4NLXA

Poliovirus polymerase - g289a/c290v loop mutant
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
461
structure length
458
Chain Sequence
b'GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSAVSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
total genus 138
structure length 458
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nlxA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nlxA02
2WB4A 3HVWA 1RTJB 1IKWA 3CDUA 2D3UA 4ZVFA 3NGDA 1S49A 4R5PA 1TVRA 1TL3B 2E9TA 4O3NA 2GIRA 4RUAA 4XPEA 4KE5A 4NYZA 1HNIB 1NNDA 3QO9A 4QW8A 5KFXA 4ECXA 1I6JA 5DQIA 4KSEB 5C24A 3H2LA 4KB7A 4GC7A 1JLAB 3G6XA 3MF5A 1D0EA 5KG4A 3BGRB 4Q8FA 4KAIA 1S1WA 3TAMA 1RTHB 1LW2A 5J2MB 4H4OA 1MU2B 1RT7B 2ASLA 4RNFA 5CYMA 4H4MA 2FVPA 4F4WA 1JLFB 1TKTB 4DG1B 2WTFA 1SUQA 4YR0A 4O44B 4EO6A 3BSOA 1T05A 4FBTA 5KFDA 4GC6A 4NLVA 1KHWA 2IJFA 1N4LA 4NCGB 5KFLA 4YP3A 1SH0A 1IKYB 4IH6A 4JV2A 4ECUA 4TLRA 1QE1B 3QLHB 2RF2B 5DG7A 2B5JA 3PW5A 3V4IA 5KFNA 4RNNA 3KLFA 4Q0BB 4NLSA 2YKMB 4ICLA 2R8IA 3KHRA 2OPQB 1S97A 1XR7A 3E51A 3G86A 5DQGA 2W9BA 3LP1A 1RDRA 3EPGA 2BQ3A 3QZ7A 5KT5A 1JLQB 2W9AA 3BQ2A 5KT4A 1EP4A 4ZHRB 3V6KA 4ZPCA 5FDLB 1RYSA 4NLGA 4NLYA 2B6AA 1IKXA 2IC3B 4RW4B 1S9GA 1S6QB 5KFIA 4IG3A 5KG5A 4K4VA 2I5JB 2R2TA 3ISNC 3H98A 3ITHA 1VRUA 2ZD1B 1RT2B 1S1TA 1JIHA 5I42B 4I7FB 3T1AA 4ED3A 1RTDB 2FLPA 1GX5A 4EYHB 4K4ZA 1LWCA 3E01A 5KFKA 3BJYA 3CJ3A 4NZ0A 3FSIA 4RW9B 3OL9A 5KFVA 2ASDA 1DLOB 2BE2B 5KFMA 2F8EX 2OPSB 2CKWA 2YNFB 3LAMA 4ECTA 1N6QB 4RW7A 3MTKA 2QE5A 2AGQA 3M8PB 1IKVA 4IDKB 1JLGA 3DOLB 1K1SA 2AX0A 1DTQA 5F8JA 5HBMB 4XPCA 1S1XB 2FVQA 3MR3A 1HMVB 2HNDB 1JLEA 3BSCA 1VRTA 1DTTB 5KT2A 3T5JA 2UVRA 3MEGA 4NLXA 4NLOA 1SV5B 