1RA7A

Poliovirus polymerase with gtp
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Genome polyprotein
publication title Structural basis for proteolysis-dependent activation of the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
total genus 144
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1ra7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ra7A02
2RF2B 3DOKB 3LANA 4ID5B 2R8GA 4ZP7A 1RT3A 4QWEA 4NLXA 3V81B 5DLGA 4O3PA 1BQNA 3BGRB 3QO9A 4IFYB 3MEDB 4NLVA 1DLOB 3HVAA 1RT5B 1RT2B 3OL9A 4MH8A 4ECXA 3LP1A 1RTHB 3ISNC 4O44A 3GIJA 1RTDA 4U6PA 1U09A 5KT3A 2IJFA 5CYMB 2GIQA 2HMIB 3N6LA 4NLQA 1TKZA 3MR3A 2V0NA 3CVKA 1TKTA 1LWFA 1MU2A 4QWDA 3MR5A 5HBMA 3DLEB 5FDLA 2OPPB 2HNYA 4IR1A 3H59A 2IJNA 3DRSA 3H5UA 3BJYA 4WYLA 4URQU 4IR9A 4H4MB 1LW0B 3FRZA 4WZMA 3DM2B 3LP0A 4IG3A 4YP3A 1RTJA 4X2BA 1S1VB 3ITHA 3IS9A 2ILZA 4WFYA 3NBPA 4K4ZA 4WE1B 2CKWA 2J6SA 5JXSA 3IG1A 4K4TA 4NLUA 1C0TA 3BQ0A 1RA7A 2ZKUA 4RW6A 1FK9A 4K4VA 2IAJB 3BQ1A 3T1AA 1BQMB 1TVRA 4R8UA 1JLGA 4TXSA 2RF2A 3OL7A 3DOKA 4MKAA 5KG0A 2VG6B 5HP1B 4F4YA 1LWEB 4F50A 3PW4A 2XCPA 3MTKA 3V81A 2YNGB 5KFIA 2BANB 5DGAA 4EEYA 3BGRA 4IFYA 3M9MB 2AQ4A 1DLOA 3KLVA 5KFGA 4ED7A 3BR9A 2XC9A 2XI3A 4FBTA 1RT2A 5KG6A 4RNFA 4RW4B 4NLPA 4IQXA 3UPFA 1RTHA 3E01B 1FKPB 2XCAA 3QLHB 4HKQA 3HHKA 2VA3A 1HNIB 4TN2A 5KFBA 2V9WA 2HMIA 1C2PA 2F8EX 1S1UB 3FQKA 3IN5A 4TLRA 5L1JA 1JLQA 4I2QB 3DLEA 4KO0B 3C6UB 2OPPA 2OPSB 1LWCA 2RKIB 4YR3A 1TKXB 3DDKA 5I42B 4H4MA 2C22A 1LW0A 3DM2A 5F8IA 1IKWB 1S1VA 1UWBB 5C5JA 3GQCA 2B6AB 2QV6A 2FVCA 2R8HA 4HYKA 4JV1A 1XR7A 5I3UB 5EWFA 1T03B 3PW0A 3MFHA 2ASJA 3DMJB 3MR6A 3CIZA 1BQMA 2AGQA 2YKMB 4DL4A 3JYTA 3BREA 4RZRA 1NHUA 5HP1A 2UVVA 3I5BA 5KT2A 4RUCA 4MK7A 5KG2A 3KK1A 2YNGA 4NLOA 2BANA 3LAKA 1GX5A 1S9EB 4ZPAA 4WZQA 2OPQB 1RT6B 2OPRB 4RW4A 2HWHA 1HQUB 3T5HA 4DL6A 3PJWA 3V4IB 1FKPA 4ECVA 4NCGA 3QLHA 4WFZA 4G1QA 1HNIA 3GV5B 4ZVFA 5D3GB 2WRMA 3HVWA 3DYAA 5DG7A 1C0UB 4I2QA 4ZPBA 4KO0A 3C6UA 2OPSA 4WXWA 4YR2A 3QO9B 1TKXA 1JKHB 5KG5A 1IKYB 4TQSA 4J9NA 5I42A 3EPGA 3KMSA 1VRUB 3CO9A 1IKWA 3KHHA 2QE5A 5F8GA 2B6AA 2YNIA 5KFTA 5KG7A 4EBDA 4XPEA 5I3UA 1T03A 4KB7A 1S97A 1T05B 4Y34A 1S1TB 3QGGA 2XI2A 5EUHA 3C6TB 5KFSA 1TKTB 3I0SB 4QWCA 3BSAA 2YKMA 5KG4A 4RNMA 5FDLB 3SI8A 2HNYB 4YMEA 1QUVA 3V6HA 3QGHA 4K4UA 4NLGA 3G6XA 5J2MB 4FBUA 3MEGB 4QW8A 1TQLA 2UUWA 1T94A 3H2LA 4IFVA 2RDJA 4FS1A 1KHWA 3H5SA 1S9EA 3KLGA 2FVQA 2OPQA 1RT6A 3IG1B 5EWGA 3NAHA 2OPRA 3OL8A 3V4IA 1HQUA 1FK9B 1S9GB 4NLDA 3M9OB 2VG5B 2W8KA 5KFOA 4J9KA 2UVRA 4PQUB 4J9QA 2UVUA 1RT7B 2HWIA 1JLGB 4J9PA 1D1UA 5D3GA 3OLAA 4NYZA 4MK9A 1K1SA 2V4QA 1C0UA 5CYQB 1ZETA 2JEJA 1S48A 4QWAA 3PHEA 5KFPA 1EETB 3IRXB 2V4RA 3RAQA 1JKHA 2WB4A 4R8UB 1IKYA 5KFWA 4TYBA 3DI6B 5KFXA 3GILA 1VRUA 4DL2A 1S0MA 4DL7A 2AX1A 4O4RA 3CJ0A 1C1CA 3CWJA 4YR0A 1EP4A 3ICLA 5F9NA 4RNHA 3VQSA 1T05A 1MMLA 2J6TA 4R5PB 1S1TA 1JLFB 2W9BB 4DG1B 3Q8PB 2DPJA 4G3IA 3C6TA 3SFGA 1JLQB 3I0SA 3ISND 4IG0B 4Q0BA 3H98A 2OH2A 1LWCB 1TV6B 4H4OB 5KG3A 2C2EA 1LW2B 5J2MA 3MEGA 3I5CA 3NL0A 5HLFA 4F4XA 4RW8B 4JV0A 3I0RA 2JEGA 3JSMB 2ZE2B 3V6JA 4NRUA 2C2DA 1RA6A 2IM1A 3H4DA 1ZTWA 2C2RA 1S9GA 3N6MA 2VG5A 4PQUA 5L9XA 1RT7A 1RYRA 4M95A 1CSJA 3JYTB 3M8PB 4ZHRA 5C25B 4Q8EA 4LSNA 2JC0A 3T5LA 3G86A 5CYQA 2AWZA 1SH0A 2I1RA 3KK1B 1S1XA 1EETA 3IRXA 2HNZB 2W9AA 4IH5A 3OHAA 3DI6A 1VRTB 2GC8A 3UR0A 3FDSA 4O3QA 5KG1A 4ECTA 3RB4A 2E9RX 3OSPA 1ZTTA 3E51A 2W8LA 4KV8B 4H54A 4NCGB 4ECSA 3KLEB 3D28A 4G1QB 1S9FA 4R5PA 1JLFA 2W9BA 4DG1A 3KLHB 4NLTA 2ALZA 1N48A 2GIRA 3DYAB 2R2UA 4IG0A 3T5KA 4MIBA 1IM4A 2AGPA 3G6YA 1TV6A 4H4OA 2ATLA 2D41A 1LW2A 4JUZA 1JLEB 3FSIA 4KHRA 4ED8A 3CDWA 4RW8A 3HVTA 1RTIB 1S4FA 2YNIB 4Y3CA 4JV2A 3JSMA 4KHMA 2ZE2A 1Z4UA 3CDEA 4ED2A 2WHOA 1N5YB 2WOMA 1S10A 1I6JA 3T19A 5KFHA 4EYIB 3NMAA 1N56A 4ZMMA 3GYNA 4U7CA 3M8PA 3PR4A 5C25A 5DQHA 3PW2A 2BRLA 4O3RA 3PW5A 2YKNB 2FJWA 3FFIB 3PVXA 5KFDA 4LQ3A 1TP7A 2HNZA 3PW7A 4IFVB 3KLFB 3MFIA 3QYYA 3MECB 3KLGB 4IRKA 3DRRB 1VRTA 3LALA 4WFXA 3OL6A 1RT1A 3H4BA 2YNHB 1JLAB 3GIKA 5L1KA 4KV8A 5KFZA 1TL1A 5DQIA 3NGDA 3KLEA 2IA6A 4QPXA 1S49A 3NAIA 3OLBA 5F8HA 1HPZB 3MEEA 4M94A 1JLCB 3KLHA 4URGA 3MR2A 3M9NB 1QAIA 5KFQA 4EBEA 1S0NA 4PWDA 4KFBB 4ZVGA 3H5XA 3H5YA 3BSNA 4ZPDA 4TY8B 1JLEA 2O5DA 1RT4B 3LP2B 3TAMB 1RTIA 1C1CB 4XO0A 1RYSA 1EP4B 3TVKA 1S6QA 1K1QA 5KFYA 1N5YA 4ECYA 1XR5A 3KHGA 5KT6A 3RBDA 4GC6A 3I5AA 4K4WA 4RW9B 4KSEB 4Q0BB 4WYWA 5F9LA 2BQUA 3EZUA 4Q44A 2ASDA 3PR5B 3SFUA 2UUTA 2YKNA 4R0EA 1JLBB 3DLKB 3FFIA 4ED6A 5HLFB 5HROB 1TL3B 2JEFA 3KLIB 4PUOB 1SV5B 3KLFA 1J5OB 4Q43A 3MECA 2YNFA 2EC0A 3I0RB 1JIHA 3DRRA 4NLYA 5KFVA 2IC3A 1FKOB 2YNHA 1JLAA 3LAMA 2W9CB 4ZVHA 2W7OA 4RW7B 4B3OB 4LQ9A 4QW9A 5F8LA 5KFEA 4EBCA 1DTQB 1HPZA 1IKXB 1JLCA 2AX0A 2I5JA 4ZHRB 4LSNB 1GX6A 5KT5A 2BQ3A 2FVPA 2E9ZA 3CJ2A 2R8JA 4KFBA 4Y2CA 5KT4A 1S1XB 4IRCA 1RAJA 1HYSA 4IKAA 4TY8A 3H40A 3HKWA 3IGNA 2WK4A 3GV7B 3V6DB 3CDUA 4J9RA 4I2PB 1RT4A 2JEIA 3LP2A 3TAMA 5KFKA 4DL5A 3RBEA 3N6NA 4IRDA 2BE2B 2HNDB 2JLEA 4MIAA 5K14A 2FLLA 2IMWP 3DLGB 1NHVA 4O3NA 2BR0A 1HNVB 3BSOA 5L1IA 