1RA7A

Poliovirus polymerase with gtp
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Genome polyprotein
publication title Structural basis for proteolysis-dependent activation of the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 144
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2003-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1ra7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ra7A02
4NLQA 2FLLA 3KHRA 3GIIA 1TKXB 2R8IA 4RNMA 5C42A 1RA7A 4IRDA 1RTIA 2AGQA 4LQ3A 4IDKB 2YKNB 5KFJA 2AQ4A 1EETB 3QGHA 3GV5B 2W9AA 1DTTB 3GYNA 1TKZB 3H5XA 3IN5A 2DPIA 4KBIA 2D7SA 2OPPA 4RNFA 4IG0B 4K4XA 4URGA 1C1CB 2B5JA 3V6DA 1RTDB 3QO9B 1KLMB 3BJYA 2I5JA 5CYQA 3UPFA 4H4MB 5EDWA 2JEFA 2VA3A 5K14B 3KK1A 3MR6A 2YKMA 2F8EX 1LW2B 4RW9A 1S0OA 4PUOB 4PQUB 3T5JA 5KFYA 3CO9A 4RW8B 3V4IA 1D0EA 4MK7A 2FJXA 3OSNA 4WYLA 1SV5B 5L9XA 3Q8PB 2JEIA 2B43A 1HMVA 1JLGB 4ZVHA 4IR1A 3M8PA 3DRRA 3IGNA 3PW4A 2XCPA 4J9SA 1QUVA 3CJ3A 3SFGA 4F4WA 3RB0A 4EEYA 2W9BB 3G6XA 2D3ZA 1RDRA 4J9NA 2OPQA 3DLEB 1EP4A 1W25A 4RNNA 3OHBA 5KFCA 4XPCA 4ECVA 1S4FA 4F4YA 3NAIA 1GX5A 1TL3B 3MEGA 5KFIA 4YP3A 2IJFA 1Z4UA 5KG2A 4EYHB 1JIHA 1HNVA 3CVKA 3IG1A 4KHRA 4MK8A 4O4GB 5KFVA 3LP0B 3JYTA 2C28A 1RT2B 2IM3A 2B6AA 3MF5A 1S9FA 2WK4A 4KFBB 1JLAB 1J5OB 3IRXB 1C1BA 4DL3A 3KOAA 1LWEA 2ZE2B 1N4LA 1TKTA 4NLWA 4DL7A 3OL7A 2E9RX 5DG8A 1TV6A 4ECWA 4WFYA 3MR2A 1HNIA 2R2UA 1IKVA 2FVSA 1LW0A 4WXOA 2IJNA 1D1UA 3H98A 5F9LA 2YNHB 1JLBB 1K1SA 2HWIA 2GIRA 4TYAA 1JX4A 1TL1B 4ECUA 2HNYA 5KG3A 1LWCA 4O44B 1RT5B 4RUAA 4IH5A 1RT4B 4ED3A 2WHOA 1RT6B 1SUQB 2VG7A 3BGRA 4RUCA 3DMJB 1S97A 2IM2A 1SH0A 3LANA 4KV8A 3KJVA 4O3SA 5F8NA 1IKWA 2YNGB 4IFVA 4G1QB 3QIDA 1FKPA 2WONA 3DLKB 4WFZA 5F8GA 4QWBA 5L1LA 3DOLB 3CDUA 3I0SA 5F8MA 4TLRA 1UWBA 4DEZA 2VA2A 4IG3B 2BANB 3PR5B 5HROB 1N56A 5JXSA 4HYKA 2RDIA 3DOKA 5EWFA 5KFMA 4ZP7A 1RT1B 3PW2A 3FQKA 2V4QA 4ICLB 3G86A 4EBCA 1JLCA 1HARA 1C0TB 4LSNA 3G6VA 5J2QB 4MK9A 1QAIA 1JLQB 3DYAB 1DLOA 5J2PB 5KFUA 3KLHB 3GQCA 2DPJA 4IKAA 4B3OB 4R0EA 4K4ZA 3KLIB 4TN2A 2OPSB 3PR4A 4PWDA 4Q8FA 4IFYA 5HLFB 4K4YA 3V81A 1FK9A 2R8GA 5FDLA 5J2MB 2OPRB 4ZHRA 4JV0A 1TVRA 5KFOA 5KT4A 2BQUA 1VRUB 4QPXA 4WXWA 2W7PA 3DM2B 3LAKA 4ZVFA 2C2EA 1HQUA 2UVRA 3KLEB 5CYMB 3BR9A 4HKQA 3ITHB 3C6UA 3CDWA 3FRZA 3TVKA 4IRKA 2VG6A 4NLVA 4DG1A 2I1RA 4I7FB 2GIQA 3G6YA 5I42B 4K4WA 1QE1B 4TY8A 2ASDA 5HBMA 1IKYA 4DL4A 2ZKUA 3BQ0A 2FVRA 1JKHA 2AX0A 3MFHA 3FFIA 4YR3A 4RW7A 5C24A 4EO6A 1T05A 2BE2A 3H2LA 2UVUA 3H40A 5EWEA 2C22A 4WZMA 2J6SA 5F8LA 1FKOB 3C6TA 3I5BA 4DL2A 2VG5A 2ZD1A 1S10A 3H59A 3HKWA 4IR9A 3DRSA 1RT3A 1HQEB 1S9GB 1WNEA 4K4SA 1C0UB 5KT2A 5L1JA 3I0RB 3T1AA 1S1WA 1BQMA 5KG5A 3KK3A 3M9OB 5KFNA 1K1QA 3FSIA 3V6HA 4ECZA 5KFKA 2WOMA 1NHUA 4K4UA 4YQWA 3QIPA 3KK2A 5F8JA 2JC0A 4ZVGA 3KLFB 4J9QA 3BSOA 5KFQA 4FBUA 3EPGA 4NLUA 1TKXA 1YVFA 4NLOA 2R2TA 3MECB 2D3UA 1VRTB 3LP2A 5DGBA 1IKXB 3DI6B 2RKIB 1T03B 4OL8A 3MR5A 3QGGA 3FQLA 5DLGA 4KHMA 1S1VB 4I2PB 1C1CA 3CJ0A 4ED0A 3QO9A 1S9EA 2HNZB 3KHHA 1KLMA 3RAQA 1TQLA 3T19A 4ED8A 4Q44A 2BR0A 2IAJB 3ISND 3Q8SB 1DTQA 5J1EA 3M9MB 4I2QA 1RTJB 2YNFA 5C42B 2ILYA 5DG7A 3E01A 2W9CA 4RW8A 1RYRA 1QAJA 1BQNB 2ATLA 4H4OB 4QWCA 3KHLA 2OPPB 1JLGA 4LSLA 1R0AA 3OL9A 5D3GB 3V6DB 2W8LA 2B5JB 5C5JA 3OSPA 2IA6A 1S0MA 2W9BA 2I5JB 4MKAA 3DLEA 5HP1B 3CJ2A 3DRPA 3TAMB 5I3UA 3OLAA 3CJ4A 5KFEA 2YKMB 2UUWA 4J9MA 4RW9B 3KLGB 3Q8QB 3IGVA 5F8IA 4Q8EA 3HVAA 3V4IB 3LP0A 3RAXA 2XCAA 1RT2A 1NNDA 4QWAA 4KFBA 3PVXA 1HMVB 3MEDB 1ZETA 3M8PB 3HVTA 3PHEA 2ZE2A 4JUZA 1MU2A 5KFSA 4EBEA 4KO0A 4NZ0A 3OL6A 4R8UA 4F4ZA 2FJWA 2OPQB 3H5SA 1EP4B 4QWEA 4FBTA 4KKOB 3NBPA 3QLHA 5KFFA 2FJVA 3MEGB 4GC6A 3RBEA 4WE1A 2YNHA 4TXSA 1TL1A 2B6AB 2RF2A 4ED2A 2XWYA 3V6JA 1RT4A 2UVWA 1HYSA 1LWEB 4RZRA 2BRKA 1SUQA 4Q0BB 1JLFB 2HWHA 1S6QA 2AWZA 1S48A 1TV6B 3SI8A 2W8KA 1HNIB 1IKVB 1S6PB 3M8QA 4TQRA 1N6QA 5DQIA 3DLKA 5C25A 1LW0B 2JC1A 3ISNC 2QE5A 1TP7A 4IG3A 5HROA 4K50A 4XO0A 4ZP6A 4MFBB 4FS1A 5KT3A 2HMIA 4NLGA 2R8HA 2YNIA 4ZVEA 5DLFA 2IM1A 4QW9A 3QYYA 4RNHA 3BGRB 3LAMA 4O3OA 1REVA 4KSEB 3T5KA 1JLQA 4QWDA 2HNDA 4KV8B 3KMSA 3KJVB 2ILZA 1IKWB 3RB3A 4B3OA 2WONB 1FKPB 1N48A 4FS2A 2ALZA 3I0SB 4NCGA 2FVQA 1UWBB 2OH2A 3PJXA 4KB7A 2J6TA 1S1UB 2OPRA 3DOKB 4ZMMA 4YMEA 2V0NA 3MR3A 4KAIA 3BQ1A 4NLYA 4G3IA 1KHVA 4NLDA 5CYMA 4RNOA 3KLEA 2JEJA 3ITHA 1JLCB 4LQ9A 1RT7A 4LSNB 1S1XB 4ZPAA 3JSMB 1GX6A 1DLOB 4MH8A 1MMLA 4RU9A 1C2PA 1NHVA 2AX1A 4H54A 4R5PA 4IFYB 1HPZB 4XPEA 3V81B 1JLEA 3PW5A 1FK9B 3NAHA 3PW0A 5FDLB 4ZHRB 4ZPCA 3GILA 1TVRB 1RA6A 2WCXA 1SH3A 4NLRA 5KG7A 3GV7B 4ID5B 4ECTA 3V6KA 1LWFA 2IC3B 5KFTA 1S9GA 3BSNA 4RW6A 3C6UB 2AGOA 3LP1B 5KFBA 5J2NA 3NGDA 3UDLA 4DG1B 2BRLA 2FLNA 5KT6A 3DLGA 5DQGA 1IKYB 1RTHA 3IS9B 2R8KA 3VQSA 3EZUA 1S1TB 3FFIB 4RW7B 5C24B 2BE2B 1S49A 3MFIA 3NMAA 4ED1A 3GIKA 1XR6A 3I5CA 2IBKA 3C6TB 2D41A 5KFLA 4Y3CA 5T14A 4IDKA 2YKNA 4URSA 3MECA 3KLVA 1EETA 1OS5A 4IH6A 4RW4B 1VRTA 1DTTA 4J9PA 1TKZA 3E51A 4MIBA 4Y2CA 1BQMB 4IG0A 3PZPA 4J9LA 1T3NA 1CSJA 2JEGA 1SH2A 3KK3B 1N5YB 3DDKA 3MEEB 1RTDA 2WB4A 3UQSA 2WOMB 1IM4A 4H4MA 2UVVA 