3OLBA

Poliovirus polymerase elongation complex with 2',3'-dideoxy-ctp
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymerase
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
total genus 138
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3olbA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3olbA02
1JLQB 3QGHA 2WK4A 3QO9B 4NCGA 4U7CA 3E01A 3Q8QB 2XC9A 2W9CB 4FBTA 2J6UA 5KG2A 3T5JA 2I5JA 4KFBB 1LWFB 3IS9B 3QLHA 4ZVGA 3BR9A 1J5OB 1C0UA 3CIZA 2XGQA 3ISNC 4ZPCA 4IG0B 4ZHRA 5L1KA 5L9XA 2BE2A 1RT5A 1ZTTA 4NRTA 2CJQA 3KNAA 1RT7A 5KFGA 4RW4B 4RW7B 3DOLA 1HPZB 3H40A 3EPGA 4JV2A 3I5CA 1JKHB 4MIBA 1C1CA 3MR2A 5KT2A 2B5JB 3OL6A 4ZPDA 5J2NA 5KFYA 2BANB 3V6DB 2HNDB 2R8JA 3Q8RB 3RB4A 3KK2A 2IM3A 5D3GB 2WONB 4NZ0A 3MEDB 4IDKB 3DI6B 3I5BA 5KFIA 2DPIA 3H5SA 3OHAA 1JLBA 2OPQA 2RF2A 4ZP8A 4XPCA 3KJVB 4NCGB 1W25A 1SV5A 1T03B 4EO8A 5KG6A 3GV8B 4WFYA 3GV7B 2OPSA 2CKWA 2D41A 4LSLA 2JLEA 2YNGA 5F8GA 4GC7A 4PQUB 1JLAA 1C0UB 2AX0A 4RNHA 3ISND 2C2DA 3KHHA 2B6AA 4RW9A 3RAXA 4QWCA 3DYAA 3NBPA 1N48A 1S9EB 3CJ2A 3DMJA 1QE1A 1RT5B 1RTHA 4K4VA 4WXWA 4IG3A 3GIMA 4EYHB 3PZPA 1LW0B 3RB3A 4MK7A 2YNFA 2FLLA 4ZPBA 2BRKA 4MK9A 5KG0A 1S1VB 5C5JA 3FRZA 1T05B 2W9BA 3MECB 4I2PA 3SFGA 4ZVEA 1RTIA 3QIPA 4RW8A 3KK2B 2JC0A 4NLOA 3LP2B 2AX1A 2AGPA 3KLIA 3KHRA 2FJVA 2B43A 1C1BA 2HNYA 1T94A 5L1LA 3M9OB 4MH8A 4TN2A 4TXSA 4NLDA 4LQ3A 1HQUA 5KT3A 1S1UA 3DLKB 3KLGB 3H4DA 4X2BA 4RNMA 4ZP7A 3EZUA 3QIDA 1NHUA 1DLOB 3G6YA 5KFSA 4NLTA 3GIJA 4O44B 1XR6A 4Y34A 1SUQA 1C2PA 2WOMA 3ICLA 4IRDA 5HP1B 3I5AA 4ED7A 4J9QA 5FDLB 2B6AB 4ECXA 4HYKA 4GC6A 1C0TA 4TLRA 5KFAA 1RT3A 3NBPB 4EBEA 3DOKA 3DMJB 3PVXA 3PR5B 1RT1A 4Q0BB 5K14B 5J2MB 1RA6A 4MKAA 2YNFB 4H4OB 1YVFA 3FQKA 4EBDA 4TYBA 3DRSA 1TKXB 2W9BB 2DPJA 4DL2A 4RW8B 1LW2A 4URQU 3N6NA 3TQ1A 5KG7A 1EETB 1K1QA 4F4XA 3V4IA 2R8GA 5J2QB 4XPEA 3PW2A 4K4UA 2W8LA 1IKWA 2W9CA 3QGIA 3OLAA 4ED2A 3RBEA 4KFBA 3PR4A 3OL7A 4TY9A 1LWFA 3IS9A 1VRTB 4O3NA 5C24B 5HBMB 1J5OA 2XGPA 4IKAA 1S6PA 2WOMB 3IN5A 2ASLA 2IBKA 3PW4A 3T1AA 5DLFA 3JSMA 1ZETA 4HKQA 4TYAA 2E9TA 2FVCA 4EEYA 5DG7A 1RTDA 1HMVB 2JEIA 5KFEA 1T3NA 1RT3B 2GIRA 4I7FA 4RW7A 4ED0A 4ECWA 1RDRA 3HVWA 1JKHA 5KT4A 3RAQA 3CJ4A 4F4YA 2VG7A 2B5JA 3TAMB 2BANA 3V6DA 4ECTA 2FVSA 3T5HA 5KFUA 1QAIA 4K50A 4WXOA 3KMSA 4KBIA 3C6TA 2V4QA 2ILYA 4IFYA 2E9RX 3QZ8A 2FLNA 3V4IB 3KJVA 2JEJA 3BQ0A 1JXLA 1T03A 1IKWB 4QWEA 3JYTB 3OSPA 2UVUA 1D1UA 2F8EX 1TP7A 2RKIB 5KFLA 2QE5A 2RDIA 2VG5B 1S97A 1JX4A 3CJ0A 4F4ZA 1JLGB 4PUOB 4PQUA 2WHOA 4I2QA 1GX6A 2UUTA 4O4GA 4EBCA 1S6PB 4K4WA 4WFZA 1S1TB 4Y2AA 2YNHA 3JSMB 3HHKA 4QW9A 1S9EA 2XI2A 4KV8B 2V9WA 1RTDB 3NAHA 1JLCB 3DRRA 2OH2A 3H2LA 1IKXB 1DTQB 1GX5A 1LW0A 4I7FB 3BSAA 4EYIB 3GV5B 1IM4A 3T5LA 1NNDA 1KLMB 3KLEB 2VG7B 4WZQA 3CVKA 3UPFA 2C2EA 1RT2B 1S1VA 4NLVA 2IM0A 1T05A 3MECA 3QZ7A 3BSCA 1N5YB 3DM2B 3H5UA 5KFZA 5J2PB 2AGOA 4WZMA 3LP2A 3C6TB 5J1EA 2WRMA 1RAJA 1BQMB 3FQLA 4IFYB 4R0EA 2EC0A 1MMLA 4RU9A 3KLGA 1Z4UA 3H5YA 3DLKA 4WE1B 1SH3A 5JXSA 4KO0B 3MF5A 4QW8A 3NGDA 4O3QA 4URGA 1DLOA 3IGNA 4Q43A 4LQ9A 3PW7A 2BR0A 1CSJA 1S1XB 3MEEB 4O44A 3BGRB 5KG4A 2VA3A 2ZD1A 1JLFB 5C25B 5HP1A 3V6JA 2GIQA 1TV6A 4I2QB 4O4GB 3VQSA 5FDLA 4KKOB 4M95A 4NYZA 2YNHB 4YR2A 5L1JA 4LSNB 2AU0A 2AWZA 1SH2A 3DRRB 3ITHB 5KFRA 2R2SA 4Q0BA 4YMEA 3T19A 5I3UA 5K14A 5J2MA 4ZP6A 2ASDA 4H4OA 3NKYA 3M9NB 5KT6A 4TQRA 4DL3A 1TKXA 4Q8FA 4MFBA 1EETA 3H5XA 5JUMA 4PWDA 5J1EB 1BQNA 3PHEA 4ECZA 5J2QA 4MKBA 3OSNA 2R2TA 1RYRA 3GQCA 4JV0A 3HKWA 2IJFA 2D7SA 3BSOA 5EWFA 1OS5A 4ED1A 3Q8PB 2RDJA 2QV6A 1ZTWA 2E9ZA 5KG3A 2BQ3A 3LAMA 4J9OA 2ATLA 4R8UB 1VRTA 4ZVHA 5C24A 5HBMA 4YP3A 4RNNA 4FS1A 2C28A 2UVVA 2ZD1B 2VG6A 3SFUA 1TV6B 2HNZB 5I42A 2OPPB 1MU2A 1RT6B 1TL1B 1HMVA 1EP4B 2GC8A 4ZP9A 1S6QA 1JIHA 4H54A 4O3RA 1S48A 3FDSA 3IG1B 4IH7A 3D28A 4ZVFA 1KHWA 2V4RA 3TAMA 5I3UB 3KLHB 2HMIB 2YKMA 4IQXA 5HROB 2HWIA 4RW6A 2IM1A 4RZRA 2W8KA 4F50A 4ECYA 5KT7A 2IC3B 4NLSA 4ED3A 1N4LA 1JLEA 5CYQA 3MFIA 2XI3A 2ASJA 4MFBB 2JEFA 4PWDB 3KOAA 4J9RA 1BQNB 4TY8B 4RUCA 3M9MB 1XR5A 1U09A 3KK3B 4K4XA 3JYTA 3OLBA 1HYSA 2RKIA 3MEGA 3QGGA 2VG5A 3DRPB 2V0NA 3Q8SB 1JLGA 4PUOA 3C6UB 4KB7A 4G1QB 4ZPAA 5KFFA 2C2RA 4OL8A 1S1TA 3IRXB 4O4RA 2VG6B 5I42B 2YNIB 4KSEB 4KV8A 1MU2B 1JLCA 3I0RA 1TKTA 4K4ZA 3CDEA 1S6QB 1IKXA 1DTQA 5F9NA 3LP0B 4IRCA 3M8QA 3QYYA 1K1SA 4O3PA 3GILA 1TKZB 3I0SA 1KLMA 3LAKA 3KLEA 3LP1A 4YR3A 1R0AB 4O3SA 3CDUA 2YKMB 1RT2A 2WB4A 1KHVA 5F8HA 4ICLB 4IOBA 4RW6B 1IKYB 3CWJA 3DLGB 3DM2A 4IFVB 1N5YA 2BRLA 5J2PA 3LANA 1N56A 4Y3CA 4URSA 5KFPA 1JLEB 3FFIA 5CYQB 1BQMA 4IH6A 4IR9A 4WE1A 4KO0A 5KG5A 4F4WA 5EWEA 3BJYA 5DGAA 3MR6A 3RB6A 2HAIA 2R2RA 3HVTA 1HNIB 1S1XA 4K4TA 3MEGB 3BGRA 3MEEA 4KHMA 5C25A 1JLFA 3MR5A 3FSIA 4IH5A 3BQ1A 1REVB 1S0NA 2UVWA 2OPRA 4ID5B 4J9PA 3V6HA 4KKOA 4YQWA 4B3OB 1HQEB 4M94A 4MK8A 4G3IA 1DTTB 2O5DA 4LSNA 3KLFB 5L1IA 1N6QB 4Q44A 4J9LA 3ITHA 3I0RB 1TKTB 1S1WB 2XCPA 1UWBB 4R5PA 3M8QB 2W7PA 1FK9A 5EUHA 3BQ2A 3IGVA 1QAJA 3I0SB 3H98A 3LP1B 4XO0A 3G6VA 2XCAA 2FVPA 5KFQA 1D0EA 2FVRA 1I6JA 2YKNB 2IA6A 5KFNA 3FFIB 4YR0A 