JA 3KLGB 3I5AA 4WFZA 1S1XA 2J6UA 2UVRA 1JLEB 3FDSA 5KFRA 5C24A 4DG1B 1TKXA 3KK1A 5KFJA 3T5KA 3PJWA 3CJ3A 4F50A 4XPCA 2W9AA 2RKIB 4TYAA 1S6QB 2OPPA 2OPRA 2FJVA 1JLBA 5F8LA 2R2TA 2ASLA 3JYTB 3I0SB 4IH7A 1HMVA 5KT2A 4RW6A 4F4XA 3PR4A 5KFCA 4J9OA 3DRRB 4U7CA 2YKMB 2OPPB 1S1WB 4KB7A 2ZE2B 4QW9A 3ITHB 5KFXA 3KHRA 3RB6A 4RW9B 3CJ2A 1RYRA 4K4YA 4K4TA 1RT5A 1RTDA 4RUAA 2HNZB 2B6AA 3OL7A 1HNIB 4M94A 1RT4A 4ZHRB 3H2LA 4K4WA 3DRSB 1S49A 1RT2A 4J9QA 3OL8A 1RTDB 3HKWA 3LP1A 2W9CB 3QLHB 4I7FA 1I6JA 2DPJA 4ZPBA 1S1TB 5I3UB 1VRTA 2ZE2A 3HVAA 4KE5A 2R8GA 4NLDA 3H4BA 4FBUA 4KV8B 2F8EX 1XR7A 4K4VA 1RT7A 3QO9A 4EBCA 4RW6B 4GC7A 5F8NA 1RT6B 2IM0A 2BRKA 1C0UB 3OSNA 3V81B 2BE2B 3SFUA 2RKIA 4URGA 3N6NA 4Q8FA 3DRPB 1S10A 5F8GA 3D5MA 5DQGA 1D0EA 2OH2A 4J9RA 3C6TB 3MF5A 1C1BA 1RYSA 3M9NB 3KHGA 2BQUA 4IRDA 5L1LA 2YNFA 2C22A 3CDEA 1D1UA 2QE5A 4NLTA 4I2QA 4Y3CA 2GC8A 2OPSB 5KFSA 1TVRA 1J5OA 2FVPA 1KHWA 2RF2A 3NAHA 1RT3A 4ZVEA 2BE2A 3UDLA 3KK3B 1UWBA 3KMSA 3JSMB 4DL7A 1FK9A 4ID5B 3C6UA 5EUHA 3DMJB 4FBTA 4F4YA 1T05B 4PQUB 5KFEA 5HLFB 4ZP9A 3ICLA 5KFHA 3NMAA 1TKTA 3KLIA 4H54A 5KFMA 4ECWA 1NHVA 1JLGB 5EWEA 1NHUA 4Q44A 5J2MA 1N6QA 1VRUA 3EZUA 3KK3A 1RDRA 3I5CA 3DOKA 4IFVB 3DRSA 1QUVA 3RAQA 1RTHA 1SV5A 3LALA 1LWCB 3FQKA 3KLHB 1T03B 3N6LA 5KT7A 5DLGA 4ECQA 3QIPB 2FJWA 1IKWB 1RTIA 3H5YA 1IKVB 3DLEB 3H40A 5FDLB 4EEYA 4IRCA 4WXWA 3H5SA 2C2EA 1Z4UA 3C6TA 3NKYA 4MFBB 3GIJA 4TY8A 3T1AA 4YQWA 2XGQA 1T3NA 2VG5A 4ECTA 3KJVA 4J9LA 1U09A 4MK9A 4J9PA 4DEZA 4ICLA 4KO0B 2BANB 4MKBA 3H59A 2VG6A 1WNEA 5KFTA 1MU2A 2YNHA 4O3OA 3CDUA 3DLGA 4IDKB 2R8HA 4ED8A 3DM2B 4WE1A 4RNOA 4ZVGA 1RTIB 1FKOB 2IC3A 5KFIA 5KG3A 3Q8PB 3BQ0A 4ECRA 5KFQA 5C25B 1CSJA 3KLHA 2HNDA 1T03A 1IKWA 4QWDA 3TAMA 2BR0A 1GX6A 2JEGA 3LANA 2IMWP 3DYAB 4LSLA 1DTTA 5T14A 1JLGA 4KHRA 5J2MB 3V4IA 1C1CA 1KLMB 4R0EA 2WB4A 2CKWA 4MKAA 1JLCA 1FKOA 2IC3B 2IJNA 4R5PB 3DM2A 1RA6A 3V6DB 4G3IA 3KLEA 1ZTWA 4U6PA 4FS1A 3GV5B 1REVA 2YKMA 1LW2B 2AU0A 4RNNA 1S0OA 3PJXA 1OS5A 3DMJA 3QZ8A 3I0SA 2FVQA 4ECVA 3LAMA 5KG1A 3DYAA 4LSLB 2W7PA 4IFYB 1S6QA 2IM1A 5KT6A 1HNVA 2WOMB 4QWBA 2AX0A 3M8PB 2GIRA 1TVRB 4X2BA 1IKVA 4URSA 3T19A 1HQUB 5JUMA 4RU9A 2J6TA 2YNFB 1DTQA 2JEIA 1BQNA 5J1EA 1RTJA 2FVSA 4EO8A 1JX4A 2E9ZA 3QIDA 4IFYA 4O3QA 2C2DA 4ED0A 3E51A 5KFPA 5KG4A 3KNAA 1BQMB 1LWFB 3QGIA 3MTKA 5DG8A 5L1KA 2OPQB 3T5HA 4MK8A 4WXOA 2WHOA 4PQUA 2XI2A 3UR0A 3DLKB 4O4RA 3DDKA 1C1CB 1NNDA 3LP2A 3HVWA 4ZP7A 3FRZA 3G86A 4NLWA 1C2PA 4ED2A 3T5JA 3GILA 5KG2A 3GYNA 3Q8RB 5KFWA 3RB4A 3CO9A 4F4WA 1RTHB 1SV5B 1DLOB 2I5JB 1HPZB 2AWZA 4F4ZA 4ED3A 2HNDB 4ECSA 1S0MA 4ED7A 1JKHB 3LP2B 5KFVA 2HNZA 5KG0A 5KFBA 3M9MB 1K1SA 5KFLA 1MMLA 3CVKA 3DRPA 1IKXB 4Q0BA 1T05A 4ICLB 1GX5A 1XR5A 1S4FA 5F8HA 3CIZA 4KHMA 2HNYA 2VG5B 3V6KA 5KG6A 5KFKA 1HYSB 5F9LA 4KO0A 4MFBA 2AGPA 4ED1A 5J1EB 3NAIA 2RF2B 1QE1A 4KV8A 4ZMMA 4RW8B 4O3SA 1RT1B 5J2PB 1TL1B 3BR9A 1RAJA 3M9OB 2R8JA 1HQUA 3OLBA 3BSAA 3CJ0A 2UUTA 2VA2A 4LSNA 3FFIB 3HHKA 3M8PA 1S0NA 2D3ZA 2ALZA 4NLXA 3DOKB 4IFVA 3KK2B 2W9BA 4DL5A 1LWCA 3LAKA 4TXSA 2ILYA 2JC1A 5HBMB 3KMQA 3KLFB 2GIQA 4TYBA 3OLAA 4IG0B 3DLKA 5KFAA 2FLNA 4TQSA 3BSOA 4O3PA 3V6DA 4G1QA 4B3OB 4MIAA 2JEJA 2YKNA 4O44B 5KT3A 2XCAA 2ASDA 4JV1A 1S6PA 4QWAA 4IG3A 4EYIB 4YR0A 3QLHA 4I7FB 2W9BB 3SI8A 1UWBB 3KK2A 2AGOA 3IG1B 4RW4B 3KLFA 1BQNB 2OPSA 3FFIA 1FKPB 3I0RB 4IQXA 4RW7A 3PW4A 2E9TA 4O3RA 3MR3A 3IRXA 4TQRA 1EP4A 4IRKA 3RB3A 5KG7A 3DLGB 4IDKA 4NCGA 1C1BB 1EETB 4KSEB 5J2PA 4IH5A 3DRRA 5KG5A 4EBEA 4DL3A 5J2NA 5HROA 1TKZA 5KT4A 2UVWA 2YKNB 5DLFA 2OPRB 2IJFA 1S9EA 2V9WA 4ECUA 4EBDA 1RA7A 2R2RA 4H4OA 3IS9B 4KKOA 4O3NA 3Q8QB 1EP4B 4DL2A 4ED6A 1N4LA 1JXLA 4LQ9A 1JLCB 4R8UB 4ZVHA 2IA6A 2VA3A 3GQCA 5C42A
chains in the Genus database with same CATH superfamily
2AW0A 2ROGA 7FD1A 5A2QU 2VD3A 3CCVS 1SKSA 2DNMA 2LLZA 4RBTA 2VQFJ 2B6AB 2BJEA 3AXMA 2VBYA 3MM5A 4Q43A 3BF4A 3BO3A 2CWKA 3UQSA 2F63A 2K8GA 5AXKA 2VFUA 3BGRB 5KOWA 2FLPA 4ED4A 3PKYA 3HKZD 5ETKA 4FF3A 1Q7YT 5CABA 2EBEA 4FF4A 4QCLA 1F5BA 2XY7A 2B43A 3SFGA 2QLWA 1AB8A 2CJYB 2O67A 2XULA 3M8QB 4X65J 3IBFB 3MOJB 1VBXA 3CO0P 4NLUA 2XNQA 1UA0A 2G0JA 2PT0A 4KQZA 1U2FA 4M5JA 3EPIA 1HW9A 4ECZA 3AT1B 3MZIA 1M5VC 1FWLA 2F9JA 1U24A 4DSIA 1URRA 4A8XA 1HI1A 1SQFA 3MD1A 4RNFA 2GJFA 4LT6A 1RP5A 2CQ2A 3GG1A 1TAQA 4LREA 4Q5VA 1HPZA 2ZH4A 4L75A 1N5QA 2CQ0A 4X4RA 2XM3A 3L4BC 1U45A 1FFWB 2HFNA 3J81Y 4YDDB 5D3GB 2DGTA 4USUA 3VWSA 3HVTA 2LP4A 4LR7A 4A8OA 3G8TA 3EGZA 4LF4F 3EGWB 4BCAA 2HNYB 3A8JA 3DDNA 5CD4A 2E5HA 5E2QA 1Q8LA 3ILJA 3CUNA 4WTOB 3GYGA 4LMZA 4CO5A 4JI2J 1HQ2A 3M1VB 4L3KA 2JLGA 1S9GA 1X60A 2JH3A 2LEPA 4RJVA 4ZIWA 4B3OA 2Y3YA 3H20A 1HIYA 