4RW9A 2B43A 1XR6A 4DL3A 1HARA 4I7FB 1SH3A 4NLWA 1IKVB 3QIDA 3KK2A 3DLKA 1JLBA 5KFCA 5HROA 1TL3A 4KKOA 3KLIA 3HVTB 1SV5A 4PUOA 1J5OA 4O3SA 3CJ5A 4GC7A 5KT7A 1FKOA 2W9CA 2WOMB 4ZPCA 3PJXA 4RW7A 3GIMA 1D0EA 5DGBA 4TY9A 4B3OA 1N6QB 4LSLB 1S1WB 4J9SA 1DTQA 4O3OA 2IM3A 1IKXA 2XWYA 3Q8QB 1C1BB 3GV8B 2B5JA 3CJ4A 1QE1B 4MKBA 5J2PB 3T5JA 4ICLB 2AGOA 2ZD1A 5KFLA 3KJVB 4MFBB 3RAXA 3UDLA 4ZP8A 5DQGA 4J9LA 1RT1B 4I2PA 4EYHB 1SUQB 3V6DA 1DTTA 4IH7A 2R8KA 1TL1B 2IM2A 5J2NB 3V6KA 3QGIA 2HAIA 2FJVA 2BE2A 2HNDA 2WCXA 1R0AB 3MEEB 3DLGA 5DG8A 1HNVA 3BQ2A 4QWBA 4NZ0A 4PWDB 1SH2A 2ASLA 5F8NA 4I7FA 3GIIA 4ID5A 1IKVA 2DPIA 5EDWA 2FLPA 4J9MA 3OHBA 4ECWA 3QZ8A 2XGPA 2CJQA 4J9OA 2IM0A 5JUMA 3MEDA 4ECQA 2FLNA 1RT5A 2FJXA 1S6QB 1S6PB 3MF5A 2WONB 1HMVB 4EO6A 5DLFA 1N6QA 4LSLA 1S1WA 4ZP6A 4K4XA 2BRKA 3UQSA 5CYMA 3G6VA 2JC1A 2D3UA 1C1BA 1REVB 3DOLB 5C24B 5J2QB 1QE1A 3QZ7A 3KHRA 1KLMB 5J2PA 4FS2A 3CJ3A 4ICLA 3KJVA 3KK3B 5KFJA 2C28A 4MFBA 2YNFB 4Q8FA 2BQRA 2IC3B 1SUQA 1JX4A 1S0OA 5J2NA 4WE1A 4IH6A 4Y2AA 2UVWA 4RNOA 5C42B 3QIPB 1R0AA 2I5JB 4XPCA 3KMQA 2IAJA 3FQLA 4MK8A 4ED1A 2VG7B 1JXLA 1HYSB 1N4LA 2VG6A 2FVSA 5T14A 4K4YA 2J6UA 5J1EB 1LWEA 1HQEB 2D3ZA 1T3NA 4F4ZA 1QAJA 3IGVA 4ECUA 4ED3A 4RUAA 3NKYA 1S6PA 2IBKA 5K14B 2WONA 2AU0A 3E01A 4KAIA 5KFUA 4Q45A 2XGQA 3KHLA 1HMVA 3DRPB 4RNNA 4WXOA 3M8QB 4ECRA 4O4GB 4IDKB 4OL8A 1S1UA 3DOLA 1REVA 1RT3B 4KBIA 4ZVEA 5C24A 5J2QA 3KK2B 3D5MA 1KLMA 2R2RA 3PZPA 1RDRA 4KKOB 3KK3A 4NLSA 1BQNB 1W25A 2RKIA 5L1LA 2FVRA 4K50A 2RDIA 3BSCA 4K4SA 4YQWA 3KNAA 1UWBA 3LP1B 3RB3A 5KFNA 5KFRA 4EO8A 1KHVA 4NLRA 4O44B 1RTDB 5C42A 2ILYA 3QIPA 4F4WA 3DMJA 2E9TA 2D7SA 5DG9A 3RB6A 1TKZB 2W7PA 4DEZA 2B5JB 4ZP9A 1LWFB 1MU2B 1NNDA 3EPIA 5HBMB 3RB0A 2VG7A 4ECZA 5F8JA 2ZD1B 4O4GA 1YVFA 4ED0A 5F8MA 3DRSB 5KFMA 2R8IA 3KOAA 5J1EA 3OSNA 5EWEA 1OS5A 1HQEA 3LP0B 4IG3B 1DTTB 1RTJB 4URSA 3ITHB 3IS9B 3NBPB 5KFAA 4TQRA 4RU9A 3Q8RB 2R2SA 4IOBA 4TYAA 4NRTA 2R2TA 1C0TB 4RW6B 2WTFA 4KE5A 3Q8SB 3DRPA 5KFFA 3TQ1A 2VA2A 1TVRB 3M8QA 1WNEA 4IDKA
chains in the Genus database with same CATH superfamily
1X31C 4EK2A 4L74A 4C8KA 3HVAA 3OL9A 3EZ5A 3PM9A 3OR2A 5H9EK 3FKBA 1YBTA 2XY7A 2H5EA 2IRYA 2M5YA 5IXUA 3IMQJ 1M0SA 3GWCA 1D09B 1QLNA 2CZ4A 3QGPA 2J6SA 1WHYA 1FK9A 1J5EJ 3T1AA 3QAEA 1DJ0A 3J80U 3BR9A 3I4HX 3W2VA 4M5KA 1S1UB 1E6VA 3ZTPA 1LWCA 2AKWB 4F0KA 2R7RA 4JV5J 4CT9A 2AT1B 2HQ3A 1SL1A 2ASJA 2VONA 5B0BA 3NGRA 5LJ3Y 3JYTA 3MXHP 4XIUA 5KG2A 2V50A 1UJ6A 4U95A 1HQUB 2MLYA 3V4MA 4LJMA 4MKVA 1KOOA 5HQ8A 4TQSA 1IKWA 2DT9A 2B6AA 4Y2KA 4KB7A 1T05B 5IC4B 4L72B 3D4JA 3R6GB 4JI5F 4YUDA 2RB7A 1KR4A 1JNRB 1UAWA 4J90A 2UVRA 2VG5B 4AXIA 1MWZA 4NYZA 4CO2A 5CABA 3OR1B 3PHEA 1FNOA 3CC7S 1VRUA 2AX1A 1S1TA 1RAEB 3Q8PB 4ZIVA 2MKYA 3SFGA 5A6WA 1YJRA 1XNQF 1UETA 2C2EA 3MMBB 4FN5A 1NH7A 1T0TV 3MEGA 3HMJG 2PIIA 2UUBF 5LT5A 4UT4A 1AB8A 2C2RA 3MGJA 3SCIE 4PQUA 3MURP 1UKUA 3RTVA 4P52A 2AZ3A 1R0BG 2EFNA 3DI6A 1ZTTA 5KG1A 2W8LA 4FXWA 1OYDA 4I4BA 1DURA 3KLHB 3LF0A 4ATNA 4OI6A 1WKLA 3OT9A 5JMNA 4PPZA 1S4EA 4ED8A 3CDWA 4QJVA 1YHQS 5F0UA 2QFJA 2ZE2A 2XLKA 2XYGB 1I6JA 2LEPA 2OFGX 4EYIB 2BDPA 3M6VA 4F2SA 2YKNB 4IFVB 3KLFB 1JJ2R 3D0IE 2RHQB 1TL1A 2HQCA 2IA6A 3G4SS 3U7JA 3CDAA 1HI1A 2CPYA 5E41A 1N5QA 2AMCB 3HLUA 3ISZA 2HHPA 1EP4B 3FGVA 2M88A 4I69A 4JI2J 2D74B 4YHHJ 3S01A 3B78A 1TL5A 1JLBB 4DSKA 2KO1A 4P7VA 3GCXP 5E7OB 2RQ4A 2PEBA 1JLCA 3CXCR 5KT5A 2UXDJ 1RABB 4IRCA 1HYSA 3V6DB 1RT4A 4N47A 4CO5A 2DGTA 4M5JA 2HNDB 5K14A 2O67A 3Q23A 2UXBJ 1N32F 5KFCA 1DBDA 4PUOA 2R4FA 3HVTB 2CJ9A 2GHVC 3HSGA 2Y8WA 1JXEA 2WOMB 4RW7A 4WWSA 2B8QA 4NCBA 2Z56B 4X4SA 1ACMB 1UEKA 3KJVB 4J9LA 2IM2A 4LBIA 1LXNA 3BQ2A 4QWBA 2CQ3A 2HWTA 5F8NA 2XZWA 4ZVQB 2FLPA 2HFSA 2IIHA 4ECWA 1UJ5A 1S6PB 2B7CB 4NPOA 3DOMA 4DX8H 1H7WA 3VGVA 3VZIA 5CQGA 3QJPA 2CFXA 4AE5A 4WE1A 4RNOA 2CJYB 3TWZA 2MQMA 2VG6A 2CADA 2VBWA 1YK9A 3IGVA 2VDIA 2PN6A 2CJXB 1H2TZ 3SXLA 4IDKB 3DOLA 2VDHA 1BQNB 3ZTSA 1G7CB 4CTAA 4NEZA 1PBUA 4BC7A 1D9AA 4NI2B 2XMWA 2VG7A 3OFEA 2YWGA 5L8RC 4KPYA 2R2SA 4N8NA 4KE5A 3Q8SB 5LJ5Y 3H2VE 4B3SF 4UY8T 3LANA 4ID5B 2FHMA 1IXKA 1F5AA 3AOBA 3GYGA 3BKFA 4B3TJ 2MLZA 3ENVA 5CYMB 4ELVA 4NLQA 2VQEJ 3MR5A 2OPPB 2HNYA 3PKMA 3ENWA 4I64A 2GQCA 2LA4A 1VQ4S 3BBCA 2ZKUA 1QSLA 2XMKA 1F3FA 1ROFA 1TVRA 3VTIA 5KOXA 4B3MJ 2VZ9A 3MTKA 3N0VA 4FBTA 1RJJA 4IQXA 4ES2A 3J7YI 5IQ6A 3W64A 1HNIB 2P5VA 3U1MA 1N34F 1JLQA 2DXEA 2O01C 4F0MA 5G0RB 1J2VA 1Q79A 1S6UA 2W2OP 1JQGA 2QL5B 4JV1A 1U2FA 1HIYA 2F8HA 1X5OA 2GJ2A 4U96A 2OKQA 3MR6A 2QMUB 1CJVA 4LVNP 1Q8IA 2YWWA 5KT2A 1R31A 2BANA 3MOZA 3PXGa 1CC8A 1X4AA 2EK6A 5AE2A 2WAQD 1PG5B 3Q0AA 3J7Z5 2Y1IA 4C3KA 4FPIA 3EPGA 2QE5A 2JRSA 1X4BA 4AYBD 3V6HA 2RDJA 2OPQA 2DNHA 3WIUA 2MKIA 4HVZA 3A8EA 2P9CA 4J9PA 1JLGB 2KZMA 2CQ0A 3G82A 5JVHQ 4C3MA 5K5MA 3CUNA 2OGUA 3VQSA 4NX9A 5LL6d 3ZZRA 3LQVA 3I6PA 3ET6B 1HBMA 3K8WA 1N36J 4FVCA 3MZIA 1GMUA 1BHNA 2GMLA 3JSMB 4NRUA 1S9GA 1U1QA 1JJCB 3VAGA 2R7XA 5L9XA 4LF7J 4ZHRA 4HH0A 1SH0A 1RAIB 2HNZB 3UO0A 4Y65A 4X64J 5IV4A 3JQKA 3C14A 4G1QB 2D69A 4DG1A 1KNZA 2AGPA 3IWNC 4XK8C 4YN3B 4QIEA 1Z4UA 3BYPA 3W63A 