4NLXA 5F8IA 1S9GB 1RTJB 3PJWA 4H4MB 1VRUA 4DL5A 1LWEA 5HLFB 1LWCB 3KK1A 4ED6A 2ALZA 3V81A 2HWHA 4K4SA 1FKPB 4R8UA 5KFKA 4FBUA 3HVTB 2JEGA 3LALA 5EDWA 3PW5A 1QUVA 4JUZA 5EWGA 2HNZA 2OPRB 2OPPA 2FJWA 2BQRA 1TL1A 1RT6A 5DGBA 4IR1A 1EP4A 4J9NA 4FS2A 4Q8EA 4QWDA 1S4FA 3IG1A 3BREA 3PJXA 1TVRB 2J6SA 3NMAA 4NLPA 1HNVB 4RNFA 4ECSA 1RT4B 3KLHA 4R5PB 3E51A 1FK9B 2HMIA 4IRKA 5HROA 3UQSA 4DEZA 3CDWA 4KE5A 3SI8A 2BQUA 2R8KA 1NHVA 3CO9A 3GIKA 3E01B 5KFMA 1TQLA 2IC3A 2FVQA 4NLQA 3V6KA 4J9MA 3BSNA 5F8NA 2XWYA 2I5JB 5F9LA 3NAIA 2AQ4A 2FLPA 5KFVA 3QLHB 4K4YA 4KAIA 4TY8A 2UUWA 4WYLA 4DL6A 2VA2A 2IM2A 2WTFA 3KK3A 1IKVA 1VRUB 1LWEB 3D5MA 4KHRA 3RBDA 4ZHRB 3DRPA 3M8PA 3KK1B 3V81B 2BE2B 2AGQA 3C6UA 5CYMA 1RT7B 2IAJA 4G1QA 3DOLB 4EO6A 4RUAA 2R8IA 4JV1A 1C1CB 3IRXA 2YNIA 3G86A 5J2NB 3H4BA 5F8JA 4QWAA 5C42A 2D3UA 3LP0A 3KHGA 1WNEA 1TKZA 2ZE2A 1R0AA 3RB0A 2IMWP 4NLRA 5KT5A 3OL9A 4ICLA 4O3OA 1JLBB 1IKYA 2OPQB 2RF2B 1S49A 3DLGA 4IFVA 5DQGA 2W9AA 3OHBA 1SV5B 1S0MA 5T14A 4U6PA 3GYNA 1TL3A 5KFOA 2OPSB 1HARA 4QPXA 4DG1A 4NLWA 2R8HA 4LSLB 2D3ZA 4RNOA 4NLGA 3G6XA 5F8MA 2YNGB 4ECVA 2JC1A 4MIAA 1FKOA 1JLAB 4ED8A 5DQIA 1IKVB 4ZMMA 4RW9B 3GIIA 1HNIA 3DYAB 5DG9A 5KFXA 1SH0A 3N6MA 3M8PB 2FJXA 1QE1B 1RTHB 4WFXA 1REVA 4IG3B 5CYMB 2IAJB 4ID5A 3TVKA 3PW0A 4QWBA 4TQSA 3MFHA 4B3OA 5DQHA 1HQEA 2IJNA 2UVRA 3CJ5A 3EPIA 1DTTA 5DLGA 3KLFA 4ECRA 3KMQA 5DG8A 5F8LA 3KHLA 5KFWA 1S0OA 1N6QA 1S1WA 4I2PB 3UR0A 1UWBA 5C42B 3KLVA 2ZKUA 3DLEA 5KFTA 1RTIB 3QIPB 3MR3A 2WCXA 4DL4A 3KLIB 2ZE2B 4Q45A 1C1BB 1JLQA 2HNYB 3QO9A 2I1RA 5KFJA 1HQUB 1S1UB 4WYWA 5KG1A 3T5KA 2YKNA 4NRUA 2ILZA 1S9FA 1TL3B 2R2UA 3CJ3A 4DG1B 1S9GA 5KFDA 1RTJA 4H4MA 1SUQB 3HVAA 5HLFA 2J6TA 4Y2CA 1FKOB 4IG0A 1LWCA 1XR7A 1RA7A 3DDKA 3OL8A 1FKPA 1C0TB 3MTKA 5KFBA 3N6LA 4ECUA 4RW4A 3DOKB 1HPZA 3NL0A 4NLUA 3H59A 1RT1B 1HYSB 1RYSA 5KFCA 4DL7A 3UDLA 2HNDA 4J9SA 2C22A 2W7OA 1S10A 5D3GA 3DRSB 1TVRA 2WONA 1HNVA 3MEDA 3DI6A 4IDKA 1RT4A 3DLEB 4J9KA 5KFHA 1LW2B 4ECQA 4NLYA
chains in the Genus database with same CATH superfamily
1HR0J 1VISA 1H3DA 3OQ2A 3T5JA 2I8EA 2F4VJ 4O23A 4QIFA 3R7NB 2EFPA 4K5SA 2ZWOA 3MR2A 3ISZA 3OL6A 1OPZA 2K3IA 4BS2A 2KU7A 1T3OA 4GO5X 3IXQA 2BEFA 1JB0C 2I6WA 3GIRA 2OPQA 1YG0A 2PFDA 3W63A 1LEOA 3LPYA 3CCQS 3EVOA 1SQFA 4RNHA 1HHQA 1SKSA 4A8XA 2WBRA 3RAXA 1HNXF 5LMUJ 5HJXA 3HXMA 4I68A 4RX6A 2BJ7A 4FN5A 4TXSA 2Y8YA 1XBWA 4XAKA 1BE4A 2LU1A 2Y0BB 3FNNA 1K0TA 4Y34A 2VPWB 2OTLS 3W5ZA 5E2QA 3I32A 3UN5A 3ZZPA 1J5EF 1S6UA 1RWXB 1S57A 4MKAA 1BD6A 3C16B 1XERA 2ZBCA 4G6VB 2WSEC 5KG7A 4F4XA 5J2QB 4XPEA 3BDPA 1SB6A 4DFKA 4HKQA 1SQEA 4BLGA 3E3XA 1U45A 1RT3B 2GIRA 1JKHA 3CJ4A 4RKUC 2Y9HA 4QQBA 1NK7A 1RWVB 3HM9A 2FHJA 4LF4J 1NH7A 3CC4S 3UD3P 1S97A 1D9AA 3JS9A 1UW9A 2FB0A 4DI6A 4V19J 4KV8B 2DXFA 1XWLA 3DRRA 4YHHJ 1UPMB 3OW2R 2K8GA 3OUYA 4NLVA 4PXCA 2ZZNA 4WIQA 4OI2A 4ZCLA 3V4MA 3BPDA 1CSJA 1UFWA 1MMNA 4C7QA 4LBHA 4YR2A 4K0KF 3TA1A 3K8VA 3D6HB 2A3JA 3O5TB 1MWQA 1CJUB 3D0GE 2ZH1A 5AXKA 4O0NA 4YUDA 1FD2A 4CLPA 3QMQA 3PHEA 5IWAJ 4MKBA 2NQPA 2IJFA 3CCJS 2V63A 5KG3A 2BQ3A 2HS4A 3ZTSA 2V34A 1OO0B 1AZSB 1X4BA 3ZFVA 2J0XA 2CQDA 4DS4A 3Q8YA 2DXEA 1S48A 4DQPA 2OGUA 5I3UB 3W61A 3OTOF 4UUWA 4ECYA 1XN9A 4HTJA 1VYAA 1NKEA 1U09A 4IOAQ 2XS2A 2E5LF 3C6UB 1URNA 3G4SS 2JRSA 4QJVA 3W5XA 1FCAA 4K4ZA 3LP0B 1GXTA 1GMUA 5LL6d 1NZ8A 1U2CA 2JJ4D 4KH1B 4CH1A 4YB5A 4DV0J 5E33A 4B3TJ 3MR5A 3TRGA 4CO0A 2V1SA 4NMXA 3WBZA 1N6QB 2OIHA 4R5PA 3IGVA 3HT3A 2IYIA 4OHVA 2XCAA 4OX9J 1UVIA 2IA6A 1N34J 5BR8J 2IA0A 2UXBF 1VRUA 2Q66A 2DGSA 5M2PA 4E98A 3D9BA 5CZXA 3DOMB 1PJ5A 3HD1A 4IQMA 1CJKA 4FP9A 1TVRB 2KH9A 3ILLA 4P2XA 3V6KA 3GB0A 1S77D 3EM1A 2AQ4A 2OHDA 2YBVA 2VA2A 2KHDA 3CD7A 3N4WA 3OFFA 3TYTA 2VPYB 1SJFA 3TX0A 3D1QA 4BC7A 2OP5A 2KFNA 2BJEA 3PO5A 4JV5F 2ZE2A 2AJ4A 2XHCA 5KT5A 3ZZOA 1Q5YA 4P71A 2AJQA 2PI5A 2PA8D 3MUMP 3PDNA 3TNVA 2XLKA 3CCZA 5AXNA 3I56S 3MM5B 2Y0SD 3WDOA 3MM8A 3QIPB 2CQPA 1C1BB 3DKDA 4R0JA 3UR3C 2ILZA 1RTJA 3A1YG 4I1TA 3POTB 1LWCA 4OJHA 3DDKA 1TUGB 2FHOB 3AODA 1BWVA 2H5EA 2N4CA 4NI2A 2DNNA 1U47A 3BN4A 4OLOA 3DLEB 4CH7A 1LW2B 3QGHA 3KG4A 1G2EA 4U7CA 4F26A 1DQ9A 2I5JA 4KFBB 4QIGA 5B08A 2W2QP 3CIZA 2V5HG 1WELA 1ZZNA 1R27B 2MKYA 1K73T 4IDKB 3MZIA 4H4KA 3TA0A 3TVZA 1VI7A 1NJYA 4FXWA 2BKOA 1QE1A 3NOGA 4I4BA 3MCMA 1Q8IA 2RRBA 4L72B 2EFQA 4ZVEA 2JC0A 4NLOA 1M1GA 1RTZA 5LXRA 4WP8A 5KT3A 1XNQF 4CM0A 1C4AA 2DYAA 3M32A 2F4FA 5HN0A 3EE3A 3CMES 1IBMF 2LQBA 1QSSA 1HWUA 3W9IA 3PR5B 2PGCA 2YNFB 3KWMA 1PYSB 1LK5A 4ED5A 1KN6A 5LMNF 4FYXB 4RW8B 2ZOGA 5DS7A 3BEGB 4F3QA 3PW2A 1IKWA 1N8RT 3RBEA 2CJYB 3OL7A 3WC0A 3CC7S 2E9TA 2RD5C 1RTDA 1VFJA 2PMHA 4CH0S 4OYWA 1X8DA 2GO9A 3V6DA 1QTMA 4KBIA 2V4QA 1VQ5S 4W92B 5ETKA 5IC6B 3JYTB 2UVUA 5KFLA 3P4UB 1SL1A 4PUOB 3TUPA 3H2LA 2HQCA 2PIIA 3CJKB 1N5YB 2FUG9 3DDIA 4WZMA 1U0HA 3NP5A 4RU9A 3NGDA 4O3QA 2BR0A 4DPOA 2A0FB 3BGRB 4DR2F 2DHGA 5THWA 4CCHA 4DR1J 2G0CA 5CA5A 3CCES 1SJ3P 4F4KA 3GQCA 5C2CA 1FJCA 1XK8A 1RWUA 1P27B 4OX6A 4HI1A 4X66J 1HA1A 4RW6A 1KEKA 2ACYA 2GX8A 2VF3A 2MQMA 1GNKA 1BQNB 1TTHB 3KK3B 5HVHA 3WQPA 1JLGA 