3J7A1 3SCLE 3H4DA 3T3FA 1WI6A 3D1OA 4RWXA 4EMDA 1SKWA 3ZTRA 1RTJB 4NEYA 5A2QY 4O4GB 2R8KA 4B3TF 3MM8B 4F2SA 1RTZA 4ZA1A 5CCMA 4DV5F 2YNIA 3MUMP 2MZQA 1UPMB 5KFDA 1KQGB 3V6JA 1GXLA 1F2HA 1TL1A 4AYBD 1N32F 2OTLS 5G0RB 1NK5A 1DURA 4DPXA 3O2IA 4DXLA 2CAJA 4DR6F 3KKFA 2VONA 1GT8A 1KFSA 2R7XA 1QE1B 1KEKA 3TJ9A 2QMWA 1MU2B 1NMEB 1X4GA 2BVZA 3KJVB 5J2NB 4DF8A 4QIEA 1TQLA 2IYGA 4C8OA 2P8IA 4TY8B 2B9WA 4WZQA 1NPRA 2DCUB 3VR1A 2HSEB 3PV8A 1NCLA 3O44A 4RPFA 4C0HA 8RUCA 2XS7A 1FRMA 1VJWA 2XZWA 3K2YA 5ITHA 1SBRA 5B0FA 1N48A 1Q95G 2FIUA 1IR2A 2D74B 2MY7A 1R43A 3U7JA 5C24B 1S1XB 1A0OB 1VR6A 2FVRA 3T1HJ 4AUKA 2AJ0A 2JZ5A 3P3DA 1B0PA 2AZ1A 2DYAA 4JI0J 4QYZJ 2VG7B 5CYQB 2QLBB 1GTHA 4K50A 2FUG9 2KU7A 3TAMB 4B3RJ 2KO1A 2HMIA 4QW8A 2DNPA 2IA0A 2GZOA 3G6YA 1DZ5A 4YR2A 2PC6A 3RAXA 3MURP 2DNLA 5IQQA 2L3MA 4C11B 3BN7A 4F0HA 5DGAA 1L3UA 2R7UA 4CLYA 1UFKA 1LW2A 2GFFA 3NWRA 1REVB 4HLBA 2HYIB 3Q22A 5DG7A 3C16B 1F0XA 3BQ2A 4LIWA 3TA1A 4N77A 4JI8F 1RHRB 1FRIA 2KT5A 2KFZA 4DOZA 3TR5A 2MQ8A 3PEJA 1VIXA 3CCLS 4USWA 2IVYA 3MWBA 3HJVA 4E98A 1V5IB 4ILRA 2OP5A 2XWXA 4F7VA 1NKBA 1Q1KA 4B3TJ 3ET6A 1FJCA 1ZAXA 4NI2B 4M63A 3W61A 1O5JA 2H48B 3RUBL 5L1IA 3CD0A 3F56A 2IAJA 1R31A 3AOBA 1VS3A 2HBRB 3HD1A 4OI4A 4FNIA 4B9UA 1Q0NA 2LYVA 3KXDA 2E5IA 2HAFA 3IG1A 4Q2MA 3VGVA 1R8BA 2Z30B 1VRUB 4WFAQ 2ZM6J 2QL5B 3IRWP 2VIHA 3EDQB 5KFYA 2OELA 3BPSP 2DD8S 2HWTA 5JXSA 1TV6B 3BDEA 1BQXA 2YPZA 1N5YB 3OTOJ 3MFHA 1R89A 3MCOA 1NDPA 4NLSA 3DOMA 3MM9A 4QJVA 5LM7E 4NZ0A 4X62J 4FXDA 1S9FA 2GQQA 4IOBA 2RQ4A 5E3CA 4JI7F 4DR7J 2WW4A 1IKYB 1EZZB 3AB2B 3F44A 2ERRA 5HBMA 1LW0B 2U2FA 3UI3A 3RB0A 3UN5A 1HBMA 3FSIA 4ZITA 3QT6A 1Y11A 1RT4B 4IUFA 4L3NA 3TVZA 1CJTB 4K59A 1FDBA 2CQPA 1RT2B 3D1HA 2FC9A 4GC6A 5IT4A 1S6OA 1KLNA 1WSRA 4LR9A 2EC2A 2OTJS 3DN9A 5THWA 2RQCA 2CUYA 5H9FJ 1U47A 1SUQB 2IDEA 2DGWA 3RAMA 1SKRA 4RNHA 4DQRA 3TZYA 2GVDB 1LWFA 4J7CA 3AQOA 2YPYA 1I3OB 1RT6A 5B0GA 2ATLA 4XTTA 3CJ5A 3IM8A 3MMAA 4DSFA 4K4UA 4OYPA 4UQGA 3QGHA 5EDWA 4YFUA 3MPDA 2F1FA 4F26A 1YIJS 2YKOA 3BGUA 5DZ7A 1YVFA 4TKTA 1EB0A 5ADZA 2QRRA 2XCPA 3UD4P 4LFAF 5BYRA 1FKPA 3LP1B 3SCIE 4UUWA 4D3HA 3CB4A 4R0JA 2HRUA 2W4CA 1JLQA 4DX8H 2R9LA 2WOMA 4IO9Q 3KLGA 1MG7A 2VOPA 1H72C 3QSYB 1KQFB 1VRQC 4K4XA 4CDIA 4AFFA 4I1TA 3FRYA 4EYHB 2BM0A 2XO6A 1TK8A 4LFBJ 4QIGA 1VMBA 3KHHA 5F8JA 4LR8A 3JB9k 2MKSA 4DV6J 4WZMA 5F8MA 4ZP8A 3S01A 3TUJC 2RDJA 4DFPA 1F5AA 1H7XA 2EPIA 2UUCJ 2B8QA 3OV7A 3MEKA 4IG0A 4KH0B 4LFCJ 1YG0A 4P7VA 3EDRB 2VBZA 3I9V9 5F3TA 1NH7A 2V0NA 3BBBA 4DCJB 3W5ZA 2AYGA 2R7QA 1QSYA 2HS0A 2BJ8A 3PZPA 3KLGB 3KG0A 4OYOA 5C24A 2W2PP 1Q5VA 4QIFA 1TKXA 3CCMS 3GONA 3GJRB 2E1RA 3PJWA 2E7XA 1PIEA 4F50A 4XPCA 4ZVRB 4F4KA 2NZCA 5ETTA 3AOAA 2PI4A 1S6QB 2GS8A 2FJVA 1JLBA 1HR0F 3LO3A 2A3JA 4IH7A 1HMVA 3UCGA 3K5MA 3UD5A 1FDDA 1U6FA 1NJYA 2G2OA 3DXBA 4TU9A 2HZCA 4KRWA 2QA4G 2YKMB 4CCHA 5IM0A 1BXNA 2ZE2B 1RWPB 1SKUB 2L9NA 4QW9A 4KTQA 4RW9B 1HNXJ 5E0OA 1WC0A 2ZH3A 3US5A 1VOMA 1RT5A 2R3VA 3CJSA 5J1PA 1CS4A 4P75A 4BS2A 4YEAA 3I55S 1GTEA 4M94A 2V2KA 5CA5A 5CZXA 1EARA 3ADAC 4CO3A 3IBCB 1S49A 4NPOA 4J9QA 3MI7X 2VKZG 2XMTA 4CO2A 2DY1A 3NGSA 3QLHB 3UVJA 1I6JA 2DPJA 3NXZA 4ZPBA 1S1TB 4C0OC 2MGZA 3CD6S 2QL7B 3HVAA 1OQ6A 3C15B 4OYAA 4NLDA 3PNIA 2MKYA 4PXDA 2MPUA 1RT7A 4K2JA 5F3ZA 1RKJA 4JYAJ 2CJXB 3QATA 4OX6A 4F0KA 2GVZA 2DEJA 1IJEB 4E8UA 4PKDB 2IM0A 1C0UB 2XB2D 2BE2B 4DS5A 3BB5A 1S99A 2PMWA 3SFUA 2YX1A 4URGA 1FNXH 1GH8A 2IYIA 3DRPB 1S10A 1QDUB 1V9OA 3D6FB 2DGUA 3D5MA 5DQGA 3C6TB 4ZPTR 3MF5A 2YNGA 3GYXB 3IA0A 3P45B 2A6OA 3QJPA 2KZZA 1KOOA 2VFVA 4CM2A 5L1LA 1GQEA 1BWEA 5FD1A 3D0IE 5GAGU 2PDAA 2KKHA 4ZVOB 3F0NA 2NQPA 2GA7A 4Y3CA 1PG5B 3OR1A 5KFSA 1CJVB 1JB0C 1RCXB 2V8VA 3FUYA 5I42B 1NRKA 3PX4A 4ZVEA 4DWIA 1PAUB 3SCJE 3KK3B 2ZH6A 4OI2A 3KMSA 2MQNA 3NCRA 3JSMB 1FK9A 2NS1B 2YH0A 5EUHA 3DMJB 4FBTA 2ROPA 3BR8A 3P5BP 1YI2S 4PQUB 1UVKA 2L9WA 4RUBA 1OYEA 5L38A 5KFHA 4ZCIA 3HXMA 2QSFA 1ZM2A 1JLGB 2NPFA 1NHUA 4ECWA 4BWJA 1RADB 2VL1A 4IFVB 3VGTA 1S12A 3OFHA 1A7GE 1UEVA 2R7RA 3RAQA 3BYRA 2JHEA 1T03B 4ELTA 4ZPWR 1D9AA 2MSTA 1VI7A 2W4DA 2EFNA 2GQ2A 1FTCA 1FXRA 1WJ9A 2LVWA 3D7SB 4USVA 1JQGA 1VYAA 3FK4A 3EXYA 5DZ6A 1NPPA 1U4BA 1MLAA 1LFWA 5FDLB 3ZFVA 4IRCA 2OEMA 1GMWA 3R6GB 4WXWA 3N9UC 2ZEJA 4ZVUB 1Z4UA 3C6TA 4ZCKA 3W1YC 2HQFA 4DDFA 2CPXA 1WD6A 2DXDA 2OUGA 4TY8A 4YQWA 1NDCA 2APOA 2XGQA 3M8RA 3PDNA 2OEJA 3KJVA 1ZAVA 4J9LA 4ECTA 1G2EA 1G4CA 2FZKB 2AJ2A 2RNEA 2IIHA 4KO0B 1XQIA 1OJ4A 2BANB 2G9OA 2WBRA 2Z2ZA 3NNAA 3IM9A 2F3JA 2E66A 4ZN3A 2XS2A 4C4WA 1FX4A 1WNEA 1LQ9A 2CA9A 3NEKA 5D4OA 4GKJJ 2DJWA 3GTYX 2HQ3A 3DLGA 4RNOA 2EFOA 3F41A 3L09A 1RTIB 1FKOB 3U1NA 3Q8PB 3BQ0A 3CC4S 5KFQA 4YOEA 