1RA7A

Poliovirus polymerase with gtp
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Genome polyprotein
publication title Structural basis for proteolysis-dependent activation of the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
total genus 144
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1ra7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ra7A02
5FDLA 3BQ1A 2XI3A 4ECVA 1D1UA 2FJVA 1TV6B 1HNIB 1RYSA 1S0OA 4XPCA 2BANB 4LSLB 4J9RA 1VRTB 1JLQA 2RF2A 3DLGA 2W9BA 3IRXB 1JKHA 1N5YA 4RW4B 3LALA 2HNYA 2R8HA 5L1IA 2VG6A 4IKAA 1RT1B 4Y2CA 3QZ8A 1N6QA 1C0UB 1IKXA 3GV8B 3G6XA 1REVA 4KKOA 4ECRA 2D41A 4G1QA 4O3NA 4Y2AA 4EO8A 4I2QA 2BQUA 1TL3B 3KMQA 3M9NB 3KHGA 3OL6A 4DG1B 2IA6A 4IDKA 4WE1A 2UUWA 1GX5A 4KV8B 3OL7A 3H5XA 2VG5B 3CDEA 3MEGB 4IFVA 5KT4A 3JSMA 4F4XA 4ECTA 4DL5A 5KG4A 3DRSA 2CJQA 5KFVA 1SV5A 4NCGA 1U09A 1JLEB 3QGGA 2OPQB 3KNAA 3MEEA 4KFBB 1S1WB 4NYZA 3HHKA 3BGRB 3LP1A 3KLEA 4WXOA 2V4RA 3MR5A 4TN2A 5KFGA 5F8LA 2YKNB 4H54A 3DMJB 3MFIA 5DG7A 4IG3B 5KFEA 1LWEA 1SUQB 2GC8A 4TXSA 1MU2A 5KFCA 3V6JA 3KHLA 2EC0A 1NNDA 5J1EA 5EWGA 1R0AA 4Q0BB 3E51A 5JXSA 1S0MA 1JLFB 3RB4A 3KLFA 4URSA 1C1CB 3BSNA 4YP3A 2YNFB 5KFYA 3HVTB 4HYKA 1RTDA 1S0NA 1ZTTA 5HLFB 2VG7B 4H4MA 5KFMA 4I2PA 3NMAA 3H5UA 1S9GB 2IAJB 3I0SA 2OPPB 3DOKB 4IOBA 4Q8FA 1JLBB 1JLGA 2JEIA 3FFIB 1IKVA 2WOMA 4LSNA 3QLHA 4URQU 1RT2B 3C6UA 3DI6B 4H4OA 4KO0B 1S1VB 1TL1B 1UWBB 1TP7A 2YNHA 1FK9B 4ZVGA 2FLNA 1S48A 2HWIA 3E01A 1HNIA 4IH7A 2BANA 1BQNA 1S6QA 5DGBA 3CO9A 3ITHA 1QE1A 3DOLA 4Q8EA 2UVUA 2YNIB 3Q8RB 1XR5A 4ID5B 5F9LA 4FS2A 2ASJA 2R8KA 2ZD1B 1S9EB 1S9FA 5KG0A 1EP4A 4J9MA 1RT3A 3HVAA 3KLIA 5FDLB 1JLAA 5KG3A 3Q8SB 2JEJA 4FBUA 5DLFA 2W9BB 5I3UA 3ISNC 4QPXA 4K4YA 2I1RA 4ED1A 2HNYB 3RB6A 5L1JA 3GIKA 1N6QB 3UQSA 1LW2A 1REVB 4DL6A 4KKOB 3LP2A 1HNVA 1HMVA 1RTHA 4G1QB 5KT5A 4DL4A 3G6VA 2IBKA 3H2LA 4LQ9A 3H5YA 4I7FA 2XCPA 4FBTA 4QWEA 4ZPBA 2AU0A 2W8KA 1XR6A 3H4DA 1RT5A 5KFDA 3V4IB 4PUOB 3QIDA 4IDKB 3BSOA 4WE1B 5HROA 4X2BA 1SH3A 1N4LA 4IFVB 5J2PA 3JSMB 5C5JA 5T14A 3DRSB 3PR5B 2YNFA 4NCGB 3Q8PB 1S1XA 4QWBA 5KFJA 1RDRA 4ZP8A 4MK7A 2W7OA 3KLEB 4TYAA 3LP1B 3GYNA 4IRKA 3QGIA 2QE5A 4NLVA 1JIHA 3VQSA 1JLBA 3FSIA 1YVFA 4RUCA 3V6KA 1R0AB 1MU2B 5KFIA 4F50A 1DTQA 2HNZA 1S10A 4RNFA 3KLVA 4KO0A 3IN5A 3H40A 3LP0B 4FS1A 1TL1A 3DLEA 1IKYA 3RAQA 3KLFB 2RDJA 5KG2A 1FK9A 3PW2A 2E9ZA 3QIPB 3JYTA 3KHHA 3NBPA 4H4MB 1LWCA 2WB4A 4I2PB 1IM4A 3GILA 3HVWA 3I0SB 1HYSB 4TQRA 4ED7A 2YNIA 1S49A 5KFKA 4F4YA 1JLGB 3MEDA 2WOMB 3BREA 3T19A 4K4SA 4EEYA 3KLHA 4ZVFA 4LSNB 2V4QA 3QLHB 5J2QB 4Y34A 3PW5A 4H4OB 3RBDA 2C2DA 4RNOA 3PW4A 3DYAA 3CJ0A 2C28A 2YNHB 3TQ1A 3E01B 1FKPA 4O3PA 1JLCB 4KB7A 1BQNB 1ZTWA 3OL9A 2FVRA 3DDKA 1S6QB 3ITHB 2DPIA 4YR3A 1NHUA 1QE1B 3DOLB 2W9CA 2AWZA 4IH5A 3UDLA 3EZUA 3MFHA 1N48A 4RZRA 3LAKA 1NHVA 1EP4B 3NL0A 2R8IA 3FRZA 1RT3B 3DRRB 3KLIB 2AGQA 1JLAB 1W25A 3DLKA 4IR9A 1C1BA 4NLQA 4ED3A 3C6TA 5J2MB 4ECWA 1T03A 2IM2A 4PQUA 3FQLA 4G3IA 5I3UB 3NKYA 2D3ZA 3UPFA 3H5SA 5I42B 2BR0A 4PUOA 5KFHA 4K50A 5KFZA 2IM1A 1S97A 3CIZA 4O3RA 3CDUA 5KFLA 4RNNA 5F8HA 2V9WA 2XI2A 3BSAA 3GIMA 1LW2B 1BQMB 3LP2B 1HNVB 3DM2A 1HMVB 1RTHB 2IJFA 4TLRA 2FVPA 2FLLA 4J9LA 2BQRA 4I7FB 1ZETA 1RT5B 3IG1A 2UVVA 2I5JA 3N6MA 1K1SA 5HROB 3LP0A 3NAHA 5L1KA 1RT7B 3NAIA 3IGVA 5J2PB 2ALZA 1C0TA 5D3GA 1RA6A 1S1XB 3QIPA 4HKQA 1TKTA 4Q44A 2UUTA 5DG9A 3LANA 4IR1A 4KBIA 4J9QA 2VA2A 4YMEA 5KFTA 2GIQA 1RT6B 5J2QA 1RYRA 3I0RA 1JXLA 4O4GA 1DTQB 2HNZB 3QO9A 2AX1A 1S4FA 3DLEB 1IKYB 2OPSA 3V6HA 4RW6B 3JYTB 3IGNA 3NBPB 4KAIA 4EBDA 1JLCA 1LWCB 2BRLA 5KFWA 3PW0A 2GIRA 3HKWA 4WZQA 1TQLA 5CYQB 2XCAA 3MEDB 2AGPA 4NLRA 2J6UA 3KLHB 2JC0A 3V6DA 2RDIA 1RT4A 4B3OA 4EBEA 4LQ3A 4K4UA 3DYAB 3UR0A 3TVKA 4DL2A 3DRRA 2WCXA 2FVCA 1JX4A 5F8MA 4WFYA 2WONB 1FKPB 3D28A 5HP1A 4NRUA 4YR2A 4ZHRB 5J2MA 1EETB 4JV2A 1DTTB 2B6AB 2W9CB 3OSPA 5I42A 5KFUA 4Q45A 4NLWA 5KFOA 4M94A 1LWFA 3CJ3A 4EYHB 2RKIB 4IRDA 5F8JA 4IH6A 1BQMA 2YNGA 3KLGB 3DLKB 3MECB 4O4RA 1C1BB 3C6TB 1T03B 4ZP9A 1RTIB 3OSNA 2V0NA 4PQUB 4K4TA 2JEFA 4WYLA 3SFGA 5L9XA 3T5JA 4WZMA 1HQUA 2R2UA 4TYBA 3ISND 3ICLA 1RT7A 4QW8A 5DGAA 3GQCA 3DM2B 5JUMA 4QWDA 4JUZA 2E9RX 5KFAA 5KFXA 2C22A 3PJWA 5DQHA 2XC9A 4MFBA 3N6LA 5C24A 3IG1B 4NLUA 1RT6A 1Z4UA 4O3QA 2XGPA 4MIBA 2ZE2A 3BSCA 3BQ0A 2I5JB 4MIAA 5F9NA 3CJ4A 2IC3A 3CWJA 1C0TB 1RA7A 4TY9A 3I5CA 5D3GB 2HNDA 4RW7A 4RW6A 3OHAA 2FVQA 5J2NA 1FKOA 2IM3A 1TKTB 5KG7A 3RB3A 4MKBA 4K4WA 2AGOA 3KK2A 4RU9A 3OL8A 1C2PA 3FQKA 4KE5A 5CYQA 3M9OB 3CJ5A 3IS9A 4RUAA 3I0RB 4O4GB 3MR3A 3QO9B 2BE2A 1S1TA 5KFSA 1DLOB 3H98A 2OPSB 5KFQA 1J5OA 3EPIA 5EWEA 2WONA 3BQ2A 4U6PA 3T5LA 3CJ2A 2YKMA 4ZHRA 3OHBA 3KMSA 1EETA 4NLXA 2ATLA 2J6TA 1DTTA 2B6AA 2D7SA 2IJNA 4R0EA 1TKZA 4XO0A 4K4VA 2ILYA 2FLPA 4KSEB 4EO6A 3V6DB 2B5JA 4ZP6A 5F8IA 1RT4B 4YR0A 2RKIA 4ECZA 1GX6A 2AQ4A 2VA3A 3KK1A 4B3OB 1MMLA 4IG0B 2W8LA 3T5KA 3KLGA 2WK4A 4ZVEA 2OPRA 3MF5A 4J9SA 5HP1B 4J9NA 3MECA 5KT2A 2R2RA 3G6YA 4ZPCA 1RTIA 5C25A 4O44B 3M9MB 2R2TA 1I6JA 1SH0A 5KG6A 1RAJA 4ED0A 3BR9A 2O5DA 5K14B 1KHVA 1LWFB 2CKWA 5HBMA 4Q43A 4ECQA 