1RA7A

Poliovirus polymerase with gtp
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for proteolysis-dependent activation of the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
molecule keywords Genome polyprotein
total genus 144
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1ra7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ra7A02
1JKHA 4DL5A 2W8KA 5J2QA 3JYTA 4O4GA 4TY9A 4IFYA 4O3SA 3MECA 4R5PA 1GX6A 2YKNA 5KT3A 2VG5A 4WZMA 2HAIA 4IG0B 2XCAA 3DLEA 3NAIA 5EWGA 1S9GB 3H98A 5J2NB 3ICLA 1Z4UA 4B3OB 4I2PA 4RW4A 5C25A 3E01B 3M8QB 2AGPA 3H5UA 3Q8PB 1JIHA 4TYAA 4I2QA 5DGAA 5KFWA 4ZMMA 3MF5A 3NGDA 1IKVB 3H4DA 2I1RA 3GIKA 4EYIB 3PZPA 5KFTA 3BSAA 4EYHB 4JV1A 1LWCA 2E9ZA 2C2EA 2OPRA 1JXLA 1TVRA 5J1EA 3IRXB 2ASJA 5EWEA 4KAIA 3T1AA 4H54A 3FSIA 4FS1A 4KB7A 2RKIA 5JUMA 1TKZB 4IG0A 4LSLB 1RTIA 2XI3A 2HNZA 2W9CA 1RYRA 1S48A 2IM0A 4ECTA 4KFBA 1QAJA 1GX5A 5KFLA 1WNEA 4ED1A 2B5JB 3H59A 4ECXA 3T5JA 1J5OB 5F8GA 1QE1A 4TY8B 4Q0BA 2R2TA 3LANA 1T05A 3T5HA 1EP4A 5KFVA 2HNYB 3DM2B 4ED8A 2OPQA 4LQ3A 3PW0A 1S97A 1NHUA 3FFIB 4MFBA 2AGQA 3GV8B 3DOKA 5DLFA 1TV6A 3ISNC 3KHRA 1S1VB 2OPSA 3C6UA 5F9LA 3D28A 3MEEB 5L1IA 4J9RA 4ECWA 2R2UA 1T94A 3MTKA 5KFZA 2XGQA 1HMVB 1KLMB 5J2MA 4IH6A 4ZPCA 1JLFA 3RAXA 3LAKA 3DYAA 1QE1B 5KFCA 1S1TB 3QLHB 2JC0A 4RW4B 2ZD1A 3M8PB 1KLMA 4O3NA 5KT5A 2OPPB 3TQ1A 2R8GA 2R8HA 3MR2A 2C22A 2B6AA 3MEGA 3KLFB 3KHHA 4QW8A 3KK2B 1N6QB 2R8IA 1JLEB 1JLBA 2BRLA 2BE2B 5D3GA 4PUOA 2YNIB 1S1VA 1TQLA 5I42A 3N6LA 1CSJA 5KFUA 3M8PA 3T5KA 2WHOA 5KFAA 4Q8EA 5J1EB 4QW9A 4K4VA 3BJYA 1TP7A 2HWHA 1SV5A 2W7PA 1T03A 4KHMA 3DLGB 1RAJA 1LWEB 1RT6B 2D7SA 1RT3A 1RT7A 4G1QB 3TAMA 4YR3A 4X2BA 4J9QA 4FS2A 4ED0A 2IBKA 5I42B 3DRPB 3PVXA 1VRTA 3OL9A 1KHWA 4LSNB 4F4YA 4ZVHA 2IM1A 3DYAB 3IS9B 3LALA 2V9WA 3H4BA 2VG6B 1R0AB 5HBMA 4ZVFA 1S9EA 1I6JA 3UDLA 4J9NA 1RT3B 4ECRA 4HYKA 3Q8SB 5K14B 1HYSA 4ECYA 2YKNB 4ZP6A 5KG1A 4IKAA 5HP1A 4J9MA 1RT2A 3IG1B 2XWYA 4B3OA 3DMJB 4NLRA 2FLPA 3OL6A 5C25B 2UVUA 3RB4A 4ID5A 5I3UB 1HPZB 3M9OB 4NLWA 4ECVA 4JUZA 1SV5B 2W9AA 4ECZA 4PWDA 4IDKA 5FDLB 2HNDA 2D3ZA 5F9NA 5KFFA 1W25A 1SUQA 3V6DB 5DG7A 4KBIA 3BQ1A 4O3RA 2I5JA 2WB4A 3BR9A 4Y3CA 4URQU 1LW2A 2AQ4A 3V81B 4QWBA 3H5SA 4G3IA 4QWDA 2RF2B 2HNDB 1MU2A 3KMSA 1RT5A 2W9BB 5HP1B 4RW8B 4KKOB 3G6VA 1BQMB 3BGRB 3PJXA 4IFVB 2FVQA 4DG1B 4Q44A 4RNOA 2C28A 4KFBB 1DLOB 3KK3B 2RDJA 3LP1A 1RTHA 2GIRA 3QO9B 4K4XA 3GILA 3GV7B 2CKWA 4IRDA 1LWFA 4Y34A 2IJFA 2AWZA 4Y2AA 1MMLA 1JLBB 1JLEA 3ISND 4KKOA 1S10A 2J6TA 4WYWA 4NLXA 3I0SB 2JC1A 2RDIA 3TVKA 2QE5A 2ATLA 1QUVA 5C42B 3KLGA 4ECSA 5KFJA 4LSLA 4MK8A 4KO0B 2GC8A 4I7FA 4JV2A 4RW9A 4YP3A 2AX0A 2OPSB 3C6UB 4Q8FA 3UR0A 3KMQA 5L1LA 1JX4A 1BQMA 3C6TB 1VRUA 3SFGA 1C1CA 1FKPB 4WFZA 2HNYA 3CDUA 3DM2A 4IH7A 5KFGA 3MFHA 3LP1B 1JLQA 2WCXA 3QGGA 1RTJB 3QZ7A 1RT2B 3G6YA 1IM4A 3GIJA 3KHLA 2YNGB 4R8UA 3NAHA 2OPPA 3NBPB 2D3UA 2DPJA 2XI2A 3CJ3A 1JLAB 3KK2A 1RA6A 5KT6A 2WOMA 4ZVGA 1REVA 1UWBB 5KT7A 4J9PA 1IKXA 2BQRA 3QGHA 2R2SA 5DG8A 5KG2A 3KK1A 2IJNA 4NLTA 2I5JB 3C6TA 4EBDA 3PR5B 2BRKA 1TKTA 4O3QA 2FVSA 3Q8RB 4QPXA 2WONB 3RBDA 4IRKA 5KT4A 1C0UA 3SI8A 3BGRA 2VG6A 4O44B 1R0AA 2YNGA 1N5YB 2FJWA 4DL7A 3E01A 1DTQA 3G86A 4MIBA 4NLPA 4RUAA 3I5CA 4MIAA 4RW7A 4F4WA 2WONA 5HLFB 4WE1A 5J2QB 3PW4A 5T14A 2C2RA 3OL8A 3DLEB 3DLGA 2WOMB 4NRUA 1REVB 1UWBA 4NCGA 4YQWA 5CYQA 1JLCA 5C24A 3MECB 4R5PB 3Q8QB 5KFYA 2E9RX 5C42A 4K50A 4KHRA 4M95A 3T5LA 3DI6A 2B43A 3LP2A 5J2NA 4ZHRB 5DQHA 3IRXA 3JSMA 1N48A 2FLLA 4PWDB 4KSEB 3M9MB 3DRRA 1QAIA 3CJ2A 3KOAA 3GIMA 1LWCB 2ILYA 2UUWA 3DOLB 3IG1A 3KLHB 1VRUB 4TYBA 4WFYA 3JSMB 4URSA 5KFBA 1HQUA 1EETB 2ZE2A 4RNHA 5KG3A 4ED7A 2YNHB 4F4ZA 2BQ3A 1S6PB 3DLKB 5KFKA 1S6QA 2RF2A 3DRSA 4IRCA 4WE1B 4J9SA 2GIQA 1TL1A 2IAJA 2QV6A 4EO6A 3BREA 4EBEA 3V4IB 2VG7A 4IFVA 4ICLB 1EP4B 2RKIB 1C1BA 1SUQB 3H2LA 5KFRA 1DLOA 3KK3A 3H5YA 4ED6A 1XR5A 3V6DA 1S6PA 3DLKA 2R8JA 4H4OB 5L9XA 2R2RA 3CDEA 3BSNA 2HNZB 3OHBA 2W9CB 3DOKB 3VQSA 5KG0A 4Q0BB 3CJ5A 3CWJA 4JV0A 2V4RA 1KHVA 4EEYA 4J9OA 4RNFA 5KT2A 3KLGB 3MR3A 5F8IA 4IH5A 4KV8A 2HMIA 1C2PA 5HROB 4FBTA 4I7FB 4DG1A 4XO0A 1ZTTA 1HMVA 1HQEA 4RNNA 3KJVB 3HHKA 1IKYA 1S9FA 5F8LA 4ED2A 2FVRA 4QWAA 4J9LA 3H40A 5CYMB 4RNMA 2ALZA 2VG7B 2C2DA 1HQEB 1HNVB 1N4LA 1S1XB 1S49A 1RTDA 3KNAA 1T3NA 4MKAA 2BQUA 2AX1A 3NL0A 4NLDA 4YMEA 3CJ4A 4NCGB 4ZP8A 3LP0B 1JLCB 5C24B 4MKBA 1FKOA 3KLIA 4NLGA 3M9NB 1K1SA 3NBPA 4NRTA 3H5XA 1C0TA 5J2PA 2YNFB 3PHEA 3PW2A 3EPGA 1RYSA 4NLUA 4MH8A 2BE2A 1RT6A 5D3GB 1ZTWA 4ZP9A 2FLNA 4IFYB 4MK7A 3DDKA 3I5AA 1ZETA 3DRPA 2B6AB 3M8QA 1RTJA 3DOLA 3MEGB 3KLFA 1RT4B 1NNDA 3KK1B 2AGOA 5F8JA 1FK9B 1S9GA 5HBMB 2CJQA 2YNIA 4I2QB 3QGIA 3G6XA 1HQUB 3RB0A 2ASDA 5DG9A 1D0EA 4XPCA 5KG7A 1S6QB 3DRSB 2OPRB 2JEGA 5KFMA 1LWEA 1S0MA 5F8MA 4G1QA 5KFEA 4O44A 1N5YA 2JLEA 4EO8A 3KLEB 4OL8A 4YR0A 4ECUA 2EC0A 1HPZA 3BSCA 4RW7B 4H4OA 3SFUA 2YNFA 2W7OA 4H4MB 3OSPA 3BQ2A 3BQ0A 4PQUA 3UPFA 2UVVA 4LQ9A 3EZUA 4WZQA 3QZ8A 3ITHB 2UVWA 1FK9A 2IC3B 2W8LA 2IA6A 2IM2A 3KJVA 4F4XA 1U09A 3LAMA 1LW0A 4QWCA 4WYLA 2BANB 1J5OA 3FQKA 1MU2B 2W9BA 3GV5B 