4RW6B 4KO0A 2YNIA 5C25B 3DM2B 4FS2A 4I2PA 4O3SA 3UR0A 4O3OA 4R8UB 2FLNA 3CJ2A 3I5BA 2W7PA 4G1QB 5F8IA 2IA6A 1RAJA 4DL5A 3N6MA 3JSMB 4ED6A 5KFUA 3KLGB 3KK1B 4WFZA 3JYTB 1RTIB 4F4YA 3DRSA 1RA6A 3I0RB 2C2EA 4LSLA 4IG0A 2WONA 4DL2A 1C1BA 5HROA 4K4YA 3MR2A 1EETA 4MK9A 3PJWA 5K14B 4Q45A 3KMSA 4RNMA 3KK2B 1LW0B 3KLEB 3EZUA 3HHKA 1ZTTA 1QAJA 3V6HA 1S1VB 4O3PA 2ILYA 3HVTB 2OH2A 3MEEA 2HNZB 1LWEB 1QUVA 3IRXB 3BSAA 3CJ5A 2J6UA 4FBUA 3MECB 2WRMA 1N48A 2E9RX 1C1CB 2QV6A 2XI2A 1KLMA 4IFYB 5KFWA 4EEYA 1RT5B 1S9EA 4WE1A 3MR6A 2WOMB 5J2MA 4QWCA 3LP2A 5KFPA 3PW7A 2AU0A 4IKAA 2R8GA 2JLEA 5KG7A 3EPIA 4WXWA 4K4XA 2VA3A 1NHUA 4NRUA 1HQUA 1BQMB 1TKZB 1ZETA 1TL1B 4TQSA 4TY8B 2ZE2A 2ILZA 3H5UA 3LP0A 4ECZA 4ED8A 3DI6B 4MIBA 3I5CA 3UDLA 2RDIA 2C2DA 5CYQA 4QWDA 1NHVA 1J5OA 2WCXA 3OLAA 3IG1B 3H40A 3DDKA 4O3QA 3H4BA 3MEDB 3V6DA 5J2PA 3V6JA 5F8GA 3KMQA 1CSJA 2D41A 1UWBB 5KFCA 2I1RA 5F8HA 5KG0A 2OPRB 2BRLA 3KLIA 5KFOA 4PUOB 4MIAA 3KK3B 4ECYA 4O4RA 1T3NA 4F50A 5F8MA 1LWFB 4HYKA 3CJ4A 4J9NA 3DMJB 4ZP7A 5L1LA 4Q44A 4ECSA 4ZMMA 3TQ1A 2C2RA 2GC8A 1RT6B 4FS1A 2V4QA 5EWFA 4MH8A 3BSNA 3I5AA 2UVWA 3T5LA 4ED0A 2IAJA 1HPZA 4MFBA 3VQSA 1C0UB 1FK9A 4RW9A 4IOBA 4HKQA 1HYSA 1REVA 1JKHB 4PWDB 2HAIA 1TKXB 5HLFB 4MK7A 3RB6A 4ZVGA 2W9CA 1R0AB 2HWHA 2RKIA 3QIPB 5J1EA 5DLFA 5J2NA 2GIQA 2YNGA 5KFRA 2W7OA 1HNVB 4RNOA 2JC0A 2YNHA 3D28A 3CWJA 1XR6A 5DQHA 2HMIA 1S1XA 3DLEA 3BQ0A 2J6TA 1Z4UA 2XI3A 2VG6B 3FFIB 4ID5A 3HKWA 3M9NB 4B3OB 4Y2CA 2XGPA 3RAXA 5L1IA 2R8JA 1JLCA 3KLHA 3V81A 3SFUA 4J9MA 5KFGA 3T19A 5J2QA 3G6YA 3HVAA 4O4GB 3DRPA 3M9MB 3RBDA 1ZTWA 3KHGA 3T5HA 1JXLA 2WK4A 4IRCA 1TV6B 1S1UB 3GIMA 4NRTA 4F4XA 1N5YB 5C42B 2V0NA 4I2QB 2BQRA 1T03A 4RW8B 3OL6A 2YKNB 