2HNYB 2HNZA 3KK2B 5K14A 3FDSA 5DQHA 2XGQA 2IAJA 1RTIB 1LW2A 4PUOA 1RTJA 4PQUA 4ZP9A 3RB6A 4M94A 3LP2B 5KG4A 1SV5A 4O3NA 1BQNA 2WTFA 4H4OA 4M95A 3M9NB 4ECRA 2C2RA 5D3GA 4U7CA 5EWGA 3H4DA 1XR5A 2QV6A 5CYQB 2R2SA 3T5LA 1S9EB 2R8JA 3KK1B 2IM0A 5HP1A 3TAMA 1DTQB 1TL3A 5J1EB 4ZPBA 3GV8B 4I2QB 5KG0A 2YNFB 2XI3A 3KLGA 4O4GA 3E01B 4MKBA 2XGPA 2W9CB 4ED7A 2CJQA 4F50A 1J5OA 1JLAA 3IRXA 4YR2A 3DRRB 3H4BA 2GC8A 3MEDA 4LSLB 1R0AB 4TY9A 2BQRA 2XI2A 4MIAA 4O3QA 2IMWP 3GIJA 5KFPA 5KFWA 3TQ1A 5I3UB 3DRPB 4KKOA 3RB4A 2UUTA 4IRCA 1HNVB 3IG1B 3RBDA 3JYTB 4ECXA 1JLBA 5KFDA 4NLSA 4NLTA 5DGAA 2FVPA 3ICLA 4O44A 1RT5A 4WFXA 4IQXA 1C1BB 2XC9A 4KE5A 3D28A 3HVTB 1RT6A 3DMJA 1TKTB 5KFZA 5KG1A 3I5AA 4Q0BA 5KT7A 4EO8A 3OL8A 1MU2B 3D5MA 1JLFA 4KO0B 3BSCA 4R8UB 4K4TA 3QZ8A 3KHGA 2YNGA 3QGIA 1S6PA 4G1QA 3NBPB 3QLHB 3DOLA 2C2DA 4NLPA 1T94A 2BANA 2WRMA 4WE1B 3HVWA 4ZPDA 2RDJA 4URQU 3EPIA 1LWCB 1RT1A 4MFBA 4ECSA 2RF2B 3UR0A 1U09A 3CDEA 4ICLA 5KFXA 2E9TA 3PJWA 4NLXA 2VG7B 1HYSB 3N6NA 1C0TA 2R2RA 4F4XA 5L1KA 5J2QA 5F9NA 3DYAA 3BQ2A 4K4VA 1S6QB 3KLHA 4QW8A 5J2PA 4J9KA 5KFHA 1RYSA 3SFUA 4IFVB 3KLIA 3M8QB 2OPSA 5L1IA 1N6QB 2ASLA 4YR0A 3H5UA 4DL5A 5HLFA 2EC0A 3BSAA 4O3PA 5KFRA 5C25B 4U6PA 3QZ7A 4DL6A 2BQ3A 5J2MA 4O4RA 2FVCA 1S1UA 4Y34A 1VRUA 2FLPA 3DM2A 4GC7A 2AU0A 1XR7A 4NRUA 2HMIB 2W7OA 4ED6A 2YNIB 5KT5A 3H5YA 4WZQA 4JV1A 4Q43A 4I7FA 1REVB 1S1XA 4IH7A 2E9ZA 5F8HA 3CWJA 3HHKA 5KFGA 3JSMA 5I42A 1QE1A 5JUMA 1ZTWA 2HNDB 4PWDB 5EUHA 3T5HA 3Q8RB 3OHAA 3CJ5A 3PW7A 4NYZA 4NCGB 4ECQA 4X2BA 1HPZA 1FKOA 4O3RA 4Y2AA 4J9OA 1ZTTA 1HQUB 3OLBA 4ID5A 1HQEA 3GIMA 2IC3A 2CKWA 3KMQA 3N6MA 2J6UA 4WYWA 2VG6B 2AGPA 4TQSA 1JXLA 1C0UA 1RT7B 3LP1A 3I0RA 5KG6A 4JV2A 3NL0A 2V4RA 4TY8B 3CIZA 5HBMB 3N6LA 3LALA 1JKHB 2ASJA 1T05B 3IS9A 3BREA 4IOBA 1S1TA 3NKYA 4R5PB 4ZP8A 3KLFA 1JLEB 2O5DA 4EBDA 2VG5B 2ZD1B 1RAJA 3DRSB 3KNAA 2JLEA 1RT3B 1LWFB 2HAIA 5KFAA 5DG9A 4ECYA 1IKXA 4RW6B 4RW4A 3DI6A 2RKIA 5J2NB 4TYBA 1T03A 2V9WA 1S1WB 1KHWA 4J9RA 4Q45A 4EYIB 3DLGB 1S0NA 1S1VA 4I2PA 1RTHB 1N5YA 3MTKA 3MEEA 3QIPB 1I6JA 4NRTA
chains in the Genus database with same CATH superfamily
1YWXA 3KHRA 1FRHA 3EGVA 1VQNS 4LQ3A 2BEFA 4OLPA 3SQGA 1SJ3P 3OPKA 4M5HA 1NK5A 1RGVA 4BLGA 2L41A 2VA3A 1MROA 5GAHU 3KK1A 3MR6A 5ETPA 4EK2A 1S0OA 3ZZUA 2QTWA 1QSSA 1D0EA 4C8LA 5IQQA 5DJBA 4G65A 4X62J 4EEYA 4FKYA 3NAIA 1VI7A 4WJBA 5KG2A 1JIHA 4CLZA 2XMTA 2WVFA 5THWA 3IRXB 2GVDA 3OL7A 2E9RX 2ATCB 2NXUA 3PM9A 4OI1A 4X4SA 4QU6A 4X65F 3RW6A 3I6PA 4F8RA 4PZVA 4P7TA 1IQTA 4V19X 4P2SA 2RDIA 5K8MA 2WAQD 1M5VC 1JLCA 3W66A 4UTGA 5A8RA 2GV1A 3OR1B 4K4YA 1DHMA 1WOOA 5SUHA 5CYMB 3VAJA 4WP3A 4F7VA 3OJSA 5I42B 2ASDA 1GK8A 5HBMA 2KT3A 2NXNA 2ZUGA 1KFSA 1AFIA 1FKOB 3UDEA 2RNEA 2C3UA 1XERA 3FBBA 3HSZA 4DSKA 3QFWA 3R5AA 3IRWP 4YQWA 3KK2A 2JJ4D 2YKAA 1P1TA 2ZITA 2OKQA 2R2TA 3HCXA 2BM0A 1TU0B 3GPAA 3L3CA 1RWUA 5DLGA 2W2NP 3HDSA 1VR6A 4U95A 2HNZB 1KLMA 4ENOA 4ED8A 3P49B 3Q8SB 4I2QA 5C42B 2W9CA 4K0KJ 1Q5VA 2GQCA 4H4OB 1KVJA 3K89A 4LSLA 1AW0A 1R0AA 3MM8B 5E3CA 1DQ8A 1PJ5A 1JWWA 3IR7B 1CULB 3OXGA 2YKMB 4RW9B 5F8IA 1WC1A 1RT2A 1NNDA 3PHEA 1MU2A 3BGOP 2A1BA 2OFGX 5CH7B 4UY8T 3PV8A 2H4YB 5ADZA 3M8YA 1HW8A 2OTLS 1BC6A 1FJCA 1UJ5A 1WSVA 4RL1A 3LAMA 3KXDA 3FC9A 1QVGR 3PXGa 2V94A 1BQXA 5GAGI 4NCGA 5KOXA 1NSPA 2MKJA 2F7VA 2V4JB 2KDOA 4ZCLA 2QT7A 2ZZNA 1N34J 1R31A 3HFVA 1GMVA 3LP1B 1YHQS 4A47A 2AZ3A 4LF4F 3LPEA 1Q86T 1Y0HA 4JP8A 4DXLA 4NASA 1VRTA 2P2CB 2B9XA 3D1QA 1T11A 3KJFB 1N0VC 4E98A 1RADB 2JLFA 5E7OB 3CO0P 1WD6A 1VQ8S 3ZZOA 2HURA 1SQEA 2HS4A 5HMXA 4JI7F 1RB0A 4DR6F 2B9WA 2XS7A 3M9NB 1U1QA 4LIWA 1YBTA 2IM0A 5HP1A 1EKSA 2OELA 2G2OA 2XI2A 3OFFA 2J9DE 2K1RB 4IRCA 2HHSA 1HNVB 3PCOB 1UVIA 4B17A 3DDNA 5HATA 5KFZA 3VVUA 1YJVA 1X4FA 4MFBA 3PJWA 4NLXA 2F9JA 1X4HA 2QIFA 2R7TA 4G6VB 2CFXA 4UOGA 4JYAJ 2BOAA 3L9ZA 4HR2A 4NXMF 2KJVA 1F0XA 1C4AA 1F9HA 2UU9F 4Q43A 4I7FA 2ZC3A 2XBPA 1NJXA 5MAOA 2NS1B 1HQEA 1C0UA 3NL0A 3T1HJ 1GXTA 3MOZA 4OJ3A 1V5IB 3NKYA 2FHKA 3KLFA 3IXQA 1B0VA 2E5HA 2YQ1A 3EJMA 5A8WA 1FD2A 3J7Z5 1BE4A 1L5UA 2MYFA 4DV6J 4RNMA 5T41A 4A8KA 2H65B 2W9AA 1VQ6S 1OY9A 1OYDA 4IG0B 4K4XA 2XHCA 5EDWA 3HHDA 3SDEB 1GTEA 4OI2A 4OZLA 2FJXA 4ZVHA 4CCHA 1WC4A 4ZITA 1SL2A 2D3ZA 2GS8A 2V6AA 2N7CA 3L95X 1SKUB 3G8SA 5B0DA 1U6BA 2MSSA 1RK8A 4KFBB 2ZOGA 3MEKA 1J2VA 4EWTA 1WTFA 1UETA 3TNVA 1EQ0A 1WHWA 2ZEJA 5AT1B 3QNWB 4KV8A 4QPTA 3KJVA 2PA3A 2OP5A 5JXSA 3UN5A 3TZWA 1OM2A 4HACA 1QAIA 1DQ9A 5J2PB 3AJDA 5HLFB 3KLEB 4NLVA 1G4CA 2K3IA 2QA4S 2UVUA 2F9DA 4DOZA 1Q95G 1VOMA 3H59A 2YQ3A 3DRSA 3JAMU 1HFEL 4OYPA 2W25A 1MWQA 4ZLLA 4FPRA 3G8QA 4B9TA 2XYHB 5KFNA 4ECZA 4JI6F 3MAAA 5E0OA 1IKXB 3R2CJ 1F2HA 3BZQA 1U2CA 3EX7B 4BC9A 3MR5A 4C97A 4CYUA 3R2DJ 4K2XA 2Z4PA 1VHIA 4Q44A 2R9LA 1RTJB 2DT9A 2Z58B 3P5BP 2YWFA 1SC1B 4ZA1A 4MKAA 5AE2A 3DRPA 5KFEA 4U8VA 3TJ8A 2O1PA 2A2CA 1HMVB 1OQ6A 2DYAA 3AQOA 1B70B 1KQGB 5U47A 3IWLA 1KVKA 2V2QA 1PYOB 2CPYA 3MEGB 3M2UB 4OX9F 2KG1A 2V9KA 4DPWA 2V69A 1LWEB 4ZK7M 4RZRA 4Q0BB 5FIIA 3JTOA 1UEVA 3I56S 1X0FA 4RLEA 2CQCA 4Y2MA 3HX9A 3W5ZA 4ZVRB 4PKDB 1Y3KA 4DI6A 3KDOA 2DISA 3C15B 1OYEA 