4ANCA 4N5SA 1HNWF 3SQGB 1XJWB 2BW7A 3M8PA 2B8PA 4Y00A 1UVJA 2YNHB 3RJMB 4QPXA 1ZZNA 1F0XA 1S0NA 2HBYB 3H5XA 3BYRA 2V1TA 3HPOA 1T9XA 4I6YA 1XBWA 4RW9B 3CDBA 2HHHJ 2UUTA 2UZAA 4OZ1A 1K73T 2EC0A 2HURA 3LPYA 1UPPA 4QW9A 3MCNA 3OW2R 1DTQB 1SJ3P 2E9ZA 2W7AA 3CJ2A 3MPWA 1FVQA 4A46A 1PC5A 2I2YA 3TAMA 3NCRA 4DL5A 3U02A 1SC6A 4O3NA 2R3VA 3ILJA 3JTPA 4O3SA 2UXCJ 1YLXA 3IA0A 1TL7B 4OI1A 2JVRA 3C8YA 2IM3A 1LK5A 1GTEA 1N0VC 2APOA 5FIIA 3GONA 1RHRB 3DGVA 2HAIA 4B9TA 1WUUA 1IM6A 5EDWA 1SQEA 2ZWPA 4NL5A 1U48A 1HI8A 3FC9A 4EFAC 3KNGA 1VRQC 2HW3A 1HMVB 3IBCB 5E0OA 4NOHA 3HK2A 2YY3A 3TZXA 2GZOA 2FGOA 4DL0C 1UA1A 3ZTRA 5C42B 1T02A 4MJKA 1S72S 4QIFA 1LWEA 3MR7A 3GFHA 2QO3A 3T3FA 3W3SA 4ECUA 2E5HA 5KFUA 4DV1F 4OX9F 2NXEA 1RT3B 3NS7B 4KBIA 4OYPA 1ZPWX 1VDHA 3KK3A 5L1LA 1MSWD 2GVZA 3J81U 2N4CA 2ILYA 3QIPA 2HQGA 1LWFB 1QVGR 1X0PA 2AEMA 3UCZP 2N3OA 4IG3B 4HACB 3KTQA 4NCAA 1IBMF 3UN2A 1HL6A 4DSJA 3M8QA 2IJNA 4WU2A 1CC7A 4M5GA 1R3NA 5EX0A 3TJ9A 4DUYJ 1TU0B 4P74A 1HHQA 2V0NA 1ZAWA 2XEXA 5DM6Q 1B0VA 2E7XA 3DM2B 3SCLE 5JXSA 1P9QC 2BW2A 1Y4ZB 3HJFA 5JVGQ 4P9SA 1FERA 5HI7A 2XCPA 1GMWA 4YS2A 1PYSB 3LH2S 4MYTA 1ZM4A 1PJ6A 4TVAB 3PG9A 4A8KA 3ADAC 2HHTA 1XMOJ 1I1GA 3RR7A 3GU0A 3NNAA 2B3TB 1XEZA 2OJ3A 3N79A 4USUA 5GAEU 5H1SV 3KK1A 1YJWS 5HQMA 4YY3F 3ILOA 3FBFA 3RZAA 3TAQA 1JKHB 2XYPB 2HRUA 3KMSA 4USTA 3DCAA 4M5LA 2NSBA 3QNWB 3G9CA 2OAUA 5KFSA 2BJ7A 3K59A 1U45A 2UUWA 3F0NA 4AXJA 3VVUA 2ZBRA 1HQUA 1HWJA 3M9OB 1RT7B 2F4VF 3IWXA 1FD2A 3BZQA 1EETB 3THVA 5KFWA 4CLSA 4TYBA 4OX7A 3RGIA 4DL7A 3CJ0A 3JB9k 1M1HA 1ZS6A 2X3GA 3ZTQA 4WFBQ 1T05A 4G3IA 1BMQB 5ITHA 3U1NA 4JV0A 2GHWA 3BBFA 1M5PC 2VG5A 2MSTA 1ZM2A 3GP9A 1BLUA 3T5LA 1X9MA 2HSEB 2I1RA 4NMLA 5B0CA 3OHAA 2F9JA 4ECTA 3FDSA 2E9RX 2XTEA 2MLXA 3RG6A 3VAJA 2E1RA 4CO1A 1T9WA 3D67A 3G96A 2C2ZB 2CYYA 2YNIB 1N5YB 4E2FB 1N56A 4G65A 4M8LA 3C16B 2IFXA 3SSSA 2B56A 2RSQA 2BRLA 1K8AT 3KLGB 1SKRA 3Q2SC 1JLAB 4ZCLA 1R8BA 1RHUB 2BOAA 5F8HA 5HN0A 3KLHA 5KFQA 4PYAA 1U8WA 3CD6S 3HCXA 3PTWA 1RWXB 4EWTA 1BQXA 3D6MB 5F9LA 1NJYA 3EZUA 2F1FA 2ASDA 3KYLA 3MAAB 3AX5A 2YKNA 5HROB 3KLFA 5KFVA 2W9CB 5HMYA 3IC1A 1Q8KA 1C4CA 1SKWA 5BYRA 5KT4A 1DRZA 4X4OA 4CLKA 2CG4A 1XQIA 2DHXA 3N6NA 2IMWP 3UCGA 3BSOA 2KHDA 5L1IA 4DL3A 1HARA 1RK8A 3FJ2A 1JLBA 1FX2A 5D15A 4KGXB 5CXTA 4LBHA 2CZVC 2H51B 4KGMA 2HHWA 1CVJA 3BN4A 4O3OA 3Q8QB 3CD7A 1Z2ZA 4ICLB 3DN9A 4MFBB 4OYAA 4ZP8A 3V6DA 2EVZA 2HNDA 4KHPJ 2KZZA 2K7JA 4NZ0A 4LR8A 3GSIA 2KDOA 3BF4A 2CJQA 2FJXA 3WX4A 4X4PA 2CQ4A 4LF9F 1RUSA 2E5IA 2B4OA 3J81Y 4DFJA 3ETMA 3KJVA 2K7KA 5KFJA 2RH3A 3BH6B 2X1GA 5I3PA 1RHKB 1HWIA 3R5GA 4ZJLA 2KVIA 1KFSA 3HFKA 2DNLA 4Y6IA 4ED4A 2FIUA 1S79A 3FMWA 1S6PA 2AEJA 2IBKA 2G0IA 2CQHA 3O44A 2VASA 2HFZA 1VQPS 3VZHA 3A12A 1FVSA 1RGVA 2RUGA 1UWBA 3LP1B 3PIPQ 4C11B 4F4WA 3DMJA 2D7SA 3DLLQ 2BMBA 4DV7F 3VAMA 4JI6J 1DHMA 2HG4A 1RTJB 4P2FA 2QYCA 3EXCX 2AJ2A 3UDVA 3R5CA 4K59A 1WNEA 4IDKA 2RF2B 4HI2A 3B4DA 2HS0A 5A2QU 4O3PA 3VF0B 1BQNA 3QO9A 4DV4F 1WF2A 2ZOMA 9ATCB 3PYFA 4B3RF 1G3OA 4NI2A 4NXNF 1QD1A 2DH7A 3R7NB 1F6TA 3S8SA 1HHTP 1F9HA 2CPFA 5LSOA 4K4ZA 3D1HA 2CNLB 3Q86A 3H7HB 1NDLA 2ZC3A 3ZFVA 4OHXA 4OYWA 2BABA 4F2RA 1V3RA 3AA9A 1FT8A 3KLVA 1PILA 2FUG9 3EWGA 5KG6A 3HSZA 3R2DJ 1PSDA 3C6UB 2OPPA 2OPSB 4WP8A 1CBKA 2NREA 2BV3A 5C5JA 4ZLLA 4C8ZA 3VV2B 5EX3A 4LSZB 1KVKA 1RHJB 2Q6CA 2UVVA 4RUCA 3TI0A 1VR6A 3VR1A 3CC4S 4YB6A 4IOCQ 2YXLA 4KGVB 3UFCX 1HNIA 2VJVA 4U9RA 3RAMA 1QSYA 2F7VA 4WBFA 4N41A 2JLGA 2GX8A 5F8GA 2MY8A 3PACA 1S97A 3JTNA 4Y34A 2IPOB 1TKTB 3AJ1A 1ZH5A 4B9LA 3GFXA 3DLBA 3H5SA 1FXDA 2LDYA 1GNKA 4JI5J 4M5DB 1FWKA 4DV5F 2J0WA 1X4FA 3H98A 2OH2A 1TV6B 5KG3A 1RA6A 3EJMA 1XNQJ 2JC0A 4J9VA 1KP6A 4JI0F 1OQ3A 2F8MA 2GGPB 3R7BB 2UUBJ 1G2EA 3M8RA 3KLEB 1ZA2B 1Q86T 3UNYA 3V2UC 2LXFA 3M8YA 2K1RB 4USVA 1O0PA 4KHRA 2CQIA 3VGSA 3JSMA 4KHMA 1U4BA 1DQ9A 1X4CA 3PHTA 3K7RA 3HT3A 5DO2A 4X65F 2DY9A 1U1MA 3KG4A 1SI9A 4PXDA 2HNZA 4DSIA 3MFIA 1GTHA 2EBGA 4PWWA 1S59A 5KFZA 4DWIA 1WJ9A 2N82B 4G1IA 2QLXA 3K5PA 2IVFB 1NPKA 1F5BA 1TKDA 3CTRA 2V8DA 1PYOB 2RIJA 1FE4A 4YEAA 2YVSA 3SQGA 5GMKa 3M1VA 1WELA 3PR5B 2KJWA 4ED6A 3QSYB 3GR0A 4ZLJA 2YNHA 1FFSB 4B3OB 4JBCA 2CWKA 4LF1A 3TW0A 4IKAA 4OIXA 4UOFA 3D68A 4E8UA 3SBMA 3MTJA 2DO4A 2BR0A 4RW9A 5M2PA 3QIDA 1SIWB 2AIRB 4ZPCA 1UVNA 2DITA 1DTQA 1KSPA 4LIRA 4A8WA 4ZVUB 3BKTA 2FJBB 1YRXA 4ZCIA 2X1AA 4IO9Q 1EB0A 3CCSS 3POTB 3FZ2A 2EKNA 3MEEB 3QMQA 4F3MA 4RU2A 1PGZA 1EAYC 2VH7A 2W24A 3PX0A 1KTQA 1QAYA 1YDLA 1SJRA 3GTYX 1Q0NA 1RHQB 5ETQA 1S6QB 4D3HA 3M2VB 4CWBA 1H3DA 1TL7A 4K4XA 3SDEB 3LWLA 2D3UA 2MQNA 3KHRA 4MAKA 4HLBA 2F4FA 3FEYB 3R27A 2QLJB 1T3NA 1FI4A 5A2QY 2AU0A 1U6FA 5BXIA 4CP5A 1HMVA 5EGYA 1DY3A 4FF2A 1UVMA 4N77A 2EFGA 2HVEA 4K50A 1VK8A 3CE8A 5KFNA 5C42A 3WC2A 3D6TB 2PFFB 4DOZA 3EPIA 4ECZA 2ZD1B 3O6QA 5BR8F 3KOAA 3D7SB 1WF1A 1MN7A 3IS9B 4LRDA 2W4PA 4N7TA 4MKYA 1CJUB 3IFEA 3DOKB 1RT3A 1VQKS 3J7YU 3NG8A 3QBCA 4XDDA 2YQ3A 2H5IB 1U09A 5KT3A 4B3SJ 5A8KB 3N6LA 3WZ0A 4F4AA 3CVKA 1LWFA 4J37A 1WWHA 1WKJA 4IR9A 4DX5A 4IG3A 5LMNF 1S1VB 3T9ZA 2W2MP 3OTOF 3ZXWA 1KDNA 3QAUA 1R8HA 3TRGA 3P45B 1B4SA 