3DRRA 3OSNA 2VG5A 2E9ZA 1C0TA 1BQNA 3M8QB 5KFBA 4ED1A 3IS9A 2O5DA 1HQEA 4WYWA 4R0EA 1OS5A 3DYAA 5D3GB 4KBIA 4IR1A 1IKWB 1JX4A 1S6PB 3DOKA 1JLBA 4R5PB 4NLPA 1TVRB 3I0SA 2IMWP 2R2SA 2FJVA 4DL7A 4KKOA 1U09A 5I3UA 4ZP8A 2IJNA 3C6TA 3QO9B 4KV8A 4IH7A 5F8NA 4KFBA 4Q43A 1FKPA 4ZVEA 3Q8PB 4PQUA 5C24B 3PR4A 3OLBA 4IQXA 2VG7A 3GIKA 4QWEA 4ECQA 3QZ8A 5KT3A 4ED2A 2BANA 4QW9A 2OPPA 1RT1A 4YQWA 1S1WB 4X2BA 3QIDA 1LW2B 3DLKA 4H4OB 4IFVA 5KFSA 3TAMB 3KJVA 2HNYA 2RDJA 3OSPA 5CYMB 4H4MB 1WNEA 2XWYA 5F8LA 1SUQB 1RT4A 3C6UA 3NBPA 4LSNA 5KG6A 2XGQA 1RT3A 1T05B 4J9RA 4RU9A 2R8HA 4WYLA 3LALA 4H54A 4TN2A 4K4TA 5DGAA 3DLGA 5HP1A 3OL7A 2B5JB 5EWEA 3H59A 3V4IB 4ECRA 3KLFB 4ECWA 4J9QA 3Q8QB 1RTJA 4ICLB 4XO0A 1S0MA 4EO8A 2JEFA 4TY9A 1TL3A 2W9BB 2IBKA 3LP1B 1SH3A 4NLQA 3NAIA 4QPXA 4KHRA 4TYAA 5KT7A 1HNIA 1EP4B 1K1QA 2B6AB 1IKXB 1JLAA 4URQU 1S9GB 4IG3B 2AQ4A 3BGRA 3ITHB 1VRUB 5KT6A 3GV7B 1RTHA 3OL8A 1S1TB 3QGHA 3QGIA 1MU2A 1RT7A 2J6SA 3PJXA 3IGNA 5KFQA 4NLRA 1LWCB 3E01B 5JUMA 3BREA 3QGGA 1JLFA 1TKTA 3ISND 4DG1A 5EWGA 4O44A 3IGVA 4ZPAA 4DL4A 5F9NA 4K4UA 3GILA 4RW7B 4NCGA 5KFEA 1IKVB 3NAHA 1IKYA 4ZP6A 1JLGB 3LAKA 2V4RA 1QE1A 1DTQB 2ZKUA 2RF2A 3QLHA 3OHAA 4K4WA 4Q8EA 2R8KA 4Q0BA 2D3ZA 2YKMA 1JLEB 3PW0A 4K4SA 4B3OA 1VRTB 2OPQA 4F4ZA 3H5XA 3MEGB 2HWIA 2YNIB 1JLQA 4KO0B 2FLLA 2DPJA 4I2PB 4ZHRA 4NLUA 3H5YA 3FDSA 5FDLA 2IC3A 1RA7A 4RW4A 3H4DA 1S6QA 4RNHA 2I5JA 5DG8A 3GV8B 2JEGA 3PW4A 3LANA 2JEJA 2ZD1A 5L1KA 3KOAA 1RT2A 3DRSB 5I42A 4I7FA 4LSLB 4IG0B 4JV0A 2WONB 4QWBA 2W8KA 1RTDA 4IRDA 1C1BB 5HROB 2FJWA 2W8LA 3KNAA 2AX1A 3GIJA 1EETB 4URGA 1DLOA 2BE2A 1S6PA 5F9LA 2OPSA 2IM0A 3PHEA 2YNFA 4WZMA 3CIZA 4MKBA 4RZRA 4M94A 4WFYA 1N6QA 3PVXA 3T5KA 1RYRA 