3OLBA

Poliovirus polymerase elongation complex with 2',3'-dideoxy-ctp
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords Polymerase
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 138
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3olbA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3olbA02
2RF2B 4RUCA 1Z4UA 4RNNA 3DM2A 5DLGA 4EYHB 4RW8A 3M9OB 1I6JA 5KG3A 3DRPB 3I5AA 2JEFA 3DI6A 1SH2A 1S6PB 3KLFB 1QE1B 2I5JA 1DTQA 2BRLA 2AQ4A 2XI3A 1IKVA 2IC3B 3KK1A 4PWDA 2BQ3A 3NBPB 4ECQA 2RF2A 4J9SA 2IA6A 1LWFB 1MMLA 5KFAA 2IBKA 1EP4B 1LWCA 4NLVA 1FK9B 5C5JA 3DRPA 2WONB 4H4OB 5KFHA 4QWEA 1RTJB 3KLFA 4F4ZA 2OPPB 1DLOB 5EWFA 3QLHA 2IC3A 5KT7A 4Q44A 2W8LA 1JKHB 5J2PB 5JXSA 4K4UA 3FRZA 2WRMA 1JXLA 3SI8A 2C22A 2WONA 2WHOA 3V6DB 1BQMA 1N48A 5KFVA 2DPJA 3BGRA 2J6SA 2OPPA 3KK2A 2UVWA 5KFCA 2FLNA 3DYAB 3M9NB 1JKHA 3G86A 3H5SA 3FQKA 3QGHA 1TQLA 4K4ZA 2W8KA 2AGPA 1JLBB 4B3OB 4H4MB 2QV6A 2XI2A 2YNIB 1S9FA 4RNHA 3V6DA 2IAJB 5J2QB 1BQNA 3I0SB 2ASJA 5KFDA 4F4XA 4J9QA 4WXWA 2OPRB 2ZE2A 1EETA 3D5MA 5KFNA 1HQUB 4I2QB 5I42B 2J6TA 3DLKB 3CJ5A 1XR6A 2VG5A 5DQGA 1C1BB 1YVFA 5C25B 4EBDA 3Q8SB 5J1EB 2YNIA 4F4YA 2O5DA 1JLQB 3E01B 4O44A 4K4XA 2WB4A 3LP2B 4QPXA 4KO0B 2OPRA 2R2SA 1HQUA 4QW8A 3DLKA 3BR9A 3PR5B 4FS1A 3N6LA 3CVKA 3ITHB 3DLEA 3MEGA 4NCGB 3MTKA 4DL4A 3C6UA 1JIHA 4ED7A 3E01A 5L1KA 1HPZA 1HNVB 1MU2A 3GYNA 3IS9A 4MKAA 2W7OA 2WOMA 4RW9B 5DGAA 4IRDA 4DL6A 5FDLB 3NKYA 4O3OA 4ZHRA 2B5JB 4NLXA 5KFRA 3KHGA 3IRXB 1S1TB 1S6QB 4Y2CA 4ECRA 3ITHA 1TL3B 1NHUA 5L9XA 1J5OB 2UVUA 3GV7B 4NLWA 4NYZA 4ZPBA 1VRUA 2HNDB 3MEEA 4RU9A 2HMIB 4J9PA 1TKTB 4MIBA 1DTTB 1XR7A 1JLFA 2B5JA 2GC8A 3MECB 4RNFA 3GIJA 3RBDA 2R8GA 4TQSA 4Q8FA 3SFGA 5KFKA 3GQCA 5KG7A 1J5OA 5HROA 4RW7B 2GIRA 4WE1B 2XWYA 3Q8QB 3LP0B 4NLSA 4EO6A 4KB7A 2RDJA 3QZ7A 5KFXA 4G1QB 4YMEA 1TKTA 5L1IA 5I3UA 2IM3A 2JEIA 4O4GA 1HNIA 2B43A 2D41A 5HP1B 2BANA 1HMVB 1T05B 4RW7A 3LANA 4URGA 4ED1A 3RAQA 1LW0B 4JV1A 3PW4A 4MK8A 1KLMA 2XGQA 4O3QA 2CJQA 4WFYA 2R8KA 4O3RA 3KHHA 2B6AB 3M8PB 4JUZA 3PW5A 4G3IA 3H5XA 3LAMA 4ID5B 3OL7A 3CWJA 4Y3CA 3H98A 2W9BB 4JV2A 1IKYB 4K4TA 1LWEB 4MFBB 5CYQA 5F9NA 4J9MA 4HKQA 5KFTA 1C2PA 3RB4A 2JEGA 3LP1A 4O3SA 4U6PA 4ID5A 2FJXA 2R8IA 3CO9A 1NHVA 3GIIA 4LSLA 1T03B 4ZVGA 1IM4A 1RTHB 4WFXA 1RT7B 5C24B 3RB0A 3FDSA 3DM2B 3RB6A 4RW8B 5C42A 3DI6B 1GX6A 2I5JB 1DTQB 1R0AA 3KOAA 1IKVB 3CIZA 3KK1B 4Y2AA 4R8UA 3DRSA 3BSOA 2YKNA 4KFBA 4RZRA 1N4LA 3NAIA 3TQ1A 5KFMA 1S10A 2V0NA 3DOKA 3GIMA 3DOLA 1LWCB 2JLEA 3KLVA 2D3UA 4NLRA 2ATLA 1S4FA 1S49A 4TLRA 4DL3A 5F8HA 5KFLA 3HVAA 4NLPA 3IG1A 2CKWA 3QLHB 2R2TA 1C0TB 3OLAA 5DQHA 3JSMA 5F8MA 1FKOA 2YNFA 1VRTA 5KFWA 3DLGA 4ZP8A 3I5BA 5L1LA 1BQMB 3EZUA 2RKIA 4IH6A 5KT5A 4QWDA 2ZD1A 3BGRB 3C6TA 5JUMA 5KFJA 1RT6A 3KK2B 4GC6A 3I0RB 2BQUA 3BJYA 1HYSA 4ZVFA 1TKXA 1C0TA 5EWEA 5L1JA 4OL8A 3TAMB 4RNOA 1N5YA 4EBEA 4ED2A 4ZP7A 1K1QA 1BQNB 3DMJA 3I0RA 5DG8A 2ZE2B 1EETB 3OHAA 4PUOA 1JLEA 2IMWP 2VG5B 4J9NA 1W25A 4ZVEA 3TAMA 3T5JA 1S97A 4Q43A 3QIPA 5KFOA 5DGBA 5KFGA 3LAKA 3KLHB 4YR2A 4O44B 3H40A 1JLAA 4U7CA 2W9AA 5KFSA 4J9LA 3NAHA 3OL8A 3V4IA 4ICLA 3D28A 4EO8A 2WCXA 4EYIB 5KFQA 3PJWA 1S1VA 3MEGB 3DLEB 4R0EA 4QWCA 3C6UB 4WXOA 2FJWA 3KLHA 1HPZB 5F9LA 3FSIA 2DPIA 1MU2B 3IS9B 3CDEA 2WOMB 3MR5A 5J2MA 2JEJA 3HVTA 3PW7A 4ZPCA 5KG1A 1RA7A 1SH3A 3QGIA 4ZHRB 4ECWA 5KFUA 1IKWA 2XCPA 3MR6A 3VQSA 3V6HA 2D7SA 1S1XA 2W9CB 4WZQA 4Q0BA 2VG6A 5KFZA 4DL7A 3KMQA 2HWIA 1VRUB 3MEEB 3MR3A 1D0EA 1WNEA 4KV8A 3QZ8A 1RTIB 1JLFB 2OPQA 3T5LA 5HLFA 3H59A 4RW6A 4ED3A 2ASDA 4KAIA 4QWAA 4K4YA 3UR0A 2YKMA 2R2RA 5HROB 2W9CA 1RT3B 4IG3B 3ICLA 5DLFA 3QIDA 2AWZA 2YNGA 1RAJA 4NLUA 5I3UB 3OHBA 3V6JA 2OPSA 3NMAA 2HNYB 1RTIA 2VG7A 4O4GB 5D3GA 1HNIB 4DL2A 2BANB 1S0MA 5F8LA 5KFEA 4LQ9A 1RT3A 1QUVA 3GV5B 1C1CB 2GIQA 1HARA 2JC1A 1KLMB 3T19A 3NGDA 2R8HA 2HNYA 3BQ0A 2FVRA 4IDKB 4I7FA 1TL1A 1RYRA 1N56A 1TKZB 3KLEA 2IM2A 4KHMA 1C1CA 1S1UA 3MEDA 5KFYA 3KJVA 5CYQB 4R5PA 3PW0A 2FJVA 3H2LA 3TVKA 5KFFA 4YR3A 3RBEA 3LP1B 4IDKA 4I2PA 3N6NA 4DL5A 1ZETA 3I5CA 1TKZA 3V81A 2HAIA 1C0UA 3JYTB 3LALA 4LSLB 5K14A 2ZKUA 5KG0A 3UQSA 4KSEB 1N6QA 5F8NA 1S9EA 5EWGA 4YP3A 1TV6A 5C42B 3KMSA 3NL0A 1LW2A 1RT1A 3H5UA 4QWBA 4FBTA 3M8QA 4TQRA 1IKXA 1QAJA 3JYTA 1ZTWA 1QAIA 1R0AB 4R8UB 2IM1A 3DRSB 2YKNB 4KFBB 3MFIA 5KT4A 2UUWA 2AU0A 4TN2A 3DOKB 4KBIA 2E9RX 3DOLB 3H4BA 3GIKA 5DG9A 3PHEA 2ALZA 5F8IA 4LQ3A 4NLTA 3IG1B 3MF5A 4LSNA 2AGQA 1SH0A 4FBUA 1SV5B 5KT2A 3SFUA 2BE2A 4F50A 4FS2A 3JSMB 3ISNC 1FKPA 2VA2A 2WK4A 4TY8A 1FKOB 2YNFB 1VRTB 4ECSA 1TVRA 3CJ3A 3DLGB 4IH7A 2HWHA 4NLYA 4IFVB 4ED8A 2RKIB 1OS5A 2ASLA 2ZD1B 4IQXA 3C6TB 4IG0A 1RT6B 4RNMA 4NRUA 1REVA 2BR0A 3N6MA 1HYSB 4XPCA 1TKXB 1KHVA 1JLCA 1SV5A 1JLGA 4Q8EA 2YNHA 3KLIA 3PJXA 3KNAA 1N5YB 4IFVA 3GV8B 3EPIA 3DDKA 4WZMA 4MKBA 3KHLA 3QGGA 3DMJB 3H5YA 5F8JA 4O3NA 5CYMA 1HQEA 4PQUA 4PUOB 1JLEB 4URSA 2V4QA 4RW4B 1S1WA 3CJ0A 3G6XA 3QIPB 4IRKA 4F4WA 4ECZA 1RT2A 2C2DA 1JLAB 1RT4A 3UPFA 5J2NA 4TY9A 4WFZA 3OL6A 3Q8RB 4JV0A 3V4IB 5DG7A 4ICLB 4IG3A 2J6UA 5KFPA 4KE5A 2AX0A 4ZPDA 2V9WA 