1RA7A

Poliovirus polymerase with gtp
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for proteolysis-dependent activation of the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
molecule keywords Genome polyprotein
total genus 144
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1ra7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ra7A02
2BANB 4ZVFA 2C28A 1SV5A 2OPRB 3MECB 4PUOA 1HYSA 3HHKA 1S9EB 4ED2A 2FJWA 2XCPA 4NLTA 5FDLB 3OSNA 5L1LA 3I5AA 3KHLA 2OPPA 3NL0A 1RT4A 1GX5A 4NLPA 3M9NB 4RW9B 4MK8A 3DOLA 5J2NB 3NBPB 4DL7A 2CJQA 3HVWA 1S0NA 2R2TA 2FVQA 5KFIA 5T14A 3DLEB 2C2RA 3KK3B 5F8NA 1EETA 2WTFA 3OSPA 3DI6B 1IKXA 4IFVA 1N5YA 1S1WA 3MECA 3MFHA 2R8GA 5CYQB 1BQMB 4PUOB 3GV7B 4Q0BB 4QWEA 3OHBA 3RAQA 3MEDB 5DG9A 4ECXA 1S9GA 4MKAA 3H5YA 2W7PA 4IG0A 1RYRA 3OLAA 4ICLB 2IJFA 4Y3CA 2IJNA 2W9AA 2ZE2B 2IM2A 4KKOA 1S0MA 1VRTA 3KK1A 3BSNA 1TKXB 5KFCA 4Q45A 3LP2B 4F4XA 4KO0B 1JLBA 1TKZB 1UWBB 3CJ2A 1CSJA 4IG3B 3CDEA 4IDKB 3V6HA 5KT2A 3CDWA 5F8LA 3FFIA 2XWYA 4ID5A 1LWFA 3T19A 2I5JB 4PWDB 4ZP6A 1QE1A 1S10A 3HVTA 1FK9B 5K14A 5I3UB 1RT5B 2R2UA 2J6UA 4YR3A 4ZVGA 4I2PA 2IA6A 1S1TB 5JUMA 5KFJA 4FBTA 1KLMA 4WE1B 2IAJB 3DMJB 4EEYA 1QAIA 2W9CB 4H4OA 4K4ZA 1HPZA 2D7SA 1QUVA 3DYAB 2ZD1B 1NHUA 4KO0A 1SV5B 2OPRA 4J9MA 3NAHA 4QWAA 2BQRA 2J6SA 4TN2A 3OL6A 3CDUA 5KFDA 3FFIB 1K1SA 2HNDA 4QWBA 1LW2B 1RTIB 3JYTA 3G6XA 1J5OA 2YKMA 1IKWB 3C6TB 1RT7A 4EO6A 3MTKA 5HROA 1JLCB 1KHVA 2FVCA 4IR1A 5DGBA 2E9TA 3M9MB 5DLFA 1RYSA 1LWEA 2WONB 4Y34A 4ZP9A 4URGA 5C5JA 5KG2A 3QIDA 1HQEB 3IGNA 3TAMA 5C25A 4J9SA 2DPIA 3DRRB 2IMWP 1S1VA 2JC1A 4WXOA 1IKXB 4IFVB 1RTHA 5DQIA 3KLVA 3T5JA 1BQMA 3M8PB 1TKTA 3GV8B 2XGQA 3QO9A 4IQXA 5I42B 2HNDB 2IM1A 2YNGB 1HYSB 4K4XA 3KHHA 1NHVA 5KFNA 3FQKA 3LP0A 3MEGB 1HARA 3MF5A 3JSMA 4ECTA 3UR0A 1SH0A 5FDLA 4EO8A 4FS2A 3QGHA 2WK4A 2HWIA 1HQEA 1JKHA 4RW8A 5CYMA 4YR2A 3KLGB 2R2SA 3KK2A 4O4RA 2RKIA 4MIAA 2BRLA 5DQHA 4TYAA 3GQCA 2UVUA 4RW6A 4LQ9A 3LAKA 1IM4A 4WXWA 4KAIA 3GIMA 2I5JA 5KFBA 2BRKA 1S1WB 3Q8SB 2YNGA 4NLRA 5F8GA 1RA6A 3KK3A 4ED6A 5KFRA 2W8LA 2C2EA 3LP0B 1S6PA 1RAJA 1DTTA 4TQSA 1RT3A 1HQUA 2W7OA 3H2LA 3D5MA 1HNVA 3DLKB 4KV8A 1C0UA 2HMIA 4RUCA 2YNIA 3I0SB 3DLGB 2FLLA 1S9GB 1DLOA 5F8HA 1EP4A 1JLQA 1N6QA 4WFYA 3KHGA 4TY9A 3H40A 2ASDA 1N48A 4PQUA 4RU9A 5F9NA 2FJVA 3HVTB 1I6JA 1MMLA 4IKAA 3KLIB 1T03A 1C2PA 3PJWA 2AX1A 1C0UB 5KG0A 5F8JA 3V6JA 3ITHA 3QIPA 1BQNB 5C24B 2XCAA 1S97A 3SFGA 4RW9A 4G3IA 4Q8FA 1TP7A 3RBEA 2IM3A 4NRUA 5J2PA 2FVSA 4X2BA 2XI3A 4RW7A 1S1TA 2YNFB 4MH8A 2ASJA 4B3OB 1LW0A 4QW8A 2IC3A 3NGDA 2AQ4A 3H5SA 3PHEA 3DDKA 5D3GA 3UQSA 1LW2A 3VQSA 4KSEB 4QWDA 3UPFA 4RNNA 4ZP8A 4Q0BA 5KFQA 3G6YA 1JKHB 4RW8B 1S1UA 3IG1B 1IKWA 3C6TA 3GV5B 2B43A 4ECZA 3OL8A 5DG7A 2ALZA 1RT2A 4M94A 4KFBA 5DG8A 1TL3A 4XPEA 5KG6A 2ILYA 1TKTB 5EWFA 4ZHRA 3PW4A 1OS5A 3N6NA 3KLHB 3PZPA 2RF2B 3BR9A 3OHAA 2YNHB 4LSLB 3PW2A 1VRUB 2HNYB 3DOKB 4NCGB 1IKVA 4H4MA 3QYYA 3MFIA 4J9PA 5K14B 4EBCA 5KFHA 5I3UA 2I1RA 3PW7A 1T3NA 2R8KA 4J9KA 4LSNB 3MEGA 3JSMB 3H4BA 2DPJA 2VA2A 3GIJA 3HKWA 2VG6B 1RT2B 2VG7A 3LALA 2FJXA 5L1IA 2WB4A 4F4ZA 4EBDA 1LWCA 4H4OB 3DYAA 4RW6B 1C1CA 5KFTA 3Q8PB 4WZQA 1MU2B 2WRMA 1DTQA 3H4DA 4EYIB 4ZP7A 2IM0A 3PW5A 3KLHA 2VA3A 4O4GB 3C6UA 1JLFA 4JUZA 3G6VA 4ECVA 2JEFA 2E9RX 5KFGA 1T03B 3MEEB 1VRUA 3DOKA 4NCGA 3V6DB 1ZTTA 1TQLA 3KNAA 3RAXA 3DM2B 3BQ1A 4ECRA 2D3UA 4MK9A 4ZVHA 5KFVA 5KT5A 1RTJA 1S6PB 3E01B 2OPSA 3DRPA 3IN5A 2VG7B 2VG6A 3CJ4A 3Q8RB 3V4IA 3HVAA 1UWBA 1C0TA 4IG3A 2FLNA 3I5CA 4IH5A 4OL8A 3IRXB 4G1QB 4ZMMA 3RB6A 1JLAA 4I2QB 2QE5A 3DOLB 3EZUA 2D3ZA 3ISNC 3NBPA 5J2QA 3IGVA 1XR6A 1DLOB 1S48A 4YMEA 3N6MA 2E9ZA 4ECQA 4TY8B 4O4GA 4FBUA 3H98A 1RT6B 3ISND 5KFSA 2WCXA 3PR5B 4I2PB 3V6DA 5KFAA 1S0OA 4MFBB 3KLFB 4ED8A 3PVXA 1RT1A 4R5PB 1RTDA 4K4SA 3ITHB 3QIPB 1S6QA 5C24A 1HNIA 4NLDA 4DG1A 3KLIA 3KLEA 1W25A 1IKYA 3N6LA 4F50A 4NLOA 1RTIA 3JYTB 4IRKA 1VRTB 2YNHA 4LSLA 2AX0A 2GC8A 3BSOA 3QLHB 4KE5A 4RW7B 4ZPAA 5D3GB 4TY8A 4NLWA 5KFMA 1TV6A 5HBMA 3BSAA 3FSIA 3CJ5A 1XR7A 1TVRB 1R0AA 1LWFB 3FQLA 5KG4A 2OPPB 4I7FB 4O44B 3QZ8A 3DLGA 3MR6A 4K4YA 5KFYA 5DQGA 2F8EX 3EPIA 4R0EA 3M8PA 4TYBA 5L1JA 4K4UA 2GIQA 4K4WA 2AU0A 2UUWA 4KFBB 3LP1B 1T94A 2FLPA 4IR9A 3MEEA 2W9CA 3E51A 4IH6A 2HAIA 2RF2A 2R8HA 4TLRA 2UVVA 2VG5A 3BGRA 4ZHRB 2V9WA 3KHRA 3CIZA 5CYMB 3KLGA 1S1XA 4Y2AA 1FKOA 5KG1A 3H5XA 4EYHB 2BE2A 3KMSA 1BQNA 2FVPA 3RBDA 3IS9A 5KT4A 1JLAB 2UUTA 2JLEA 2YNFA 1C1CB 5JXSA 2R8JA 1TKZA 4QPXA 5KFEA 3T5HA 5HP1A 4O3QA 4DL6A 4RNMA 3H5UA 2AWZA 4J9OA 4M95A 3KJVA 4FS1A 1JLEA 4IRDA 1RT1B 5KG5A 4KHRA 4R5PA 2W9BA 1RTDB 4Q8EA 1FK9A 5I42A 1RT5A 2ASLA 5J2NA 3H59A 3T5KA 3DRSA 4TXSA 3ICLA 3T5LA 1C0TB 4WYLA 2HNZB 3G86A 4IH7A 1K1QA 4O3PA 2V4RA 1TL3B 4JV2A 4ED7A 3GIKA 3QGGA 2D41A 4NYZA 5KT7A 2YKNB 4R8UA 4IOBA 4DL5A 2BQUA 3OL9A 3V81B 5DLGA 3M8QA 4YR0A 1ZETA 1RDRA 3GIIA 4WFXA 4K4TA 1S49A 4IG0B 4ED3A 1IKVB 4H4MB 4O44A 2W8KA 3BQ0A 4J9NA 1T05A 3PJXA 2JEGA 3KK1B 3NMAA 5J2PB 4LSNA 1D0EA 1S6QB 1HNIB 2GIRA 3TAMB 2R2RA 5C25B 4IFYB 2RDJA 1JX4A 4MIBA 1LW0B 4O3RA 2IC3B 3LAMA 4URSA 4O3SA 1Z4UA 