2ILZA 2YNGB 1XR7A 5C42B 3PVXA 2HMIA 4RNMA 5KT3A 3MR6A 2XWYA 4MK8A 1HQEA 1LW0B 3V81A 4WFZA 4OL8A 1HQUB 3T1AA 4O3OA 5EWFA 2ASLA 4NLYA 5F8GA 3GV7B 4ZPAA 1TVRB 4NLGA 4EYIB 1T3NA 3DRPA 1TKXA 2JLEA 1HPZA 4ICLA 4ZVHA 4J9OA 4WFXA 4MFBB 3KK3A 2W9AA 5C24B 1QAJA 2QV6A 4ECUA 3TAMA 5KFRA 2ZKUA 4R8UA 2ZE2B 5DG8A 4IRCA 4TY8A 4NLSA 3H59A 4PWDA 1S6PA 1VRUA 5EDWA 3RBEA 1OS5A 4GC7A 2J6SA 4NZ0A 2D3UA 2IM0A 2IC3B 4O3SA 1DLOA 2WHOA 3NGDA 1IKWB 3M8QB 4RW8A 4QW9A 3RB0A 2HNDB 4RW7B 5J2NB 1FKOB 4Y3CA 4NLTA 3QGHA 4ZP7A 1RTJA 2XGQA 3GIIA 3RAXA 3KK2B 1WNEA 2DPJA 5KFNA 4RW9A 3M8PA 4KHMA 3IS9B 2R8GA 2UVWA 4WYWA 4ZPDA 2BE2B 4NLDA 4F4ZA 1S1TB 3KJVA 4IG0A 1KLMB 2BQ3A 3H4BA 1J5OB 4ZMMA 2BRKA 3QYYA 4EBCA 3OLAA 3CDWA 2FVSA 1S1UB 4YQWA 2YKMB 1T05B 4O44A 3PHEA 2FJWA 1HYSA 1TKZB 1QAIA 2C2RA 4MH8A 5KG1A 5EUHA 5KFBA 1TV6A 5DLGA 5K14A 2B5JB 4LSLA 4R5PB 4QWCA 3Q8QB 1HARA 3FDSA 3PZPA 1VRTA 3PJXA 3KK1B 2AX0A 2OH2A 3IRXA 4ED8A 4IFYB 4RW4A 5C42A 1N56A 2OPRB 1RT1A 3G86A 4KHRA 4URGA 1C0UA 2ASDA 5C25B 5CYMB 3SFUA 1LW0A 1T94A 3CVKA 4J9PA 5KFFA 1CSJA 1TL3A 5DQGA 5HBMB 5F8NA 3GV5B 3DLGB 1JLQB 2RF2B 1N5YB 1JKHB 4WXWA 4DG1A 1TVRA 2HMIB 2VG6B 2JEGA 3I5AA 4KV8A 2VG5A 3BJYA 2B43A 1KHWA 1IKXB 2IMWP 3MEGA 3KHRA 3PR4A 1HQEB 2W7PA 1JLEA 3OLBA 2OPQA 4IQXA 3V81B 4KFBA 4F4WA 4I2QB 2UVRA 2F8EX 1S1WA 3MTKA 3BGRA 4JV1A 3KOAA 3N6NA 3QZ7A 2YKNA 1IKWA 3DMJA 3M8QA 5L1LA 4IG3A 4RNHA 1SUQA 4MKAA 4NRTA 3V4IA 2C2EA 1D0EA 4DL7A 4NLOA 3DRPB 4Q0BA 1TKXB 1HPZB 4ICLB 4ECSA 1JLFA 4K4ZA 4J9KA 4ECXA 3KK3B 1C1CA 2E9TA 2WTFA 5KT7A 4DL3A 1SV5B 3SI8A 3HVTA 4ECYA 3TAMB 5HLFA 4R8UB 5KT6A 2VG7A 3MEEB 4XPEA 4TY8B 4ED2A 2WRMA 4PWDB 1S6PB 1VRUB 3D5MA 3I5BA 1S9GA 2IAJA 3LAMA 2OPPA 3DOKA 1KLMA 3PW7A 4RW8B 3FFIA 1LWEB 1QUVA 2HAIA 1S1UA 5J1EB 1RT2A 5DQIA 3DI6A 1RTJB 1S1VA 1T05A 4MK9A 1UWBA 4GC6A 4RW9B 2HWHA 4QWAA 3M8PB 3EPGA 4K4XA 1RTDB 3T5HA 2R8JA 4DEZA 5KG5A 4JV0A 4R5PA 2R2SA 3KJVB 4TQSA 4IFYA 5KFPA 1K1QA 1IKVB 4ID5A 2FJXA 4M95A 3MR2A 1SH2A 2ZD1A 3C6UB 1S9EA 3GIJA 4NLPA 2JC1A 4U7CA 4ED6A 5CYMA
chains in the Genus database with same CATH superfamily
1NU4A 3SZ2A 3NS5A 1NJWA 2C2MB 2AJQA 2KFZA 3QZ8A 5IV4A 3TAPA 2FTRA 1MSWD 4CLUA 2VOOA 4C2MA 4OI3A 1YLXA 3H5XA 2EFPA 3EM1A 2CJQA 4OJ3A 3KLEA 4ELVA 2ADBA 3EGNA 5ETVA 3AJ2A 3TEGA 2ZHOA 2BVZA 1JLBB 2WOMA 2DHAA 1RQ0A 1T9UA 1PC4A 1E6VB 2X1BA 1S48A 3D0GE 5DGBA 2QA4G 2UVUA 3M2UA 1G2EA 4OHWA 3KLIA 2BZ2A 3J81Y 3JSBA 4DLGA 2DR7A 2N82B 1SXLA 2AEJA 1BMQB 5HI7A 3PHTA 1REVB 3LP2A 5BYRA 1VQPS 5KFDA 3J81j 2XO6A 2XNRA 4NE9C 1MN9A 1I3OB 3LP1B 5B0BA 2F4FA 3ONQA 1J2VA 1UFWA 2AD9A 4P9SA 3ZTPA 2WAQD 1Q1KA 4DR2J 4J37A 3DCAA 1TTHB 4ZN1A 1IM4A 4ZLPA 2W2PP 2FJVA 1TK5A 3KLHA 3A8EA 1WG4A 3QT8A 1HNXF 1RWNB 2DNGA 2Y8YA 2AJ4A 2CDRB 3W3SA 2ZH5A 1VHFA 4LRFA 4USTA 4NLQA 5J2MB 1TKDA 3GJTB 4YB5A 4LR7A 1OYEA 4DN9A 5ETSA 1BQMB 2H5EA 2E1PA 3D9BA 2I5JA 3N6MA 3Q8YA 4X84A 4M5DA 1RT7B 2LKZA 4PEOA 4DR6J 4UOCA 1WI6A 4IR1A 4DUTA 3EVWA 1DTQB 3CSKA 1FESA 1T9XA 3MEDB 2RDIA 2ZBQA 1MWZA 2HW3A 3CJQA 3KDOA 1FKPB 2XYPB 3ZZTA 2XMMA 2HZAA 2Z30B 4DV4F 4DFKA 2OMLA 4KGZB 2DISA 4LF5F 4A8FA 4NZ6A 4K4TA 3W9HA 4WYLA 4WZMA 2CQ1A 5L46A 4N77A 3DLBA 3AJ1A 3MHYA 4GMKA 2QJ3A 4F2RA 3R8YA 1U1PA 4CT9A 1RA7A 1F5AA 3JS9A 5IFMA 3GYGA 2PC6A 2DR6A 4CLYA 1KNZA 4QR0A 2V2VA 2VBZA 4HH1A 5HJXA 1U25A 3GR1A 4M8LA 1J5OA 1FI4A 3MD3A 1WTBA 1UJ6A 3HSGA 1R8PA 3CJ2A 3OHBA 4OMFG 1GXTA 3VZHA 3GJRB 1ZM2A 3OUYB 3V6DB 1ZAWA 4ZPVR 4ZP6A 3R5DA 1HNWJ 2W8LA 2I38A 3GFYA 1QSLA 4LF7F 5A8KB 1LXNA 3CCUS 1O8BA 2WW8A 4LIWA 2KVIA 1TL4A 3K5PA 3EJMA 3RRHA 1PAUB 3GJSB 1M5SA 2XZ2A 2KXFA 3G87A 3MZIA 4X66F 4ILRA 4KGKA 1KD1T 4KYZA 4NZ0A 2D3UA 4N41A 1P1TA 4JI0J 2X51A 4ZP7A 2DPJA 2RS8A 1EB0A 2K06A 3Q89A 4IG0A 5L39A 2DRBA 1IQTA 2JOQA 1RWWB 3SDEB 2CA9A 3KK1B 3ADAC 3R9LA 2OPRB 2J7WA 2XNQA 3OVBA 1TFWA 2YPYA 1NKBA 1N34J 2CJBA 3PKYA 5IV3A 3UWTA 2H5IB 3UD3P 1VQMS 2GJFA 2HWTA 1FJCA 1V3RA 2W2QP 4K0KF 2PEBA 3F73A 3L7UA 4JI7J 1CS4A 2DGWA 4HT5A 4OX9J 3BPSP 4ECYA 4U96A 2IAJA 4QIWD 2Q66A 1S1UA 5DQIA 4KRWA 2XQCA 1NBEB 4KGXB 4C3KA 3KJVB 1FE4A 4ID5A 5GMDA 1SH2A 2ZD1A 3KUEA 1RKIA 2IY5B 2NPIA 1MROB 2BANB 4LSLB 4CRJA 4DR4F 3EYZA 2ACYA 2E7WA 3SCJE 1PYSB 1ZPWX 1X9WA 4PXCA 4Q2MA 1SJ3P 4DSFA 4WE1A 3OL7A 3OVAA 1EHWA 1WHXA 3MEEA 4KFBB 1KTVA 4ETXA 4IG3B 4CZCA 5KFCA 3T41A 3KHLA 3CD5A 3BN4A 4P72A 1JLFB 4B3RF 2RAQA 3RRKA 1RTDA 1ZTTA 2DNYA 3HF5A 2ZM6J 2JH3A 3A3NB 4PG7A 1TL1B 5GAHU 1N33F 2HHHF 1WG1A 4FYXB 4FS2A 1LNQA 2NXJA 1QJHA 5LT5A 2JEJA 4DS5A 1X60A 3DKDA 1UCNA 2LXFA 4G1QB 1HBMB 4ZJOA 5CAAA 2XCPA 4ZPBA 3KXDA 2W8KA 1ZM3A 4X2BA 1NJZA 5CXTA 3PR5B 3OVSA 4XTTA 5T7LA 2MLYA 3Q83A 3BO2A 2QG9B 2OO4A 2XTDA 2G0CA 3QIPB 3NBPA 4Z37A 4EEYA 4OJHA 3CNQP 3IRWP 2YNHB 3TQ1A 2VU5A 2MQ8A 2W9CA 1AUSL 2M4MA 3TUZC 3MXHP 3ZNJ1 2AF6A 1RT3B 1JLAB 5DRKA 1M5HA 2RVJA 4CP5A 1UEKA 2JVRA 1V3SA 2VONA 2X3GA 1C0TA 2OD4A 1Q5VA 1RCOB 3MMCB 1RHQB 4C8LA 4YDXA 1MW7A 5HATA 1AYEA 3VGVA 5A8WA 2JRSA 2OFGX 1IVZA 4FYDA 4B3MJ 3ILIA 4J7CA 2X1GA 4CM2A 1UAWA 1FNMA 4NYOA 2KYZA 2RKIB 2BJDA 1F2GA 4O4RA 5F3TA 3OSNA 4Q2LA 1ZM9A 1DHMA 1IUJA 4M5HA 4DV2J 5DQHA 3TUJC 4IO1A 