3QIDA 3IGNA 2O5DA 3ITHA 4IDKB 4Q45A 3OLAA 4WFXA 4NLQA 1LW2B 5KFNA 3E51A 5KFPA 4XPEA 3KLEA 2V0NA 2ZE2B 1IKWA 3HKWA 4WXOA 5DQGA 4U6PA 5KG6A 3V6JA 3T19A 3GQCA 4O3OA 5DLGA 4NLOA 5JXSA 3N6NA 4H4MA 3MFIA 3V6HA 1SH0A 5KFXA 3N6MA 2OPQB 4DL4A 2BR0A 3MEDA 4TXSA 2IMWP 4O4RA 1K1QA 1EETA 3I0SA 1LW0B 1RT1B 2JEJA 3CJ0A 3MEEA 5KFOA 3QYYA 2YKMA 2VA3A 4M94A 3EPIA 3FQLA 5KG4A 3HVAA 4K4UA 4RU9A 4RZRA 1D1UA 3CO9A 3FRZA 1HARA 3OLBA 4ICLA 1FKPA 4PUOB 1TL3B 1DTTB 3QIPA 4RW6B 4ZPDA 4QWEA 4ECQA 1JLQB 4ZVEA 3RB3A 1N6QA 2FJXA 2J6SA 3OHAA 1S1TA 3QLHA 4O3PA 4F50A 4RW9B 3KLHA 2ZD1B 2WTFA 4K4SA 1DTTA 4EBCA 3FDSA 5L1KA 4K4YA 4TLRA 4R0EA 2WRMA 4YR2A 3PR4A 4NZ0A 3UQSA 3LP0A 1RT1A 3NMAA 5C5JA 5F8NA 4Q43A 5K14A 5CYMA 2IC3A 3OSNA 1C0TB 5J2PB 1HYSB 4DL2A 4FBUA 1S4FA 1RT7B 1S9EB 1S1UB 1IKVA 4J9KA 4MK9A 3RBEA 1TL3A 3QIPB 1S1WB 4RW6A 4DL6A 2BANA 4LSNA 1JLAA 4ID5B 5I3UA 1RT4A 4K4ZA 4GC7A 5KFHA 2XGPA 1JLGA 5EUHA 4TN2A 4GC6A 3HVTA 3PW5A 1IKXB 4ED3A 5KFDA 3NKYA 1RA7A 2UUTA 1TKTB 1IKWB 1S1WA 3KHGA 2FVPA 4RUCA 5HLFA 4IQXA 1RTIB 2ZKUA 3IGVA 5KFSA 1NHVA 5EDWA 2V4QA 5FDLA 5L1JA 3PW7A 4IR1A 4WXWA 5DGBA 2B5JA 1C0UB 3HVWA 5KFQA 3CVKA 1T05B 2UVRA 5CYQB 3DRRB 2HWIA 2FVCA 1TKZA 1RTHB 3QO9A 4MFBB 3V6KA 3DI6B 3LP2B 3MR6A 2ILZA 4TQSA 1RDRA 3JYTB 1TV6B 5EWFA 3V81A 3IN5A 3I0RA 1BQNB 3GYNA 1RT5B 4TY8A 2J6UA 4ZHRA 4RW8A 3BSOA 2IAJB 4K4WA 2E9TA 1SH2A 5F8HA 2IM3A 4I2PB 5J2MB 3KLVA 4PQUB 1XR6A 4Y2CA 3FFIA 1BQNA 1LWFB 3I5BA 4TQRA 4KO0A 3V4IA 1HNIB 4K4TA 4NLYA 3PJWA 4DEZA 3OL7A 1SH3A 2YNHA 1C1CB 2FJVA 1S0OA 1S0NA 4IOBA 4ZP7A 1TL1B 4DL3A 3CIZA 2VA2A 2D41A 4KV8B 4URGA 2HMIB 3RAQA 1S1UA 1JLFB 1HNIA 2XC9A 1C1BB 1OS5A 3RB6A 3D5MA 3CDWA 3I0RB 1TKXB 2F8EX 3MR5A 1XR7A 4IG3B 2YKMB 5KG5A 3GIIA 4NLSA 2AU0A 1JLGB 5HROA 3HVTB 2WK4A 3TAMB 4ZPBA 4NLVA 1HNVA 1S1XA 1RTDB 3MEDB 2XCPA 1VRTB 1TKXA 2VG5B 2R8KA 3IS9A 4IR9A 1IKYB 4NYZA 1FKOB 4R8UB 4HKQA 1N56A 1JKHB 2ASLA 1T03B 5KFIA 5DQIA 2OH2A 4O4GB 2JEFA 4U7CA 4ZPAA 3KLIB 3DMJA 4KE5A 2JEIA 1DTQB 4IG3A 1TVRB 2DPIA 1YVFA
chains in the Genus database with same CATH superfamily
4OI1A 3NP5A 5AXLA 4A8QA 2HK3A 4USKA 1DJ0A 1N5VA 3JYTA 3QQCD 4TY9A 4CT9A 3PZPA 2Y8YA 5J1PA 2LECA 4R5PA 4DWIA 1R0CB 2XCAA 2XEXA 2BJEA 2GZOA 4LF8F 3NAIA 3MUVP 2UXDF 4OHYA 1S9GB 1HWJA 3H98A 5J2NB 4JI7F 2ZHBA 4I2PA 4YDDB 3D4JA 3SBMA 3GFHA 2POKA 5T7LB 1G2EA 2AGPA 2DR8A 1JIHA 1FEEA 2VPWB 4DFJA 2BOPA 3TJ8A 3H4DA 3CNQP 1VQKS 3UD5A 4OX9F 3BDEA 4JBCA 4TU8A 4NMXA 5KFTA 4EYIB 3NNHA 3BSAA 3SQOP 4EYHB 1VQ4S 1LWCA 3W5YA 2XO6A 2C2EA 1TVRA 1SJQA 1YJVA 4ZVRB 1YKWA 5HQLA 5DDOC 1D9DA 2W2QP 4D3HA 4LMZA 4KAIA 1RABB 4H54A 5ETLA 3VGVA 2EPIA 2DR6A 3BPSP 4ZN3A 4FS1A 3IP0A 1SC1B 1WKKA 3OR1A 2CQIA 4IG0A 9RUBA 4LSLB 2D9OA 1U2RA 5F0UA 2HNZA 3R6GB 3BF4A 3OTBA 6FD1A 4OIXA 2RE1A 1GX5A 1QAJA 1WNEA 1BY9A 2DK2A 3MAHA 3R5AA 3T6JA 2B4PA 5H9EJ 1OYEA 4TY8B 1YRUA 1Q8KA 2RQKA 3LANA 4L72B 4P52A 3UI3A 4X64F 1T05A 4LFBF 1HW9A 2DNPA 1WOOA 3HJFA 2KDOA 3GPAA 2HNYB 2HK2A 3RR8A 2FZKB 4YS2A 4MKVA 3GTYX 4HACA 2ZH8A 4MFBA 2F4VJ 1PYTA 1PJ6A 2IRYA 4PYDA 1QSYA 2D69A 3F41A 1TV6A 3MPVA 1QM9A 2H65B 2W2PP 4MMOA 1GTHA 2OPSA 5F9LA 3MMAA 1PC4A 5FLXY 2EBEA 3D28A 3G96A 3C16B 2JLGA 1QJHA 3CCJS 1QTMA 4NXNJ 1WHWA 3BKTA 3PEHA 4K5RA 4N41A 4QIVA 4C97A 2RMLA 2MY8A 4J91A 2B3TB 4IH6A 4M5NA 5J2MA 3TZZA 4P9SA 5IM0A 3M6XA 1PC5A 4P2XA 2XM3A 1B0VA 2Z2LA 1Y7PA 1HBMA 1VK8A 2B4VA 4ANDA 2QT7A 2XS7A 4YY3J 1VIOA 4OYBA 2ZD1A 3CJ8A 1KLMA 1BMQB 2EI5A 1YLXA 3BYRA 1F60B 1U0HB 2A6MA 2AKWB 2OPPB 2K7KA 2R8GA 3SXLA 2F65A 2KJWA 1N6QB 3HFKA 3DLJA 4KGKA 3CCRS 3VZIA 3QRPA 1S59A 2B7BB 3PCOB 4JOUA 4ZPTR 1UPPA 2YNIB 1S1VA 4PUOA 5D3GA 3R5GA 4YUDA 3N6LA 2JZ5A 2BZ2A 2QRRA 4CZCA 1RAEB 3W3SA 5B0EA 1KEKA 4Q8EA 3DDNA 3FJ2A 4Q7AA 1TP7A 1ZS6A 4USJC 4P2FA 3SIPB 1O51A 2P6SA 3KLHB 3SCJE 1RT7A 3S1TA 4G1QB 3TAMA 4AT1B 2JVRA 4WKYA 1O8BA 1K73T 3K0JA 3R1HA 5I42B 3DRPB 3JTNA 3OL9A 1VRTA 4BHQA 1L3TA 3MI7X 2IM1A 3LALA 2EBGA 2R7QA 2VG6B 3MDFA 4FZVA 4UT4A 4RLEA 4N5SA 2XMTA 1HBNA 1NH7A 4ZN1A 2DHGA 2N4DA 4F0KA 2FGOA 2M0GB 2EFVA 4ECRA 4ZITA 4HYKA 3FCHA 1DBDA 2HQDA 4HR2A 2LA4A 2MQ8A 4P71A 5KG1A 2Y0SD 3MEKA 1RT2A 3IG1B 3KUHA 3UN2A 4NXNF 4L3KA 3NNCA 2NQPA 1WHXA 4B3OA 2G4BA 1R89A 3OL6A 1T9VA 2N7CA 4A8XA 1AROP 3M9OB 1HPZB 4ECVA 2F9DA 5GMEA 4DR1J 2QLWA 2HHWA 4JUZA 3TEGA 4DL0C 1HLWA 1UZHA 4I68A 2W9AA 3BH7B 4ECZA 2WVEA 2XB2D 3Q2SC 3R3TA 1UKUA 3BR8A 1SC4B 2HNDA 3OFFA 5KFFA 1SUQA 1T3OA 2KVIA 3HD1A 3L7PA 3V6DB 2ZWOA 2ALYB 1F9EB 4FNHA 5CD4H 2Y1JA 2DNMA 1NBEB 4MT1A 3DGPA 3BDPA 1ZYQA 2NXEA 1U6ZA 1RACB 1GTEA 4QWDA 4G3IA 1MU2A 1RT5A 4KRWA 5GMKa 1Y4ZB 4DR3F 2V34A 1R6VA 2KXHA 5A8WA 3EVWA 3PJXA 2FUG9 2AHOB 4IFVB 1NDCA 4DBQA 2DXFA 2YKQA 1U4BA 2IDEA 2C28A 3HHLB 2BJ8A 3QO9B 4FXWA 4IRDA 4FF3A 2K8GA 3AD8C 2AWZA 4PXCA 2IJFA 5B09A 4DSIA 1MMLA 1R7IA 1YDLA 1KWMA 3LWLA 3U02A 1S10A 2ZZNA 3AT1B 4NLXA 3TZWA 1Q78A 3TVKA 3DGVA 2RHQB 3M32B 3VGSA 3KLGA 2WB1D 1RLCL 4UY85 3OPKA 1UJ4A 2Y1IA 4EWTA 2EFGA 3MAAB 1B0TA 3ZTQA 1QAXA 2QGFB 1Q95G 4DV2J 3QRRA 3O3LA 2DXDA 3QAEA 2MKSA 3ZZPA 4WFZA 2IVYA 3DM2A 3CDUA 3MFHA 4C9DA 2MKHA 1RCXB 2WBMA 3R5CA 1KOOA 