4ZVHA 1S1VB 2I1RA 4IRCA 4RW4A 1CSJA 3MFHA 3DRRB 5KFIA 3T1AA 1S9GB 1S6PA 4HYKA 1QE1A 2FVQA 4J9RA 3PZPA 5J2MB 3IGVA 3KHRA 4Y34A 3HVTB 3NBPA 2FLPA 4URQU 4ZPAA 1IKWB 4XPEA 1LWFA 1EP4A 3DRRA 4XO0A 1FK9A 1NNDA 3QYYA 1S1XB 2F8EX 4H4OA 5EDWA 1RTJA 1S9GA 4Q0BB 2VG6B 4M94A 3E51A 1DLOA 4TYAA 4IFYB 5KG4A 4MIAA 3IN5A 4K4VA 4KV8B 5J2PA 2OPQB 5HLFB 4RW6B 4WYWA 3IGNA 4IH5A 2YKMB 4KHRA 5DQIA 2D3ZA 4ECTA 4X2BA 1RTDB 2R8JA 2YNGB 1U09A 4IFYA 3DYAA 2OPSB 3V6KA 2VG7B 4ED0A 4ECXA 4QW9A 5D3GB 2C2EA 4IR9A 4RUAA 4B3OA 1JLBA 4H4MA 3BQ1A 3M9MB 4J9KA 3G6VA 2IAJA 3ISND 4J9OA 5KT6A 4O3PA 5J2QA 3I0SA 1RTDA 2VA3A 5KG5A 3OL9A 5I42A 2R2UA 4I2QA 2IM0A 2IJFA 3FFIB 2C28A 3BSAA 1C1BA 1S0NA 5C25A 5KG6A 3UDLA 4YR0A 5J1EA 3H4DA 4I7FB 4H54A 1TL1B 4NLGA 4NZ0A 3KLEB 1JLQA 4ZP6A 1S1UB 3LP2A 3MEDB 4KO0A 1RT5B 3KJVB 3KK3B 4R5PB 1XR5A 4MK9A 3EPGA 3FFIA 1S0OA 1SUQB 3RAXA 4GC7A 4NCGA 4I2PB 5EUHA 3OSPA 3V81B 4K50A 1GX5A 1C0UB 1HNVA 4EBCA 5K14B 1RT5A 4K4SA 4NLDA 4RW9A 3KK3A 3T5KA 2W7PA 3HHKA 3PW2A 4KKOB 5FDLA 3MR2A 2FVSA 1RA6A 1N6QB 1S9EB 1SUQA 1S1TA 1S6QA 3IRXA 1TV6B 2BQRA 2OH2A 1TL3A 1LW2B 1RT1B 4ECUA 3BREA 3FQLA 2ILZA 3M8QB 1IKXB 3QO9B 4DG1B 4TYBA 3CDUA 2EC0A 2HNDA 5KT3A 2HMIA 3CJ2A 2QE5A 4KKOA 5F8GA 1DTTA 4DEZA 2XCAA 3MECA 1RYSA 4IR1A 4O4RA 2V4RA 3OLBA 1ZTTA 2AGOA 3CJ4A 2XGPA 4EEYA 5KG2A 4WE1A 2UUTA 3HKWA 3LP0A 4ZMMA 1UWBB 2FVCA 3QO9A 4DG1A 2C2RA 2XC9A 3KLGB 4LSNB 1KHWA 3PVXA 4G1QA 4WYLA 2BE2B 1RDRA 4ECYA 4ECVA 1FKPB 5HP1A 4TY8B 4MH8A 2BRKA 1HMVA 1T05A 2E9ZA 1TVRB 4YQWA 2WTFA 1LW0A 4MK7A 2HNZB 1UWBA 4IG0B 2FVPA 3PR4A 3KLGA 1REVB 2AX1A 2B6AA 1K1SA 3CDWA 4K4WA 2IJNA 3M8PA 1JLCB 3BSNA 5KFBA 4ED6A 3GILA 1JLGB 2YNHB 3KLIB 2FLLA 2ILYA 1T94A 2HNZA 5HBMB 3OSNA 2W9BA 3BQ2A 1IKYA 1LWEA 3T5HA 4MFBA 2RDIA 2JC0A 4ZP9A 4TXSA 5CYMB 1HQEB 1D1UA 3Q8PB 4PQUB 3BSCA 1JX4A 3RB3A 2UVVA 3HVWA 1S1WB 2E9TA 4M95A 4Q45A 4IOBA 5HBMA 1T3NA 1RT2B 4NRTA 5T14A 3G6YA 1RT4B 4NLOA 1TP7A 5J2NB 1T03A 2UVRA 4PWDB 4NLQA 4IKAA 1RTHA 1S48A 5C24A 1RT7A
chains in the Genus database with same CATH superfamily
4CO5A 2UUCF 4WP3A 4RW8A 3JAMU 1RGVA 3OTDA 4NLVA 3B6BA 4F4ZA 5HAOA 2KXNB 2C22A 3MXHP 2KL8A 5KFVA 3ZZUA 2D68A 3BGRA 5IQQA 1N52B 3H5SA 1QUPA 4B3OB 4QIVA 2MY7A 2YKAA 2Y3YA 2BBEA 4ZDNA 1CJVB 3L7PA 1T9TA 2NXJA 4Y00A 2PA8D 4FS1A 2YWGA 3N4WA 4NCGB 1VBKA 3CB4A 5LMUF 3D68A 1R8CA 3DN9A 2WOMA 4DPYA 4DL6A 4O3OA 3ITHA 3T1HF 4HL9A 2C42A 2KM8C 2GC8A 1UFKA 2HAFA 2Q6BA 3F41A 2VB6A 5KFXA 2K1RA 4AXIA 1HBMA 3IFEA 1PBAA 3QT7A 3ZTPA 4MK8A 3D6HB 4NASA 2V2QA 2K7KA 2OIHA 3NS5A 3DXSX 4Y3CA 1OSCA 4JV2A 1LWEB 5ETLA 2HVDA 3GJSB 2HKEA 3L4BC 2R8IA 3NCPA 2BJEA 4KRWA 3IRWP 4OYMA 5DM7Q 5HQMA 2D3UA 1DBDA 3ET6B 3HDSA 1V6HA 1VIOA 3OTOJ 2PMWA 1X4EA 3MCNA 3KK2B 1NCLA 4C98A 4CT8A 2PIIA 1SC6A 4WK3A 5SZTA 4MMOA 3SCKE 5B09A 3LAKA 2CIMA 1UW9A 5ETSA 1F2HA 1HPZB 4DXLA 3TARA 2M9KA 4MJKA 2XWXA 3MR6A 3V6HA 2R3VA 3K5LA 4BWJA 2WVCA 2IPOB 2OPQA 3H59A 3CUNA 4XDCA 1KRPA 2Z2ZA 3QIDA 3QBCA 5I3UB 1XMBA 1RTIA 4RBUA 2CVEA 3NGDA 1TL4A 2RMLA 1VDHA 2ZZTA 4ZVTB 3AT1B 3AD8C 2YY3A 3CD5A 3W62A 1FWKA 1CBKA 3W2VA 5EWGA 3POTB 4NEZA 2F4VJ 4OV1A 8ATCB 3M8QA 1ICEB 2DRDA 4C48A 3AODA 5T7LA 2CJAA 5IFMA 5ITHA 3M32B 2V5HG 3JSMB 4TY8A 5JVGQ 1FKOB 3QAEA 1DURA 1OS5A 2L08A 3M8RA 3PY8A 1HQ2A 2AJ1A 2CQPA 4IFVA 1TFWA 4PUOB 3CD7A 5IT9U 2BEFA 1S1WA 2HGNA 1RT4A 4FYVB 3OL6A 2BOPA 2V9WA 1N5TA 2YX4A 3RBXA 2FVQA 1LWFA 1EP4A 3TOQA 2LEPA 4EMDA 3EYZA 4OX7A 2X1BA 3GJRB 4DLGA 1BD6A 1AA1B 3M9MB 4UOHA 2F8HA 3UD3P 5KG5A 2VA3A 4BWMA 4DR3F 4D3HA 1OJ4A 2IM0A 2IJFA 2X3DA 4AL6A 1TU0B 5C25A 5LSRA 2DXDA 4DOZA 3C2PA 4CLFA 3RBZA 5GAEU 4OYAA 3J80Y 5D0RA 1GXTA 1NLKL 3MM6B 4LF1A 3JTNA 1C0UB 3KK3A 1JNRB 2KTQA 1S1TA 2ILZA 2BYCA 4DG1B 2GQ2A 2HLUA 2GHVC 4A4JA 4WE1A 1UWBB 1K8AT 2FY8A 1FDNA 1RADB 3LQVA 3K8VA 2HNZB 3KLGA 3OR1A 4LF7F 3HJFA 4B9VA 3MPWA 4Y65A 2R7XA 2OMLA 4CLPA 1QTNB 2D74B 3RW6A 3ZXWA 5HBMA 1T3NA 4E8UA 4PKDB 1U6FA 2B7CB 4IKAA 2V50A 5H1SV 1JK9B 2LQBA 4A8WA 2BQ3A 2UXBF 1KVIA 1AFIA 4UOCA 3HD1A 3DRPA 2VQFJ 5EWFA 5I3PA 2DY9A 1UUJA 1J27A 2V68A 1Q5VA 4J5OA 5ADZA 2IVFB 4CM0A 4I69A 2ZVSA 1U8SA 2VBXA 5AE1A 2OPRB 5D0EA 4ANEA 3SSRA 2W25A 3Q8SB 2YNIA 4JV5F 4B9SA 4WKRA 5EHHA 1FJGJ 3RUBL 2HQFA 2QMWA 1U24A 4QYZK 4ZHRA 4FYDA 1S6QB 2CVIA 2NYIA 1DTTB 2B5JA 4ZVQB 3M05A 3SFGA 5KG7A 2GIRA 4EO6A 5D78A 3CC2S 2PI5A 1UVNA 2V1TA 4QYRA 1GMVA 1O0PA 3CCZA 4DV4J 1OQ3A 1PGZA 3OL7A 2RHSB 1M5SA 2MLXA 2AV5A 5HI7A 4JI7J 1SQEA 3M1VA 2BUNA 4RU2A 2VU5A 3P45B 1VJWA 2C2KB 1Q82T 3PRVA 5C42A 1VBXA 3R5AA 3JQJA 2I5JB 1DTQB 4FKXA 1FX4A 3CIZA 2Q66A 4LVOP 4DBQA 4A8OA 2ZH1A 3FBEA 4NLRA 2ZBPA 5A0YB 5L46A 1VRTA 4CNYA 3I5BA 5JUMA 1Y5LB 3TAQA 1RT6A 3A3OB 2BQUA 2UV8G 3TWZA 1U1NA 3R5GA 3HO1A 3A8JA 2DRAA 1RKJA 1OO0B 3GSIA 5A8RA 2VG5B 4J9NA 3MEKA 2B4VA 2JRSA 4J9LA 2W4CA 1A0OB 4FNHA 2J5AA 5KFQA 4CP5A 4R0EA 4WXOA 3KLHA 3I55S 2M3DA 3MUVP 2A2DA 1UFWA 3HVTA 3PFOA 1QDUB 3FCWA 2A1BA 3TZZA 4QU7A 2JLFA 3QZ8A 2VPYB 2EVZA 2JLGA 5HLFA 1U2CA 3MTJA 4UOGA 3AJDA 3N5BA 1RHRB 5GMEA 2UXCF 2DCUB 2FVRA 1FRMA 1N56A 3R3TA 4RUBA 2G0JA 2MB0B 3IAS9 1YLXA 1MMDA 2P9GA 5K14A 