4TU9A 4FPRA 4JI4J 3CD7A 2IC3A 5GAEI 3W1YC 2J0SD 3OHAA 3THTA 1TKTB 1FE0A 3KK2A 3OL8A 2MQLA 2NXUA 4W98A 2YKQA 3EE3A 2DNHA 1PG5B 5M2UA 4FKYA 2GMLA 4XO0A 3NWRA 5C7PA 4F8RA 2VQEJ 4L3NA 1S79A 1JMTA 1DAXA 1R31A 1TELA 5KG6A 3RYLA 2R7UA 2QZ8A 2CPJA 1HL6A 2ILZA 4RNMA 1NMEB 2B7CB 1SKSA 4KH1B 1ZOTA 3J7ZT 3ET6A 2G9OA 3GV7B 3IBCB 3LPEA 1RUSA 2DIUA 1IR0A 3VAKA 4LSZB 3TAMA 4Y00A 3RB0A 1S5ZA 1N5TA 1WDDA 4NLDA 1X0PA 2HBQB 4ZMMA 3SSSA 1R8CA 2VC0A 1IBMJ 2ZUGA 4O44A 1BXNA 2FUG9 3M1VB 3PJXA 1R89A 3IRXA 2KXHA 5EHHA 4ER8A 4CO3A 2GJ2A 1FNOA 5F8NA 2MY7A 2XMTA 3DDNA 3MM6B 4F3OA 3PR4A 1O51A 2AJ0A 5ITHA 5K5MA 1FFWB 3V4IA 2YTCA 1OSDA 2DNLA 3KK3B 2WTFA 5ETOA 5KT7A 4HACB 2VG7A 2LQ5A 1WC6A 2QL5B 2FY1A 1Q7LB 1GH8A 1RTJB 4NXMJ 5JMNA 1CJVB 2X7IA 4DEZA 4ZK7M 1T8EA 5EX3A 1IKVB 1UVIA 1WORA 4DX7A 2OAUA 4ED6A 4E8UA 2OHDA 4LF1A 4AFFA 5GAGU 2QA2A 3G6XA 2JWNA 4I2QA 2BQUA 5LOQA 2VKRA 4AQYF 1NK4A 1LWXA 3MEGB 3JSMA 1QVFR 1U09A 4I6YA 1AFJA 4NYZA 3HHKA 2V4RA 4NI2B 4P2SA 3MM8B 2UUAF 4AL5A 3VTIA 2XMWA 2ZVSA 2KFYA 4X64F 2CYYA 1VMBA 2V2QA 1LKZA 4DQSA 1DQ9A 1GMVA 3IM9A 1S9GB 1M0SA 4I6WA 1NSAA 2A18A 5ETLA 3QATA 1U6ZA 1PCAA 4OYPA 3I4HX 7FD1A 1B3TA 1VQ9S 3QT5A 4AD6A 1KRPA 5FDLB 4A4JA 3C14A 1CLFA 5DLFA 4WCEQ 1FEEA 4H4KC 4FDFA 4DZDA 3WIVA 1YQHA 3DNCA 2ZH1A 1O0PA 1DARA 4HLBA 4IFVB 1U2RA 4ZP8A 1XWLA 1UW4A 2ROGA 2XHCA 1JLBA 3UD4P 5LJ3Y 3H40A 3HM9A 1IKYA 4H4MB 2B8QA 4I2PB 3IWXA 1R8AA 3QWUA 5IM0B 5C2GA 3DYAA 4DQIA 2CPDA 3GG0A 3ITHB 4HR2A 2VDIA 1LFWA 1NHVA 1WSRA 2QYGA 4UQGA 1NK0A 4OZNA 5KFLA 1XK8A 1XMOF 2IJFA 1NK6A 2R7OA 3Q24A 3TYTA 3F41A 1K1SA 1HWIA 1U2FA 1RA6A 4U8YA 2E44A 3TP2A 1WDTA 3BDEA 3MR7A 4UY8T 1RZMA 2R4FA 3MCMA 1UEVA 3HXMA 3AA8A 1U48A 2CQPA 5F3ZA 2F7VA 5HJYA 2BKOA 1LK5A 3DGPA 1JX4A 4MIWA 4F7VA 5J2MA 3N79A 4CO4A 4EYHB 2VF3A 5I3PA 4LJMA 1B0PA 1GMWD 3SCKE 1BQMA 4BS2A 2DXFA 2IIHA 1RTIB 4PQUB 2JEFA 4I56A 2R2UA 1LQ9A 1RT7A 2YQ1A 2LYVA 4JUZA 2JNJA 2EW9A 2FJDB 2ZBRA 1SQGA 3NGRA 1K8AT 5C24A 3I32A 2G2OA 3I5CA 5D3GB 2UV8A 2R7WA 4LF5J 1F3VA 1OPZA 2CZVC 3H98A 5EWEA 3T5LA 1IQZA 2XZWA 5IOLA 4CM0A 4FKXA 3SQOP 2OFHX 3FEZA 2WK4A 1HBOB 2DGVA 4LR9A 1SC6A 3CCMS 3B8HA 5IQQA 4ZCIA 4I6AA 4KHPF 2EKYA 2Y9HA 4WFZA 3VCDA 2J5AA 2K1RA 3CDAA 1HR0F 4C7QA 5CH7B 2JLEA 2VC1A 2ZNYA 1G7CB 2ZKUA 4LF7J 4GC7A 4QW9A 2Z57B 1FWLA 1H2UX 2LMIA 4OX6A 4KHMA 3OUYA 2E1CA 5IWAF 2BRKA 1JQGA 3M6VA 1T05B 4X66J 1HYSA 2VOPA 4DFMA 1T3NA 1DRZA 4QZVB 4URGA 4NCBA 1Q78A 3TVZA 2KU7A 5HBMB 4DG1A 3DXSX 2VG6B 2B43A 4OZLA 5LSOA 4IQXA 3MM9B 1SI9A 2LA6A 3KOAA 1U2CA 3QZ7A 3NCQA 1AW0A 1F5CA 4HHUA 4XPEA 4TY8B 1RU2A 3D5MA 3DOMB 5I3QA 4LRBA 1R6YA 2HAIA 5D77A 1WWHA 1U49A 1EKRA 3A8IA 4K0KJ 4USHA 2OD6A 5KFPA 2Y3YA 5FLXY 5T41A 2DGOA 1CPZA 3P45B 2ZH4A 1PJ5A 2I8EA 3BYPA 3EGWB 1UVKA 4PG6A 2ERRA 4WU3A 2KRBA 1FFGB 3SQGA 8ATCB 1UEUA 2P6SA 4JI3F 2VG5B 5FJ4A 3ZTOA 1YHQS 1JLEB 2DNMA 3MPYA 2UXCF 3CJ8A 3U1LA 1VQSA 3QT7A 4DR4J 2EK6A 2KJVA 1NNDA 2M8HA 2CNKB 1P1LA 2DRDA 1C1CB 1T9YA 3SEOA 4Q8FA 2JEIA 4A48A 5ETMA 1X4AA 3NGKA 1BQNA 2BANA 4UZCA 3CO9A 3QJLA 2PMWA 1NK8A 5KG0A 2FZKB 1EP4A 1YI2S 4B3RJ 2MSSA 2ZH2A 4P2FA 2DCUB 4DV5F 1YJTA 5I3UA 3HCXA 4NA2A 1IR2A 1RWXB 4M5LA 1LW2A 3MUTP 3CCWA 3LTOA 2F9DA 1N33J 1U4BA 2HHHJ 1QM9A 3L9ZA 1EKSA 2ZJRQ 3SMZA 4B9SA 2B3TB 3FKBA 2ZH3A 1GMWA 3CCRS 4ED4A 1TL1A 1FVSA 1VIXA 3GILA 1OM2A 4EK2A 2RDDA 2KFNA 2V5HG 1NAQA 2HGNA 4H4KA 5HVHA 2A3JA 3J7YU 5EGYA 4KY3A 2HK3A 4USKA 4OX7A 1SJFA 4P74A 1UZHA 1HBMA 3V2UC 1PAEX 2XLKA 3I87A 3CCVS 4QYRA 2V9WA 4QR1A 2ABYA 1N54B 1FKAF 4M5JA 3T1HF 2K7JA 2VPYB 5J2PB 4DI6A 3QIPA 2KKHA 2VL1A 1PYOB 3W2VA 3GSDA 2DEJA 1S72S 2CPYA 4WZQA 1TQLA 3TWZA 2PI5A 1S12A 4J5OA 4LQ3A 4CLFA 2FVCA 5E3QA 4A8KA 4WIQA 2H4WB 4YR2A 3N5FA 4HEA9 2F3JA 4NLWA 5KFOA 2HVHA 4K59A 4IRDA 4L73A 4DV0F 1KFDA 2G0IA 3HK2A 2FGOA 5K8OA 2HRUA 1T03B 2BDPA 2ZH8A 3M6XA 4KT0C 4CWBA 3QRQA 2DYAA 1N5QA 3QT6A 5JUMA 4A8MP 3V4MA 1H7XA 2C22A 2P8IA 3UE2A 2XS7A 4O3QA 5F9NA 2FVQA 1AFIA 3POTB 2VIHA 3CD6S 4FP9A 4OHZA 3M9OB 4RUAA 1VGYA 3HVRA 2OPSB 4NLXA 2FLPA 2RKIA 4F25A 1GX6A 1A7GE 2CJKA 3FRYA 2VFRA 5C25A 2V8DA 3TARA 4B9VA 4NMXA 5GMEA 2MGZA 1FXDA 4PRFA 5C42B 4N56A 3GFZA 4L72B 5AXKA 4DZ6A 5K8NA 1VIOA 3T1AA 5EWFA 4NEZA 2QLJB 3P5BP 3HSZA 1KQFB 2B9WA 4WFXA 2HVEA 2BXJA 3TQEA 2GAHC 3RBEA 3TA2A 1D3WA 3ZXWA 3WX8A 2DGQA 2BE2B 4CLLA 5D0GA 1TMJA 3PRBA 4TKTA 2VPXB 4W92B 4TU7A 2G13A 1TKZB 4MH8A 5KG1A 2HHPA 1HARA 3FDSA 2DTJA 1F9EB 3HD1A 2DGXA 2HBRB 2CDQA 2FZGB 1L5UA 1S4EA 5DQGA 3NS7B 3DLGB 2RF2B 1IKXB 1MWQA 3UCGA 1U02A 4X4RA 1VCTA 9ATCB 3N6NA 3OTCA 4RNHA 3FCWA 2MZJA 1RK8A 5HLFA 2XBPA 2KHCA 1S6PB 3CCZA 2RRBA 1LWEB 1ZYQA 3DU6A 5AXLA 5J1EB 1S1VA 4RW9B 3M8PB 2CXEA 4K4XA 1REGX 2UUBJ 3M1VA 2L3MA 2NR0A 4RBTA 4NLPA 1XIQA 2NQPA 4P6QA 4LBHA 2OMOA 4RW4B 2BJ7A 3MCOA 1FDNA 1N6QA 4JOUA 1UJ5A 4Y2AA 4OHYA 2VBWA 1UMJA 4YB6A 3KMQA 2YQ3A 3M7VA 3KKFA 3D67A 5KG4A 2B51A 3VAIA 1WC0A 4FZVA 3BPDA 2IA0A 2YKNB 3MFIA 1SUQB 5GMKa 2EC0A 3D4JA 1I1GA 4YP3A 2GGPB 2ZZMA 1VHIA 1HBNA 2CQCA 3H5UA 3QFWA 1IKVA 4AQYJ 1JXVA 1TP7A 4RPFA 3IXQA 1RKJA 1X5PA 2RUGA 5LSRA 2UUAJ 2ZOGA 1S9EB 3QJJA 3HVAA 1OO0B 4X64J 2L08A 3W66A 1U1OA 