1SKUB 4OHWA 4L75A 2CQ0A 3KHLA 4K2JA 1GNKA 1MMDA 2ZFHA 2ZUGA 3MMAB 1B70B 4DU7A 1CULB 4R8UA 3NAHA 3M32A 3KG0A 5B0DA 4DR5J 3NBPB 4JI2J 2FYXA 4IOAQ 2MGZB 1OJ4A 2FQQB 3CJ3A 1WSRA 2BW2A 2J8AA 4M5LA 2HHQA 5IT9Y 3MCNA 4CRJA 5KT6A 1RP5A 3JXOA 1LNQA 5KT7A 4JI5F 4HI2A 2ZHAA 4J9PA 1TTHB 3M6VA 4DLEA 3QGHA 2CJKA 2M9KA 2F63A 2MY7A 3CB4A 1FFWB 3CCWA 2V1SA 3AXMA 4USWA 4DQSA 4F02A 1AFIA 2OI2A 2J7WA 2MLYA 3AQOA 3AA8A 3MAQA 3DHWC 4IRKA 1OYDA 3IR7B 4FKXA 2VQEJ 2KZZA 3BN4A 1C0UA 3ELHA 1N5TA 4I56A 2CADA 3BH6B 1R0AA 3AJ1A 1N52B 3FBEA 3UO0A 3E01A 1DTQA 3EUNA 1SL0A 3PYGA 3I5CA 3T1HF 1IR2A 3TOQA 2PIIA 2D9PA 2XSJB 5J2QB 4WP3A 2F4VF 1YRTA 2WOMB 3THPA 2CNNB 1XK8A 1JLCA 3GP9A 3MECB 5CYQA 1ZH5A 1UA1A 2VICA 5KFYA 3UCGA 5C42A 2DNRA 2ZNYA 3X3UA 4JYAJ 4DPUA 3CMES 3GFYA 2ZVSA 5D4NA 1UFWA 3JSMA 3NGRA 1N48A 3QJPA 4KSEB 5FIIA 4ZVSB 4NZ6A 4PWDB 1KQSR 2VFUA 2WZ1A 3BKFA 1RWVB 2HIQA 2R3VA 3DOLB 2ZEJA 1NB7A 1X9SA 2VQFJ 3TVZA 2VBZA 2LVWA 1UZDA 4B17A 5FJ4A 2MZSA 3DOMA 4RNHA 3K58A 1X8DA 1XMBA 1CC7A 3TVYA 4MIWA 2KT5A 2YWEA 2HQGA 4OV6A 4JI4J 3R2DJ 2E5LJ 2GIQA 1U02A 2NXCA 4YB7A 3R8YA 1TFYA 1B64A 4MYUA 4IFVA 1KQKA 3LPYA 2N3OA 4ICLB 2BOAA 4DU8A 1YI2S 1EP4B 3BGUA 1C1BA 4LIWA 3A3PB 4DSLA 4BCAA 1NU4A 1CS4B 1S77D 1XR5A 3GMGA 4H4OB 1OPZA 1KONA 2R2RA 3CDEA 5FD1A 2W9CB 3EGWB 3J81j 3JSBA 1P27B 5KG0A 3CJ5A 4DV0F 4JI6F 1HNXJ 2P9CA 1R43A 3VVUA 4P2MA 1SPBP 3C19A 3FBFA 1LV5A 5BR8J 2G1HA 5DDQC 3KLGB 1U1MA 5D8HB 1SQFA 3MR3A 4ZLNA 1M1GA 1N0VC 4IH5A 4C3KA 2M4MA 4BWMA 1ZTTA 1NRKA 3DU6A 3K8VA 1AUSL 2OJ3A 1WG1A 1H7XA 1UTAA 2XWXA 4ED2A 2GO8A 1D8ZA 3KG1A 2FVRA 3RRGA 2XY6A 4JI8J 3CW2C 2RD5C 1U6FA 4CH1A 4P7VA 4ETXA 2YQ0A 1VS3A 3AXKA 2AMCB 4MTPA 2RSQA 1FVQA 2YH1A 3AX5A 3BM7A 3C16A 1S49A 1RTDA 1RQ0A 5DO2A 2DXEA 1FRXA 3G2XA 5A0YB 2BQUA 1Q53A 4NLDA 4RUBA 4PQAA 3BPDA 2NREA 1X4HA 4NCGB 1JLCB 3OTEA 4MKBA 1FKOA 4OX7A 1VGYA 2E5HA 5E3QA 4DPOA 1MWYA 2ZWPA 3M9NB 1VQ9S 2AJQA 2CPFA 1R8HA 8AT1B 4Y2KA 3H5XA 2DY1A 5BR8F 5J2PA 1L3KA 3PHEA 3PW2A 1GXLA 4ZLJA 4MH8A 2JVOA 1HBOA 2ZZMA 1NUEA 1RTZA 4MK7A 1RK8A 3QWUA 2OEKA 4C8MA 3VQTA 3M8QA 4DPWA 3LGHA 1N34F 4IQMA 5F8JA 2J0XA 2ZM6J 4RBTA 2CJQA 2YNIA 4LT6A 1IBMF 3ZXWA 1HQUB 3TA2A 2UUAJ 2DGXA 3IR6B 3RBXA 5GADU 1QDUB 1D0EA 1XNRJ 1RHKB 1SXLA 5KG7A 1R8PA 4ER8A 4NASA 2QL7B 4A47A 4TNOA 1MNEA 4G1QA 3MZIA 1DY3A 4AQYF 4LFCJ 4O44A 5IT4A 1KRPA 3KLEB 2V8PA 2DHXA 2MHNA 1H72C 4ECUA 4ZCIA 3W5XA 1ICEB 5GAHI 4RW7B 3LGNA 3PG9A 1OPIA 4LR8A 1E6YA 2G2YA 1U7LA 2CPXA 3UPFA 4E2FB 4LQ9A 3EZUA 2YQ3A 4WZQA 3IXQA 3MPYA 5B08A 3EZ5A 4PYAA 2FHOB 2E29A 5GAEI 5ETMA 3KJVA 2XYGB 3DDIA 1Y00A 3LAMA 2UUBJ 1LW0A 4QWCA 2ZH1A 4QU6A 2BANB 2DKOB 2W4PA 4PXDA 3GV5B 3QIDA 1S57A 1UEVA 2WW8A 3MMBA 5CZXA 3SCLE 5KOXA 3C15A 1OM2A 1DQ8A 3MM5A 1D3WA 4WFXA 1GMWD 3HVRA 2E1CA 4XPEA 1XNQJ 1HD0A 3FRYA 2AZ1A 4ZCMA 1VHFA 1O5JA 2ZE2B 1PJ7A 1X9MA 3QJLA 3K5NA 2CJXB 2FHJD 3B78A 3HKWA 1Y5IB 1LFPA 3P96A 4WXOA 5DQGA 2Q66A 4WTOB 3CMQA 4ES3A 4M5HA 4O3OA 2FHMA 1NHKL 4NLOA 1KVKA 2PMWA 1S12A 2ZH7A 1TK5A 1SL2A 2ZH5A 4DFPA 1YITS 2OPQB 2EEYA 4DL4A 3I9V9 2IMWP 2VC1A 2V6AA 2MKCA 5LSOA 1EETA 2FY8A 3I0SA 1CJVA 1LW0B 3CJ0A 2HIYA 2OO4A 2YTCA 3QYYA 4TVAB 1RAAB 4DCPB 4CLUA 3JAMU 5KG4A 3HVAA 4HT7A 3EPIA 4DUTA 2XS2A 3VAIA 1GFWB 2C2NA 3D6TB 1KBRA 1HARA 4A48A 1D1UA 2DIVA 4OX9J 4RW6B 1DTTB 3EX7B 2PC6A 4O0IA 4QWEA 2QL9B 4ECQA 4HDHA 1X0FA 1NXIA 3NNAA 1RWMB 1S7IA 4DLGA 5SZTA 2KT2A 4XDDA 2IRXA 2E1PA 2ROGA 3G6ES 5C7PA 3CCLS 2ZBCA 1SC3B 3FDSA 3HJVA 2Y8WA 2LQ9A 2ZJRQ 3K5LA 4K4YA 1SL1A 2HGMA 4NZ0A 3Q22A 3UQSA 3LPEA 3N5FA 2KM8C 1RT1A 1B3TA 5K8OA 4QZVB 3WC0A 2ZH4A 3MD1A 2DVIA 5ETKA 2FIUA 1OQ6A 1U0SA 2KXFA 3AQPA 4CLTA 1Y0HA 1YWXA 1H2TZ 3PX6A 1RWNB 3RBEA 4FBUA 1U1RA 4MK9A 4LF6J 1NMEB 1FJCA 1S1WB 2W4CA 4LSNA 4NEYA 3PACA 4AXIA 1DARA 5LMNJ 3QT5A 3FSXA 3HX9A 2IJRA 2P2CB 4WU3A 1Q79A 1NKBA 3NKYA 5H9EK 1IUJA 3LH2S 1IKWB 4DHVA 1S1WA 1XQIA 3MURP 3ENAA 3GJRB 3WIUA 1GAOA 5L9NA 3THVA 2C3MA 5ETQA 1RTIB 2PDAA 3VHQA 2V4QA 2NYHA 3T1HJ 1X5SA 4IR1A 1FRJA 5AXNA 5A6PA 5ITHA 3V6KA 1RGVA 3ZZZA 4NOHA 5RUBA 2B5JA 1C0UB 1QD1A 5F3TA 2RS2A 2RRAA 4B9UA 2HHPA 2DR5A 2UVRA 3EVMA 5CYQB 4QIEA 1QAYA 3OUYA 4X4VA 2XSJA 3QO9A 1ZZNA 4MFBB 8RUCA 1OY8A 1YJ7A 3DRYA 5ETVA 2AD9A 1S72S 2HPUA 1WG4A 5EWFA 2DNKA 3BBBA 4X64J 4LFBJ 4ITSA 4CO5A 3I56S 3IN5A 4ELTA 1RT5B 1YIJS 4TY8A 4ZHRA 2IAJB 3FK4A 3HHDA 4K4WA 2VBYA 1KD1T 1SH2A 2MLZA 3N01A 2DNZA 5AJ3J 1X5OA 1XR6A 3MPDA 1CJTB 1NK5A 3MM7A 5A8KA 3I5BA 4DUZJ 2HSEB 1GH8A 2OFGX 2YVSA 1YQHA 2HFSA 1HNIB 4K4TA 5IC4B 3PJWA 1TMMA 1FDBA 2GVZA 4DEZA 3PIOQ 4RL1A 1FRHA 5D0EA 3H8YA 2YKOA 4HH1A 3GG0A 2FC8A 3NCPA 1V3SA 8ATCB 3CIZA 4LRFA 2D41A 3U1MA 5E2QA 2UUCJ 3RAQA 3MMCA 3PX0A 1WOPA 3PM9A 1C1BB 1T0TV 3TUJC 2IA0A 3RB6A 5GAGU 4PG8A 4NXMF 1XR7A 5KG5A 3OR1B 4NLSA 2YPYA 4RBVA 1NK8A 1V5IB 2AU0A 1JLGB 3ZTRA 3CJQA 3M8WA 4PXEA 4DJBA 1VCTA 2DITA 3HCXA 1BLUA 2RHSB 4J90A 1HNVA 5K9FA 5IXUA 3VF0B 1S1XA 3SDEB 2ZH3A 2OP5A 1HI8A 4UQTA 1VRTB 3QSYB 1FHTA 4RPFA 2R8KA 4F0HA 4JI4F 5K8NA 3OJSA 1IKYB 2OSRA 4NYZA 4UOCA 3UDCA 4E98A 2ZH9A 2D3O1 2V8DA 1D09B 4W92B 4HKQA 1WUUA 5DQIA 1KC8T 5F41A 3MMCB 1HBUB 2HAFA 3UNYA 