4CI0B 1BE4A 4ED7A 3E01B 3A3PB 3HHKA 2V2QA 4U8VA 4K7QA 1B0PA 3DM2A 2MKCA 1R8PA 4OQJA 1NDCA 5I3UB 1CEZA 1N34J 3IM8A 2QEXS 2J7WA 1PKUA 4MK7A 3BH7B 4G1PA 2Y0SD 4ECVA 3SV3A 3TQEA 1NPPA 4RBTA 4MTPA 2G0CA 1K44A 2L41A 2OTLS 2XZ2A 2ZZTA 3QFHA 1KRPA 4FF1A 1QVFR 3W62A 2VIHA 4AFFA 1E6YA 2FLOA 5HMXA 4ANEA 3G6XA 2X51A 2LDIA 3SSQA 3TR5A 3GFYA 5CYJA 4B9NA 1K1SA 1HQ2A 1JKHA 1U47A 4GVLA 4DL2A 2B9XA 1C1CA 3TVYA 4R5PB 3JSYA 2MDAA 1QTMA 2DIUA 4QCLA 4TU8A 1TR0A 3ZNJ1 2G2OA 3AX2A 3QFWA 3S7RA 4DCPB 3EVMA 3GJRB 3GPAA 1RT7A 5ETTA 1IN0A 2ZHOA 3DLJA 1IR2A 1EETA 1X4GA 2HVDA 3R5DA 4DU7A 1LFPA 1RAOA 2ZHAA 4WIIA 4F36A 2LXIA 2YWKA 2GIRA 2R2UA 2XLIA 2H3EB 2DHHA 2J7UA 4DR6F 2WHOA 2E44A 1VISA 3W65A 2HBRB 2MTLA 5FLXY 2MZTA 3A13A 5CCMA 1RHMB 4E0DA 1HNWJ 2MQ8A 2ZOGA 3CD5A 1K0TA 4X4UA 2QMXA 1U26A 3G71S 4DMZA 1VQ5S 3HD2A 1OJ4A 4XO0A 3TUJC 5A8RB 1N5YA 3I5AA 4Q0BB 3C16A 4WYWA 4UTGA 2VICA 1U7LA 3AX3A 2RJZA 1J5OB 5D4OA 1JLAA 1VLOA 5A8WB 2FVPA 3R3TA 3H0PA 3IGNA 3QT8A 2M0GB 2JEIA 4NZ6A 4H4KC 4PG7A 2VOPA 1NSAA 3FVYA 4MIAA 4DQIA 2DNRA 1U24A 4NLWA 4F26A 2C2MB 3MAAA 5HROA 4GC7A 1EJ7L 2W9CA 4OZ3A 1D0EA 2OUGA 1EKSA 4KGZB 2KFZA 5AXMA 2V68A 2IDLA 3OTCA 4OJ3A 4MKBA 2ZH8A 1Y5NB 3US5A 1RT1B 2LECA 5IQQA 1DTTA 5K8PA 5J2NB 3EXYA 3PNIA 3W9JA 2IRXA 1WC3A 3KJNB 1CQMA 5DG8A 3VHQA 1APSA 4ZITA 2ABYA 1VQLS 3ULHA 3LTOA 3NCQA 5JUMA 4ECQA 2PMHA 1SBRA 2G13A 1RWWB 4ID8A 4WP9A 4C8MA 3TAPA 4DF8A 1W7WA 4LFAF 2OEKA 4ZVSB 4F4KA 2UV8G 3ZZYA 4ICLA 4ELUA 3FEXB 1Y00A 4MFBA 2BQRA 2IC3B 3F73A 2C2OB 4ZVTB 1NK6A 4E98A 3I9V9 2DNGA 1VJQA 3NLCA 5J1EB 2R42A 1QAJA 2AYEA 3GFZA 3DRPB 3FSXA 1SL0A 1G6BA 3PZPA 2FVRA 4K4SA 1OIAA 4EO8A 3RB6A 2U1AA 4PKDB 4OX9J 1UJ4A 2FZKB 3LP0B 4URSA 2WVFA 4NRTA 4LF4F 3MMCB 4C8NA 2PEHA 4QWEA 4GKKF 1P9YA 3NP5A 4UW2A 4MT1A 1U1PA 8RUCA 1Y5IB 2PMWA 3TX8A 3LP1A 1IBMJ 5MLCV 2UU9F 5B7WA 1REGX 3DLEB 3MAQA 3FRZA 3TZZA 1RTJA 2ZITA 2CNKB 2EFOA 2RF2A 4FYXB 3M9MB 4TKTA 2XC9A 2XI3A 3UPFA 5D0RA 3DHWC 4OX6A 2DHGA 5D4LA 2AEFA 2V34A 3FQKA 1H6KX 2NYHA 4ZJOA 2C22A 1WC0A 2VBYA 2WVEA 2H9ZA 4FPRA 4WFAQ 2YX7A 3Q22A 3NRBA 2MKHA 4JI3F 4FP9A 3D3CJ 2ZH1A 3O5TB 4LRBA 3CEDA 2A0FB 3HVWA 2AHOB 3C6UA 2OPSA 1TK5A 1VBZA 2KN4A 4OX8A 4YY3J 2HQDA 4XPEA 3F44A 3BSAA 5FDLB 4HHJA 4WKYA 5IOLA 3HKZD 3H2LA 2ZDPA 2J8SA 3BBBA 1ZA1B 2XB2D 1URNA 4WJBA 5E3PA 2KL8A 5IM0B 2XG8A 5CYQB 1ZETA 1S48A 4W98A 3L9ZA 3IRXB 3CF5Q 2Y8YA 4KYZA 3DRXA 5KFXA 4DBQA 4IUFA 5T41A 1CJKB 2W9BB 2F4VJ 2ZNZA 4PR6A 1TL4A 4H4OB 5KAKA 3NL0A 5HLFA 4LFBF 1N52B 1ZAXA 4B9UA 3D66A 1CSJA 1NH8A 3NCPA 3G86A 2AWZA 4DR4F 4M5DA 2W9AA 4IH5A 2GC8A 1P6TA 3OSPA 3V5RA 3PEHA 2IJRA 1RE1B 1HWLA 1TV6A 2ROPA 2ZFHA 3W8GA 4Z37A 3JQJA 4X4TA 2HHVA 1TFYA 3KKFA 2ZZNA 2VF3A 1B0TA 4C0HA 2DNZA 4ZMMA 3PR4A 2XTCA 1Q82T 1H98A 2FJWA 3FFIB 5DJBA 1L3VA 2GGPA 4IRKA 3DRRB 3M2RB 4JYAF 3QWUA 3BGFA 5GADI 3KLEA 3NAIA 4EBEA 2K1RA 2YKOA 4PWDA 1VQ6S 1NSPA 3M7VA 2RMLA 4PZVA 1SJFA 4GC6A 2PFDA 4Q44A 2VKRA 1IBKF 3EE3A 4DV6J 3I0RB 3LAMA 4DV0F 3ENQA 3SYZA 5E33A 3KUGA 6AT1B 2CPEA 2V8VA 1S1XB 1M1KT 2RAQA 1SPBP 4DPTA 1U2CA 2YWHA 5CAAA 4FXVA 3EM1A 1JB0C 4AQYF 1HNXF 4B3OA 3C2PA 2BA9A 3OTEA 2EG1A 1M5HA 2V2VA 1AT1B 5F0WA 3AB2B 2UUCJ 3A8KA 2KB2A 4DFKA 2K3IA 2XZDB 5E5NA 2HLTA 1NHKL 1VJWA 3B54A 3EGNA 5IZHA 4WTOB 2P6TA 2J8AA 4A8FA 1UMJA 3DNCA 3O8WA 4FS2A 2HRYA 2NUUG 2C28A 4W4MA 3CCRS 1WSVA 5ETLA 1JX4A 2OEJA 1Q4RA 5LMUF 3GCWP 4LF9J 4UQTA 1RBLA 2IAJA 4DPWA 1GMWD 3B4MA 4K4YA 4OV1A 2ZBQA 1FX4A 4HT7A 4DDFA 4Q45A 3M2VA 2BEFA 1F5CA 2OTJS 2YX1A 2IYIA 2NXUA 2KJVA 3D5MA 2D3O1 2QL7B 3K17A 2K3KA 2HPUA 2V8PA 3GJSB 3VWSA 1RWUA 5KFRA 4NLRA 1NNDA 3BB5A 2DD8S 2F63A 5KFMA 2DEJA 3OSNA 2H48B 4CLWA 4TQRA 4IOBA 4LF5F 1V5VA 1H0HB 2VA2A 2EXUA 4DV7J 5AE3A 1RLDA 1CJTB 5DLGA 3HFZB 4NLVA 1DLOB 5ETOA 2Z57B 4AL5A 2IJFA 3H5UA 2OD4A 1R0CB 3KXDA 4DV4J 3IS9A 2XHWA 1T9UA 5DDRC 4QOTA 4B3RJ 1CJUA 4NXNJ 3HX9A 4TXSA 2XLJA 3DOKA 5HP1B 2BUNA 2BJ8A 1QY7A 2AQ4A 3SQOP 3NGSA 4JI8F 1VQ8S 2OHDA 4A8SA 1A9NB 1TKXB 1S76D 3P6YC 1GH8A 2XULA 3AODA 1S1VA 1FWPA 2AV5A 7AT1B 3CMES 3MFHA 1S7IA 2BJ3A 1FO1A 1NMEB 1UPMB 1H7XA 2GV1A 2JZ5A 3LGNA 4PG8A 3QWPA 3V4IB 1YJ9S 2BVZA 1CQNA 1GXTA 2CQDA 1VS3A 3ELHA 3DHXA 1C0UB 1UZDA 5KG5A 2HIQA 1ZOTA 4CLYA 5I3UA 3F56A 3BGUA 2DHSA 3OXGA 2C1EB 5EUHA 2OMLA 3SI8A 4NLGA 4WCEQ 2EBEA 3TVZA 4FS1A 5IT0A 3KUEA 3DU5A 1YJUA 4NLDA 5T7LB 5KFOA 4HI1A 2Q3PA 4RWWA 5D0HA 2V4QA 2OSRA 1KN6A 2V4RA 4USMA 2CPHA 2QYGA 1TUGB 2FQQB 1NK9A 5IT9U 2C3UA 1S0MA 2NXNA 4Q7AA 5CD4H 1MMLA 2J6TA 2XM3A 5D77A 3D6HB 3TZYA 2CPIA 4EU0A 1FRJA 4RW8B 1JJHA 1XC9A 4DV5J 3V6JA 1MNEA 3AD9C 3TYTA 4X62F 1RB0A 4TU9A 1RQ0A 4BDPA 3NWRA 2VPYB 4O3QA 1FRXA 4CH7A 4R5PA 3K5MA 2P9GA 1FA0A 2HHQA 1U1RA 1IM4A 3NGUA 4LRAA 1RBOB 2ATLA 4JI0J 4DI6A 3U1LA 1JLEB 3JAMU 2R7TA 1NZAA 4KT0C 1BWVA 4P72A 1U1NA 3CJTA 3T9NA 4LF8F 2E1CA 2FC8A 1ZBTA 1YWXA 2ZEJA 2D68A 2FDNA 5DQIA 4WU3A 4S0MA 2ZVIA 4X65J 2Y0BB 3MR2A 4I67A 2Z30B 3W1YC 4Q5VA 5KFYA 2PA8D 3R5BA 4EZ6A 2PMZD 3LOUA 1N54B 3ENAA 1WDTA 1KONA 1PC4A 3G8SA 3UI3A 4DCOB 2JEFA 3KLIB 3TUZC 1M5SA 2CIMA 4LQ9A 1RBAA 5F3ZA 5DZ7A 1BC6A 2V69A 2ZH7A 3VAIA 2Z2LA 3H40A 2WVDA 3IR6B 