3W5YA 1AZSA 4KKOB 1HMVA 2J9CA 2PN6A 3OT9A 2MJUA 1XR6A 3MM8A 3ZZZA 1IJFB 2KJWA 2W7OA 3GYNA 2MY8A 3L3CA 2DHXA 4NLVA 4FF4A 3H0PA 5KFIA 2E5GA 1WELA 5KG2A 2MJNA 1LWCA 5HSPA 3MPUB 5KFKA 2OTJS 2ZNZA 2FJBB 4H4OB 1JK9B 2C28A 2EG1A 2F65A 2KI2A 3NEKA 1Q82T 5L38A 4IH5A 2G1DA 4KJIA 1HBUB 1EQMA 4ED3A 3R5JB 4PXDA 2RH3A 1HI1A 1IBLF 4NCAA 2IM1A 3SV3A 1KOOA 3IBFB 2AT1B 1RU1A 2B8PA 1WJ9A 1ZETA 3RW7A 3W61A 1CC7A 1FRKA 2UUTA 1HWKA 1Y5LB 3MMAB 2HNZB 2CNLB 3PX6A 1XMOJ 3OFEA 2W2MP 4ILMA 4RU2A 4HHHA 4C8OA 1N32F 2FDNA 2J9DA 4F0MA 1OSCA 2HVZA 3HFZB 2AMCB 3QSIA 4QBUA 2ZDOA 4HL9A 1F3FA 3PYEA 3UN3A 5HMWA 1JJ2R 4F0HA 5IC4B 2BJ1A 2B4OA 2NSCA 4CQ1A 4U8VA 4NLUA 2A1BA 3A1YG 3PM9A 3QAEA 5F0WA 3CJKB 4JI6F 4CH0S 2KM8C 1C2PA 2VFTA 4AL7A 1ZZFA 2KL8A 2NXEA 2J6TA 4R0EA 3CUNA 1RT4B 3IAS9 2XLIA 2EFVA 4RWXA 2HS4A 5MAOA 4F4AA 1RTIA 2GA7A 4OFZA 1VQNS 3CW2C 2YNGB 2QT7A 3G4SS 2HMIA 2MQMA 5KT3A 4QYZK 5AJ3F 1VDHA 2V63A 4NLGA 4C8NA 2MB0B 2HIYA 4J9OA 1TL5A 4MFBB 1T02A 4LFBF 1WTFA 1LFPA 3NOGA 3TJAA 3H59A 1SPBP 2AJFE 4RW7B 2K8GA 1HA1A 4KHPJ 3N5BA 1WEXA 4ZPDA 2GVZB 4C3MA 1KVIA 3CDWA 1HR0J 1HBOA 2FQQB 2N7YA 1Y00A 3RW6A 2JLFA 4PZVA 3EDRB 5CZXA 4QWCA 4R5PB 3MAAA 2OH2A 2BW7A 1WC3A 3D7SB 1R27B 1ZM4A 3DRXA 1U26A 3AHPA 1JKHB 3VR1A 5IWAJ 4B9UA 3TA1A 2C2OB 2VKZG 1SQFA 2FPHX 3NP5A 3W2WB 3C46A 2DGUA 4LBPA 1HPZB 2DVIA 1I51B 3HMJG 3SI8A 3HVTA 4R8UB 4CI0B 2OPPA 1SJQA 1H74A 5F41A 1GK8A 3DI6A 1T05A 4GC6A 3EDQB 3H8YA 4WJBA 3TZZA 2RILA 4NX9A 3FBCA 2CQ2A 2FJXA 8AT1B 1HHTP 2JC1A 3CE8A 2BX6A 2XI3A 1UWAA 3WDOA 2VG6A 1NB2A 5DZ7A 1RT1B 1HD1A 4NZ7A 4PG8A 3THPA 4Y28C 1IBCB 3Q8UA 2Q79A 2VFVA 2MMYA 3MM9A 2C2KB 3OL6A 4ID8A 3AFGA 4DUYF 2OPQB 2DGSA 4WKYA 2RQ4A 4TN2A 3DDIA 5F8LA 3DMJB 5DG7A 3AQPA 5ETRA 1R0AA 1L3TA 4MT1A 1F0XA 6FDRA 1BY9A 3I0SA 3E8OA 3F44A 4JI3J 1UWBB 2YWEA 3E01A 3OXGA 3SSQA 1QE1A 3H2VE 1UVNA 2UXCJ 1X4EA 1GTHA 1S7IA 4NOHA 2W9BB 2OTLS 1FHTA 3CJSA 4ED1A 3OD2A 2JJ4D 4M5GA 2IBKA 4DL4A 3G6VA 1KWMA 2RQCA 4RX6A 3PEJA 3M2RB 3CMAS 1GMUA 4NCGB 3M05A 3LO3A 4DV5J 4J90A 1MU2B 1WC5A 2NXNA 3FBFA 2N3OA 3KHHA 1X5OA 2QFIA 4WKRA 4AUKA 1JLGB 3O8WA 5GAHI 4LF6F 1WKLA 1FJEB 1QDUB 4KB7A 1PILA 1V5VA 2J7KA 2HHWA 2AWZA 4DPTA 1PBUA 3VAHA 4OI0A 1C1BA 3NXZA 1QUPA 4Y2IA 4ZOSA 2HK2A 3GU0A 1K0TA 2ZBCA 3HZGA 3CIZA 4WTOB 3GB0A 1JNZB 1RTHB 1UUJA 3M6WA 3IG1A 3KG4A 1OJ4A 3K5LA 2F4VF 2KTQA 3PEHA 3V6HA 2CPFA 3JYTB 4ZS6A 4EBDA 2G2ZA 1CJKB 4EU0A 2AKWB 3BKUA 4NLRA 2ZOMA 2L9NA 3T1HJ 2EWHA 3EZOA 1BD6A 5F8MA 4WFYA 1VLYA 3DLHA 2RD5C 5E7OB 2F63A 1DTTB 2IHR1 5KFUA 3NCRA 4Q45A 2DNQA 5E5NA 3CJ3A 2MPUA 4YS2A 1RB0A 2F5GA 3SYZA 2QA4S 1FRIA 2DCLA 2XMUA 3WC0A 1SL0A 2DH8A 4U7UK 3QRPA 2E5JA 4DV0J 3L4BC 5J2NA 2C3MA 2RE1A 4AXIA 3WHIA 3UI3A 3BQ2A 5GVQA 3OPKA 2NPFA 1TR0A 5A8RB 1YWXA 1GT8A 4K4VA 4CT8A 2J8SA 2MSTA 2WBMA 4ZVEA 1KDNA 4LFCF 4CYUA 5K14B 1NM2A 5IT9U 4LVOP 3SCLE 4OYBA 3G8SA 3G96A 3L7OA 1HQEA 2FJAB 1APSA 2ASLA 1YX2A 1TU0B 2A10A 1M90T 4C8YA 1KBRA 2EKNA 5DG8A 4PWDA 1VRUA 5F0UA 2W24A 2QFJA 3B6BA 2XGQA 1R8HA 1X4BA 2DB1A 3UDVA 2FVSA 2YKMB 4EGLA 3FUYA 4OZ0A 3DHWC 1S0VA 4DF8A 1AA1B 1TV6A 4P71A 3PZPA 1VRTA 4I67A 5C42A 1N56A 4BDPA 4JYAF 3M2VB 2V2ZA 2SXLA 5E3AA 3BJYA 1NSQA 1IN0A 3V81B 2ZKTA 2Q1LA 3BGRA 3FC9A 1FRLA 1PKUA 1BQXA 2P6TA 1UW9A 3RUBL 3DRPB 4MMOA 3G8TA 3EXYA 2C3YA 3GCXP 1U1NA 3PW7A 4RW8B 3FFIA 5D0EA 3TEHB 1RT2A 3U7JA 5SUHA 3FZ2A 2DY1A 2PSZA 3T5HA 2XSJB 3HULA 3LOUA 3JB9k 5K20B 2IRUA 4U7CA 2CWXA 3BQ1A 2V69A 2ZOFA 2HQCA 3DLGA 2RF2A 1LV5A 2HNYA 4EI2A 1IKXA 2E66A 4GKKF 3C15A 1S6OA 3Q86A 4Y2MA 4CLWA 1B0VA 4ZITA 1UA0A 4WIIA 3D6MB 1YRXA 3DRSA 1IJEB 1HD0A 3CMES 1F2HA 1LWEA 2POKA 3GZ7A 4TXSA 4HTJA 4XDCA 5J1EA 1N5SA 5JXSA 3RB4A 3HHLC 3I82A 3SBMA 1WI8A 3M30A 5DDOC 2PFDA 3ETOA 1VQ4S 4C48A 2COLA 2GNKA 5H1SV 1Q8LA 2X1AA 1DFDA 1S6QA 4CCHA 3Q8RB 2AW0A 1XR5A 2EG2A 3CO0P 1X7VA 3MAHA 4PXBA 1TAQA 2B4PA 2I1RA 1NJIT 5GAGI 4YHHF 2E1RA 1X4DA 1HNVA 4CDIA 4QWEA 1N52B 3QIDA 5HROA 2PA8D 2UZAA 2GGPA 2X1FA 1RDRA 4N8NA 4DSLA 3K5NA 4F0KA 1FXLA 3KLFB 5CHCB 1VQLS 4DBQA 1NKCA 5G0RA 4FPIA 4TQRA 1TFYA 3BREA 5J2QB 3GSIA 4YOEA 3RBDA 3PW4A 2U1AA 4DSIA 4P2MA 4L6V3 4LBIA 3UCUP 3DDKA 1NHUA 5LMNF 2QLXA 1D9DA 2VFSA 2R3VA 4GRSA 2WVBA 3JXOA 3FVYA 2XM3A 2QX0A 4RNNA 2JDJA 2M3DA 4OLOA 4X4OA 2ROPA 2HLTA 4I7FB 1RT5B 2ALZA 3JQKA 5DO2A 1S1XB 3QFHA 4HH0A 3P96A 5BXIA 4WBFA 2XYHB 2DEIA 1IBLJ 3LA0A 3DLEB 4E2FB 2G4BA 2HRYA 2B9XA 3PW0A 2DR8A 3WC2A 5CYQB 3PIOQ 2JC0A 3ZFVA 1HBUA 4K4UA 3UR0A 2HYIB 3GFHA 1S99A 1RBOB 4ZHRB 3ENQA 3FZBA 1NPPA 1FJGF 2ZJQQ 1FWKA 5IC6B 2VPWB 3DLKB 2KYXA 1WEYA 4DFPA 1N32J 2RHSB 2VDHA 1VQKS 3VVTA 2AJ1A 4CLZA 2IPOB 4DPXA 4MIBA 3D6TB 1D9AA 5CABA 4X4NA 2HNDA 1U0HA 1G3OA 2YKAA 1FKOA 1FDBA 4KE5A 3PV8A 1TAUA 3IS9A 1KN6A 3I0RB 4O4GB 3E2EA 3JSRA 3CEDA 3MD1A 3B4MA 2AV5A 2ATLA 1UVMA 1J5EF 2VA3A 4ECZA 3AJDA 2G0JA 3LGNA 1WF2A 4J9NA 3G6YA 4JI6J 3M9MB 1I6JA 1RLCL 1B4SA 5HMXA 3EZ5A 2Z58B 2O5DA 3ULHA 4OV1A 1X4HA 2Q43A 5AT1B 3ILOA 1KQSR 1CULB 4ZPAA 2R7QA 1NRKA 4ICLA 3O6QA 1QAJA 2ZE2B 5C2CA 2H1YA 2E5HA 3AH6A 3KYLA 3ZZPA 3BS9A 5AJ3J 3GMGA 1HWJA 2R8GA 3UNYA 1S1TB 1CJTB 1NCLA 4OZ1A 3M8RA 1L3KA 3GYXB 