4KT0C 1RWWB 2PFDA 2VPZB 2XTCA 2XG8A 4DX7A 3RRKA 1YVFA 2K3IA 3DYAA 4N7TA 3N28A 1H2UX 2W8KA 5HN0A 5J2QA 4O4GA 4GMKA 5IC6B 4NX9A 4K2XA 3RYLA 4F25A 3M8YA 3MECA 3K2YA 2YQ1A 1Q8IA 3EGVA 1NSAA 4O3SA 4DXLA 1GX6A 2N4CA 3A12A 5KT3A 1UJ6A 4NYOA 4O0NA 3TO8A 5EWGA 3PJ9A 1FI4A 3GCXP 2HQFA 1R8AA 3OQ2A 5A6WA 4C2MA 3O44A 4B3OB 2KVQE 3H7HB 4OLOA 3E01B 3M8QB 1RHUB 4W90B 1KKHA 5JJBA 4OMFG 2AT1B 1XIQA 3Q8PB 3TWZA 3ONQA 2VQEF 3AB4B 1WD6A 4ZMMA 5HSPA 3NGDA 2FLOA 1TZ0A 2I1RA 2RT3A 1JK9B 2Y1RI 1R6YA 2BVZA 2BJ7A 3MM9A 5I3QA 3QT7A 1T8EA 1JXLA 1S6OA 3DKDA 2PMHA 2X1GA 1SKSA 2W24A 5U47A 3J7YI 3EDRB 2ASJA 5LJ5Y 5GADI 2H54B 2P8IA 3MPWA 3T1AA 3CMAS 7FD1A 1EKSA 1NSKL 2FZCB 4DL2A 3NG8A 4KB7A 1VMBA 5HANA 5JUMA 1TKZB 2XY5A 3MXHP 3W2WB 1H7WA 1RTIA 2XI3A 4YB6A 6AT1B 2W9CA 4HHUA 1S48A 4M5DA 2I0XA 4ECTA 1RYRA 1N0UA 4KFBA 2KN4A 5J1NA 4WU2A 5MLCV 3H2UB 3FCVA 4ECXA 2Q6BA 4NA2A 1HQ2A 1PYOB 2CPIA 1WWHA 2NSCA 3DLHA 3KTQA 1FNMA 3D66A 2NPFA 4UOHA 2XYPB 1VQ6S 4A8KA 2V9KA 2OUGA 1ZAXA 4CO0A 5KFVA 3DM2B 3W65A 4LQ3A 1S97A 2GJ2A 3MM7B 1UW9A 3GV8B 2KO1A 4LF8J 2QX0A 3GWCA 1LEOA 4Z37A 5EGYA 5BJRA 1B0PA 1UMJA 4OI2A 2KFYA 5JVGQ 5DLFA 1K44A 3ISNC 4XAKA 1S1VB 1ROFA 3TR5A 5E3RA 2HFZA 2CWXA 2CJYB 3HD2A 2R2UA 4PG4A 2CPDA 1SKWA 1WC5A 3FMWA 3GSIA 3UR3C 1KLMB 2ATCB 2EK1A 3TZYA 3FBBA 4ZPCA 2QJ3A 4MKYA 2EW9A 2QFIA 1NLKL 4CLFA 2CPZA 5L8RC 1Q8LA 3BBFA 2X1FA 1B4SA 1IJFB 1YX2A 1U26A 2EFOA 5EHHA 1XERA 1IN0A 4CI0B 3M8PB 3RJMB 1Q7LB 4K5SA 5HJXA 1UVIA 3V5RA 4DUZF 3GIRA 2R8HA 3TQ1A 4C8OA 3KHHA 5HQMA 4QW8A 1VC5A 1YZ6A 1JLBA 1HW8A 1C4CA 1HI1A 1NPKA 2IMOA 1TQLA 4CLLA 1SIZA 2E5GA 2Z56B 3OFHA 5I3PA 3M8PA 5KFUA 3T5KA 2WHOA 2HFNA 2C3PA 3MM6A 4L76A 3BJYA 2HWHA 4Q2LA 1T03A 1M1HA 1V3RA 4KHMA 2MTLA 1RAJA 1LWEB 4G1IA 2D7SA 1RT3A 4CLWA 4AD6A 3F56A 4C11B 2QIFA 4DPTA 1I51B 3BYPA 4YR3A 2NZ4A 3PVXA 2BKPA 2JHEA 3FEYB 3LW5C 3CGIA 1KHWA 4LSNB 2PGCA 4F4YA 2H9ZA 4RX6A 3DYAB 3IS9B 1SBRA 4LBHA 5B7WA 5HMYA 4CIOA 1U24A 2A10A 1R0AB 2ZH6A 2M3DA 4B3MF 1Y9OA 1YJTA 2GIFA 3M8RA 4JYAF 1XMOJ 2GO9A 1CEZA 2MDAA 3KNGA 2VPXB 1I94F 1HYSA 3OXFA 3TEHB 4ZP6A 5CXTA 4J9MA 2F9JA 4DSJA 1RUSA 3S01A 2XWYA 5GVQA 3TJAA 4NLRA 2I9SA 5C25B 2FLPA 2UVUA 4LF6F 1KFDA 1OY6A 2CVIA 4PRFA 3OR2B 4P74A 2V94A 1X4CA 4CLSA 2EXUA 4H4KC 1BWVA 1F5CA 2OD4A 4FVCA 4IDKA 4PR6A 2XLKA 4A8MP 5F9NA 1S5ZA 4IO1A 2CRLA 1WELA 3ZTPA 3J80U 4V19J 2QLJB 3BQ1A 5IWAJ 2I5JA 2IPOB 1N8RT 1LW2A 3BB5A 4JI7J 1NK9A 4JI1J 4HTJA 4QWBA 3H5SA 2W9BB 1X4DA 3AWRA 1HBMB 5HP1B 4RW8B 3SCKE 3QPIA 1WEYA 3G6VA 2XS5A 4PPDA 5LL6d 3U7JA 2NCKL 4RBUA 5HVGA 4KGXB 4KFBB 1DLOB 3CC7S 1RTHA 2F3JA 2GIRA 1FCAA 2WSCC 2CKWA 3HHLC 3GV7B 2HBYB 2PMZD 1XC9A 2UUCF 1SJRA 1JLBB 4NL5A 2NXJA 3ISND 4C0BA 3HHNB 2OSQA 1P1TA 1HHSA 1TL5A 2A2CA 2CNKB 4Y65A 5K8PA 4ECSA 4LSLA 4JV2A 4I7FA 3OD2A 2HGNA 4YOEA 3G8QA 1TAQA 5IS2A 3D6FB 2FY1A 2KFNA 2PN6A 4RW9A 1E6VA 1I3OB 2AX0A 2OPSB 3KXDA 2VOPA 1HIYA 5I4MA 3W66A 2XQCA 3K7RA 3CJRA 3C6TB 5A8WB 5CCLA 2UUBF 2V4JB 1C1CA 1FKPB 2HRUA 3W64A 2HNYA 4DPYA 2CJ9A 2P9GA 5KFGA 3GZ7A 3LP1B 3NS6A 1JLQA 3QGGA 1RTJB 2YKAA 1FJGJ 2QZ8A 1FX4A 1RT2B 2MQMA 3EM1A 1IM4A 4OZ0A 4ZCKA 3G6YA 3CF5Q 3SMZA 5DETA 3HK2A 1RAOA 1M5KC 2UXBJ 2BXJA 1KVJA 2BYCA 2XI2A 1HR0F 1NAQA 3KK2A 3TP2A 5AE2A 3GCWP 4ZVGA 3P6YC 3P49B 3QAUA 3PEJA 2R2SA 4FNIA 2EWHA 1I1GA 4UF4A 1ZAWA 5KG2A 3KK1A 1WJ9A 3K5MA 4NLTA 2I5JB 5BXIA 4GO7X 1IBMJ 3Q8RB 1K8AT 4LFCF 4DPXA 3OTOJ 2ERRA 1Q7YT 3GR0A 5KT4A 4M5JA 2XMVA 3THTA 3BGRA 2VG6A 2DGSA 4O44B 2ACMA 1JJHA 2Z2YB 3F73A 3AD7C 1HNZF 2PE8A 5IQ6A 3UE2A 4DV3F 2V2QA 2EFQA 4RW7A 4MIAA 2WONA 2BABA 4ZVPB 3PW4A 2V50A 5CZVA 3OL8A 5T14A 2KG1A 4ELUA 2DH7A 1UWBA 4QR0A 4NCGA 5C24A 2DEJA 4R5PB 3Q8VA 2IVFB 4KHRA 5THWA 4CLKA 5ETRA 2CA9A 2CAJA 3T5LA 2XY7A 3DI6A 4ZHRB 2APOA 3EGZA 1U47A 1UP1A 1S76D 3DRRA 4DZDA 2J9CA 3KOAA 5IT0A 2UUWA 4QYRA 1WHYA 4F3MA 2J76E 2D1CA 1F1BB 2WSEC 1LOUA 2VKZG 4LF5F 1EETB 4ED7A 4F4ZA 3OXLA 1S6PB 3TRGA 2AEMA 4AFFA 1S6QA 4IYQA 4IRCA 1HNWJ 4M1KA 2BKOA 2IAJA 3EGNA 3BREA 3M2RB 3NGSA 5L38A 4Q5VA 1FNXH 1EARA 1T05B 2KRRA 2WVFA 2ZOMA 4OYZA 3TX0A 1CPZA 2MMYA 3H2LA 5HATA 2B9XA 1EKRA 1DLOA 1FFSB 5KFRA 4B02A 1S6PA 4EUVA 2R8JA 5L9XA 3ZO7A 3F0NA 4Q0BB 3BSNA 1GMUA 2HNZB 2V2ZA 2YX1A 3VQSA 3OHBA 1SB6A 3D54A 2ZJQQ 2B7CB 2ZC3A 1P1LA 4J9OA 4BLGA 4JI3J 3AB2B 1Q1KA 4KV8A 5D6GA 4I7FB 4DG1A 4XO0A 1IR0A 1J2VA 4C6AA 2N7YA 3KJVB 3PY8A 4F4KA 3CCSS 2CJAA 3H20A 3JTOA 4LBPA 4M63A 2HRTA 5HMWA 2E1RA 2L41A 4QWAA 2WVCA 3H40A 1Z2LA 3W9JA 2H5JB 3ADAC 3U1LA 4OX6A 4RNMA 2R7RA 2ALZA 3OVSA 2WVBA 4X4PA 2BJ3A 2M7SA 3HT3A 4J5OA 2VH7A 4C7QA 4LF9J 1FRIA 1S1XB 4OYAA 2DHSA 1T3NA 4MKAA 2DJWA 1CQMA 4PQUA 2R9LA 2Y9HA 3LP0B 1A0OB 3KLIA 1PGZA 4NLGA 3ETMA 3FEXB 2RVJA 1K1SA 1GXUA 3B6BA 4NRTA 3MR7A 1RYSA 2CWKA 4U96A 2F7VA 4X4TA 1RT6A 5D3GB 4I6WA 3CCES 2FLNA 1UJ5A 4IFYB 5ETNA 5IV4A 1S0VA 1NB2A 2R7WA 1RTJA 3DOLA 4L73A 2HG4A 1RT4B 2PT0A 3KK1B 4DV6J 1CQNA 2G1DA 5AT1B 1FK9B 2AGOA 1NJIT 2XO7A 1S9GA 1WACA 2RIJA 1KN6A 4NXMJ 1YJRA 3QGIA 2AJ1A 3G6XA 3NCRA 1HBOB 2QC3A 2DO0A 3KDOA 1FJGF 5C2CA 1TL7A 3MD3A 2BACA 1L5UA 2HRYA 3UVJA 5KFMA 3NMRA 6FDRA 1LWEA 1S0MA 1FXRA 2K1RA 