1CULB 2W2OP 2U1AA 1KKHA 2CPDA 5IQ6A 4C7QA 2ZH7A 4QWDA 3D4JA 3TAMA 2BR0A 2DHGA 1VC6A 1RWXB 2CPEA 3BV8A 2FQQB 5A8KA 4OX9F 1D9FA 3G87A 1SJRA 1JLGA 3TQEA 4R0EA 2ZWPA 1XNRJ 2CQBA 3DM2A 3R8YA 4DV5J 3TZZA 1ZTWA 2FZCB 3IR5B 4CYUB 3GV5B 3BPDA 2WVCA 2XSJB 2FY1A 3U02A 5A76A 1NZAA 2PFFB 1TMJA 1QSLA 3M6VA 5BXIA 2B4PA 3I31A 4ZDNA 1WC1A 4LSLB 1AA1B 3T9NA 3UO0A 4AQYF 3PX0A 5DM7Q 5ETSA 3J80Y 1HNVA 1OPIA 4YB7A 2HRTA 3DLLQ 4HKQA 3OR2B 3HMJG 4AXIA 3D0HE 2ZZMA 3R5CA 1HQUB 5JUMA 3PIOQ 2Q6CA 9ATCB 2YNFB 2ZBQA 3JSRA 1WC4A 1U02A 3MM6B 3UE2A 2DGXA 5D0HA 3WHIA 5J1EA 4DV4J 2RHQB 1HBUB 1JX4A 4IFYA 3NG8A 3T1HF 2QMXA 5KG4A 3KNAA 1BQMB 3QGIA 4P2SA 3K5NA 2J9EA 3CMAS 2B7BB 2F7VA 1REGX 3DGVA 3T5HA 1W2IA 2CQ3A 4IQMA 2UP1A 4GKKJ 2G0IA 3UR0A 2C2ZB 1SVDA 2PIIA 4DCPB 2V2QA 3POTB 3AAWB 4NLWA 1FA0A 5D78A 5HAOA 1VC5A 1WKKA 3I96A 1AW0A 1JWWA 2XLJA 2NUHA 3D68A 1CJTA 4BHQA 3S8SA 1HNZJ 1RWWB 2LQ5A 3RRHA 3C46A 1N88A 4PYDA 4M5DA 4F4ZA 3K7RA 1JK9B 5IT9U 2YX4A 2NXCA 2E1CA 2W1BA 5KFBA 4P2XA 1WOSA 4Z7YA 4BLGA 3IC1A 2XTJP 1FE4A 2W7AA 1NM2A 2ZOGA 1NJZA 5IXUA 1GX5A 4OIXA 1XR5A 8ATCB 5F8HA 1WACA 3OVAA 3W2VB 5E33A 2C3MA 5KG6A 3R1HA 1HYSB 2DNHA 5AE1A 7AT1B 4OHWA 5J1EB 3NAIA 4EWTA 4B9VA 4RW8B 1RJJA 3KDOA 4FVCA 2WSCC 3W66A 3BSAA 5KOXA 2FJBB 3CJ0A 2CXEA 3FFIB 1T9TA 3L9ZA 3FSXA 3HHKA 2CQ4A 3M8PA 4X62F 1WKJA 2ALZA 4NLXA 4IFVA 4KR0B 4PWUA 4DR3J 1WOOA 2PMHA 4DZDA 2QEXS 2LMIA 3LAKA 5ETPA 1NK6A 3MOZA 4DUYJ 2ILYA 4NXNF 2PFDA 4WBFA 3CD7A 4OZ0A 3GFHA 2Y1JA 1N33J 3M32A 4IG0B 4E2FB 4OYIA 1NZ8A 1E6VA 4B3OB 1NAQA 3V6DA 1UVNA 3HZGA 2DVIA 1X31C 3R5BA 4MIAA 2JEJA 4A47A 2QA2A 1HWIA 5AT1B 2XLIA 5CXTA 4JV1A 1S6PA 4J9UE 4X66F 4QWAA 2UU9J 4U8YA 2BJ9A 3MAAB 4YR0A 3QLHA 3UVJB 2W9BB 1YRTA 3KK2A 1XMQF 1T9UA 3IG1B 4X4TA 1H73A 3RR8A 4JI0F 3IMQJ 3VAMA 3C3LA 1MMNA 1UVMA 2MZJA 3MUVP 3I0RB 2QL9B 4IQXA 4RW7A 2DKOB 5BYQA 5AE3A 9RUBA 1NU4A 5E41A 3HHLD 3PW4A 1VQPS 3MR3A 2DIUA 1H98A 3IRXA 1HNZF 4JI6J 4CZCA 3QGPA 2MKKA 4IRKA 4KHPJ 4IDKA 3U1LA 4NCGA 1C1BB 1PJ7A 1KC8T 2DGSA 3PYGA 3BGLA 2M70A 2ZVIA 4QPTA 3K5PA 2PE8A 4DL3A 5J2NA 3B8HA 2BJ7A 3O8WA 3HVRA 1TKZA 4DUTA 5KT4A 2BW2A 1VBKA 1X4EA 1BHNA 2OPRB 2DB1A 3T1YF 1VK3A 3ENQA 2V9WA 4ECUA 1YBUA 2MDAA 3D1QA 3TW0A 3OJUA 3IS9B 3Q8QB 1U8SA 1EP4B 3ENAA 4J37A 4LBHA 2VA3A 4LF8J 4FXVA 1S5ZA 4Y2IA 2CIMA 2HS3A 1RI7A 1LXNA 1FD2A 3NS5A 5LSOA 1Z2ZA 2QYCA 3MFIA 3NCPA 3SYZA 4NYZA 1JJCB 4ZLLA 2XY6A 5HQMA 2W01A 1WSVA 3TVYA 3UNGC 3QFWA 4NLOA 4X4VA 4YN3B 3W2WA 1IBKF 3VAIA 4DUYF 4DUZF 3MEEB 4WIIA 3MAAA 2BW7A 3PYFA 4Q7AA 2ZNYA 1SJ1A 1QVGR 2HWHA 1OO0B 2ZBIA 4C3MA 5DM6Q 2ZH8A 4JI4J 2R8IA 3CWJA 3HSGA 4KAIA 4Q8EA 3EGVA 4XIUA 1VIOA 2RUGA 3D6MB 5A8RB 2O66A 2P9EA 5ETLA 3KYLA 1PYOB 1Z2LA 1AZSB 2CVEA 2CDQA 2K1RA 2LQ9A 2D7SA 1Q5YA 1BQMA 1RUSA 2M3DA 3FKBA 3JQKA 4NCGB 3PG9A 4OV6A 1SJ3P 2KG0A 3OSPA 1ZETA 4C8NA 1S59A 3CXCR 3Q83A 5L9XA 5FDLA 3M30A 2HFVA 2YBVA 2GMJA 3TANA 4ERDA 2H3EB 3QIPA 4UY85 4DN9A 1MNEA 1SB6A 3H7HB 3K17A 4LBIA 4ZVFA 4JI2F 3VF0B 3TZXA 3K58A 3Q2TC 2AV5A 3TVKA 4F3QA 1U1QA 4ZJQA 1HNVB 3PACA 4LRCA 3OD2A 1B4SA 1RABB 2AP6A 2BRLA 5A8RA 4ZK7M 3U1MA 2FLLA 2J6SA 3QO9B 3CGIA 1PSDA 3MM9B 3CMQA 2M52A 5HLFA 2BDPA 4J9SA 4DSLA 1N32J 3N0VA 2JL9A 4K2XA 3CCTA 4F0MA 4QWEA 4DL4A 3A8EA 2AX1A 3OJSA 5I3UA 1QM9A 1JKHA 3LP0B 3FGVA 4JP8A 4LUBA 4DX5A 4X4QA 2W9CA 1XC9A 4YP3A 2BABA 4J90A 4RR5A 4DQPA 3J7AN 3UPFA 3FVYA 4CLWA 2HS4A 4AD6A 5A8WB 3IP0A 4DHVA 1KHVA 1FVSA 2HHHF 2DHSA 4ES2A 1U0HA 5IWAJ 5J2QB 1B64A 4IYQA 4DSJA 3POTA 3ULHA 3MAHA 2C28A 1RAIB 3ITHA 4NMXA 3MHYA 3NS7B 4BDPA 5IC6B 5DGBA 2ZHAA 1PYSB 2WCXA 2IM2A 4D3GA 3LW5C 3U27A 5D6GA 1WOPA 4F2RA 4NWBA 2DR8A 3A4TA 1N36J 1C0TA 5K5MA 2B4UA 1NJWA 1WF1A 2RT3A 3M8QA 1ITPA 3OFGA 1RSCA 4LF9F 2V8PA 3HHLB 3VZIA 5F8IA 3KHGA 3OFFA 1CJUB 1ZTTA 2BOPA 4NLPA 3C15A 4UT4A 1VRTB 1NLKL 1FVQA 2CPHA 4IOCQ 1YJTA 3MR5A 3MEDB 2H5EA 2Q79A 2VOOA 5J2QA 1D09B 4DU7A 5A8KB 2J0WA 1LW0A 1L3TA 1S1UB 2BX6A 2YKQA 4HL9A 2VFSA 4C9DA 4NLRA 4PWDB 1K1QA 1PJ6A 3NBPB 5L9NA 2KI2A 1TTHB 3AWRA 4PR6A 1JLAA 1XNRF 4RUCA 1N5VA 1DY3A 1WEYA 2HBZB 4RW9A 3VGUA 2BJ3A 2G1HA 2MJUA 2AGQA 5B7WA 4CLKA 2H4YB 1U1NA 3AD8C 1TELA 1WDTA 2CPJA 3H90A 1RXOB 1UP1A 3UDCA 5AXNA 1TKDA 1QAIA 2KFNA 2M8HA 3IXQA 2C1EB 4OYMA 1S0VA 5HROB 2ACMA 1KTQA 2V4JB 1J5OB 1B99A 5LL6d 1ZAWA 3I5BA 3EWGA 4I2PA 3WBZA 5K8MA 3HFVA 1RT3B 2NREA 1EETA 3C8YA 2VQEJ 5ETMA 2O01C 2HZAA 1DTQB 4IKAA 1TKXB 2B56A 2DR6A 2L08A 2VH7A 2V2VA 1JLEA 2HBYB 4U7UK 3VCDA 5HN0A 1RCOB 1RWVB 1UJ5A 2D3UA 2QSWA 4LVOP 4M5GA 4J9NA 5SUHA 4DV2F 3G8SA 4HTIA 3PX6A 1UETA 1VQKS 5DG9A 3G96A 4YHHJ 1C0UA 3G6XA 4WU3A 2GO9A 1WG4A 4CLUA 3W8GA 4HDGA 1GK8A 1UTAA 3C16A 3GFZA 4MK7A 4PZVA 3D28A 1PILA 4YR3A 1HQEB 