1PBAA 2HLUA 1WKJA 3OFFA 2C2RA 1EJ7L 3SIPB 4LFBJ 3BGOP 2DH7A 4NYPA 3DN9A 5CYMB 3B4DA 1CJUB 3BDPA 4X4VA 1TL3A 5HN0A 5JVHQ 4WXWA 3CMQA 3IR6B 3MM7A 1RBAA 3C8YA 4KTQA 1XN9A 2UVRA 2F8EX 4V19J 1DY3A 2HS3A 4RL1A 1BE4A 1RAAB 2Y0BB 2XS5A 3RTVA 2WRMA 3DOKA 3M6UA 4E98A 1Q53A 4RWWA 4R5PA 3W9JA 4V19X 1YBAA 1NZ8A 5DETA 4DJBA 3OTOF 5ADZA 4B3TF 4Y0FA 1NEEA 4B02A 1KONA 1G4CA 5BYSA 3VVUA 2HZCA 2OSRA 4J9RA 4RLEA 1JKHA 4DCPB 5B0CA 3FMWA 1RHMB 2M9KA 1C0UB 4YN3B 4EO8A 2BBEA 4B17A 5E2QA 4NEYA 4ZVPB 4IDKA 1RAGB 3CDEA 1UFLA 1S1WB 4WXOA 2HRTA 2FGCA 3QRRA 3VAGA 4Q7AA 4Q0BB 4C11B 2M88A 5ETQA 2LEAA 2XWXA 3KG1A 4ZVQB 2MQQA 2BKPA 1PSDA 2HFSA 4LSNA 3CTRA 2JZ5A 3L7PA 3NGUA 3KDNA 2N3LA 4DUYJ 3DOLA 3FSXA 4BHQA 2YWHA 2PMHA 1XQIA 2DHGA 3MM5A 4P10A 5CA5A 3HJVA 3R5AA 3OR2B 1HHQA 4LF4F 2W2NP 3HHLA 2HG4A 4A8SA 2UXDF 1H72C 3EUNA 4DV6F 1B99A 2YX4A 3HLUA 5M2PA 1XEZA 4LF2A 4L3KA 1X0FA 1QAYA 3KLEB 2BE7D 3VQSA 4RUCA 4F50A 1S10A 2RDJA 3LUYA 2RQKA 4Y2KA 2F40A 4F4YA 1S49A 3GONA 1KC8T 2WOMB 2RT3A 2V4QA 2C2DA 2HFZA 3AXMA 3HPOA 2EBEA 3A3OB 2LEPA 3KLIB 1GFWB 4ECWA 2BM1A 1FD8A 3NKYA 1JWWA 1RTZA 3BSAA 3RRGA 2Y8WA 3LP2B 4LF6J 3DM2A 3MMJA 2FVPA 2LECA 1UVLA 4ZPTR 1T9TA 1MNEA 4KPCA 1SC1B 3BH7B 1Q8BA 2ZITA 4ZLJA 4Q44A 4DF4A 4UUWA 1RYRA 1JXLA 3AXKA 3QO9A 2C2ZB 3K5OA 3CC4S 3IGNA 2BRLA 1XMQF 4EFAC 2GIRA 2OUGA 1XERA 2XCAA 3KLHB 3AD9C 1DBDA 3TVKA 2AJ2A 3J7YI 2O1PA 2WONB 4NRUA 1QAXA 2F4VJ 1NSKL 5DDQC 1N0UA 3ETMA 2RUSA 2EVZA 4ZVTB 1K9MT 2JLGA 1UVJA 2OEKA 5LXYA 1HQUA 4DLEA 1D9FA 4ZLNA 3OTEA 4WFNQ 2GW8A 3WBZA 2CADA 1XNQF 2I5JB 4M5DB 4JP8A 3RB3A 2E5IA 1CJKA 4IYQA 2A6MA 4ZIVA 1DLOB 2KDOA 4TLQA 2HQDA 3FMBA 2IRYA 1YIJS 1DTTA 2J0QD 4ZCMA 2B5JA 4DR6F 5D4OA 1N36F 2B4VA 5HANA 2YQ0A 2H54B 3FEXB 2G1HA 1NDLA 2V1TA 2K3KA 3RJMB 4JI2F 4C8KA 3M8ZA 5F8GA 2CJAA 1TKXA 2BA9A 4LFCJ 3VAFA 5H9EJ 5HVGA 3QGHA 1H7WA 4X65F 1QD1A 2UVWA 3FCVA 1UL3A 1L3VA 2LLZA 2ZH6A 1J5OB 4QU7A 4WF9Q 2YY3A 1UJ4A 1CC8A 2P9EA 3RR7A 2HHQA 1QAIA 1ZAXA 5K14A 4M1KA 2QMWA 2BEFA 2DNRA 3G86A 1GAOA 4OIXA 4J9PA 4QYZJ 1NKEA 3TVYA 3I96A 4UUXA 4KV8A 2L48A 2IMWP 3D6HB 2BOAA 3BR8A 1XBWA 3CJRA 5KTQA 1D0EA 2VICA 4WP3A 2BKNA 3CXCR 1NJXA 4ECXA 4A8QA 4R25A 2VODA 3OBIA 4K8RA 2LQJA 4JYAJ 3CT9A 4CO5A 1RBLA 2LCWA 1SKRA 5KG5A 4ZLLA 1OYDA 2Z2YB 2VHGA 4OI4A 2MYFA 5D4LA 1Y11A 1U6FA 7FDRA 3D1OA 2E29A 3SSRA 1MG7A 1URNA 1ITPA 3M2VA 5L1IA 1YJWS 3S01A 2VASA 5GADU 1T95A 3KHGA 4Z7CA 1GX5A 4P73A 2P9CA 1MLAA 4C0HA 1CS4B 5KFEA 1KVKA 4ZCKA 2B7BB 2BW2A 2YNFB 4HYKA 1Q4RA 4GKKJ 2VJVA 1YTYA 2FZCB 2IAJB 3H20A 1VBYA 4NA3A 1S76D 1O5JA 5MLCV 3QLHA 2MLZA 3BKTA 4ZVGA 3CCJS 2MKJA 4CTAA 3CF5Q 4N7TA 3JQJA 2WBRA 4Q8EA 4ID5B 3UW1A 4WFAQ 1A6LA 2R8KA 2ZD1B 3R7NB 2Z0GA 2Z4PA 2JL9A 4LIRA 3NCPA 4FBUA 2QN6B 2DO0A 5B09A 2VFUA 4OHVA 1KSPA 4Z7YA 3G82A 3QJPA 3BF4A 2FHMA 4ELTA 1CG2A 1QY7A 3OR1A 4WE1B 4LF9J 1VS3A 2J9EA 2QSFA 1JIHA 1YVFA 3D54A 2OP5A 4FS1A 4YHHJ 2WB4A 2EFOA 5HQLA 2J9DE 3L09A 2EPIA 1OQ6A 2AZ1A 1AROP 3T3FA 1F60B 1Z1ZA 1BC6A 1SIWB 3DRYA 3BV8A 4DDFA 3MFHA 1RACB 2ZHAA 3IM8A 3C6TA 4ZVOB 2ZWOA 1RWOB 2LFVA 4W4MA 2CVIA 3W64A 2CJYB 4LRDA 4TLRA 1NJYA 2BQRA 3IMQJ 4BWJA 1ZAVA 2V4JA 1T3OA 5LMNJ 5DZ6A 1YJNS 4PABA 1WOOA 5T7LB 2MLXA 4J9QA 2VA2A 2APOA 2DNNA 2GIQA 4XK8C 5J2QA 2KRRA 2RB7A 3PKMA 3NBPB 3P3DA 2AGPA 1YG0A 2HQGA 4B3OA 5D15A 3VGSA 2C3OA 5HP1A 4FXWA 2UU9F 4MKYA 1GTEA 2W9CB 2DR9A 3K8WA 2RU3A 1LWFA 5F8JA 3UCZP 3TJ8A 4CIOA 2LXUA 1KVJA 2WB1D 1AB8A 4TYBA 2XTCA 1FF2A 1Q7YT 3GQCA 5DM7Q 2XMKA 3LGMA 4PG4A 2KG0A 5RUBA 2HURA 4GKJJ 2HQIA 3BSCA 1W26A 3X3UA 4MIAA 1FJGJ 1CQNA 3CJ4A 4QCLA 3CWJA 1C0TB 4PYDA 1L3SA 2ZZTA 2HHUA 2CQIA 5CYQA 5L9NA 4LVNP 4ZVSB 2UV8G 3D6FB 3PTWA 4PAAA 3W9IA 1RISA 4DU7A 4ZHRA 5A8WB 2BUNA 5AE1A 5F8IA 4AT1B 4P7VA 1UZDA 2AYMA 5KT2A 4HI2A 5B0AA 2NXCA 1Y9OA 2B4UA 2YH1A 1KTQA 3BR9A 3T9ZA 2CKWA 3CB4A 1WEZA 5DS7A 4ES3A 3X1LB 2FIUA 4RO0A 1N0VC 2KT2A 2O01C 3US5A 1J5EJ 2UP1A 3KJNB 3O3LA 1RSCA 1URRA 2DNKA 1VFJA 3IFEA 1OS5A 2IC3B 2W7AA 4FNHA 3NGDA 2LVWA 3GIIA 2NYIA 3KK2B 2QL9B 4YFUA 2OGUA 2MKSA 3IO1A 4WYWA 2CG8A 3NMRA 4DR3F 4LREA 3H4BA 3QYYA 4DV2F 1FDAA 2V68A 2GHVC 1FX4A 3Q8QB 3AB2B 3MPVA 2C3UA 2Z56B 1FNXH 5AXMA 3W62A 3CVKA 1NB7A 5KFFA 2EBGA 3KJFB 3IC1A 2ZC4A 5BR8F 1KHWA 1VQYA 2E7XA 1RP5A 1P6TA 3MTKA 1YK9A 2QRRA 2MKKA 4DL7A 1GNKA 4L74A 1VC0A 3TAMB 4OYXA 2DNZA 3TZXA 2DRAA 3D66A 1E6VA 2R8JA 3MEKA 1OY9A 1K1QA 5HK4A 5CYMA 1CJUA 4BCAA 3BGLA 3IRXB 3ZNUA 3LALA 4IKAA 1YDLA 4AL6A 2W01A 1REVA 2M5YA 4IOAQ 4DUZF 4USIA 1RE1B 5E3PA 3HSDA 3OTOJ 4B3TJ 3R2CJ 3KNAA 4LUBA 1HNXJ 3LP1A 3OXLA 3Q22A 3V4IB 5EWGA 3R7SB 5DDRC 4OJGA 4KQZA 2VG7B 1FD2A 3GWCA 1RAIB 4J9UE 1Y4ZB 2J0WA 1H73A 2NLWA 2A2CA 2BE9B 2YKPA 4OZJA 1S57A 3DXBA 1RHUB 5K8PA 1VRQC 5H9FJ 3Q8SB 1PJ7A 4GVBB 3ISNC 1UA1A 3RB6A 5L1JA 2HAFA 1YJUA 2BJ9A 3IWLA 5KT5A 1VK8A 5JVGQ 3PCOB 2P9GA 5J1PA 1YJVA 2X3DA 4C11A 3JSMB 1WACA 5LM7E 2AHOB 3G6ES 1DTQA 4DV4J 1TK0A 3MPDA 2DR5A 2E9ZA 4LF4J 2AEMA 3HVWA 3PY8A 4TU8A 3MEDA 2UXDJ 3DLLQ 4DV6J 2F1FA 1Q79A 4O3PA 1FKPA 4D3HA 3S6EA 1JLCB 1NDPA 1KLNA 2M52A 3OR2A 4ZDNA 3OXFA 1N48A 4RZRA 1D09B 2A6OA 3C14B 3FQLA 2AEFA 3IA0A 2QC3A 4XDDA 4CNYA 