2CXEA 1F9EB 4IRDA 5A8RA 1YBAA 2B43A 2OO4A 1J5OA 1WC4A 3W8PA 3LGHA 5A8WA 1FEEA 2HYIB 4B9SA 2LLZA 1R7IA 2D9PA 5HK4A 1VK3A 3THTA 2FJVA 4A8QA 4OV6A 2D9OA 4J9OA 3CCQS 3HF5A 4ZPWR 2KFYA 3JTOA 1LKZA 1UCNA 4UOCA 3KFWX 4RLEA 4Q8FA 3I9ZA 5J2NA 2DJWA 3GJTB 2HQIA 4PRFA 3UD5A 1YX2A 2L08A 5HJXA 3HO1A 4ANDA 2H65B 4OZ2A 1PAUB 5DS7A 3ZTOA 3FBBA 4JI4F 2RHSB 2R2RA 2RKIA 2JHEA 2B9WA 1NK5A 1RP5A 2L9WA 4ZN1A 2MB0B 1BY9A 3DC2A 3CCUS 2QGFB 5HBMB 4U7UK 1ULRA 3OQ2A 3SEOA 3CC2S 5J1EA 1FNXH 4TYAA 4HL9A 2MMYA 4OJ1A 3DRPA 1X60A 2W2NP 4HTIA 5BR8J 1UVIA 1KFDA 2LVWA 3MEDB 1RT5B 4OYIA 2DGXA 4CO4A 3ISNC 1QUPA 1MWYA 2GIQA 1X0FA 2J0SD 2FPHX 4DV2F 3LP0A 2CKWA 4A8YA 1VC5A 3TP2A 2DRAA 2WB1D 3CCTA 1VBKA 4F50A 3UVJB 2N4DA 5LMNJ 4AUKA 4UF4A 1UEVA 4NLPA 1LV5A 4AL7A 3OTOJ 4TN2A 3MI7X 3DLEA 3QT6A 5I42B 2GVDA 2MQPA 1XR7A 5EWFA 3PO5A 2CJAA 3VQTA 4RX6A 4RZRA 1TMMA 1UUJA 3LAKA 2PT0A 3H2UB 1GXLA 2N7YA 5IT9Y 5RUBA 1NB2A 4LREA 4BWJA 5GMEA 4TNOA 3CO9A 3H20A 4EBDA 3BS9A 4KH0B 3QGGA 5BYQA 3K58A 5K8NA 4K4UA 4QW8A 1XNRJ 1TQLA 1FDBA 5AXKA 2JNJA 3VVTA 1FK9B 4B3TF 2LQJA 2P8IA 3N01A 2KRRA 3UWTA 3TEHB 1FDNA 4FDFA 3JAMY 2R7QA 3W5YA 3G8TA 1E6VB 3A8JA 1LWCB 4CLLA 5AT1B 3ILLA 2K06A 1KOHA 2JEGA 3H4DA 1FRMA 1FNMA 3JYTB 3D9BA 3RYLA 5IM0A 2B4VA 5CYQA 3IRXA 4K5RA 1NK0A 5L39A 3B8HA 4QU6A 2RUSA 1U02A 1XN9A 1CJKA 2WSCC 2W9BA 3AA8A 2BKPA 4DU8A 1VMBA 1LNQA 4H4OA 3FEZA 3FCVA 2NR0A 1RI7A 2G2YA 2M70A 2GJFA 3PW2A 3PW5A 3PVXA 1KQKA 4DR6J 3DRYA 4CH1A 2ROEA 2VOOA 1RCXB 3GIKA 5AJ3F 3MMJA 3NGDA 1TAUA 1V5IB 2B9EA 4FYDA 4LF6F 4URGA 5E2QA 3BO2A 1S5ZA 1VQSA 1EKRA 3KWMA 1NXIA 2DY1A 3ZZOA 2Z2YB 2GO8A 1XR5A 3M30B 5C2GA 3I55S 2GAHC 3DLKB 3FFIA 4B9MA 1TL3B 2ZBPA 2YNFA 3DRRA 3M2RA 3PRDA 2POKA 2B9YA 5KFEA 2A2CA 1WOOA 1VQ7S 3FSYA 4D3GA 4Y2CA 3C46A 3HKWA 3RBZA 2JDJA 2QIFA 2ALYB 5E3CA 5EHHA 1HNVB 1SH3A 4B17A 2LYVA 3H42A 2DKOB 2WSEC 1WDDA 1FFWB 4LSLB 1S1WB 3MM7B 2Z0GA 3OPKA 2B5JA 2MHNA 5HL7Q 3QT5A 1TAQA 3K5LA 3RAXA 2A18A 1SUQB 3WIVA 2MZSA 1TL1B 4NXMF 3UN5A 1FFGB 1FJGJ 1FTRA 1WEYA 3AHPA 3PV8A 2XYHB 1J27A 2Y1RI 2V1SA 3IP0A 4ZN3A 2FLNA 4C0BA 3JSBA 3BGOP 4CZCA 1IBLJ 1MG7A 5SZTA 2XTDA 1REVB 2XSFA 3CJ3A 3GZ7A 3BO4A 1H74A 2UVWA 4LFAJ 1HYSB 1X4EA 5D0GA 1HQEB 2O3DA 2KM8B 5K14B 3OVAA 2ZBCA 2XGQA 1KS2A 3ETOA 2PC6A 3OXFA 4BWMA 1RDRA 4ZVPB 1W25A 1RISA 3GMGA 3BPSP 1V3SA 2XMVA 5DG9A 1MU2B 2W2QP 3A3OB 1S57A 2R7UA 5B0GA 3MD1A 3M8ZA 4DX6A 1YJVA 5HVFA 2XTJP 5EWEA 3ITHB 2HS4A 2UXCF 1AXQA 5CZVA 4RW6B 2GNKA 1DARA 5ETSA 5K8MA 4NLXA 4C8YA 3PYGA 3D1OA 2H4YB 4LT6A 3L7OA 4LF4J 3Q2TC 1RTZA 1YJTA 3M6UA 4GKKJ 1RADB 3TX0A 1LWXA 1WEZA 1RWKB 4YP3A 3MEKA 2ILZA 4WE1B 1MN9A 3IG1A 2UU9J 4DX7A 1BQMB 3BM7A 2FHJA 4UY85 3OL7A 1EARA 4MKAA 3UNGC 2VG6B 2QG9B 1FRKA 5KFIA 2DGQA 2J5AA 4WK3A 1DLOA 1FJCA 2E7VA 2MEWA 4DJBA 4HKQA 4M1KA 5J1NA 5KFBA 1RWVB 4I2QB 4KO0B 3MM8B 4PXEA 1F9FA 1XERA 3UR3C 2J9DE 1LXJA 5ETVA 4RWXA 5HP1A 3EVOA 1GX5A 1NEEA 1Y3KA 4DL6A 4NCGA 3MAHA 1S0VA 4ES1A 1NO8A 3DYAA 5DG7A 4JI3J 3PFEA 5ETMA 1TKXA 1IKYB 3KHHA 3AQPA 5HVHA 3RR8A 1X5TA 3CCMS 4OLOA 3MPYA 2HNYB 2ZKTA 2KFNA 3D1QA 2FVQA 5DRKA 2YH0A 2HGMA 3V4IA 5CHCB 4CIOA 2BKNA 3WDOA 2VQFF 4PQAA 1NSQA 1C0UA 3NS5A 3RAQA 1WTBA 1Q1KA 2MXYA 1VQ9S 1JLFB 1JLQB 4LF2A 5AE1A 5T7LA 2DNMA 1D3WA 4LSNA 4CM2A 5GADU 2YKAA 4LFBJ 1VRTB 1HR0F 1XIQA 4ECSA 2QLWA 1AYEA 1FXRA 4DR4J 2DRDA 2QJ3A 3UD3P 1AUSL 4RW8A 3K8VA 4ER8A 4LFCJ 2V63A 3W5ZA 2DR8A 5KFHA 1F3VA 3T1YF 1SJQA 4CNYA 1SQGA 3PW7A 3QYYA 5L1KA 2MQOA 2DNKA 2EC2A 2BX6A 3TUPA 3EVWA 3H5YA 1N88A 4FYWB 3N5BA 1JLEA 2FTRA 2D1CA 4JYAJ 1Q5VA 3R6LB 1M90T 3MUTP 1K1QA 1PYTA 4DF4A 3RBDA 2CAJA 4L6V3 5D6GA 2Q1LA 4ZS6A 2UV8A 1GQEA 2CRLA 4NLYA 4ZVHA 5GAEI 1WEXA 4ERDA 4WTYA 2P9EA 4LBPA 1T7PA 3HZGA 2I5JA 3AD7C 4ZHRB 4DR5F 5DDPC 4WK1A 1IBKJ 1R27B 2NSCA 4I56A 1FTCA 4I2PB 4DV0J 2H5JB 2ZM6F 2V94A 1OSDA 4I7FB 1IKVB 3I96A 3KK2A 5D0EA 4KKOA 3KLIA 1KQSR 1RKJA 2ERRA 3D2WA 1N6QB 1FJEB 4B9VA 2MGZB 2AGOA 1R43A 1V6HA 1CPZA 2AZ1A 4IH7A 1U2RA 2GMJA 4ITSA 3V6KA 4AQYJ 1HNXJ 1R0AB 5D4PA 1SH2A 1VI7A 1F2HA 3CJRA 2XGPA 2IM0A 1F60B 4P2SA 4EO6A 3QRPA 2CPZA 5C24B 3CCVS 5F41A 3ILIA 4WPAA 4Z2XA 2P2CB 5CZXA 5KOWA 3FCWA 2GHPA 4DXLA 5T14A 3BR8A 4DSEA 3AD8C 2EG2A 3K0JA 1GMVA 5LMUJ 3MPVA 2DB1A 4KGKA 5H9FK 3IR5B 1S1UA 3M32B 1NJIT 2VHGA 3BSCA 5B08A 1SXLA 3KNAA 1EIYB 1TKZB 4I1TA 2M9KA 2VB6A 4ED0A 3DRSB 5LSLA 2A10A 3AAWB 3NBPB 2W2PP 4EMDA 4DPOA 5A6PA 2WTFA 3M6WA 4IQMA 1MROB 3MDFA 4MH8A 4LF5J 3T41A 1X9SA 5LXYA 1EZZB 3BN7A 1Q5YA 2XS5A 3KDOA 2R7VA 1P27B 4QWDA 5HBMA 4KJIA 2ZH6A 1LW0B 4WZMA 1JMTA 2B4PA 5ETNA 5HVGA 3IR7B 4K5SA 2DH9A 4DR3F 1Y11A 1LWEB 3OR1A 3O2IA 4EEYA 1YI2S 4RKUC 2LCWA 3HD1A 3QLHB 1CLFA 5F3TA 2DGSA 1RAHB 2V9WA 2ZH5A 2HQFA 4USKA 3MMBA 1HBOB 5HATA 4QIVA 1TK0A 4JI8J 2R8HA 2FVCA 2CNNB 3EGVA 4LRFA 3PW0A 3HJVA 2DH8A 1Z1ZA 3R97A 3UVJA 1VHIA 3R9LA 1S9EB 4M5IA 1PO6A 2UUAF 4DUZF 5D3GB 2WRMA 2QN6B 4F25A 2QRRA 5I42A 3QJLA 3Q24A 2R7OA 3UN3A 2COLA 2XI2A 5DDOC 2L48A 4GMKA 3SMZA 2AJQA 1T94A 1W2BR 4IFVA 1KHWA 4P10A 4L76A 2GQQA 2VC0A 1Y10A 3ZZTA 2UVUA 3O1LA 2HWIA 2ZBIA 1ITPA 1NUEA 3OV7A 4OI3A 3GILA 1EP4A 2AYGA 4RNHA 5JJBA 4NEYA 5BJRA 