4LQ3A 2YNIB 3I0SA 1FKPA 1HMVB 3I0RB 5J1EA 5KFPA 4Q43A 4ECSA 3NAIA 5J2MA 2BR0A 4ECWA 3QO9B 5EWGA 3D28A 3RB0A 2AGOA 3V81A 1S1UB 3IG1A 4RW4A 4J9RA 3DM2A 1TVRA 3CJ3A 1S4FA 2R8IA 2IAJA 3RB4A 4RUAA 1RTJB 1ZTWA 2JEIA 2OPSB 3DRPB 5KFUA 5KT3A 5KT6A 3MEDA 1KHWA 4NZ0A 1NNDA 1QAJA 2RKIB 1U09A 4XO0A 2UVRA 3MR3A 4O3OA 2CKWA 4I2QA 1REVA 2YKMB 2XGPA 3T1AA 1RT7B 2AGPA 5HLFA 2O5DA 1J5OB 1YVFA 2OPQA 4MKBA 4QWCA 3CWJA 3LP1A 2VG5B 4YQWA 2V0NA 5L9XA 1RT3B 4HYKA 5C42A 5KG3A 2HMIB 3KMQA 1RTHB 3BGRB 4RNOA 4F4WA 4RZRA 3IS9B 4XPCA 2XI2A 1FKOB 3CO9A 4GC7A 1EP4B 1JLQB 4KB7A 1N6QB 3NKYA 3DLEA 4WE1A 1D1UA 3PR4A 4NLXA 1T05B 4NRTA 4NLUA 4KBIA 1JLGB 5KFZA 3BREA 5HP1B 1TV6B 5HBMB 5KFFA 4DL4A 1JIHA 2WOMB 4JV0A 5KFLA 4ECUA 1JLEB 4ZPBA 5EWEA 4EBEA 1TL1B 4ZPCA 3UDLA 4U6PA 2HNZA 4RNFA 4K50A 2BQ3A 2B5JA 2UVWA 2OH2A 4Y2CA 3QZ7A 3PW0A 5DGAA 4B3OA 1RT6A 1C1BA 1S9EA 3RB3A 2C2DA 1LWCB 1DTTB 4MFBA 3KLFA 4ID5B 2AGQA 4KV8B 1WNEA 1DTQB 2YKNA 4R8UB 3GYNA 4WZMA 4ZPDA 3TVKA 2JEJA 2ILZA 5F8IA 3V6KA 2IBKA 3KLEB 2JC0A 1XR5A 1RT4B 1KLMB 4URQU 4J9LA 4ECYA 1EETB 3BSCA 4IRCA 3BQ2A 5HLFB 2FVRA 4Q44A 1FKPB 1HMVA 4IFYA 3BJYA 4HKQA 4NLGA 3KK2B 4PQUB 3Q8QB 3IRXA 5F8MA 5J1EB 1R0AB 2EC0A 4RNHA 3MR5A 5C42B 4DL3A 5J2QB 1SUQA 2XC9A 1JLCA 4NLVA 4ZVEA 3QGIA 2J6TA 4RW4B 1TKXA 3KOAA 4ICLA 2ATLA 5EUHA 4IDKA 1HNVB 3DLKA 4KHMA 4QW9A 2WHOA 1SH2A 3LP2A 1JLGA 5KFWA 4TQRA 4NLYA 4NLSA 4WFZA 4K4VA 1RA7A 1S9FA 3C6UB 2B6AB 1JLFB 3SFUA 1S1XB 1REVB 3DI6A 3FRZA 3OL7A 2C22A 1SUQB 1N5YB 3QLHA 1QE1B 4NLQA 2V4QA 5CYQA 3CVKA 5KFKA 2B5JB 4YP3A 5L1KA 1HPZB 2RDIA 3E01A 5KFOA 3V4IB 2ZKUA 1N56A 4DL2A 4JV1A 3FDSA 4I7FA 4G1QA 4DEZA 3OLBA 3I0RA 5J2MB 3KJVB 2ZD1A 2ZE2A 4KKOB 4ED1A 3TQ1A 2HNYA 1N4LA 2W9BB 2BANA 2B6AA 1JLBB 5EDWA 3DRSB 4GC6A 4J9QA 5HROB 1HQUB 3MR2A 5F9LA 3DRRA 1SH3A 1S1VB 3M9OB 4MK7A 4ED0A 4PWDA 4O3NA 1TL1A 3SI8A 1LWEB 2WONA 2QV6A 4DG1B 4H54A 1JXLA 2WOMA 1MU2A 3I5BA 3CJ0A 2BE2B 1GX6A 5KFXA 3EPGA 1IKYB 2HWHA 1C1BB 3M8QB 4U7CA 3GILA 3DMJA 3LANA 4F4YA 4WYWA 2OPQB 5KG7A
chains in the Genus database with same CATH superfamily
2BANB 1OQ3A 4ZVFA 2OPRB 3MECB 3VHQA 4UZCA 5GMEA 3W3SA 4ZCMA 4DV1J 1HBUB 2P6SA 4DV6F 3KUHA 1M5VC 2FJDB 3I5AA 3RYLA 2GA7A 2MQMA 2NCKL 2OPPA 4DPTA 3J80U 4TU7A 2MTLA 4NLPA 3CC2S 4DUTA 3AY0A 4S0MA 2A6OA 3SMZA 5CZVA 1X8DA 1XIQA 3FEXB 2BOPA 5FJ4A 2FVQA 2V5HG 5T14A 3PKMA 1XTZA 2H5EA 3NY0A 2K7KA 1U1LA 1H74A 4H4KC 3JSBA 2C2KB 3D6HB 5EX3A 4OYPA 4FKYA 2VUGA 3MECA 1M5OC 4DQIA 1F1BB 3D7SB 4WP3A 4DR4F 5DG9A 2E1MC 1FT8A 5D15A 3T6BA 2W7PA 2VIHA 1WF1A 4IG0A 4DR1J 5DDOC 2HGLA 3R6LB 4ICLB 3O3LA 4P71A 4CM2A 2AIRB 2RRAA 1UW4A 1RWUA 3FC9A 5D77A 5AT1B 5H9FK 2GS8A 4J91A 1BWVA 3LP2B 4C9DA 1FWLA 4KO0B 2JZ5A 3CJ2A 3VAHA 3TX8A 3W63A 2X51A 2DVIA 3DLBA 1ZM3A 4AL5A 3UN3A 1FRJA 4JYAJ 2HQFA 2DCUB 1LWFA 2VC1A 4M63A 1M5KC 1BGXT 1ZM4A 2VKRA 1QE1A 2XNQA 3HHLC 3HVTA 5K14A 1KTVA 3SSSA 2LEBA 1F0XA 3GFZA 2HW3A 4Y2IA 2CDRB 1RAEB 4KTQA 1S1TB 2HHXA 4KR0B 3TUZC 2C42A 3BPDA 3QRQA 4F3QA 1VQSA 4EEYA 2ZJPQ 2D1CA 2CJBA 2JLGA 4KO0A 1H2VZ 3GPAA 3Q83A 1B99A 5A8WA 2FGCA 3M6XA 1K1SA 4QWBA 4ELUA 1RTIB 4ED4A 3G6XA 2YKMA 1HBMB 3M05A 1RT7A 1YIJS 4ZVTB 1VQKS 5HROA 1JLCB 2Y0BB 5D6GA 1KHVA 3L7PA 1T7PA 3CD0A 1Q5YA 4E8UA 2R7QA 2E9TA 4KT0C 1RYSA 4RUBA 1I94F 1FESA 5KG2A 1XMQF 2DPIA 3OR1B 3OFEA 1SJ3P 1S1VA 2J9CA 3UD5A 4C3LA 4EWTA 5DQIA 3ZXWA 1N36F 4RU2A 3MPDA 1AZSB 1ZS6A 3ENAA 4N5SA 3HHDA 1NSKL 3TP2A 4LF8F 1DJ0A 4WU3A 2RIJA 2HBRB 4LJMA 5DZ6A 2A2CA 1V5VA 2OGUA 4AL7A 1D8YA 2YNGB 1V3SA 4K4XA 1YZ7A 4BS2A 3IM9A 3KHHA 1YZ6A 2G4BA 3LP0A 3GJRB 1N8RT 5IZHA 1NLKL 3UR0A 2PO4A 2E5LF 2UXBJ 1KQGB 2XY5A 1X5OA 4UY85 5K8MA 1A6LA 2QL5B 2HQCA 3OR1A 4YR2A 1BWEA 1W26A 2WZ1A 2GVZB 3M4XA 3GQCA 2BRLA 2A2DA 3CMES 4QBUA 1C4AA 1CJKA 2NYIA 1R0BG 2R7TA 2I5JA 2IBOA 1YJRA 2QC3A 2W2MP 1L5UA 1VC5A 2DISA 4WTYA 2BE9B 5F8GA 2B4VA 1RA6A 1XQIA 2YNGA 3EVMA 3UI3A 2RQMA 3LP0B 2W8LA 4F3OA 4BLGA 1B3TA 4LBPA 3BDPA 4NXNF 1PSDA 2XS5A 2VBZA 4OZ5A 3DLKB 2LEAA 3UN5A 1VBXA 1C0UA 3I0SB 3Q89A 3QWPA 5CD4H 2L48A 1SL1A 4ANDA 1PBAA 1UJ6A 2C3YA 2M8HA 3M2UB 4ER8A 2FLLA 5F8HA 3D68A 4Z7YA 1JLQA 3HHLB 3UDEA 1J27A 2ZHBA 5M2PA 3WIVA 2OUGA 3EVWA 1PILA 1B64A 3H40A 2G1HA 2M5YA 4OZNA 1Q82T 1K44A 2HQDA 5B0GA 4LF5F 2NPIA 2ASDA 1RBOB 1RP5A 4UY8T 5F9NA 2XO6A 1VQLS 2AYEA 2GMLA 2M52A 3ILJA 4C6AA 4LF8J 1B7FA 1U1MA 2ZDPA 2NYHA 2CIMA 4DR3J 1ZAXA 4ZVSB 1T9YA 1C0UB 2AX1A 3QIPA 1VIOA 2Q79A 5C24B 3SEOA 2MQOA 4M5JA 3GTYX 4RW9A 4Q8FA 2BBEA 1TP7A 3G9CA 2HFZA 2ZC4A 3MMCA 5H9FJ 4C8KA 3HHLA 2ASJA 3FZ2A 2K1RB 1ZZNA 4PXBA 3C14B 3HSZA 3NGDA 2AQ4A 3PKYA 2H1YA 1HLWA 1KP6A 2DRAA 1LW2A 2HZAA 2HSEB 3UPFA 4CNYA 2FJAB 2OEKA 2ZNZA 2AV5A 3ENQA 4U7UK 4CLZA 4N76A 3NNAA 2ABYA 5DZ7A 3G6YA 1QJHA 2KJVA 3N4WA 4NA1A 4PQAA 3R7SB 5IXUA 5KTQA 3NGSA 5DG7A 3OL8A 2ALZA 3BN7A 3TNVA 3T1HJ 2CJXB 2Z4PA 3QGPA 1LEOA 3R1LA 1TMJA 2YQ3A 3OR2A 4K5RA 1TL3A 1VLOA 3BGLA 4DN9A 2LMIA 5GAGU 4ZLJA 3H25A 4JI3F 2GAHC 3I4PA 1VISA 1B0PA 3R1HA 1E6YB 2WSCC 1OS5A 2DKOB 2RVJA 2WW4A 3KLHB 2XQCA 4C8LA 1H73A 1GMUA 4QR0A 2V68A 4LSLB 4NA2A 2QMUB 4NCGB 3OHAA 1IKVA 2B56A 3NGTA 3QYYA 5I3UA 