1WF1A 4ZVUB 4B3RF 2BM0A 2DNYA 1M5KC 2FGOA 1DY3A 3KMSA 1HBNA 3JYTA 1QAIA 3MPYA 1IQTA 1FTCA 1SJFA 3SEOA 2PD1A 2XYPB 1HWUA 1NSPA 2FJDB 2IFXA 2QX0A 3MF5A 3PKYA 4C8LA 1SH0A 3HVRA 2CZ9A 3M8ZA 1FO1A 2ZH9A 4IG0A 1N34J 1REVA 3N6MA 1MNEA 1XMOF 3ENVA 1N5YB 3EPIA 4WZMA 3S7RA 1TFYA 3L7OA 5ETRA 1R6YA 4FP9A 4IRKA 4ECZA 4WKYA 3DGPA 3Q8RB 4IG3A 5KFPA 2W2QP 2CPHA 1RAEB 3J81j 3GE9A 3OTBA 1UETA 3BB5A 1WOOA 2RRBA 2BV3A 2IHR1 2NZCA 4Q0BB 3EM1A 2C1EB 5HQ8A 4AQYJ 4ANCA 1HWJA 1D9DA 2OI2A 4YB6A 4OIXA 2V8HA 4N41A 2O66A 4RL1A 3K89A 3V6KA 4B3OA 4ZJLA 1T7PA 1JXEA 2VPWB 4QIWD 2E1RA 3JXOA 5LJ3Y 3IR5B 3QAUA 3JS9A 4F0HA 4Q2MA 4X4TA 2QL7B 1M5VC 1FRXA 4KGVB 4DFJA 3HF5A 4DPWA 3IC1A 4NCGA 5EUHA 4EBCA 3KG1A 3DLHA 4KKOB 2V2KA 1TV6B 1RT1B 3JTOA 4LF5J 1U8WA 2GW8A 3SBMA 4TU7A 4DS5A 2OMOA 4B17A 1OIAA 8RUCA 3TNVA 1PYTA 5GMKa 1KP6A 4ZLNA 1FNMA 2KT5A 1K1SA 2DNZA 4DV5J 2MQ8A 1LWEA 4DUZF 2RQ4A 3GJQB 3BSCA 2G9OA 1M90T 1ZA2B 4YUDA 3BDPA 5CYJA 4YOEA 4X4NA 3ZZOA 5M2PA 5KFAA 2J8AA 1NDLA 2HW3A 3ET6A 2CQ3A 4PCQA 3CCQS 2AHOB 4ZVSB 3UN2A 2X3GA 2WHOA 3D2WA 2DPJA 3KK2A 3I0SB 4QZVB 1SJQA 2CFXA 4K4XA 2WB4A 5L8RC 4JI8J 1CC8A 3DLKA 4C6AA 3MTKA 1ZPVA 1HPZA 3VAMA 4Y0FA 4MKAA 3MUTP 4RW9B 1MROB 4ECRA 4QIGA 2XMVA 2MZ1A 2MMYA 1U48A 4RU9A 2DJWA 1B4SA 4JI3F 3UDEA 2C3MA 5CXTA 5I3UA 2XLJA 5D0HA 1RE1B 3RYLA 1S6UA 1Q5YA 2LCWA 1VQ4S 2MQPA 1ZPWX 3AQPA 3M2RB 3CWJA 3UDCA 1IBMF 4K59A 5HMXA 3W2WB 4I68A 1A9NB 4B9LA 2B7BB 1YIJS 4X65J 4OX9F 3POTA 5CZXA 2LQ9A 1IQZA 1SXLA 1KDNA 1VJQA 1VQ6S 1X4AA 2ZM6J 3NAIA 1FRLA 3GIMA 1LWCB 1CQNA 2ZUAA 3RAMA 1CVJA 3CCLS 3M32A 2HQIA 2BM1A 5A8KA 3JSMA 1FKOA 1L3VA 2RUGA 1L3TA 2BJ9A 2ZFHA 5L1JA 2HIQA 5DJBA 2XS5A 3HX9A 1NUEA 3NWGA 1NU4A 4RNOA 4EBEA 5DDRC 1YJNS 4PUOA 1MWQA 2IMWP 3VGTA 1UVMA 1VC6A 3RRKA 1BHNA 4ZLLA 3O6QA 4TKTA 3MM5B 5F9LA 2Y0BB 3IA0A 2F9DA 2C2OB 2D7SA 2NXNA 2VUGA 1RSCA 4QCLA 3UR0A 1HBUA 1Z2LA 5DLFA 3IBFB 2XYHB 1F1BB 1PBUA 4O4GB 3GR1A 4CLLA 2MQLA 2B3TB 1D09B 1TKZB 2CQGA 4EK2A 3KXDA 2FJVA 1SKWA 2ACMA 3MM6A 1OY6A 2BJ7A 2HFNA 4A8YA 3E3XA 3SIPB 1C0UA 2DNRA 5A6WA 1WSRA 2HHTA 3DOKB 3PIPQ 3CIMA 1WKKA 2J0XA 2HHHF 2ALZA 1S12A 3LUYA 1NJXA 2B9YA 1SV5B 3GCWP 5B0DA 7FDRA 4W4MA 3RB4A 3BEGB 2E5HA 1RHJB 2OUGA 4GKKF 1WC0A 1WC6A 1TKXB 1P8GA 4Q8EA 3GV8B 3MUMP 4GMKA 2XLIA 1S77D 3UD5A 3QMQA 2AYMA 3CJTA 3K57A 4ZVHA 4UF4A 1N32J 3QJPA 2V8VA 1T3OA 1KSPA 3LWLA 4B3MF 4XO0A 2F8EX 2H9ZA 3SCIE 2WZ1A 2ZH5A 3KTQA 4L6V3 2GQQA 4ENOA 4DR5F 1U09A 3MMJA 4Q2LA 1IXKA 4QW9A 4RUAA 3M2UB 2B4PA 1X4BA 4Y2MA 4IQMA 4OFZA 3C3LA 2QLWA 3KUGA 1SUQB 1NB7A 2CJYB 3WX8A 3O44A 2M8DB 4ILRA 2MHNA 2O01C 1S9EB 4HDGA 1S6QA 2DGUA 2RSQA 4DU7A 1D9FA 1RXOB 2UUAJ 4DV1J 4O23A 2RILA 1WC3A 1DTTA 3HHLC 3OLBA 4X66F 2KO1A 3CSKA 2IRUA 3T41A 2HGMA 2KFZA 4WYLA 2XO7A 4F04B 4ECVA 3WX4A 4PXDA 4YQWA 1YJ7A 1P1TA 4ED6A 4DV0J 1UL3A 4C8OA 1GMWD 4OJHA 4TXSA 3K58A 3IM9A 1CULB 2B9WA 1JJCB 3EXCX 3PX6A 1HLWA 3D3BJ 2KHCA 1TK8A 1B0VA 4KGXB 4ERDA 2OFHX 1NDPA 5KG3A 4ZPTR 1SH2A 2I5JA 1DTQA 2BRLA 4NXMF 4C0HA 5E3CA 2RF2A 4JI0F 4H4OB 1JNZB 3ZZTA 3ENWA 2NS1B 1JKHB 5A0YA 4DR6J 3SI8A 3EVOA 3V6DB 3A12A 3SQGA 5IC6B 5MAOA 1C4AA 2RDDA 1NK4A 1YRTA 4RNHA 3CJ8A 2FLOA 2MSSA 1UEUA 3UD4P 2VG5A 3D3CJ 1C1BB 2KI2A 1TK0A 1PJ6A 1PILA 4KO0B 3DRYA 2ZDPA 1SJ1A 2MLYA 3E01A 4M5NA 2Q3PA 3TP2A 3KHGA 4HLBA 3H8YA 4H4KC 2KYZA 1J5OB 3RGIA 1RCOB 3PX0A 4B08A 3UVJB 2L9DA 2A10A 2XSJA 4G1QB 2EFQA 2E5LJ 3OVBA 3RAQA 3I87A 1YX2A 1XIQA 3D1HA 2DHSA 2NQPA 1XMQJ 2RAQA 3TUPA 2VFRA 2N4CA 3TRGA 1CPZA 1TR0A 1NAQA 3AAWB 3LGNA 4N7TA 4FYYB 1RT7B 3IWLA 2WVDA 3AB2B 2HLTA 1GX6A 2Y1LB 1N5QA 2W2OP 2CKWA 1N33J 2MPUA 3L7UA 2M88A 3VF0B 5L1LA 4ELVA 5CQGA 1FESA 4UOFA 2XHWA 4P9SA 1N5YA 3ELHA 4OJGA 1Y3JA 1NK8A 3CCVS 4P10A 3R7NB 2R7UA 2G2OA 4DPXA 4TLQA 2WB1D 4YR2A 4JI1F 4U7CA 1JJHA 3E2EA 2K06A 3MOJB 1X0FA 1AZSA 2VFVA 1T8EA 1VOMA 4Z7YA 3JAMY 4Z37A 4Q0BA 2CZVC 4DL7A 1U49A 3KMQA 3MEEB 3T5LA 2YQ1A 5AXMA 4OZNA 1B3TA 5ETNA 4P75A 1RAJA 4OYWA 3SQOP 2N82B 4I4BA 1HNIB 4DV3F 3TUIC 2CQ2A 2ROPA 4KH1B 1FEHA 2QLBB 1OMSA 3V2UC 2B8PA 3UN3A 3BQ0A 2APOA 1QY7A 3PRBA 2Z2YB 4AE5A 3BGUA 2OELA 4JI6F 3Q8UA 3U1MA 1Q4RA 1REGX 3H42A 3SYZA 4RO0A 5DO2A 3DLJA 3BM7A 2M7SA 3BZQA 1TV6A 2VOPA 1RT1A 4DSLA 3M6VA 2PC6A 5IWAJ 3DOLB 1XJWB 1X7VA 2ADBA 1V3ZA 2BABA 4FBUA 4IH7A 3DLBA 2MZJA 2RUSA 1Y5NB 2HHWA 1ROFA 3KHLA 1ITPA 2ZWPA 4F7VA 4LFAJ 1J5EJ 4CI0B 2D3O1 4DV2F 4HTIA 4CWBA 4F4WA 2ZH2A 4P7VA 5GMDA 3PTWA 5EX0A 1U25A 2ZHOA 2ZBRA 1S1XB 4X84A 2ZBIA 2W2NP 4IH5A 4BLGA 4KHRA 3OJUA 2D3ZA 2UUCJ 3H0PA 1B64A 1H7XA 2Z4PA 2OPSB 2CNKB 4ED4A 1QLNA 2DNGA 3V4MA 3Q2SC 4CO2A 3I0SA 2VONA 2KXHA 1FWPA 3FFIB 1S0NA 2MYFA 4NLGA 1TL1B 2ZH4A 3KJVB 1MN9A 2DNMA 3K7RA 1F60B 4G1PA 3KJFB 3PW2A 1H2UX 4RW9A 1TUVA 1MROA 4CH1A 4KH0B 3RR7A 4NMLA 1Y4ZB 2OLWA 3CJ2A 5F8GA 3I82A 2V8PA 2BW7A 1ZTTA 1N54B 4MT1A 1HBOB 4A8KA 5B0FA 4QQBA 2QFJA 1RKIA 3C14B 5LMUJ 1VCTA 2H5JB 3T1HJ 2EK6A 2AX1A 3CDWA 4K4WA 1M5OC 2H5IB 2QYGA 4USHA 3IAM9 2RDIA 3IR6B 6FDRA 5LMNF 4BC7A 2QIFA 3CEDA 3K5MA 2G0IA 1I6JA 3VGVA 4PWDA 1G3OA 2IA6A 2IBKA 1LWCA 3KLFA 2OPPB 1MG7A 4Q44A 2W8LA 2VQEF 3FRZA 3ETOA 4GVBA 2WONA 