3EX7B 4KC5A 1O8BA 3CJKB 1JNZB 1LW2B 2XHCA 2AYMA 3OJUA 3I5CA 1OPIA 2C2DA 2BOPA 2KM8C 4FYYB 3ZZZA 3FBEA 3OTDA 3KK1B 3BO3A 4H54A 4BS2A 4X62J 3TJ8A 1N48A 4P73A 3OD2A 1S99A 4OYZA 4X84A 3HVTA 4Y3CA 3T6JA 4JV2A 4RBVA 2WOMA 4YB5A 2FHOB 4EGLA 2ZUGA 5THWA 3TZWA 4LRCA 4QYZK 1WHWA 1TP7A 1WACA 4M5MA 1D9FA 3W7BA 3I87A 4FNHA 1S49A 3OLBA 2E66A 4LF8J 1N5SA 2DR9A 1VLYA 3N4WA 2MZQA 4ECYA 1NDPA 4B08A 5KT6A 2MZRA 4A8MP 1TELA 3DGPB 1FHTA 4PAAA 2QA4S 2NZCA 4GO7X 4P71A 4V19X 4P2XA 3S1TA 3L09A 4DV3F 5B0AA 3JQMA 2BE9B 3JXOA 4JOUA 4Z7CA 2BE2B 2FLLA 3M2UB 4N56A 2R7SA 3M30A 3DLHA 6FDRA 1NZ8A 1P1TA 4ZVRB 3DLKA 2KYZA 4ZDNA 1TL3A 3A4TA 2IYGA 2RNEA 1FDAA 4AL6A 3E3XA 1B99A 1QE1B 1UEUA 1U0HB 5A76A 2V6AA 1HNVA 2W25A 3AJ2A 3R7SB 4UUXA 4FVMA 4DPUA 4L3NA 3GIIA 4ID5A 2G0JA 2DPIA 2VJUA 2H54B 2DHAA 2XMJA 3QZ8A 1HD0A 2BJ1A 4X4RA 2Y1JA 4LSLA 1S1WA 3MM7A 5CYMA 4BBYA 1NDKA 3NOCA 3CW2C 4PABA 1AW0A 1Y0HA 1SUQA 3MM5B 2XNQA 2AJFE 2YQ0A 2RE1A 1U6ZA 1AFIA 1PCAA 3MCMA 3QATA 4BLGA 4XPCA 1FJ7A 3HHLB 3IXQA 5DZ6A 3LO3A 4RUAA 2HVHA 4ZLPA 2XO6A 4HTJA 2PI5A 2FB0A 1REVA 5HJYA 1R6VA 3CT9A 2XS7A 4QZVB 1X5PA 5G0RA 2HVZA 2WW8A 2ZH3A 3D0HE 3AT1B 1XMBA 2A6MA 2EW9A 3IO1A 2DGVA 2W7PA 3CJSA 3H8YA 4DEZA 3P4UB 4JI4J 2RDDA 3PJ9A 2R8IA 4PG6A 2IVMA 2YQ1A 1HQEA 4OLPA 3EDRB 5SUHA 2CJKA 5IWAF 1I94F 4ZP7A 4RUHA 5A0YB 1IUJA 1OMSA 4USHA 2NZ4A 1H38A 3GIJA 2B7BB 2HMIB 2V5HG 3MR3A 1UP1A 1MU2A 4C97A 4IR1A 1X5SA 2YX4A 4QIGA 4H4MB 4ELTA 4OHVA 3ITHA 2GAGC 2HGNA 4RW6A 4K4VA 1VQMS 1JLGA 3OFHA 4J9UE 5IFMA 2F40A 4DV2J 5EN1A 4FKYA 3HP6A 3KUHA 4RNFA 3Q8UA 2VA3A 2F8EX 5L1JA 2LU2A 3ET6A 3J7ZT 4QYRA 1WOSA 1T11A 1UWBB 1AA1B 3DMJB 2HGLA 1BQMA 1RWPB 2YKMB 1B3TA 2DGWA 4Y2MA 1ZM9A 2RQCA 2JWNA 2VPXB 3HHEA 2C3MA 2DNNA 4ZPAA 3NEKA 2J7KA 3S6EA 2OPRB 1YKWA 1JXVA 4G1QA 2RQMA 3EYZA 4I2QA 3MUMP 4KO0A 3MM8A 1Q8BA 3QO9B 4J9NA 4HT5A 5KG7A 4C6AA 1YGYA 1FRIA 1MLAA 3C6TB 4K2JA 4OHZA 1N8RT 4YMEA 4OZNA 1HBNB 3J80Y 1Y9OA 2E7WA 5FLXU 2HFNA 3NAHA 3OL8A 2ZVSA 2HK2A 4J9QA 1KD1T 4MK9A 5KFPA 1IKYA 2A6OA 1NK7A 4OZ5A 3ICLA 4Z7YA 1WHVA 3C15B 3ZZ0A 4IG0B 3UDCA 3RRGA 2H4WB 2DR6A 2G9OA 3ZNUA 4WFNQ 2CA9A 4GO5X 4P7TA 3CCES 3I4PA 3SSRA 1I5OB 5IC6B 2DO0A 2OMOA 1N32J 1BGXT 3VALA 3PX6A 2DVIA 1HWUA 1TTHB 3UR0A 2KT5A 3RB4A 2PA3A 4KIAA 5B09A 5GAGI 1JLFA 1VBXA 2BBEA 2PO4A 4P75A 5L38A 1ZPVA 1T9TA 5IT4A 3H25A 4PWUA 1TZ0A 2LQBA 2MY7A 3MECB 1VRTA 2Z2ZA 2A1BA 1HPZB 4ILRA 3M9NB 1QAIA 2PD1A 1RYSA 2Q6BA 5AJ3J 1HBUB 4IO1A 3I32A 4LF6J 2FJDB 2RILA 2ACMA 5E3QA 4R0EA 1SV5B 1XK8A 1JIHA 1FKOB 3WBZA 2VFTA 4FKXA 3HFVA 1U1KA 3R5JB 3R5AA 5CD4A 1M1GA 1HKAA 3C66A 2QTWA 1KKHA 3PFOA 4TLQA 4N76A 4OMFG 1AFJA 3NNCA 1SB6A 1NKEA 2F5GA 1GXUA 4M5NA 3GIRA 3PJXA 2RRAA 1NCLA 1YIJS 3UDEA 1EQMA 3SCJE 1XTZA 4I2PA 4HACA 2R8KA 1RU2A 2DIVA 2K8GA 1T3OA 4J91A 4HR2A 4KRWA 4I7FA 3RW7A 1IKVA 2DGUA 1KQFB 3AWRA 4NXMJ 1N6QA 3M1VB 3FNNA 2OLWA 5J2QB 3AB4B 2MGZA 8AT1B 2W01A 1OPZA 1R0AA 2RD5C 2C3YA 2BJDA 4F4ZA 3NKYA 2RS8A 2VFRA 5C2CA 4RNNA 2HFUA 1OO0B 2CQ2A 2RU9A 4ZVEA 5C24A 1VBYA 3FCHA 3EGWB 3ZZPA 1EHWA 4YB7A 2CVEA 4F8RA 2G4BA 2A3JA 4YQWA 3N28A 1RTDB 4NASA 4WKRA 3W60A 2SXLA 4MMOA 4K0KF 3DKDA 1C0TB 1UFLA 1YZ6A 4RO0A 3R1LA 4R8UB 1QJHA 4A8XA 3M32A 2ZUAA 3AY0A 4MYUA 4GKJF 2GFFA 4C0OC 2XWXA 2AJ1A 1UTAA 1TKZA 1VCTA 2WBMA 4L73A 3DRSA 3KG1A 5HMWA 2HHSA 1TMJA 4X2BA 3NBPA 1SVDA 3VGTA 1AZSB 1RA7A 1NAQA 1OY8A 1YQHA 4RJVA 4F4YA 2HFVA 3PW4A 4LIWA 2YNGB 2Q43A 5DGAA 2XMAA 2IVYA 3IBWA 4USJC 1MROA 5KFGA 2LEAA 2W4CA 3CB4A 4U67Q 2XCAA 1FKPB 1N5VA 3IN5A 4TLRA 1KQGB 4B02A 4YR3A 2KT3A 1LW0A 1KBRA 2FHKA 3P5TL 1O5JA 2FD2A 5BYSA 5D78A 4U7UD 3CSKA 2DR7A 3W2WB 2AGQA 2X7IA 1L3SA 1NHUA 2ACYA 2J76E 3C19A 1U0SA 1T8EA 1KVJA 2NCKL 4NLOA 1D9DA 1U25A 2N7CA 3HULA 3QLHA 1SJ4P 2O66A 2MZJA 4W92B 1OY9A 3OUYB 1CULB 1HBOA 4PYDA 1B7FA 4OYBA 4DR2F 2YNIA 3Q8VA 1ZZFA 3FRYA 1T9VA 4QWCA 1URRA 1T9YA 4KPCA 1VC0A 3QGHA 5J2MB 2XY6A 3Q83A 1S9EA 4WP3A 3KLGA 4L75A 2EK1A 2X3DA 4NE9C 4DS4A 5D3GA 3OLAA 4ZPVR 2WZ1A 4Y0FA 1XMQF 2HZCA 2G1HA 2JSXA 4CT8A 2ZC4A 5F9NA 1B7YB 1WC5A 2DPJA 2VQFJ 1AROP 3ISND 4QR1A 3HHLC 2LFVA 4PG5A 2VD3A 3L4BC 3PDNA 1B64A 4QIWD 1YRUA 2IM1A 4DN0A 4KR0B 1GFWB 5E3RA 2X1FA 5C25B 1FXLA 3PCOB 2LKZA 4IOAQ 2DCUB 2MYFA 2XY5A 4QR0A 4KV8B 3C3LA 1UVLA 4YOEA 2XS2A 3M05A 3CJKA 1L3KA 1LW2A 1RTIB 4C3LA 1HR0J 1N33F 3NMAA 3BEGB 3GYNA 1E6YB 3K57A 1OQ6A 3ZO7A 1SJ1A 2KXNB 3T1HF 2LQ9A 3U27A 2QT7A 2MQQA 2CJBA 3TO8A 3T1YJ 4KFBB 3P5BP 4QBUA 2ZJQQ 2O5DA 1MWQA 1C1CB 3WC0A 1X8DA 3I31A 3H90A 4K4WA 1HA1A 4OYMA 2VKZG 2LMIA 3FZBA 2V4JB 1RAFB 2NXCA 1HHSA 1IQTA 1BWEA 2AX0A 4DV1J 2BQ3A 2NS1B 3X1LB 4X66F 1U49A 3GV7B 1S77D 4J9RA 4JI7F 3M6XA 3W66A 4CCHA 1EQ0A 1YJ7A 3CPWR 3TJAA 4DR5J 1WG5A 1H72C 2RRNA 3A3NB 2EFQA 2HFOA 3DGPA 1K9MT 3BPDA 2FY1A 5KT7A 3TA0A 4ZKAA 2ZM6J 4C11A 1U8SA 5G4DA 2KXHA 5KFLA 2PI4A 4XDCA 2OFHX 3BDEA 2Z58B 3JSRA 4O0IA 2BE2A 3NNHA 2WCXA 3M2UA 2NPFA 2ADCA 4JI1F 4C8OA 4XAKA 2IBOA 2VUGA 3DDIA 4J5OA 1R6YA 2ZDOA 1WTFA 3NY0A 3F41A 3AOCA 1NBEB 3PRBA 2QL9B 2BRKA 2JC1A 2AYBA 4CH0S 1QE1A 4QQBA 5C7PA 1LOUA 1WD6A 1U0HA 2IMOA 2FHJD 4CLUA 2CZ9A 2E1PA 3J7AN 5HMZA 3FQLA 2RQKA 3CGIA 