3GFZA 4BWJA 3HI9A 1V6HA 1G7CB 2BZ2A 4C8NA 5G0RB 3QJPA 3J80Y 4L6V3 3EGWB 1MMLA 1XMBA 3LF0A 3UNGC 3AOCA 2ZH7A 4ZHRB 3GILA 4JI2J 3GV7B 4X62F 2L9NA 4RKUC 1MW7A 2ADCA 1F3FA 3WC0A 2BE2B 3W9JA 4LJMA 2CQ2A 2HHTA 2ZWPA 4O23A 3OR2A 3QT7A 2MZQA 2ROGA 2Y1RI 2UVVA 7FD1A 3OQ2A 1RAGB 1AA1B 4DPYA 1WSRA 5KG4A 4A46A 2GFFA 5HSPA 4CM2A 5D3GA 1XR5A 2EWHA 5CYQB 4XIUA 4DV7J 4QIEA 4YB7A 3TARA 4FP9A 2B51A 3ZZZA 4CLLA 4LVNP 3IRXA 3M6XA 3HP6A 3A8IA 5HL7Q 4LR8A 1GT8A 2W4PA 1U1NA 4Y2IA 4RJVA 3BYPA 2F4FA 2X1AA 3BSCA 3BS9A 5C7PA 3NBPB 4ZPDA 5A76A 4ID8A 2KKHA 5LMNF 4YB6A 5I4MA 4KGXB 5F9NA 4K4VA 4QW8A 2IBOA 3OR1A 1N6QB 3DHWC 3THPA 1S12A 4Y34A 1XWLA 2YX4A 3NRBA 1MMNA 3A3NB 1PAUB 2ZHOA 5I42A 1VHFA 2DTJA 5EUHA 3I82A 3WX4A 3QSIA 4K0KF 2XSJB 1HPZA 1FKOA 3J81U 2IC3A 2J6UA 4HI1A 4DV5F 4CLPA 2V4RA 1WEXA 1WOPA 2QMXA 3EVMA 1T05B 1T0TV 3HLUA 4EBDA 1RP5A 2GHVC 2BJ7A 3QRQA 4TYBA 1UA1A 3A12A 4FXDA 3AD7C 3QT8A 2AW0A 5C42A 4KYZA 4AXIA 3NS6A 2UXCF 2KTQA 2D69A 1SC6A 1C1CB 4DPXA 5M2PA 1CULA 2D1CA 2YKMA 4RW9A 1U4BA 1SV5B 4A8SA 2VF3A 1IBLJ 4IR1A 1PC4A 1U25A 4CTAB 4ECVA 1GMUA 2QRRA 4CIOA 1NAQA 2HGLA 1N34F 2KFYA 5IM0B 4KJIA 2HFNA 3VCDA 3TX8A 2XLJA 4CRJA 1MG7A 3C46A 3K2YA 4PAAA 3SQOP 4UOCA 2DHAA 3CD5A 1WF2A 4B3OB 4K4ZA 2WVEA 5KFOA 1S99A 2A2DA 3DM2B 4ZVFA 3WZ0A 5AXKA 2BM1A 1FDAA 1F5BA 1T02A 2DR5A 1YTYA 4DL2A 2VG5A 2LQ5A 1RWPB 5GAHI 1QTNB 1RWVB 1TMJA 2DNNA 4YOEA 5F8JA 3KUEA 4I6WA 4LSZB 4I2PB 2K7KA 2D9PA 3ZTRA 2M7SA 4OYIA 2PIIA 1QAXA 4JYAF 2I5JB 1MNEA 2MEWA 1Z2ZA 2C2KB 1MMDA 4DQRA 2CDQA 1NPRA 2XCAA 2QA1A 1FE0A 2CWKA 3VTIA 1QSLA 4N41A 2HHHJ 4EBEA 3H5SA 3EGNA 2YBVA 3ELHA 5B09A 2JX2A 2VV5A 4BCAA 5T7LB 1RISA 3FEXB 3RR7A 3RJMB 1GXUA 1NB7A 4XO0A 4ZJQA 1N33F 2CPDA 1VQYA 1BGXT 2UUAJ 3BDEA 4DV6F 2EBGA 3JSYA 1UWBB 4XAKA 3VF0B 2I2YA 2JVOA 5H9FJ 4CQ1A 4MH8A 4CP5A 2DIVA 2KH9A 1UTAA 4CT9A 4ZN1A 4ELTA 5KG7A 1UAWA 5DO2A 3P6YC 2W4DA 4HVZA 3RRKA 3UI3A 4UF4A 2FLNA 3U1NA 4EI2A 4JI8J 3NGRA 2VKRA 3FFIB 5AXMA 3TEHB 1TK8A 3GIKA 2CVEA 4ANDA 4Y3CA 2COLA 2RDDA 2CRLA 2NXJA 3K57A 2G1DA 4IG0A 4J9LA 1T3NA 1CSJA 1SH2A 2J0QD 2NZ4A 5HI7A 2WB4A 3RR8A 3SDEA 3T41A 3LP2B 4CNZA 4K5RA 4O3NA 2VC1A 1IBKF 3L09A 4ECRA 3DHXA 3AOBA 3HM9A 3LWMA 2W2QP 1U47A 3NWGA 2J5AA 3N5BA 4MIAA 3BGUA 4WIQA 1D9DA 1BLUA 5ETOA 3K5MA 4KE5A 3TO8A 3D28A 5KG1A 3I5AA 2FGCA 3R7SB 3R27A 1S72S 3DGPB 1WDTA 2GCFA 5DDRC 2XYPB 4DX5A 1CJUB 2VG7B 4F4XA 1J27A 4DR2J 3JTPA 1S6QB 5J2PA 2C3YA 1CJTB 2JSXA 3M8QB 5L1IA 3ET6A 1A6LA 3B82A 5HLFA 3J7A1 4EMDA 2AU0A 5L38A 2FTRA 3GYXB 2PI5A 4B9VA 3FNNA 2BX6A 3CJ5A 4OV1A 4ID5A 1O8BA 1DQAA 4RPFA 4TQSA 1CG2A 1TAUA 4JV2A 2F1FA 2Y8YA 1VMBA 1K0TA 5LL6d 2KL8A 1DARA 3RG6A 2WVBA 2VHGA 1IKXA 1RHQB 4M5GA 2ZH4A 1YJTA 2R7WA 2DR9A 1H0HB 2EKNA 2HG4A 3VR1A 1I1GA 3ULHA 3W61A 5IV3A 2DPIA 1RWKB 4URGA 1RTDB 3QO9B 4C9DA 2IVYA 4LR7A 4AFFA 3A4TA 2HHQA 5ITHA 4G1PA 2GA7A 3GG1A 2PGCA 1HMVA 2CNOB 3CGIA 3IGNA 1EB0A 2W9BB 1RDRA 2JOQA 5F0UA 4N8OA 2CG4A 3M2UA 3MEGA 5E3RA 5KFIA 3CCLS 1URNA 2N3LA 1LWEA 2ACYA 2YPYA 1NUEA 1VQSA 4JI2F 2CJ9A 4PG7A 1M1HA 1R8PA 3DLHA 3GG0A 1LWCA 4B3RJ 1RT4B 4OLOA 3PFEA 2RSQA 5E3AA 3W65A 5HAOA 2XZ2A 1HD0A 1RBOB 3GB0A 5G0RA 4DU8A 2UXBJ 2DNYA 2QL9B 3GQCA 4CO2A 4PWDA 1M5HA 4ZHRA 3H7HB 4I68A 1Q5YA 1NK7A 4LF8J 1GH8A 4LBPA 1P1LA 1HWKA 1RAHB 2QLFB 1QE1B 1VQPS 2BE7D 2AX0A 3MFHA 2BE2A 2CQGA 2C22A 4DPUA 1S10A 4JI0J 1WNEA 1XNQF 5KT2A 3SMZA 4ZPWR 4USIA 4Z37A 2WB1D 5D77A 3MECB 1U0SA 3FCWA 4RX6A 4OL8A 2XZDB 4USMA 4KHMA 3EZOA 5C2GA 3R1LA 3KHHA 3D0IE 1YRUA 3O3LA 2ILYA 2HGMA 3S6EA 1NK9A 1JB0C 3KUGA 4DR7J 3IGVA 1YJ7A 3LP0A 5A2QY 1NM2A 3MEDB 2J0SD 3FMBA 2CXEA 3D6MB 4JUZA 2QO3A 1D9FA 2ALYB 1D3WA 3NBPA 4DDFA 1BWVA 4ED5A 3BKTA 1UVMA 3PRVA 1JLFB 3VZHA 1HNIB 4P71A 1N6QA 3DLKA 3WQPA 2V2ZA 4ZPTR 3M2VB 3TVZA 4IG3A 5HROA 2CPEA 3AA8A 5LOQA 5KT3A 2ZH2A 1QD1A 2MQ8A 2BVZA 1VQKS 2XY7A 4DV4J 4C8OA 4B3TF 2X1BA 3MUVP 4MYUA 1R8AA 1HA1A 2A3JA 1YIJS 5CABA 4P72A 3DOKB 1FJEB 3PIOQ 2V0NA 4ILMA 4X84A 4ZPAA 2I8EA 1IBMJ 4WIIA 1KS2A 3LPYA 3PW0A 4GKJJ 1RA6A 2LA6A 2ZVSA 3PACA 2PSZA 1Q79A 4ZIVA 3D66A 4A8FA 2CQ1A 1VK3A 4DV2F 1OS5A 4IH6A 5KOWA 2RRBA 4KIAA 1HL6A 2WSCC 5HK4A 1M1GA 4ZP9A 1SV5A 4FF2A 2WTFA 3UD5A 4M95A 1IR2A 3SSQA 3VALA 1YZ6A 3CCQS 1RWOB 4CTAA 2R2SA 2I6WA 1NDLA 1N5SA 4DQSA 3C8YA 1RWWB 4NZ6A 1WKKA 3A13A 3NOCA 3CC7S 3IWXA 3PYGA 5H9EJ 5H9FK 4NOHA 4KKOA 2DO4A 5KFDA 3ICLA 2CJKA 3HVTB 1WHVA 1TKTB 1SXLA 3UDCA 3D5MA 2Z57B 3OUYA 2JHEA 3GCWP 2Y1IA 5CA5A 2WRMA 2OD6A 2CPFA 1IXKA 3CF5Q 4N7TA 4WFNQ 4HH0A 3PX4A 4OMFG 2LQ9A 3LQVA 4OIXA 2BA9A 5KFRA 1RTZA 1WG4A 3DM2A 3D6FB 2YNIB 4WZQA 1GTHA 1UFLA 2YKQA 2MKIA 2I38A 2MB0B 2DNOA 2EFNA 2HK3A 4KR0B 4F26A 4DCOB 4FXVA 1EQMA 1Q0NA 4WYWA 2BKNA 4TY8B 3M6WA 1OY6A 3F0NA 3M30B 1X4AA 1U49A 1LWFB 5DG9A 5J2NB 4J9RA 2ZOFA 2DKOB 4I2PA 1TUWA 5IS2A 2HVHA 2XTJP 4LFCJ 3SYZA 3R5GA 4ZLPA 2RS8A 5BYQA 4USHA 1DTTB 3QMQA 3NOGA 3BJYA 2I5JA 1JQGA 4DX8H 2OMLA 4X4TA 5CQGA 1YRTA 2YY3A 8RUCA 3SFGA 2DJWA 2IJFA 1YJUA 4KHRA 5KFVA 2LDIA 3JYTA 3HHLC 2HHWA 2EW9A 4PXBA 1N4LA 1L3VA 5T7LA 3C3LA 3HO1A 3PEHA 2C42A 1ZBTA 2QFIA 2H5IB 3Q23A 4WP8A 1MWYA 1HHTP 4JI8F 5HO4A 2LEPA 4RUAA 