2CFXA 4B17A 1T3NA 4HT5A 2DGVA 3MEGA 2P5VA 2OFHX 2F1FA 3OV7A 2OP5A 1NHKL 3PYGA 5LT5A 5DDQC 3PCOB 2FDNA 2FHOB 2G1DA 1NRKA 1C1CA 2I38A 2RE1A 4HTIA 1DHMA 1WI8A 5LL6d 3MEKA 3H4DA 1AUSL 2EFOA 5E33A 4DSJA 3RAMA 4CQ1A 3KLHA 4O4GB 3C6UA 3DLHA 4L73A 4ECVA 3CULA 1U48A 3K5MA 2GQQA 3MEEB 1WELA 4MTPA 4NCGA 1I1GA 5IM0A 1TQLA 4LREA 5D0EA 3R5AA 2BE7D 3BQ1A 4DF8A 4B3TJ 2U2FA 2NR0A 4MK9A 1WORA 2MKYA 5ETNA 4PKDB 1RTJA 1S6PB 3PJ9A 5IT4A 4CLKA 4G1PA 5K9FA 2X7IA 3J7YU 1VLYA 3W65A 3HVAA 4IG3A 1UMJA 2J76E 4DU7A 2IY5B 3KG4A 4ILRA 1RU2A 1D3WA 2MZTA 3MMAB 3RB6A 5GVQA 3OJUA 2D3ZA 5J2QA 1J5OA 1DLOB 4NXMF 2XTCA 2E9ZA 2FC8A 3BBFA 3AX3A 3FJ2A 3KKFA 1WC5A 1R8PA 4O4GA 3MPUB 4WPAA 5LOQA 1KC8T 1AYEA 4I2PB 1OY9A 2OAUA 1N36J 1FKAF 1HWKA 2FYXA 2PFDA 1WI6A 2VPWB 4MFBB 4P52A 4KGZB 3E8OA 3FGVA 3ITHB 3S7RA 1R6VA 4DG1A 3M7VA 3D66A 3LWMA 1K9MT 3UO0A 3AOAA 3KFWX 5CHCB 2WAQD 1Q1KA 2M2BA 3HSGA 3N6LA 4TVAB 5CZXA 2L9WA 3RBZA 1NJIT 2HHWA 5T7LA 2PE8A 2YNHA 2N4CA 4XAKA 2VBYA 5ETRA 1L3VA 2Z2LA 1FJEB 3WQPA 4FF1A 3W5YA 4ENOA 2VICA 3HZEA 3MCOA 5F0WA 3A12A 2HVEA 2CZ9A 2YKQA 5E2QA 1TVRB 3W2WA 2UXBF 3R9LA 1LWFB 3ZTQA 4I7FB 2KM8B 4FF2A 4J9UE 1HHSA 2MKIA 1H2UX 4J5OA 3BGUA 4DV4F 2AYGA 2DRDA 2V2KA 3KWMA 4U67Q 2ZUGA 3EPIA 4NE9C 4R0EA 1CJVA 1KFSA 1AB8A 1DBDA 2X1BA 1Y5IB 4DQQA 2UUWA 1TL7A 2MKHA 1T94A 3LP1B 4YFUA 2K3IA 2P6TA 3HI9A 4IO9Q 2FLPA 2DR5A 3IA0A 1RLCL 3MUVP 1SKRA 2YH1A 2RF2A 2YPZA 2ZEJA 4JP8A 3DXBA 2R8HA 4F67A 1PG5B 1SIWB 3BGRA 2ZJRQ 1A9NB 4OLPA 2HQIA 2AJ0A 3MGJA 1TL5A 5L46A 3K2YA 4DV0F 1FKOA 4EYHB 1PO6A 4DR7J 4DR1F 3CJKA 3ILIA 2QA4S 2UUTA 4CO3A 4KJIA 2Q66A 4ELVA 2LECA 1X4FA 1KFDA 1WHWA 2A0FB 2DB1A 2YNFA 3UR3C 1TKZA 3OVSA 2DO0A 2DK2A 2Z0GA 5IT9U 4JI7F 2OSRA 1S0VA 4JI0F 4J9OA 2BMBA 3M2VA 4TU8A 1JLEA 1PAEX 1WKLA 1RT1B 2ZOGA 3M8YA 3MR7A 2VFSA 3N9UC 5DS7A 5LXYA 2CPJA 1K73T 5LMNF 1RTDB 4B9UA 4Q8EA 1BQXA 1RT5A 2FC9A 3M2RB 5L8RC 1QVGR 3H59A 3R6GB 1GMVA 2XSJB 2AW0A 3DRSA 3CCES 3CCJS 3T5KA 1IBMF 2CJAA 3Q86A 2QA1A 1MLAA 2HNZB 3G86A 4CDIA 2RT3A 3BKTA 2MGZA 1K1QA 3WC2A 1F5BA 1OQ6A 3BM7A 3TZWA 1NB2A 3BEGB 3L95X 2YKNB 3V5RA 4I6YA 3GFXA 2ROEA 2CDQA 3NCQA 2XLIA 2VPZB 5AE1A 5EGYA 1RDRA 3HF5A 1LXJA 3PV8A 2HG4A 3BQ0A 2W8KA 3P45B 3PJXA 1NAQA 1AA1B 3TEHB 3R7NB 2JEGA 1GH8A 2R7UA 1TMMA 3FBFA 3PRVA 4NX9A 1ZM2A 3TAMB 1RAOA 2R2RA 4IFYB 1JX4A 4DV5F 3MCNA 4KH1B 1VK8A 4O3RA 2IC3B 3LAMA 4HDHA 4URSA 4Y28C 3A13A 1FE4A 3I0SA 3MCMA 3OD2A 1FKPA 1WG5A 2DNNA 5J1EA 4ECSA 3CCRS 2BR0A 4ZVOB 4PXDA 1IR1A 1X4GA 4OYWA 3SCJE 4DMZA 5M2UA 5IOLA 5IC4B 4NYOA 1UFLA 2MZSA 4ZLNA 5JVGQ 2HRTA 5KOXA 4KHPF 1V3ZA 5LSOA 5JMNA 2AKWB 2HKEA 2OD4A 3FUYA 3DM2A 3GZ7A 3D3BJ 4L3KA 3TR5A 4DPXA 5A0YB 5B09A 1VQMS 1KOHA 3DRPB 3LPEA 3SQGB 2Q3PA 1KHWA 2PI5A 1HBNA 3CF5Q 2UVRA 3MR3A 4O3OA 4ID8A 5K8NA 3NWGA 2CWXA 4C4WA 3H20A 3PO5A 3MUMP 2RS8A 4BWJA 8AT1B 4MKBA 4V19X 4QWCA 3O2IA 1T9UA 1U1RA 3CMQA 3LF0A 4MAKA 5A8RA 5L9XA 1HNXF 2AJ4A 2IYGA 2DR6A 5C42A 1RAFB 1RAGB 2BJ9A 2EK1A 2GMJA 4WBFA 4XK8C 3QQCD 3KMQA 4Q7AA 4X66J 4F4WA 4K0KJ 3IBCB 4RZRA 1V9OA 2DHAA 2C1EB 2DNOA 2V8HA 4R0JA 4XPCA 3ZZUA 5DRKA 1O8BA 1RWNB 4JI8J 2DIVA 1N6QB 1HKAA 4KB7A 4JI2J 4FPRA 4JI5J 3IWLA 4GKKF 3DLEA 1QD1A 4WE1A 4WWSA 3TZZA 4OI3A 5H1SV 3K58A 1TKDA 4OJ1A 5IV4A 1G4CA 1WEYA 2RQKA 2PMHA 3HHNB 5KFZA 2O66A 4UOHA 3J81Y 3TZXA 2LFVA 1HQ2A 4LRDA 1HWUA 5KFFA 2H5JB 1QLNA 1Q8KA 2NS1B 2YWHA 1HIYA 5C2CA 1WTBA 1IR0A 1REGX 2Y9HA 5J1PA 2IJRA 2QMWA 4ZN1A 2RU3A 2WBMA 3UDLA 4EBEA 2CQ1A 2F4VF 2DJWA 2QYGA 4RNFA 4USHA 4C8ZA 2BKOA 5DO2A 2BQ3A 2EVZA 1VBKA 3CCZA 4GVBB 2Q1LA 3B4MA 3I82A 4E98A 4DUYJ 1UVIA 1C1BA 4OJ3A 3VGTA 3RB3A 1S4EA 2C2DA 2G9OA 1DTTB 1TAQA 5D0GA 4UT4A 1FE0A 2CQIA 4HHUA 2VJUA 4ANCA 4ID5B 4KRWA 4X4TA 2KXFA 4DFMA 4OV1A 2KYXA 3K5OA 1VQPS 4WZMA 5HVFA 4DSEA 1XNQF 1R31A 1Q8IA 4HLBA 4NWBA 4OYAA 5IV3A 3TZYA 2RU9A 3GP9A 4I56A 1DRZA 2IBKA 3KLEB 1FX4A 5HK4A 1NK5A 1FFSB 4URQU 3FBBA 4J9LA 2CPDA 4LVOP 2GZOA 4IRCA 5HLFB 2FVRA 3HJFA 3UNGC 1EX8A 4JI6J 3PYEA 2V34A 1F3VA 3EDQB 1Y3JA 4HKQA 2OLWA 4ILLA 3Q8QB 3DU5A 4DLEA 4ZVPB 3GJTB 2F7VA 5F8MA 3JSRA 4DX7A 2EC0A 2CUYA 2DGWA 4RNHA 3HT3A 1T9VA 2XZDB 4DL3A 2IVMA 5J2QB 3IAM9 1X4DA 3IWXA 3PRDA 4OYZA 5BYSA 3MURP 4ZVEA 2BM1A 1PGZA 2J6TA 2YKAA 4O0IA 3KOAA 2A18A 2V94A 2DY9A 2UUAF 1HNVB 2QA4G 1FFWB 3TQEA 1CC8A 4DV3J 2E7XA 2E1RA 1JLGA 2AZ1A 2LXIA 4X4SA 4TQRA 1WJ9A 1KRPA 3M6WA 2PN6A 1RA7A 2EKYA 4HVZA 5ETKA 5IWAJ 2XZWA 2KFYA 1S9FA 1PAUB 3IAS9 4KGKA 1UA0A 1F2HA 1WTFA 1YSJA 1VJQA 1REVB 4JOUA 1F9EB 3OL7A 3EWGA 3GFHA 1VOMA 5KOWA 5LJ3Y 1Y00A 3R27A 4UOGA 1DURA 3W64A 3CVKA 4CO5A 5KFKA 4YP3A 5L1KA 4LVNP 1TFYA 4DCPB 4NCBA 2B9EA 3B4DA 3E01A 4GKJJ 1S12A 2ZKUA 4FVCA 3AB4B 1JNRB 5A6PA 3QSYB 4I7FA 4ZOSA 2BJ8A 2B8QA 3I0RA 5HMXA 4Y0FA 3KJVB 1D09B 1YJUA 2ZD1A 5B7WA 4ED1A 3MPYA 2HIYA 1H6KX 1TK8A 2VBWA 2BKPA 3X1LB 5LMUJ 4J7CA 3HP6A 5EDWA 2KHCA 1OWXA 4K8RA 1HQUB 2EEYA 2OEMA 4DZDA 4OLOA 1S1VB 5ETSA 5A8KA 4R25A 4ED0A 1SC4B 1IBLF 4PWDA 1LWEB 4N7TA 3TUIC 2XY7A 3H7HB 1WSVA 3BGFA 2J0XA 1X0PA 4ZPTR 1WWHA 1VC0A 2WOMA 3DCAA 2E44A 3BR8A 2L9NA 3CJ0A 3IBWA 4CO0A 4UQTA 1IKYB 2LU1A 2M9KA 3M8QB 4CLUA 1IBKJ 3DRXA 1Q78A 