2J6UA 2MKKA 4DV6F 2DGOA 2QX0A 4ED3A 4KAIA 3EDQB 3DU6A 1M5VC 2W1BA 3AH6A 4OYXA 2QMWA 3MM5A 3TUIC 3MOJB 1B70B 9RUBA 4O44B 5J1PA 4TU7A 3OVSA 2Q79A 3HHLA 3MM6B 4ZCMA 1C4AA 1OS5A 1KLNA 1DTTB 4GVBB 2GW8A 1GK8A 1L3TA 2FY8A 5DDQC 3V81B 3BGRB 4IFYB 1RT2B 2UUCF 2BM1A 2BYCA 1RTHB 3FUYA 3R1HA 2OIHA 4U6PA 2YBVA 1TKTA 4DR7F 3Q89A 2GA7A 2J0XA 1IR1A 1VC6A 4WF9Q 1Q8LA 4WFYA 4F0HA 1HW9A 2EEYA 4K4TA 5GAHI 3CCWA 1K47A 1FF2A 3W9IA 2HHUA 1Q95G 5A0YA 1HWKA 2AW0A 2VL1A 4DCJB 4RW4B 4ES3A 2ZZMA 2HMIA 4DR3J 3MM9B 3OVBA 2EFVA 3OFGA 5CA5A 4H4MA 2WVBA 5F8IA 2HHXA 2GO9A 1T03B 1LEOA 2JX2A 2VV5A 3OXLA 3CIZA 5LXRA 1PBAA 2FGCA 3AXKA 4YDXA 5HO4A 3BREA 2M7SA 3J7A1 3R2CJ 4OHYA 5AXNA 1P8GA 1L5UA 3G8QA 3IWLA 1SC3B 3PJWA 2ZJPQ 4BHQA 2M3DA 4ZPBA 2G2ZA 2E1MC 4DSLA 2Z4PA 3G87A 4F67A 4DFMA 5KFTA 2CVIA 2UUAJ 2QC3A 4YB1P 3B82A 5K20B 4DUZJ 4QR2A 2DRBA 3I0SB 3PKYA 5KG4A 2YKMA 1QUVA 4FZVA 5IS2A 2OPRA 2C3OA 2ZHBA 3MUVP 5LM7E 1FCAA 4USWA 1MMDA 3CWJA 4YR0A 4F3OA 5K9FA 1RACB 3C6TA 1S7HA 1UL3A 1HBNA 2GIFA 2RRBA 4F4XA 3D0GE 4F7VA 2E29A 2XBPA 4DR1F 3GG0A 2V9KA 1RU1A 2JOQA 2XMTA 3K89A 1RYRA 3FMBA 4F3QA 4FNIA 3FK4A 3AJDA 4LVOP 4P6QA 1I3OB 1PJ5A 3VAKA 3IBFB 2E5LF 3E51A 4DQQA 3C15A 4CM0A 4IG0A 3OJSA 1VOMA 4MIBA 3G6YA 2D41A 4JUZA 2CQ1A 2V2KA 2R9LA 2FZGB 2MKSA 1HNZF 2XMUA 1S10A 3KG0A 1BD6A 3CD0A 4DSFA 5DQHA 5CCLA 4C7QA 5KFDA 4O23A 3EZOA 3POTA 5M2UA 1SCJB 2O1PA 4ZCKA 3MEEA 4M94A 2AJ0A 1XWLA 2Y1LB 3PX4A 3PY8A 4OI2A 2V8GA 4TY8B 3LP2B 2L3MA 2M8DB 1S6QA 5U47A 3QT7A 2LU1A 4U8YA 3SDEA 3W9HA 5HLFB 4CLPA 3HVRA 4Q43A 3MECA 5B0DA 3CJ8A 3GYXB 4EBCA 3NXZA 1M5OC 1HPZA 3HI9A 1IKXB 1GX6A 3AFGA 3RBXA 3IAM9 1RAJA 2LQ5A 3L7PA 5GMDA 2PE8A 2PGCA 5KFKA 1HBUA 2JLEA 4K2XA 1NRKA 4N8OA 4DV3J 1SV5A 3CJ5A 1FKOA 1UA0A 1X4HA 3NWGA 2QSWA 3R8YA 5DGBA 1IBCB 1FD8A 2VFSA 1WG1A 4KH1B 4RPFA 3CJ4A 5J2PB 1YSJA 2ZD1A 2D3OR 2YWFA 1NKBA 4UUWA 2IY5B 5LOQA 2HLUA 2ZWOA 1YTYA 1IVZA 4F02A 4ILLA 4PWDB 2ASLA 3CCLS 4J9MA 4ZLNA 4NYPA 4ZA1A 3HSDA 2QZ8A 1SC4B 5A8KA 3THPA 3CMAS 1KLMB 1QSSA 1PAEX 5B0FA 2E5GA 2JFDA 2HRTA 3DXBA 1S0OA 3TANA 2GS8A 2FVSA 1WORA 2D3ZA 3HXMA 4Y2IA 1YG0A 2ZH4A 2Q66A 1VIXA 3E01A 3KHLA 1VFJA 4O4GB 4OL8A 1GAOA 5J2QA 4HDHA 4NWBA 3AQOA 2AJ4A 1IJFB 4UZBA 4QPTA 1RWOB 1ZM3A 2J9CA 2CPJA 4KY3A 5KFAA 3Q8RB 2R2TA 1UW9A 3LGMA 5KFFA 1IQZA 4CLFA 1SC1B 1WG4A 2QLBB 2CWXA 2C3PA 1O51A 4ECXA 1X9WA 5IWAJ 2FJEB 1RTDA 1J5EF 1I94J 5H9EJ 3BJYA 4WYLA 4URQU 2JH3A 3WX8A 2HBQB 3K5NA 1C0TA 1Y3JA 4OI0A 2IAJB 4R8UA 2MZ1A 2CQCA 4OZ0A 2KI2A 4CLZA 2JJ4D 4HHHA 4DQPA 4JV5F 2J9EA 2ZNYA 3HHNB 4ZPTR 3N5FA 3FBCA 2E5JA 1NJZA 2DCLA 1PJ7A 4FF4A 1X7VA 1AZSA 3G6ES 2KTQA 3PRVA 4UZCA 4ZVOB 2X1BA 4DL4A 1RZMA 1WF0A 3MCOA 2YNGA 2PSZA 1RT6B 2HWHA 1FKPA 1H2VZ 4DQSA 4WFZA 1FE0A 4ZVFA 2KYXA 2M52A 3DXSX 4OZLA 1NSKL 4WXWA 4R25A 2MKJA 2XSJB 2Y9HA 4ILMA 1D8ZA 4M63A 1S6OA 3LA0A 2BJ9A 3W2WA 2VODA 4RNMA 1U1LA 4PPDA 4CYUB 3J81j 1DAXA 1RSCA 1FRLA 4J9KA 2YPZA 3N9UC 3GSDA 1RAAB 3CIMA 1A6LA 3PYDA 3OUYA 4QWAA 1CULA 5GAGU 2LQ8A 4HEA9 4DPXA 4ENOA 2KH9A 4O4RA 3PEJA 2CDQA 4NMXA 4USIA 4Q0BA 2MQLA 5J2MA 1NJWA 1Z2LA 2GJIA 1R8CA 2I9SA 2YKPA 2VFVA 3UW1A 4M95A 2NQPA 5HANA 2IRUA 1KVIA 3D28A 4X4VA 3NGTA 4KQZA 2CNOB 3T5KA 1VYAA 1MW7A 3PO4A 3FSIA 3TARA 1HW8A 3KJFB 4EI2A 4ED2A 1Q81T 2I0XA 2OD6A 5C25A 3GB0A 1VGYA 2L9DA 1YRTA 2CQBA 2FC9A 5ETKA 1PIEA 3LALA 3OL6A 1RT1A 5B0EA 4KV8A 1WOPA 1VIOA 4JI2F 1WC1A 2V2ZA 4YHHF 3W5XA 4ZPDA 3M8WA 1XNRF 1RTIA 3HZEA 1FWLA 3IM9A 1H73A 2AD9A 2A2DA 2JL9A 3I82A 4KSEB 2DNYA 2UXDF 3MMAB 3KJQB 2M8HA 3I56S 2IC3A 4NA1A 2W7OA 2LA6A 3QPIA 5F8LA 2KVQE 4KFBA 2UXBF 1NJXA 2DEIA 2HEKA 5LSRA 2WK4A 3CDUA 3MHYA 1HI0P 1OSCA 3UCUP 4ETZA 3DLGB 1KC8T 4Y28C 2V4JA 1CS4B 5L46A 3GG1A 4A48A 3RRKA 5CH7B 2XWYA 1C1BB 2V67A 4OFZA 2JFKA 2Y3YA 2XMMA 4G6VB 3MMCA 3CJQA 1YJNS 4ZK7M 2DBBA 3BGLA 4OJHA 3QJJA 1NB7A 3MF5A 1FEHA 2WONB 3NGKA 3LPEA 3VGUA 5DLFA 3UQSA 4KTQA 1DFDA 1I51B 5D8HB 1WI6A 2QLFB 2NYIA 3T6BA 5M2RA 3X3UA 2QSFA 4IH6A 4Y2AA 4XTTA 4C2MA 2N3LA 4ED1A 1EX8A 2OI2A 5MAOA 2B51A 2DTJA 3A8IA 2KG1A 4K8RA 3M8SA 1LQ9A 2RDIA 3EGZA 2DK2A 3RB3A 3VCDA 3MCSA 3OR2B 3O3LA 4LMZA 1RLCL 1Q7LB 2EKYA 4ZJQA 3P96A 4NA3A 4RU9A 3GLJA 1D8YA 4FXDA 4HHUA 1OY6A 3TQ1A 1RCOB 2VQEF 4LUBA 1JWWA 2VBZA 4K0KJ 1SKSA 1A0OB 2F65A 1FJGF 4O44A 3W2VB 6FD1A 1OYEA 3MM6A 3OFFA 2AP6A 5FDLA 4B3MF 3H59A 2WSFC 2XO7A 3OTBA 4GKJJ 1DQAA 1K0VA 2J0QD 3UD4P 4RL1A 4GVBA 3BQ0A 4NLUA 4YDDB 1RXOB 2IHR1 1IBLF 3BQ1A 1AUDA 1G4CA 1NLKL 1ICEB 4I6AA 1U1OA 3V81A 3EMTA 2KXFA 3BGRA 4IFYA 1KWMA 4J7CA 1RT2A 1RTHA 4LR7A 4CNZA 2RKIB 1W2IA 1IKWB 3GQCA 3HM9A 1UWAA 2B6AB 2QV6A 3L3CA 2F9DA 4BCAA 2DXFA 2CUYA 4NYOA 3K2YA 3I5BA 3L7UA 3D6FB 2I8EA 3PYEA 1H2UX 2RS2A 4RW4A 3T5HA 2IDEA 4RR5A 3GV5B 2ADBA 2FZCB 3MM9A 1WHXA 4UOHA 1SL2A 1VRUB 4A8OA 1M5KC 3TEGA 4C4WA 1LK7A 1T03A 1S1TB 3VAFA 1Y5LB 3W61A 4DLEA 1TUVA 3GR1A 2CDRB 3JS9A 3MEGB 1U6BA 3CCZA 4DR2J 1TFWA 2VPWB 3SV4A 4PQUB 3WHIA 1D1UA 1RAGB 3QRQA 2QA1A 2JEJA 1N36F 3RRHA 2EI5A 3BKUA 3DI6B 4OYOA 1R8AA 5GVQA 3IRWP 1F2GA 4O0NA 1KEKA 2HIYA 2AF6A 3I0SA 4LF7F 2LP4A 2BJEA 2GQ2A 3TNVA 1XMQJ 2GVDB 4F04B 1N5TA 4I0WA 3ZZUA 4X64F 