4OJ3A 2H4YB 5IC4B 2QLXA 4OQJA 1FJEB 3JTPA 3FZBA 4J9QA 2JHEA 1HQUB 2DGSA 1YVFA 1FD2A 3Q89A 5J1EB 4LBHA 1SVDA 5IT9Y 1TAUA 4QW8A 3W63A 5AXLA 2H48B 2EXUA 2A6OA 1KR4A 3SZ2A 3ZZPA 2OKQA 4NYZA 1UJ5A 3VTIA 4RW7B 4DQRA 2X51A 3K0JA 2JEIA 3BR8A 4K2XA 1N36F 4O4GA 3FEXB 2EFGA 4ID5B 2FC9A 1QM9A 1NJYA 2IA0A 2EW9A 2N3OA 4XIUA 5HVFA 1RHMB 4KQZA 1U4BA 4WFNQ 4DSFA 3GTYX 4DR2F 3DOKA 1S57A 3ZTOA 1S4FA 2PE8A 3D6TB 3HVAA 3HSZA 1Q53A 4CLSA 2HFZA 5KOWA 2D69A 1TKXA 1C0TA 4OL8A 4NWBA 3ONQA 2JVRA 4M5HA 3VAKA 1JXVA 4ZVEA 1YJUA 4ETXA 4AFFA 5DGBA 3P3DA 2CQ0A 3OL8A 2A3JA 3D28A 2WCXA 3WHIA 3P4UB 2V67A 2GMJA 1FFGB 4N47A 4M5LA 1NO8A 1SH3A 3X1LB 2PO4A 3VQSA 4WZQA 4RKUC 2RJZA 3Q86A 2XY5A 4KAIA 2XMMA 1IR1A 3TJAA 3V6JA 3NMAA 3BN4A 5K20B 4LF8F 3M2UA 1UJ4A 1T02A 1K9MT 1YBUA 4C97A 4BCAA 2IM2A 3W8PA 3R5BA 5KFYA 2HBYB 2HK2A 3D6FB 4NE9C 3EZ5A 4RX6A 3I5CA 4RUHA 4KSEB 2V34A 1S9EA 2XM3A 4DR3J 2M8HA 3NL0A 3HFZB 4LIRA 2CQHA 1B0PA 1HA1A 2IM1A 2GO9A 2UUWA 3THVA 3GIKA 5F8IA 3ISNC 2YNFB 4A48A 3KDOA 1WOSA 2BKNA 4LUBA 3A3NB 3K5NA 1SJRA 4FXDA 2J9CA 3KNAA 4U95A 3BKUA 2C2NA 2MZSA 1E6YB 2NCKL 3Q23A 1U0HB 4LF7J 1X5TA 3KUEA 5E3AA 4M5IA 2VFUA 3HKZD 4GRSA 2ZH3A 1SC3B 4H4OA 4M5KA 3QJJA 3KJQB 2OP5A 2ZNZA 4WU3A 1JB0C 1Y3KA 4ETZA 2VG7B 4DFMA 2J7WA 3M8WA 5GAGI 1FRKA 2UXBJ 4J9KA 4LF9F 2XYGB 2HWTA 4Y2IA 1C1BA 1IR2A 4NZ0A 1IBKF 3FBCA 1S1UB 2LXIA 4KO0A 3DNCA 3UFCX 1QTMA 4DU8A 1RWWB 2QLFB 3DOMB 1SKUB 5DS7A 5DM6Q 2XY6A 2OH2A 2WSFC 3U27A 1IKXB 1J2VA 2CWXA 3ZO7A 3C16B 4O4RA 3UVJA 2E66A 5KG2A 2MGZB 4G1QA 1APSA 5H9EK 1FKPB 2WTFA 1OYDA 1ZAVA 5EN1A 5H9FK 4C0OC 5HVHA 3GILA 4K8RA 4C8NA 3UNYA 2RU9A 1S5ZA 4OHVA 2I0XA 1HQEB 1RHKB 1RAAB 4U8VA 3R7BB 3OVSA 1RT2B 3G6YA 5T14A 2UVRA 3MAQA 5DZ6A 2YH0A 1RT7A 2V63A 2QMUB 2QT7A 1Z4UA 2XI3A 3OR2B 2JH3A 3DC2A 3AD9C 1FK9B 2DHHA 5F0UA 4CRJA 2IC3A 1XNQF 2POKA 4YHHF 3NS7B 3OTCA 5IQ6A 2DY1A 3CTRA 1VISA 3SSSA 3G86A 4C0BA 4PWUA 3PYFA 3N28A 2V8GA 4WXWA 2XULA 2WSCC 3CJ5A 1BQXA 3TR5A 2F1FA 3BO3A 4WU2A 4KT0C 2U1AA 2G2YA 3ITHB 1JIHA 2XTJP 3AJ1A 2NR0A 5L1KA 2HBQB 2GJIA 1I94F 3NKYA 2V9KA 2UVUA 4FYWB 1AW0A 1KOOA 2KXFA 3MEEA 2GX8A 4J9PA 4MIBA 2R8GA 4TQSA 4G6VB 5HMZA 4ZK7M 1HNIA 2YWKA 2R8KA 3KHHA 2ZBQA 2ZUGA 3MCMA 3J81U 2QGFB 3C15B 3KYLA 1C2PA 2PSZA 1SBRA 2P6TA 5BJRA 1RWXB 3PACA 2Y8WA 5K8PA 5HVGA 1TMJA 3FDSA 2MZRA 2UXCJ 1Y00A 4J37A 3I96A 1H6KX 4IO9Q 1RCXB 3DOLA 2JLEA 1Y5IB 1CJUB 3ISZA 4O0NA 3HHLB 3QLHB 4NLPA 3GWCA 4B3RJ 1Z2ZA 3T9ZA 2E1MC 4CO1A 2F9JA 1HFEL 3R5JB 4HTJA 4ILLA 3LO3A 2R42A 4JOUA 4OX8A 3ILIA 3ZZ0A 5DG8A 1PYOB 3TAMA 1S97A 1NZ8A 4NZ6A 3AB4B 3M6UA 2MJNA 2KN4A 4F3MA 1SCJB 1SC1B 3WIVA 1NK0A 1S1XA 3MR3A 1G6BA 4CQ1A 1RTIB 2DGOA 2OJ3A 2OPSA 3A13A 1VFJA 3NCQA 2R8HA 4Q5VA 1TL1A 4C3LA 4S0MA 3KJVA 2W7AA 1AT1B 4HHUA 1ZETA 4L76A 2ZBCA 1NPRA 3AD7C 1NSAA 1ZTWA 5T7LB 1AUDA 1R0AB 2CRLA 2SXLA 3U1LA 3C14A 3VAJA 2DR5A 2IJRA 4IFVB 2DD8S 3CCUS 1Y7PA 3HSDA 4I1TA 2EKYA 4PG5A 1QAYA 2HRUA 1UEVA 5K8NA 3MCOA 3D4JA 1Q79A 3QIPB 3UPFA 3QRPA 1S1VB 1CSJA 1YJWS 2XTCA 4ZKAA 4C2MA 5CCLA 2RD5C 5J2MB 3KHRA 4DQPA 3KJNB 4DUZJ 3O1LA 1RZMA 1UA0A 1S9GA 2HS4A 3IN5A 1VC0A 1B99A 4P71A 4DL0C 3RZAA 4A8QA 2CQDA 1KONA 3SDEA 4ECXA 5U47A 3OL9A 3U1NA 3CCSS 5J1EA 3T3FA 5G0RB 4TU9A 3KK3B 1T9VA 1VQ8S 3FSYA 4K50A 5A2QY 3G4SS 4G65A 3CCWA 1LW2B 2ROGA 4M5GA 3FQLA 2HPUA 4QIEA 1W2BR 4DEZA 2XS2A 3KNGA 2UU9F 2XGPA 3HKWA 4ZMMA 2NZ4A 3QO9A 2R7QA 3KLGB 5KAKA 1FKAF 1FI4A 1TMMA 2ACYA 1HHTP 3MI7X 2FVPA 2EFNA 1JMTA 2EKNA 3F73A 2W2PP 4OV6A 5HBMB 3OSNA 4JI3J 2HRTA 4LRBA 1AROP 2KG0A 4YDDB 3PJXA 5DLGA 3DRPB 2ZH7A 4ATNA 3W60A 3PKMA 1IBMJ 1D9AA 1TELA 2DH9A 2J0QD 5KTQA 3B4DA 3DHWC 4BHQA 4K4UA 4OX9J 2QFIA 1H7WA 2LA6A 3HCXA 3AA9A 2DGVA 1WDTA 1TQLA 2DISA 3TI0A 2FHJA 2YNIB 1GH8A 3W5XA 2H3EB 3D5MA 3MDFA 4FDFA 5LT5A 2VFSA 2XZDB 4Z7CA 2IDEA 4OI4A 3S1TA 3VAFA 4DFKA 2ZDOA 2M0GB 3CVKA 1VHFA 1Q78A 1U1KA 1VBZA 4HI1A 2D3OR 3QFHA 5FDLB 2B5JB 3I9V9 3BYRA 4MYUA 1XR7A 1RUSA 3BV8A 4J9UE 2K7JA 1R8PA 2M70A 4NLSA 2RDJA 1DQ9A 2ADCA 3AHPA 1TKTA 1H38A 4BS2A 3M1VB 2ZH6A 4JUZA 3H5XA 2AJ4A 2LYVA 1IN0A 1VQPS 4DN9A 4NX9A 4HI2A 1NHVA 1WHVA 1RB0A 4ZVGA 3J7A1 4PWWA 2EEYA 4OYIA 3CMAS 4DV6F 2R2TA 3MGJA 4UUWA 3OLAA 3M2VB 2YNFA 3F56A 3JSRA 3FCVA 1X9MA 1RLDA 3G82A 1XN9A 4HT7A 3I0RA 1U7LA 2HHHJ 1E6YA 1EARA 2GNKA 1W25A 3KLHB 1LK5A 2HG4A 4GKKJ 4ES2A 3MEGB 3C6UB 3TAPA 5HMYA 3TYTA 3UCGA 1FA0A 1VK3A 3A1YG 3TZXA 1RWVB 3ENAA 1NK6A 1KFSA 2VG7A 2W24A 1RT3A 4B3MJ 2HFOA 1LFPA 2HNYA 3TW0A 2C2ZB 3DRXA 1SI9A 5LSOA 1S1UA 5CYQB 1HBNB 4FPRA 1YTYA 3DOMA 3JYTB 5BYSA 4K5SA 3EVMA 5KG0A 3I9ZA 1A6LA 1SB6A 1IKXA 4DX7A 1WHYA 3C16A 4ZCIA 4NCBA 2MGZA 4LQ3A 1FKPA 4PYAA 2VA2A 2CNOB 5D15A 1SJ3P 3Q83A 3O8WA 2ZD1B 3C6TB 3FNNA 4B9TA 2DITA 5MLCV 1PIEA 2DKOB 2DO0A 3R6GB 4X66J 3M6WA 1HI0P 2JSXA 1HQEA 3ILJA 1B70B 1RT2A 2EBGA 3WC0A 4WFZA 1VQKS 3BF4A 2O1PA 3J80U 2XZ2A 4RW4A 1ZM9A 3FK4A 1TUWA 5KFIA 2A2CA 3OR2A 4RBTA 5JVHQ 4OYOA 1IKWB 2YX1A 4NPOA 3NOGA 4KIAA 3O2IA 1FK9A 4LF4F 3NLCA 4M94A 4MIAA 4USUA 3W61A 2CQBA 1KVJA 4PABA 2ATCB 4CO0A 1RAHB 4DV4F 3JSBA 4ED0A 2GVDB 4NXMJ 3R1HA 1NHKL 3HHDA 4JI0J 1RTDA 2A18A 