1NZ8A 1SUQB 3NXZA 5FJ4A 2DEIA 4IFVA 5F8GA 4J91A 1UWBA 4H4KA 5AE1A 4HLBA 4C2MA 2VICA 3KLHB 4R0EA 1PIEA 3M6UA 1YG0A 4DZDA 1FI4A 3MMBB 3CMES 2BQUA 1VLYA 2DH9A 3W8GA 4DL4A 3HZEA 3FFIA 4EO6A 2KM8C 2V8GA 4WZMA 1NRKA 1FRMA 1RT3A 4LF5F 2HIQA 3D54A 1S1WA 2CQ3A 3M9OB 3BM7A 3AT1B 5KFQA 1R8BA 2X3DA 2FHOB 3LP2A 4GO5X 1KOOA 1YJNS 3W5XA 4DU7A 3D0GE 1N52B 3M8WA 2AJ4A 2H3EB 4QWCA 4NA1A 3SBMA 2B5JB 4JI3J 4F0HA 1JJ4A 3SV4A 3OLAA 3OXLA 1UVJA 4PXCA 2IYIA 2ZNYA 5K8NA 2GIFA 3RGIA 4PCQA 2HAFA 2E5JA 2CZ9A 1SQFA 3DGPA 1B7FA 4ED2A 1O5JA 4A4JA 1CJUA 1VGYA 3QGPA 2V2VA 2U1AA 1S6QA 2VBWA 1S6PB 4QIGA 3M8QA 1S7HA 3ISNC 4YFUA 3EXYA 4KSEB 2NSCA 2KXHA 1NXIA 1RAIB 2CADA 2WONB 2ALZA 1PYTA 4KB7A 2CNLB 1IUJA 4X66J 2E7XA 2M5YA 1FD8A 2MMYA 4QIVA 4TU8A 4X4QA 2UUBJ 1OWXA 3KG4A 4ELVA 1C2PA 2FY1A 2AX1A 1GNKA 3J80U 1TMMA 2BW7A 3I96A 3CCRS 2DCLA 3G82A 4KY3A 3C6UB 3R7BB 1CC8A 1RKJA 5DQGA 1IJEB 2GNKA 4AL6A 1RAEB 1XR6A 3US5A 4LFAJ 1WEYA 2RHQB 1S6UA 2IRUA 3KK3B 4YS2A 1RTDA 2ZBIA 3BEGB 4XK8C 4DR1F 3K17A 3OBIA 1V9OA 3DNCA 5HVGA 2C2RA 5D4PA 3HULA 3TAMA 3TP2A 2ZUAA 1RCXB 1Y5IB 2HFVA 4DCPB 4ZDNA 2IMWP 1Q4RA 3FK4A 3ENVA 5I3UB 3NLCA 2UUTA 2W4CA 4P2MA 2BW2A 2FC8A 4DSLA 3K5NA 2BYCA 4C98A 2V8VA 2ZBQA 3TZXA 4JBCA 2O66A 3ILIA 2UXDJ 3EPIA 2LQBA 2RF2B 5IQ6A 2APOA 2QA2A 4NL5A 4WKYA 1VC0A 4FDFA 5ETSA 2R7RA 4WFBQ 4GMKA 2PEHA 1SIWB 2U2FA 3OT9A 3J7ZT 4C8YA 1S1XA 3JSMA 1QE1A 4HHUA 2MJNA 3AAWB 5IC4B 2RAQA 1NK4A 1E6YB 3GIMA 1FKAF 5DZ6A 3FKBA 4B02A 4DR7F 4UOHA 4OZ5A 5H9EK 3I9V9 3EGZA 4QYZK 1X4EA 4JI4J 3MDFA 3JSBA 1N5YA 1KWMA 2HNYA 3EICA 1QDUB 1WI8A 1XMQJ 5A6PA 2F8HA 3HSDA 5D6GA 3R9LA 2RQKA 4FF1A 1VIXA 1AYEA 4DV4F 1JLGB 2XCPA 1QAYA 1Y7PA 5KFCA 4XPCA 2GO9A 2BJEA 3LA0A 2XEXA 3FZBA 4GKJF 1HNIA 3M2VA 2IJNA 1D1UA 4YY3J 3JXOA 1N36F 2YNHB 3B8HA 2X51A 3O1LA 3U02A 2G4BA 1NSQA 1VQMS 2BACA 2G2YA 3DOLB 2BANB 2W7AA 2YTCA 3DOKA 4WTYA 1IM6A 2IFXA 5EX3A 5HMZA 4IKAA 3PY8A 1G2EA 3W9IA 1IR0A 5J2MB 4HKQA 3ITHB 3CDWA 3FRZA 1N5TA 1SC3B 2OFHX 3V5RA 1UFWA 1G1XA 1H3DA 1FO1A 4HDHA 4HTJA 1IJFB 2B4PA 1HBNB 1WORA 3R5DA 2OGUA 1RU2A 4O0IA 2H51B 4X65J 1VJWA 4ZVGA 1R27B 3MMJA 4FBUA 3T3FA 5ETVA 3DLBA 2R7UA 2D3UA 4AD6A 3THVA 2V1SA 2CNKB 1T03B 1SJ4P 4OHXA 3T19A 4U67Q 4UT4A 2K3KA 2JVRA 3RZAA 5DETA 3VV2B 1QLNA 5D0GA 4ATNA 2W8LA 4LREA 5ETQA 2IA6A 3RU0A 2XMWA 3DXSX 1LK7A 4LMZA 2IYGA 2KG0A 2XZWA 4N5SA 2FDNA 1HWLA 3HVTA 2OPQB 3CCWA 3RTVA 4GC6A 2UZAA 4U96A 3Q8UA 3S1TA 3TOQA 3CJTA 2CQIA 1H72C 1MN7A 1Q8IA 4WKRA 4Y6IA 3TR5A 4ZP6A 5GADU 4OI3A 4NLGA 1Y00A 2YNIA 3O6QA 4QWDA 1U1KA 4UZCA 4LFCF 2A6MA 2ZNZA 1S1UB 1U6FA 2XMUA 1NDKA 4YMEA 4NLYA 4Y00A 3D1OA 3BDPA 2Z2YB 1X4CA 2HFSA 2CQ4A 2HHXA 1R0BG 1FRLA 1V3ZA 1S57A 3M30A 4KC5A 3B4MA 1LOUA 1LWFA 1S9GA 5J2NA 2PD1A 4ZVUB 1WI6A 2DR6A 3AJ2A 3PFOA 4DBQA 3T6JA 4KT0C 2NREA 2NYIA 2AP6A 5CZXA 3QWUA 3KLVA 1EX8A 1DTTA 4C8MA 2M0GB 3MM6A 3W7BA 1UPPA 1R6YA 4FYWB 1ZM4A 2LQJA 2LEAA 1NU4A 4M5LA 3QFHA 1BQNA 2PMWA 2OHDA 3T1YF 4U7CA 5EWGA 2QV6A 1DY3A 2B0GA 1M0SA 1DTQB 5J1EB 5HQMA 3KLGA 3AB4B 3WIUA 2M8HA 1WC0A 2R7OA 2AYGA 1WHXA 5BJRA 1W7WA 5D78A 2VU5A 3BBBA 5LSRA 3IG1B 4JI5J 4LF4J 2HKEA 2L9DA 2G1HA 4PYDA 3GSIA 1BWEA 1U24A 5IT0A 2RDJA 3SV3A 3KLHA 2FGOA 2DXFA 4OHVA 3R97A 3MMBA 1V5VA 5IZHA 2QYCA 1RLDA 3RYLA 2Y0BB 4UY85 2HZAA 4JV1A 4DMZA 2ZFHA 3O44A 3HHKA 1ZTWA 1F2GA 2UUCJ 1SBRA 2E1MC 2PA8D 4J9OA 2C2OB 4G1IA 1KN6A 3Q89A 1RQ0A 2W2PP 5AXLA 2VG6B 2HK2A 3CIZA 2Y3YA 3IS9A 3HHLB 4NE9C 3KNAA 3OXFA 2B8PA 2GVZB 3ENAA 2RMLA 2M2BA 1KHWA 2M70A 5FLXU 1I51B 3MEEA 1X5SA 1N5VA 4NLQA 1HNWF 2FLLA 4J5OA 1TKXB 1ZOTA 1RA7A 1RTIA 2LLZA 3UDVA 1ZA1B 2HPUA 1KQSR 3H5XA 3F56A 1X5PA 4YB5A 4NXMJ 3B4DA 2B5JA 2KT5A 4CH0S 2UU9J 2JEFA 2Z0GA 2HQIA 2BABA 4B9MA 3T5JA 3OSNA 2Q6BA 2GZOA 4HI2A 1ROFA 3GONA 3DLEB 1KR4A 4DLGA 4MK8A 3K5LA 3M8ZA 1J5OB 4PG5A 3EXCX 1JLAB 1X4DA 1C1BA 2MQLA 1ZAXA 4BC7A 1YLXA 2ZZTA 3H42A 4WFAQ 5KG3A 1CEZA 3MM9B 4IH5A 1P6TA 3DMJB 1NCLA 4RBUA 2YNGB 2WONA 5L1LA 3GJRB 5F8MA 2M8DB 3PR5B 2RHSB 5EWFA 4ZP7A 3PW2A 2V4QA 1YRXA 4LVOP 1C0TB 1JLQB 4DR4J 5CD4H 2DPJA 3EMTA 2F4VF 1T9VA 3QJJA 2OPRB 2W7PA 2UVRA 2P6SA 3C6UA 2I1RA 5E41A 2DGSA 4KGVB 2ZH5A 3I5BA 2ZM6F 4PPDA 3KG0A 3I0RB 3T1AA 2DCUB 3KK3A 1WDDA 2XQCA 1KP6A 1NHUA 1NBEB 4NLUA 1NK6A 3FMWA 2RQMA 1PILA 1ZAWA 2W01A 3IFEA 3MD3A 1HQ2A 4NPOA 3CTRA 2IAJB 2Q1LA 5EN1A 5HVFA 4ZVSB 1SJQA 2EG2A 4PRFA 1S76D 1Q8LA 5I3UA 4J9MA 2V8HA 3MM7B 4MAKA 2RQ4A 1U26A 3HFKA 2ZE2A 5AJ3J 4DFMA 5KFSA 4NZ0A 3J7YU 5H1SV 3D6HB 2IIHA 4OZJA 4JI6J 5LT5A 2E5LF 2RF2A 1L3TA 3AH6A 6AT1B 2WBRA 1S48A 1KTQA 3P5TL 1FWPA 2JC1A 3OFEA 3ZTOA 1A9NB 3W60A 1NK0A 3SSSA 3E3XA 3T5KA 4M5JA 2KYZA 4GKKF 1R89A 3I0SB 1E6YA 3MPUB 2RJZA 1PJ6A 2MZ1A 3GR0A 4LQ9A 2ZH6A 2YWKA 1NEEA 2DH8A 2H9ZA 4GO7X 1U1PA 4NYPA 3DOMB 3VAFA 2ZKTA 4OX9J 5L39A 3W2VB 3VQSA 3CE8A 1KKHA 5T14A 1W2BR 4U7UD 3BH7B 3N79A 4QYRA 1CJVA 3RB6A 1WC6A 2HBYB 2DGWA 3MUTP 2PFDA 2R8JA 5DM6Q 3OTCA 3LO3A 4ZPBA 5KG0A 2WZ1A 4BDPA 3NMRA 5BR8J 1SCJB 1OO0B 4LIRA 1GQEA 4OHYA 4XTTA 2BQRA 2K06A 2XZTB 5IT9U 3W3SA 3FEYB 7FDRA 2FVPA 4ILRA 4EO8A 4K4TA 2DY1A 2D68A 3G8TA 1UL3A 3DOLA 2BANA 9ATCB 1Y5LB 5KAKA 3OVAA 4F0MA 1WKJA 