2HBZB 2D9OA 3Q2TC 1IWGA 1QLNA 4DPYA 2CPXA 3DFEA 4DS4A 5L1KA 1UKUA 2VJUA 3ELHA 3GCWP 1JJCB 3LANA 3C66A 4P52A 3MMBB 2KVQE 5B0DA 3BYRA 1IKYB 1DQ8A 4K5RA 2DGTA 1UETA 3MGJA 3I9ZA 2J6UA 3V6DA 2ZVIA 4PKDB 3DYAB 1JJHA 1R0BG 3JTPA 4A47A 5A8KA 5LSLA 3JTOA 4CO0A 2UXBF 2KZZA 1IWAA 1XMQJ 3DC2A 5A76A 2CUYA 3ISND 5DGAA 4QW8A 1HW9A 2EFGA 4LFAF 3UN2A 2LEBA 3RR8A 3NS6A 3KTQA 3AD7C 3UO0A 5DDPC 4MAKA 4K4WA 4MKBA 1T9VA 2D74B 4DR1F 3Q23A 3CJ5A 3PG9A 1Z2LA 2V8PA 3MAQA 3JAMU 2XY6A 2WONA 4ZPWR 2ZHBA 3FSYA 3SDEA 2AQ4A 1XNQJ 3KK1A 4PG5A 3K8VA 2OPRA 3DGPB 3HD2A 2XO7A 2YWGA 4ES1A 3VV2B 1WHWA 1KHVA 4HVZA 2CWKA 5A2QY 2HHVA 1KR4A 1DURA 4USMA 2H9ZA 4ZVRB 1Q5YA 1N36J 4B3SF 5C24B 1NXIA 4ECUA 5EDWA 4CO1A 3D3CJ 1DLOA 1IKWB 3RAXA 4JI2J 1SVDA 5D4PA 2M7SA 4DU8A 3KJVA 3QNWB 3TA0A 4M5IA 3LF0A 4DR7F 1MROA 4LSLA 4M63A 1V6HA 2H65B 2CVEA 2KXNB 1YKWA 1WC1A 1U1MA 1G6BA 4X65J 3R5BA 3SFUA 4CLPA 1VQ6S 3J81U 4A46A 1N5YB 3AX3A 1X31C 3BGFA 2RQMA 3KHRA 3OLBA 4KFBA 1HKAA 2CPHA 2K1RB 1H3DA 4IG3A 3A8JA 2DBBA 1HHSA 2YBVA 1JLFA 2DKOB 4ED2A 3I5BA 3LAMA 1R8BA 3MOZA 2OELA 2RMLA 2FHOB 2ZWPA 1HLWA 3S1TA 1F9FA 3I56S 3GIJA 3NNHA 5CCMA 1HYSB 2PO4A 3QSYB 4OI1A 4G1QA 5D0HA 1PIEA 1F9HA 4DG1B 1BWVA 1JJ4A 2NZ4A 4DL5A 1JB0C 1SQEA 5A2QU 1M1KT 3HFKA 1R43A 1FERA 4URSA 2XG8A 4V1Ak 1LOUA 2PD1A 4IOBA 1A0OB 4QIGA 5JJBA 3FCHA 1O6XA 2YNHA 3P49B 2IJRA 4IH7A 1WOPA 3PJ9A 2YNIB 4I69A 3N0VA 2BABA 2MZQA 2HPUA 4B9TA 4J9MA 1RT3A 1JLAA 1F1BB 3HHEA 4RKUC 2ZUAA 3AY0A 2QLWA 3BO3A 3HHNB 3AOAA 3IR5B 3BN7A 2KB2A 4FBTA 1R6VA 3SQGB 2Y1RI 1SJ1A 4X4UA 3BSOA 2U2FA 3BBFA 5C5JA 2YNFA 2OSQA 2CJXB 4W90B 4NWBA 2GQQA 1E6YB 3MMCA 3IN5A 5I4MA 2F8MA 2I6WA 3HKZD 4CNZA 3T19A 4Y6IA 4Y34A 2W25A 3P4UB 3CJ0A 3JTNA 1BQNB 2A0FB 2MZSA 3FJ2A 3H90A 2ZFHA 3UDLA 1EAYC 1S7HA 1EP4B 3O44A 4M5NA 1FWPA 2IVMA 2V2KA 2IM2A 4PPZA 3OJSA 5I3UB 3H5SA 1VQOS 1K44A 1LW2B 4N47A 2FLLA 3B78A 2H5JB 1M5PC 1FJ7A 2MDAA 3NAHA 2GX8A 3IGVA 3WQPA 1TKTA 3M8WA 2YH0A 2HHXA 2D69A 2LU1A 1YGYA 1TK8A 1UPMB 4Z2XA 2AX1A 2QMUB 4IUFA 5KFWA 1XTZA 3HKWA 3CJTA 4YY3F 1EIYB 5HVFA 9RUBA 3PNIA 3OFHA 4Q5VA 2KT3A 1MMNA 3UDEA 4FF1A 4JI1F 4YB1P 3F0NA 3KLGB 3HI9A 4U67Q 2VZ9A 2NUHA 1VQ5S 2FD2A 2EC2A 2HIQA 2XC9A 2UU9J 1Z4UA 2XGPA 5IQ6A 4G65A 3CD0A 2XMJA 4OYIA 2MXYA 4PQAA 1NPKA 4HT7A 1OY6A 5KG7A 4FVCA 3ENWA 3DLJA 3M4XA 2GQ2A 3CULA 3W2VB 3TOQA 3OQ2A 1Q81T 3G9CA 3PRVA 4U6PA 4FYVB 1Q95G 2BJ3A 2DXEA 2D7SA 4EO6A 4YEAA 2OLWA 1KP6A 1NSPA 3MF5A 4ZPCA 4X4TA 2R2TA 3HDSA 4OZ2A 1I94F 2R7RA 3SXLA 2ZC3A 2ATCB 3MM6A 3W8GA 1OWXA 1YRTA 3N4WA 1DZ5A 1TVRB 3TX0A 4ZJQA 2P2CB 3T1YF 3KK3A 4HACA 4ZKAA 5FD1A 2QV6A 4IRCA 1SKUB 1XNRF 1UPPA 3UN5A 1HWUA 2IM0A 3OTBA 3M8QB 1RTJA 4F4KA 4WWSA 4C0BA 1CJVA 4X62F 4KR0B 4L76A 1U1KA 2BQ3A 3MDFA 4YQWA 2ALYB 2GCFA 1BWEA 2QSWA 5DLGA 3KNGA 2J8AA 3AX5A 3TRGA 4ED8A 2GMJA 1WUUA 2JX2A 5C25B 3QBCA 4DSJA 3KWMA 3RBZA 2MGZB 2JVOA 4DR3J 3EVMA 3I4PA 3MEGA 3LW5C 1NHKL 4DV1F 3K7RA 4JV1A 4NI2A 5KAKA 4UQTA 3W5ZA 3TZYA 1C4CA 2H51B 5HAOA 2E9TA 5E0OA 1RYSA 4OYZA 6FD1A 1S9GA 2ROEA 3N9UC 3SCIE 2LDIA 5BR8J 4QWAA 2YX7A 4ED5A 3B82A 1WKKA 2CQ0A 3BM7A 4B9NA 3GP9A 1SL1A 5FDLA 1P8GA 4CLSA 1HNIB 2DT9A 2HQ3A 1AXQA 2GV1A 3OW2R 1D8YA 3GV8B 3MURP 4NL5A 5SZTA 3C19A 1KQGB 1P9YA 2IA6A 1Q8IA 5D6GA 4D3GA 5KT4A 4IFVA 3NGTA 5B0GA 5KFVA 1L3UA 4U95A 1NK9A 2MQOA 3MR5A 1UFKA 3ILLA 1GXUA 3VWSA 3E51A 1R3NA 1RXOB 3GLJA 5HLFB 4H4MA 5KFMA 4G1PA 4I2PA 2MHNA 4DUZJ 5IM0A 1S1VB 1MMDA 3K0JA 4K2JA 3FBEA 2N4DA 1HI8A 2HWIA 3ITHA 2HS0A 2MHEA 4GVLA 5CCLA 4DHVA 1ZH5A 3EICA 3P5TL 2ZZNA 4OYOA 4OJ1A 3O1LA 4ANEA 4X4QA 1Y3KA 2IBOA 5AXNA 3AX2A 2O66A 3R1HA 1I5OB 2GJIA 1N6QB 4KC5A 3ZTQA 3UQSA 2UUBF 1HQ2A 3AAWB 5E33A 5ETTA 2AU0A 4DQQA 4FN5A 2FC9A 4UW2A 3MCSA 2LQ8A 1N4LA 2R7TA 2I9SA 3LH2S 2HFOA 1SKWA 1QVGR 4IRKA 3TAQA 4DV3F 4ENOA 1HBNB 5H9EK 1VBKA 5EN1A 3R5GA 4K4SA 1VI7A 2K2PA 4LRAA 3J7Z5 1ZTWA 4GVBA 5CD4A 2RSQA 3DRRB 2V50A 2AGQA 4IR9A 2F8HA 1T7PA 4PQUA 1SC4B 5I42B 2BR0A 5KFHA 1S97A 4CLTA 1AZSB 2QMXA 3ZTSA 2XI2A 1FA0A 1HMVB 3PO5A 1QSYA 5ETPA 2UVVA 2C2NA 3QWPA 5D3GA 1IXKA 2VQFF 4S0MA 1N5VA 3HJFA 2QYCA 4KBIA 1F5BA 5IZHA 1TL7B 2V8VA 3U27A 2D68A 4RW6B 3FEYB 4L75A 1JLCA 1LWCB 3A8KA 2DITA 2VUGA 3EGVA 2GVDB 4EBEA 4UF4A 4UOFA 3D28A 2HBYB 3D1QA 2IVYA 1X9SA 4JV2A 2B6AB 4CH1A 4BLGA 1X5SA 3HT0A 4NXNF 2XLJA 1TMMA 1XC9A 4DL0C 3RG6A 3OTDA 3T5JA 3GIRA 1X4CA 2MKIA 4KPYA 2E9RX 5KFXA 1B64A 3MMBA 4DQRA 3U1MA 4KGMA 2UXBJ 2IM3A 4AYBD 4XIUA 5A0YB 3MR3A 3R6LB 2XY7A 3W7BA 5ETNA 4LFAJ 3CCES 2E5LF 3BO4A 4E0DA 3W65A 4I4BA 3D68A 3ENVA 4BBYA 1MMLA 5KOXA 3T5KA 3RAMA 1FT8A 1ELOA 3LQVA 3GPAA 2YX1A 2WVDA 1VQ7S 4DR1J 2ZBPA 5HBMA 3CC2S 1XR7A 3PVXA 1EZZB 2WVEA 1PJ6A 4OI6A 1KKHA 1M1HA 1Y0HA 4USWA 2R7XA 3W5XA 3VQTA 4EYIB 1PC5A 4NPOA 4NMLA 3MUMP 2RRAA 2D3OR 3CC7S 4F02A 4DR5F 4TY8A 3DOMA 4DPUA 2NREA 4Y3CA 4NLTA 3V5RA 2IMOA 3NNAA 3SV4A 5D0RA 4QU6A 4F4ZA 2ZJPQ 3FGVA 3OLAA 2FJWA 4OI2A 4B3SJ 2DJWA 1RWPB 1HI0P 3RZAA 4USVA 3L95X 1RAFB 1S77D 5CZVA 2HMIB 2JEGA 1RADB 2VG5A 2I2YA 3N01A 1X4GA 3VAJA 1JLEA 2HQFA 1Z2ZA 3W60A 4DR7J 1IKWA 3IR7B 4DOZA 1ZA2B 1C1CA 1SV5B 2XMVA 5A6WA 5LL6d 3RU0A 3T6JA 2Y0SD 1FXRA 