1X4FA 2ZVIA 1GAOA 2QZ8A 2RT3A 4X4PA 4CNZA 2XHCA 2IDLA 2KFNA 5BYQA 1GX5A 2H54B 4NLDA 2EG2A 1HD0A 4RWWA 1VQMS 1DQ8A 2J9DA 3MURP 4IR1A 4CH7A 2V4RA 3NWRA 2UUTA 3QRQA 1U0SA 3CE8A 3IMQJ 1OY8A 1V3SA 2FJEB 2GO8A 1SL0A 1X0PA 1JLGB 2DK2A 1L3UA 4CLYA 4PG6A 4ES3A 3C15A 2UVVA 5HK4A 2L9NA 4M95A 1SKSA 1FE0A 1UVKA 3FEZA 3J7ZT 2P8IA 4RUCA 4OI3A 2DIVA 3S01A 1NM2A 1RI7A 3AXMA 4ECQA 2HFSA 3NEKA 4YB1P 1CS4B 2GHWA 5HJYA 5KFHA 2YQ0A 4KTQA 1CJUA 3DHXA 2GV1A 3HHLA 3QLHA 4DJBA 3R2DJ 4UY85 2P5VA 1N48A 1FRJA 2GMHA 2MQNA 3M9NB 2FQQB 3FQKA 4QBUA 3SSQA 2QV6A 4DV7F 1AFJA 2J0WA 2ASJA 4YS2A 1VYAA 3DLKB 3CDAA 1HWLA 2CUYA 4CDIA 4DSJA 1F3VA 3BR9A 5DDPC 3RRHA 3DGVA 1HNVB 2W7OA 5DGAA 3MPDA 2V2VA 4LSZB 2HVIA 1OQ6A 4C8KA 3HZEA 2HHVA 1OY9A 4ZPBA 2DXFA 2MTLA 2CPFA 4JI1J 2EC2A 4RNFA 3GIJA 2VBWA 2FD2A 2XWYA 4GKJF 3QPIA 1YJTA 4JI5F 3MM8B 1YJVA 4LBPA 4RWXA 3T1YF 4WFYA 1AB8A 4O3RA 2ZOMA 3EDRB 5CAAA 1PKUA 1WG4A 2YTCA 2QTWA 3M8SA 3CW2C 2CQCA 2MZTA 1NSKL 2ZOFA 4MKYA 2W4PA 4DV3J 4UTGA 1RTHB 1Y0HA 3RB6A 3PV8A 2CJBA 3DI6B 3JQKA 1R27B 1R0AA 2GA7A 4H4KA 3TQ1A 2EG1A 1BXNA 5A8KB 3GMGA 2O3DA 4JI6J 1S49A 5KFLA 4P52A 3QT8A 2KYXA 1NSQA 3HSJA 5DQHA 1K73T 2IVMA 1VQLS 2B8QA 4I56A 2I9SA 2LDIA 4OYPA 2KU7A 1RWOB 3OHAA 2LEBA 1N5VA 1X9SA 3QIPA 1DZ5A 3KFWX 1PC5A 4K2JA 1S1VA 2V4JB 4QWCA 2C3UA 2QA4G 1NKCA 5J2MA 1GMUA 3TX8A 5K5MA 4CM2A 1HBUB 5T41A 1QJHA 4P7TA 1R0CB 5BYRA 1VRUB 4DV2J 4QWAA 3C8YA 2R2RA 2W9CA 4XK8C 2AWZA 1IBLF 4LMZA 1LXJA 2HQGA 2RB7A 3GV5B 3LGHA 2KT3A 2N7YA 2ZKTA 4KHMA 5G0RA 2Z30B 2B4OA 3EGNA 3H2LA 3UNGC 2LLZA 3IO1A 2HAIA 3HT0A 5FD1A 1M1KT 1LW2A 2FJBB 3B54A 3PRDA 5ETOA 1QAJA 4R8UB 5D0GA 1RU1A 1JJ4A 3CGIA 4NLTA 3IG1B 1U1PA 1PJ7A 4OI1A 2Z0GA 4LFCF 4FF3A 4CZCA 2DHGA 2RKIB 3VCDA 1LQ9A 4UQTA 4X4OA 2MQMA 4K7QA 2KZMA 3HHNB 2LEAA 2B56A 3DDKA 3OPKA 1T11A 4P74A 2I2YA 2CWKA 3K17A 2C2DA 2EWHA 4JV0A 3MD1A 5DZ7A 1ZM4A 4J9RA 3THPA 4LRAA 3ADAC 1D8YA 2VG6B 5LMNJ 4KV8B 2LMIA 4WYWA 3IGNA 1G4CA 1UZDA 4K0KF 2G1HA 4IFYA 5F41A 4P2FA 4IOCQ 4J9OA 5KT6A 4C3MA 1MW7A 3B4MA 4V19X 4X4RA 1OPZA 5AJ3F 2VQEJ 3GU0A 1GNKA 2LQ5A 4AD6A 3GIRA 1XR5A 1RHUB 3OTEA 5ETMA 4OHWA 2ZM6F 1RT5A 2FVSA 5FDLA 1V5IB 2VZ9A 3G71S 4TYBA 3NG8A 2Q6CA 1EIYB 4OYBA 1EHWA 4DDFA 1CC7A 2FVCA 3LTOA 2HSEB 3G6ES 3OD2A 4PPZA 5HMWA 4DCOB 2ASYA 1PJ5A 1HIYA 1Z1ZA 3NS6A 2YNHB 4I6AA 1RWUA 1T94A 2XLKA 2QO3A 3WC2A 1RLCL 2H51B 4USKA 1N36J 2F4FA 5J2NB 2BKOA 2RF2B 2H5EA 4NYOA 4AT1B 3M9OB 4YDXA 1QE1B 4WTYA 1YZ7A 2PEBA 1XTZA 4QWEA 4EZ9A 3SQGB 3M2VA 2ZHBA 2WRMA 3DDIA 3J7YI 1KC8T 4DR7F 4K4ZA 4U8YA 2IAJB 4ZCKA 4DR2J 4HVZA 1ZZNA 1URNA 5KFDA 5C7PA 4AXJA 2HHXA 4Q7AA 3PX4A 2JNJA 1JLQB 3E01B 3LP2B 3I6PA 2HQDA 2R2SA 1YJRA 3MEGA 3C6UA 3NGUA 3J7AN 2GQCA 1ZYQA 4K5RA 1MWYA 1HR0F 2XSJB 3X3UA 3BO4A 4E0DA 5KFKA 1KBRA 3GQCA 4CLTA 1UW4A 2FHMA 1MMNA 3QZ7A 2R7WA 2IM3A 3L09A 5HP1B 1T05B 2CAJA 1LW0B 3PW4A 2FZKB 1VQ9S 2BJ3A 2GCFA 4G3IA 3BGLA 1X5PA 2ZZMA 1FNXH 3QWUA 3QFWA 1X5SA 1KQSR 3H98A 2FDNA 2YKQA 5CYQA 4K4TA 4CO3A 3LPYA 4DZ6A 4WF9Q 1T03B 2HRYA 2JFKA 3DM2B 1ZA1B 1B7YB 2E1AA 3KK1B 4Y2AA 4HHJA 4RZRA 1EKSA 4PG7A 3LA0A 4J90A 4C7QA 1SKRA 1GTEA 3LF0A 2FZGB 2ZD1A 3C6TA 3RG6A 3AA8A 5EWEA 4JI4F 4JB8B 2YH1A 4ED2A 1QVGR 3NGTA 3UCZP 4X4QA 2GIFA 2R7TA 1F3FA 3M30B 1AZSB 1F6TA 4IUFA 3VALA 1Q81T 2QC3A 4DV1F 3DKDA 2DPIA 3CD0A 3CDEA 4ZPCA 1T9XA 4U7UD 1IKWA 4HR2A 2ASDA 2BE9B 3F44A 2GVDA 2V94A 2BANB 2LDYA 2BX6A 4X4UA 6AT1B 3VR1A 3DU6A 3U7JA 2NREA 4DWIA 3UO0A 4DUTA 1UZHA 1NKEA 4OHXA 1ZS6A 4I6WA 4YR3A 1FJCA 2F3JA 4DQSA 1PAUB 2AZ1A 4IDKA 2C3PA 4LF9J 3PXGa 1X4DA 2YWWA 4P2SA 1PC4A 2HQ3A 3H5UA 4F36A 4OYZA 2IRYA 2L3MA 4PG4A 5B0BA 4TN2A 5AE2A 2JZ5A 2X1AA 2AYGA 2DEJA 4FS2A 2OD4A 3AWRA 3GFXA 3NGKA 2HVZA 1FCAA 1JLGA 4NL5A 3QGGA 4WCEQ 3K5OA 3H5YA 3GFZA 1X5OA 4LVNP 3KG4A 2MZQA 4ZVPB 3RTVA 1JLAB 2GHPA 4TY9A 1N88A 5B0EA 1XERA 4P6QA 2WSEC 3QQCD 3IR7B 2LP4A 1CS4A 1FFWB 1LK7A 2KFYA 3DRRA 2NXEA 1NNDA 2QSWA 1OSDA 2QMXA 3ETMA 4TYAA 5KG4A 1U2RA 2HS3A 1S7IA 1WHWA 4UZCA 1KNZA 3EZOA 2CQ1A 2QJ3A 1NB2A 1VR6A 1N0VC 3G6VA 4LJMA 3CT9A 3BSAA 4MIWA 5KG6A 1SL1A 5LOQA 4I7FB 3MAAB 1XNQJ 3HD2A 2QLJB 3WQPA 4YHHJ 1XK8A 5LM7E 4GC7A 2CPDA 2AMCB 1HNVA 4B3TF 3HHKA 1T9YA 4W90B 1SQFA 3LOUA 1L3KA 2VKZG 3QT5A 4YEAA 3T6JA 4OLOA 2RNEA 3BREA 4ZS6A 1WWHA 2DGTA 3Q24A 4A8FA 3B82A 2XCAA 1IJFB 1A7GE 3CF5Q 4OZ5A 2G2ZA 4U9RA 1I94J 3EGZA 1ELOA 3MM8A 1R0BG 1V9OA 3PR4A 2C2MB 3BQ2A 1D1UA 2J76E 1JX4A 4WJBA 4DI6A 4X62F 1XWLA 4IOBA 2MKYA 3GONA 3RW7A 2HYIB 1TP7A 4PWDB 1RTHA 4KY3A 1FT8A 4L72B 4J7CA 3DI6A 3KLFB 5EX3A 1H74A 3RR8A 4GVBB 2WONB 1RTJB 1TKDA 1DLOB 5KT7A 1Q95G 2AIRB 1WI6A 2KT2A 4LIWA 3HHLD 1P1LA 2AJFE 5LSLA 4OI2A 2J0SD 5CH7B 3N0VA 4XAKA 2J6TA 4I2QB 1NBEB 4EBDA 2Y1JA 2XG8A 2V4JA 2L9WA 2AJQA 3R2CJ 5IWAF 5IV4A 4ELUA 2B4UA 4Y2CA 4LR8A 1G2EA 4WWSA 1Q16B 1NKBA 1VRUA 2Z58B 2PDAA 5ETTA 3UW1A 3FBFA 3MMBB 2LA4A 1EX8A 1TK5A 3OUYB 3FVYA 4USWA 4CTAB 1F5AA 4URGA 1XNRF 3W3SA 2XGQA 1J5EF 2CJQA 5HO4A 1HW9A 4DPTA 4C8ZA 1IJEB 1BY9A 3L95X 5F9NA 4MFBB 2H1YA 1X31C 2Q43A 2JEGA 4U6PA 3CO9A 2HFUA 2OEJA 3MMAB 2RQCA 4N8OA 1IKVB 4R8UA 1S10A 1M1GA 4DQQA 2Y1IA 