5F8MA 2F5GA 3VR1A 2QLFB 4ES1A 1NJXA 4ERDA 4EO8A 4M5MA 2LDIA 4FXVA 1HL6A 1WORA 2B56A 5B0AA 2LQJA 3MGJA 3SFUA 1FTCA 4F7VA 1S4EA 2YNFA 2PI4A 4U7UK 3UVJB 4X4OA 2QLBB 2W7OA 2MQLA 4NA3A 2W25A 4CO4A 2DIUA 4H4MB 4BDPA 3OSPA 4JI0J 5C2GA 1QVFR 1VHIA 1Q16B 2OHDA 3PFOA 5ADZA 1TK8A 2UVVA 3FZ2A 1FK9A 3T41A 2W8LA 2IA6A 1F9FA 2IM2A 1S6UA 4OLPA 2KH9A 1VQPS 4USIA 3KDNA 2C1EB 1PJ5A 2JJ4D 5KTQA 1JNRB 1HA1A 4Y0FA 2RRBA 3WIVA 1V3ZA 1O6XA 2M70A 3D1OA 5E3AA 2W9BA 3IGNA 4A8FA 2A6OA 1V9OA 5HI7A 2XTEA 4RWWA 4Q45A 4YFUA 4NLQA 1LW2B 2QA2A 1X4GA 1UVLA 1HFEL 2V0NA 3VZHA 2PA8D 1IKWA 3R5JB 1IVZA 3H42A 1G1XA 3D3BJ 2X3DA 2C2ZB 1RBLA 3D6HB 3T19A 4CH0S 3A4TA 3CXCR 4QCLA 1AFJA 5JXSA 2D68A 3N6NA 2E5IA 1U8SA 4XK8C 1SH0A 5KFXA 2HZVA 3NS5A 4C8LA 2HKEA 2Z2MA 4CM0A 2FGCA 4PAAA 1UVJA 2ZVIA 2JLFA 3N9UC 4QYZK 4LF7F 3JS9A 2VD3A 3BGOP 4QR1A 2ZOGA 2K2PA 3EXYA 4CH7A 2E5LF 1DQ9A 1OSCA 2CQCA 1X60A 3CO9A 4KYZA 4ICLA 1FKPA 2AYBA 4PUOB 2L9DA 3QIPA 3HI9A 4ZPDA 2DYAA 4LUBA 2QA1A 3PIPQ 1B7FA 4OJHA 3UWTA 2RAQA 2VDHA 2HS4A 2M88A 1REGX 2JH3A 4ZVEA 5IV3A 5GAGI 1N6QA 3RZAA 2J6SA 2UXCJ 4O3PA 2LEPA 3NLCA 1RADB 4RW9B 5HO4A 1HWIA 2ZD1B 4WFBQ 3FVYA 2WTFA 4KTQA 4K4SA 4PEOA 4Y2IA 3TJ9A 2CQGA 3IM9A 1DTTA 4B08A 3KUEA 5A8KB 1A9NB 4C8NA 5AE3A 3U1NA 2WRMA 4YEAA 3PR4A 5FLXU 1VBKA 2VL1A 4USMA 3NMAA 3AOAA 1NZ8A 4Q43A 2KYXA 4GVBA 2YWKA 5J2PB 5D78A 4OHVA 5L1JA 1S4FA 1HBNB 1S1UB 2MKYA 3SV4A 1N32J 1Q5YA 2DRAA 1TL3A 3E2EA 2BANA 1CBKA 2HFVA 1RT4A 4FN5A 1GMVA 1HNWF 4GC7A 5B0FA 1KQFB 3NOGA 3QJJA 2DR9A 1UEUA 2MJUA 1IXKA 1RWXB 1TKTB 3W61A 3ZZYA 5T41A 3QNWB 5HLFA 2IBOA 2QFJA 3G4SS 4X4UA 3IGVA 2ZKUA 1NHVA 4P7TA 3WBZA 4P2SA 3D1HA 4WBFA 2AIRB 2OEJA 2DR7A 1JXVA 2W2OP 3HVWA 2VASA 4NYPA 3CVKA 1U49A 4OYMA 5EX3A 3GR1A 3ZZRA 2AEFA 2LXIA 2DBBA 2FC9A 1RHMB 5ETSA 4FPRA 4C98A 4CLYA 1KTVA 2PI5A 4EZ6A 2HHXA 2DH8A 3DI6B 3FKBA 4OJ1A 1L3SA 4M5DB 4N77A 1MSWD 1HNZJ 1M5HA 2X7IA 1X4FA 2HURA 3J7Z5 2WW4A 4PG5A 3NGUA 4F3OA 4LRBA 1P6TA 3A8EA 3C8YA 5JVHQ 4DQPA 2J7UA 3Q2TC 4ETZA 1Y5LB 4TU9A 2DHHA 2ZUAA 1XMOF 3UN3A 4DV2F 5HK4A 5F8HA 4I2PB 3T6BA 3KLVA 4QYZJ 2VIHA 5IT9U 4Y2CA 1VYAA 2GV1A 1BQNA 2CQ4A 4KO0A 4OI6A 3V4IA 3BS9A 5BYRA 5A8RA 4NLYA 3OL7A 2YNHA 4BBYA 1W26A 3MPUB 1S0OA 1S0NA 2OTJS 1RHJB 4IOBA 2MQQA 4ZP7A 5EDWA 2VA2A 2HMIB 5D0HA 1K0TA 4NMLA 1JLFB 3VTIA 1B7YB 1E6VB 4USUA 1UAWA 5KT5A 3FSYA 2K3KA 4B3RF 1TKXB 3MR5A 4UTGA 2DGUA 4M5IA 2KHDA 1WSVA 3CDBA 2RRNA 1DRZA 4DQIA 3HVTB 1RE1B 3KJFB 2MQOA 4ZPBA 1NPPA 3GONA 3IMQJ 4QPTA 2W4DA 1CJTA 1RTDB 1X31C 2XCPA 1TKXA 4P6QA 2VG5B 2K7JA 3ENVA 3CCVS 3TW0A 1JJ4A 3M7VA 1VR6A 3JTPA 4CWBA 2IRUA 5AXKA 1CULA 3RUBL 1GXTA 1PBUA 2CDRB 4R8UB 1IBKF 2IY5B 1N56A 1VC6A 1KOHA 4G6VB 1FRKA 1T95A 4N47A 2L48A 4O4GB 7FDRA 1H74A 1N36F 3CD0A 3L7OA 3KLIB 3DMJA 3R5DA 3J81U 3K57A 1XNQF 4EMDA 4F2SA 1TVRB 4F04B 5L39A 1WG5A 1JKHA 4DL5A 2Z4PA 2DNLA 2V2KA 1TAUA 1HHQA 3GJSB 2NZCA 5AE1A 4CLZA 5GAHU 1HBUA 4BC9A 4IFYA 4UY8T 2XHCA 4WZMA 1X4BA 4JI1F 1WHVA 3H2VE 4MJKA 2KL8A 5C25A 5LXRA 3C66A 5F0WA 1EHWA 2SXLA 4F26A 1FX2A 3QT6A 1K9MT 2CIMA 3SYZA 2E7XA 1KFSA 4TYAA 2C3UA 4I2QA 4UZBA 5KFWA 5DM7Q 3MF5A 1QSSA 1IKVB 2LEAA 2MQNA 3WX4A 4WIQA 4OHZA 1N36J 3R7BB 4JV1A 3C46A 2E9ZA 2RH3A 2KHCA 1W2IA 2CNOB 3ZNJ1 3AX2A 2Q6CA 2KU7A 5EWEA 1RWPB 3I6PA 3G8SA 4LBIA 3FSIA 4FF4A 2XMKA 5CCMA 1NK4A 3HSJA 1R3NA 4ANEA 3M2RA 3QGPA 4I67A 1WI6A 2HWTA 2IM0A 3D7SB 2MXYA 3TA1A 3ILIA 5HVHA 1BUXA 5KFLA 1T7PA 2K06A 3T5JA 1J5OB 4WF9Q 5F8GA 2WAQD 4YN3B 2R2TA 5A2QU 1I94J 4Q0BA 3UNGC 2DNOA 3I31A 2BA9A 2ZC4A 4U8VA 1T9UA 2GJFA 1XTZA 2NUUG 2OPQA 5LJ3Y 2HQ3A 1NHUA 1FRMA 1VQSA 1R8CA 3OFGA 4WFAQ 2AGQA 5A2QY 4N76A 3MM5B 4DR1F 3DOKA 1T02A 3M2VB 3C6UA 5F3ZA 3OTCA 3L3CA 3US5A 2YX7A 5L1IA 5ETTA 4J9RA 4B3TJ 3BV8A 4HACB 1T94A 4OQJA 4F36A 2F8MA 5HL7Q 2FJEB 2XGQA 1FWLA 1FKAF 2DEIA 1JLFA 2J9DE 1MN7A 3I4PA 5EX0A 1SJ3P 1YTYA 1M5VC 3DLBA 1FE4A 3ZZTA 1V6HA 2JC0A 3ZZOA 2I8EA 3G87A 2CNLB 2GAGC 3J7AN 2RUGA 3LO3A 3PDNA 2C22A 2BBEA 2B6AA 1Y11A 1VLOA 2VBXA 4I69A 4KR0B 4AYBD 2R8IA 3EJMA 4JI2F 2FHKA 4G65A 2VDIA 4JV5J 1DHMA 3OW2R 5I42A 3A8KA 2GHPA 2PA3A 1CSJA 4PWUA 3GFZA 5IFMA 3E3XA 2ZBRA 4O3NA 4QW9A 2W7PA 1GQEA 1SV5A 4DS4A 1NJWA 3DLGB 3FCWA 2OMOA 2OEMA 3ENWA 3HFVA 4X2BA 1FNOA 2IBKA 3HLUA 3K5PA 3UCZP 1VDHA 1P8GA 3QWPA 4ZVHA 3QATA 3H4BA 4IUFA 1WC4A 2A0FB 4ZVFA 4NZ7A 4OYPA 1RT3B 3LUYA 3MOZA 1ZBTA 2GVDA 3Q8SB 5K14B 1WEZA 2HYIB 2CPJA 1TU0B 3JSRA 1WC1A 5K20B 4NA1A 3I87A 3DMJB 2E66A 1APSA 2HVHA 5I3UB 4WP9A 1FESA 1BQXA 2Y3YA 4WPAA 5D77A 4OI3A 3DGPB 4X65F 4J9VA 1HWLA 1IBKJ 1H3DA 5K8MA 2XLJA 3HXMA 2DCLA 2D3ZA 4DI6A 1W25A 5DG7A 2B9EA 5B0GA 4KBIA 5MAOA 4HEA9 2WB4A 3BR9A 4URQU 2H51B 3J7ZT 3M6UA 2AQ4A 4U7UD 1LXJA 1UPMB 1KLNA 4RKUC 2Z2ZA 1RJJA 2HNDB 3I9ZA 2MSTA 4LIRA 4LF2A 2R7UA 2L3MA 3NXZA 4A46A 2DCUB 3BBCA 4KKOB 2LMIA 4C3LA 3BGRB 2DB1A 4Q44A 1YG0A 3W9IA 4DV5J 3T1YJ 4QR2A 5HVFA 4K4XA 1FXLA 1QUPA 3CD5A 3TI0A 4Y34A 4Y2AA 2H3EB 2LDYA 1X9WA 3AOCA 1JB0C 3GYGA 2MSSA 2E7WA 2VZ9A 2RDIA 4DV4J 1VJWA 2AW0A 2GA7A 2VPYB 3F44A 5D0RA 1VQLS 1D8YA 5KFJA 2R7TA 3IO1A 4KO0B 4Y6IA 3QFHA 2NYIA 4LRDA 4WP8A 3JAMY 4ZLPA 5LMUJ 4DR4J 3O8WA 