2Z2YB 3KHLA 3KDNA 4I6WA 3GV7B 2UUAF 4LVNP 4P10A 1PKUA 4USIA 3NBPA 2J0QD 2X7IA 2BOAA 3BGRA 4JI3J 3E3XA 2FJAB 3DLEA 3E01B 3Q86A 1NXIA 4WP9A 1PC5A 4PXCA 2C2MB 1WEXA 3A8KA 3JTPA 3MD3A 3VAKA 1KLMA 3CE8A 3UDEA 3UR3C 3QGGA 2C2RA 3OVBA 2OAUA 3NNCA 1B0VA 4EFAC 2V4RA 5J1NA 2W8LA 5CD4H 5LMUF 4DV1J 4FYDA 1F5CA 2V69A 2W2MP 2DR7A 3TZWA 5ETQA 2PSZA 3D54A 3RYLA 4RU2A 3ILLA 5DQIA 2N4CA 4IR9A 2GCFA 5EWGA 4QWCA 4JI7J 3JTOA 3TAQA 2XSFA 3DOLA 1WC6A 1IVZA 1RZMA 1R6YA 1UZDA 4FVMA 4ITSA 3BDPA 1HYSA 1VGYA 1A9NB 4ZS6A 4NLGA 1JXVA 1HMVB 1SIWB 4TLRA 2D1CA 1UEKA 3WIUA 1SQEA 2CNOB 2HBQB 2Q3PA 4HHUA 5HJYA 3IRXB 3RG6A 4AE5A 1S1VA 5EWFA 3CD5A 3N5FA 2E5GA 2W8KA 1SH2A 4CLTA 3CCUS 1D9DA 4RBVA 5BR8J 3T5LA 4OYXA 2ZFHA 2P6TA 3PVXA 4LQ3A 2GHPA 3FMWA 2V8GA 3TYTA 3K89A 1IM4A 4I56A 2LXFA 3QZ7A 4KGXB 3IR7B 1XEZA 1Q53A 4URQU 2XGPA 3DLJA 3RJMB 1KQKA 1FI4A 5E3RA 4CQ1A 4ZPAA 2HG4A 1K47A 2EWHA 1CLFA 3RRGA 3P6YC 3VVTA 2IDLA 3ISND 4EI2A 2CNLB 1LFPA 3TOQA 4C11A 2RHSB 2BBEA 4YB6A 2ZOMA 3V4MA 3EX7B 3R5AA 2HK3A 1WF0A 2FD2A 3MM7B 1X0PA 4C3LA 4DV7F 1FKAF 5HP1A 2IRYA 2F8HA 2IBKA 2FLOA 4KGVB 1NEEA 2C3YA 1HWUA 3I5AA 4ILMA 4NZ6A 3SZ2A 3FDSA 4Y2KA 5C7PA 5K20B 3SQGA 3G82A 1FXLA 4YB5A 1RWKB 3CJ3A 2EEYA 2MLXA 2LQ8A 4DU8A 1RHQB 1FHTA 2BV3A 1TL4A 4DR2F 1DJ0A 2H65B 3GWCA 2Z2LA 2OPRA 3LF0A 3QT5A 3R97A 1ZA2B 2LA4A 3FEZA 2DHAA 3I0SB 3T6JA 1T9XA 3I56S 2PI5A 4KYZA 3NGRA 5KFCA 4DCOB 2D69A 2AJ4A 3X3UA 4CLSA 1RK8A 2GHVC 5T7LA 1P8GA 4KB7A 3HO1A 3ITHB 4OZ2A 3PEHA 1HBOB 3VGSA 4G1PA 4WKYA 3T1YJ 3CJ2A 4K4YA 4K4TA 1KONA 2Z0GA 1DQAA 4UOHA 3VZHA 1IBMJ 2GMHA 4F36A 4DR6J 2B6AA 5HSPA 3OL7A 1QJHA 1HNIB 3EJMA 3KUHA 2OFGX 4B9SA 2R7OA 3H2LA 3W2WB 3QQCD 1QTMA 4PG7A 4CLZA 2CPZA 3HKWA 3LP1A 4DX6A 4WCEQ 2ZZNA 1Y5LB 1Y9OA 3S1TA 4WP3A 1RKIA 1YBAA 5I3UB 1VRTA 1CG2A 4ETZA 2R8GA 2K2PA 5HMZA 1G6BA 2F8EX 1R27B 4OJGA 2PD1A 4P74A 3N4WA 4EZ6A 4MMOA 2KXHA 3OT9A 3ZXWA 5F8NA 2CZ9A 2DHXA 3H8YA 4RBUA 1VLOA 1Y3JA 3CCZA 2YKAA 5F41A 2BRKA 3OSNA 4F67A 2L41A 1KBRA 3V81B 4WPAA 1NB2A 4DV0F 4Q8FA 3R7BB 1UFWA 2OH2A 1Y0HA 3R27A 3R7NB 1ZPVA 2EG1A 4UOGA 2RS8A 2Y0SD 4IRDA 2YNFA 4N8NA 2C22A 3AODA 2XG8A 1EQ0A 1X8DA 2K7KA 3CDEA 2A1BA 2YWFA 1D1UA 1RACB 1H6KX 1X5TA 4JI1J 1J5OA 1HD0A 3EGNA 2FVPA 2RF2A 3R6LB 4USMA 5ETNA 1RT3A 3A1YG 2A0FB 4A46A 2QLJB 3W2VA 2XBPA 3ELHA 1O0PA 5LMNJ 1R3NA 2LXUA 5A6PA 4F4YA 2D3O1 3GE9A 5E3PA 3AJ1A 4CIOA 2KG1A 2V34A 3QT7A 4NA2A 2KHDA 3ICLA 4QYRA 3THTA 1EIYB 1TKTA 3KLIA 4WJBA 4E0DA 2AT1B 4YUDA 1N6QA 1ULRA 2A18A 2HPUA 3EZUA 2RQMA 1RDRA 4CNYA 2IBOA 3DRSA 1QUVA 3NOCA 3LALA 4B3SF 1LWCB 1DHMA 4P9SA 2VPXB 4RUHA 3FZBA 2WVBA 3UDVA 3KLHB 3MPUB 4I64A 5KT7A 3MMCB 3IWNC 2MKIA 2M8DB 2FJWA 1FRHA 3I87A 2VICA 1KP6A 4A4JA 3DLEB 3TO8A 3P96A 5G4DA 2YQ1A 3GJTB 2C2EA 1MN7A 3BEGB 4MFBB 3HI9A 5ETVA 4ZIVA 3GIJA 2BA9A 4DZ6A 5ETOA 4RLEA 1HI0P 4PQAA 3TI0A 4I68A 2KL8A 1FRLA 1FO1A 3EZOA 3PIPQ 2H4WB 4ILLA 2VF3A 4JYAF 2DNZA 1WORA 2AMCB 4DPUA 2VG6A 2QN6B 3WDOA 3PJ9A 2CJ9A 2QA1A 1CJKB 3TA2A 2XLKA 3DLHA 4GKKF 1KOHA 3P49B 3DM2B 4NZ7A 4ECRA 3CJ8A 1P9YA 2MZTA 4CI0B 2AEFA 1CSJA 1T03A 2HNDA 2HHUA 2OFHX 1AT1B 1GX6A 3HHLC 5H9FK 4C6AA 4LSLA 4CLFA 5T14A 3V4IA 1U1MA 2DRAA 2ZWOA 1C1CA 4YY3F 3HM9A 2WB4A 3TA0A 4DR4F 2J9DE 1JLCA 2IC3B 2J7KA 1NSQA 1VQ5S 2LU2A 4N47A 1U25A 3OTCA 3W63A 1WDDA 3V6DB 4WWSA 4I69A 4U6PA 4FS1A 3SV4A 3N01A 4DPWA 4ES3A 2YKMA 2VFRA 2LCWA 1HR0J 2AU0A 4RNNA 2XTDA 3JQJA 2EK1A 5HJXA 4ETXA 4CO1A 1S0OA 3KJNB 1OS5A 3DMJA 1HBUA 3M7VA 2IVMA 3I0SA 4B9NA 2UXDJ 3R2DJ 1U7LA 5KG1A 3DYAA 2RRNA 1TMMA 2MHNA 2VQEF 1S6QA 3CDBA 2QIFA 5KT6A 3QWUA 3EUNA 4DR4J 1IQTA 2F65A 2AX0A 2OMLA 1CJVA 1SCJB 4X2BA 1IKVA 1WEZA 4OYZA 3GB0A 4URSA 3CCSS 4A8MP 2J6TA 4AL6A 1Q78A 2FHMA 3Q2SC 4ELVA 5DDQC 2UUCF 1H2VZ 1X5PA 3CC2S 2FVSA 1RTJA 2OO4A 5CQGA 1LEOA 3ZZUA 4EO8A 1JJ4A 4LF5F 1AFIA 3QIDA 4K0KJ 3NWGA 3SEOA 5SZTA 2C2DA 3OUYA 4ED0A 3E51A 2FHKA 5KFPA 2MB0B 2K3KA 4ANDA 1AZSA 1GMVA 4LFBF 4M5KA 1YJNS 1KVJA 3DDKA 1C1CB 3QPIA 2HVEA 1NHKL 3LP2A 5GVQA 2MGZB 4DR1J 3VQTA 3FRZA 1NDLA 5CCLA 3QRRA 2BKOA 3B6BA 5M2RA 1TL7B 3D67A 5L46A 4B3MJ 4HHHA 1N5TA 1X4DA 2QA4S 2W4PA 1AROP 2CJAA 2Z57B 3CO9A 2HIQA 4F4WA 2GW8A 1RTHB 2VDIA 3MUTP 5LMUJ 2Y1IA 2NR0A 2AWZA 3ZZPA 2ZC4A 3JS9A 1U49A 1S0MA 4DV1F 4RO0A 2AKWB 2CZVC 2FTRA 5JJBA 3EICA 2J9CA 2RMLA 3M9MB 2E29A 3SDEB 2AIRB 1UFLA 2M9KA 2ZNZA 5GMKa 1IKXB 1LKZA 1UZHA 4MIWA 4MYUA 2ZDPA 1H7WA 3L95X 3AOCA 1S4FA 4ICLB 4L76A 2FYXA 2HQIA 1YLXA 1HWKA 2VG5B 2ZBRA 3C14B 4KHMA 1JMTA 3Q8YA 5HATA 1HBNA 4ED8A 2LA6A 3I6PA 4AXJA 1ZPWX 2WB1D 1QE1A 5KTQA 4ZMMA 2Y0BB 3A12A 3C19A 3VALA 3BR9A 4C48A 3MMJA 3OLBA 1LWXA 5IT0A 1Y5NB 3OTBA 3M30B 2LECA 5HMYA 5H1SV 1GXTA 2D3ZA 2OKQA 4M5IA 3RBZA 3UNYA 