3LANA 2OPQB 2KM8C 1YBAA 3RZAA 4ALZA 1SV5A 4PUOA 3RTVA 3CMAS 3HHKA 2VQFF 4OZ3A 4DQSA 2OFGX 3A8KA 4QYZJ 3MM8B 1U26A 1Y4ZB 4NLTA 2GAGC 5FDLB 5L1LA 2UZAA 2CG8A 1U4BA 2HHHF 4Q2LA 3KHLA 2FJEB 4HL9A 1RT4A 1GX5A 2H54B 1BXNA 3HFKA 4CYUA 2DO4A 5A76A 4N56A 3MDFA 3NBPB 3FEZA 5HQLA 3G4SS 3HVWA 3PTWA 1WDTA 2DR8A 1S0NA 2R2TA 3SSRA 5LXRA 3W9JA 1U6BA 2UXCJ 5F8NA 1EETA 2DH7A 2WTFA 3DI6B 1IKXA 4IFVA 3CXCR 3OSPA 2X1FA 2HVHA 3OXLA 1QSLA 1M90T 2E66A 2KN4A 3M30A 3MFHA 4PUOB 4AUKA 1BQMB 3D6FB 3GV7B 2BVZA 1EQ0A 2HRUA 4ZVQB 4QWEA 4OI4A 1FNXH 2GHPA 3JXOA 2C2ZB 4ECXA 2D9PA 4MKAA 4RWWA 3H5YA 3CCWA 3HLUA 5ETPA 2ZE2B 4KKOA 2W24A 4Q5VA 1VRTA 4I6AA 1S0MA 4QU6A 1TKXB 4DSIA 3W5XA 4OX9J 2Y1RI 4LF6F 4DN0A 4ATNA 3CDEA 1S57A 4IDKB 5KT2A 3P49B 3CDWA 5E3AA 2UU9F 4HT7A 1HA1A 2HAFA 2HWTA 2C2MB 1V5IB 4GKKJ 4ZP6A 1S10A 2GMHA 1FK9B 4X4RA 2R2UA 2WVEA 2YPYA 2FD2A 3RR8A 3J7A1 3PEJA 1UKUA 4HDGA 4ELTA 5KFJA 4FBTA 1NBEB 4WIQA 1KLMA 1F60B 2CA9A 2RHSB 3UCGA 3DMJB 2HVIA 4F4KA 4K4ZA 1QUVA 3TYTA 4A8MP 1WUUA 2OPRA 3NAHA 2MPUA 1XMOJ 1ZH5A 4CZCA 4OIXA 2HNDA 1VR6A 4UOCA 1K47A 2GX8A 4J9VA 4DR5J 2MZRA 3HD2A 2K7JA 2WONB 4Y34A 1M5SA 3DHXA 3ILLA 4OYMA 3FEYB 2XYHB 3MAAA 4KPYA 1MW7A 2MZQA 1M1KT 2DHHA 2VB6A 1RHJB 1QDUB 3US5A 5GAEU 1UETA 2E5IA 2KT3A 1TUGB 3KLVA 1YJTA 2HFUA 1RAHB 2HURA 3I6PA 1RZMA 4HACB 4ZITA 4X65J 2YH0A 2I2YA 1RI7A 1OSDA 4U7UD 1BY9A 3GV8B 3KYLA 2XGQA 2DIUA 2ZVSA 3RRGA 2DCLA 2HNDB 2D3OR 1NHVA 1G7CB 2HS4A 3MEGB 1HARA 2ATCB 1F6TA 2BUNA 2VOOA 4EO8A 5K8PA 2W4PA 2HHVA 2YX4A 4AYBD 1AW0A 4B9TA 4CNZA 1BE4A 3CO0P 1G3OA 3GLJA 1I51B 2Q6BA 2BX6A 1B0TA 1JKHA 2OELA 4RW8A 1QM9A 4UUXA 3H2UB 4PWUA 5CYMA 3KLGB 3KK2A 4O4RA 2JVOA 2MZJA 4P10A 5DQHA 1KEKA 4CTAB 3T1YJ 1SIZA 1WG4A 2KT5A 4LQ9A 4M5LA 4YS2A 3GIMA 2W01A 5L38A 4X4PA 4K2JA 2BRKA 4CO4A 2XYPB 1NXIA 3QWUA 4ED6A 3KK3A 4A47A 6FDRA 3BO3A 1S6PA 1S79A 1DTTA 4B02A 2VJVA 1YTYA 1RT3A 4DPWA 3D5MA 2HRYA 3FCVA 2V2ZA 3A1YG 1ZZFA 2HMIA 1IQTA 3W66A 1MMNA 1RLDA 1IBMJ 5ETLA 1U02A 1S9GB 1DLOA 5LMNJ 4K59A 1R7IA 2F63A 3CTRA 2XMJA 3FZBA 5CXTA 3EYZA 1VMBA 1APSA 2B4OA 2B9XA 2GV1A 4TY9A 2AD9A 4UQGA 4JI0J 1N52B 1RCOB 1SBRA 2UUBF 1JMTA 3NGRA 4XTTA 4YUDA 4TU9A 3PY8A 2QT7A 4QYRA 4FYYB 3QJJA 4ZJLA 1PYTA 1R8HA 4FKXA 5B0DA 3MUTP 3VR1A 3HVTB 4HI1A 3LOUA 5I4MA 1C2PA 3PJWA 1S7HA 2P2CB 4IYQA 5F8JA 4CLYA 2HMIB 2ZH7A 3SFGA 3Q8UA 3TOQA 1URNA 4DV0J 3RBEA 2BZ2A 5J2PA 2FVSA 3TA0A 2XI3A 1UAWA 3LGNA 2FHKA 4B3OB 3CT9A 1PJ6A 4EFAC 2MXYA 4NEZA 2Z2ZA 1EZZB 4L72B 2IRYA 4YDDB 4X4VA 5D3GA 3F44A 1X9MA 4KSEB 3D1OA 1VQNS 3K5LA 3EE3A 7FDRA 2VQEF 3N5BA 3Q2SC 4U95A 1S1UA 1S99A 2OTJS 3IG1B 1IKWA 3C6TA 4D3HA 2APOA 5ADZA 4DV4J 4ECZA 1TL7B 1K0VA 2EFNA 5FD1A 4DFKA 1G2EA 1CPZA 1WD6A 2IDLA 1IWAA 5KG6A 1EB0A 5D0RA 1S7IA 2OMOA 2EFVA 1Q5VA 3PW4A 3N6NA 2IMOA 2WW8A 3UNYA 4CIOA 2F5GA 1FEEA 2X3DA 2DNHA 1O6XA 3C66A 3PW2A 3QSIA 3DOKB 3PYFA 1C4CA 1YRXA 1H0HB 1OPZA 5K14B 1M0SA 1NSPA 3JSYA 4BC7A 2VFVA 5CAAA 3PW7A 1FDBA 1R6YA 3BYPA 4LSNB 3W9IA 2QFJA 3CJQA 1NCLA 5JVHQ 2VG6B 3J81j 4OJHA 2FJXA 1VQ8S 2WB4A 4EBDA 3D67A 5A8KB 4OZJA 4B3MF 3S6EA 4MJKA 3DKDA 4OHXA 3RG6A 1YDLA 4EYIB 3PNIA 4LR8A 3QATA 5ETQA 4FYDA 1N5VA 3I87A 1JLFA 3QFWA 2J7WA 2L08A 2JDJA 1FJCA 4CM0A 3CPWR 3DOKA 1FRIA 4W98A 3AT1B 2VHGA 5G0RB 3KNAA 1N0VC 1V6HA 3R5BA 2XM3A 3V6DB 4ECRA 4ZVHA 5KFVA 3DHWC 4DV7F 2BXJA 3DFEA 4PG7A 2RMLA 2VG6A 3ISZA 3V4IA 1UWBA 2QFIA 1GTHA 3BV8A 3GSDA 4DI6A 3J7AN 3GMGA 3IRXB 4G1QB 3GR1A 5SZTA 2ZH3A 4PABA 1WDDA 4JV5J 3HK2A 5D0HA 2QE5A 3ZZRA 3EZUA 2PEHA 2J9DA 3NBPA 3A3NB 4FNHA 1XR6A 1X7VA 3TA1A 3ZZPA 4YMEA 8ATCB 5DETA 4DUZJ 4ECQA 1NJZA 3ISND 2CQ4A 2KFZA 1Q7LB 5HN0A 3PR5B 3POTA 3R97A 1DFDA 2QO3A 4DZ6A 3V6DA 3N5FA 5G0RA 5KFAA 3Q2TC 2EKNA 1S0OA 3KLFB 1EIYB 4C2MA 4NMLA 4OX7A 3UE2A 2V63A 1RKJA 3QIPB 1S6QA 5GMDA 5C24A 1HNIA 1RXOB 1RACB 3CCUS 2L3MA 2LA4A 2XG8A 4DS5A 3M32A 2GO9A 3U1MA 3KLIA 1RUSA 2VD3A 1W25A 2BJ1A 3ZO7A 3O6QA 2XMAA 3JYTB 3QRRA 4X4QA 1VRTB 2XHWA 4LSLA 2AX0A 4LBHA 2NXJA 3QLHB 1RU1A 1HHTP 4FN5A 3WHIA 2GVDA 3TW0A 3NG8A 1RWXB 1VRQC 4NA3A 4C8NA 1HBUA 2R7RA 1WF0A 3THTA 4JI3J 2KG1A 3CJ5A 3FSIA 1R0AA 1HBNB 3FQLA 4P6QA 3V2UC 2XBPA 4RR5A 4O44B 1M1HA 3QZ8A 1PBUA 3FNNA 1UVLA 3N28A 2F8EX 1BC6A 2QJ3A 2PFFB 3M8PA 3OR2B 4TYBA 2HHPA 4C11B 5E41A 3Q23A 2KB2A 3LW5C 3AD8C 4KFBB 3G96A 1NUEA 3IN5A 4IR9A 3MEEA 3E51A 1MN9A 2HAIA 4FYWB 3WC0A 5CCLA 3CNQP 4DSFA 3ZTSA 4B3SF 2V9WA 2LLZA 3CIZA 1S1XA 4Y2AA 3ADAC 4QPTA 1S72S 3BB5A 1PKUA 2D69A 2ZWOA 4HR2A 1KN6A 3ELHA 3RBDA 4DR3F 3BKFA 2R9LA 2L9DA 1GMWD 2R7XA 4C48A 2MKSA 4L6V3 4PPDA 3CJ8A 1C1CB 4L74A 4RPFA 2R8JA 2C2OB 4BDPA 3VZHA 4F8RA 2Z2MA 2I9SA 4F25A 2MLZA 2O1PA 2AF6A 2AWZA 2A6MA 5E7OB 2CQDA 4L76A 1RK8A 3HXMA 1UA1A 2FGOA 3SV4A 1T11A 2W9BA 1QTNB 2ZC3A 2DXFA 3GU0A 3LQVA 4NZ7A 3ZZYA 2QRRA 4ES3A 1T0TV 4P75A 4P74A 1M1GA 4WP9A 5DM7Q 4TXSA 2V67A 2KU7A 3GJQB 1U49A 1LKZA 3CDBA 4WYLA 4IH7A 5T7LB 3AWRA 2UXDJ 2VFTA 1TL3B 3MM6B 4JV2A 3GFYA 3OXGA 4ED7A 3JQKA 2MQPA 5KT7A 4CLFA 2VDHA 2MKKA 4DFPA 4DL5A 2BQUA 2YWGA 1SCJB 1CG2A 5DLGA 3GJSB 4G6VB 3SCIE 4WFXA 4JBCA 1S49A 3LGHA 4N47A 1IKVB 4RX6A 4ED3A 4QU7A 2JJ4D 4OZLA 3SBMA 