2OIHA 5L1KA 2GJIA 1ZA2B 4NCBA 1F9FA 3QZ7A 1FJ7A 1NZAA 5J2MA 1K0VA 4B9NA 1SC4B 3CWJA 1PBAA 4KGZB 5JUMA 2HNDB 2GHPA 3VQTA 2HZVA 5DM7Q 2I9SA 4LF6J 2YH0A 1U45A 1S1TA 1OQ3A 2YKPA 2Z56B 1T03A 3DLGB 4DPTA 1RTHB 2KXFA 1B99A 5LMNJ 1FXDA 5LSLA 1ZYQA 1EETB 2D9OA 3ZZPA 3C66A 5JVGQ 2FB0A 1AUSL 4RW8B 4E2FB 4GVBB 1O51A 3O8WA 1ICEB 4P52A 3CJ3A 4DV5J 3K0JA 2CJAA 1P27B 2OPQA 5MLCV 1S4FA 4OYOA 1MSWD 5E3QA 2J0WA 3D6TB 3HSJA 1SJRA 1S9FA 1RHUB 5DDPC 3EVOA 2FIUA 3HJVA 3H98A 1JLBB 5F0WA 1JX4A 3F44A 1TL1B 2OAUA 2AYEA 2ZVIA 1SQGA 2UXCJ 1SH0A 2ZH1A 3GJSB 2R8KA 3CDUA 4HHHA 2H5EA 2EBEA 1WJ9A 3G86A 4EBCA 3M8RA 1XQIA 1RHJB 4P7VA 4F4AA 2XB2D 3ZZTA 1HQUA 1TFWA 3LOUA 2DR8A 1TTHB 2ZKUA 1JKHA 4E8UA 3H2LA 1KQFB 2J6SA 5F8LA 2OD4A 2ZD1A 4NMXA 4CO4A 3BPDA 2BJ9A 4DV0J 1WACA 3IMQJ 3M7VA 3FSIA 4JI5F 1WTBA 1H7WA 5B08A 2RIJA 3DI6B 2KJWA 1VK8A 4WWSA 2Y0SD 4S0MA 4BS2A 2YX7A 3HT3A 1BXNA 1DTQA 5J1EA 4ZKAA 3HK2A 3R5JB 4WP9A 4DN9A 1UWAA 4P2FA 3OSPA 3THTA 2BBEA 8ATCB 4NI2B 3K8VA 4NWBA 2UUWA 1PBUA 1YITS 4DFPA 4NCAA 3G2XA 1ZPVA 2GMHA 2DRBA 2UUCF 3NCRA 3HD2A 3TW0A 5DZ7A 3HHNB 3M32B 4F4ZA 4KTQA 1EP4B 2CZ4A 5F3ZA 2G0JA 3Q86A 5G4DA 1F5CA 3H20A 1JJCB 2CPHA 2NYHA 4TQRA 2ZJQQ 1NSKL 4K50A 1HW9A 4FS1A 2MKYA 3VAMA 1EHWA 5DLFA 4O3OA 2J9DA 4DX7A 5D8HB 2VD3A 3P96A 3GFXA 1TL7B 3TQEA 4P75A 1APSA 1TL4A 4OJGA 1VQ5S 1JXEA 4G3IA 4TU7A 2HQFA 2HS3A 1XMOF 2VBZA 4LSNB 3JAMY 2QSWA 5D0RA 4RU9A 3X1LB 1JMTA 3JQJA 3HHLA 2AEFA 1UUJA 1ZAVA 2VL1A 3V6KA 5KFTA 5GAEU 1ZM2A 3C14B 4CLTA 4ED1A 3DFEA 1VBYA 3I31A 5DDOC 3ETOA 2B7BB 2FZKB 2QLJB 2DY9A 4PWUA 4J9PA 2LKZA 4M5DB 2JEGA 1N33J 2WOMB 2GMJA 1FX2A 1FE4A 4M94A 1XIQA 1LV5A 1J5EJ 1OJ4A 4N47A 3W8PA 1S9EB 2J8SA 3KK1B 4I1TA 2FJAB 4OZ2A 2YNFB 1ZPWX 2XGPA 4ED7A 1VLOA 1L3SA 4DR4F 3MCSA 1J5OA 4I56A 1DFDA 1JLAA 5B0GA 4K59A 4YR2A 1JXVA 3LGNA 4YDXA 4ZJLA 5GADI 1VQOS 3H8YA 3GE9A 1F9EB 3IWNC 4FXWA 3U1MA 3G96A 3MM9A 4J7CA 3DMJA 1HBOB 1Q8BA 2MKSA 3KHGA 2YNGA 1IBCB 3EE3A 2G2ZA 1TAQA 2DRDA 4NLPA 1YZ7A 3FCVA 4DS4A 5B0BA 3BR8A 2BKPA 1C0TA 1H2VZ 3SFUA 1IBKJ 4DF8A 2CQBA 2EC0A 1PYSB 4M63A 2QEXS 1GXLA 3HVRA 2XO7A 2CPJA 4AQYJ 4IH7A 1UZDA 1VRQC 4WU2A 4OHWA 3PW7A 1OPZA 4Y2AA 2MHEA 2E7VA 1UZHA 1YSJA 2JZ5A 1U1RA 1JXLA 3I0RA 4FYYB 5KG6A 1W26A 5HBMB 2CDRB 4ZS6A 2WW8A 4R5PB 1FA0A 1DRZA 3HHLD 2V1TA 5AJ3F 4RW4A 2V9WA 3JQKA 4KQZA 3NS5A 2PI4A 3IA0A 2EVZA 4CLSA 4CLFA 2DNGA 4CLWA 2AZ1A 2DXEA 3RAMA 2HBQB 5KFJA 1N88A 3GYNA 4N56A 1TKZB 2LU2A 1KLMB 1HIYA 3OTEA 4CLUA 1LW2B 3MM7A 1SI9A 4CO0A 3DCAA 2CVIA 2B43A 3M6VA 3DRRA 1KFDA 3PW4A 1W2IA 3BO4A 1NDCA 2KT2A 5D4OA 1L3KA 1E6VA 1FDDA 1RT2B 3JS9A 4D3HA 2YWWA 4DL3A 3ZTPA 3MR2A 2MZTA 2R2UA 4DQPA 4WXOA 2XNQA 1HNZJ 4IQMA 4O44B 2WHOA 3D2WA 2V50A 1S97A 2IM2A 2HVEA 4TLRA 3I0SA 5K20B 4DHVA 1RT1B 3J81Y 1HLWA 3PEJA 5A6WA 2FHJA 3D1HA 2EFOA 1F6TA 4JV0A 3KFWX 2DGXA 4WXWA 1GFWB 2QN6B 3BR9A 4OQJA 4PQAA 5D0HA 3W2VA 1HNXJ 2O3DA 2C2ZB 1CBKA 1GMWA 2KZZA 1FDNA 3H40A 5BR8F 2C3MA 1N8RT 4A8XA 3JTNA 4RWWA 2QL5B 2E1PA 2VUGA 3N28A 3QIPA 4X4RA 1YVFA 2KXNB 1VRTB 3PG9A 4GVLA 3PYFA 1RWXB 2VFTA 3ISND 4FF4A 1VCTA 2ATLA 2IDLA 3OL9A 3UCUP 4ITSA 1G3OA 5HP1B 4ES2A 4QR2A 4B9LA 1EJ7L 2A18A 5I3QA 4DS5A 1XNQJ 3R5CA 3A8JA 4OI0A 5K9FA 3C16B 3CD6S 4I64A 3RBEA 4LF6F 2KU7A 1T9WA 2IRXA 2JWNA 2UVWA 4C11B 4L76A 2BRKA 4W98A 5EX0A 1Y9OA 1I94F 3FEZA 4P74A 4LF7J 2DNLA 1OMSA 3NCPA 4MFBB 4MTPA 1H38A 3BGRB 5AE3A 1YQHA 2HNDA 2CZVC 5FD1A 4MT1A 2FVQA 3CIMA 4B9UA 4JI1J 1TZ0A 2J6TA 1RU1A 4DJBA 4TNOA 4KHPF 5CYMA 4RNOA 2PC6A 2HLTA 2BE9B 2PMZD 1DLOB 3AB2B 3R1HA 1OPIA 2CNNB 2FHJD 3BN7A 3NAHA 1TVRB 1NKEA 1SKWA 4I0WA 3BSNA 2DIUA 3VAGA 3BKUA 3TWZA 4OFZA 3DLGA 2FJDB 1RTHA 3EZUA 2YVSA 3I5CA 2IBKA 2EG1A 3NNAA 1GMWD 1EETA 2AKWB 2R42A 1I5OB 3N5FA 2RE1A 2BMBA 5A8WB 3TX0A 1KQKA 3D3BJ 5HJXA 2HNZA 4DUYJ 4F4KA 2XGQA 3J7YI 4B3TJ 1NJZA 1LNQA 1T7PA 1TK0A 4GVBA 4H4OA 4Y0FA 2Q66A 3MM8A 2NPFA 3QQCD 3T5LA 2H54B 5KTQA 3CCVS 1HI1A 1B4SA 5A0YB 2XI3A 3CJ8A 2YKOA 1YJRA 3Q22A 4TY9A 2M9KA 4YDDB 3TZZA 2ZBPA 3M8SA 1JLBA 4NLTA 4GRSA 4DV2J 2L08A 3UD4P 3OL8A 4ZCKA 1HHQA 4J9VA 1URRA 4DCJB 4UW2A 4WE1B 4DV0F 3MZIA 4LUBA 3AODA 5EGYA 1U6ZA 4IYQA 1U2FA 3A8KA 2ASLA 4DL5A 1HI8A 4DL6A 2KHCA 1F3VA 3GCXP 4NRUA 2HMIB 1SKRA 3H5YA 2V4JA 4HACB 1REVB 3UVJB 2HGNA 2KHDA 1PSDA 3KMQA 3CCES 3UCZP 3LP1A 1MWZA 3QAUA 1YBUA 1I3OB 4YHHJ 3VGUA 2VJUA 4IOCQ 2DGQA 3R6LB 4CO5A 3FGVA 3DRSB 4U8YA 1CQNA 3DI6A 2DD8S 4C3LA 1S0NA 4ERDA 1VFJA 4Q7AA 3MUMP 2PEBA 1H73A 3PKMA 3DXBA 1FEEA 3QGHA 2VB6A 3F41A 4CYUB 1FRIA 3V2UC 4C3MA 4H4MB 4X4NA 3WX8A 3RRGA 5L9XA 2V8PA 1N5QA 4F3OA 3M32A 1EP4A 1TELA 2K1RA 4EYHB 4WU3A 1HNVA 2C28A 2KRBA 2IM3A 1PO6A 3BV8A 2OI2A 4ECWA 2FVSA 1Y10A 4N77A 1K1SA 2HWIA 1TUGB 3ONQA 1LWXA 2QGFB 1TL7A 4Q5VA 1F1BB 2HRTA 3DN9A 1A0OB 5KFMA 4F25A 1EKRA 4LSNA 1AB8A 2C2NA 5KFUA 1FWLA 3EVWA 1DJ0A 2XS5A 5D15A 3TUZC 3LAKA 4WK3A 2C2EA 1J5EF 1SJFA 3TVKA 3GJQB 4FKXA 2ZJPQ 3K5OA 3TZYA 4PABA 3BQ0A 1ITPA 3IAS9 3BPSP 2MQNA 4K5SA 2CIMA 4M5DA 4ED4A 4FVMA 5KFKA 2M52A 2WOMA 1X8DA 1WHYA 8AT1B 2ACMA 2DNRA 3U7JA 3OR2B 5DGBA 2HYIB 3W63A 3QGGA 1R43A 2ZJRQ 3BB5A 3ETMA 1S9EA 2BR0A 2YNFA 1KSPA 5DG7A 2HQ3A 