3M8PA 3MEEB 4IDKA 3DOLA 5KFFA 5HBMA 2AGOA 3G6VA 2UVVA 5D3GA 1KLMB 3RAQA 2C28A 1HMVA 2HNDA 1HARA 1C2PA 4WFXA 1S9EB 4WE1B 4J9OA 1DTTA 2XCPA 3BQ1A 4DL6A 3CDEA 2UVUA 4RW6A 1SV5A 1XR5A 3GYNA 4ZVHA 5C25A 3DM2A 3LP2B 1D1UA 4OL8A 4QWAA 1FKOB 3MFIA 1S10A 3UPFA 4R8UA 2AWZA 5L1JA 1QAIA 3NL0A 4G1QA 3RB4A 3KHLA 5JXSA 3H5SA 1HQUB 1TQLA 4NLDA 3Q8SB 3GQCA 3JSMA 3KLGA 5EUHA 3KK1A 3JYTA 2ZE2B 1RTIA 4ECVA 3I0RA 3LP0B 5CYQB 4DL3A 1J5OB 5DGBA 4Y3CA 3Q8RB 3PZPA 2VA2A 5K14A 3V6DB 3KK2A 5J2PB 3N6NA 1LW0A 3QYYA 3KLEA 5KG1A 5KFHA 1S1VA 3NMAA 3KLIB 2WHOA 3SI8A 3HVTA 3BR9A 2HNZA 1LWEA 3CDWA 3IRXA 3SFGA 3CO9A 4NLWA 1S48A 5DG9A 4YMEA 4J9KA 3MECA 4JUZA 4Y34A 4TYBA 1C1CA 4URSA 3FQKA 4IFYA 1S4FA 1RT5A 4J9PA 3RB3A 2BRKA 4EBDA 1GX6A 2WOMA 4EBEA 2C22A 4JV1A 2IAJB 1HPZB 4MFBB 1FK9B 2JC1A 1HYSB 1REVB 2V9WA 3CVKA 5KFTA 4ZPBA 4ZP9A 4IRKA 2W9CB 2FVSA 4K50A 1S0OA 1BQMA 1TKZA 2RKIB 1TL1A 5J1EB 3N6LA 5J2NB 5DLGA 2YNGB 1SH2A 4TY8A 5EDWA 1W25A 3OHBA 4J9LA 2FVRA 2ALZA 3DI6A 2AGPA 2YNHB 2FVCA 3MR5A 3TVKA 2HMIB 3DLEB 3NKYA 3IG1A 5KG2A 4ID5B 1S9FA 3MEDA 1JLCB 4U6PA 3KLHB 3V81B 4IR9A 4IH5A 3PW2A 1UWBA 5J2QB 2OPRA 5KFAA 4PUOA 3DRPB 5C5JA 3KK3A 2BR0A 4KHMA 1N56A 2IM3A 5KFYA 3M9OB 3GV5B 1IM4A 5KFZA 1LWFA 2ASJA 1T03B 2FJXA 3DMJA 3CJ0A 3DRRB 2VG5B 1RT6A 1C0TB 1BQNB 1S0NA 3MFHA 2R2UA 4MK8A 3RBEA 3IS9B 1HQEB 1KHVA 4G3IA 5KFJA 4YR2A 3DYAB 2UUTA 1C0UA 4Y2AA 4DEZA 4M95A 1MMLA 5KG3A 3DOKB 1JLBB 1JKHA 3I0SB 4PWDA 1TKXA 2UUWA 4ED7A 5HLFA 2DPIA 4NLTA 1R0AA 4KKOB 3PR5B 3QIPA 5I3UB 2XC9A 5L9XA 3C6TB 4KV8B 1HNVA 4KFBB 4PQUB 1FKPB 3KLVA 4LQ3A 2JEIA 2VG7B 2EC0A 3UQSA 2BANB 2VG6A 4ZPDA 3FFIA 4TXSA 2OPPB 4J9SA 2IM2A 2BQUA 1RT1B 4WZQA 3DLKB 4TQRA 4IFVB 3KJVB 5T14A 2ATLA 