3H7HB 4YFUA 3KLVA 2XEXA 3IG1A 5JMNA 1C0TB 1ZH5A 2R7OA 5F8MA 3TQEA 5CCMA 1BQMB 1R7IA 2RKIA 4IH6A 3CC4S 3GG0A 2RHQB 5CD4H 1RAFB 2WAQD 3BKFA 2A0FB 1K1QA 3NNAA 1EETB 1VGYA 4ZOSA 2CYYA 2QG9B 2P2CB 5KFOA 3UR3C 1DJ0A 1RISA 1EQMA 3VGSA 4P2XA 3BBBA 1YI2S 3G8SA 3CMES 1KFDA 3O3LA 1RU2A 1PO6A 5KFUA 2VG6A 1ACMB 1BWEA 4KV8A 1JLFB 3D0HE 3H2UB 1ZZFA 1YZ6A 3OHBA 1EZZB 4USVA 4FYXB 3EDQB 4MYTA 4NXNJ 3AJ2A 1DAXA 1N0UA 2G4BA 2RS8A 1RAGB 3EGWB 4C3KA 3JSYA 4DL5A 3IWXA 2C3YA 3A8EA 4PXBA 4DFPA 2X1GA 3TZYA 1P27B 2NPFA 2D9OA 4A8SA 4F25A 3I4PA 1WUUA 5DG9A 1U45A 3R8YA 2P9EA 1UEKA 1R89A 3K2YA 2BZ2A 4QR0A 4IQXA 4FN5A 2D9PA 3CMQA 4NRUA 4XPCA 1BLUA 4JI2F 1KHVA 4KYZA 3TO8A 2YNHA 2UU9J 4UY8T 5E0OA 3CULA 2DNOA 3EE3A 3NOCA 2VJVA 5J2NA 4DUYF 4ICLB 3OV7A 2J6UA 1QE1A 2HZAA 2RQMA 2FLPA 4EWTA 1H3DA 3W7BA 4XPEA 1FTRA 2F65A 3QYYA 3V5RA 4DR4F 2ZC4A 2AF6A 2K3KA 3P49B 4K4VA 1U2FA 1G1XA 2P9CA 2EFOA 4F8RA 2WW8A 1UP1A 5IOLA 4I0WA 3LWMA 4WPAA 2CZ4A 2ZC3A 1BWVA 4CT9A 5D3GB 2FB0A 2ERRA 4OJ1A 2IAJA 4UW2A 4FNIA 1PG5B 3EVWA 3R7SB 2FGCA 3R6LB 2DR8A 4B9MA 1JLQA 4ZP6A 3LP2A 3MEDB 1LEOA 2CQ4A 4R5PB 2GAGC 4MK9A 3RAXA 2KZZA 3ZZYA 4JYAF 3IWNC 3V81B 2OO4A 2AJ0A 1GXUA 4K4SA 2HGLA 3NXZA 3UN5A 4DPUA 5AXKA 1UTAA 2VDHA 3FEYB 3Q8VA 3TA0A 2OSQA 2DGWA 3CJ4A 2AW0A 2C2RA 2GAHC 2XC9A 3EGVA 3D54A 5LL6d 5HP1A 4MH8A 4ELTA 1T05A 3VWSA 1LW0A 2KG1A 2OFGX 3RJMB 2I6WA 3TJ8A 2MJUA 2DEIA 5CYMB 2DRBA 5D77A 2BOAA 3HULA 2IYGA 5H9EJ 1T03A 3UDVA 4IO1A 1GXLA 1KQFB 3DM2A 2NXUA 5H9FJ 3CO0P 2N4DA 2ZOGA 4FF4A 2IC3B 3KK1A 1EJ7L 3KDNA 1KQGB 1HD1A 2BA9A 1YSJA 4MAKA 1JXLA 1HW8A 3AOBA 1HI1A 5KFCA 3NGRA 4M5DB 2AGPA 3PM9A 4OZ3A 3RU0A 1S7HA 1CEZA 2ZJPQ 5I42B 3ZTQA 4TVAB 4DV6J 2GFFA 1UWAA 3M30A 2GJ2A 2YBVA 3R5CA 4AL7A 5ETQA 3L9ZA 5KFRA 4Z2XA 5L9XA 4NLWA 3OXGA 2HNDB 3OFGA 1H0HB 3Q8QB 1GQEA 3AX2A 2BANA 4FXWA 1ZAXA 1TL7A 5G4DA 2DHXA 3K8WA 2DYAA 1IUJA 4HKQA 1SPBP 4F4KA 2J8SA 1AUSL 3IM8A 1GMWA 3U02A 5GAEI 4J9VA 5E3PA 1YBAA 1IM4A 1UAWA 5C24B 4O0IA 5E5NA 1FRHA 2MKJA 2QL9B 5HATA 2ATLA 1WC4A 4DL3A 2EBEA 4ZJOA 4ZP8A 5KT5A 3WIUA 1DQAA 1XQIA 3PEHA 1FXDA 4WP9A 3PEJA 1NMEB 3TAMB 3CDBA 4DMZA 1BQNB 3G96A 2FZCB 4O44B 2IYIA 1JLAA 3WDOA 3DDNA 3DLLQ 4EYIB 1O6XA 2QEXS 3LW5C 4N5SA 5KG1A 4ANDA 3EXYA 4ECWA 2XCPA 1VQ5S 4K4YA 2XQCA 2BDPA 3MWBA 1S6OA 3OFHA 4A8XA 3N79A 4PR6A 2DH8A 4DZDA 2GIQA 2JC1A 1H2TZ 4LF4J 1L3SA 4A46A 3FC9A 2RQKA 4I7FA 2K3IA 3MAAA 1RYRA 1BC6A 4DLEA 1C1CA 1WKJA 1V5VA 2VC1A 4P2MA 1F5BA 3BH7B 3BN7A 1NH8A 4X4VA 4PXEA 2MSTA 3VQTA 1W7WA 2CA9A 4KFBB 3MFIA 5KT4A 4LRCA 1KS2A 1YDLA 4DSKA 2E9RX 1FWLA 3W9IA 2UUBF 5F3TA 2FUG9 2J7UA 1SL2A 3DLGB 1VQNS 5EGYA 2XNRA 1HYSB 3MM7B 4CLUA 3R9LA 3L3CA 2G13A 1R8AA 4NZ7A 3CJ0A 4X64F 3ZNJ1 3MM9A 2ZNYA 3EX7B 2B0GA 1YKWA 3UI3A 2AX0A 1S9GB 1HL6A 4URQU 1HNZF 4W98A 1IBCB 3AOCA 1RTJA 3ENQA 3SV4A 1DLOA 1FNOA 2QL5B 4C9DA 3SDEB 2L41A 2N7CA 2Y9HA 2BXJA 3R97A 4R0JA 4DQIA 1U6ZA 3ISND 2Y8YA 5E41A 5CD4A 1YGYA 4I2QA 3DXBA 4YR0A 1SIZA 2QA1A 2RVJA 3QGPA 3HXMA 2AJ2A 2OHDA 4DV7J 1HNXF 2W7PA 1E6VB 4ECUA 1TL5A 1IWGA 3QO9B 4UT4A 2AP6A 2QRRA 2KHDA 3MMBA 3VAHA 3OUYA 4KGZB 1F9EB 5A8WB 4FZVA 3PVXA 5A6PA 2CDRB 3IP0A 4CTAA 3PYGA 4L3KA 2AEMA 4A47A 1JLCB 2VV5A 2NUHA 1YK9A 5GVQA 3T5HA 4MFBA 3AH6A 4PQUB 3GSDA 4GKJJ 3CD6S 2E9TA 1KTVA 4JI5J 2KVIA 5ETPA 1S72S 2XMTA 1S48A 3T1YJ 1UFLA 1NPKA 3MMAA 1VC5A 2FTRA 5B0AA 3CJKA 4F3QA 1IKVA 4J9SA 5C5JA 5CZVA 3VHQA 2DO4A 5L9NA 1BQMA 4PAAA 1KKHA 2J6SA 1RP5A 2YWFA 3CXCR 4H4MB 4ZLPA 1S9FA 3TEHB 2GS8A 1EETA 2PGCA 1R6VA 2PFFB 2W2MP 2XMJA 4WTOB 3FJ2A 4G1IA 3CC7S 3N6LA 2FC8A 3AQOA 1CJVA 5E3RA 2PEHA 2AKWB 3PNIA 4NLXA 3IRXB 4U7UK 3BPSP 3NCRA 2PI4A 1TKTB 1JLFA 5RUBA 2PN6A 3VAIA 2EFVA 3TVZA 3OQ2A 2OD6A 5L1IA 3VGUA 4ED1A 5GADU 3CCTA 3MPVA 5CHCB 3PW5A 2G0CA 2KH9A 6FD1A 4DF8A 1RHQB 2B51A 1WEXA 1IBLJ 4DPOA 1NEEA 2R9LA 1FE4A 3ZFVA 4WFXA 4LREA 4DR1F 4EU0A 1WKLA 4C4WA 1WC5A 3G82B 2KKHA 2V6AA 2Z8QA 2NSBA 1FDAA 1Y11A 5GAGU 5GAHU 3MAHA 5GADI 3I0RB 3UWTA 4ZP7A 2RS2A 4YB5A 1UVLA 4Q43A 4YN3B 4LFCJ 1O5JA 2W9AA 3NAHA 4B3SF 4ICLA 4EO8A 2Z57B 1YJ9S 1U1OA 1LXNA 5D4LA 2DIUA 3FSIA 1MU2B 4OI6A 1JWWA 1RA7A 1TUGB 1IM6A 1IWAA 4XDDA 2YQ3A 3LH2S 2HWIA 2NPIA 1UJ6A 2ALYB 5ETVA 3QT6A 4EFAC 5GAHI 4LF6F 2E7WA 1RBLA 1RT3B 2O67A 3CPWR 1BMQB 2JWNA 2HNYB 5D3GA 2XMKA 4I67A 2VASA 5IXUA 1WEZA 1VLYA 4CLZA 4WFAQ 1XC9A 1IVZA 1S0VA 2LVWA 1UMJA 2BJDA 2VBZA 1F2GA 4USJC 4F0MA 1TAQA 3GCXP 3MEDA 2IBOA 4R5PA 1WSVA 4DX5A 4K0KJ 3VVTA 2UXDF 3AXKA 3V81A 3D67A 5LXRA 3BDEA 2DB1A 3WBZA 2U2FA 4JV5J 2CG4A 4L75A 2RRAA 3DFEA 5AJ3J 2AU0A 5BR8F 2RU3A 3D1QA 3PHEA 3D0IE 1G7CB 2AEJA 2M4MA 3SFUA 1Q8LA 1U1LA 2WK4A 2ASLA 2K2PA 2HFVA 4WIQA 2MLZA 5CYMA 1RBAA 3HSGA 4RW4B 3G6XA 4KR0B 4LR9A 4L74A 2OAUA 2I1RA 2VFTA 4DCPB 3MFHA 3TJ9A 2YX7A 1O51A 3IGVA 3Q2TC 9RUBA 4ZPAA 5A2QU 2CPXA 3FSXA 1CJTB 2CJKA 2DR9A 1LKZA 2OGUA 2HVHA 1HHSA 1RTDB 1Q1KA 3Q0AA 4M5DA 3NP5A 1FFSB 3BBFA 5B0CA 4FVCA 3QSIA 4XTTA 5I42A 2NYHA 4EI2A 4DF4A 3UDLA 2VD3A 2DNPA 3KLEB 4QU6A 2X1FA 3T6BA 4ZPWR 3FZ2A 4DSEA 4DR7J 2DT9A 1RAIB 2BACA 1RQ0A 2QYCA 3GYXB 1QSYA 1N5SA 3H20A 5E3QA 2VPZB 5IM0B 2HNDA 3THTA 3PO5A 