1QAJA 2VQEJ 1B0PA 2ZH3A 3ILJA 5D3GB 4LBHA 3FRYA 4DV1J 2BDPA 4B3MF 3Q8QB 4AQYF 4Q8EA 3V4IB 2KYXA 2MSTA 1Q53A 2UP1A 4KFBA 3E8OA 4F2SA 4LF5J 1HBOA 3ZXWA 3MAHA 1UMJA 1VQ4S 4J90A 3K7RA 3EZ5A 4FYXB 2XWYA 3R5BA 1FDBA 3RRHA 9RUBA 5B7WA 5DQIA 1LW0B 1X31C 3OFHA 4DL0C 2NR0A 2XWXA 4EUVA 2GX8A 3BH6B 4CI0B 5B0EA 2K8GA 4ANEA 2LXFA 3PO5A 3KMSA 4LF9F 5CYJA 3WDOA 1RKIA 1KD1T 4JV5F 2HRYA 1VQ9S 3PNIA 3KLEA 1FNXH 1VS3A 2EKYA 1NHVA 4R5PA 3GZ7A 4IFYB 1HPZB 4XPEA 3PW5A 4ALZA 2IC3B 2ZBCA 5HQLA 5IWAF 2P9GA 3W2WB 2HQGA 3OD2A 3C6TB 4NXNF 3LW5C 2B9YA 1TKZA 1D8ZA 1KEKA 2LYVA 1BQMB 1P8GA 3DDKA 1HNZF 1LW2A 3UO0A 5E5NA 1D09B 1RTJA 3MXHP 3TA0A 3ZZYA 4FN5A 4HDGA 4MKVA 4LT6A 5IFMA 1AZSB 3DRXA 2WSEC 5LMUF 3M1VB 3E01B 4MKBA 3ADAC 5KFPA 3TQ1A 2WSFC 1PAEX 1RWNB 4CH1A 2MY8A 4C8ZA 1HNXF 4O44A 1Q7LB 3OTBA 3L7PA 3IM8A 4Q0BA 4R8UB 1XN9A 2N4CA 3N0VA 2C2DA 2Z30B 5E33A 3HVWA 1RT1A 3B54A 3IR5B 3FVYA 2CYYA 4DR1J 3N6NA 5GAEI 3GWCA 2LP4A 1T8EA 2FC9A 3C15A 2BQ3A 2AT1B 1X5OA 2W7OA 2AJFE 4I69A 1RI7A 3B6BA 3BN4A 4R25A 1RAAB 2VFUA 3HJFA 1ZTTA 2R3VA 3AQPA 3D4JA 4A8QA 3N6MA 2F5GA 5B0CA 3A1YG 2HBZB 2ABYA 2HHUA 1SKSA 1JLEB 2VG5B 4EFAC 2GQ2A 2JLEA 3W5YA 2HVIA 4EYIB 3H0PA 3I4PA 3CDAA 2RD5C 4KGMA 2OEJA 2C2MB 2EEYA 1EIYB 4H4KC 2D7SA 3KJNB 4D3GA 4LF7F 2OO4A 3SSRA 5CYQA 1LFWA 4C0OC 3M4XA 1L3UA 2DNKA 3FSXA 2M4MA 4MK7A 4WYLA 4LBIA 1K44A 2LA4A 1QUVA 1X60A 2HS0A 3RB0A 4JI1F 3DU5A 4RNNA 3C16A 1TL3B 3SCIE 2X1GA 1Z4UA 1RAFB 4PXEA 1T9TA 4DR3J 4M5MA 1AROP 4C11A 5HJYA 4IOAQ 5J1PA 2RILA 4QU7A 3BGRA 2F40A 2HSEB 3I4HX 3LANA 3O2IA 2RQCA 2NSBA 4WFZA 1N32F 2FHMA 5BYSA 2L9WA 3G6VA 4DUYF 5J2QB 1DLOA 4M5KA 1HHSA 1LQ9A 2VDIA 2PE8A 3CT9A 3PR4A 2OPSB 4C7QA 4Q8FA 4F36A 2R8GA 2XSJA 5KT4A 3JSRA 4F04B 1TVRA 1VRUB 3PO4A 2IPOB 1UJ6A 2GIQA 4K4WA 4XDDA 1M5KC 1FEHA 1AFJA 2FVRA 1NPPA 1T05A 5DDQC 2A10A 2XMAA 2MY7A 3CD7A 3CJQA 1N36J 4OHZA 4J9QA 4C4WA 1HBUB 3T6BA 4NLOA 2AHOB 1P9QC 2DB1A 1C1CA 2QJ3A 3CJ0A 4ED0A 4EZ6A 4TKTA 5A0YA 3M9MB 2QLBB 3OTDA 2E29A 1TR0A 1FX4A 3VZIA 4AE5A 5C5JA 3MPYA 3JB9k 1VQ7S 3KKFA 1U7LA 4JB8B 4L3NA 2CUYA 4TLQA 4QWAA 3NY0A 2X7IA 1Z2LA 2O67A 3IBWA 2JRSA 3QPIA 2FJWA 1FVSA 1FJGF 2JNJA 2BJ8A 5IM0A 4QYZJ 4RWXA 2V2KA 1NKCA 4WE1A 2GJFA 1HBMB 2EI5A 3UN3A 3QT5A 4YHHF 4EZ9A 3V6JA 3CJSA 2KO1A 2M3DA 3QRPA 4V1Ak 3R6GB 2HMIA 4ZVPB 2R8HA 2IM1A 1RUSA 3OTOF 3QYYA 1REVA 2VBXA 2V5HG 3UVJA 2ILZA 4B3OA 3ET6B 1FKPB 3SEOA 1CC7A 2OH2A 2FUG9 3GR1A 2XMVA 5F3TA 4NEZA 4B3SF 1GX6A 2FPHX 3VGSA 2Y1LB 3V81B 1FK9B 5FDLB 4DQIA 2MGZB 2VASA 1OSDA 2YH1A 4ID5B 1VC6A 1UCNA 1S79A 2AGOA 2AEMA 3OVSA 3CULA 4AL7A 4X64J 5HN0A 4OYAA 3SXLA 2ZZMA 2MJUA 3NP5A 2QL7B 2HVZA 3P45B 5JMNA 2XYGB 5E2QA 4H4MA 3AJ1A 2RH3A 3FDSA 1QVFR 3IBFB 2KFZA 1AXQA 4FYVB 4ELUA 3HHEA 2HFUA 1VDHA 2Q3PA 4N8NA 2B4OA 3GFHA 1UW9A 2FJBB 2V34A 1ZS6A 1FTCA 4O0NA 1RWMB 1YI2S 2POKA 1DZ5A 4FVCA 2GQQA 3CMQA 4P73A 3O5TB 1NSAA 3TEGA 5L8RC 1UEKA 3FZ2A 5K5MA 3DLLQ 1PKUA 2MZRA 1LWCB 1U09A 2R2RA 2CQPA 4QOTA 1JJHA 5K8OA 3T1YJ 6FD1A 4OYMA 5LM7E 2FLPA 4UUXA 3G9CA 2OMOA 1XR7A 4C6AA 3PIPQ 2OSRA 4PWDB 3Q8VA 5M2UA 2ZDOA 1KBRA 3MAQA 4KH0B 2VQEF 4EGLA 4DF4A 3V4MA 2XY6A 4DV1F 3N6LA 2ASJA 3BREA 2ERRA 4Q2MA 1FXRA 2BOPA 3SCKE 2XMKA 5LXYA 2DNHA 1UVKA 3HD1A 3TRGA 1RCOB 2XG8A 2JH3A 2MKKA 2ZBRA 4KBIA 5KFYA 3V4IA 2FLOA 2JEIA 3AWRA 2DXDA 3EDRB 4A48A 3QATA 2HEKA 3LP0B 4HHJA 4OZ3A 4ES1A 3KOAA 3KNGA 2NXEA 4CO1A 1LW0A 3LTOA 1NLKL 3LH2S 1HNWJ 2VG7A 1O0PA 1NO8A 3MPWA 1CJTA 4V19J 2B8QA 3S7RA 3DLKB 4DV3J 3FBFA 3FCHA 4IG3B 5HROB 3HZGA 1CPZA 4ICLB 1VC5A 4KH1B 3D7SB 4MK9A 4I4BA 3RUBL 3P4UB 4TN2A 4IFYA 3FJ2A 1RE1B 3N9UC 3J7AN 4E0DA 3CDBA 2AV5A 2GHWA 2BJ1A 3W2WA 2WBMA 3NS7B 4NZ7A 1U48A 5EWEA 3C6TA 5GMEA 2VPYB 2OSQA 3HKWA 4OZ1A 2CQDA 2EC2A 4P2XA 1VJQA 4OJHA 1BQMA 3BBFA 2JLGA 3TUJC 3MCNA 1AZSA 4U7UK 1S1VB 1N0UA 3FUYA 2ZC4A 3QO9A 2J0XA 2VQFJ 3M1VA 3QWPA 3E01A 2F4VJ 1X5TA 4LRDA 4PEOA 2YWGA 2OPPB 3EUNA 3V6DB 1CS4B 2W9BA 4RU2A 3CMAS 3UE2A 2R7SA 2MQQA 2CPZA 1F5AA 4QBUA 4CLKA 2V68A 1NPKA 2ZM6J 3M8PB 3LGMA 1NKBA 3OL6A 4R8UA 2LU1A 5C2CA 4KKOB 2R7XA 3DGVA 3MURP 4TXSA 4HT5A 1X4GA 5CZVA 1RT4A 4Q2LA 3OUYB 1KOHA 2QE5A 4TVAB 2LEBA 4ZVEA 4QW9A 3CCUS 2ZDPA 2R4FA 4OYZA 4C3KA 3KUHA 4R0JA 4HTIA 2MDAA 4FS2A 4WPAA 3MMCB 3MR3A 2B3TB 4NLDA 2J9CA 1FT8A 4K8RA 2CA9A 1NHKL 4DSEA 4KPCA 3MHYA 1WKLA 1YK9A 4EU0A 2DHGA 2NUUG 1JLEA 3MI7X 4ZPCA 2VIHA 2JFDA 1REGX 3AX5A 3A3OB 4B9SA 2XMJA 2ZHAA 1QJHA 2BRLA 2HW3A 2XTEA 1H74A 1LXJA 5LXRA 3F73A 2E5LJ 1XJWB 2RRAA 2DH7A 1YBAA 4DR3F 2ZWOA 4USUA 3MECA 2WVDA 3MGJA 3TI0A 2N3OA 2HQDA 1LK5A 2VZ9A 4OYWA 4M5IA 3UQSA 2P9CA 4ETXA 2IMOA 5DQHA 4HEA9 4GKKJ 2CQ0A 4F67A 2ASYA 5CAAA 4KPYA 3VWSA 1TL3A 3GV8B 4OZNA 2AIRB 2QLXA 4UOFA 5ETTA 3C19A 3CEDA 2GC8A 3MEDA 1KTVA 1T3OA 3GIJA 2NCKL 5KFWA 2J8AA 2EK6A 3RBDA 3JYTB 3T1HF 4WFXA 4IQXA 1JLFA 2UV8G 3UFCX 1T94A 2FQQB 4URQU 3ILOA 1KC8T 1SB6A 5J2QA 3BQ2A 2YQ0A 1RYSA 4IFVB 2OPSA 2Y9HA 4F3QA 3CD0A 4O3PA 2E7WA 4QZVB 2FVCA 1VRUA 2DVIA 3S01A 1GAOA 2KB2A 2DNMA 5B0AA 2BXJA 1WC5A 1LEOA 2JDJA 4ECQA 1PJ7A 5AXNA 2AGPA 1YX2A 3LALA 1BHNA 2ROPA 2D3OR 1HBUA 3AXMA 2VODA 4ZLNA 1RT3B 3H2UB 5KFAA 3MMAB 1U02A 1WELA 