1VQ9S 2JOQA 3A8IA 4L74A 2W9BA 4DV4F 1FRJA 1LWCA 1WHVA 4QOTA 4LIRA 3NP5A 3CJKA 2OGUA 3L7OA 2CG4A 4HACB 2MZSA 3L7UA 3KMQA 2P9GA 4P72A 1ZM4A 2MEWA 2KB2A 2LQBA 3LPYA 2UU9F 2BXJA 5IZHA 2E5LJ 3CCQS 3OLAA 3Q0AA 3QJJA 3HHNB 3FMBA 4L72B 3DLKA 1ZA1B 4N56A 4TQSA 4G1QA 3TRGA 2HHXA 1WKLA 2RD5C 1P9QC 1NH8A 1YJUA 2YKNA 1EHWA 1RQ0A 4O44B 2XCAA 1UVJA 2UXBJ 3WC0A 1RE1B 4USKA 4IG3A 4NASA 4C0BA 3BH6B 4QIVA 3TARA 3J7ZT 1WELA 2AGOA 1X9MA 1AYEA 4A8WA 2ZDOA 2JFDA 4U7UD 2DCLA 2L9DA 5FIIA 2XNRA 2OPSA 2DNYA 3FFIA 4PG6A 1FKPB 2C42A 2QTWA 3UD3P 2WW8A 3R5DA 4X66J 4O3RA 3M2UB 3ZZYA 4TQRA 2F4VF 1EP4A 2DRDA 3RB3A 2PGCA 2NXUA 3W64A 5KG7A 3DLGB 2R7TA 1C4CA 3MMAB 1F60B 3J81U 1U26A 4IH5A 5KG5A 3RW6A 3RRKA 3A13A 1PO6A 1SIZA 2RH3A 5HROA 1KQSR 2W25A 2CQGA 2IPOB 3HX9A 4HR2A 4DI6A 5C2GA 5HO4A 2YKNB 4LSZB 2V6AA 1NK8A 1IBKJ 2YTCA 1H2UX 2DIVA 2KN4A 1KVKA 3CTRA 3UN2A 4JI6F 1M90T 1B70B 1LXJA 1RA7A 4O3NA 1IR0A 1JXLA 1QVFR 4ZVHA 5CYJA 4KPYA 2JDJA 5C42A 4QU7A 2ATCB 2VASA 2RQKA 4QIWD 2C3UA 5KFOA 1TK0A 2RVJA 1S1UA 4ZCMA 1OY8A 5IWAF 2I5JA 4ZPVR 5CYQA 1GNKA 1Y3KA 4JUZA 5K8PA 2ZHOA 3OTDA 2ZJQQ 2DPIA 4ZHRA 1U1RA 4HI2A 1VQ8S 1LK5A 3QSIA 1TKTB 1WTFA 4USHA 3ZTPA 4BBYA 2GJIA 3MECB 1Q8KA 1ZYQA 2ILZA 2DGOA 1RU2A 2EVZA 1Q82T 4KKOB 4JV2A 1KR4A 3SCKE 2UUWA 3K5OA 3CCRS 4DQSA 3D3BJ 2OLWA 4LJMA 2ZBCA 2ADBA 4OZJA 1YBTA 4UF4A 4PG4A 4FPIA 5B0DA 2BKPA 3BSCA 3HVTB 2XQCA 1YHQS 1AUDA 3JYTA 1JJ2R 2MQMA 3HJFA 3H98A 3GG0A 3N6MA 3Q23A 2IY5B 4TU7A 4DL6A 1DRZA 2WONB 4DV6F 4LF2A 2M5YA 1IWAA 4OYBA 4AT1B 2O5DA 3ETMA 4Y34A 2VBWA 4LSNB 2D68A 1VC0A 4DPYA 4U67Q 4JV0A 4YB1P 1FDAA 2QJ3A 5I42A 2J0SD 4OHZA 4RW8A 2DGQA 2B0GA 2JLEA 1P6TA 3TX0A 2VPYB 1UA1A 4Y2CA 2D41A 2JX2A 3MM7A 4BWMA 1ZS6A 3R5GA 2YQ3A 4G1IA 4G6VB 1I94F 1S6PB 3KLIB 2V5HG 3MMBB 3HFZB 2D9OA 3BO2A 1TK5A 3EPGA 4CTAA 3RBEA 4CNZA 4FF2A 4K4ZA 2B3TB 2K7JA 1X5SA 2WVDA 4M5HA 2B8PA 1KSPA 4ID5A 1XK8A 2AJ1A 3M32B 4P73A 5KFFA 2BZ2A 4DFJA 3TQ1A 4WFXA 3V4IB 4NRUA 1TR0A 3P5TL 1HWJA 1BC6A 4DUZJ 1NKCA 2I0XA 1CS4B 4OI1A 1TL3B 2J5AA 3FC9A 5D4NA 3ZTOA 5T41A 1HBOA 1S57A 3FBFA 4CT8A 1KN6A 2QZ8A 2OI2A 2KXFA 2WONA 1B7YB 2VG6B 2VDHA 3O5TB 4FPRA 5EHHA 2D3OR 3OTEA 1JNRB 1BY9A 4X65F 1ZH5A 5EN1A 1VFJA 2GQCA 3DOLB 4XDCA 3EVMA 2KH9A 3GV8B 2KHCA 1HNWF 3NL0A 3D2WA 1PGZA 3FCWA 2XYPB 1MWYA 5HL7Q 3ZZZA 3OTOF 5KT5A 4NEZA 1PBUA 1D3WA 1JLAB 1RT7B 2C2KB 3TWZA 2VJVA 1VBYA 3MR6A 3G6VA 3SQGB 3GMGA 3M8YA 2IVFB 2KZMA 2VV5A 4DBQA 4TVAB 1YJRA 1RAOA 4B02A 3H0PA 3DRXA 4X4NA 4K8RA 3CJ4A 2DNOA 3GJSB 2FJXA 3MM5B 2JEFA 3BBFA 1ZM3A 2DR9A 3RBDA 1NB7A 1T11A 4NCBA 3MCMA 3WQPA 4FS2A 2IM3A 4ZPDA 3DU5A 4CRJA 5LSRA 2MQOA 2DXFA 2ZHBA 4C8MA 3W5YA 1F3VA 5B0BA 1PBAA 1VQLS 1RLCL 3M1VA 2BQRA 1K0VA 4ZP6A 4A8FA 2K3IA 1BMQB 3DI6B 3H5XA 1JLFB 2J7WA 2BANA 4FYYB 5KFNA 4R5PA 1FWKA 2ZD1B 1MN9A 5A6WA 3V6HA 4EZ9A 3PM9A 1F3FA 3SV3A 2CQ1A 3AJDA 2A2DA 3WZ0A 2OSQA 1JNZB 2JFKA 1QLNA 1CPZA 3PHEA 1U1PA 3MEDA 3JQMA 1HA1A 3SSRA 3G82B 2E5LF 3EMTA 2PO4A 4WF9Q 4H4MA 4Q45A 3M6XA 1S1VB 2AQ4A 4GKJF 3FBBA 2G13A 4ECXA 2R2SA 2DY9A 1MROA 2HQGA 2DISA 3QBCA 4KFBA 3CF5Q 4C97A 3SBMA 2JVRA 2VZ9A 1N54B 2ZUAA 4U95A 4PUOB 3BGOP 3DI6A 3PFEA 4DL0C 3HULA 2C3OA 2GGPB 1OQ3A 3PXGa 1NUEA 3CCWA 2ZD1A 4CYUA 3V81A 3CJQA 4IH6A 3PYDA 2KDOA 5EX0A 5I3QA 4OX9J 1XTZA 3VAJA 1RHMB 3BSNA 2O3DA 3VQSA 2WTFA 3KLEB 4YHHF 4J9KA 2BACA 2CQIA 2PN6A 3RBXA 4WFBQ 1FK9B 4DLEA 2G1DA 4YMEA 3N28A 3HP6A 4KHPF 2NXEA 3PW5A 2B4OA 3BBCA 2XC9A 2KVIA 2OEKA 3GCXP 4Z2XA 3RTVA 4QU6A 1HNIA 1BLUA 1OPZA 1FT8A 4JB8B 1FNMA 3H2UB 2MSSA 3UWTA 4UZBA 4J9MA 1F6TA 2BQ3A 4C8YA 1FNOA 4Y6IA 3KJFB 3UCZP 4DSKA 2N4DA 4H4OB 3WX4A 2V94A 2V63A 3FBEA 5KFZA 2OD4A 1S9EB 3GIRA 3LGMA 3KLVA 2KRBA 4MT1A 1C0TB 5L8RC 3CC7S 4CH7A 1XMOJ 4K4SA 5AXLA 5H9EJ 3NCQA 3M6WA 3PW2A 2P2CB 1VQNS 1JLBB 2E9RX 1MMDA 3TEGA 2HKEA 4U96A 4NLQA 5BR8F 3MXHP 4KFBB 4QPXA 3NGDA 4IR1A 4FN5A 4B9MA 2HWIA 3DCAA 4I2QB 1V6HA 4J5OA 3CDWA 3H5UA 4M95A 3H2VE 4H4KA 1NK9A 3KTQA 3PW0A 3PHTA 1URNA 1U0HB 3OXGA 3R1LA 5C5JA 2XZ2A 2CJBA 4NLVA 3K8VA 4WU2A 1M1KT 4YS2A 2AD9A 2MKHA 3O6QA 1TAUA 1M5SA 3CCES 3OHBA 3MEGA 3AX5A 3LP0A 4LF7F 1DFDA 3RZAA 4WYLA 2ASJA 2Q6BA 2ZM6F 3DFEA 2BKNA 5U47A 4Y28C 3LTOA 3DOMB 2UVUA 2V2ZA 4OLOA 1T95A 3LPEA 1FEEA 1MWZA 3NY0A 3BO4A 4M1KA 1W2BR 5DQHA 3OL6A 4ZLPA 1NJIT 1QAJA 2GAGC 3M2VB 3AX3A 2HFZA 2W2NP 4F3OA 5CYMA 1H2TZ 3VAGA 3ILIA 3ISNC 3AH6A 5K9FA 3SSSA 1N34F 1T9VA 2WK4A 3PR5B 1UEUA 3K59A 1YITS 2J6UA 2VB6A 3D3CJ 4WFZA 3M2UA 1T7PA 2JRSA 4WK3A 2VC1A 4DG1B 3W62A 5KFJA 2DTJA 3KK1A 5FJ4A 5HQLA 1GMUA 3AA8A 2RKIB 2AHOB 1FERA 4LRDA 1NKEA 4TYAA 1FD8A 5F8LA 1LV5A 1UAWA 1J2VA 1E6YA 3JYTB 4F4XA 4RW6A 4OJ3A 4PXBA 2V50A 5BYSA 3PR4A 1UL3A 2CNKB 3KWMA 4J9OA 1FJ7A 