3I0RA 2ZE2B 1ZTWA 7FD1A 1TK8A 2CQGA 2YH1A 2VPZB 5I3QA 3DFEA 2YKQA 2HS3A 4Q8EA 1VHFA 5K8OA 4CRJA 1S1XA 1SQFA 2BKOA 4EZ9A 2IA0A 3D54A 1UFWA 2QA4G 2FJAB 2I6WA 2ALZA 4PCQA 4RBUA 5ETPA 1QAXA 1S4FA 1G1XA 2U2FA 5I4MA 3CDEA 5ADZA 4U7CA 1GT8A 5ETRA 2I38A 3GE9A 4O3RA 4LR9A 1HLWA 3E2EA 3H4BA 1N33J 3D3BJ 1JLCB 3QSIA 4CO0A 4HH1A 2HHHF 2EWHA 4H4KA 1NM2A 4I68A 1RT4B 2MHEA 4OJGA 2DR5A 7FDRA 2NLWA 4UOGA 3KHGA 3T1HJ 2KKHA 2BQUA 2H1YA 4AT1B 4PUOB 2KU7A 1SKUB 2DISA 4RW7B 4EUVA 3GJQB 4PEOA 3IAS9 2R8JA 3G2XA 4TY8A 5FJ4A 5HQLA 3LP2A 3RBEA 2F3JA 4CO3A 4DFPA 2MJNA 3CMQA 4X66J 4JI7J 4UQGA 1T95A 3VAHA 2L9NA 2OELA 2W4DA 3DOMB 2MSSA 1UW4A 4J9SA 2Z2MA 1IKXA 3GV8B 2OEMA 4BC9A 2CG8A 4DUTA 2RT3A 3UDLA 4EYHB 5FD1A 4NA2A 4LFCF 3QGIA 3TA1A 2DXDA 2DNOA 4ED5A 2WVCA 1IJEB 1NU4A 4DHVA 5AXLA 3OHBA 3BDPA 1CJTA 3CNQP 3BV8A 4ZP6A 1YZ7A 4JI1J 3DOLB 1IR0A 5J2PA 2QA2A 1Q78A 1JK9B 2YNFB 4CTAB 8ATCB 2LXUA 2M2BA 2CPDA 2VG7B 2HK3A 3OBIA 4FF3A 1HD1A 3HSJA 4JB8B 1L3UA 3MD3A 1LFWA 4IYQA 1UVKA 2WW4A 3MPDA 4WXOA 1CG2A 4ECRA 1Y7PA 2YTCA 4CLTA 1YITS 3RU0A 1KLMA 3SZ2A 4NLSA 1WKKA 4Q2MA 2BM0A 4P2MA 1KHVA 2HBZB 3DDNA 2NUHA 2E9TA 3SIPB 2B5JB 1P1LA 3RB0A 2RVJA 5F8JA 5GAHU 1YVFA 3QQCD 5F8MA 4X4NA 5HSPA 2XNRA 4DUYF 1TVRB 3LWMA 4Q2LA 4DPYA 4O4GA 2R8GA 3SCKE 2BACA 2MJUA 3MPUB 3P49B 3AOAA 3UE2A 4R0JA 5IV3A 1VQOS 2JVOA 3A1YG 3AXMA 4W90B 2R7WA 2DYAA 4DS5A 2JLFA 1CJVB 3CO0P 5KG0A 4DR7J 2HKEA 1XMOF 2BANB 2C2NA 5KTQA 1NK4A 1C2PA 4PXBA 1DQ8A 4OHWA 4CQ1A 3DDKA 1OWXA 2ROGA 1RWNB 2Z8QA 4HYKA 1WI8A 4I6WA 3ONQA 4PXCA 2YPYA 2V8HA 4C98A 2BXJA 4WZQA 2OPQB 1A7GE 1X4DA 2C2KB 4HDGA 1DZ5A 5H9FJ 4YR2A 3G82B 3K5OA 2XZTB 2K2PA 3E8OA 3HDSA 4DN9A 1HBMB 2E1AA 1Q53A 4FBUA 4OI4A 2BZ2A 4ZOSA 1BUXA 4C8LA 5EWGA 1RT6A 3IG1B 4FYVB 1S12A 4V19J 1S9GB 2W8KA 1R89A 1QDUB 1SIZA 1RKIA 4JP8A 4ALZA 2CPXA 4RUBA 2WB4A 4DLGA 2XSJA 2KRBA 5L9NA 4DZDA 2NPIA 3C14B 4DG1B 2YWEA 4CYUA 1FESA 1UFKA 4A47A 3N6MA 3CCJS 3PIOQ 1FKAF 1NKCA 2PDAA 3M8PB 4OZJA 2DNQA 2KT2A 2ZH2A 2GMHA 1WSRA 2GCFA 3RUBL 4DR1J 4NCGB 2HZAA 2WBRA 1S9FA 1F1BB 4NLTA 2VC1A 3DYAB 1FDDA 2E5LJ 2G1DA 2CQPA 3QRRA 1QM9A 1UZHA 3T19A 3P3DA 3WQPA 3NS6A 1RWMB 2OP5A 1OM2A 4LQ3A 3Q8YA 2ZOFA 2ATCB 4ZIWA 4WFXA 2ZH9A 1HNZJ 2BE7D 1NPRA 4M5HA 4V1Ak 1Q16B 2VBXA 4ZVGA 4C48A 3BSNA 2M4MA 3TAMB 1BXNA 3TVKA 4YFUA 1TUWA 4GRSA 1O6XA 2RU3A 3SFUA 1MMNA 1JJ4A 5HAOA 2J9DA 2OSQA 3EUNA 3B6BA 4LSNB 3LUYA 1N0UA 1IWAA 2ZJRQ 2HZVA 1GEHA 2XQCA 4DQRA 1NHVA 1HFEL 4WIQA 1XR6A 2P6SA 3MMAA 2NXJA 1FRHA 4L3KA 3TA2A 3HHLD 4MIWA 3ZC4A 2EFPA 3GIMA 3MWBA 4TY9A 2DNPA 2FYXA 4KHPF 3CULA 2QFIA 3T5JA 4C9DA 5DQGA 1V9OA 1V3ZA 4DZ6A 2KHCA 4PG4A 3DLGA 2LEBA 3HHDA 1CS4A 3M4XA 3MEDA 1RT5A 2MPUA 3TOQA 4NZ7A 3P8BB 3G6VA 3LW5C 1C1BA 3QZ7A 1ELOA 3RW6A 3KK3B 2VU5A 4QYZJ 2GVZB 5E3AA 2ASYA 3QIPB 1W26A 2I5JB 2UP1A 3KMQA 1NK8A 4MK8A 1QTNB 1JXLA 1N4LA 3EICA 3KDNA 3HT0A 2C42A 2EPIA 2WONA 1Q7YT 1YBUA 3M8QB 5DM7Q 3NOGA 3KK2B 4KKOB 4JI6F 4QU7A 1VQNS 1ZYQA 5DETA 1IWGA 2HVIA 4ZP9A 2B4UA 2KG0A 2VFUA 4AD6A 4X4QA 4ETXA 1WC6A 3NMRA 5D4NA 2B0GA 1VQYA 4A4JA 3L95X 4CDIA 1ZAVA 2HAFA 1KTVA
chains in the Genus database with same CATH topology
3DOKB 5K8MA 1RT3A 1VQKS 3J7YU 4NLXA 3NG8A 4XDDA 5DDQC 3V81B 4C8YA 3BGRB 4IFYB 4C8KA 3D1OA 3HVAA 2YQ3A 4LT6A 1RT2B 3L7OA 2BM1A 2BYCA 2UUCF 3OL9A 3EZ5A 1RTHB 2OIHA 3R1HA 3Q2TC 4U6PA 1U09A 3OR2A 3PM9A 5KT3A 5A8KB 3N6LA 2XY7A 1YJTA 3M6UA 3WZ0A 3CVKA 1TKTA 2H5EA 1LWFA 2IRYA 2M5YA 4J37A 5IXUA 1WWHA 4DR7F 2GA7A 1WEZA 1M0SA 3GWCA 4IR9A 2J0XA 4IG3A 1VC6A 4YP3A 1QLNA 2CZ4A 5LMNF 1S1VB 4WF9Q 1Q8LA 2ILZA 4WFYA 3MEKA 3T9ZA 4WE1B 3QGPA 1HW9A 2J6SA 1WHYA 3IG1A 4K4TA 5GAHI 1FK9A 3CCWA 3OTOF 3T1AA 1BQMB 3BM7A 1FF2A 2FHJA 4UY85 3OL7A 4MKAA 3QAEA 1DJ0A 3UNGC 2VG6B 3QAUA 1R8HA 3TRGA 2HHUA 1FRKA 5KFIA 2DGQA 5A0YA 4CI0B 2J5AA 1HWKA 4WK3A 1DLOA 2AW0A 2VL1A 4ED7A 3BR9A 1FJCA 3I4HX 4RW4B 3E01B 4ES3A 4DJBA 3W2VA 4HKQA 3HHKA 2ZZMA 4M1KA 5J1NA 5KFBA 2HMIA 1S1UB 3MM9B 3OVBA 4I2QB 1E6VA 2EFVA 4KO0B 3MM8B 1LWCA 4PXEA 3OFGA 1B0PA 5CA5A 4H4MA 3DM2A 2MKCA 5F8IA 1R8PA 2R7RA 2HHXA 4OQJA 4CT9A 1F9FA 1XERA 2HQ3A 5I3UB 2GO9A 1SL1A 1T03B 2ASJA 2VV5A 2JX2A 3OXLA 3UR3C 5B0BA 2VONA 3CIZA 2J9DE 1LXJA 1CEZA 5LXRA 5LJ3Y 2QEXS 2FGCA 5HO4A 4YDXA 2J7WA 3JYTA 3BREA 2M7SA 3J7A1 4RWXA 5HP1A 3MXHP 4OHYA 5AXNA 4XIUA 1P8GA 4MK7A 5KG2A 1GX5A 1L5UA 3G8QA 1UJ6A 4G1PA 3IWLA 1NEEA 1HQUB 1Y3KA 2Y0SD 3PJWA 2ZJPQ 4DL6A 4ECVA 4NCGA 3V4MA 4BHQA 3MAHA 3SV3A 4LJMA 4RBTA 2M3DA 4MTPA 2G0CA 4ES1A 1S0VA 1NO8A 3DYAA 2L41A 5DG7A 2OTLS 4ZPBA 2E1MC 3PFEA 4DSLA 2XZ2A 2Z4PA 1KOOA 1TKXA 5HQ8A 1IKYB 4TQSA 4F67A 4DFMA 1IKWA 3KHHA 2DT9A 3AQPA 2B6AA 5KFTA 1KRPA 2CVIA 4Y2KA 4FF1A 4KB7A 4YB1P 3RR8A 1T05B 3B82A 1X5TA 1QVFR 3CCMS 4QR2A 4AFFA 2DRBA 4L72B 3I0SB 4OLOA 3PKYA 3MPYA 2YKMA 5KG4A 2HNYB 1E6YA 2FLOA 5HMXA 1QUVA 2ZKTA 3G6XA 2X51A 4JI5F 2KFNA 4FZVA 3D1QA 4YUDA 2RB7A 2FVQA 1KR4A 5DRKA 2YH0A 2HGMA 5IS2A 2OPRA 2LDIA 3V4IA 1JNRB 1UAWA 3SSQA 2C3OA 5CHCB 2UVRA 2VG5B 4CIOA 4AXIA 3WDOA 3TR5A 2VQFF 3GFYA 4PQAA 5CYJA 1MWZA 4NYZA 4CO2A 1K1SA 4B9NA 1C0UA 3NS5A 2ZHBA 3OR1B 3PHEA 3MUVP 3RAQA 1JKHA 1FNOA 1U47A