1S1WB 3GIIA 1PGZA 2AGQA 4IDKB 5ETKA 3AA9A 3GV5B 4RNFA 1NDPA 1G6BA 1WG1A 2HVDA 4QR0A 2DGUA 2CPIA 4I6AA 3W62A 2XNRA 4ZVTB 1WUUA 1CVJA 4Z2XA 4LRCA 3KWMA 3IBCB 1FWKA 4F4YA 3CJKB 4YP3A 1DBDA 2B56A 3CVKA 1PC5A 2D3O1 3NGSA 4O4GB 1HBMA 6FDRA 3MF5A 3ZO7A 2YXLA 1Q81T 2BKOA 2MZJA 5D0EA 2XHWA 1TKTA 4NLWA 4DL7A 5DG8A 4WFYA 3EDQB 2LQ8A 1T9YA 2MKHA 3GSDA 4X64F 4U9RA 3TJ9A 4RUCA 5IOLA 3AX3A 5IT4A 2ADBA 4O3SA 1FKPA 1RABB 4K2JA 2DBBA 3FQKA 3DYAB 5BYRA 2QFJA 2KZMA 3V81A 1FK9A 5FDLA 4ZPVR 2MGZA 4QPXA 4C0HA 4P6QA 2AYMA 4UQGA 3WIVA 3VAKA 1FESA 4QCLA 4TY8A 2MQMA 3GU0A 5FLXY 4ZCMA 4KRWA 3G82B 3DKDA 4DLEA 4K4SA 4X4PA 4OX6A 2DGVA 3L4BC 2PFFB 3T9NA 1UJ4A 4K4UA 1A7GE 3K8WA 2DNZA 3EPGA 2GGPB 3VAIA 2RUGA 2GMLA 3CNQP 1RHRB 3FQLA 3ENQA 2GAHC 1M90T 1OIAA 4AYBD 4ZJOA 3C2PA 1RBAA 2M88A 1BUXA 4DSFA 1X9SA 3TAMB 4X4VA 3IAM9 4FZVA 2XO6A 2A6OA 2QX0A 3TANA 5EHHA 5ETRA 4CT8A 3CCTA 4M1KA 1M5PC 1SUQA 3I55S 2FYXA 4CO3A 3BGLA 1M1KT 3UR3C 2J76E 2L3MA 2LXIA 1SVDA 1MN9A 2H48B 2HFOA 3B78A 4RNHA 3R3TA 3RW7A 2R7VA 1IKWB 1KNZA 3GLJA 3G4SS 3I87A 1FFSB 3QJLA 3QBCA 5RUBA 1S1XB 4DV7F 1QTMA 3JSMB 3UD3P 4MIWA 3AD9C 2VPXB 1NB2A 5L9NA 5KFBA 3HMJG 4DG1B 4LRBA 5KT6A 2LDYA 4RW7B 1N54B 1S49A 2RU9A 1R8CA 2N4DA 3MOJB 3D67A 3E2EA 4URSA 3TAPA 1CLFA 3W64A 2LVWA 2EK1A 3PX0A 1Q7YT 3PZPA 4DPOA 2DR7A 5HVHA 1N5YB 2QLWA 1SIZA 1XEZA 3R8YA 1IM4A 2HHPA 2HNYB 4HL9A 4NMLA 5ETNA 4A8WA 1Q82T 4DV3F 3NGTA 3FBEA 5LJ3Y 1XMOJ 1U1LA 2BJDA 2LMIA 4ANCA 2WVCA 3IO1A 1JJ2R 2IVMA 1H6KX 2LFVA 1FTRA 1HWJA 1OY8A 1YKWA 2IDEA 3NEKA 4UZBA 2E1CA 1IWGA 3RB4A 3KDNA 2E66A 4ECXA 4NLSA 4AXJA 5IV4A 3PKYA 2GJ2A 1T9UA 1S6OA 1LFPA 4KO0B 1S6PA 3QLHB 3LUYA 3LGHA 4NA3A 2QZ8A 3NWRA 1FRXA 2DEJA 2XMMA 4CZCA 4ICLA 2W2OP 2E44A 1UEUA 1HYSB 4J9KA 3AY0A 3UN2A 4YR0A 2XTCA 4U6PA 4O4RA 4W90B 2KVIA 4DZ6A 5JVHQ 1TUVA 3WBZA 2VQFF 2NZCA 4CWBA 4X2BA 4O3RA 1IBLF 1YDLA 3OLBA 2AJQA 2CKWA 4PPZA 1RT7B 4DFJA 2IVFB 2PT0A 3NG8A 1ULRA 4YB1P 1KRPA 3MR7A 3GTYX 4ECYA 2QMUB 4RW6B 2R7QA 4CLYA 1S1VA 5SZTA 3TA2A 4NRTA 2R8IA 1IR1A 2YKNB 3VAHA 1WF0A 2OPPA 1UA0A 1Q1KA 3V6DA 1S7IA 1CS4A 2G13A 3MPVA 5K14B 4X4OA 2NUHA 2RRNA 4PUOB 5IT9Y 1NJWA 3CO9A 1PG5B 2VFVA 2F8MA 3M8PA 4JOUA 4F4WA 3G6XA 1W25A 3OHBA 3D68A 4C48A 2VPZB 4QJVA 4BWMA 1VIOA 2H4WB 2GO8A 3DU6A 3CCSS 5A2QU 3U27A 2YX1A 2GIRA 2HFZA 2J7KA 1RT6B 2G0IA 2OTJS 1X9WA 3CPWR 4G1QB 1R0CB 3N01A 2RB7A 4CDIA 2ZH9A 3MMCA 4HYKA 4A8MP 4LFBJ 3M2RB 3QT6A 5IC6B 3GMGA 4NA2A 3BYRA 2HBRB 4DSIA 2DGTA 3AHPA 4ZCIA 4IRKA 1XBWA 1PCAA 1NH8A 5K8PA 3POTB 1TL5A 4F0KA 2MXYA 1F60B 1S9GB 1FERA 2HHHF 4PG4A 2X1FA 5J1NA 3VHQA 2MKCA 2DHHA 1K1QA 3IP0A 3X3UA 1T95A 4RBVA 4IO1A 3MM6B 2FY8A 5GMKa 2P9EA 2HIYA 3UCGA 3VGVA 2GW8A 2UUAF 1RYRA 3G87A 1BQNB 4ETZA 4WCEQ 3NNCA 2L48A 4PYAA 4L74A 1JLGA 4OX8A 2PN6A 1YJWS 3CJ4A 3KLGB 2QYGA 3UW1A 3A3PB 4F02A 1Y3JA 1ZETA 3GJTB 2E1RA 4MMOA 4NYOA 1Y4ZB 4FBTA 2Z2LA 4QWEA 5A8KB 2AEJA 5KFFA 2ZHBA 2P6TA 2CJYB 2YNHA 2MPUA 2B6AB 3HT0A 3W9HA 1TV6B 2Q43A 3SI8A 4OI6A 1IKVB 1CJKB 3SIPB 4W92B 3J81j 4OV6A 5CD4A 4YUDA 1Q16B 5JJBA 3RB3A 3PJXA 4USVA 3D0HE 4P9SA 4ZIWA 2JEJA 3ITHA 2OEKA 1KVIA 3S8SA 2EXUA 4J9UE 4USJC 4OJ1A 1NJIT 4M5NA 1SL0A 4NLRA 4L72B 3MMAA 1HBNA 2VBYA 4LR9A 5LJ5Y 1IKYB 3IS9B 5C24B 3MFIA 4WBFA 1KONA 3Q8YA 2D41A 4UUWA 2AD9A 1S5ZA 1I94J 4IDKA 5IXUA 1WG5A 4I6YA 1BD6A 4Y2CA 2RVJA 2VOOA 2IHR1 3CXCR 3MEEB 3IR6B 4C0BA 2IRYA 1RTIB 3HF5A 4ER8A 4DR2F 1P9YA 3FSYA 3WHIA 2Z2ZA 1VBZA 2H1YA 4KHPJ 3RBXA 2NXCA 3H4DA 2CQHA 3CJRA 2W2MP 3CJKA 4DX6A 4O4GA 4CM0A 1RACB 2B4UA 2FZGB 1BMQB 1B64A 3TA1A 4AT1B 5CHCB 4NEYA 1X4BA 5DGAA 1C1BB 3AOAA 2XC9A 3H2VE 5LSOA 1RBLA 3GFYA 2KRRA 1WF1A 3QGIA 4DUZJ 1ACMB 1AUDA 4M8LA 4CNYA 5KFXA 2MTLA 3P3DA 3DYAA 3KYLA 3ZFVA 3H5UA 5C25B 3BSAA 1XNRJ 3PYDA 3HXMA 3A8EA 1S1UA 4LRAA 3R7NB 3ZTSA 1AT1B 4DN0A 2CPXA 3Q2TC 4BHQA 1UVNA 2N82B 1UP1A 2G9OA 4DR5J 1RXOB 2RT3A 2BV3A 2MLXA 3BO3A 3CCMS 2O5DA 3Q83A 4AL5A 4NX9A 2GGPA 1XK8A 3GYGA 2SXLA 5DS7A 1IQZA 2LXUA 2XM3A 1D8YA 4B3RF 1ZM3A 4L3KA 5CCMA 2AQ4A 3MWBA 1QY7A 4XDCA 4N76A 5B0FA 1VYAA 3UPFA 4PQUB 2UXBF 2BUNA 2W1BA 1DAXA 4KGKA 3Q8PB 3IC1A 2VH7A 4FF3A 1IVZA 4LF8F 3M05A 1QSYA 1GX5A 1VBXA 3IG1A 2Q79A 3SCLE 2WK4A 3Q2SC 3FBCA 3ZC4A 2CWXA 1FRJA 2ZE2B 4JI0F 1M5SA 2VKZG 4ECUA 1HKAA 1RT5B 1X7VA 4ED3A 1BY9A 2NQPA 3BO2A 3Q0AA 2E1AA 1IKWA 3NNHA 3QIDA 1JNZB 2Z8QA 2VA2A 1Q8KA 1HR0J 4Z7YA 1S0VA 3G6ES 2OEMA 1CQMA 1H2TZ 1FHTA 2E5IA 3L7UA 1R6VA 3CC2S 2P8IA 3KLIB 5M2RA 1TKDA 3K5PA 2QG9B 1U0HB 3K59A 3N4WA 2MZSA 4ZN3A 2VG6A 4L73A 2AJ0A 4DG1A 3G6YA 3QRRA 3PTWA 2DK2A 2C3PA 4RW7A 1TK5A 3SZ2A 2AYBA 2AJ2A 2W24A 4A8YA 2GVZA 2XS2A 5GAGU 3V6HA 3PRBA 1U1OA 1UFKA 2JC0A 2E5GA 1TKXA 2XULA 1Z1ZA 2EFQA 1WWHA 5GVQA 2RKIB 5HANA 1RZMA 3MM5B 2VFSA 1CJVB 1ZZNA 2KI2A 2CJXB 3I32A 3PHTA 3GP9A 1XTZA 2DO0A 2HQCA 3SQGB 4ZLJA 3OVBA 1H98A 1UKUA 1D9AA 1MROB 2J7WA 3DLEA 4YEAA 1Q78A 3HVAA 2KVQE 4C8KA 1IBMF 3H25A 3PVXA 4KO0A 5F41A 3QLHA 1EZZB 2DRAA 4I67A 4QQBA 4MJKA 1HYSA 2GVDB 1WEZA 1QM9A 2C3OA 3QAEA 2AWZA 3HPOA 3EYZA 2W8KA 4DFKA 3ISZA 1JLQA 5HMWA 1N48A 1RAOA 3EWGA 4J37A 1KDNA 2OPRA 3W1YC 2RU3A 3BQ1A 1KHVA 4B3MJ 1JLCB 1RT7A 2EPIA 