1JJ4A 2NLWA 4DZ6A 1OSDA 2C2RA 1SC3B 7AT1B 5E3QA 2FZGB 4OQJA 3CEDA 1FT8A 3IRWP 4O3SA 1SJQA 2MZQA 4LSZB 6FD1A 2EFGA 5ETRA 1JLEB 1U0SA 3G71S 2ADBA 1UEKA 2FTRA 4A8FA 4XK8C 5EWEA 4CO5A 4DJBA 4AQYJ 1Q1KA 4OYIA 2W7AA 5IT4A 2P9CA 4NPOA 2ZH4A 3A13A 3WX8A 5I3QA 3TA2A 3BN7A 3M8QB 1HI0P 3W60A 3G6VA 1F5AA 4FZVA 2HQGA 1WC5A 2YKNB 3KNGA 2CJ9A 2P8IA 2ZUGA 5F8IA 3PJWA 3SCKE 1FTRA 3A12A 4ED6A 5L38A 4LRAA 2YX4A 3JQJA 1YWXA 4DWIA 1FDBA 1WF1A 2VHGA 1WUUA 4WKRA 2BJ8A 2UUCJ 2P6TA 2YWKA 3CW2C 4NXNF 3THTA 2BE7D 1HR0F 4ID8A 4DFJA 2UUWA 1DQ8A 1N5QA 4NMLA 2F4VF 2J7KA 4ZVQB 2XMTA 1LFPA 3J7Z5 5J2NB 3OXGA 3GZ7A 1RADB 3GFHA 3LGHA 3OL9A 5GMEA 2RS8A 2OKQA 1Y9OA 2W2OP 5MAOA 4ECVA 3MWBA 2YKAA 5B09A 3PW0A 1HQEA 3FCVA 5LMUF 4PWUA 2JDJA 3O1LA 5F8LA 1AFIA 3QT6A 4I2PB 4KIAA 4QU6A 3TVYA 1FXDA 3KLIB 3B8HA 2CNOB 2L48A 4M5KA 3Q24A 1H7WA 5KFDA 2PEBA 3HVAA 3AD9C 3MTKA 5DRKA 4ECUA 4NLUA 7FD1A 3M8SA 5KFCA 4KQZA 2C3OA 1N32J 2O01C 3JQKA 3QSIA 4M5DB 2RQ4A 4FXDA 2QLXA 3SIPB 3T1YF 4Q2MA 1OQ6A 1FNXH 3MMBB 5E3RA 3ONQA 4IG0B 3AX3A 2CJQA 4JI5J 1RT7A 2VDHA 3MUVP 3GPAA 3HFZB 4NZ0A 1FE4A 3VAIA 1R6YA 3TAPA 2V4JA 3PV8A 4LF4F 4LF6J 3M7VA 1JLAA 1FNOA 4PR6A 2XZ2A 4BBYA 4ILMA 4IG3A 2KYXA 4MK7A 4YHHF 3JB9k 5E3PA 2OD4A 5C5JA 4N77A 3EYZA 4YB7A 2LXIA 1BUXA 2M5YA 3PYFA 4F8RA 3QT7A 3M1VB 4M1KA 4NZ6A 1C2PA 1YJNS 2B6AB 4HYKA 4EBEA 5DZ6A 2ZC3A 5B0BA 4C2MA 3SYZA 2CPZA 5CXTA 3UN3A 3TQ1A 3VF0B 1PCAA 3QPIA 1TL7A 2UV8A 2DO4A 3A8JA 5IWAF 4LJMA 4ED2A 3QQCD 3ENAA 4HVZA 3LO3A 4O3NA 1IBKF 2JEIA 3RAQA 1Q53A 4OJ1A 3OR2B 4PEOA 2FVSA 3C6TA 4N76A 2E9RX 5B0DA 2DNRA 3U1NA 1T03A 2V8VA 2HLTA 3OT9A 1TP7A 4X84A 2DNOA 2ZJPQ 1GX6A 3OTEA 3DHXA 1GAOA 3OV7A 1S9EA 1TMJA 4AE5A 4KPCA 3BSAA 4DUZJ 2V68A 1SJ4P 2C2EA 1VC0A 2VD3A 5T7LA 1VBXA 1T11A 3LP2A 2A10A 1U1PA 5G0RB 1QSLA 4Q43A 4I6YA 3OFHA 1J2VA 1DRZA 2O3DA 2VQEF 4WFBQ 4DV0F 3UDCA 2QZ8A 4B3TF 1QLNA 2E7VA 1GK8A 3P5TL 2M8DB 3ITHB 3UCZP 4E2FB 4AL5A 4N5SA 5CAAA 3NKYA 1W2IA 1FERA 4K8RA 2HFSA 2HHWA 2UUAJ 5J1EB 3GMGA 2Q6CA 3MCNA 4OX9F 2R2TA 1H74A 3J7AN 3BSOA 5EWFA 4ED1A 1N34F 5BR8F 1VDHA 3LTOA 2DIVA 3DU6A 5HBMA 5H1SV 2UVVA 1MN7A 8RUCA 2QC3A 1T9UA 3UNGC 4NL5A 4JYAJ 1JIHA 4LREA 3LF0A 4P9SA 3TZYA 3KLHB 5ETLA 2XMKA 3A8KA 4RZRA 1QD1A 3FEZA 2HQIA 3I31A 3K8WA 3TO8A 4ED3A 3MFIA 2AEJA 4M63A 2C2MB 1WEZA 2V8GA 2KZMA 2MZ1A 1SJ1A 3QT8A 4LF5J 4LT6A 1K44A 5KFFA 1N5SA 2FLOA 2XMAA 2PT0A 1IQZA 1DTQA 1S6QB 1KLMA 3BKTA 2P6SA 4IFVB 3DM2A 2B9YA 3LANA 5BYQA 2RHSB 2HRYA 4KO0A 3A3PB 5B0EA 3D1OA 1REVB 2FYXA 3V6HA 4WBFA 4LSNA 2JFDA 4ATNA 3MPDA 5EN1A 4C8MA 1CJVB 2FVPA 1IBLJ 1JXEA 1DY3A 3OR1A 2CAJA 4L3KA 1WD6A 3IBCB 3SQGB 1RT6A 5DGBA 4IR1A 4OHYA 2KT2A 3NMAA 2LEPA 4K2XA 2HBZB 2BOAA 2DR5A 3K5OA 5KFMA 3T9NA 3BSNA 4HHUA 3R7SB 4WYLA 4PCQA 1O8BA 2V2VA 2BE2B 2W01A 3HZGA 3G86A 3LH2S 2DHSA 2XMMA 2DHXA 3CE8A 4A8YA 2G2YA 2CQ0A 1YJ7A 2CJBA 3CT9A 4U6PA 2WBMA 1LNQA 2KHCA 2K1RA 3TEGA 2FJXA 1C4CA 1JWWA 1NB7A 3BH6B 1Q4RA 5DG8A 1S1WA 4TLQA 3SDEB 2G1HA 2IDLA 3L7PA 3OXLA 3AD8C 2RJZA 4WPAA 1WOOA 2GVZB 4CLZA 4V19X 1FJEB 2H65B 2LCWA 1HWKA 4J9SA 3HDSA 4C0HA 2DR8A 3VR1A 4J7CA 3Q8QB 2J6UA 3AOAA 4CLLA 1SQGA 4A8SA 4OZ1A 4JI0J 2GFFA 2XGQA 2XTJP 4RWXA 4RW4B 4UY85 5KFYA 2QL7B 3QRRA 1CJTB 5L8RC 1RAFB 3MMJA 3RR8A 3D7SB 1S99A 4WFYA 2L9NA 3B78A 4LSLA 2KFYA 4DV1J 4KPYA 3G82A 5EX3A 2HEKA 1KTQA 1IJEB 4WXWA 3SSRA 1HL6A 3AXKA 3PIOQ 2DHHA 3MCOA 4NCBA 3PFEA 1SL2A 4WTOB 5D78A 3NNHA 1BXNA 4NLDA 2VFSA 3KLGB 4RNMA 4LBIA 2HZVA 2RNEA 3R8YA 3BKFA 4LR9A 2DD8S 4N8NA 4TLRA 1RT3A 4DR1F 4F7VA 2AYBA 3HJVA 3AX2A 3A8IA 1VQNS 1B0VA 4GVBA 2ZM6F 1RK8A 1P6TA 4PKDB 3E2EA 3CCSS 2QMUB 1R8HA 3D6MB 1HD0A 5LSOA 3CCRS 5KT4A 4UZBA 2M8HA 4X66F 3AJ2A 1H38A 1NB2A 5KFUA 1SIWB 5GAGI 3NGTA 3QZ8A 3TUJC 3RR7A 2DGUA 1RKIA 2QE5A 1SKRA 2NUUG 3CJ0A 5I4MA 3W5YA 2UUTA 2HRTA 1AYEA 4Y2AA 1RCOB 4CTAA 2DRAA 2HZCA 2VG7B 4WZQA 1CJUA 1AB8A 5C2GA 5HQ8A 4PYDA 4DV4J 1E6VB 1RAJA 1ICEB 2MZJA 4URGA 4DU7A 3IAM9 2VA3A 2BM1A 3KDNA 4AQYF 2MEWA 1HWIA 2A1BA 1SVDA 2V8PA 2DRDA 3DN9A 3RBXA 2OLWA 4DX6A 4MAKA 5I3UA 1G1XA 1TL4A 3M9NB 4J90A 1VRQC 3I4PA 4D3HA 1L3UA 4JV0A 3ZNJ1 3THVA 1EQMA 2FY1A 2GVDB 1VC5A 4RNNA 1UFKA 4A4JA 4M5GA 3SFUA 1FVQA 1TV6B 2OPPB 3DFEA 2GJ2A 3TAMA 2HMIB 2UUCF 3C14B 2M2BA 4DSFA 1RAAB 1N5TA 2RRAA 4QYZK 5F3ZA 2MGZA 3EGWB 2XI3A 4MFBB 4RUCA 1XR5A 4KT0C 2BBEA 1FRJA 3HFKA 5A6PA 1T02A 4KHPJ 2FHMA 1WTFA 3LAKA 2E1RA 4RUBA 1R0AB 2BRLA 2V6AA 5KFPA 2VU5A 4A46A 4JI4J 3MR6A 3K17A 2ASYA 1NO8A 3HKZD 1SJRA 4PG6A 4DBQA 5C25A 3UE2A 4ZK7M 4WK1A 2CZ4A 4YQWA 3EDQB 3I0SB 3LP1B 2NPFA 2EWHA 2DHAA 2HFZA 2QN6B 2CDQA 5KFNA 3FFIB 4X62F 3U27A 1NDLA 5EHHA 1WI8A 2IPOB 1N33J 2HBQB 3D0IE 4JI3J 2HGMA 1N32F 5HROA 1PJ6A 4IOCQ 5DZ7A 1XEZA 1YZ6A 3IM9A 3KYLA 2RT3A 4J9MA 1O6XA 3HCXA 2GW8A 3H25A 2MKCA 4ZJQA 3GFYA 2F8MA 4IUFA 2XLJA 3MM5A 3CPWR 5D0EA 1EAYC 1X4DA 2J7WA 3KXDA 2OPQB 3GYNA 4Z2XA 5E0OA 3LA0A 2D3ZA 2C2OB 4LF6F 3POTA 1LXNA 2BX6A 1IKVB 2UUBJ 2PMZD 3U02A 3RZAA 3D0HE 5CYMB 4P10A 4KGVB 2IHR1 4FNHA 2RILA 2AYGA 2UVRA 4PRFA 5JMNA 3UR0A 1UWBA 3DLEA 3HZEA 2WCXA 2XMWA 1YRXA 1P9YA 2AHOB 1TL5A 2E5HA 4F4AA 3FMBA 4ZKAA 4H4MA 