5HVHA 2KI2A 4BBYA 1D0EA 2CPIA 3CCQS 4Y2MA 3NEKA 4DF4A 4LIRA 3WDOA 2RDJA 4MIBA 1LW0B 3Q8VA 2BM0A 1Z4UA 2VU5A 1HMVB 4P7TA 3VVTA 4Q43A 3VGVA 1ACMB 5HATA 1YJNS 4CT9A 3CCLS 3TWZA 4ECWA 2EBGA 3QO9B 5EWGA 1T8EA 2BOAA 2ZITA 2MQNA 5CD4A 2KYZA 1KD1T 1RSCA 3GG0A 3TJ8A 3UN2A 1TVRA 3CJ3A 3IR7B 2M70A 1S4FA 3PHTA 2W4CA 3UFCX 2R8IA 2VKZG 1RTJB 2BJ3A 2C3OA 5D4NA 3VCDA 2QL7B 1ZTWA 1XMQJ 1HNWJ 1ITPA 3A8IA 2CNOB 4NZ0A 4PEOA 1NPPA 1NNDA 1U09A 3ZTPA 1X4HA 3AD9C 1VQ5S 5CYJA 2DH9A 5HJYA 2HS0A 1H7XA 1REVA 2ZBRA 4IR1A 1VQ6S 2QLWA 2O5DA 1J5OB 3BBBA 1HNZJ 4LUBA 2JRSA 1ZM9A 1FI4A 4F0HA 3PX6A 2DNZA 3CWJA 1YBUA 5L39A 2RS2A 4I4BA 2KT2A 2JOQA 2V0NA 3A3PB 4MKYA 2B9WA 3MM9A 3MD1A 4LFAF 4CH1A 1RTHB 2VV5A 4RNOA 2EC2A 3KG0A 1RABB 2XI2A 2MHNA 4CT8A 3CO9A 3DN9A 3MD3A 1QUPA 1JLQB 3BPSP 4KIAA 1OJ4A 1RTZA 2QSWA 1D1UA 2CPZA 1UJ5A 3HSJA 2PI4A 3BKUA 4NRTA 4NLUA 3G87A 2YXLA 2BEFA 4C97A 3GIRA 3VGSA 2DEJA 3AJDA 4OI2A 3U1LA 3IR6B 1JJ2R 3RR7A 2AJFE 3JTOA 1FCAA 2WOMB 3PFOA 5KFLA 3QFHA 5L9NA 4ECUA 1IN0A 4P2FA 1TL1B 2GGPA 1AFJA 1RISA 2HNZA 4K50A 2OH2A 2B5JA 2UVWA 1X9WA 4Y2CA 4UTGA 5DGAA 2OMLA 3UVJB 1RT6A 2PMZD 2FLOA 1BUXA 1SC3B 4LSZB 3I96A 4EU0A 2N82B 1DZ5A 2ZBIA 4LF1A 4QIEA 3FCHA 4KV8B 2CZVC 2YQ0A 4ZK7M 3G71S 1KR4A 2ILZA 2YY3A 3GWCA 4Z2XA 3EXCX 2ACMA 2J7KA 5I3QA 2D3O1 4W92B 1VHIA 4WCEQ 4NCAA 2DNPA 1MG7A 3AXMA 2QGFB 3TANA 1EETB 3BSCA 2B4PA 1Z1ZA 4OI6A 4OHZA 4DL0C 5MLCV 1IBCB 4DV6J 2HEKA 1FKPB 4ZKAA 3NMRA 1OO0B 4ETZA 3BJYA 2GVZA 1IJFB 4CLTA 2UXDF 1RWVB 2DHGA 2H4WB 2O67A 3IRXA 1I5OB 1XNRF 4OYXA 3LA0A 1FD8A 3MR5A 2AHOB 1LK5A 3M6UA 3SDEA 1SUQA 5C42B 3PO4A 1FRKA 4B9MA 2CQPA 1MN7A 2Y1JA 1JWWA 1TKXA 1VHFA 2QLXA 3HULA 2ATLA 2ZFHA 5EUHA 4L75A 4IDKA 3DLKA 4KHMA 3WIUA 4DV2J 4EZ6A 3OUYA 3ENVA 4QJVA 1DQAA 4XDCA 2ZUAA 5GAEI 3OW2R 3RW6A 1ICEB 4NLYA 4K4VA 4WFZA 1VI7A 2LDYA 3MTJA 4PWWA 4DU8A 3S8SA 4YOEA 3EVOA 4G1IA 2FY8A 2B6AB 1ELOA 1OYEA 2XMTA 4DX5A 2PD1A 3SFUA 4QIGA 3FRZA 3CD6S 1N5YB 3C15A 3LGMA 3S01A 1SUQB 4P2MA 4U8VA 3QLHA 2XSFA 4PG5A 5IT0A 3NWRA 1HBOB 4NLQA 2GVDB 7AT1B 3G8QA 2IFXA 5CYQA 1HWIA 4X64F 1HR0J 2BW7A 2CPFA 2WBRA 4I64A 2RDIA 4N8OA 1KNZA 3HT0A 3HD1A 4DL2A 2V8DA 3R5JB 2A1BA 1KTQA 3OTCA 3W9HA 1W2IA 4BC9A 3J80Y 3F56A 3VWSA 1P1TA 4M5HA 2I0XA 1N4LA 1R3NA 1Q53A 2B6AA 1JLBB 3MOJB 2K1RA 3DDNA 1O5JA 4LR9A 2RNEA 2ZH6A 4A8YA 4GC6A 4J9QA 1NDCA 3HKZD 2KRRA 2DNGA 2ZBQA 1CULA 1WF2A 1SH3A 3L09A 2HHQA 5AXMA 1H3DA 2CPHA 5C7PA 3AQOA 1BHNA 4O3NA 2W7AA 1YK9A 2QV6A 2ZNYA 1NKEA 2MDAA 3VAMA 1JXLA 3RW7A 4DLGA 3CD5A 1PYOB 4W4MA 2XLJA 3ZZOA 2ZWPA 5KFXA 4LFCJ 1VQYA 4B9NA 1C1BB 2E29A 1KS2A 3GILA 3VAGA 3JS9A 1LV5A 4WYWA 1SJQA 3C16B 1CQMA 5KG7A 3CC7S 3P6YC 2BKNA 2V1TA 1S9EB 4I1TA 2FJWA 2XCPA 3P3DA 4EZ9A 1HWLA 2HFNA 1GK8A 3HFVA 3KJQB 9ATCB 3R5CA 2LDIA 2QYCA 3D2WA 4P7VA 1FXLA 3I32A 1JB0C 4LFBF 3M9NB 4FPIA 4MK8A 2OEJA 1J2VA 2GQ2A 2LQ5A 1NU4A 4DL7A 1B4SA 2G0IA 2XB2D 3HO1A 1N5TA 2K8GA 3PFEA 3DLEB 2C2RA 4ZS6A 3KK3B 2CNKB 1N5SA 1SC1B 1T9WA 1S1WA 2O3DA 1HI0P 3KJNB 2GJIA 4UZBA 4AFFA 4WFBQ 4FP9A 4Q0BB 4JI1F 3OHBA 3RAQA 3G6ES 3EGVA 3MEDB 2VF3A 3R2CJ 1S9GA 1T9XA 3EDRB 2CWKA 3FBEA 4C8YA 1FDDA 4Y3CA 5BR8J 2IJNA 4IQMA 3NS7B 3K57A 2Y3YA 4KC5A 1FD2A 3OXFA 3CW2C 3U1NA 4DQRA 1Y5NB 4Q45A 1NH7A 4IG3B 1U2CA 4C8MA 4OI1A 3O5TB 2AT1B 5F8LA 1L3SA 3OTEA 1Y10A 3FFIA 2F4FA 1FNOA 3O44A 1KQSR 2XWYA 4ID5A 4PG6A 1P9QC 5HAOA 3T19A 2MQLA 3DC2A 4PWDB 3NGKA 3D0GE 1WHYA 2F65A 2J6UA 5IC6B 4YR3A 4ZVGA 2XS7A 3AB2B 3GB0A 4I2PA 2DRBA 5E3QA 5JUMA 1VDHA 4ZPWR 5BXIA 2NSBA 4TLQA 1FFGB 1NH8A 1QAIA 1Y7PA 1HPZA 2P9GA 3DYAB 4H4OA 3BDEA 3E3XA 2ZD1B 1NPRA 4F7VA 1SV5B 1U45A 3PG9A 2YX7A 4TN2A 3OL6A 2R7VA 2MLYA 3FMWA 3FFIB 3NOGA 3MOZA 4DPYA 1Z2ZA 2Q43A 2OIHA 2VFUA 1N34J 1IKWB 3C6TB 4EO6A 4QYZK 2M88A 2FIUA 3MTKA 5IFMA 2PSZA 1R27B 2FVCA 4UW2A 5HQ8A 4P2SA 4WK1A 3HVRA 5DGBA 5DLFA 1HI1A 3TO8A 1QTMA 1LWEA 1Q8BA 2FZCB 4ZP9A 1OIAA 3AJ2A 5C5JA 1HQEB 1LOUA 5HI7A 3TAMA 5C25A 4FYXB 5CQGA 2NREA 4B3RF 1U1PA 1L3TA 1IKXB 2GNKA 1RTHA 2HQGA 2NZCA 4IFVB 4QIWD 3PIOQ 3T5JA 1TK5A 4USUA 1NSQA 2ALYB 3ULHA 3W60A 2NZ4A 1BQMA 1TKTA 3MAHA 2XTEA 3NCPA 3ZZTA 2DGTA 5I42B 2A10A 2IM1A 1Q95G 1NK7A 1YJWS 4USVA 2DEIA 5KFNA 3MF5A 1B70B 1FWPA 3VV2B 5FDLA 4FS2A 4WJBA 2LEPA 1WOOA 2LXUA 2ZBPA 1LNQA 1VIXA 1U1NA 3DRYA 1L3UA 2WK4A 4QIVA 3UDCA 1HQEA 4MYTA 4YEAA 4CYUB 1N32F 2ROGA 3M1VB 1A7GE 1BLUA 3LH2S 2RKIA 4Q2MA 1S77D 2JSXA 4TYAA 2ZKTA 3AHPA 1YKWA 2JWNA 4RW6A 4TNOA 3DGPA 3PX4A 3M8ZA 3LAKA 4PZVA 5LSRA 3CJTA 4YHHF 5AJ3F 1N33J 1FTCA 1HW8A 3TARA 3BN4A 3GYXB 2CQCA 2RUSA 4ZJOA 3WZ0A 2EXUA 4NLRA 2NQPA 2N7CA 8RUCA 2C2EA 2KDOA 1UTAA 4PXCA 3D6MB 1HQUA 2BJEA 3D1QA 3H2LA 2ZM6J 2W7OA 5A2QY 1XMBA 4KV8A 4M8LA 5BJRA 5K8OA 4RUCA 3GONA 2NLWA 3DLGB 1RBLA 2G2YA 1FJGJ 3OVBA 2XSJA 1XC9A 3CIMA 5AE2A 1EP4A 4OYBA 5HMWA 3EGZA 1HD1A 3H42A 1UP1A 1KSPA 2MGZB 1WSRA 2IHR1 1D9DA 4WFNQ 1SVDA 3FKBA 4LF9F 2XMUA 1N48A 2GIFA 2KVQE 1RBAA 2MSSA 3ETMA 1CEZA 1MMLA 2UP1A 3M32B 1VGYA 3KLIB 1T03A 5KG0A 1FXDA 1KBRA 5GADI 2XYGB 1BQNB 3QMQA 2DR9A 3ET6A 4A48A 2DGOA 2K3KA 4MYUA 2IM3A 4OYIA 2JFDA 2VPYB 2DNKA 1VYAA 4GVBA 4MH8A 5ETTA 3GG1A 4DBQA 2IC3A 