3R97A 4B08A 2VB6A 1MWYA 5U47A 2R2SA 1YZ6A 2GO9A 5BJRA 2RJZA 4CO2A 4ATNA 1RWUA 2GFFA 4MYTA 4XPCA 5IT9Y 2IRXA 4OYAA 3MAAB 1RLDA 1N5YA 4A8YA 1ICEB 4ECRA 4UY85 4ITSA 2VBYA 3R1LA 1NK7A 2FYXA 1ZZNA 4F4XA 2GQCA 3QGGA 2CFXA 4H54A 1YJ7A 3VGTA 1DJ0A 4LT6A 3BSNA 2E7VA 3HVTB 1S0NA 2XSFA 2OPPB 1SCJB 4URQU 3ENAA 3DI6B 4KO0B 4ANDA 2VV5A 4C8MA 2OIHA 1HIYA 5F9LA 1IR1A 1B70B 2CJ9A 3NG8A 1U8WA 2E1AA 4EZ9A 2NCKL 2KO1A 4DL6A 3ZZRA 2GMHA 5GADI 4C98A 3H5YA 2CPIA 8RUCA 2LXIA 4PUOB 3GE9A 5J2PA 1H2VZ 1M1GA 2MKHA 2HGLA 3FSIA 2PGCA 3V6KA 1B7YB 3P8BB 2FHJD 2IDLA 1R0AB 1RJJA 3BZQA 3KLVA 4ETZA 5LMUF 3PW2A 5EX0A 3I0SB 2YNIA 3OFGA 3MUVP 3QAUA 2Z2ZA 3QQCD 2XHWA 2BOPA 4QIFA 1OMSA 1EX8A 3E01B 1QE1B 4HHJA 3A13A 4QR2A 4GO7X 3FRZA 2IVFB 2EFNA 1T03A 1U7LA 2HKEA 4G3IA 3UPFA 2JHEA 4K50A 2QEXS 1CVJA 3GIMA 3CCQS 3O5TB 4ILLA 1E6YA 2KH9A 3AODA 3H25A 2CAJA 2W4DA 4HKQA 3POTA 3M32B 2NS1B 5DG9A 2OPSA 2YKOA 2PEHA 4KAIA 1CQMA 2KHDA 4ZN3A 2KT5A 4C0OC 4DL2A 4X4PA 2GS8A 3R3TA 1EETB 3OSPA 3K58A 4ES2A 2HHTA 1F6TA 1HW8A 3UNGC 3MECB 1C1BB 2MEWA 2V0NA 3ZO7A 4F2SA 4FXDA 3PFEA 1H6KX 4OQJA 4YY3J 4WP9A 4RR5A 4N5SA 3R6GB 3N6LA 3IG1B 1FDDA 4FYYB 4RJVA 3OJUA 4JI1J 3B54A 4TY9A 3TW0A 2RS2A 3FNNA 1TUGB 4RU9A 1R0CB 1Q0NA 4A8OA 2HEKA 2BE2A 3Q8VA 2JFKA 3VZIA 3NRBA 2V67A 1TKZA 4KSEB 4Y65A 2C3PA 4YR0A 2VH7A 3KLGA 5FLXU 4J9SA 2FB0A 4OLPA 1ZA1B 4C8ZA 4RUBA 1LK7A 2YWFA 3MR6A 1RWVB 2XWYA 5H9FK 1ZBTA 3CIMA 1LW0B 1FTCA 2Y1JA 3BB5A 2BJEA 2WSEC 4G6VB 4ZVHA 1WSVA 2W9AA 5HMZA 1PGZA 1S6PA 3C3LA 1N88A 1I94J 5J2NB 4RW9A 3M8PA 1RHJB 1WHYA 1FVQA 4EBCA 5CD4H 1PO6A 3K2YA 3KG0A 2CZ9A 3T1YJ 2RNEA 2MQNA 1XNRJ 4RW4A 5E41A 2CNOB 4OYMA 2DNPA 4P2XA 1GQEA 3H42A 4CYUB 6AT1B 4X62J 1JLQB 2CG4A 1TVRA 4USUA 1WF0A 4GO5X 2KM8B 1HQEB 5DM6Q 4PR6A 5ETKA 2Q6BA 2YKNA 5L1LA 3M8QA 1SUQA 4NRTA 4NLOA 3PO4A 1TUVA 3RGIA 3DU5A 1U1RA 2BACA 3NGSA 4PWDB 1VRUB 1VYAA 1QUVA 2N4CA 3T9NA 4F26A 1VBXA 4QOTA 2DD8S 2DK2A 2DNOA 4MJKA 4JV0A 4DV1J 1FFSB 4UZBA 1NDKA 4WP8A 3C6UB 4JI8F 1S9EA 3VGUA 4KH0B 1D1UA 3MCNA 1TV6B 2NZCA 1BUXA 2FHJA 4JB8B 1VRTB 4I68A 1DQAA 2VBXA 4BWMA 1NLKL 1WF1A 4Y2CA 4KKOA 2BJ8A 4NA1A 3M9NB 2HFVA 4OZ3A 3ZZ0A 4ECTA 3U1NA 1QTNB 3BGRB 4LRCA 2ASDA 1T11A 1HFEL 4ZJLA 1S0MA 1FX2A 1KS2A 3NMAA 1FRXA 3FFIB 2IYGA 4DFJA 4HI1A 1RT2B 4H4OA 2ZH7A 2XZTB 1FK9B 2FLNA 4WPAA 3OV7A 1HNIA 4BC7A 3HHLD 4I1TA 2YXLA 3K17A 4QIVA 2ASJA 3HO1A 4HDHA 2XZDB 5KG3A 3WZ0A 4QPXA 4K4YA 2HNYB 3LWLA 2R7SA 3BGUA 4J91A 3Q0AA 3C15B 3H2LA 3C2PA 2XYGB 1YBTA 3H4DA 1Y5NB 5D8HB 4A8WA 4KGVB 5B7WA 1SH3A 1H2TZ 3DRSB 4DMZA 4MK7A 1X8DA 2Q6CA 3QGIA 3MMAA 2HNZA 3G8QA 3LP0B 1Y3JA 2GHWA 2V1SA 2V34A 4ZVUB 2LQBA 4MKVA 3ZZOA 2VPZB 3IBWA 4A8XA 3M30B 2QLFB 1B0TA 3TX8A 5J1NA 2OJ3A 3R2DJ 2XMAA 4DX8H 4B9MA 2GAGC 2AP6A 5M2RA 3ZC4A 3OL9A 1S6QB 2HGMA 2DPIA 2XTEA 3PRDA 1ULRA 2CRLA 3PX4A 4DV3J 5IXUA 2AZ3A 3NL0A 1J27A 4I64A 3VAMA 4JI5F 3PIPQ 3IWNC 3J7AN 2L9WA 1HNVB 3EX7B 1RWMB 3EGZA 5HROB 2PFFB 3NAIA 2HVDA 3CJKA 3MTJA 5GAEU 4UTGA 1QTMA 2FJEB 5CQGA 1X9MA 2RHQB 1R7IA 5KFTA 5B0FA 3PXGa 1RT6B 2O3DA 3AOCA 1S4FA 2ZEJA 1VLOA 3CDBA 2GZOA 3WX4A 5G0RB 1ZPVA 2EXUA 4UOGA 1RT4A 2CQBA 2OKQA 1TUWA 2EFQA 3DRRA 2WCXA 5E3RA 1OY8A 5LJ5Y 3UFCX 1ZS6A 2MZ1A 2VQFJ 3J80Y 1NK5A 5I42A 1GEHA 3TJ9A 5E3CA 3C16B 2R9LA 2YNGA 4UOHA 2V6AA 5THWA 1HNZF 4C4WA 1B7FA 3ICLA 2K7KA 3VF0B 3EXCX 4DPWA 1N8RT 2DHSA 1VQ8S 4MFBA 4JV5F 4M5MA 4FYWB 2VD3A 3UVJB 1TL7A 4RW7A 4RW6A 4NXNJ 2K3IA 3D3BJ 1LXJA 3D2WA 2HFNA 2CPZA 2GVZA 2GVDA 4DPOA 1U47A 2E1MC 5LXRA 3NY0A 3I6PA 2B6AA 2IJNA 4WK3A 4DQPA 1OPIA 1SBRA 5BYQA 1SH0A 3TUIC 3CCTA 1RABB 4TVAB 4P75A 5HMYA 3A3PB 1BLUA 2CQDA 1SJRA 4CLKA 3PYGA 4Q43A 2A2DA 3CCSS 2E5LJ 1U24A 2UUCF 2ZDPA 4NLYA 3GJQB 1XJWB 3W2WA 1TZ0A 1GXLA 3UD5A 1HPZA 2XEXA 2AIRB 3EMTA 4WTYA 1V3ZA 5A0YA 5KFRA 4R8UA 4LF8F 2WHOA 2HNDB 1U0HB 1YITS 1FKOB 3MWBA 3K57A 2H3EB 2AYBA 3IS9B 4YB7A 1RAHB 1KLMB 5K9FA 2OEJA 1FRMA 1IBKF 4FXVA 5EUHA 4DV7F 2EI5A 4DR5J 4IFYB 1YJ9S 1RT1A 2EEYA 1RHKB 1OQ3A 4UT4A 1RCXB 3S7RA 1CSJA 4P7TA 1WC4A 1YRUA 3J80U 7AT1B 3I5AA 2DIVA 2WVCA 4PWUA 3JSYA 3QPIA 2OPQA 1VR6A 4F4WA 2HVIA 3DMJA 2DH9A 4MKAA 2C2EA 2I0XA 4IO9Q 2HZVA 4ICLB 1U1QA 4J9KA 5KT6A 4WK1A 5FIIA 4OZ5A 1NUEA 1H98A 4R0JA 1VJWA 1UWBA 2JFDA 2HWHA 3FBBA 3EPGA 1XMBA 3LPYA 4K5SA 2AYGA 4TQSA 4F67A 4G1IA 1YZ7A 2B56A 2YWWA 2CPEA 4M95A 2XTJP 3GG1A 1IM6A 2D1CA 5HO4A 2W9BA 3M2UB 1WHVA 2NYHA 2CQ4A 2OEMA 2D41A 4O3NA 1YJRA 2GO8A 1TL3B 1K73T 5A6PA 5HQ8A 3DHXA 1WD6A 1S6UA 4OX8A 3MM7B 3M2RA 1SV5A 4NCGA 3GFXA 4N76A 3BKFA 4PWWA 4QIEA 5KFGA 4MTPA 2GC8A 4LR8A 3V6JA 1MU2A 2M0GB 3NLCA 1VC6A 2C1EB 5DJBA 4AE5A 2Q3PA 4C97A 3T6BA 2N7CA 3DOKB 4ANCA 1JLGA 3KUHA 3ZTRA 1FRJA 2LDYA 3MOJB 1NH7A 1U8SA 2CQHA 1W2BR 3U02A 1UTAA 2PE8A 5B0EA 2YWKA 3LWMA 3M8SA 2FLOA 4DR2F 3H2UB 3GIKA 4AXJA 3HHDA 1RTHA 2HHSA 2MTLA 3K89A 4LQ9A 4PCQA 1YSJA 3BEGB 2GHPA 4IDKB 3HZEA 2KN4A 5T14A 3Q8PB 1FCAA 2LP4A 4QWBA 5G4DA 1X4FA 2LA4A 4TYAA 2QE5A 4K2XA 2KZMA 4RNFA 4KO0A 1SB6A 3JYTA 3H7HB 4EMDA 1AUDA 4LSNB 4YUDA 1SL2A 1FEHA 3K5MA 4RNOA 1VISA 1FTRA 3EVOA 2Z2MA 3DOLB 2PIIA 3F56A 1U45A 3EZUA 1C4AA 1U1LA 3AD8C 1Y10A 3MM5B 4O0NA 