3F56A 1R3NA 3ILIA 1FKPA 3ZXWA 1F1BB 5KFBA 3FEXB 1I94J 4OHWA 2KFZA 3AJDA 2UXCF 3R2DJ 2H4WB 2MKKA 1FRXA 1HNVA 4IDKA 2J8SA 5KG2A 3M8WA 3VV2B 1B99A 2CUYA 4DLEA 5GAGU 3W1YC 1PSDA 4ZPCA 3H40A 1JKHB 9ATCB 3MOZA 2HZAA 4QR2A 5D3GB 4M5IA 1UVKA 5KFIA 3Q86A 2DY1A 2WVEA 4E8UA 3MI7X 3NWRA 3TJ9A 2AX0A 2WAQD 2QYCA 4U8VA 4Z7YA 1U02A 3AA8A 4C8OA 2YNFA 4DUZF 2KTQA 2LKZA 3OUYB 3F73A 3FRZA 3SFGA 4RW8A 3KK2B 3KHRA 4YY3F 2GA7A 4UOFA 2F8HA 1FE0A 2HSEB 4HH0A 1YJ9S 2CPIA 1G4CA 3GIJA 1XR6A 3TX8A 3BPSP 3D54A 3DOKA 3KJNB 3WIUA 3M8RA 2EXUA 1S12A 3GFZA 2BW7A 4TYBA 1TK0A 1N0UA 2UUAF 4CNYA 4DQSA 5M2RA 1RB0A 3GG0A 1X4HA 3PCOB 4DV6J 1H2TZ 2QJ3A 3MPYA 4ANDA 1VQKS 1U7LA 2FVCA 1Y00A 4U8YA 2K7KA 1CEZA 5BJRA 3CJKA 4ECTA 4L6V3 4EI2A 1TAUA 4HHHA 1YJRA 2ZBQA 3BQ0A 4J9UE 1FESA 1VK8A 4E0DA 4U9RA 3EZOA 4K4WA 1LQ9A 3X3UA 2AV5A 5D6GA 1WOSA 1MW7A 1VJWA 3H5UA 3AOBA 2F5GA 1TZ0A 3NY0A 1SH3A 3DLLQ 3W2WB 1DLOA 3PW7A 3PX0A 3OXFA 4EU0A 3CGIA 4QPTA 2IJRA 4NYZA 4ZDNA 2AWZA 4USVA 1KQGB 2CDRB 2C3YA 2E29A 4M5JA 2VFTA 3I6PA 5F41A 1WKJA 1QY7A 3QFHA 1NSQA 1BQNA 1RYRA 4OYXA 2ZDOA 1IBLF 2D7SA 2M52A 5D0GA 1YBAA 5F3TA 2ATLA 1HBNB 1VBKA 3SMZA 4O3RA 1CJKB 4A8WA 3ULHA 2V4RA 2N3LA 1Y3KA 1JMTA 4B3MJ 1JLEA 3DLHA 2E7XA 4K5RA 1KVIA 1X4EA 4I56A 4K4XA 4WF9Q 5AE3A 4DV3J 4N7TA 4LF9J 4KH0B 1Q5VA 4UOGA 1WC6A 3M8QA 1GTHA 4TU7A 3IP0A 3W8GA 1QTNB 3EGZA 1KHVA 3BBBA 5B7WA 3L4BC 2YPYA 5LSLA 4IR9A 5KG5A 4LF8J 4DR5J 3TZXA 2UZAA 1UKUA 3MEKA 1VQLS 2XCPA 2ZVIA 4DSJA 3D6FB 4H4KC 4PYAA 2VKZG 2D3OR 1VQ6S 2CPXA 3S01A 4YDDB 2Y3YA 4I64A 4PPZA 4NE9C 4YR0A 1RTJB 3NOCA 4ANEA 3EVWA 1HBOB 1LWCB 1BGXT 2MZSA 4R8UA 5KFKA 1Q82T 2J7UA 4JUZA 5IQ6A 4OFZA 1RWOB 3PTWA 1YIJS 3QRQA 4C6AA 4ES2A 4LIWA 1ZH5A 3L95X 3W2VB 2I5JB 1O0PA 2MZRA 3TZWA 4QOTA 1RLCL 2RMLA 4KHRA 1RAIB 3EUNA 4JI0F 3W62A 4G1QA 3MAQA 4EO6A 1K9MT 1D8ZA 1Y5NB 5JVGQ 5DETA 2KG0A 1V3ZA 1SL0A 2Z4PA 2XG8A 2B9XA 2QT7A 4OYBA 4DV1F 4LFCF 1HNIA 1SH0A 1QE1B 2ROEA 3TVKA 4B3OA 2IJNA 4DOZA 4ECRA 4C48A 4X4UA 3KLVA 4A8QA 4M5DA 2KYZA 5B0AA 2MQQA 3WC2A 2I1RA 2RE1A 3FSXA 2QMXA 2V50A 1T0TV 1U1MA 3MMBA 2Y1RI 4ZVSB 3M32B 4IG0A 1RA7A 2HIQA 1L5UA 4UTGA 4L3NA 3NGRA 5L46A 2C22A 1Q78A 1RT4A 5KFHA 3EX7B 4NLYA 4U7UK 4BC9A 2HHVA 4CO4A 2V8HA 3J81Y 3BR9A 5EX0A 1H98A 3EPGA 1KWMA 2IIHA 1UFLA 2EEYA 4G65A 3V6DB 1UEVA 4LRDA 1HBMB 2G13A 2DPIA 1Q8BA 3K58A 1U6FA 3GV8B 3BBFA 2WVDA 2OPSA 1TFYA 2CKWA 3N79A 2CIMA 3BBCA 3RUBL 2VONA 2B6AA 3CMAS 5EGYA 5A0YA 5E41A 3UFCX 1SC6A 2J76E 1U0HB 2VOPA 1R0CB 1S1UA 4CP5A 4ZP7A 3JXOA 2Q79A 4ZIWA 5CHCB 4IRDA 4J9QA 3NBPB 3AJ1A 3PVXA 2XY7A 3NLCA 1X0PA 4RBUA 4TNOA 4MKYA 2QLBB 1DHMA 3VGTA 1Z2LA 2DEJA 4URQU 5ETPA 4EMDA 2CYYA 2E5IA 3P8BB 2W8LA 4FF2A 1TK5A 1TU0B 4BCAA 1J5OA 1NM2A 2MSTA 4ETXA 3N0VA 1VS3A 2BE9B 4RW7A 4PXBA 3G8QA 4OZ2A 2BANA 4ELVA 4K50A 1GEHA 2BW2A 1CQMA 1F6TA 4NA1A 3BH7B 2RDIA 1JX4A 1JLGB 3FUYA 1S6PB 3I9V9 3JSMB 1VGYA 4NASA 1U49A 2YKQA 3VVTA 3GV5B 2J8AA 4B08A 1D9FA 2VZ9A 1NUEA 3MECA 3QZ7A 4WP9A 3OVSA 4PG4A 5J1EA 2DVIA 2DH7A 2EC0A 2HQ3A 3D4JA 4OHXA 4F2SA 1F60B 3OVAA 2K06A 1A9NB 1VBZA 4JI4F 4LQ9A 1NJIT 2X1BA 4P52A 2WSCC 2YNHB 5KAKA 3OTOJ 2AU0A 2YQ1A 4YEAA 2D69A 2ZITA 5D15A 1XNRJ 1EETA 2M70A 2X1AA 3Q8PB 1MLAA 1NEEA 3R5GA 4DR3J 3V5RA 5C24A 4HLBA 3C66A 1KNZA 2GC8A 1N33F 2IVFB 1PBUA 1S6QA 2MLZA 3D28A 4JI3F 4FF3A 2CQIA 3FGVA 4CZCA 5KT7A 4WIIA 1N4LA 2FGOA 4J9RA 4ALZA 2LXFA 5E7OB 3LGMA 1VK3A 1HW9A 4O4RA 3CTRA 3JSBA 1XMQJ 1ZA2B 1WSVA 1JLCA 4LIRA 1DFDA 3TAQA 5RUBA 4OLPA 4O3PA 1B64A 2B51A 1CJVA 1F9EB 4J37A 3BB5A 5J2PA 4Y3CA 2Z2LA 5CCMA 2APOA 4AT1B 3OPKA 1Q8KA 3AY0A 3SQGA 1JLFA 2UUBF 4CLFA 4KKOA 1LOUA 1HQEB 1QAJA 1M1HA 4XO0A 2HFVA 4IO9Q 3R1LA 3U1MA 2WSFC 1R8CA 2LLZA 2MHNA 4EUVA 1E6YB 2BQRA 1OMSA 2WB1D 3GIKA 1J27A 2IC3A 4B17A 1HNWJ 2FLPA 4KAIA 3HHEA 1RT7B 2DGWA 3ZTRA 2R7QA 3CCTA 2F1FA 2D3UA 2VIHA 1TKZA 3SDEA 2F63A 3BM7A 2J0WA 2ROGA 1IKYA 2K3KA 2V4JB 4JP8A 2YWEA 2DRBA 4C11A 3UVJA 1U1OA 4MIWA 1JLAB 4ED8A 1BC6A 4TVAB 4IG3B 1S72S 3FMWA 1YX2A 3HF5A 3AB2B 3KHLA 4DL4A 1X5PA 1GT8A 3DXSX 4WYWA 2AMCB 2NCKL 3J80U 4DG1B 2DR7A 2HYIB 1TFWA 4UOCA 4QU7A 1F2HA 1XR7A 2VJUA 4RW4A 2LQ9A 4F36A 1UAWA 3US5A 3BYRA 3MCSA 1CJTA 1VOMA 4OI3A 3QSYB 3QO9B 3E01A 2XC9A 5A2QY 3QLHA 1KQSR 3SEOA 4DN0A 1UUJA 5GAHI 3OTCA 2OMLA 5L1KA 4DV6F 2LEAA 4NRTA 5KFGA 5BYRA 3EZ5A 5KT2A 3GCXP 2GMHA 3MEDB 3DI6B 3I5BA 1W26A 4LR7A 4CLKA 1R0BG 1SV5A 1T03B 2E1AA 3GJSB 2OSRA 2JX2A 3CCLS 1IBMJ 1Q81T 1S9EB 3CJ2A 3QWPA 1CC7A 1FF2A 5KG0A 1L3SA 1R8BA 1FX4A 1K0VA 2OTJS 5T7LB 3LP2B 4QBUA 5DDQC 3EXYA 3ZZUA 1Q95G 2DNZA 1HHTP 3GONA 3EZUA 3KG1A 3G6YA 2UU9J 2N4DA 2MJNA 3OTDA 5JVHQ 2Q1LA 2AT1B 5K20B 7FDRA 2AW0A 2V2QA 3CJSA 3DMJB 4KJIA 2JVOA 1U2FA 4GO7X 3DRSA 2W9BB 2LFVA 3N6NA 2XSJA 2F9DA 3AQPA 1NJWA 1UJ4A 4RR5A 4TY9A 1LWFA 5HBMB 2HWTA 3T1AA 2RH3A 1X7VA 2J9EA 4ED0A 2VV5A 2ZH8A 2W24A 2DCUB 2VG7A 3LPEA 1FXRA 2PN6A 5FIIA 1W2BR 1VBYA 1PBAA 4BWJA 3KJVA 3MOJB 4DR2J 4B9TA 4DV3F 5H9FK 1DTQB 4QIEA 1KLMB 2CWXA 1MSWD 2HS3A 3DM2B 4ES1A 2CPEA 3BGOP 1RAEB 4IFYB 4KO0B 1PO6A 2GVDA 1VQYA 2CPJA 5KG4A 4TU9A 4LF8F 4DR5F 1TV6A 4HDHA 3VQSA 1PIEA 5FDLA 