2D74B 2QZ8A 3OUYB 3H5SA 1VJWA 2HHSA 3DDKA 4P72A 4N41A 1NKCA 1SL2A 4QWDA 3CC4S 3TAPA 3AA8A 3HMJG 1F9HA 4LF7J 2KKHA 1JKHB 3JQMA 4RW8B 2Y8YA 3F41A 3NCRA 3M6VA 3GV5B 2B43A 1PIEA 3OTDA 5K5MA 5FLXY 1MMDA 9RUBA 1SJ4P 4KFBA 2GHVC 3IM8A 4DR2J 2KH9A 1XMOF 4OZ0A 5B0CA 3EGNA 2MKJA 5HQMA 4XPEA 3SZ2A 1SI9A 2QL9B 5F41A 1MROA 2CQ0A 1UFKA 4CWBA 4USMA 5EWFA 4DR2F 2CPXA 4CLPA 1T02A 1N54B 5E3CA 2RUGA 2JHEA 3Q22A 1DY3A 1VRUB 3RBXA 2ZH9A 2YTCA 4H4MA 4J9PA 2G0CA 2DNMA 4EBCA 4F2SA 5KFHA 2AEJA 4QR1A 3MXHP 2I1RA 2RD5C 3KNGA 2VASA 2R8KA 3AH6A 1FJGF 3JSMB 4RUHA 2DGQA 3DNCA 2D9OA 2VG7A 3HKWA 4LRCA 3LALA 1ZA2B 5L1IA 2H9ZA 5M2RA 1LWCA 4WU2A 2J0WA 2CVIA 4CTAA 2B4UA 2ZDOA 2HPUA 3H90A 4XDDA 3Q8PB 4WZQA 2XZTB 2WRMA 1DTQA 2HZVA 2X1AA 4ZP7A 1FRLA 3AAWB 5RUBA 3OQ2A 3RGIA 2CG4A 4JUZA 3ZTRA 4CRJA 3PW5A 1NK4A 2VA3A 3GE9A 2E9RX 4YHHJ 5AJ3J 2EPIA 1AROP 3BO4A 1VRUA 1VQ7S 1RWOB 2HBZB 4M5DA 1KONA 2V8PA 3TA2A 1LFPA 2ZH2A 1N32J 2J7UA 1M5HA 1PC5A 5IS2A 1OY8A 2OPSA 2NPFA 2VG7B 2XULA 3Q8RB 1GFWB 2FLNA 1C0TA 2RRNA 4U96A 4IUFA 2J9DE 3B8HA 1PCAA 2LQJA 1JLAA 2WVDA 4I2QB 4PAAA 4A8SA 3ISNC 4NI2A 3IGVA 3JAMU 3BYRA 2KFNA 3N6MA 2F8HA 4FBUA 1RB0A 3G82B 5U47A 5HMZA 1PJ7A 1KVJA 2NXNA 5KFSA 2WCXA 3I55S 3PACA 4ES1A 3VAJA 1Q8LA 4B08A 2AYMA 3P4UB 4RKUC 4A8OA 2ZM6F 2HHHJ 5GADU 1CLFA 2R7WA 5C2GA 3PVXA 1XBWA 3ZZZA 4R5PB 1RCXB 3EX7B 3CSKA 2VQFJ 3QT7A 2DNQA 2DNLA 5IQ6A 2H65B 5ETVA 3KLEA 1M5PC 3D9BA 2LCWA 1UJ4A 2BA9A 2V8VA 2X1GA 3AD7C 1RTIA 3AXKA 3Q24A 1FVQA 4QIFA 4NEYA 3O8WA 3F73A 2GC8A 2IIHA 3KDNA 4RW7B 5D3GB 2H3EB 3G82A 1CJUA 5THWA 1U1QA 4Y00A 4M1KA 1IBLJ 1ZPVA 2FJBB 1TV6A 3FSXA 4K7QA 4YB6A 5HBMA 5FIIA 5CCMA 3MM8A 2J0QD 1WG1A 2XS2A 1NDPA 3JTPA 4DJBA 2OPPB 2LQBA 1KQKA 1FTRA 1RE1B 3IXQA 2KXNB 3OVAA 2BJ7A 3MR6A 1NM2A 2HZCA 4NPOA 1H98A 4UF4A 2EFPA 5L1JA 5D8HB 2ERRA 4K4UA 2GIQA 1NJYA 2VH7A 2AU0A 2M8DB 4ILMA 2EG1A 3UDVA 2A3JA 3OFFA 2HBQB 4OI0A 3K5PA 1U7LA 3AA9A 4B3RJ 4EMDA 2FZKB 3IC1A 1DQ8A 1CQNA 4IH6A 1AT1B 2DTJA 4OV6A 4GKJF 1Y11A 4GMKA 4D3GA 3HHEA 2VG5A 4X4NA 4ZHRB 3MHYA 3BBCA 2DT9A 3I9ZA 2MZ1A 2ZHAA 3NP5A 4C7QA 2GO8A 5DDRC 3H5XA 2FVPA 3EICA 3R8YA 3IS9A 5KT4A 2XEXA 1FA0A 4GO7X 3CCMS 1SXLA 3NS5A 1U6FA 5JXSA 4FXVA 4DV3F 3ENWA 4QPXA 5KFEA 3T5HA 1U24A 4O3QA 4DPOA 4RNMA 2F40A 5B0BA 1DQ9A 2B7CB 2MLXA 2X3GA 4FNIA 4YB1P 3KJVA 4FS1A 2ZVIA 3DOMA 5IQQA 2XY6A 2GJFA 4IRDA 3CCVS 5DDPC 1FK9A 5I42A 2ADBA 2ASLA 2PT0A 5J2NA 4WK3A 3I9V9 4HEA9 2LP4A 3M2UA 2JFKA 4LT6A 1CJTA 2EK6A 2WVBA 4LFBJ 3LPYA 3UVJA 3T5LA 2XLKA 1A0OB 4DSKA 3GCWP 1JK9B 1WC6A 2GFFA 5E3PA 5LM7E 2VBXA 2HYIB 3CB4A 5CH7B 4AD6A 3GIKA 3QGGA 2D41A 2DNYA 2WSFC 4IOCQ 4IOBA 3MMJA 1KVKA 1KQFB 2HGMA 5A8WB 3CUNA 3V81B 3AOCA 3M8QA 4YR0A 1ZETA 3GIIA 3R5GA 1CBKA 1T05A 5LSLA 4O44A 4J9NA 1YRTA 4LFCF 2QG9B 3D0HE 1LQ9A 4OX6A 4DR6J 1S76D 1XNQJ 2DBBA 3NMAA 3KK1B 4LSNA 1S6QB 1CJTB 1HNIB 3IRWP 3L3CA 2QLJB 3DU6A 4RO0A 3RJMB 4CH7A 6FD1A 4KGVB 3LTOA 2FHMA 1LXNA 2HS3A 1MNEA 2CVEA 3C14A 3JB9k 4LQ3A 1Q16B 3LO3A 2ZJQQ 4DUYF 4EGLA 3FRYA 3VZIA 5KFPA 2C3MA 3NAIA 2H4YB 2QTWA 1RHQB 5J2MA 1ZYQA 1EHWA 3D28A 1QSYA 2QX0A 2QSFA 5HMYA 3V81A 2GJ2A 1X9SA 1OSCA 2BW2A 4J9RA 1VQ9S 3RRKA 1S6UA 3OTBA 2UUCJ 4F36A 3RB4A 2IAJA 2WVFA 1RJJA 4DX8H 4RUAA 3W7BA 3UWTA 2XNRA 5KFUA 2E1PA 2RRBA 5KT3A 1HWJA 3HZGA 1FX2A 1HR0F 2MQ8A 3EXYA 4XO0A 1UZHA 4BHQA 1EJ7L 4JI2F 2AGPA 1FRHA 3C19A 4N77A 1E6VA 2HLUA 4YY3J 3FSYA 1T3OA 2Z57B 4CP5A 2PC6A 4WFAQ 4B9VA 3EM1A 2K06A 3HPOA 1RT3B 4HYKA 1IVZA 2ZZTA 4DV2F 1GMWA 2AJ1A 4G65A 5KG3A 3WX4A 1UVMA 1RWMB 2HK2A 1NB7A 3DLLQ 1F5CA 2DR7A 4P9SA 4GC7A 2LYVA 2Y8WA 2QN6B 3R7BB 4AE5A 2CNLB 1SQEA 4NLXA 2OO4A 4KBIA 3DDIA 4I0WA 2GCFA 1S5ZA 5HP1B 1IWGA 2KZMA 3D54A 3FVYA 4AQYJ 4CLWA 3A4TA 4DL4A 3AODA 4JV0A 5DM6Q 3PRBA 1WHVA 3BS9A 5EWEA 4AL6A 5AE3A 4U6PA 1NSAA 3KDOA 2F8MA 2ACYA 4KPCA 2OKQA 4MIWA 3SCLE 3QZ7A 2O01C 1WC0A 3D1HA 2EFQA 1S9EA 3EMTA 2XZ2A 1LWCB 1FF2A 4PYAA 4MFBA 1UW9A 2FHJA 2AGQA 1WNEA 1DTQB 1OMSA 2XMMA 2RAQA 3ETOA 3GYNA 4ZPDA 3TVKA 4R8UB 3VAFA 3FMBA 3QBCA 3TAQA 2E1CA 4RBTA 3F0NA 4C8OA 1FEHA 3PDNA 1X0FA 4JB8B 3IBFB 2Y1IA 3AJ1A 1FNMA 4ECYA 1S6OA 2B0GA 3ONQA 3W2VB 1XNRJ 1U2RA 1GEHA 4ED5A 3BQ2A 5T41A 1HMVA 3BH7B 4DXLA 2CQGA 2GHWA 1YBTA 4PQUB 2AYBA 4NLGA 3KK2B 2MY7A 1FDAA 5D4PA 3K89A 3W2WB 3QRPA 2R7SA 3B54A 4F0KA 2H48B 1HHQA 1JLCA 3T6JA 4NLVA 3QGIA 1J5EF 4KYZA 4RW4B 3K8WA 5GAHI 1JJ4A 4FYVB 4ICLA 4NZ6A 3N0VA 1W2BR 4JI7J 1MSWD 3D4JA 3I4HX 1YRUA 3W62A 2MB0B 1P6TA 3KXDA 3MM6A 3NRBA 1SH2A 3LP2A 6AT1B 3UD4P 2HQ3A 1NK8A 1WC1A 1Y0HA 2FZGB 3C6UB 1TELA 3SQOP 1WEZA 1JLFB 3K7RA 2FPHX 2MEWA 1TAUA 4OQJA 2YKOA 1B7YB 2F3JA 4QQBA 3IMQJ 1U0HB 4DR7F 1QE1B 4M5NA 1VQOS 4W90B 4F2RA 1CJUB 1YHQS 2V4QA 3QAUA 2B5JB 5CA5A 3Q0AA 1HPZB 1RHRB 1ROFA 7FD1A 1HNWF 4EK2A 3OT9A 3R3TA 5KFOA 3MAQA 1N56A 2YWKA 4M5MA 3SIPB 1TU0B 2G0JA 3FDSA 1WC3A 3D0IE 4MT1A 3OLBA 1IQZA 4DWIA 4NXMJ 4DFJA 1CJKB 1JXVA 3UD3P 1SJFA 1UVNA 3TQ1A 2HNYA 4I6WA 3DLJA 1YWXA 1VBYA 1N34F 3P5BP 3PYDA 4OHWA 2Q6CA 1R89A 2PDAA 3DRSB 3H0PA 4LFAJ 1U0HA 5HROB 4GRSA 3MR2A 1RHMB 2RQ4A 3W61A 4MK7A 1P27B 5E0OA 4XIUA 1TL1A 3DXSX 3SI8A 3VALA 2W4DA 2Z8QA 4DG1B 