4YY3F 2LQ8A 4DG1A 3A8IA 4LSNB 4FF1A 1RACB 2BE2B 1WEYA 1WJ9A 4NA3A 1S4EA 1P6TA 2E9ZA 2KM8B 1IR0A 2N3LA 4MK7A 1WHXA 4RLEA 2H4WB 1UWBA 5D4PA 1HR0J 1B7FA 3W64A 2W01A 2HNZA 3B8HA 3ZZRA 4ZVRB 2HQCA 3Q8PB 2IRXA 3RB3A 1TTHB 3HJVA 1L5UA 4NLOA 1AYEA 3CNQP 1R31A 4ZN3A 5C24A 4EYHB 1VS3A 1S6PB 2AQ4A 2M52A 1W2IA 1U26A 4CLKA 1HNWF 4ZVOB 4N76A 4NEYA 1RAOA 1NJIT 3GPAA 3PDNA 3DYAB 3HFVA 2W8KA 1JLBB 2M5YA 1BQNA 2JOQA 5D4OA 3LGMA 4MKVA 4LFBF 1YWXA 1XR6A 3HM9A 1XMOJ 2O5DA 1FD8A 4O44A 1BUXA 2JDJA 2KRBA 4QJVA 3UCUP 1WACA 3TUZC 2UP1A 2OPRA 3PR5B 3S6EA 4F0KA 4JI4J 1VIXA 5HANA 4DS4A 1FRIA 4F2SA 1VRQC 1I5OB 1M5HA 4LR7A 4KHPF 3MECB 4Q8FA 1VLOA 1R8HA 3QRRA 3KWMA 4E2FB 1YQHA 5HL7Q 4YMEA 3D9BA 4ZA1A 1DRZA 1HMVB 3QJLA 4OHYA 2B6AB 4CIOA 4OZ1A 1FHTA 2W9BB 4ALZA 3EMTA 3VAGA 5KFTA 1PYSB 1OM2A 3R5DA 1LOUA 2HVEA 4KPCA 3RB0A 2J9EA 3GYGA 5K8OA 3TEGA 2PA3A 3FGVA 3KOAA 1SJ4P 3BSOA 4KFBA 5KFMA 2V0NA 2AD9A 2UV8A 1F5CA 4RBVA 2WBMA 5KFWA 3DLGA 4QWDA 1MSWD 5KFJA 4GC6A 3BJYA 4NOHA 1HYSA 3MM7A 3N5FA 3B78A 2DVIA 2E29A 2VKRA 5M2UA 1XEZA 1PSDA 5KFSA 2DNQA 1F9FA 5KOXA 1H2VZ 4OX6A 3IS9B 2JEJA 4FVMA 2IMOA 4OZ0A 3P8BB 1TZ0A 3UE2A 2W9CB 2XBPA 5KFZA 3GB0A 3D7SB 3OFEA 3VZHA 5HROB 1Q0NA 1NK7A 2IIHA 3ICLA 3W66A 1EAYC 1VI7A 5F8LA 4ZIWA 3Q22A 2Z2LA 1KLMB 4ES1A 2KDOA 5FLXU 5AE3A 2PT0A 3CCES 2HZVA 3EUNA 5D4NA 4J91A 3LP1B 2DTJA 1U6BA 3VVUA 4JBCA 2FIUA 4M5JA 2XY7A 2ZKUA 3OTOF 1E6VA 3UQSA 1KVKA 4F4AA 2GMLA 4FBTA 4NYPA 1HI8A 3DRSB 2DH7A 3H4BA 3F0NA 2AZ3A 4N77A 2J7KA 3KG0A 2DNKA 5A8WA 1WTBA 1PAEX 4B3TJ 1DARA 1WELA 2WW4A 2YKPA 2V2ZA 3MMCB 1RTZA 1JLCA 1KTQA 2GVZB 4MKBA 5C2GA 3DMJB 1ZBTA 2BE7D 5F8JA 2ZJRQ 2X7IA 3QATA 4PQUA 1OYEA 1S59A 2CPZA 1P9YA 4URSA 1K0VA 3A3PB 3CJSA 1F9HA 4KGMA 3V4IB 1AXQA 4HYKA 3PZPA 2XMAA 4TU8A 3AFGA 1SQGA 4NI2B 1CLFA 3E51A 4IFYB 4X62J 1NRKA 4L73A 2W1BA 4X2BA 2F7VA 2YNGB 4IR9A 4H4MA 1DHMA 5ETKA 4O3PA 2F4VF 1MN7A 2KB2A 4V1Ak 1RWNB 2LXUA 3I32A 2YPYA 1RT5B 4U67Q 3EPGA 3KUHA 4I2PB 1YITS 5BXIA 3ZZZA 2CQIA 3QSYB 1N6QB 3IRXA 1KLNA 3SXLA 1RJJA 1S99A 5KT3A 3WZ0A 3MPUB 4KKOA 1RYSA 3BH6B 4EEYA 4KPYA 3GLJA 3PJ9A 1R43A 3PFEA 2LXFA 3FMBA 3I31A 1OPIA 4F26A 2XTDA 2OEKA 5KFBA 3KLIB 3D1OA 2B9XA 4CYUB 3HVWA 4Q45A 1FDDA 3A8KA 1XNRJ 5L38A 1X4HA 3GZ7A 5D6GA 3NBPB 1Q8KA 2C3OA 3FBBA 2B9EA 1MMLA 4PPDA 2F63A 1UCNA 5J2PB 4USIA 5HQLA 3NY0A 4LRFA 2VPXB 4EGLA 1X4CA 2XI2A 4ED5A 1QD1A 1VBYA 1FXRA 1VQOS 4YB7A 2XMUA 3O5TB 3HI9A 4WIIA 1LNQA 4DL4A 1QVFR 4ED7A 1MU2A 3GYNA 2BW2A 3RBDA 3NGSA 1TL3B 2VBYA 2R4FA 4ID8A 2Q79A 2HMIB 2OTJS 2EK1A 2F8MA 3G8TA 2LECA 2GGPB 4M8LA 1UPMB 4B9NA 3NMRA 5HN0A 5M2RA 2AT1B 4DR5J 3GP9A 1IKYB 2KVQE 4ZPVR 2VQFF 3TX0A 3M2RA 5HSPA 3GIIA 3BS9A 3W2WA 3CCJS 2BKPA 1CJKB 3FCHA 2MQOA 1SC4B 1JQGA 5F8HA 3P5TL 1WDDA 1MLAA 4PXCA 3R1LA 3S8SA 3BGOP 4RR5A 1FJGF 2EFPA 4ZVFA 1MWZA 3I4HX 2MKIA 1EB0A 2ZE2B 3G2XA 1U1MA 2ZWOA 3TA2A 1CQMA 2FJAB 3KKFA 2MKCA 3DLEB 4JI2J 2HURA 3MR5A 3A4TA 1KOHA 3W9JA 3PW7A 2HHUA 4W92B 1X4GA 1CJTA 3MM5A 1D0EA 2MKKA 4QR1A 4ED3A 4C8YA 4DUYJ 4OHZA 4Y6IA 2QA4S 4UQGA 4JI7F 1FF2A 3JB9k 3FRYA 3W9HA 3C66A 1S0MA 2EI5A 4LQ9A 1QUVA 4DR4J 2VOOA 1R8BA 1K0TA 4IDKB 1HWKA 2HS0A 3PIOQ 3KLEA 4LF2A 5DRKA 4HACB 4PEOA 3TVKA 1T9WA 1S76D 1TKZA 4NA1A 2HBZB 3LALA 4LSLB 5K9FA 4CH0S 5F8NA 2CJXB 4HEA9 3IBCB 1UVIA 4NCAA 5IM0A 4TQRA 2YKNB 4FPIA 2E1PA 4KBIA 2E5JA 4OYXA 4JYAJ 4LSNA 2KRRA 2BE2A 7FD1A 1SIWB 4ECSA 2AGQA 4ER8A 4NLYA 4V19J 4RNMA 3H25A 5F3ZA 1NJWA 1WTFA 1SV5A 3SMZA 3P96A 4PQAA 4QOTA 3SV3A 4O3NA 1JLEB 5FIIA 3J7Z5 1WI8A 1GK8A 4M63A 3QWPA 1RK8A 5DG7A 2JJ4D 3DRRB 1S6PA 2VC0A 1D8ZA 2OTLS 4WP8A 5EDWA 1DFDA 2RE1A 2IY5B 1I1GA 5LJ5Y 2ABYA 4RW6B 2R7SA 1VHIA 2YKMB 9ATCB 4JP8A 2FYXA 4DCJB 4ECTA 2WVEA 5IT4A 3DYAA 2V1SA 3ZNUA 1JLBA 1Q8IA 5DDOC 1OWXA 2FHOB 1RWKB 4TNOA 1V3RA 4F2RA 4CLWA 2NUUG 3G9CA 1JJ2R 1VQ7S 1WD6A 4ZITA 4QIFA 5E33A 4P73A 2CPYA 2CPEA 4AUKA 1SUQA 4C11B 2BQRA 1WC1A 2NSCA 1N34F 1M1HA 2PMHA 3MZIA 3T9NA 2EC0A 2QE5A 3TA1A 3MECA 2E5IA 3G87A 5I4MA 2CPIA 1RDRA 5L39A 2BRKA 1HMVA 1TVRB 2V69A 1WG1A 3OXLA 1FERA 3D0GE 2B6AA 3OW2R 2CJ9A 1EQ0A 2DNHA 1ULRA 2E7VA 2W9BA 4KGKA 1D3WA 3US5A 2JC0A 1HWIA 2MKSA 4AQYF 1EKRA 1URRA 1CULA 4EUVA 4RNNA 2JEFA 2YVSA 3BBCA 3H2VE 5DDQC 5IV3A 1R3NA 1NJZA 3HP6A 2FLNA 1JKHA 3QGHA 3W1YC 2ROEA 5IS2A 3V6DA 5AXNA 5J2QB 4F4XA 3TANA 4LF5F 4F4YA 2MEWA 4QPXA 3C19A 4OMFG 2VODA 4PG8A 3CCRS 4QPTA 5IZHA 3TZWA 5CA5A 2YKOA 1YRXA 3IS9A 1ZM3A 3W5ZA 1NHUA 2RRNA 1GEHA 4OZ2A 2R7RA 2L48A 4P72A 4DV5F 2LU2A 1J5OA 5HROA 4F3OA 3LP0B 4HT5A 1O8BA 2B43A 2D41A 1KLMA 1ZOTA 2RH3A 2OEMA 3EJMA 1WF2A 3M8PB 1LWXA 2I8EA 2F40A 2MQQA 2LU1A 1YG0A 4J9MA 5J1PA 3LP1A 2FJXA 3MOZA 3RRGA 3JQMA 1VQYA 2LQJA 2WVBA 4RW8B 2VJUA 5CABA 4KJIA 3M7VA 2HZCA 3DRSA 3PG9A 1RWMB 1U47A 4TLRA 2DGXA 4JI8F 4N8NA 2XMWA 3EZUA 3BGRB 4BC9A 5E2QA 4PRFA 3MMCA 3PYDA 3TUJC 8AT1B 3P5BP 1YRUA 1RWPB 2GVZA 3GFYA 2HBRB 3AX3A 2XSFA 3DMJA 3ZTSA 5F0WA 2AYEA 1NK5A 3P6YC 3T5JA 2UUBJ 4Y2KA 5KFGA 3HMJG 3V4IA 1RABB 2YWHA 4QR2A 3PJWA 4EZ6A 2FJWA 7AT1B 2CG8A 2WOMB 4I6YA 3QGIA 2E44A 4Y28C 3NNCA 4NI2A 3EICA 5D8HB 1KD1T 4X64J 1WNEA 2DR6A 5SUHA 