2KDOA 4LSNB 3ZNUA 1U48A 1WHWA 3HVRA 1U8SA 4Q8FA 3UDVA 4RJVA 4V1Ak 4MFBA 2CJXB 3FBBA 2AJ2A 4CRJA 2NREA 2RDJA 3W9JA 2PE8A 4J5OA 5AJ3J 2M3DA 2MQLA 2BJ1A 2HLUA 2AD9A 1RT6B 5L9NA 4DR7J 4WTYA 3GFXA 2MYFA 2LDYA 2B7BB 1M5OC 2BV3A 3MXHP 2HVZA 1RHKB 3BYPA 1XMOJ 4ELUA 3RU0A 1GQEA 1HYSA 2RKIA 3QGGA 3A8EA 1PAUB 4ZPAA 1F3FA 2Q43A 1MU2B 5F9NA 4IRCA 4JB8B 1K1SA 3I0SA 3LP1A 1V5IB 5CZVA 4FPIA 1N56A 1HHSA 3VGVA 3FFIA 2ZH6A 1KBRA 2D9PA 4WE1A 2RQKA 4HDGA 2ZFHA 4FF4A 1N52B 4RLEA 4Q44A 1S1WB 4ENOA 4QCLA 4LFBJ 1KDNA 1M5VC 1D3WA 1IXKA 3HVTB 3J81U 3QT5A 4P75A 4N47A 1S4FA 5GAHU 3PJXA 3UQSA 1K47A 1T9TA 1TQLA 4WK3A 4ELTA 1IKVA 3DRPA 5E3CA 3TW0A 5CYMA 1NK4A 1H7XA 2YNIA 1B0PA 3HO1A 3VTIA 3WZ0A 1S49A 4EK2A 4RWWA 4L75A 1FTCA 1HARA 2R8HA 4LSLB 1R8PA 3L7UA 3K89A 5CABA 3W65A 3G82B 5DG9A 4P6QA 5KFXA 1YRUA 2BMBA 3TZZA 2GHVC 3KLFA 2XTDA 1S0OA 4K59A 4NA2A 3AA9A 3T1YJ 4JI8J 4Y6IA 2HK2A 2DNQA 1S9GA 5HLFA 3ZZTA 1PGZA 3IMQJ 2OO4A 2VOOA 3OJSA 2W7OA 5D3GA 2HFNA 4GVBB 4C9DA 4HACB 5IT0A 1CLFA 4Y2KA 3NNCA 1WG1A 1VLYA 1HPZB 3FRYA 2YVSA 1UJ5A 2HNDB 2EG2A 3KK2A 2J5AA 3IM8A 1VJQA 1JLBA 2EC2A 4DX7A 5HI7A 3GV7B 2PMWA 1REGX 4CO2A 3S6EA 3J7YI 2FDNA 1EKSA 5F8GA 3CXCR 1L3TA 2CJAA 5HMWA 4CTAB 1YJUA 4P72A 1ELOA 2XM3A 4F0HA 4P2FA 2FJAB 2MPUA 3L9ZA 4ZCMA 4QIVA 1RTIA 2B43A 3HD2A 2YWWA 4F3OA 2LA4A 4LQ3A 1S59A 2HHHJ 1IBKJ 3M05A 2HHSA 3IO1A 2C3MA 3VZIA 3PXGa 1C0TA 2MKHA 5KFAA 3T3FA 3IWNC 3PACA 5A6WA 5HQLA 1LFWA 5AE2A 1RAOA 4FDFA 3I55S 2HG4A 1XNRF 3H90A 1KC8T 1U1KA 2QFIA 5HVFA 2ZNZA 3IS9A 1FO1A 4DR3F 3IN5A 4I6AA 5DG7A 4EEYA 5K8MA 4ILRA 2OEKA 2ZHAA 4ECWA 1B3TA 2Z56B 4ZA1A 3TAMB 1F3VA 2MGZB 2B8QA 3F41A 2Z8QA 2FLNA 1OYDA 3W2WA 2VQEJ 5D4NA 3OSPA 4F4ZA 4PQUA 3KJFB 1GMWA 4QW9A 2QL5B 1NRKA 2XI2A 2DH9A 2V9WA 2OH2A 1GX5A 1XMQF 3AT1B 1S1VA 4PAAA 1T05A 4USMA 1HBNA 3TR5A 3GJQB 5C25B 4JI1J 4O4GB 2LQ8A 4R25A 4CYUA 1NCLA 1FJGJ 1SH2A 2R2SA 5KFRA 1RACB 2IFXA 1EQ0A 2W4DA 1VQ4S 5GAEI 3EGNA 2E9ZA 2XULA 4B9MA 2YQ3A 1UVNA 2ZD1B 4GKKJ 3N5BA 1AUSL 1FJ7A 5HROB 2XMJA 4UW2A 3QBCA 3AFGA 4PWDB 3KOAA 4GMKA 3X1LB 3CCVS 2Z2ZA 1HNWF 1YRTA 4UUXA 2GGPB 2Z0GA 4UQTA 1S1TA 4WJBA 3TI0A 4ZS6A 3FK4A 3QYYA 1IWGA 3GE9A 2K7JA 1Q16B 2HVHA 5F8HA 5HK4A 1T95A 5CYQB 5LT5A 3HSZA 4F0KA 1HBOA 4K4TA 3MEGB 2VICA 2EFVA 4WP3A 2PEHA 4HT5A 1IM6A 1UWBB 4NCAA 3BQ2A 1RKJA 1RHRB 1SC1B 2KXFA 3MPUB 3MGJA 3W2VA 4CM2A 5CD4A 3M8ZA 4H4MB 2KI2A 2IBOA 3MPVA 1B4SA 1FKPB 5A2QU 2JWNA 2DY9A 2DJWA 3OBIA 2QIFA 5EDWA 3PW5A 4EZ9A 1TL1A 2M7SA 4Q8EA 3C15B 3IG1A 4NLPA 1HNVB 1ZPVA 3E51A 1VR6A 3OTBA 2CQ2A 1FFSB 1X9SA 4K4YA 4TY8A 2BA9A 3VALA 1VQ8S 3IRXA 3J7YU 3H4BA 4B9NA 4X4PA 4WKYA 1WNEA 1FI4A 2CRLA 3W8PA 4UQGA 3RB0A 2E5JA 4NLWA 4MKVA 2DK2A 4OI4A 3HHNB 1W7WA 3M8PB 4ZCKA 1X5SA 1K8AT 4WFXA 3O8WA 2SXLA 2IAJB 4M5NA 3KFWX 5DLGA 2A6MA 2QA1A 2XZTB 4QYRA 1MROA 2HIYA 2BOPA 1N36F 3GR1A 1FKOB 1KTVA 2GQCA 3DC2A 4QR0A 2UU9F 2M88A 2CQHA 2PO4A 3DOKB 3NL0A 2NXEA 2ZH9A 4ZVUB 3UDLA 1YGYA 2J9DA 1HBMA 1TKDA 2F3JA 4J9KA 2IYGA 2WVFA 1NBEB 2A18A 1HFEL 3TANA 5LSRA 1WG4A 1YJWS 3JSRA 4DQRA 1F2GA 3ZZYA 1C1CA 1RE1B 3TEHB 2I0XA 2IM3A 2ATCB 4OV1A 3WHIA 2RF2A 1ACMB 2YWFA 4NCGB 4EO8A 4KY3A 4X4VA 4WCEQ 2ZKTA 2D41A 2R42A 2JLEA 3BGLA 3T41A 1VQ9S 2C2DA 1XMBA 4RW9A 3ZZ0A 3NBPA 1RTHA 2FLLA 4ZVPB 4UZCA 1M5HA 2ZM6J 3ETOA 3NNAA 3M9OB 1S76D 3AD7C 3MD3A 3BGFA 4C8YA 4LFAJ 1DLOB 4FXVA 2CVIA 2EBGA 5GAEU 2DKOB 1Y0HA 4FVMA 1VQSA 2PC6A 1GMVA 4WU3A 1RT1A 1UCNA 2O1PA 2KZZA 2XYHB 3FQKA 4LRCA 2XTEA 3FCHA 2C2NA 1NXIA 2R8GA 3OLAA 4IO1A 5AJ3F 4MYTA 1S6PA 2IBKA 1ZETA 2EKNA 2MKJA 3HX9A 2ZUAA 3JSMA 1YITS 2RUGA 4OX8A 5DO2A 2J0SD 4DR7F 4F4YA 1U8WA 1U4BA 3T5HA 3KMSA 4OMFG 4UT4A 2LP4A 3FCWA 3N9UC 3ADAC 4QWEA 1HBUB 9RUBA 2F8EX 3ELHA 1XMOF 3QRPA 2D3O1 1EZZB 4LRBA 1H2UX 2YNHA 1S6OA 2ALYB 3P3DA 1KD1T 4P7TA 4CNZA 3UPFA 2JFKA 1WG5A 4YB1P 1AW0A 4ILLA 1NMEB 3MF5A 2XEXA 4USWA 2W25A 3QAEA 3UW1A 1O5JA 1RQ0A 2H1YA 3C19A 3PFOA 4FYYB 1VMBA 4YMEA 5K14A 4YFUA 2NSBA 1WDDA 4OV6A 4DL3A 4LFBF 3CDAA 2P5VA 4MTPA 3JAMY 4J9OA 3W3SA 4R8UB 3GCWP 3EJMA 1RU2A 2VASA 4USTA 4DV5J 4HT7A 3ZTQA 4JOUA 2W8KA 4F50A 1WHYA 2CQ4A 3D66A 1CC8A 3PRDA 4U95A 3VGSA 4G1QB 2BACA 2DNMA 2DH8A 2Z58B 3K2YA 2JVRA 4K7QA 1RAGB 1SCJB 4S0MA 3CWJA 4X62J 4URSA 3PKYA 5H9EJ 4C0OC 2JHEA 1KS2A 3GR0A 1HNIB 1S1XA 4KHMA 2DB1A 1IQTA 2LA6A 2GMLA 4OYZA 1E6YA 4B3OB 2LU2A 2O5DA 2W7PA 1U25A 1FNMA 4AXJA 4USJC 1I6JA 2ZOFA 1YKWA 4JI8F 5A8KB 1HNZJ 1SI9A 3M2VA 2HWHA 1FHTA 1S7HA 3LALA 1RBAA 4WFAQ 2FQQB 4YB6A 2HNZA 3M4XA 1ZZFA 1HKAA 2HGNA 1RT4B 4NA3A 2ZWPA 4JI7J 1FK9B 1NPKA 4CLYA 4AUKA 1NDCA 3R5BA 3ZC4A 2AGQA 1R8AA 2KG1A 3A3NB 1CULA 1WI6A 4FKYA 2B8PA 2HBRB 1FWLA 1LXJA 3K59A 1DZ5A 4Y2IA 4OIXA 4OHZA 4B3SJ 2XO7A 1U26A 1WC0A 3NWGA 2OPSB 4DG1A 2MB0B 4DR4J 2LQ5A 4NLGA 3GG1A 5IM0B 4DXLA 1IWAA 3Q23A 2UXCJ 3H20A 5A0YB 3SCLE 1ZAVA 3O2IA 4TQSA 4X4RA 4LVNP 4PXDA 4C98A 3F0NA 5C42B 3MR3A 5HANA 3R3TA 5E5NA 3QO9A 1M1KT 1S1UB 3MD1A 2VBWA 4Q2LA 3CJ3A 1T9YA 2HHHF 1U1RA 1UPPA 5HQMA 2IDEA 2CZVC 4O0IA 3O3LA 3MMCA 3MEDA 3DI6A 2VKRA 4ECQA 1OSCA 2C1EB 4ZIVA 2QMWA 2RSQA 4LMZA 1GMWD 1J5OB 4EGLA 2EW9A 1ZM9A 4NEZA 2QEXS 