3M4XA 4P75A 1CG2A 2EFPA 3P4UB 1WC6A 2G0IA 4ZA1A 2QLXA 3W1YC 2GQQA 4YP3A 3MUTP 4Q8FA 1URNA 4L6V3 2GW8A 2DGOA 3JB9k 1J5EJ 1QSLA 1MW7A 1X4EA 1JWWA 1BQMA 4KH0B 1VRUA 5CYJA 2W2NP 1XWLA 4RU2A 2NPIA 3OVAA 2OMLA 1CVJA 2HBRB 1UETA 2WCXA 3A3OB 1AA1B 3Q8UA 4JI3F 3QZ7A 3D6MB 3FC9A 1Q4RA 4KIAA 5CA5A 4N56A 3GIJA 4HHHA 2YNGB 4PABA 3SEOA 3LGMA 3TX8A 3KJQB 1U0HA 1RBOB 1SJ1A 2LXUA 2D3UA 2OPPA 1URRA 1UFLA 2Z57B 1MN9A 4FYXB 4P10A 4QJVA 2LA6A 4V1Ak 4Y28C 2HHHJ 2WOMA 2IIHA 2HHTA 1REVA 2YH0A 3ET6B 4X66J 3PXGa 1UA0A 1IM6A 1IBLF 5IM0B 5DG8A 3R6LB 1U25A 3VAKA 2F40A 1RWUA 5EN1A 3C6TA 4RUHA 1RXOB 2L9WA 4OZ2A 4DDFA 2KTQA 4DR6F 1TKTA 4PXBA 4O3QA 1U1PA 3Q0AA 1R0BG 2ASYA 4F4AA 2FVSA 4C8KA 4RR5A 3CCUS 3P3DA 3RU0A 2YBVA 3SI8A 1M5OC 3S7RA 4WCEQ 4DR5F 2FJWA 2YNGA 3IAM9 3H90A 1Q82T 1TUGB 2FPHX 1N32F 2Q43A 3G86A 4MIBA 4NLPA 4LFAJ 5M2PA 4RUAA 4F4WA 2OTLS 2QMUB 4ZJLA 2C2RA 1ZM9A 2R7OA 3B4DA 3DLEB 4NRUA 1REVB 3ET6A 4DX8H 1E6YB 5A76A 4C3MA 2E9RX 5M2UA 5T7LA 4K0KF 2O3DA 1AZSA 5H9FK 1RAHB 2X51A 4NEZA 4C48A 2FB0A 3Q89A 4X4SA 2B43A 1W2BR 5J2NA 1D9FA 2FLLA 1HD1A 4WTYA 3M9MB 1BXNA 1LQ9A 3CJ2A 1LWXA 3IBCB 3GIMA 4I6AA 1LWCB 4FP9A 3L9ZA 2KG0A 2AJFE 1RKIA 2AJ4A 1U48A 3MMBB 2ZHOA 3FGVA 3OTOF 4ILMA 1RHQB 2G2ZA 4E8UA 1VBZA 1VRUB 4TYBA 4WFYA 1RLDA 5KFBA 1HQUA 1LFWA 2G2OA 3BGFA 1BC6A 5LMNF 3LTOA 4N8NA 2BQ3A 2A1BA 4USHA 3DRSA 2RF2A 2YWGA 1G3OA 3AJDA 4LVNP 4WE1B 5LXYA 4EO6A 3CJKA 4DR2F 2F4FA 3KJNB 3CUNA 4DV7J 5LOQA 1Q5VA 3LA0A 1FEHA 3QBCA 2DGWA 4CO3A 2VOOA 2KT3A 2RKIB 1VQNS 4KY3A 3H5YA 1RZMA 3IC1A 3N79A 4LR9A 3G71S 1X5PA 1QVGR 2BX6A 2E5JA 2RJZA 2JOQA 2E1MC 1T9WA 1CJUB 1WF0A 3GE9A 4XDCA 2V4RA 2CQDA 1WDDA 2COLA 2DNNA 2A18A 4AL6A 2G9OA 1MLAA 4LJMA 3MUMP 2BJDA 1ZM2A 3B54A 5E0OA 1R27B 1NK6A 5F8IA 4RJVA 1C2PA 3SV3A 1M5SA 2DTJA 2JNJA 2ZKTA 4RNNA 1FXDA 4DSKA 3HHKA 3CO0P 3CTRA 3D9BA 1S9FA 1FJEB 2VONA 2B9WA 1WDTA 4DCJB 5CYMB 2MJNA 3WX8A 3ZC4A 1PKUA 2VG7B 3PYFA 1OMSA 3HP6A 2GJIA 2H5IB 4IO9Q 4AL7A 1S79A 2XNQA 3DU5A 4J37A 2C2DA 2B51A 3TUIC 3CC4S 4ZOSA 3MHYA 1VJQA 2RQMA 2AX1A 2HS0A 1RAGB 4YMEA 3SSRA 3AODA 4Z7CA 1R31A 1LK7A 3CULA 2DNGA 2GHWA 2HVZA 2KB2A 2ZDOA 3NBPA 3VVTA 3SZ2A 2IYGA 2RQ4A 3L09A 4LVOP 2YNFB 5A0YA 4CYUA 3T9ZA 3EPGA 4NLUA 4FYWB 2BE2A 2W01A 2MYFA 4L74A 4RO0A 2UV8G 4YDXA 2LEBA 1CJVB 2WBRA 3DDKA 3I5AA 4DQQA 3DRPA 3MEGB 3KLFA 1ZETA 2PO4A 2HQCA 3DXBA 1NNDA 2ROEA 3HZGA 1TUWA 2V67A 3PTWA 4OJGA 4L3NA 1S99A 4HVZA 4I2QB 5SUHA 3H25A 1B99A 2DGVA 1FT8A 3CIMA 2ZH2A 4CCHA 4Z2XA 4X4NA 2ASDA 1RU1A 1VFJA 3FEZA 4DOZA 5DG9A 1A6LA 3DRSB 4CDIA 2CXEA 4LF4J 1KP6A 3GU0A 1U1KA 4Q2MA 5KFEA 5BYQA 1N5YA 2V2VA 2CUYA 1NCLA 1SC6A 2OELA 2QSFA 2E44A 3O5TB 4H4OA 1VC0A 1N33J 1M0SA 1I5OB 1OIAA 2MZJA 5DZ7A 2QG9B 3W8GA 1T11A 3BQ2A 4W98A 5D15A 3WQPA 5LMUF 1HHTP 3UDEA 2MLXA 2JDJA 4OZ5A 2UVWA 2IC3B 2XZDB 2ZBQA 5DS7A 1U1NA 5KAKA 3HT0A 3CC2S 4F4XA 1U09A 1JNZB 1X4AA 4B3SJ 4WYLA 2CPYA 3V2UC 3FQKA 1MU2B 4IOCQ 4Z7YA 2I2YA 2M2BA 4DSEA 5DJBA 2O5DA 3R2CJ 3ITHA 4OZLA 4IDKB 2R7VA 2HBQB 3CCQS 5KFPA 3E51A 1G6BA 1RISA 1YBTA 3A13A 3DNCA 4UUWA 5DDRC 1HKAA 1RWKB 1DURA 3V6JA 1UVNA 4ZCLA 5HMZA 3GQCA 4X84A 2H1YA 3NCQA 5DLGA 3M2VA 4LSZB 3VAGA 3H0PA 4H4MA 3MFIA 3D0GE 1KVIA 1ZAVA 3TNVA 3N6MA 3GG1A 2BR0A 3MEDA 4KQZA 4PPZA 4DV3J 3AX3A 4O4RA 1TMJA 4JI8F 1K1QA 3NGKA 4FYVB 1TELA 3NS7B 2J0SD 1CC8A 1LK5A 1YRXA 2Y0BB 5E7OB 2QEXS 4X65J 2HLTA 2O1PA 2H4WB 3K8WA 2VA3A 4ZVOB 4KC5A 4FYDA 2Y1LB 1UEKA 2Z58B 3FQLA 3MWBA 2LQ5A 3VALA 1SIWB 4DUYJ 4RU9A 3C15B 1X5TA 4RZRA 3CE8A 3FRZA 3OLBA 2AJ2A 1XEZA 4ZPWR 3TUZC 2KZMA 1WTFA 1TL3B 3A3NB 1SCJB 5LM7E 4FF2A 2HHHF 3RB3A 3EDQB 3RRHA 1IQTA 4KGVB 3C2PA 1S1TA 3QLHA 1YK9A 1RCOB 2XBPA 1MWQA 4ED4A 1PIEA 2V63A 2ZBPA 3PKYA 1FDNA 3KLHA 4M5GA 2FJDB 3Q86A 4QOTA 4EBCA 3TAPA 1DZ5A 1H0HB 3TAQA 3UFCX 2DHAA 2ROPA 1G7CB 4TLRA 4Y00A 4DR2J 3C14A 3LF0A 2CZ9A 2GX8A 4YR2A 3JQJA 3LP0A 4DFMA 5C5JA 1KTQA 2V69A 1BGXT 1RSCA 2C2MB 2ZJPQ 2VKRA 5K14A 2IC3A 1N88A 1C0TB 2G13A 3D68A 2VFSA 3M2UB 4WWSA 3RGIA 1RT7B 1S9EB 2IHR1 1IKVA 1FERA 4J9KA 4LF9F 2CPHA 3HDSA 5IQQA 3QIPB 3G82B 4DL6A 2BEFA 2CPEA 3GJTB 3CSKA 4NI2A 1JLAA 4ID5B 4ES2A 2DNQA 2QL5B 5KFHA 4DV5F 1JLGA 4GC6A 3T1YF 3PW5A 3IWNC 2B8PA 1IKXB 1L3UA 5KFDA 2VHGA 1RA7A 2UUTA 1JJCB 1NEEA 2CYYA 1DQAA 3IAS9 2EVZA 3G82A 3ZZUA 3KHGA 2BE9B 2FVPA 3OR2A 1CJKB 2JFKA 4RUCA 4HDGA 1YHQS 4C4WA 2CQBA 3BKUA 3J7A1 3PW7A 3PYDA 3HZEA 2DD8S 5DGBA 5CQGA 1PAEX 4K59A 5ETPA 2P6TA 2QA4S 3ZFVA 1N34J 4B3RJ 4C0HA 2ZZTA 3AA9A 4OYWA 1NK7A 4YHHF 2LYVA 5CD4A 3DRRB 3Q8YA 2XTDA 3U27A 2HLUA 2MPUA 2BJ9A 2FVCA 4DMZA 4EFAC 1TKZA 2HVEA 1UW4A 2LQBA 2RUSA 4F8RA 4TQSA 2X1BA 2YWFA 2HFUA 5DRKA 2VODA 1TV6B 1FD8A 4FDFA 1CLFA 3A1YG 3DN9A 4CM2A 1BQNB 1FVSA 2YY3A 2MQPA 2D3OR 2J6UA 2B4UA 1IBCB 3BSOA 2FJAB 3D3CJ 4RW8A 4CO2A 2BE7D 4FF1A 2HFOA 3ULHA 4JI0F 2LXFA 3M30A 4PQUB 4ED5A 3RW6A 3FMBA 4OI0A 1PG5B 3RR7A 2OLWA 2MB0B 2GGPB 3FFIA 2CJBA 2XZWA 3DC2A 3M6WA 1LWFB 1UWAA 3TA0A 4TQRA 2XLIA 3CJKB 1IBLJ 4PWWA 1RAIB 1JMTA 3O2IA 4I0WA 2J5AA 1SH3A 1GK8A 3EVOA 3NY0A 2BM1A 4MAKA 3GLJA 4OHXA 3WZ0A 2FJVA 4H4KA 4DL3A 3D0HE 1NZAA 3G9CA 1WOSA 3OXGA 2PEBA 1ZM4A 2XC9A 