1R8BA 1ZAWA 1MU2A 1J5EJ 1HNZF 2QEXS 2MSTA 1R43A 4OX8A 3UW1A 4WF9Q 3EPGA 1TZ0A 2F9DA 2HWHA 1ZOTA 4QR2A 5HO4A 3N79A 2H5IB 2EFGA 3NNHA 3SDEB 1SJRA 3MCSA 1WOSA 3SCKE 2ROPA 4LF2A 2C28A 2J8SA 1RHUB 2JX2A 2H51B 4ED2A 3OSNA 2WB1D 3L9ZA 5AXNA 2AJQA 3M1VA 2RSQA 1YI2S 3AQPA 3NL0A 4AT1B 2FB0A 2HVDA 1HD0A 2RJZA 4RW9B 3TUJC 2CJYB 2XHCA 3DOLA 5J2NB 2DXEA 1X5SA 2CJQA 4KGMA 2HLTA 2DNRA 5KFIA 1NZAA 5FLXU 3MPVA 1N5YA 1URRA 3N01A 4LR7A 2LKZA 1XERA 3W5ZA 2V4JB 3EGWB 1Q86T 2R8GA 1LWXA 2R3VA 2CADA 4J90A 5CYQB 5SUHA 4DOZA 3PIPQ 3C3LA 3U27A 3P96A 2BV3A 2MYFA 2YWFA 3TJ9A 3QPIA 3L4BC 2CJKA 4B3TF 1XN9A 3SQGA 1P1LA 4E0DA 4WKRA 1UPPA 3IP0A 1RYRA 4FXWA 1O0PA 3D6TB 1XJWB 3OLAA 1YJ7A 2GGPB 2IJFA 1BD6A 3CJKB 4ANEA 3KTQA 4CLLA 1JJCB 2IM2A 2F9JA 2C2NA 2W9AA 3KK1A 3QJPA 1RHKB 3BSNA 5KFCA 4ERDA 4AQYF 2POKA 4F4XA 4ZN3A 1F2GA 1JLBA 1TKZB 1UWBB 3V6HA 1CSJA 1VBZA 5A8RB 3OJSA 1EKSA 2VC0A 3E2EA 2P9EA 4RBVA 4OYOA 2I5JB 1EARA 2FQQB 2QLBB 1IBKF 2V1SA 1X4EA 3CE8A 1U8WA 5I3UB 1RT5B 3M2RA 2W2QP 3PEHA 1VC6A 1VQ4S 3C46A 1YJVA 3POTB 4CO2A 1YX2A 2ADCA 2IA6A 2KHDA 3LWLA 1U8SA 4FF3A 2E5HA 4IO1A 1WOPA 4WE1B 2IAJB 3FK4A 3TEGA 2AZ3A 3MMCB 2W9CB 2ZZNA 4DSLA 2D7SA 3TI0A 1NHUA 4J9MA 1VCTA 2R42A 4QWAA 2BQRA 2J6SA 3CDUA 2V9KA 4A46A 4YN3B 5KFDA 2HK3A 1LW2B 3JYTA 3T1HF 2LQ9A 4P2XA 1L3KA 2HHUA 3RRHA 5KAKA 2MJUA 4NYPA 3PX0A 2XMWA 2JVRA 4OMFG 3M9MB 4B3SJ 5IT9Y 1EAYC 2BYCA 3HJVA 4URGA 2UV8G 5A6WA 3QIDA 3IGNA 1BMQB 4DPUA 2XO7A 4J9SA 2IMWP 3DRRB 1MROB 1GXLA 5B0FA 2UUCF 2JC1A 4WXOA 2MKCA 3MMAA 1NJXA 3T9NA 2K2PA 3EJMA 1U47A 1UVKA 4USTA 1V3RA 3KJFB 3M8PB 3VF0B 2OJ3A 3QO9A 4IQXA 2CZ4A 4U8YA 4DUZF 1PC4A 4A8KA 1HYSB 1AFIA 4ECTA 3FQKA 3JSMA 4JV5F 5A0YA 1B0VA 1SH0A 1HBOA 2QLFB 2FTRA 2FHJD 5AXKA 2VONA 1WHXA 3QGHA 2IRXA 2HWIA 4DV7J 4LF5J 2R2SA 4DR6F 4MIAA 1UEKA 2UVUA 5E5NA 5K20B 1OY6A 3B78A 1IM4A 4WXWA 4KAIA 2DHXA 4OZ2A 5F0UA 5KFBA 1NZ8A 1KKHA 1S1WB 1ZPWX 3Q8SB 4ZCKA 2DGXA 2M3DA 2YQ1A 1NK0A 2DY1A 1DAXA 3MMBA 1VS3A 2AEFA 4ES2A 3UCZP 5KFRA 5H9EK 1HYSA 1RAJA 4TQSA 2E7VA 3IFEA 4B3MJ 1NMEB 1CULB 2E5JA 2GW8A 2J9EA 1YGYA 4NXNJ 1HNVA 1FJ7A 2YNIA 4PXEA 2CYYA 3ZZ0A 3K8VA 3NXZA 4NI2B 1D8ZA 2QIFA 2LA6A 3HM9A 1N6QA 1FRXA 4WFYA 2JNJA 3QAEA 1RQ0A 3TX0A 3KHGA 4WIIA 3W2VA 1TUVA 4ZIWA 1Q4RA 1VK3A 3C16A 3KUEA 1GXTA 1S59A 1U6ZA 4M5GA 4DHVA 4PQUA 4RU9A 2B7BB 4I68A 2FJVA 2YX1A 1I6JA 3THPA 4YDXA 5I3PA 3TJAA 1U0SA 2EG2A 4IKAA 4FVMA 4PG8A 3BF4A 2E5LJ 4A8FA 5IM0B 3V6JA 3ITHA 2XCAA 3BGOP 4K2XA 1S97A 1UL3A 4G3IA 1GT8A 1KDNA 4C0BA 3K0JA 3JTNA 4NRUA 1QY7A 1JQGA 1SJ1A 2OD6A 4X2BA 1RKIA 4RW7A 1S1TA 2L41A 2YNFB 2VQEJ 1AUDA 3B82A 4ETXA 1QVFR 1LW0A 2FUG9 3G2XA 2D68A 4QW8A 3PM9A 4BWMA 1TFWA 1N0UA 3PHEA 2KRBA 4F3MA 1SKUB 4LMZA 3UQSA 1NDLA 3VQSA 4RNNA 3EZ5A 4CH0S 1I94J 4USKA 3HDSA 4ZP8A 4AXJA 2CAJA 4ZVRB 4Q0BA 1QAXA 3OBIA 5KFQA 1KVIA 3W8PA 1YQHA 5BYRA 2MJNA 1HBMA 4FZVA 3U02A 2BACA 4M94A 1RT2A 3TVYA 3I56S 2XTJP 2RB7A 4PPZA 4F4AA 3JQJA 5HL7Q 5DG8A 3M8WA 3CEDA 3CCTA 3L7OA 3LUYA 5ITHA 1CJVB 2Y0SD 1D9FA 1G1XA 2UV8A 1SB6A 3SSQA 5F3TA 1X4CA 2ILYA 2PEBA 3QT6A 4ZA1A 2I6WA 5LJ5Y 1TKTB 4ZHRA 2EW9A 1ZA1B 4C0OC 3PZPA 2AJ2A 2RF2B 3BR9A 4LRAA 2YNHB 4RBUA 1O51A 1R0CB 2HNYB 2HFOA 2KO1A 5E3RA 2KJWA 3MFIA 1ULRA 4DCJB 3IR5B 4Y6IA 2FY1A 1YITS 1GQEA 2CJ9A 4A8XA 4J9KA 3H4BA 2DPJA 1U25A 2VA2A 3GIJA 2HGNA 1RT2B 4LBIA 4USIA 4JYAF 3MM9B 4F4ZA 3SYZA 1Q0NA 1I3OB 2BJDA 3DGVA 3DYAA 4H4OB 1GNKA 4RW6B 4C3KA 5KFTA 4KH0B 1MU2B 1RADB 2W2PP 3BZQA 1IXKA 1RGVA 2ZOFA 2IM0A 1CS4A 1R8CA 4J37A 4Y65A 2MQQA 3G6VA 2JEFA 1K0TA 1OM2A 1UEVA 4ZPVR 5KFGA 3AX5A 4ZJQA 1ZTTA 1NPKA 3T1YF 4LIWA 3VGUA 1T03B 4DR4J 3RAXA 1NO8A 1Y9OA 3DM2B 3KUGA 2M4MA 2D3UA 4RWXA 4AXIA 2HFSA 4WP8A 5KT5A 2KTQA 3E01B 3DRPA 1Y5LB 3CJ4A 5EX0A 2RILA 1X4AA 1SQGA 2UUBJ 2NXUA 4NMXA 3I5CA 4IH5A 4M5IA 2DD8S 4OL8A 1EQMA 4X4UA 1H7WA 1NEEA 1RAIB 3ZFVA 4ZMMA 4YB7A 3DOLB 2YVSA 4NL5A 5JJBA 2CQ2A 2BDPA 1S48A 1H72C 1CS4B 1HL6A 4TY8B 4C3MA 3H98A 1RT6B 3P5TL 1TUWA 4ZLPA 2G2OA 3R5DA 4CI0B 2LXFA 2EI5A 2W2NP 4FDFA 4ITSA 4PCQA 3JAMY 4ED8A 2V4JA 4O0NA 1RT1A 1N88A 4DV1F 3NLCA 1RTDA 4K4SA 1JJHA 1FO1A 4KY3A 4A4JA 3IWNC 1UWAA 4NLDA 3CJSA 1Q79A 1K8AT 4OHYA 2EBEA 1UEUA 2NUUG 2N3OA 1IKYA 2CQHA 2MHEA 2N4DA 3DGPB 4DR5F 1KWMA 4NLOA 4F50A 4IRKA 1FRMA 2W1BA 3BSOA 4KE5A 4USJC 4ZPAA 4TY8A 1RWKB 3AOBA 4BCAA 4NLWA 2NXEA 5KFMA 1OPIA 3BSAA 3ZNUA 4X4OA 1XR7A 2R7OA 4WKYA 4KHPJ 3ZC4A 5KG4A 2IVYA 2B8PA 1P9YA 2COLA 3DLGA 3MWBA 4M5KA 2C3UA 2ZH5A 1GTEA 4K4YA 1OYDA 2Z2YB 5KFYA 5DQGA 3T41A 2NXCA 3V4MA 4LF7F 4B9SA 4HH0A 2XMKA 4X65F 2CQBA 2RHQB 3MI7X 4K4WA 3CD7A 4X84A 5GAGI 1NK9A 2XMVA 2W9CA 3L7UA 2V2QA 5H9EJ 3CDAA 3M8SA 4LF6J 4TLRA 2UVVA 4QCLA 1FHTA 1E6YA 4OFZA 3KHRA 4EI2A 1KOOA 2MMYA 2ZBCA 4OHVA 2Z30B 5CYMB 3KLGA 2VOPA 1CC7A 3C15B 2LVWA 5KG1A 1DARA 2BE2A 3KMSA 2I8EA 1BQNA 2YBVA 3TVZA 3ET6B 4I69A 3WBZA 4PG4A 3J7ZT 3K5NA 4GO5X 1JLAB 4P73A 2Z58B 1W7WA 2KL8A 1SKSA 3H8YA 2JLEA 2JH3A 1JXEA 2RQCA 2HIQA 4RJVA 4C0HA 3D3CJ 4HI2A 2CRLA 1X5TA 3VQTA 3VVUA 4E2FB 4DL6A 5HP1A 4LF9J 4FF4A 3H5UA 4M95A 1U2FA 2OSQA 2PGCA 2KZZA 5KG5A 4KHRA 4R5PA 2E1AA 4M5DB 4LRBA 3THVA 1JNZB 1KLNA 