1IJFB 1SC3B 1RU1A 3JXOA 4U7CA 4KJIA 1S1WB 1HD1A 2VC0A 5B08A 3UW1A 2G2ZA 3PKMA 2HGMA 1I51B 4FZVA 4TNOA 5K8OA 4RUAA 1OSCA 2HNZB 4FYXB 5DETA 1RHKB 1NSPA 1OYDA 2NZ4A 2XZTB 1RT4A 5F0UA 2ZZTA 2VPZB 3V2UC 1RT2A 4HTJA 1KDNA 4I7FA 1SC6A 3M2VA 1HNWJ 1YJVA 1R0BG 1FCAA 3TX8A 4PEOA 1SL2A 4ELUA 2FY8A 1UWAA 5MLCV 4V1Ak 3H4BA 4KV8B 2IHR1 2CQHA 4DQIA 1XR7A 1N52B 4NYOA 2DNRA 1OMSA 5GAEI 4CM0A 4EBCA 2F4VJ 1RT6B 2J9DA 4O0NA 5D4PA 3F73A 3M2RA 4FYWB 4PABA 4EGLA 2CVIA 4X64F 1T8EA 2MJNA 2RKIA 3BGFA 4ZN1A 2M7SA 1N33F 2LKZA 4C8LA 2CPYA 4RKUC 1D0EA 4J9RA 3C2PA 4NCAA 3G71S 1WHWA 2RE1A 1C1BA 3IR6B 3LH2S 5E5NA 1UMJA 2BQUA 3KUEA 2CFXA 5LXRA 2YWHA 2V1SA 1T0TV 2H5JB 1BWVA 1Q16B 2OSRA 3AJ2A 3EE3A 1VQ6S 2DH9A 2Y8WA 1TVRA 4GO5X 1KHWA 1GFWB 4LF8F 4JV5F 5HMWA 4X64J 3NAHA 1O8BA 2V8HA 2BE2A 3UDLA 4LF4J 1HBNB 3DRYA 1VISA 3AFGA 2AEJA 4CT9A 4DL7A 2HURA 4ID5B 2LDIA 2ROEA 3C6UA 1RAHB 4CWBA 5IS2A 4KPCA 1WHXA 1ICEB 2X51A 2Z56B 4K7QA 3H25A 2G2YA 3EYZA 1T05B 3AB4B 2DHHA 1UKUA 2V8DA 2VUGA 3DGPB 5KFEA 4ZP9A 3T5KA 2BYCA 3ZNJ1 4H54A 2XY5A 3PO5A 3M05A 2LDYA 4Q44A 2J8SA 2V9KA 5J2MA 4C3KA 2WBMA 3KK3A 3I5CA 4DV2J 3PY8A 3DOKA 4TLQA 3G6ES 1NPKA 3C66A 2OIHA 1RTHA 3B54A 3CJKB 3V5RA 2IJRA 3MCSA 3N6LA 4DR5F 1OSDA 4OQJA 5DLGA 3PRBA 1VHIA 3QIPB 3ZNUA 2YX7A 1K0TA 1IKWB 1APSA 1RTIA 2X3DA 3OR2A 3H5YA 1IKVB 4MYTA 1ELOA 3DHXA 3SXLA 3UFCX 5LXYA 3LWMA 3MDFA 2ZH1A 2FJEB 5BJRA 2ZUGA 3NKYA 2R42A 3I82A 4PPDA 3VV2B 4CP5A 3FCVA 4ZVPB 1W26A 2AEMA 1WUUA 3T1AA 1RGVA 2VG5A 1T3NA 4JI5F 3K0JA 1U09A 4MK9A 4DEZA 4ICLA 1WI8A 2DNNA 2HQCA 4A8YA 4MKBA 3TEHB 3KNGA 2D9PA 2XMJA 2YNHA 4YY3J 4O3OA 3M8SA 1EKSA 2R8HA 1WF2A 4R25A 4ZVGA 2I8EA 4HH1A 1H3DA 5AE2A 2LU1A 3AQPA 2AYMA 3R5JB 3KLHA 5A8WA 1U6BA 1IKWA 1F2GA 1N34J 1UUJA 4IOAQ 1NSKL 2H1YA 3NNHA 1FXDA 1DARA 2MMYA 3DDIA 1M1GA 1NJXA 1O51A 1IUJA 2Q1LA 1F9FA 2QT7A 3DYAB 1DTTA 2H9ZA 5J2MB 2IMWP 5AXMA 2UUBF 4C8KA 5IT9Y 1GXUA 1WHYA 1WC5A 1FKOA 4A48A 4ZKAA 4RL1A 4LBPA 4R5PB 2AJFE 2Z8QA 4OI6A 4G3IA 1ZZFA 3KLEA 4ID8A 2Z4PA 4P71A 1LW2B 1IBCB 4HVZA 1LK7A 2HVIA 4ZLNA 3PJXA 2Y9HA 2EKNA 1E6YB 4F04B 1CQMA 3I32A 1OIAA 2IM1A 4IFYB 4ZJLA 4LF1A 2P6SA 2WOMB 1FEHA 2GIRA 2MLYA 2YVSA 1WG1A 3D6HB 3T19A 1V3SA 1YK9A 2VHGA 1TUVA 3N79A 4B3SJ 3W8PA 4OI3A 1XNQF 1X4BA 2JJ4D 1FF2A 4RU9A 2XMMA 4W90B 3ZZRA 3AHPA 5E3QA 3DC2A 1BQNA 1YWXA 4EUVA 4KC5A 1QD1A 1YTYA 2HFSA 2E9ZA 2OHDA 5M2UA 2OMOA 4MAKA 2NCKL 3K5LA 5RUBA 3ETOA 3M8ZA 2Y1RI 2L48A 3ENVA 1LWFB 5DG8A 5L1KA 3MTKA 4DV7J 4QR2A 1VQOS 2EFPA 2MZRA 4MK8A 3PO4A 4JI5J 1W7WA 2WHOA 4P6QA 5D4LA 1M5KC 3BH7B 4PQUA 4DPTA 1D8YA 4DFKA 3RGIA 1UCNA 3THVA 4JI3F 3NS6A 1NNDA 1Q4RA 1OY6A 2RU9A 3HVWA 1NDKA 4X84A 3G86A 4S0MA 3ZC4A 1C2PA 3ZZOA 4ED2A 2GO8A 4OMFG 2FB0A 2HHPA 4W4MA 1Z1ZA 3GYNA 4DN0A 3GILA 3TNVA 1TUWA 1SPBP 3TJ8A 5KFWA 4Z37A 5GMEA 3RB4A 2HVHA 1KVIA 1SV5B 1IR1A 4W92B 5IV3A 2I5JB 4PWWA 1HPZB 1MW7A 5B0AA 2HNDB 4Y0FA 4ECSA 4CH0S 4ED7A 5B0EA 1I1GA 3QRPA 1F9HA 1UW9A 2HNZA 1IWGA 3PFOA 4K5RA 1K1SA 4XK8C 3HLUA 5KFLA 5KFVA 5KG0A 4A8QA 3MPYA 1OY9A 3DRPA 1KD1T 1IBLF 4GVBB 5E3AA 3OQ2A 1Q79A 2VBXA 3CIZA 1YRXA 2HNYA 4OX7A 3JSYA 4UTGA 5AJ3J 3V6KA 5KFKA 2PA8D 2JLFA 4MFBA 3W9IA 3FSYA 1QTNB 3W9HA 2FHJA 4GVBA 1JJHA 2RF2B 1X4FA 2KT2A 1IBLJ 4KV8A 2CQCA 4ES1A 2ZH2A 1IM6A 4O3SA 2A6MA 2R8JA 3M9OB 2YH1A 1HQUA 4FNHA 4CO0A 2HHVA 3RR7A 2UXCJ 2HHHJ 4MKVA 1NK7A 1UJ4A 1TU0B 2XMVA 1U48A 2MY8A 2AF6A 3DOKB 1S0NA 1QSSA 1UVIA 4W98A 3LGHA 3KK2B 4K5SA 4HH0A 3CPWR 4TXSA 4BC9A 2XYGB 1RBLA 5DDPC 5LT5A 2ACYA 2DNGA 4P2FA 1Y4ZB 1RAEB 5KFAA 2FLNA 3BSOA 2MLZA 1YGYA 4O23A 2A2CA 4X4PA 2YWGA 4P7TA 1Q8IA 1SC1B 3FZ2A 2MKJA 4I7FB 1FDNA 2BM1A 2EBGA 1OM2A 1UWBB 4CLLA 3E2EA 5IOLA 1Y10A 2EI5A 4RW4B 5GMDA 4OV1A 3KLFA 2DRBA 4B3RF 3OR1B 1TFYA 2E1AA 3CEDA 4P2MA 2F8MA 3OVSA 4V19X 2ABYA 1UW4A 2FC8A 3K57A 4OHYA 1SC4B 5A0YB 1XMQJ 3B78A 4UY8T 4GVLA 4MKYA 4KSEB 1EETB 3R2CJ 3D6TB 4GRSA 2X1AA 3IAM9 3ILOA 1YQHA 4KT0C 4EBEA 4L6V3 1L3KA 2CWXA 1N5SA 3GP9A 3VVUA 4DJBA 1XBWA 1SL0A 3QT8A 4N7TA 1ZBTA 4M5NA 2IJFA 2UV8G 3VAFA 3FEYB 5D8HB 4DS4A 4H4OA 4KKOA 1RLDA 2IA6A 4EU0A 1AUSL 4ED6A 1N4LA 1JLCB 2YY3A 4F02A 2MYFA 2DNKA 4AQYJ 5HK4A 2FZGB 2ZH5A 2KXNB 3S7RA 2Y1LB 2NSCA 1DLOA 4M5DB 4NOHA 5KFUA 3TUZC 3QRQA 2DH7A 4OHVA 3E01A 3KJQB 3JSBA 1X4HA 2NYHA 4DR3F 1ZZNA 3G9CA 3IGVA 1X0FA 2P5VA 3GIKA 4AL5A 1IKYA 3ISZA 4KGZB 3OL9A 4QQBA 2W7OA 3EZ5A 2O1PA 2DEIA 4OX8A 5DS7A 2UVVA 2POKA 2NPIA 3PRDA 3FJ2A 3I4PA 3BJYA 1HHSA 3VAHA 2RRBA 3W9JA 2HLTA 1TV6A 1VQSA 1ACMB 2OPQA 3M6UA 5CZVA 2UZAA 5DDOC 3JAMU 1V3ZA 2XMUA 2N7CA 1IKXA 3IN5A 1N36F 2F4FA 3BYPA 4A8KA 2IAJB 4DX7A 1YZ7A 2FJDB 3NGUA 2UUBJ 2HFUA 1MSWD 1G1XA 3D66A 2COLA 2EFQA 4C98A 2I38A 3ZTSA 4ZVQB 3KUGA 3KOAA 