2HW3A 1QVGR 4RW7B 1RABB 4LBPA 4AFFA 1IR2A 2BANB 1FD8A 4YY3J 2WONB 1CVJA 3ZO7A 3MTJA 1SIZA 1FDNA 2MZTA 1AXQA 3DDNA 3HP6A 4Y0FA 4DF4A 3A3OB 4GC7A 2EFOA 3R5JB 3ISND 3KHHA 1P1TA 3ILJA 5B0CA 5GVQA 3ENWA 1EHWA 2QYGA 3DMJA 4EYHB 4ZPBA 1RHMB 2W9BA 3MECB 1P1LA 3G9CA 5E3AA 4MH8A 3DCAA 1HQUA 2OMOA 2OJ3A 2RU3A 2LXUA 3GU0A 5T41A 1SUQA 4F25A 4ED7A 4JI1F 2ACMA 2GAHC 3NS5A 3M6XA 1FJGF 2HQFA 2H51B 1EETB 3FVYA 4M8LA 1IJFB 1FDDA 2NSCA 4JI2J 4YOEA 5BYSA 4U67Q 2IVMA 5C24B 3PO4A 2G0JA 2WOMB 2ASLA 4TYAA 3VAGA 2C42A 4GKKF 5DM7Q 2B5JA 2DNYA 1ZA1B 3W66A 1X31C 1FRMA 4IFYA 3GSDA 4QYZJ 2AZ1A 2ZDPA 2JEJA 4ES3A 3LW5C 2WHOA 3R5CA 1ZM2A 2BABA 3CCMS 2AJ1A 2Q3PA 3MURP 1UVMA 1JLCB 2ZBIA 2W2NP 1IM4A 1NNDA 3BO3A 1DJ0A 2GIFA 2IM0A 1JK9B 4OZ0A 5J2PB 1NJZA 3H5YA 4QW8A 3KTQA 3SXLA 3R6LB 1X9MA 1JLFB 5HP1A 4KKOB 1H6KX 5J2MA 4ZP6A 5KT6A 1MNEA 5IZHA 2CADA 3HKWA 2GJIA 1ZTWA 2IRXA 5LJ5Y 2YKPA 4DV2F 1JJHA 5D4OA 1MU2A 3QJLA 4IH7A 3HHDA 5L39A 2VC0A 5H9EK 2IM1A 2IC3B 5DM6Q 2CQ1A 2ASJA 2POKA 4EZ6A 2LYVA 3G6ES 3V2UC 4P7VA 2VG5A 3U7JA 4KB7A 4OL8A 5I42B 1F5CA 3AX5A 1F5BA 3Q0AA 3IWXA 1TKZB 3P49B 2V94A 4IOBA 1ITPA 1IKYB 1D8YA 4C11B 3UVJB 1BQMA 2R2RA 3HVTA 1X4GA 2F65A 3M2UA 3MEEA 5HJYA 2D9OA 2ZJQQ 4RBVA 5A8WA 2FJVA 5EUHA 2VFUA 5HSPA 5KFQA 2FZCB 1PG5B 2H48B 2AJFE 2KXHA 2R3VA 1VCTA 2QRRA 2LVWA 3D3BJ 3R6GB 4N8OA 2OPRB 2FJWA 3K5LA 4ZLPA 2WZ1A 4RNFA 4DUYF 2XZDB 2YWGA 3E01B 4NLQA 4ZPWR 5ETOA 3MMAA 3QLHB 4LFCJ 1Q8LA 5C7PA 3D5MA 3KK1B 2DGVA 4RUAA 3W9HA 1M90T 3K5NA 2PFFB 3G8TA 4F3MA 4ICLA 4DQQA 4U96A 3DLGA 4C8KA 1SV5B 5KFOA 4QPXA 4J9VA 1WDTA 4OX7A 4F2RA 1RBOB 3Q83A 2M9KA 2CG4A 3HFVA 1U1QA 3CJ5A 2WW4A 2V69A 1T9VA 4GRSA 4Q45A 4USIA 1N54B 5KFJA 2R7RA 2YX1A 1UZDA 4KYZA 4HACA 4LFAF 4Y2CA 1HPZA 2MQ8A 1F9FA 3GJTB 4DL7A 2XQCA 2HNDA 3DRSB 4XTTA 1JLQB 2XSJB 1KQFB 5D4LA 4C0BA 1LWFB 3HSJA 1H73A 4ZHRA 3TOQA 3I5CA 4MIBA 2W1BA 5HO4A 3IFEA 2R8JA 3Q8RB 3DGVA 4AL6A 3KJVB 3B54A 5KG6A 4PPDA 2M4MA 1X9WA 4DSEA 2VL1A 4PG8A 4PG5A 3DYAA 1WEXA 2CA9A 4USKA 1RT5B 3PY8A 3L7OA 3RB3A 1SKUB 1RCXB 2B56A 3KJQB 4CLUA 3H7HB 2MKIA 1UMJA 1CS4A 2BJDA 4L73A 1YI2S 4BHQA 3DNCA 4LF7J 3UDEA 1S79A 2OFHX 1IR0A 3NRBA 3R97A 2C2ZB 2FHKA 3TQEA 5FDLB 3QFWA 5G4DA 3JAMU 2MDAA 2DGQA 1WJ9A 1H2VZ 3LUYA 1EKRA 3RRHA 1KKHA 2W9CA 3QGIA 1NJXA 5JJBA 2KJVA 4G1PA 3NMRA 3NGKA 3TJ8A 2I2YA 3NG8A 3QJPA 2CZ9A 2H3EB 2CQCA 2VUGA 4N41A 3D1HA 1RDRA 1JNZB 2AEFA 4DV5F 1B0TA 4KTQA 1JNRB 3EGVA 3IR6B 1SXLA 3V4IB 2BVZA 5D0RA 1JXLA 1LK7A 1YSJA 1HYSB 2RKIB 5D8HB 4O4GA 2D1CA 1VIOA 3HHKA 1KVJA 2V2KA 4CI0B 1LW0A 4I7FB 1QJHA 1VQPS 3BSCA 3AXMA 3T1HJ 2WRMA 4WWSA 4WE1B 2HS0A 2OFGX 1PYOB 3FEYB 4O44A 2ZD1A 3IBFB 2GIQA 4I2QB 2KN4A 4QZVB 3CULA 4Q0BA 2GQQA 1KFDA 4H4OA 5FJ4A 2VQFF 3H5XA 5JUMA 4PWDA 2Y8WA 2GGPA 2QLFB 1HNZF 4YP3A 3IA0A 1R43A 1WWHA 4OYAA 4DL0C 1KR4A 3MHYA 5ETVA 2HWIA 3N28A 4JI7F 2QSFA 1ZPWX 3Q89A 5CYQA 2JEFA 4KR0B 2ROPA 2H4YB 3MEGA 3WIVA 3DRPB 3H42A 4HR2A 3HSGA 2A6OA 2BM0A 2YNIB 2BDPA 1IKXA 1RP5A 2ZH2A 3HSDA 1RT2A 2WB4A 3VAFA 3PM9A 3SQOP 4NX9A 4FF1A 4B3SF 4IH6A 4DR4F 3BJYA 2XY5A 2B4UA 2UVWA 4X4OA 4J9PA 1FFGB 3C15A 4G3IA 2B0GA 3KLFB 5L1IA 2NZCA 3CCUS 3H98A 1XIQA 5A8RB 2KL8A 1OY9A 4Q5VA 2BUNA 1QUPA 1X4FA 4NLXA 1S9GB 4Y28C 4DS5A 5HLFB 2ALZA 3HLUA 5HMZA 5EWGA 1NH8A 4A8OA 2Y1LB 1Z1ZA 4ANCA 5IOLA 2NXJA 4ECSA 2Z57B 4OZ5A 3BS9A 1NHVA 3MM9A 4B9VA 1FRHA 4LR8A 2AZ3A 5F8NA 3HT0A 3M30B 5KFVA 2CQ3A 4DL6A 2B4PA 1IN0A 3M8PA 3PYDA 2IAJA 2L41A 2R8IA 1VQ7S 2X3GA 1AFJA 3J7ZT 2VBYA 4QWAA 1VQOS 2V8DA 3D2WA 3MM7A 1JLBB 1B7YB 3OHBA 3CJ8A 2BKPA 1FKOA 3IAS9 3QNWB 1RSCA 3VVUA 1Y5LB 1S7IA 4ID5A 3MFHA 1ZAWA 4X65J 4X4QA 1DTTA 3J80Y 4X4TA 2ERRA 1RTIB 1R31A 1FX2A 2MLXA 1LV5A 4DQIA 4NRUA 2GO8A 1V3RA 1KSPA 1DARA 4F04B 1C0TB 1Y10A 1RXOB 3MUTP 5D0HA 1HWLA 3FBEA 1ZOTA 3TUIC 2M0GB 4KGMA 1HD1A 2QTWA 4ZPVR 4NCGA 1FEHA 4ZJLA 3IS9B 2YQ0A 5GMKa 4JI2F 3ISNC 5KOWA 2LDIA 1ZTTA 4Y2MA 2E1CA 1GFWB 2EK6A 2ZH5A 1KRPA 5AXLA 3K57A 2P2CB 2B3TB 3CCWA 3UI3A 1NAQA 2YY3A 5B0FA 4PQUB 4DSKA 3B4MA 3SCJE 1VC6A 4QR1A 3CSKA 4DFMA 5KTQA 1A7GE 3E8OA 1S1VB 5K5MA 1T05B 2FIUA 4ZCIA 2EI5A 5CH7B 4X2BA 2JL9A 2MY7A 5KFSA 2E44A 4ECXA 4GC6A 4CYUB 4DSIA 2ZEJA 3J81j 3IC1A 3AOCA 2QLWA 4EWTA 1YVFA 4EBDA 2DPJA 4ER8A 4DL2A 2RQMA 4DX5A 3BO2A 1V9OA 1HBUA 2AJ0A 2GNKA 4OI0A 2NYIA 5DLFA 1A0OB 4DPWA 1CQNA 2EBEA 5KFEA 3HVWA 5K9FA 2RU9A 2FHJD 3I96A 3CUNA 1G3OA 3OJUA 1UJ6A 1LKZA 4FYVB 3PJ9A 1T9XA 1U2RA 2W2PP 3RG6A 5AE1A 1S1TB 1N5VA 4DPTA 5CCLA 1BHNA 1YBTA 2GHWA 2G9OA 3IR5B 3T6JA 4KGKA 3FQLA 3MAAA 3DLKA 4DCPB 3ZZRA 5JXSA 2HFUA 2BXJA 3K5MA 2NXCA 2O67A 1UZHA 3V6JA 2G0IA 1OY8A 2FJEB 1WKKA 3SV4A 4TQRA 1TKXA 1DQAA 1YJTA 1RZMA 2B7CB 1OS5A 3FSYA 5MLCV 1TUVA 3NS7B 3LAMA 1VRTA 1I51B 4LF2A 1TL1B 1HMVA 4ZP9A 3FDSA 3IG1B 3GTYX 1SC4B 4IQXA 2XY6A 2JOQA 1Q7LB 2VC1A 4OI6A 4D3GA 2QX0A 2MHEA 3MM6A 4TY8B 3M9MB 1CG2A 4ZITA 2CPFA 5IC4B 3IRXB 2K2PA 4I6WA 1Y5IB 3KLEA 2D74B 2YKMB 1OPIA 2RDDA 1U24A 2VFRA 5A8KA 4XDDA 1U6ZA 1BY9A 3GJRB 3NCPA 4I0WA 1YHQS 4MK8A 1TR0A 4AL7A 1FK9A 1V6HA 1MROB 3KUHA 2FVRA 3JSYA 2HFOA 1M5PC 2O66A 1VLOA 1R7IA 4K4SA 1QUVA 5DDOC 1AUDA 