5LMUJ 4DSEA 4LMZA 2D3ZA 4PUOA 1FRHA 2M2BA 3IAM9 3EWGA 5KFZA 4O3RA 3CDUA 5F8HA 2HFUA 1H38A 3HHLB 2WVFA 5HQMA 4C6AA 3E3XA 2WSFC 4J9LA 2BM0A 1K47A 1NZAA 4F36A 4ZIWA 2WSCC 2W2OP 4YMEA 2W4CA 3PFOA 4TNOA 4OHXA 3D1HA 4F04B 5A8RA 2O67A 2ZBIA 3AB4B 2FY8A 4XAKA 2HSEB 2W1BA 3KUGA 3CPWR 4M94A 5K8MA 3DGVA 1VC5A 2Z2LA 2J0XA 3SFGA 4PYAA 4ERDA 5L9XA 2B9EA 2PDAA 3DM2B 4QWDA 5KFAA 4K7QA 3M32A 1JXEA 3PJWA 4QQBA 2PI4A 1HNWF 1CBKA 3D0IE 2WW4A 5KOWA 2AGOA 3Q2SC 3PX0A 3FQKA 1U6BA 3FK4A 3QO9B 2MZTA 2G2YA 3KFWX 2LQ9A 3TO8A 2YKMA 1EETA 2V8HA 4CH7A 3G2XA 4IG0B 3MECA 1P27B 2IFXA 3A12A 2OI2A 4FNIA 1NPRA 4IQMA 3GR0A 4JI0F 4N8OA 2ZH9A 3TI0A 2CIMA 5B08A 4HDGA 2FC8A 3V81A 1HQUB 2CNNB 3HFVA 4C9DA 3WIUA 2R7VA 3DRPA 1SIZA 4FF2A 2DHHA 1S59A 2XS2A 4NLSA 4WU2A 4RW8A 1Y5IB 2QA1A 4EZ6A 2QLBB 3BH6B 1WNEA 5KFNA 1N34F 1T0TV 2XSJA 2YPZA 1S1UB 1T9WA 2BYCA 1Q86T 1BHNA 4DCOB 2RIJA 4JI7F 2B5JB 5CYJA 4OX9F 3N28A 1G1XA 1T94A 1LW0A 2EK1A 3GV5B 1UP1A 4ELUA 1V5IB 3I55S 3R27A 3S8SA 2QL7B 2W7PA 4DSKA 2DY9A 1QSSA 1SC3B 1TKXB 4HTIA 2QIFA 4K4ZA 4DL3A 3NOCA 3R7BB 3MEEB 2RRNA 4QPTA 1M5OC 1RAOA 2R42A 1VOMA 1RTDB 3HT3A 1YBUA 2PA3A 4EWTA 1KEKA 1W7WA 1VK3A 5D4NA 3AA9A 4JBCA 4ECVA 4O23A 3P6YC 4C3LA 1S0OA 1JLQA 1W2IA 2R8HA 2WZ1A 3HX9A 2ZM6F 2FHKA 3M8YA 3PACA 2H48B 2UUWA 4KV8B 3TR5A 1LEOA 2MKCA 4JI8J 3QGPA 4QJVA 2DXDA 2M8DB 1EQ0A 2ASYA 4OV6A 3KLFA 1EARA 3D0HE 5KFYA 2PMZD 4USJC 3AWRA 4DX5A 2MZRA 2ACMA 3C6UA 3KJQB 1D8ZA 1CEZA 3TANA 2LU2A 1ACMB 1P9QC 1WG5A 1JNRB 1S9FA 3AOBA 1Y7PA 2D9PA 3HSJA 4X4SA 1HWLA 3MI7X 3VALA 1RHRB 1M5VC 2Y1LB 4I7FA 1RT5A 4DWIA 2J76E 1V9OA 1S1XA 5KFJA 1WOSA 3A4TA 2NSBA 2AYEA 3ZZUA 3DLEA 2KG1A 3RAQA 1FO1A 2NUUG 1FK9A 4ED7A 4WFBQ 2IYIA 4ZVFA 5HL7Q 3QLHB 3PW5A 3MPWA 4NASA 4M5KA 1RI7A 1VBZA 2JSXA 5D78A 4CTAB 4EUVA 2FVRA 4YR3A 3VHQA 3LAKA 3PYFA 2R8IA 2D3O1 3PDNA 1W25A 3DLKA 1KOHA 1ROFA 2YVSA 1H0HB 3QMQA 4BC9A 3G82B 1BGXT 4O0IA 4J9VA 4B3MF 3OR1B 3LP0A 3W63A 2P5VA 2CZ4A 3PYDA 3ZZYA 1Q8KA 2GIFA 2XY5A 4RBVA 3I0RA 3R5CA 4O4GA 4JI5J 1A9NB 2BV3A 4U7UD 4DX6A 3UR3C 1NO8A 4LF9F 2B9YA 3BBBA 4KIAA 4PXEA 1U0SA 2B0GA 2F9JA 4FVMA 4JI4F 1SJ4P 3K59A 3I31A 1AT1B 4IH6A 3HP6A 2W4PA 2XULA 3C6TB 4ZP9A 2QGFB 1CULA 2CQGA 4OYWA 3RBXA 3ILJA 4IOCQ 2C42A 1NH8A 3ISZA 2MQPA 3IP0A 4F3QA 3ET6B 1RT6A 2VQEF 2ZE2A 3UDCA 3BQ0A 2L41A 2V4JB 3W8PA 3LGHA 4RBUA 5IT4A 4RUHA 3AT1B 2ADCA 2QTWA 1HNZJ 1S1TA 3TZWA 1CJTA 2MKYA 5KFSA 5KFQA 3THVA 3EPIA 4F3MA 1RAEB 5L8RC 3KMSA 4ALZA 2Y1IA 3NWGA 2ILYA 4JV5J 4B3OB 4ZA1A 3C16A 3TUPA 5HP1B 3BBCA 1OIAA 2R2RA 2IDEA 4O44B 2RU9A 1RAJA 4U9RA 4ZCLA 4ED0A 1LWFB 4FF3A 4ECQA 1K0VA 1MN7A 1NDCA 4YDDB 4MK8A 5IT0A 3I9V9 2J7UA 2M70A 4OL8A 4O3OA 2CQ3A 3UVJA 4DCJB 1IBMF 2BMBA 2V8GA 5IS2A 2J6SA 4O3SA 3O2IA 5AE3A 3GTYX 1RWKB 3JQMA 4PPDA 3NNCA 2UUCJ 1RGVA 4MYUA 4GKJF 3PHEA 1Q16B 5KFBA 2AX0A 4B9LA 4LF8J 1PYTA 3CGIA 4KHRA 1C0UA 2H4YB 3AQOA 1KFSA 3CCLS 2V9KA 2V94A 2PT0A 4NXMF 2QO3A 1VJQA 4I0WA 1KQKA 1IBKJ 4I2QB 3G71S 1S1WA 4DV7J 4DXLA 4Q0BA 2XB2D 4ECSA 3J7A1 3JAMY 5AE2A 1KLMA 3TNVA 1X5TA 4MK9A 2L9DA 2Z8QA 4IFYA 4DN0A 3MR2A 2DO4A 1M5KC
chains in the Genus database with same CATH topology
1U6FA 1NU4A 3SZ2A 7FDRA 2GFFA 4MYTA 3D1OA 4XPCA 3NS5A 1NJWA 5IT9Y 2E29A 2IRXA 3SSRA 1URNA 1N5YA 2NQPA 4P6QA 2OMOA 4RW4B 3M2VA 5L1IA 2AJQA 2KFZA 1FDNA 3QZ8A 1N6QA 1YJWS 4A8YA 3TAPA 2FTRA 4ECRA 4JOUA 1UJ5A 4Y2AA 4OHYA 1MSWD 2VBWA 3S01A 4UY85 1UMJA 2VASA 2VOOA 5GADU 4ITSA 4C2MA 4YB6A 3KMQA 2YQ3A 1T95A 2VBYA 4OI3A 3KHGA 3R1LA 1NK7A 1ZZNA 1GX5A 3H5XA 3KKFA 2P9CA 4F4XA 2GQCA 4C0HA 2EFPA 5KG4A 2B51A 2CJQA 3VAIA 4OJ3A 3QGGA 2CFXA 4FZVA 3KLEA 4ELVA 2IA0A 2ADBA 2YKNB 3EGNA 4H54A 3MFIA 5KFEA 1SUQB 5GMKa 4ZCKA 2EC0A 1DJ0A 4LT6A 1I1GA 3BSNA 2GGPB 2B7BB 2BW2A 2YNFB 3AJ2A 3HVTB 4YP3A 1HBNA 4HYKA 1S0NA 1Q4RA 2XSFA 2CQCA 2ZHOA 1YTYA 3H5UA 2IAJB 3H20A 2OPPB 1VBYA 2BVZA 1JLBB 4NA3A 1S76D 1IKVA 1O5JA 1RQ0A 2DHAA 2WOMA 5MLCV 3QLHA 4URQU 3DI6B 4KO0B 1PC4A 2VV5A 1E6VB 1TP7A 2X1BA 4C8MA 4ZVGA 1S48A 3CCJS 2MKJA 4CTAA 3D0GE 3IXQA 1RKJA 5DGBA 3CF5Q 2QA4G 1X5PA 2WBRA 2UVUA 4Q8EA 2RUGA 2OIHA 3M2UA 5LSRA 4ID5B 3UW1A 5F9LA 4WFAQ 1A6LA 2R8KA 2ZOGA 2ZD1B 2CJ9A 1S9EB 3QJJA 1G2EA 4OHWA 2Z0GA 2Z4PA 3HVAA 3KLIA 2BZ2A 3NG8A 1OO0B 2JL9A 4LIRA 3NCPA 2L08A 3J81Y 3JSBA 4FBUA 4DLGA 2DR7A 2N82B 2DO0A 2E1AA 5B09A 1U1OA 1SXLA 2VFUA 5HI7A 4OHVA 1KSPA 4EZ9A 2KO1A 1REVB 4DL6A 4KKOB 3LP2A 1HMVA 3ZZRA 3QJPA 3BF4A 2GMHA 2J9CA 2PN6A 5GADI 4C98A 2MJUA 3H5YA 2FHMA 5BYRA 2CPIA 1VQPS 1XR6A 3MM8A 4ELTA 1CG2A 2LXIA 3ZZZA 5KFDA 1IJFB 4PUOB 1QY7A 3OR1A 4WE1B 3GE9A 2XNRA 1VS3A 2KJWA 5J2PA 1H2VZ 2W7OA 2J9EA 3LP1B 3GYNA 2MY8A 5B0BA 2QSFA 2MKHA 3L3CA 2DHXA 3ONQA 4NLVA 1JIHA 2HGLA 2PGCA 1J2VA 1YVFA 1UFWA 3FSIA 3V6KA 2FHJD 2AD9A 4FF4A 1R0AB 5KFIA 1RJJA 3D54A 3BZQA 3KLVA 2OP5A 2E5GA 1WELA 2WAQD 1Q1KA 4FS1A 4ETZA 5LMUF 4J37A 3DCAA 5KG2A 2MJNA 3PW2A 1LWCA 2WB4A 5EX0A 2EFOA 1IM4A 4ZLPA 2J9DE 3I0SB 3L09A 2EPIA 2YNIA 3OFGA 5KFKA 3MUVP 1OQ6A 3QAUA 2OTJS 2FJVA 2ZNZA 1TK5A 3KLHA 1AROP 3A8EA 3T3FA 2FJBB 4H4OB 1JK9B 1F60B 1WG4A 2XHWA 2BOPA 1HNXF 2C28A 1Z1ZA 1BC6A 4QIFA 2EG1A 3E01B 2DNGA 1SIWB