4Y00A 1S97A 4JI4F 1F9EB 4H4MB 2XI3A 2EG2A 4JOUA 2BUNA 2R4FA 2W24A 4WFNQ 2I1RA 3B4MA 1U1LA 4LF6J 1LNQA 4QR0A 5ETRA 1G3OA 2DO0A 5HP1B 3BQ1A 2R7SA 3G2XA 5L1JA 2RSQA 5CYMB 1VLYA 1SXLA 2ZC3A 2XEXA 4HDHA 3CNQP 5CHCB 1RAGB 4EO6A 2HZVA 1EAYC 1U6ZA 3UCUP 4Q0BB 1HQEA 1TZ0A 2YWWA 1PYTA 4I0WA 3GCWP 3RW7A 3FNNA 3OFEA 1G7CB 3GR0A 4LRFA 1BUXA 4LF6F 2CRLA 2DH8A 3CW2C 1FFGB 2C2OB 4L73A 2IFXA 5D0EA 2Y8YA 3BZQA 5LOQA 3IAS9 1F1BB 2VFTA 3MEGB 3MM6A 4NYPA 1S76D 2CDRB 3PW7A 4GMKA 3AA9A 2PA3A 2VG7A 3IWLA 2V1TA 2CPFA 2DR5A 1S77D 1RT1A 4OJ1A 3HSJA 1CJUA 2YNGB 3J81j 3MPWA 3HHLA 4I4BA 4OZNA 1T94A 5F0WA 2WSEC 2XWYA 1L3SA 1VQ4S 1R8CA 2RDIA 1HKAA 1XR6A 5EX3A 2LEBA 4AL7A 2YNHB 4XDDA 5F9NA 1TKZB 4ER8A 4ZLJA 3W3SA 5LSLA 4WYWA 4ZPCA 2FPHX 2GAHC 2QV6A 1SUQA 3HDSA 3L3CA 1XNQJ 1XIQA 1U1KA 3HSDA 3ZZTA 1GEHA 3W7BA 1CVJA 1RISA 2YXLA 1HHTP 2ZH9A 3TAPA 4P52A 3I9ZA 4DG1A 3KK1B 3SQOP 1HLWA 1VHFA 4LF5J 1VCTA 3J7YI 1FTRA 4TU8A 3DXSX 4ECYA 1DTTB 4RNMA 2YWEA 3QFHA 1GAOA 4WKRA 2XMWA 3QYYA 1UJ6A 2IRXA 2KJVA 2VPWB 3OXLA 3SSQA 3MMCA 2KM8B 4HYKA 3FBCA 1RHJB 5E7OB 4DV3J 4I2PB 2RS2A 4WFYA 1FX2A 5MAOA 2XMAA 1TUGB 4DQQA 2DNQA 4HT7A 1CC7A 4IG3B 5C42B 1R0CB 2CJQA 4BC7A 5HMXA 3GPAA 1RT5B 3PTWA 1N6QB 3DHWC 3OW2R 3BKTA 1S1WA 1V5VA 3CSKA 3X1LB 4IO1A 1N5YA 4ZVSB 4Y65A 1KTVA 2F9DA 2UXDF 4NX9A 1HARA 2E7WA 2ZKUA 3FEXB 2MKCA 3NLCA 1FFSB 1FRXA 3OBIA 1ZOTA 2PMZD 2ADCA 3L7PA 2JC0A 4PUOA 4PWDA 3BKFA 1VQ7S 4HT5A 1Y5IB 5CAAA 1JLQB 1U1OA 5K14B 8AT1B 2MHEA 2VODA 1QY7A 1AXQA 3ZZ0A 4LFAJ 1TP7A 2F40A 1SH3A 2XS5A 5CH7B 3WX8A 1RWOB 1YZ6A 4WE1B 3O1LA 5K14A 3D0GE 6AT1B 4DR7F 1DQ9A 4RWWA 4RW4A 1CJKA 1S48A 2CYYA 6FD1A 1YKWA 3M2RB 4QYZK 2OD6A 4I6AA 4DR5J 4Q2LA 2P9CA 2OJ3A 1MWQA 1K73T 4NXMJ 1YJWS 2K06A 1FRKA 5IFMA 1EQMA 2GVDA 3HT0A 3HFKA 4NE9C 5K8NA 3GIMA 3NGTA 3P4UB 1S9GB 4ZJOA 1JLFA 5JVHQ 2I2YA 4ANCA 2GVZB 4X4SA 2FVCA 1O6XA 5KFGA 4UZCA 2CG8A 1XERA 1YDLA 2I9SA 2C2NA 3ENWA 3MR2A 2QGFB 2XYHB 3JAMY 1XJWB 2V4QA 2BJ1A 3MECA 1LWEB 1TL3A 2QFJA 2EW9A 1FJGJ 1S1TA 4J91A 4USJC 3IWXA 2DBBA 3BREA 2HMIB 2FGCA 4NRTA 4TY9A 1H74A 4XO0A 5JMNA 1PC4A 2LEAA 4X4UA 1X7VA 2KYXA 3GR1A 1BE4A 1IXKA 3HHDA 2LQJA 4XAKA 3ZTQA 4DFMA 4R8UA 4FKXA 3A3PB 4DPOA 5B0CA 5I4MA 3WC2A 2EC0A 3AY0A 4OL8A 1U8WA 3IS9A 4TN2A 4DSEA 2KTQA 3FQLA 3S6EA 1SH0A 2BMBA 2ZITA 4MH8A 4ZVTB 4CTAB 5IM0B 2EXUA 5AJ3F 1ROFA 2NXJA 3Q8UA 1N0VC 2R2UA 1YJ9S 1QAYA 4RZRA 2BEFA 1X4CA 3GIIA 2JNJA 3Q8SB 3QJLA 3DU6A 2HW3A 1XMOF 4NA3A 2KVQE 2HK2A 2M0GB 2E5JA 3NGKA 1V3RA 4KH1B 5D15A 1HHQA 2MZ1A 1Q86T 1S4EA 5A0YA 1R6VA 3I0RA 3MEEA 4RW7B 1N56A 4F25A 4FP9A 2GHWA 4O4GA 2MXYA 3OHAA 1R0AA 5GAHU 2MTLA 1QUPA 2B5JB 2DT9A 2YNIB 4MIBA 1NK4A 1P1TA 4CLPA 1SQGA 1HI8A 4KBIA 2ZVSA 1C4AA 2E1MC 2B9EA 2N3LA 4NXMF 2K1RB 1LWEA 2AZ3A 2B4VA 3K8WA 3GZ7A 2QLFB 1J27A 3IGNA 2ZKTA 1X9WA 3JTNA 1W25A 4FXWA 1S6UA 2CZ4A 2EFGA 2YQ0A 4G1QB 3VTIA 2JVOA 3BN4A 3C6UB 4O44A 3DGPA 4WK1A 4ENOA 3MAQA 2ZJRQ 1LOUA 2HAIA 3IFEA 3JSMA 7FDRA 1E6VB 1VDHA 2EKYA 3AX2A 3T6BA 5DJBA 5D3GA 1L3VA 1JIHA 3PCOB 2ZOFA 3LUYA 3HT3A 4Y2AA 1R0AB 4NLYA 3MTJA 4KGKA 4G65A 1WG5A 2B5JA 1CULA 2GMLA 2KYZA 1S1XA 3MGJA 3Q8VA 4XPEA 1JLEB 2RB7A 5KFRA 2UVRA 1NBEB 4GO7X 4ALZA 2XTEA 4U8VA 2KFYA 2HEKA 2RAQA 3HHEA 3MPVA 2XO7A 2HGNA 2W9AA 3ONQA 1DBDA 4WTYA 1VBZA 5H9EK 1PCAA 4LFCF 2OPPA 1HNXF 2CADA 2R2TA 2ASLA 5KT2A 1Y7PA 1CC8A 2CJKA 1T9WA 4NA1A 1NSAA 3TP2A 1RWUA 4DMZA 5LJ5Y 2QFIA 3DRRB 2RILA 2OPPB 3PYEA 1B0TA 4N8OA 3SDEA 3RB6A 5KFXA 4NXNJ 3KHRA 3BM7A 1EX8A 4B9LA 3HZEA 2G0CA 4DLGA 2XMKA 1RYRA 3EVOA 2RIJA 1RTDA 2HLUA 4DR2J 4HACA 2EK6A 3A3OB 1N0UA 3LWLA 1IN0A 1HL6A 4PPZA 1I94J 4ZHRB 2AYEA 1ZM9A 4K4WA 3DRSB 3H42A 3MCNA 1NK0A 4V19J 2FHJD 3OL8A 2R7VA 1RTDB 2M4MA 3AD7C 4LF7J 2W9CB 5B09A 1XWLA 4CH1A 4DF4A 4KIAA 1RWNB 3FCHA 1SJFA 1TL7A 2N3OA 4KE5A 2ZE2A 4A8SA 1X4AA 5T7LB 2HHQA 4LF9J 2NUUG 1X5OA 4I6YA 4FBUA 2UXCF 4K4VA 5GAHI 2DGVA 1A6LA 4B08A 1FJEB 3QO9A 2IMOA 2PEBA 4RW6B 4JI8J 4GC7A 2QO3A 2V67A 1YJ7A 1EKRA 2WVEA 2XHCA 5D0RA 3N6NA 1MROB 2H51B 2E1PA 5F8GA 4JI1F 4OYWA 1DQ8A 1RBAA 3N5BA 3R3TA 1J5EJ 1RYSA 5C25A 3HD2A 5C2CA 4CO4A 5KAKA 1FE0A 4ANEA 2DK2A 3KFWX 2KM8C 3M9NB 1Q7LB 3EVWA 4B17A 5LJ3Y 5JVGQ 3SIPB 3MR7A 2FGOA 2A10A 2QE5A 4NLTA 4I2QA 2MQPA 2GC8A 2B9XA 2OPSB 2J76E 2LFVA 2QMUB 1HBMB 1SJQA 3TJAA 5GAEU 2BE9B 1J5EF 1KRPA 4B9TA 1TFWA 1KWMA 2YWKA 2AJQA 1UWBA 1Y00A 1I5OB 3NMRA 2V4JA 2SXLA 2XSJA 3QNWB 5L39A 4N41A 1B7FA 4OLPA 4X4OA 2G4BA 1GMWD 5D0GA 1RHUB 2DXEA 4MJKA 4ATNA 2R7WA 2F5GA 3QAUA 5HLFB 1B3TA 3NMAA 3HSZA 5KFMA 1KS2A 2DO4A 1NHVA 5EWEA 1YRUA 1VRUA 2JWNA 1M1HA 1R8HA 1SV5A 1IBMF 2N82B 5DDRC 3FQKA 2WZ1A 1RB0A 1D8ZA 4PYAA 4PG8A 4C2MA 3LQVA 1DAXA 4ECQA 3NRBA 3CDAA 2MQLA 5HVGA 