2YNGA 4A8MP 4NLUA 2K1RB 3DCAA 1ZAWA 2XS7A 1HBMB 4USTA 1UKUA 3HT3A 1HNZJ 1GT8A 5KFEA 4X65F 3BKTA 3NRBA 3T19A 2ZHAA 3MR7A 1BGXT 2VL1A 4ZCLA 3PW0A 1WORA 2E7XA 4NA2A 5KFFA 3RBEA 4I2PA 3N6NA 2JL9A 2UZAA 1N6QA 4IOAQ 4QWBA 2DNNA 3J7YU 3CJQA 4HH0A 1KWMA 1HNXJ 3W65A 3OBIA 4ED8A 3CJ3A 2HWHA 1YHQS 3EWGA 2XNQA 2BR0A 4OZLA 3KLIA 4ZIVA 4CYUA 3OT9A 2M2BA 2BJ1A 3TVYA 1KEKA 4KE5A 4ZPDA 2V8DA 2VICA 3PCOB 2XZWA 4IRCA 3T1AA 3NBPA 2A6MA 4M1KA 2DGQA 1NDCA 4ZJQA 2CPJA 2BVZA 1WG5A 2E5GA 1QSLA 5J2PA 2OPQB 3IBWA 2P6SA 2CNLB 1NDKA 2Y0SD 2YWEA 4LRDA 2R8JA 4B02A 4HHHA 3G8QA 2FHJD 2C2EA 1LFWA 3BQ1A 3GFHA 3ILOA 2RIJA 2C28A 4USMA 3ZC4A 3MD3A 1VQSA 2HHSA 1S0OA 3FFIA 4PYDA 1WF0A 3OSPA 5DETA 3MR2A 4F67A 3W2VB 1TL3A 2XTEA 3C46A 3M8QB 2QN6B 3CDUA 2HMIA 1F0XA 3VZIA 5K8MA 2KJVA 2FHKA 2GGPA 2DR7A 4DSIA 5B0GA 4UUXA 1KHWA 4E98A 2E1CA 4TY8B 1HBOA 1Q8BA 1N32F 4WBFA 2IJNA 3BSNA 1T95A 2ILYA 2MY8A 4LF8J 1IKYA 2COLA 4ZP9A 1FXLA 4CO4A 4M5MA 1S1WB 3BO2A 1HHQA 3VV2B 1RT4B 1C4CA 3MHYA 5IT0A 3GG1A 2HHQA 3I5AA 1YBTA 1NH7A 1CJKA 5AT1B 2Z2MA 2DNLA 1I3OB 1LWFB 1EP4B 2DXEA 2XO6A 5JXSA 4FKYA 2CXEA 3HK2A 4DR1J 3N9UC 4I64A 2OPPA 2MXYA 2UVWA 2HEKA 4NXNF 2LFVA 1M5PC 4HDHA 1BE4A 3AY0A 2ZE2A 5KFNA 5DQGA 2UUAF 2OSRA 4GO5X 5C25B 3OFFA 1N8RT 3HFKA 2DCLA 1HQUA 3DLEA 3ULHA 3M6XA 3W5YA 2ZH8A 4IRDA 4F02A 1NXIA 2JVOA 1S1TB 1FX2A 4NMXA 4KC5A 4N56A 3GV7B 4LBIA 3BYPA 5J1NA 4DV0F 2HHPA 1FDBA 4ILMA 1U02A 4B3SJ 1WOPA 4GVLA 4WE1B 3N01A 4KB7A 3FKBA 1TL7B 3ZTRA 2AYBA 4WK1A 3HZGA 1Q86T 4X4SA 3GR0A 3LANA 2DBBA 4RW7A 4JV1A 1GTHA 4O3QA 3OR1B 2MKHA 2J9DE 4OZJA 3LAMA 1QAXA 4DX8H 4RJVA 4LF6J 4ZN1A 2ZITA 1W26A 4HACA 1GFWB 1CG2A 4FXVA 4O3SA 1H98A 2WBRA 4ID5A 2LKZA 4LSLA 4DR6F 4PZVA 1IBKJ 4AYBD 4DN0A 4HH1A 2VIHA 1I51B 3ILLA 2YKNA 1N4LA 5C2CA 1XBWA 4R25A 1T9UA 2UXDJ 2Y1RI 4GO7X 2PFDA 1UA1A 2KJWA 3AX5A 2ZJQQ 3Q8YA 4OLPA 4ZLJA 2Z56B 3J81Y 2JFDA 5BR8J 2G1DA 3QNWB 1JLEA 2D1CA 2QSFA 3H40A 2VHGA 1X9WA 3CCMS 5LXYA 3BGFA 2E5LF 5FJ4A 2YPZA 4OI0A 3AOAA 4ZHRB 5HJXA 3HPOA 1K47A 2BJ8A 1UVJA 3I56S 3DU5A 4RW6A 1XMQF 2YKMA 3R27A 3K59A 4RPFA 4DL2A 1FEEA 5A76A 3SCJE 2FY1A 1NZAA 4ITSA 1C1CB 1HARA 3OXFA 4WFBQ 2I38A 4BBYA 1KQKA 1PCAA 3M4XA 4FF2A 4QYZJ 3BPDA 4LT6A 1QSSA 2GJFA 3PHTA 2MHEA 1N33F 1RBOB 2CNNB 5B08A 4ZCMA 3K5PA 4BDPA 2K8GA 4C11A 4YP3A 3MCSA 5C42B 4C8MA 3D6MB 2DHAA 1Y10A 2WVFA 4B9UA 2MDAA 2XB2D 3NNHA 2Q1LA 1UPPA 1FVQA 1Q7LB 1X60A 2XZTB 5KT2A 4F50A 3IXQA 1VRTB 1TVRA 1RT6B 3PYEA 4U96A 2H65B 4YY3J 1X8DA 3MM9B 2FPHX 3CJRA 3H90A 5A8RB 1M0SA 2V4QA 1H72C 4D3GA 1ZM2A 2PMZD 5I3QA 2VF3A 3W8GA 1LV5A 3E8OA 1NPPA 2R7VA 1VK8A 3GJTB 2F5GA 3FUYA 3LPEA 4Y34A 1HKAA 3HVTB 1B0TA 1FJ7A 2VH7A 1U0HA 1NK9A 5E7OB 2CADA 2AEFA 3HHEA 5HLFB 3FMWA 2ZEJA 2EPIA 5DQIA 5JJBA 1VMBA 2HK3A 1P9QC 2QA2A 2ZZNA 2CDQA 5J2QA 5THWA 2R2UA 1HNWJ 5B7WA 3H4DA 4H54A 3OJSA 2YXLA 3M8YA 4L3NA 5K14B 3T5KA 1RA6A 3HLUA 1Y9OA 2VDIA 4LFBJ 1T0TV 2GZOA 2JX2A 3D66A 1U1QA 1KN6A 2AGOA 2BMBA 3PO4A 1U1RA 3LP0A 2HIYA 4DX6A 4LFAF 1H73A 4CCHA 4ECYA 4DHVA 4UZBA 3SCLE 4IYQA 4MTPA 4IG0B 1REVB 2NXCA 2W4DA 1K44A 3M8PA 3OVAA 4KHPJ 2FLLA 5FLXY 2IVYA 1S79A 3CJKB 4NRTA 4AL5A 1Q7YT 4NLQA 1FVSA 3DGPB 4IG3B 2NLWA
chains in the Genus database with same CATH topology
2RF2B 4CO5A 2UUCF 2H5EA 4EYHB 4NYOA 4RW8A 3M9OB 4YDXA 1I6JA 1VS3A 1S6PB 1QE1B 4WTYA 2AQ4A 4PWDA 1G3OA 1XTZA 1RGVA 2IA6A 2M52A 3OTDA 1LWCA 4QWEA 4NLVA 2IBKA 4F4ZA 4EZ9A 3SQGB 3KLFA 1W2IA 1U26A 2OPPB 1HNWF 4N76A 4Q44A 2W8LA 3M2VA 2VQEF 2ZHBA 2KXNB 3FRZA 2WRMA 3ETOA 1NJIT 3J7YI 2C22A 2WONA 3MXHP 5KFVA 1KC8T 3ZZUA 2D68A 3BGRA 4OJ3A 5IQQA 3PDNA 3DYAB 1N52B 3H5SA 4DR7F 1QUPA 4K4ZA 2W8KA 4B3OB 1JLBB 4QIVA 2MY7A 2QLXA 2IAJB 4ZCKA 4OQJA 2M5YA 4HVZA 1ZZNA 1FJEB 1BQNA 2YKAA 2JOQA 5KFDA 3JTPA 3FZBA 4J9QA 1URNA 5D4OA 2JHEA 3LGMA 4AXJA 4LFBF 1HQUB 2HHXA 1YWXA 2DGSA 1XR6A 2BBEA 4Q7AA 1YVFA 1FD2A 3HM9A 4ZDNA 5J1EB 3PX4A 3L7PA 2O5DA 1FD8A 1JLQB 3E01B 4O44A 2JDJA 2KRBA 4QJVA 3UCUP 3LP2B 1WACA 4Y00A 3TUZC 5IT9Y 3I6PA 2OPRA 2UP1A 2R2SA 1TAUA 2PA8D 4QW8A 4FS1A 3PR5B 1YJRA 3MEGA 2YWGA 3N4WA 3S6EA 4NCGB 3C6UA 5AXLA 1VIXA 3CB4A 5LMUF 2GQCA 1R8CA 3DN9A 2WOMA 4DL6A 4O3OA 4DS4A 1ZYQA 1FRIA 4F2SA 4K5RA 1KR4A 3ITHA 3T1HF 3SZ2A 3ZZPA 1MWYA 1HR0F 2OKQA 4HL9A 4NYZA 1UJ5A 1M5HA 2XSJB 2C42A 2KM8C 3X3UA 4KHPF 3MECB 2GC8A 3BO4A 4E0DA 4Q8FA 5KFKA 3GQCA 1R8HA 3VTIA 4RW7B 2Q6BA 4DQRA 3KWMA 1UW4A 2FHMA 2X51A 3K0JA 1MMNA 3QZ7A 1YQHA 2VB6A 3F41A 5KFXA 4YMEA 2K1RA 3BR8A 2IM3A 4K2XA 3L09A 1HBMA 4ZA1A 4O4GA 3IFEA 4AXIA 3FEXB 1N36F 1DRZA 2EFGA 5HP1B 1HMVB 1T05B 1LW0B 3QJLA 3PW4A 4MK8A 1VQ9S 4OHYA 2GCFA 2B6AB 4CIOA 4G3IA 3BGLA 1X5PA 2ZZMA 4OZ1A 2K7KA 1FHTA 2OIHA 3NS5A 4ID5B 1FNXH 2FC9A 3DXSX 4Y3CA 3QWUA 1X5SA 1KQSR 3H98A 2FDNA 1OSCA 2W9BB 2YKQA 4ALZA 4JV2A 1LWEB 4K4TA 5CYQA 4CO3A 1QM9A 3VAGA 3LPYA 1NJYA 2IA0A 5KFTA 2EW9A 2N3OA 4XIUA 2R8IA 4WF9Q 4KQZA 3R5DA 1U4BA 1T03B 1LOUA 2HRYA 4WFNQ 4DSFA 3NCPA 3RB0A 2JFKA 2J9EA 2BJEA 3DM2B 5K8OA 2E1AA 4KRWA 3IRWP 2PA3A 3FGVA 3KOAA 1SJ4P 3KK1B 4Y2AA 4HHJA 3BSOA 4KFBA 4RZRA 5DM7Q 5KFMA 2V0NA 4DR2F 3DOKA 4PG7A 2D3UA 2AD9A 1S4FA </