1EP4A 3T6BA 2W4PA 3BREA 3HI9A 5K8NA 2J6SA 2D68A 2YKOA 2BQUA 2FVQA 2EFNA 2MLYA 5IM0A 2R7XA 1B70B 3RRGA 1LWEB 2RHQB 4M5MA 2MQNA 2GZOA 1C1CB 4OZ3A 2V2ZA 4C8ZA 4ZPTR 5C42A 3F44A 2FPHX 2OEJA 2N7YA 3VHQA 1WTBA 4NLRA 2RQCA 4O3OA 2RF2B 5DQGA 3HMJG 1TUWA 4DSLA 1KP6A 4CIOA 5F8MA 2FZKB 5DQIA 4RW9B 3GIIA 1UTAA 3S8SA 1RTHB 5M2UA 1OIAA 3RJMB 5DQHA 5LXYA 4BWMA 3EPIA 4ZVOB 2B9EA 1HLWA 2QL9B 3HJFA 2MQPA 4AYBD 4LF7F 1S9FA 5KOXA 2J9DE 3IR7B 1OYEA 2HHUA 2J6TA 5A76A 3S1TA 1N0VC 2EPIA 4P2MA 1X4AA 2CFXA 1RT1B 4YN3B 2WONA 2CPYA 2R7UA 2VPZB 1FRLA 3AAWB 4FBTA 2ZHBA 4FNIA 1ZBTA 2NR0A 2DNHA 5L9XA 1XJWB 4JV2A 5ETMA 3DOLA 1PILA 1NHKL 1FKAF 3HHLA 2DGTA 4ZPDA 4OJ3A 2GJFA 1JQGA 1WEYA 2ZVSA 1PC4A 4UY8T 4DF8A 4W98A 2NYHA 4ZP8A 3I82A 2OSQA 1W25A 2FC8A 3HPOA 2YNGA 3SBMA 1C0UB 2HK3A 4QWCA 1N48A 1NK5A 1ZAXA 3PZPA 1RWNB 2XYGB 1OQ3A 1NPPA 5H9FJ 2ZBRA 2FJDB 5D77A 5CYJA 2AGPA 2HNYA 1T94A 3T1HF 3H4DA 2DGOA 4Y65A 2ZH3A 2NXNA 1HI8A 1JJCB 3VAKA 2WOMA 3ICLA 2HKEA 2R7SA 1TK8A 1RWMB 4FYWB 5K14B 3K5PA 2E66A 4QIWD 4CQ1A 3PX6A 2JH3A 3M6WA 1DAXA 3BO4A 2XB2D 4RU2A 1V3SA 2R4FA 1RI7A 2DCLA 4X64J 2QG9B 1I5OB 1Q79A 4DCOB 1FRKA 1WF0A 1T3NA 3CD5A 3VGUA 5LJ3Y 3G96A 2PSZA 4LUBA 4USUA 1QAIA 4ZVRB 2OEMA 1JJ2R 2DTJA 2MQOA 3ET6B 2E7WA 2N82B 5IT9Y 4WFNQ 2JSXA 2KM8C 2MXYA 3TJAA 1GXLA 2YPZA 4DMZA 3DRYA 4RUHA 4EYIB 4DN9A 3PYGA 1YZ7A 1ROFA 3BR8A 1MMDA 1R6VA 1Q0NA 3RTVA 2C3UA 1ZM3A 1S1XB 4L74A 1QVFR 1DBDA 2RIJA 5ITHA 4DUTA 3K0JA 2QA2A 4P73A 2R7TA 3C16A 1M5SA 1RHUB 2L08A 5J2QA 2MSSA 4ZN1A 3LGNA 3M2VB 1UP1A 1V5VA 1SKWA 4ZVHA 1TMMA 2C28A 3JTOA 2KM8B 4FYDA 3I87A 3OFGA 2XBPA 5IQQA 2HNZB 1APSA 5I42A 3PEHA 4NEYA 5LM7E 2JNJA 4ZVFA 3SV3A 2HRUA 2AYMA 1WHVA 2DNLA 3ILOA 2R7VA 1PC5A 2G2OA 2CNKB 4ZLNA 2MKSA 4GKJJ 1X5OA 5HMXA 1CULB 2EK1A 5ETTA 2VG6B 3TARA 4KSEB 4KV8A 3H2VE 3CDUA 1WKLA 2DNPA 4W4MA 2DEIA 5HVGA 2QLJB 4HHJA 1NLKL 4DDFA 1UEUA 1X0FA 3RB6A 1IBCB 2KKHA 1KFSA 1UA1A 4IH5A 2OPRA 4M94A 1SPBP 3MDFA 1A6LA 3AQOA 3I0RB 1TKTB 4X65F 3KKFA 4B3RJ 1M0SA 4M5LA 5HL7Q 1EX8A 3DGPB 2HVDA 4DL5A 3KK1A 4FBUA 4HL9A 4NXMJ 1AZSA 2VJVA 4QWDA 2XMUA 3MMCB 2KT3A 2ZNYA 3BZQA 1FWPA 4DEZA 3CO9A 4HTIA 1ZS6A 2GCFA 5F9LA 2Z2YB 1H72C 2IM2A 3U1LA 4TU8A 3WX4A 3V81B 4G1IA 3C6UA 1RISA 2HHTA 2L9WA 4L76A 3P5BP 3LP0A 1N36J 2C3PA 1Z2ZA 1QAXA 3MR7A 1FEEA 3PIPQ 4A8KA 1S0MA 4F67A 2B4OA 4ZMMA 3PEJA 4ZLLA 4LF1A 3QATA 3N6MA 1BQXA 3M2RB 1N6QA 3ZTPA 1RHQB 3G87A 5KFTA 2UV8G 2VPXB 1JLQA 3PKMA 5DDRC 1HQUB 1RLDA 1X5TA 1G7CB 2YH0A 1TL3B 2XYPB 2RRNA 1SUQB 4X4NA 2XZWA 3OL8A 3DRXA 3DXBA 2IMOA 1KLNA 2KJWA 5FLXY 3AHPA 4OZNA 3DOMA 2G1DA 2HHPA 5SZTA 1TVRA 2WW8A 1NK9A 2IY5B 3JTPA 1NK8A 3B82A 2GMJA 3Q8VA 1EB0A 3BKUA 1RT5A 2KB2A 1X4CA 2HHXA 4DZDA 2B5JB 2YX7A 4C3KA 2LMIA 1U6BA 3CD6S 2YWHA 2GS8A 4XPCA 2ZHOA 4MMOA 4NYOA 4I67A 2F9JA 2VFVA 2XNRA 2VODA 1RWWB 3DHWC 3S7RA 4JI5F 2COLA 2BRKA 4MK9A 3QIPA 3CF5Q 1CBKA 1C1BA 5L1LA 3IBWA 4C3MA 4TN2A 2UXDJ 3BV8A 2HHQA 5HP1B 2RS2A 5J2MB 3A4TA 4B9SA 3RGIA 4Z37A 2HVEA 1LW2A 3V4IA 2Z2MA 4KFBA 3PR4A 3GLJA 4HEA9 4IKAA 4BDPA 1MG7A 4C97A 4I7FA 4NYPA 2DISA 1D9DA 1P9QC 3EICA 2CJKA 2NXUA 2CWKA 2X51A 2DR6A 2BKNA 2OI2A 2HQDA 4KC5A 2VG5B 3PX4A 4I2QA 4EBCA 2AF6A 1XTZA 3ENVA 3NAHA 2PDAA 3Q2TC 4J91A 2N3OA 2VB6A 1WHXA 1URRA 3CVKA 3OFEA 3TUZC 2HGLA 2J0QD 1RAHB 1BQMB 4R0EA 3CJQA 2HURA 1Z4UA 2HVIA 3DLJA 3IGNA 2ABYA 3VZHA 3M2UB 3MEEB 2XTCA 3UD5A 1YTYA 5F0WA 4M95A 1HIYA 2VBZA 1WACA 5A8WB 4Q7AA 5L1JA 3DRRB 1Y4ZB 3R9LA 2W2MP 2GAGC 2C2KB 4Y00A 3OSNA 3VAJA 2V1TA 4XDCA 4FS1A 2WVBA 3QJJA 1Y3JA 3CNQP 4H54A 4CDIA 1KHWA 8AT1B 1TELA 2IRUA 3M6VA 4I69A 1GH8A 2V9KA 3PHTA 4NLSA 3MMAB 2BYCA 1WC3A 1OY6A 3JYTA 3OLBA 3R7BB 3RBZA 5D4PA 1BWEA 4PUOA 1M5KC 4DV7J 3NEKA 5CD4H 1KQKA 4FVCA 4JYAF 3W64A 5A8RA 4ICLB 1N5YA 3DLGB 3RW7A 2DITA 4ERDA 3K7RA 1U1LA 2XO6A 3CJRA 5DGAA 3BGRA 1HI1A 2MJUA 4LF5F 1UVLA 1VHFA 1H0HB 3D67A 4U7UD 3B6BA 3M30A 3C3LA 5ETSA 1PKUA 4OYOA 1YJVA 2VBXA 1ULRA 3HHLD 1IUJA 2R7OA 1QAYA 4OYMA 4J9NA 1PAEX 2ZJRQ 4R5PB 2XNQA 2DGXA 2R8KA 2XWYA 2R7WA 5ETQA 2KXNB 3KK3A 2KRBA 1VRUB 3RBDA 4ZHRB 3DLBA 1RGVA 1RHJB 2DNGA 3FJ2A 2CVEA 1NKCA 3GSIA 2MY8A 3UCGA 3KHGA 2KO1A 3PRVA 2B4VA 4RNOA 3BF4A 4MIAA 1IVZA 3DYAB 4C3LA 3CB4A 2X7IA 2KVIA 4MT1A 3KMQA 2X1GA 5I3PA 2ZKUA 1CS4B 2ZE2B 3VAHA 1U1NA 5KG1A 2YKNA 4LVOP 1RJJA 3H2UB 3FBCA 2AEMA 1N88A 4CLWA 3P6YC 3L3CA 5IFMA 2IVYA 2BZ2A 3MM8B 1WC1A 2DO0A 2W9CB 3ZTOA 1YQHA 4PWWA 2E5GA 3CJTA 4OZJA 1AT1B 4X64F 3M6UA 2W4CA 1AA1B 1FDAA 3PRBA 5IT9U 4DFPA 5BXIA 3KNAA 3CIMA 4ZLJA 2A2DA 5J2NA 4NI2B 2GQ2A 3RB4A 4NWBA 3VWSA 1OJ4A 2X3DA 2ZZTA 4JI6J 3RRKA 2LECA 3EDRB 3NS6A 3BGUA 1LW0B 3FZ2A 3GP9A 2ADCA 2Y1JA 4I2PA 1O51A 3AB4B 4FKXA 3KLIA 1L3VA 2ZH7A 1VIXA 4F0MA 5LOQA 3M8YA 2BJ3A 4USHA 3VQTA 2XS7A 4NLTA 4O44B 3ZZZA 2FGCA 4CLSA 4CT9A 2F40A 5K8OA 4Q0BB 5IV3A 4DR6J 1RA6A 4H4OB 4IYQA 1GXUA 3UCUP 2QGFB 5SUHA 5GADI 1DURA 2ZOMA 4KGZB 4UF4A 1WOPA 4DHVA 1I3OB 5U47A 2ZZMA 2NUHA 2ZC4A 1XQIA 4EFAC 4WXOA 2I9SA 2QFJA 2ILYA 1RWKB 1NKBA 1IKWB 3NXZA 3P96A 1D1UA 1HNXJ 3G2XA 4GKJF 4WFZA 4HI2A 1RTDB 4MJKA 1IKXB 3NCRA 5DDPC 3T5LA 4RBTA 3ENQA 1RT2B 1ZM4A 2KRRA 