4RUHA 3CB4A 5A8RB 1SPBP 4RO0A 5ETLA 1SJ1A 3DC2A 4W4MA 1SH3A 2IJRA 1NK8A 5ETMA 4RW6A 1V3RA 3NGDA 1DURA 2QMWA 4OYBA 3HFZB 1S1TB 4USTA 1U8SA 2CG8A 3JQMA 3MTJA 3PX6A 5KFLA 2YKNA 3CC4S 2OJ3A 3SCJE 3E51A 3NGUA 4MIBA 4CH7A 1FNOA 3KK2B 5K14A 3CCZA 1LXNA 3D9BA 3MCMA 2IAJA 4HH1A 1IN0A 4PUOA 3HSGA 2YWHA 4LF9J 1ZM9A 5D4LA 4JV5J 5L46A 4DSJA 1B7YB 2MHNA 4Y65A 2DGOA 4I2QB 2HZCA 4LFBF 3AFGA 2HLUA 2W9CB 3H4BA 4LSLB 1R0AB 5IWAJ 4O3QA 2V8DA 1FRKA 2F3JA 1M5OC 1K73T 1NMEB 4NXNJ 4LF2A 1RT6A 1FCAA 5KT7A 2J9EA 1MU2B 3QZ8A 4P10A 4G1QA 4YN3B 2VFRA 3ZZRA 3CDEA 4FNHA 2E9TA 2EFVA 3L7OA 4AUKA 4DWIA 4PWWA 2B7CB 3M2RA 4LF1A 1YJ9S 5KFHA 3KTQA 4ZOSA 2DITA 2D74B 1UW4A 4GC7A 5LMUJ 1WOSA 4ED6A 1H7XA 2HRUA 2E9ZA 5F8HA 5KFGA 2QSFA 1X0PA 1R3NA 3T5HA 3POTA 4NYZA 4NCGB 1RHKB 2NLWA 3CUNA 2QC3A 2FZCB 1HQUB 3DOMA 3NCQA 2KFNA 4Y2KA 4F3MA 3ZTQA 3KG1A 1HI0P 1UPMB 4IUFA 1JKHB 3DDIA 2XY5A 2VONA 4Y28C 4Z7CA 1X9MA 2ZD1B 2HAIA 2Y8WA 4Q45A 2MQPA 5E3PA 4IRDA 2C1EB 4DQQA 3BKFA 2ZOMA 4WF9Q 1LKZA 3IN5A 3PDNA 3D3CJ 1KLNA 3TUIC 3RBZA 4RR5A 1K8AT 2F8EX 2GAGC 1B0TA 2MQOA 2JFKA 4J9SA 2ROEA 3LWLA 1S77D 4J9NA 1S59A 1GEHA 5A8KA 1TFYA 1JNRB 3UNYA 2XTDA 1U8WA 4HT7A 5HMYA 2K7JA 2B6AA 5I3PA 3PRDA 1V3SA 4WK1A 1TV6A 2HHVA 1IKVA 2V63A 2ZH8A 5F9LA 3PYEA 1CJKA 1R8HA 4TYAA 2XSFA 2RS2A 5CCLA 4JI7J 4DR6J 5F8NA 4QWBA 4DEZA 1N56A 1O6XA 4FNIA 3CSKA 1HARA 3OV7A 2AJ1A 3H90A 3ILLA 4PG6A 3K58A 2HWTA 1EARA 4USKA 2CAJA 4JI3F 2VC0A 4I7FB 5CXTA 1ELOA 3T9ZA 1IKYA 2AF6A 4YR3A 5C24A 2XLKA 3ZZ0A 3QSYB 2JL9A 4IR9A 1HQEB 1C0UB 5L1JA 5KG5A 3CW2C 1NJYA 1RJJA 2LECA 4ILLA 1C4CA 1FXLA 2VDHA 3I9ZA 3KLFB 3BSOA 2CJBA 2VPWB 2Q6CA 2Y1JA 2Z2MA 3TJAA 4DUZF 2EFGA 1N32J 2DNQA 3UWTA 3RAQA 1TQLA 2DHXA 2B4VA 4DUTA 3TVYA 2DHSA 4RW8A 2FD2A 1NH7A 2I0XA 3KHLA 3Q24A 4FYDA 3EM1A 3NGKA 2MLYA 1XNRF 4UQTA 4X66F 1S0MA 2J7UA 3CJ2A 3PJ9A 4MYTA 3VGTA 4USWA 2UV8A 1JK9B 2UUBF 1HWUA 3RAXA 2BJ3A 4B08A 1VBKA 1EAYC 3DRYA 2KM8B 3GIRA 4K7QA 1OSCA 4OX7A 2FJVA 4DR5F 3BF4A 3ENWA 1H2UX 1TL1A 2PO4A 3WC2A 2HWHA 4LFAF 2KN4A 1HWIA 3ZNUA 5C25A 2RUSA 1FFGB 2PMHA 1TP7A 3MPDA 1K47A 4TU9A 2NPIA 4KV8B 4OI4A 3KJVB 4L75A 2AMCB 3TUPA 5D4NA 2B9EA 2H5JB 4BBYA 4ZMMA 3ZNJ1 4KAIA 4ZVQB 4IO9Q 3OJUA 1RHMB 7AT1B 3MCOA 1UVLA 3KJQB 3BGFA 4H54A 3AD8C 1ZH5A 4ECTA 2WCXA 5GMDA 3AXKA 1RLCL 4OYXA 1FJGJ 4FPIA 3UDLA 2VJVA 3AX2A 4RUBA 2V67A 2IA0A 3NMAA 2EFPA 3TAQA 2VOPA 4ES3A 1FNMA 4RW4B 5BXIA 1FVQA 2F65A 3CCJS 3DLJA 1IWAA 3IM9A 2DNPA 4RBTA 2UXDF 3OTOJ 2FJEB 3G71S 2MLZA 2YPZA 4PG8A 2IY5B 3MAAB 3HKZD 4PQUA 1Y11A 1QUPA 4MKYA 1WC3A 1HD1A 4QIWD 1RSCA 1HR0F 4B3SJ 4NI2A 2LCWA 3OFGA 2CJQA 4F50A 2O01C 1R7IA 3DRRB 2K2PA 3BBCA 1SL1A 1VISA 3DRPB 1YGYA 4PXDA 1FF2A 1E6VB 4QR1A 4A8OA 1VQLS 4X4UA 1RT5A 2YWEA 4OZ0A 2WW4A 2X3GA 5DRKA 4JI4F 2G0CA 4PR6A 4ECSA 4LRFA 3UR0A 1ZZFA 1K9MT 2P5VA 1T9XA 1Y5NB 3VVTA 2QA4G 4WTOB 1XC9A 3KLIA 2OUGA 1U0HA 1XMQF 5KT5A 1FFWB 3MD1A 1U2RA 3P8BB 3Q8RB 3OHAA 2N7YA 3TYTA 4F2RA 2F63A 4QIFA 1U1MA 2XLIA 1B3TA 2OLWA 4ZVOB 3OW2R 4IOBA 3C14A 4ZP8A 1MLAA 1RAJA 1S4EA 2RKIA 2PDAA 2A0FB 5HQ8A 4YY3F 3MM5A 3U1LA 3MTKA 3QIPB 1I6JA
chains in the Genus database with same CATH topology
1YWXA 2DNGA 3KHRA 3GIIA 1PGZA 1FRHA 3RAMA 3SYZA 2AGQA 1VQNS 4LQ3A 4IDKB 4OLPA 3SQGA 5KFJA 1SJ3P 3AA9A 4ZLPA 2RS8A 5BYQA 4USHA 3GV5B 1N88A 1DTTB 3GYNA 3OPKA 1TKZB 2LU2A 4N56A 1NK5A 3QMQA 1RGVA 4RNFA 1G6BA 1KLMB 3BJYA 2I5JA 1WG1A 2L41A 3OTEA 1MROA 2VA3A 4QR0A 5GAHU 3MR6A 3KK1A 1LW2B 4DX8H 1S0OA 2DGUA 2CPIA 3MM7A 3ZZUA 4I6AA 1QSSA 1SI9A 4CO0A 1D0EA 3DCAA 4C8LA 2XNRA 2OMLA 5IQQA 4X4TA 2CVIA 5CQGA 1YRTA 2B43A 3M6VA 5DJBA 3DRRA 1KFDA 2YY3A 3PW4A 1CVJA 3SFGA 1W2IA 4Z2XA 3BO4A 4EEYA 3KWMA 2KT2A 4F4YA 3NAIA 1VI7A 2DJWA 2IJFA 1DBDA 1L3KA 2B56A 1JIHA 1PC5A 1YJUA 3CVKA 4KHRA 2XMTA 2LDIA 4O4GB 1HBMA 3HHLC 1E6VA 5KFVA 3JYTA 1FDDA 1RT2B 2HHWA 6FDRA 5THWA 2EW9A 3MF5A 4D3HA 1Q81T 3IRXB 2MZJA 2XHWA 4DL3A 4PXBA 1N4LA 1L3VA 1TKTA 4NLWA 5T7LA 4DL7A 3C3LA 3OL7A 2E9RX 5DG8A 4WFYA 3MR2A 3HO1A 2MZTA 2R2UA 3PEHA 2C42A 1ZBTA 4DQPA 2NXUA 4WXOA 2MKHA 2XNQA 3PM9A 3Q23A 4OI1A 3GSDA 1MWYA 1HHTP 4X64F 4IQMA 4JI8F 5HO4A 4O44B 4U9RA 4X4SA 2LEPA 4RUAA 2WHOA 3D2WA 4QU6A 1SUQB 4X65F 4RUCA 1S97A 2IM2A 3RW6A 4FBTA 5FJ4A 5IT4A 2ADBA 4O3SA 4IFVA 3I6PA 1FKPA 4F8RA 5F8GA 4TLRA 3I0SA 4P7TA 1IQTA 1UWBA 4H4KA 5AE1A 4DHVA 4V19X 4P2SA 2RDIA 5K8MA 2WAQD 2DBBA 1RT1B 3FQKA 1M5VC 4HLBA 4C2MA 3J81Y 1JLCA 3DYAB 3PEJA 5BYRA 5A6WA 5A8RA 3KLHB 2FHJA 4R0EA 2GV1A 2QFJA 3OR1B 3D1HA 1YG0A 3M6UA 2KZMA 4K4YA 1DHMA 2EFOA 3V81A 1FK9A 3MMBB 3CMES 5FDLA 4JV0A 4ZPVR 2MGZA 3KFWX 2BQUA 5SUHA 4QPXA 2DGXA 4WXWA 4C0HA 1VLYA 2DH9A 4P6QA 3BR9A 2AYMA 4OQJA 5CYMB 4PQAA 3VAJA 4UQGA 3VAKA 1FESA 3W2VA 2O3DA 5I42B 3OJSA 4QCLA 4TY8A 2ASDA 5HBMA 4DL4A 2KT3A 2MQMA 3HZEA 3FFIA 4EO6A 2ZUGA 5FLXY 2KZZA 1FDNA 2KM8C 3H40A 2V8GA 1KFSA 5BR8F 1AFIA 4WZMA 1NRKA 1FKOB 2C3MA 4KRWA 4ZCMA 1N8RT 1FRMA 4A8XA 1RT3A 2RNEA 2C3UA 4K4SA 1XERA 4X4PA 3JTNA 4OX6A 4RWWA 4DLEA 2HIQA 2DGVA 3D54A 1S1WA 4DSKA 2CQ3A 2VUGA 2PFFB 3R5AA 3N28A 3M9OB 3BM7A 3T9NA 1UJ4A 4K4UA 4YQWA 3QIPA 1A7GE 3KK2A 2JJ4D 3IRWP 2YKAA 1P1TA 3K8WA 5KFQA