3HX9A 3OTOF 5MAOA 5D4OA 1TL4A 3MM7B 5DJBA 1SL0A 1UCNA 3ICLA 4ZVUB 1C0TB 1XWLA 2UU9J 4PRFA 2CNNB 2DH8A 4O3PA 2V4RA 5B08A 3GCXP 4OX9F 2ZH1A 4NYZA 1IM6A 3WX8A 4LRFA 4YB5A 4R8UA 4DX6A 3GSIA 5A2QU 4X62J 3OL9A 1N33F 2ZZMA 2P8IA 2PMWA 4QZVB 1SC6A 3HCXA 4K4TA 2DHSA 4IG0B 3J81U 4H4MB 4LF4J 2V69A 2RH3A 3X3UA 4DS4A 3G8SA 3ILOA 3MMBB 4TKTA 1SQFA 5J2PB 3MM7A 2GIRA 2P9CA 3MAAB 5C25B 2EWHA 2J8AA 4USWA 1FWKA 1R8AA 1ZBTA 2IYIA 3K17A 2YWWA 5J1NA 2YNIB 2DITA 2YWEA 4O3SA 2UXCF 1YLXA 2AEMA 2NUHA 3I0RB 4QOTA 4DQPA 2KG0A 1RWPB 3PXGa 1WKKA 3S1TA 4RL1A 2M7SA 1U1KA 2IPOB 4C98A 3RB0A 2AGOA 2QMXA 1UUJA 2HBYB 3UCUP 1S1UB 4JI4F 3IG1A 4RW4A 2RDDA 1QSSA 2ZH8A 1P8GA 3HFZB 1NDKA 1UPMB 4ZIVA 2U1AA 1NKBA 5GAHU 2VODA 2JEIA 5EN1A 2IVFB 2OPSB 2VL1A 5KT6A 3MEDA 3ZTOA 1Q7YT 4ZDNA 1QAJA 1MWYA 2RKIB 1WC4A 2WSEC 4O23A 4CCHA 1WEXA 3A3OB 2CKWA 4I2QA 5F3ZA 2YKMB 5B0EA 3T1AA 1RT7B 3DOMB 2B9YA 2XGPA 3T3FA 2ZH4A 5HLFA 4V19J 1YVFA 2IRUA 2OPQA 1PYSB 3AX2A 5ETMA 5IWAF 2WVCA 4MKVA 3LP1A 2CPEA 5HVGA 2VG5B 1VFJA 4FXDA 4YQWA 2J5AA 1XK8A 4PYDA 1UZDA 2VZ9A 3T9ZA 4HTJA 1H38A 1CVJA 2CQ3A 2ASYA 3BGRB 3G8TA 5LMUF 4I67A 2V8GA 3IS9B 1AZSA 3MM5A 3BO2A 1FKOB 3MPWA 1EP4B 1YG0A 3OFHA 1Z2LA 3NKYA 1HW9A 2JLFA 3EZOA 3GR0A 2J0SD 3PR4A 4MMOA 1T05B 4F0MA 2V6AA 1JLGB 3GYGA 3BREA 2DXDA 1XEZA 4UUWA 2OTLS 1TV6B 1WACA 5HBMB 1X60A 1T95A 3O1LA 1JIHA 3M2VB 3TRGA 1JLEB 5BR8F 3CCSS 1FERA 2G13A 4ZPBA 4ZPCA 4N8NA 3EUNA 3VAKA 4JI4J 3TUPA 5G4DA 3MM5B 2PA3A 2QA2A 2Z56B 2ZHOA 3MZIA 4F02A 1FDNA 4JI1J 3PW0A 2LU2A 4B3OA 2JL9A 3AFGA 2DGSA 3RUBL 1ZAVA 3NNCA 3A8EA 4Y2KA 2YKPA 1F5AA 2UUAJ 5EHHA 2VFRA 2VDIA 3KLFA 1TTHB 3HSDA 2YKNA 4L3NA 5AXLA 3QJLA 3BH6B 2E5GA 2HFVA 3NS6A 5D78A 2JEJA 2CPYA 2PIIA 5F8IA 1SPBP 4HHHA 4NOHA 3V6KA 4LF4F 4RLEA 5B0AA 1TR0A 3CJRA 4H4KA 2N7YA 2PA8D 2C3PA 1XR5A 1RT4B 2JC0A 1KLMB 3FCWA 4X62F 1HI8A 1X4BA 4Q44A 3C8YA 2OI2A 4B9LA 4JI6F 3Q8YA 2BABA 1IUJA 1F3FA 2N3LA 3NGUA 3OPKA 4IFYA 3ZNJ1 3W8GA 4OZ1A 4U9RA 2OHDA 1NJWA 2IDEA 1X31C 3I31A 4DCOB 5D4LA 5J1EB 1R0AB 3M30B 4CLSA 3OTOJ 2XC9A 1Q81T 1D9AA 3KG1A 1GXUA 2B51A 4KGXB 2DGUA 2SXLA 2V2VA 3RU0A 5HSPA 4C11A 2G2ZA 2AMCB 2V50A 2XTDA 4K0KF 3OFGA 2VPXB 4QW9A 5HANA 2NSCA 1HNXJ 3VTIA 2DYAA 1AXQA 2WHOA 3QNWB 4HHJA 4F26A 5CABA 4HACA 5KFWA 3SV3A 4NLSA 1EKRA 5HJXA 4K5SA 4Z37A 1E6VB 3J7Z5 2KXHA 1IR2A 2F4VJ 1S1XB 3QT8A 3DI6A 4EUVA 1F9FA 4WTOB 2C22A 1HFEL 2XWXA 1IJEB 3QT5A 1T9TA 5GMKa 4PR6A 1LK7A 1QAYA 4A8WA 1SKWA 4UOFA 1LFWA 1FXRA 4HH1A 4F04B 1YJ9S 4KQZA 3U7JA 3HHLD 4Z7CA 1UFWA 1RWWB 3V4IB 1U1OA 3M8RA 4OJGA 3NOCA 4X64J 4JV1A 4CO1A 3C2PA 1UVJA 2AP6A 2KVIA 4G1QA 4DEZA 4YY3F 1RAAB 1WKJA 3B6BA 1PJ5A 2GQCA 3IO1A 2W2OP 5J2MB 4JI5F 2E7WA 2MY8A 2ZE2A 4KKOB 4JI8F 2ZOMA 4NASA 1Y3KA 2B3TB 2HHTA 2W9BB 4A8QA 2BANA 4ZCLA 4V1Ak 4DDFA 4X66F 1NK6A 4ZCIA 2M0GB 1N5QA 5F9LA 3DRRA 3M9OB 3K59A 3VAIA 4DV5J 3R2DJ 2CXEA 1G6BA 2R4FA 2WONA 2Y1LB 2LQ8A 1GAOA 1FVSA 1MWZA 3W1YC 4H54A 2HVZA 3A8JA 1MWQA 3I5BA 1TK0A 2IA0A 3CGIA 2BE2B 1X5PA 1GX6A 4ZLLA 4IOAQ 3SXLA 2W25A 5BYQA 4U7CA 3H2VE 3J7YI 1H2TZ 3DMJA 5ETOA 4GVLA 4F4YA 3P8BB 3FBCA
chains in the Genus database with same CATH topology
2BANB 1OQ3A 4ZVFA 2OPRB 3MECB 3W3SA 4ZCMA 1HBUB 2P6SA 4DV6F 1M5VC 2FJDB 3I5AA 3RYLA 2GA7A 2MQMA 2OPPA 4TU7A 4NLPA 3CC2S 3AY0A 3SMZA 5CZVA 1X8DA 3FEXB 2BOPA 5FJ4A 2FVQA 2V5HG 5T14A 3PKMA 1XTZA 2H5EA 2K7KA 1U1LA 4H4KC 3JSBA 5EX3A 4DQIA 1M5OC 2VUGA 3MECA 4DR4F 5DG9A 2E1MC 1FT8A 3T6BA 2W7PA 1WF1A 4IG0A 5DDOC 2HGLA 4ICLB 3O3LA 2RRAA 1UW4A 1RWUA 5D77A 3LP2B 4C9DA 4KO0B 2JZ5A 3CJ2A 3VAHA 3TX8A 3DLBA 2X51A 2DVIA 1ZM3A 4AL5A 1FRJA 2DCUB 1LWFA 2VC1A 4M63A 1M5KC 1BGXT 2XNQA 1ZM4A 1QE1A 2VKRA 3HHLC 3HVTA 5K14A 1KTVA 3SSSA 2LEBA 1F0XA 3GFZA 2HW3A 4Y2IA 2HHXA 4KTQA 1S1TB 4KR0B 3TUZC 2C42A 4F3QA 1VQSA 4EEYA 2ZJPQ 2D1CA 2CJBA 2JLGA 4KO0A 1H2VZ 5A8WA 2FGCA 3M6XA 1K1SA 4QWBA 4ELUA 1RTIB 3G6XA 2YKMA 1HBMB 3M05A 1RT7A 1YIJS 1VQKS 5HROA 1JLCB 5D6GA 1KHVA 3L7PA 1T7PA 3CD0A 4E8UA 2R7QA 2E9TA 4KT0C 1RYSA 1I94F 1FESA 5KG2A 1XMQF 2DPIA 3OR1B 3OFEA 1SJ3P 1S1VA 2J9CA 4C3LA 4EWTA 5DQIA 1N36F 4RU2A 4N5SA 3HHDA 3TP2A 4LF8F 1DJ0A 4WU3A 2RIJA 4LJMA 2A2CA 1D8YA 4AL7A 1URNA 2YNGB 1V3SA 4K4XA 4BS2A 3KHHA 2G4BA 3LP0A 1N8RT 5IZHA 3UR0A 2PO4A 2E5LF 1KQGB 2XY5A 1X5OA 4UY85 5K8MA 1A6LA 3OR1A 4YR2A 1BWEA 3M4XA 3GQCA 2BRLA 2A2DA 3CMES 4QBUA 1C4AA 2NYIA 2R7TA 2I5JA 2IBOA 1YJRA 1L5UA 1VC5A 2DISA 4WTYA 2YNGA 5F8GA 2B4VA 1RA6A 3IRWP 2VA3A 2W8LA 3UI3A 2RQMA 3LP0B 3BDPA 4NXNF 2XS5A 1PSDA 2VBZA 4OZ5A 3DLKB 2LEAA 1VBXA 1C0UA 3I0SB 3QWPA 5CD4H 2L48A 1SL1A 2FLLA 1UJ6A 2M8HA 2C3YA 3M2UB 5F8HA 1JLQA 3HHLB 2ZHBA 5M2PA 1PILA 1B64A 3H40A 4LF5F 2M5YA 4OZNA 1Q82T 5B0GA 2NPIA 2ASDA 1RP5A 4UY8T 5F9NA 1VQLS 2AYEA 2GMLA 2M52A 1B7FA 1U1MA 2ZDPA 2CIMA 1ZAXA 2AX1A 1C0UB 3QIPA 1VIOA 2Q79A 5C24B 3SEOA 2MQOA 4RW9A 4Q8FA 2BBEA 1TP7A 3G9CA 2HFZA 2ZC4A 3MMCA 5H9FJ 4C8KA 3HHLA 2ASJA 3FZ2A 2K1RB 1ZZNA 4PXBA 3NGDA 2AQ4A 3PKYA 2DRAA 1LW2A 3UPFA 4CNYA 2FJAB 2ZNZA 3ENQA 2AV5A 4U7UK 4N76A 3NNAA 2ABYA 3G6YA 1QJHA 2KJVA 3N4WA 4NA1A 4PQAA 5IXUA 5KTQA 5DG7A 3OL8A 2ALZA 3BN7A 3TNVA 2Z4PA 3QGPA 3R1LA