1M5PC 3N5BA 2V8GA 3D5MA 3I0RB 5GAEU 3UD3P 2F8EX 1MROA 2HGLA 4TKTA 2YKMB 1U1LA 1F9HA 3PO4A 4GKKJ 3GYXB 3ZZ0A 5HROA 1FD2A 4ZVUB 1J27A 3RAMA 1AUDA 1MG7A 3PRDA 3GB0A 1RHRB 2V68A 3HULA 3EE3A 3TAMB 4CNYA 3K59A 2OIHA 4ILLA 4OZJA 3OV7A 1XMQJ 1FTRA 4CNZA 2QN6B 2UV8A 3EWGA 1TUVA 1U8WA 3IS9A 5E41A 4X62J 2XNRA 3E8OA 2AV5A 3UDVA 4IR9A 2P9EA 1JKHB 3SDEA 3CPWR 2MZ1A 1T03B 1HR0J 1IJEB 2OH2A 3SSSA 2RU9A 2VFTA 2UZAA 3L7UA 3C14B 1H6KX 5G4DA 2N3LA 3KHRA 2R42A 4RWXA 4ZPAA 1XJWB 2JEFA 3GSDA 1FJ7A 2VB6A 1DTQB 2BV3A 1FRLA 2OD6A 2DPIA 1NDPA 2HBZB 1Y10A 2DISA 4UZCA 2EFNA 3D1QA 1SI9A 1F3VA 2EK6A 3W2VB 1L3VA 3CJTA 3IBFB 2V1TA 1PYSB 3QMQA 3AJ2A 2YKNA 2Z30B 2VG5A 4IG0B 1VOMA 2HAIA 4OV1A 3DLEA 4NCBA 3KYLA 2GNKA 2K1RB 3AH6A 2WSFC 4O23A 3ICLA 4ZDNA 1Z4UA 3R97A 3M30B 4RW4A 2LU1A 1F5BA 3W63A 5L46A 1VQOS 2CQ3A 4PG6A 4DR7F 2WVDA 4I64A 3R7SB 4DR3J 2U2FA 3H5UA 4NE9C 5DGAA 1TFWA 1SJFA 1V5VA 3P8BB 4KGZB 2J8SA 2XYHB 3EICA 3GIKA 2RB7A 2CVEA 2GQ2A 2OPRA 4ZVQB 2AZ3A 4GKJJ 4ZKAA 5J1EA 2OFHX 3CT9A 2Z8QA 3IRXB 3RTVA 1WC3A 3BZQA 3W60A 4OZNA 1RU2A 1U45A 2KXNB 2UU9J 1YBAA 4ZK7M 4M8LA 1JXEA 2RKIA 2C2KB 1ULRA 2BUNA 1KR4A 4I1TA 4W4MA 4J9UE 5IZHA 4F3QA 3X1LB 5E33A 4M5KA 3CDAA 3I96A 4N8OA 3CCTA 3NRBA 4S0MA 4ED1A 2B5JB 3H59A 4LRCA 2J0QD 4F2RA 4JV5F 4KJIA 1QE1A 3RG6A 3I55S 3OFEA 3T5HA 1F2GA 3QSIA 1YSJA 1EP4A 3NEKA 3JQKA 3M1VB 3PW0A 2GGPA 3FFIB 5CABA 1WC0A 2LP4A 3FUYA 5AJ3F 2GMJA 2GVZB 2F8HA 3MEEB 3R7NB 4UOGA 3HMJG 4DR4F 4ECWA 1K0VA 3MM6B 4U9RA 3J81Y 4OJ3A 3MTKA 2VBWA 3KG4A 5KFZA 3VCDA 1HMVB 4V19X 3NOCA 4OX8A 1U2CA 2YPZA 1AXQA 2FJBB 3B82A 5DDPC 4DUYF 3SCIE 3LAKA 1T9YA 3IRWP 2QTWA 3RAXA 4GKJF 1OWXA 1QE1B 2YXLA 3ZNUA 3R5BA 4HT5A 5KFCA 4ZVTB 2P5VA 4QU7A 1S1TB 3QLHB 4USTA 3T9NA 2MKKA 1KNZA 2D74B 4RW4B 1U1QA 2UU9F 1UUJA 2CG8A 2QO3A 3POTB 4QIWD 2LQ8A 3EMTA 3MR2A 1SKRA 3MEGA 3KLFB 4ZIWA 1Q0NA 3KK2B 2EKYA 2HQIA 2NXNA 1JLEB 2BRLA 1Z1ZA 2BE2B 3UN5A 2B4OA 2VV5A 5ETOA 3K17A 4YHHJ 4OYOA 5KFAA 2XMJA 3V4MA 4K4VA 5J1EB 4DN9A 1GT8A 1QY7A 2AF6A 2GFFA 3WHIA 1RT6B 3GJQB 4FS2A 4ED0A 1YJWS 4J9QA 1QLNA 3UCUP 2B9YA 3DHXA 3PHTA 2X1AA 1RBAA 1Y5NB 5E3CA 2LKZA 1BD6A 4GO5X 1NDLA 3CEDA 2RQCA 5HBMA 5AXMA 1H98A 1S9EA 1I6JA 3UDLA 4J9NA 2MZQA 3POTA 1SQGA 1TL7B 1TL4A 4UUXA 4ECYA 4USVA 1F6TA 2YKNB 3JQMA 4IKAA 1FWPA 4R0JA 5HP1A 2FTRA 1BHNA 2H4YB 2VJVA 2F1FA 1F3FA 1K47A 3RB4A 4ID5A 2NLWA 1EZZB 4NLWA 1XMQF 2C2OB 1SV5B 3ENQA 4PWDA 2HS3A 5FDLB 3MCMA 3VAHA 2QA4G 3CCMS 2IDLA 3PKMA 4X62F 2BM0A 4O3RA 4Y3CA 3ILLA 1KDNA 4AL5A 1M90T 3HF5A 2C42A 2MEWA 3VGUA 3V81B 1OQ3A 2JX2A 2HHUA 2RF2B 3KMSA 1G4CA 2KRBA 3KWMA 4ZPVR 1ZA1B 4QBUA 1FWKA 5KOWA 1BQMB 4P72A 2FVQA 1ZA2B 4DG1B 4RNOA 2CZ4A 4TLQA 2MZTA 3AY0A 3KK3B 2RDJA 3LP1A 2LFVA 4NWBA 3GILA 3PO5A 3TZXA 2UXDJ 1LWFA 4PG7A 4UQGA 3HFZB 1JLEA 3BGLA 4WJBA 4KKOA 1EJ7L 1U1OA 4WYWA 2J6TA 3I0SB 2JC1A 2VFRA 2QE5A 2ATLA 1QUVA 5C42B 1RAFB 3PV8A 1AZSB 2XULA 1O0PA 4MK8A 2GC8A 2Q79A 3QFWA 2B0GA 2AYGA 2V9WA 2RU3A 1RWOB 1X0PA 3MTJA 2CG4A 3C6UB 3UR0A 3KMQA 2RNEA 5L1LA 1C4AA 1YJ9S 1H73A 1JX4A 4FXDA 2UP1A 4HHJA 3SFGA 2O66A 2VC0A 4IH7A 3AFGA 2DGQA 3EXCX 1PSDA 3CCZA 5B0CA 1ZPWX 1WF2A 4G1PA 5HMXA 3C3LA 2V8HA 2XHWA 4DQRA 4B3SF 1NKCA 4TU7A 4GVBB 1CS4A 3OJUA 1PILA 2DPJA 2KFZA 2PFFB 1JLAB 1RA6A 1EB0A 5BYSA 1UWBB 4PKDB 1EQ0A 2R4FA 4CLPA 1IKXA 2BQRA 1PO6A 1EAYC 1D9AA 2EC2A 2IJNA 2JWNA 2X3GA 4ZS6A 3DRXA 5LSLA 4EBDA 1QTNB 3PR5B 2BKNA 2BRKA 3LOUA 3PYEA 3I32A 3RBDA 4QPXA 2WONB 1VISA 5CHCB 4BS2A 1CJKA 2LLZA 1AT1B 4KHPJ 4HLBA 3MM8B 2UXBF 2J7KA 2JL9A 1N5YB 4QQBA 4GKKF 5IOLA 4CQ1A 4DL7A 4OFZA 2ZITA 3J7YU 3HM9A 1N33F 5H1SV 2MKIA 5D0GA 4WE1A 1VK3A 2BW7A 2ZM6F 5HLFB 1FF2A 1N5SA 3DLGA 3MM8A 4YQWA 1P9YA 3IA0A 2R7SA 1GEHA 2B8QA 3ETOA 3R27A 1T9TA 2E1AA 3Q8QB 3BO4A 4K50A 1Y3JA 4GRSA 4DFKA 3KUGA 3O6QA 4F67A 4LF4F 4M95A 4CTAA 1N54B 2CQPA 2ZOFA 3LP2A 1H38A 5DQHA 3IRXA 3NWRA 1ZM3A 1VRQC 1QAIA 2CDQA 3MCSA 1VQMS 3KFWX 3MM9B 3FBCA 4EK2A 2ILYA 1IR1A 4HL9A 1F2HA 1YZ7A 3W2WA 1NKEA 3IG1A 3MMJA 3JSMB 4URSA 2JFDA 2ZE2A 4P73A 5KG3A 2ZNZA 2YNHB 4JB8B 3PNIA 3DLKB 5KFKA 3Q24A 4DS5A 1MWZA 3MCOA 2OAUA 4KPYA 4J9SA 1TL1A 1XN9A 2QV6A 4WK1A 3J80Y 4EBEA 3V4IB 1ELOA 1CJUA 2VG7A 3L95X 2AEJA 4JI6J 2RS8A 1VQ5S 4ID8A 1SUQB 3V6DA 3KKFA 5HQ8A 3M05A 3KK3A 1FO1A 4KH1B 4ED6A 3DLKA 2H48B 2Q3PA 2U1AA 1NDKA 2BDPA 4U8YA 3CD6S 3DOKB 4I4BA 4EGLA 2M52A 1Y3KA 3CWJA 4Y2MA 4JV0A 1KHVA 4EEYA 4DZ6A 2A2DA 2HVDA 5HAOA 4RNFA 2YWWA 3NGTA 5KT2A 2G0JA 4B9MA 1A7GE 2HMIA 2JRSA 4FBTA 1UVMA 4C8ZA 5HROB 2W7AA 5B0BA 5CAAA 1HMVA 1HQEA 4PZVA 2ZBIA 3I82A 4ENOA 2UXCF 1NK0A 1IKYA 5F8LA 2ABYA 1KSPA 1HWUA 4J9LA 4PCQA 1PCAA 3RBZA 1Q81T 3Q23A 2HHVA 2EG1A 3N4WA 1HQEB 1HNVB 1OY9A 4OZ1A 3CD7A 1P9QC 2KYZA 1N4LA 3KNAA 2NR0A 3UW1A 5LT5A 2AJ0A 4NCAA 3NL0A 4OZ3A 2GAHC 3CJ4A 3OTDA 4OI4A 5D4LA 4A4JA 4C0OC 4DCOB 4ZP8A 3TYTA 2CZVC 1GMWA 3W9HA 5C24B 4D3GA 2XMAA 5HJYA 2FDNA 4ZJOA 3ZTSA 4C8YA 3D2WA 1WI8A 3BN7A 2FHJA 2KKHA 1C0TA 1PBAA 4ILRA 1Q8BA 4DV1F 1SQEA 4U67Q 1ZTWA 1MMNA 2DRDA 2OGUA 4ZP9A 4OYIA 5D4OA 4LF7J 4LF1A 4A8OA 2B6AB 2BJ1A 3IBWA 5E5NA 4A8WA 3HHEA 3WC2A 4GVLA 5HBMB 4J7CA 2N82B 3EYZA 2DH9A 2XZ2A 