2AGOA 3T9ZA 4YDXA 1OM2A 2JLFA 3M1VA 1MWZA 4DV2J 2QO3A 1J5EJ 1Y7PA 1L3KA 5J1NA 4PZVA 2DNKA 2FY8A 2XWXA 2CPHA 4B3RF 4W90B 2DXDA 1KOOA 4ECZA 2XLIA 4DV4F 2OELA 2QV6A 4PQAA 1NK0A 4NXMF 3C46A 3AH6A 1MN9A 5HAOA 1UWAA 2L9DA 3OR2A 2YKMA 3MM9B 3CDBA 3R27A 4WU2A 4FPRA 4CWBA 3VAMA 2XMVA 3QAUA 1FA0A 1S5ZA 4NOHA 3UD4P 4YR3A 2H54B 4YS2A 3MM7B 4MYUA 4RW6B 2PA3A 1KOHA 2H5IB 4CT8A 3P45B 1SBRA 5G0RA 4F4WA 1BMQB 1UVJA 4C4WA 1S0NA 4ID5B 4A8MP 4K0KJ 4B9UA 4DUYJ 1DTTB 3B4DA 4A47A 1FRIA 3ITHA 4P74A 4KHPF 1RU1A 4ZOSA 4PG7A 4ED4A 4UOHA 1VQMS 5FLXU 3KUGA 3LWMA 3RAMA 1FWKA 3J7A1 5AXMA 1LWEA 3I4HX 3D3CJ 4ZVTB 4HH1A 2CG8A 3Q8UA 4FS2A 2H5JB 3QGPA 3KLHA 4DU8A 3CDWA 2E1MC 6AT1B 5DJBA 3KDOA 2E5LJ 1F9HA 3NGUA 2B9WA 2Z30B 1WSRA 4CLTA 4JV1A 1X60A 3AWRA 1WF2A 2RB7A 3ETMA 1NSKL 2WVCA 2L3MA 5K8PA 1G6BA 2IMWP 2OUGA 4IFVA 3CC2S 1TAQA 2W9AA 3JQMA 4KRWA 5T14A 4CO1A 1T7PA 3OVBA 4ZN3A 4P2SA 1REVA 3THPA 3JTNA 1QDUB 5KFWA 1NPRA 1R89A 3QWUA 2U1AA 3LQVA 3UN2A 3R2CJ 3T5KA 2UXBJ 3C2PA 2UXDF 5HMYA 1MWYA 1BLUA 5GADU 3N6LA 3FKBA 1JXVA 1YBUA 1OWXA 2VDIA 1LWXA 3EMTA 2WK4A 2AKWB 2OAUA 4ZVGA 1C0UA 3SCIE 3VCDA 4DX8H 2BE2A 1GTEA 3KG0A 3GYXB 1XC9A 2NZ4A 2LEBA 2AIRB 1I94F 4JV5J 2Q6BA 1FVSA 3H5SA 3OHAA 1HWJA 3W7BA 3L09A 1KONA 2XS5A 5FD1A 2Y1IA 2EVZA 2DBBA 3C8YA 4K4VA 3GIMA 3HULA 3SSSA 4C8NA 3UO0A 2AYEA 1FXLA 2N7CA 1HQ2A 2AX1A 1EARA 3MAAB 2V67A 3CD0A 3DLKB 1FFWB 3QIDA 1NHUA 2VH7A 2DT9A 1UA0A 1Q86T 1QM9A 5F0UA 3I5AA 2GVZA 3NGSA 3LOUA 3SSQA 1WC4A 2PI4A 3KUEA 4RL1A 1TKXB 3CMQA 2F7VA 1K1QA 3ET6A 2RUSA 4K4UA 1RBLA 2X1FA 2MMYA 4LRFA 4AXIA 3D68A 5IV4A 1VRTB 4Z7CA 1P8GA 3PYEA 3Q22A 2XGPA 4ZJOA 3PW4A 2RVJA 3N5FA 5ADZA 1HMVB 1NSAA 2JZ5A 2CXEA 1VHIA 2MTLA 1RWPB 2EKYA 2P9GA 4DCJB 3GYGA 2G4BA 3EVMA 3D6TB 5GMDA 1TL7B 3MM6B 2GHPA 4CO3A 1I1GA 2E1PA 2QSWA 4DV7F 2QA4G 1KVKA 2CNNB 3KLEB 1T8EA 2DR9A 2VQFJ 1IR1A 1HW8A 4PABA 5KFZA 1EIYB 2OD6A 3C6TB 2IRYA 3TP2A 3TWZA 1XNQJ 4ETZA 3MPWA 1MMLA 3KLGA 4DPYA 2A2CA 1NZAA 2CQGA 3PG9A 3T19A 2ASDA 4XIUA 5LMNJ 1RUSA 2I38A 3FC9A 3HK2A 4DLGA 1NSPA 5AT1B 4X4SA 2FC9A 3FZBA 3N01A 4C8LA 2BJ9A 3PNIA 8ATCB 4NZ7A 2VG6A 3EWGA 1EP4B 2QA4S 1PJ7A 3H8YA 2EG1A 2UP1A 1WORA 1CPZA 3CO0P 1YK9A 5IS2A 2CNLB 1QSYA 1YDLA 3OD2A 2XHWA 5ETNA 4GVLA 1T9WA 2V0NA 3Q8SB 1NU4A 3RW6A 2YH1A 1NDKA 4RO0A 4ITSA 3R5AA 2GV1A 3I0RA 1TKTA 3CDEA 3GILA 2AP6A 2HBYB 3R1HA 4RPFA 2FD2A 4OJGA 1E6VA 2LQJA 4OYPA 3DGPA 3H0PA 4B3MF 3G8SA 1UL3A 4AD6A 2HAIA 2U2FA 3BQ1A 3FSIA 3HHLC 3RYLA 5IXUA 2YTCA 1NK6A 4J9LA 2J9CA 4LF9F 2YXLA 4N56A 3LWLA 3IWLA 3NCQA 4TKTA 2ZBPA 1D0EA 2G2ZA 3GWCA 3I9ZA 2NPIA 4M5HA 4B02A 3V81A 1EJ7L 3DU5A 2JEGA 3O6QA 2XSFA 2NS1B 3UWTA 3EXCX 2OPPA 2P9EA 4F02A 4B9LA 2HMIA 4IRKA 1S4EA 3C14A 2CPDA 4KE5A 3SI8A 2KVQE 4DPXA 1D09B 2JLGA 3MAHA 3NAIA 5J1PA 2WTFA 1UETA 5HATA 1AROP 2HAFA 2HPUA 3OR1B 1YLXA 3DOLB 4KGXB 3HHLB 3M2RA 5F8JA 4A48A 1F0XA 2FJBB 1PYTA 4K2JA 1R0AA 4PXEA 3UNYA 2RAQA 4OI1A 4OZLA 3SZ2A 2H9ZA 4JBCA 1TL3A 4JI6F 3G6XA 2YNGB 2JC1A 2DIUA 2KT5A 4QWBA 2PD1A 6FDRA 1UW4A 2R9LA 1NDPA 2HNYB 1Y11A 3O44A 1S0VA 2R2UA 1Q7YT 2K1RB 3R5DA 3H59A 3Q2SC 3BDEA 5B0GA 1RYSA 1B7FA 2CQBA 3FBFA 4NXNJ 1S10A 4DR6F 5CQGA 4DPUA 1ZYQA
chains in the Genus database with same CATH topology
2IYGA 1FRLA 3AAWB 4FBTA 1H3DA 3OQ2A 5KG2A 3T5JA 2A18A 2ZHBA 1HFEL 2I8EA 4FNIA 4O23A 4DLEA 3TANA 5GAGU 5LSRA 1ZBTA 2NR0A 4QIFA 1PSDA 1WG4A 1YJWS 4ZPCA 2DNHA 5L9XA 3JSRA 2EFPA 4DQRA 4K5SA 1F2GA 4JV2A 3H40A 3DOLA 1PILA 3MR2A 1JKHB 3ZZYA 1C1CA 1FKAF 3ISZA 3HHLA 2DGTA 3OL6A 4ZPDA 4OJ3A 1OPZA 3MOZA 2K3IA 4BS2A 2KU7A 2I0XA 4QR2A 1T3OA 1WEYA 2IM3A 3IXQA 4GO5X 5D3GB 2ZVSA 1PC4A 4OV1A 4UY8T 1UVKA 1JB0C 4DF8A 5KFIA 2OPQA 1YG0A 4ZP8A 2RF2A 3I82A 2YWFA 3LPYA 2OSQA 1W25A 4NCGB 4EO8A 4X4VA 2FC8A 4WCEQ 3CCQS 2ZKTA 2D41A 3HPOA 2JLEA 2YNGA 4E8UA 3MI7X 3BGLA 1VQ9S 1C0UB 2AX0A 4RNHA 2C2DA 1SKSA 4A8XA 1XMBA 2WBRA 4RW9A 3RAXA 1HNXF 3ZZ0A 4QWCA 3NBPA 2WAQD 1N48A 2QYCA 1RTHA 1NK5A 1ZAXA 3PZPA 3AA8A 4C8OA 3HXMA 1OQ3A 4I68A 2YNFA 2FLLA 5H9FJ 4DUZF 2KTQA 2LKZA 3OUYB 3F73A 3FRZA 3SFGA 4RX6A 1M5HA 2FJDB 4RW8A 5D77A 3KK2B 5CYJA 2AGPA 3ETOA 3KHRA 4FN5A 2HNYA 4YY3F 1T94A 3NNAA 3M9OB 2GA7A 4TXSA 1S76D 3T1HF 1XBWA 3H4DA 2F8HA 2DGOA 4XAKA 3MD3A 4Y65A 2ZH3A 3BGFA 4C8YA 2LU1A 1DLOB 1FE0A 1YJ9S 4FXVA 4HH0A 1HI8A 2CPIA 2CVIA 3GIJA 3FNNA 3VAKA 1K0TA 1XR6A 2EBGA 4Y34A 2VPWB 2WOMA 3ICLA 3TX8A 2OTLS 5E2QA 5GAEU 3I32A 1Y0HA 2R7SA 1TK8A 3ZZPA 3D54A 4FVMA 1J5EF 3DOKA 1VQSA 2PC6A 4WU3A 1RT1A 5K14B 1S6UA 3K5PA 4MKAA 2E66A 2O1PA 4QIWD 1BD6A 3M8RA 2KZZA 4CQ1A 3GFZA 1XERA 2ZBCA 3FQKA 4TYBA 2XTEA 3PX6A 2JH3A 3FCHA 1DAXA 3M6WA 4G6VB 3BO4A 1TK0A 2XB2D 1N0UA 2WSEC 5KG7A 4F4XA 2R8GA 4RU2A 1V3SA 2R4FA 5J2QB 4XPEA 3BDPA 2UUAF 3OLAA 1RI7A 1SB6A 4CNYA 4DQSA 5M2RA 3GG0A 2DCLA 1X4HA 1Q79A 4IO1A 5AJ3F 4DFKA 4MYTA 1H2TZ 1S6PA 3MPYA 1VQKS 2IBKA 4HKQA 1FRKA 1SQEA 2MKJA 3HX9A 3JSMA 1ZETA 1U7LA 1WF0A 2FVCA 1YITS 2RUGA 4OX8A 1Y00A 3E3XA 1T3NA 1RT3B 2GIRA 3CD5A 5DO2A 1U45A 2K7KA 1JKHA 5LJ3Y 2J0SD 1CEZA 3CJ4A 4RKUC 2PSZA 3G96A 4LUBA 4F4YA 4DR7F 5BJRA 1U4BA 3CJKA 4QQBA 4ECTA 1NK7A 3T5HA 1QAIA</