1SL1A 4EEYA 3NOGA 3GSDA 3H40A 2IRUA 2Z58B 3D9BA 1K8AT 2J8AA 1HW8A 3H5SA 3J7Z5 1SI9A 2DITA 4J9VA 4QZVB 2WSFC 5M2PA 3CT9A 4OFZA 4J9PA 4K0KF 5HQ8A 2XZDB 3QAEA 2XHWA 1WTBA 3H59A 3T41A 2RJZA 4ZCLA 2GX8A 1MU2A 1T9YA 1YX2A 3CDUA 1WWHA 1BD6A 1RWMB 3B82A 3LOUA 1P1LA 1RAAB 4IDKB 4JBCA 4WE1A 5KFIA 4Z7CA 2IC3A 5KG3A 1TL5A 4YDXA 3J7YU 2E44A 1AFJA 1RAFB 2HHTA 1FESA 2HVZA 2YKPA 2GNKA 6FDRA 2WRMA 3BKUA 5C25B 1QAXA 1JXEA 3GLJA 5HVFA 1CQNA 2EFVA 3GSIA 4U9RA 2JEGA 3LANA 1WC3A 4PXEA 1M5PC 3MM8A 4KHRA 3I4HX 4Y2MA 3SMZA 1KLMB 2CKWA 1K9MT 4M5MA 4MKAA 2X1FA 4ED5A 2IJNA 4FDFA 5DO2A 2HQDA 1RA6A 3J80U 1U2RA 1U2CA 2X3GA 3HF5A 4M8LA 3LGNA 3OXFA 3B4DA 1H0HB 4FKYA 1REVA 4OZ1A 1M0SA 4HHJA 4USTA 5LMNF 1M5OC 4N76A 2ZJPQ 2HFOA 2GIFA 3QZ8A 3MMBA 2LXIA 2VJUA 2FVQA 3OUYB 4ECVA 3LAMA 3M8WA 2W7PA 1N8RT 3Q24A 5D77A 4EK2A 4QWBA 4F4AA 3M8PB 1TVRB 1SJ4P 4NL5A 3IO1A 3TUIC 1RBOB 2QX0A 3HCXA 4DL5A 2QLXA 1Q8BA 2X1GA 4NI2A 1DTQA 2ZBPA 4WP8A 2RU3A 3DLBA 2JEIA 2BE7D 3ET6B 4UOCA 1VQYA 1EJ7L 4OZLA 2H5IB 4O3QA 1Q81T 4F8RA 2ALYB 2CNNB 2QG9B 3KG4A 2OPQB 2M2BA 2NSBA 3EXCX 4WXOA 4DV3F 5I3PA 2ASYA 4QBUA 2XI2A 3QWPA 2RRAA 3P8BB 3DLKB 2CPIA 4O4RA 4LRBA 1R7IA 2Q66A 2WAQD 4LRAA 1R8AA 2PEHA 2Q43A 4ZP7A 1T02A 5HANA 3HPOA 3CIMA 3Q89A 5IV4A 3T5JA 4WIQA 5KG2A 3HK2A 1BGXT 4C8ZA 3Q8RB 2QYGA 4UUXA 4UW2A 3T9ZA 3CCJS 4F3MA 1KFDA 4PCQA 1XMBA 3W5XA 2VKRA 4H4KC 1DLOB 1S72S 1CEZA 4ED3A 3IBWA 4KGMA 2CQDA 3THPA 2C3PA 1JKHB 3LP2B 4OHXA 2HHSA 4B3MF 3GFYA 4QR1A 5FLXU 1CBKA 1MMLA 3CVKA 2B9YA 4Q0BA 2HIYA 1T05A 1S7HA 3G4SS 4HEA9 5KFTA 3RU0A 5GAGI 5GADI 1IQZA 2HRYA 4KO0A 5F9LA 2AGPA 4ED1A 2HHWA 1FWPA 2J0XA 1UVLA 2FDNA 4I67A 1VK8A 3CULA 1RT1B 4FYVB 5J2PB 1TL1B 4UOFA 1RAJA 3QMQA 2KRRA 2E7VA 1L5UA 2UUTA 5G0RA 2VA2A 3M4XA 4LSNA 3LA0A 1P27B 1UPPA 2UUAJ 3EM1A 4RX6A 3DNCA 3W65A 2Z2MA 1OWXA 3GJQB 2VQFF 2MQQA 4OZ5A 1HWLA 2QC3A 4PG5A 2GV1A 2JC1A 2NYIA 5HBMB 3KLFB 3R7SB 4FF1A 2GIQA 4M5LA 3ZO7A 4DV0J 4TYBA 2RUSA 1S7IA 3GU0A 3AD9C 2W2QP 2NXNA 1VJQA 3G8QA 3WIVA 1NO8A 4O3PA 5HI7A 4OZ3A 4DR1F 4HI1A 4KY3A 2UV8A 3KG1A 4NMLA 2KJWA 5KT3A 2ASDA 2GGPA 1S79A 1PJ5A 2RDDA 4EYIB 3UN3A 3PRVA 3SI8A 1XN9A 1HFEL 2KT3A 4JV5J 4OJHA 1M5HA 3CMES 1BQNB 3AXKA 2HGLA 3A3NB 4OI0A 1KNZA 4N5SA 4MTPA 2JSXA 4ZOSA 2E9TA 4PRFA 3VHQA 1YSJA 3DKDA 5EGYA 2V68A 1K44A 2X1BA 2FHOB 1PAEX 2M88A 5FLXY 4O0IA 2HVDA 2AYBA 1FJGF 2UXBF 5J2PA 3OPKA 2B7CB 2N7YA 3DRRA 3GFXA 5DRKA 3C14A 2GJ2A 1VQMS 2H54B 2J7UA 2BJDA 5DLFA 2UVWA 3CJRA 3TUPA 3W60A 2XTCA 2WVFA 5IC4B 5GADU 2B51A 1S9EA 3O3LA 1U0SA 1H38A 2VU5A 4EBDA 1T3OA 2R2RA 2NLWA 3E8OA 4PAAA 4DL2A 3BS9A 4UQTA 1R8PA 4LQ9A 2I6WA 3R9LA 4R8UB 3CJTA 5HVHA 1X9SA 3GQCA
chains in the Genus database with same CATH topology
2AW0A 2ROGA 7FD1A 3CCVS 2VD3A 1SKSA 2DNMA 2LLZA 4RBTA 2B6AB 2BJEA 3MM5A 2VBYA 3BO3A 4Q43A 3BF4A 3UQSA 2K8GA 5AXKA 2VFUA 3BGRB 5KOWA 2FLPA 3PKYA 3HKZD 4FF3A 1Q7YT 2EBEA 4FF4A 4QCLA 1F5BA 2XY7A 2B43A 3SFGA 2QLWA 2O67A 2XULA 3M8QB 3MOJB 1VBXA 4NLUA 2XNQA 1UA0A 2PT0A 4KQZA 1U2FA 3EPIA 4ECZA 1HW9A 4HKQA 1M5VC 3MZIA 2F9JA 1U24A 4DSIA 1URRA 4A8XA 1HI1A 3MD1A 4RNFA 4LT6A 1RP5A 2CQ2A 3GG1A 1TAQA 4Q5VA 1HPZA 2ZH4A 1N5QA 2CQ0A 4X4RA 1U45A 3J81Y 2HFNA 5D3GB 4YDDB 2DGTA 3VWSA 4A8OA 3HVTA 3G8TA 3EGZA 4LF4F 3EGWB 4BCAA 2HNYB 3DDNA 2E5HA 5E2QA 1Q8LA 3CUNA 4LMZA 4CO5A 3M1VB 2JLGA 1S9GA 2JH3A 2LEPA 4B3OA 3H20A 3J7A1 3SCLE 3H4DA 3T3FA 1WI6A 3D1OA 4RWXA 4B3TF 1SKWA 1RTJB 5A2QY 2R8KA 4O4GB 3MM8B 4F2SA 4ZA1A 5CCMA 4DV5F 2YNIA 3MUMP 2MZQA 5KFDA 1KQGB 3V6JA 1GXLA 1TL1A 4AYBD 1N32F 2OTLS 5G0RB 1NK5A 1DURA 3O2IA 4DR6F 3KKFA 2VONA 1GT8A 1KFSA 2R7XA 1QE1B 1KEKA 2QMWA 1MU2B 1X4GA 2BVZA 3KJVB 5J2NB 4DF8A 4QIEA 1TQLA 2IYGA 4C8OA 4TY8B 2B9WA 4WZQA 2DCUB 3VR1A 3PV8A 3O44A 2XS7A 1FRMA 1VJWA 2XZWA 3K2YA 5ITHA 1SBRA 5B0FA 1N48A 2FIUA 2MY7A 2D74B 3U7JA 1R43A 5C24B 1S1XB 2FVRA 4AUKA 2AJ0A 2JZ5A 3P3DA 1B0PA 4QYZJ 2VG7B 5CYQB 1GTHA 4K50A 2FUG9 2KU7A 3TAMB 2KO1A 2HMIA 4QW8A 2DNPA 2IA0A 1DZ5A 4YR2A 2PC6A 3RAXA 3MURP 2DNLA 5IQQA 2L3MA 4C11B 3BN7A 5DGAA 1L3UA 2R7UA 2GFFA 1LW2A 4HLBA 2HYIB 1REVB 3Q22A 5DG7A 1F0XA 3BQ2A 4LIWA 3TA1A 4N77A 4JI8F 1FRIA 2KT5A 2KFZA 4DOZA 3TR5A 3PEJA 1VIXA 3CCLS 2IVYA 3MWBA 4E98A 4ILRA 2OP5A 2XWXA 1NKBA 1Q1KA 1FJCA 1ZAXA 4M63A 1O5JA 5L1IA 3CD0A 3F56A 2IAJA 1R31A 1VS3A 4OI4A 4FNIA 4B9UA 2LYVA 4Q2MA 2E5IA 3IG1A 4WFAQ 1R8BA 1VRUB 3IRWP 5KFYA 2DD8S 2HWTA 5JXSA 1TV6B 3BDEA 1BQXA 1N5YB 3MFHA 1R89A 3MM9A 4QJVA 4NLSA 3DOMA 4FXDA 4NZ0A 1S9FA 2GQQA 4IOBA 2RQ4A 5E3CA 4JI7F 1IKYB 3AB2B 3F44A 2ERRA 5HBMA 1LW0B 2U2FA 3UI3A 3RB0A 1HBMA 3FSIA 1RT4B 4IUFA 4L3NA 3TVZA 4K59A 1FDBA 2CQPA 1RT2B 3D1HA 2FC9A 4GC6A 5IT4A 1S6OA 1KLNA 2OTJS 3DN9A 5THWA 5H9FJ