3RB0A 1FA0A 2QSWA 3MOJB 3FNNA 4XPCA 1WKLA 1S6QB 4I6YA 3VAFA 2OPRB 3ILJA 2JEGA 4K0KJ 1W7WA 3P5TL 1JJ2R 2XMMA 1TKDA 4OL8A 4ALZA 2JLEA 2VU5A 2Z0GA 3HKZD 1IWAA 4OYXA 1NSQA 2J9EA 9ATCB 4YR0A 4JI5J 2EC0A 1HPZA 3BSCA 3W5ZA 4LFAF 2DRBA 1FDDA 4A8SA 1XBWA 3G8TA 3JSYA 3OUYB 3BO2A 3BQ0A 4LF5J 2XMWA 2AYMA 1VIXA 4EU0A 2VJUA 3TANA 1R8BA 3QZ8A 1NJYA 3ITHB 2CQ1A 2M8DB 1FFGB 3RW7A 5A8RB 2CQHA 3IFEA 1PAUB 4ANCA 2FD2A 4DR6J 2DGTA 2CFXA 2EG2A 1DFDA 4HI1A 1J5OA 4DV1J 2DNHA 3ILOA 2O01C 4LREA 2I6WA 4YB1P 4DF8A 3TARA 1F0XA 3OLAA 5KFNA 3KLEA 2IFXA 2G0CA 4QIFA 1VQ7S 7AT1B 2HHSA 1DAXA 1SJ4P 4CTAB 2YX4A 5KG6A 4U6PA 3M8SA 2IVMA 1EX8A 4DV4F 3V6HA 4DV7F 3PFEA 3O1LA 3P45B 2GS8A 3M1VA 4X4QA 2HVIA 1VLYA 2PD1A 2R7XA 4TXSA 4UW2A 4DSFA 4AE5A 1UL3A 3R1LA 3HO1A 2QYCA 3Q83A 2AYEA 3K89A 4K8RA 4ZIVA 4JP8A 1RT1B 2JEJA 3MEEA 4AUKA 5KFOA 2KM8B 2YKMA 4ED8A 4AQYJ 2RDDA 1TK0A 1J5EF 4M94A 4LRAA 4K4UA 1ITPA 3M2UA 2QMWA 2A3JA 1XNRF 2PSZA 3L4BC 3MAAA 3CJSA 3D67A 4A8YA 2UUAF 4WKRA 3SQGA 2MZRA 1YGYA 1JLQB 1OO0B 3PRBA 2VQFF 3WDOA 2FJXA 5LSRA 5M2RA 3AAWB 3OHAA 3OT9A 1U6BA 3A8IA 1NSPA 1AYEA 2V4JA 1LKZA 1SVDA 3ZTOA 4F50A 2HZCA 2EKNA 2W2MP 2XZTB 3HHLD 4HH0A 1ACMB 3M8ZA 1AB8A 4ATNA 2XMUA 4DX6A 5L1KA 3AOBA 1YJNS 1NPRA 4KPCA 3DLLQ 1RB0A 3D0IE 4R0EA 2QMXA 4DN0A 3BO3A 4C11A 4MYTA 1KQGB 1ZPVA 5F8NA 2NUHA 3GFXA 3AD9C 4F0MA 2KI2A 2GVDB 4B3MJ 2PEHA 3OSNA 2I38A 5CYMA 1HYSB 4CYUB 3TUPA 1KS2A 4ELVA 4LR7A 1VQ8S 2MKJA 1EIYB 3QT8A 4WK3A 2HW3A 3IM8A 2FZGB 3IR5B 4RW6A 5E3PA 4CP5A 1UCNA 4HTIA 2ACYA 2M8HA 3VWSA 5I3UA 1EQMA 3K5OA 4K4ZA 2W1BA 1WKJA 3W7BA 2XGPA 3T3FA 1ZOTA 4TN2A 5EUHA 3HVTA 1NJZA 4X66F 1RKJA 2HZAA 4B9VA 4ED3A 1WTBA 1Q86T 5G0RA 5JMNA 1VBXA 1AW0A 2GMHA 2NS1B 2JSXA 4EZ9A 2DNYA 4IQXA 3EZOA 3HSZA 2DO4A 5GMDA 5K5MA 5KFSA 3ISZA 1U2FA 4YB5A 5FDLA 3HPOA 3QRQA 2XTJP 4WXWA 3DXSX 1VI7A 3HSGA 1UVKA 2J0WA 1F5AA 2GCFA 4DV0J 1HNXF 1IQZA 4ZLLA 1H2VZ 3TQEA 5KFQA 4DV6F 4KHPF 2O67A 2LU2A 2YKPA 3A8JA 3HSDA 3OBIA 3W62A 2HWIA 4CO1A 4YY3F 1ZZFA 3OVBA 4DF4A 4NI2B 1RTHB 2AP6A 2BMBA 1NO8A 4FKYA 2RILA 3LP2B 3NWGA 5IWAF 2ILZA 2YWHA 3DCAA 3MR6A 1YJUA 1RDRA 3VAJA 3LQVA 3JYTB 3V81A 3DOMB 4B9NA 3HHLA 3LWMA 4B9TA 3R9LA 5G0RB 3I0RA 1JQGA 3GYNA 1M1KT 2VF3A 4CT8A 1N5QA 1T9XA 3SSQA 3IWXA 2E9TA 2E7VA 3IWLA 1WEXA 4WFNQ 2IM3A 2H5EA 5J2MB 3DFEA 2CQ2A 2KJVA 3S6EA 1NH8A 1BWEA 4U95A 4UOFA 3S8SA 1Z2ZA 1VBYA 1YBUA 2V8VA 1X7VA 2NXUA 4WIIA 5D4PA 2DT9A 3W8PA 4NPOA 2Q1LA 4B3TF 2C3OA 1C1CB 2L9NA 4EI2A 1MROB 5DM6Q 3I4HX 4FVMA 2M5YA 3BEGB 4K7QA 1TL1B 1UFKA 4XTTA 1HI0P 4KV8B 4URGA 2LCWA 1S1UA 2NSBA 1HNIA 4KGMA 3VV2B 1OS5A 3B4MA 1IWGA 2HEKA 4BWJA 3CDWA 2J9DA 4BC7A 4X4RA 4R25A 1FDAA 2MHEA 4IG3B 3GIIA 3UD4P 2MGZA 2C3YA 2ZDPA 3B8HA 3VAMA 4DX5A 4DR7J 4FPIA 2GQCA 3W2VA 2L08A 2WK4A 4NLVA 1VQYA 5CH7B 3SQGB 3MEDB 3PRVA 1HWKA 3P5BP 4B9SA 2VUGA 2OKQA 5H9FJ 1S7HA 4ZJQA 2V5HG 3VGTA 2GMLA 3AHPA 4XIUA 2QYGA 1FKOB 2VFVA 2XSFA 1FE0A 1BE4A 4FYYB 3PX4A 2GHVC 1OSDA 2ADBA 3N0VA 1LXNA 2ASLA 4QIGA 1WF1A 5KFIA 2ADCA 5DZ6A 4AXJA 1RI7A 3FZBA 2DY9A 4U7CA 1TR0A 2IYIA 4B9LA 4KE5A 2JEIA 4IG3A 1NM2A 4E0DA
chains in the Genus database with same CATH topology
4OI1A 3NP5A 5AXLA 1DJ0A 1N5VA 3JYTA 4TY9A 4CT9A 5J1PA 2LECA 4R5PA 4DWIA 2XCAA 2XEXA 2BJEA 4LF8F 2UXDF 3NAIA 3MUVP 4OHYA 1S9GB 1HWJA 3H98A 5J2NB 4JI7F 2ZHBA 4I2PA 4YDDB 3GFHA 2POKA 5T7LB 1G2EA 2AGPA 2DR8A 1JIHA 1FEEA 2VPWB 4DFJA 2BOPA 1VQKS 3H4DA 4OX9F 3BDEA 4JBCA 4TU8A 4EYIB 5KFTA 3NNHA 3BSAA 4EYHB 1VQ4S 1LWCA 2C2EA 1TVRA 1SJQA 1YJVA 5DDOC 1D9DA 4D3HA 4LMZA 4KAIA 4H54A 2EPIA 4FS1A 3OR1A 2CQIA 4IG0A 4LSLB 2D9OA 1U2RA 5F0UA 2HNZA 3BF4A 3OTBA 6FD1A 4OIXA 2RE1A 1GX5A 1QAJA 1WNEA 1BY9A 2DK2A 3MAHA 3R5AA 3T6JA 2B4PA 5H9EJ 4B3MF 4TY8B 1YRUA 2RQKA 3LANA 4L72B 3UI3A 4X64F 1T05A 4LFBF 1HW9A 2DNPA 3HJFA 2KDOA 2HNYB 3RR8A 2ZH8A 4MFBA 2IRYA 1QSYA 3F41A 1TV6A 3MPVA 1QM9A 4MMOA 3KHRA 5FLXY 1GTHA 2OPSA 5F9LA 3MMAA 1PC4A 3G96A 2EBEA 3D28A 2JLGA 3CCJS 1QTMA 1QJHA 4N41A 1WHWA 4K5RA 3PEHA 4QIVA 4C97A 2RMLA 2MY8A 5J2MA 2B3TB 4IH6A 5IM0A 3M6XA 1PC5A 1B0VA 2Z2LA 1Y7PA 1HBMA 1VK8A 2B4VA 2XS7A 2QT7A 1VIOA 2ZD1A 4OZLA 1KLMA 2EI5A 4O3NA 5KT5A 1F60B 2OPPB 2R8GA 2K7KA 3SXLA 2KJWA 1N6QB 3HFKA 3DLJA 4KGKA 3VZIA 2B7BB 5D3GA 4JOUA 4ZPTR 4PUOA 2YNIB 1S1VA 4YUDA 3N6LA 2JZ5A 2BZ2A 2QRRA 4CZCA 3W3SA 5B0EA 1KEKA 4Q8EA 3DDNA 3FJ2A 4Q7AA 1TP7A 4USJC 1O51A 2P6SA 3KLHB 3SCJE 1RT7A 3S1TA 4G1QB 3TAMA 1K73T 2JVRA 4WKYA 1O8BA 3K0JA 3R1HA 5I42B 3DRPB 3JTNA 3OL9A 1VRTA 4BHQA 1L3TA 3MI7X 2IM1A 3LALA 2EBGA 2R7QA 2VG6B 3MDFA 4FZVA 4N5SA 4RLEA 2XMTA 1HBNA 1NH7A 2DHGA 2N4DA 2FGOA 2M0GB 2EFVA 4ECRA 4HYKA 3FCHA 1DBDA 2LA4A 5KG1A 2Y0SD 3MEKA 1RT2A 3IG1B 2NQPA 4NXNF 3NNCA 1WHXA 4B3OA 2G4BA 1R89A 3OL6A 2N7CA 4A8XA 1AROP 3M9OB 1HPZB 4ECVA 2F9DA 2HHWA 2QLWA 4JUZA 4DL0C 2W9AA 4ECZA 4I68A 2XB2D 3Q2SC 3R3TA 1UKUA 3BR8A 3OFFA 2HNDA 5KFFA 1SUQA 1T3OA 2KVIA 3L7PA 3V6DB 2Y1JA 4FNHA 5CD4H 2DNMA 3DGPA 3BDPA 1ZYQA 1U6ZA 4G3IA 1GTEA 4QWDA 1MU2A 1RT5A 4KRWA 5GMKa 1Y4ZB 4DR3F 2KXHA 5A8WA 3PJXA 4IFVB 2FUG9 4DBQA 1U4BA 2YKQA 2C28A 3HHLB 3QO9B 4FXWA 4IRDA 4FF3A 2K8GA 2AWZA 4PXCA 2IJFA 5B09A