2R2RA 2HNYB 2B43A 4EBCA 4O4GA 4EYIB 3KHHA 3FRZA 1FKOA 1S1UA 1TV6A 1N5YA 3GIIA 2XCAA 1RT4B 3C6UB 3ICLA 3NBPB 4I2QA 4LSNB 1RT3B 5C42A 4U7CA 4RW8A 4RUCA 3D5MA 2YKNA 1T94A 4LQ9A 2D7SA 4MKAA 3IN5A 3M8QA 1TP7A 3DLGB 5HP1B 2IM1A 3FQLA 4WXOA 2CJQA 1YVFA 4O3RA 4YR3A 3RB0A
chains in the Genus database with same CATH superfamily
2QLWA 3I55S 3EE3A 2B56A 3CUNA 4QCLA 3QO9A 1H74A 1UWAA 4A8QA 3M6VA 4F0KA 3JSBA 2QTWA 3NCRA 2MTLA 3O2IA 3AY0A 2FVPA 2J0SD 4P75A 2ZH2A 3NCQA 4OX7A 5DZ7A 3N5FA 2MLXA 4CYUA 4NI2B 1TAUA 3V6KA 2VOOA 2NZCA 3ZXWA 2CJXB 3MMCA 5LSOA 3CCWA 1WHYA 2HHXA 2F8EX 2RS8A 2KFYA 1XQIA 1G4CA 2YX1A 1NPKA 1DTTB 2GGPA 1TL5A 1HWJA 2AEJA 3I5BA 2Z0GA 4PABA 2DCLA 5E5NA 4MK9A 1NK9A 1HBUA 3L9ZA 3HXMA 3Q2SC 4DV6F 4O3PA 3MCMA 1WEXA 1T11A 3AB2B 2QV6A 3LPEA 4PZVA 2HZCA 3IBCB 1AT1B 1CJKA 2RIJA 3HHEA 3G9CA 1BQMB 1R8BA 3W62A 1XIQA 1WDTA 4DS4A 4K0KJ 2EFNA 4BHQA 2V67A 5CYQA 3TYTA 1NHVA 2CUYA 5D78A 4X4VA 4OQJA 1H2TZ 3UFCX 3T6BA 1CSJA 1FJ7A 3GJSB 5C2CA 3M32A 1U1PA 2V4QA 3IWLA 4YOEA 2OIHA 4CLSA 3GG1A 1N32J 1GH8A 1GTEA 5J1EA 1O5JA 5KFRA 4WP3A 4YY3F 4RNOA 2XZWA 2HMIA 1YJUA 4OZ5A 1MMNA 3CW2C 5HMZA 3MPUB 4FF4A 2O5DA 3UNGC 1VQ5S 2XM3A 4IR1A 2V9KA 3EYZA 4DL7A 2FHKA 4Q43A 3PR4A 4IOCQ 4QWEA 1T0TV 4ZVUB 1RU1A 4X2BA 5KFSA 2XTDA 3PYEA 2RDJA 5CYMB 2Z2LA 5ITHA 2YWFA 4LSNA 4J9RA 2D74B 3MCSA 4MYTA 2OFGX 3BPDA 4F4KA 2P8IA 4M8LA 3PX0A 3MTJA 3T1YJ 1YSJA 1GMWD 4JI6J 2W9BB 1SVDA 2BM1A 4HDGA 2W4DA 4PRFA 2QC3A 2RQCA 1SJ4P 3GR1A 1L3TA 2Y1JA 2B8QA 1JLFA 1TKTA 4NYPA 4ZA1A 3UCZP 1TK0A 1N36J 2HBRB 1DTQB 3D7SB 1YTYA 2OPQA 3MEGB 4C6AA 2HBQB 2ZDOA 2MHEA 2FJDB 3CNQP 1UPPA 1SB6A 2AEMA 2IMOA 2CRLA 4ZJOA 3IAS9 4WFYA 5THWA 3R5BA 3NNHA 2XCPA 3MAAB 5C25A 4ZVHA 2QL9B 5E3RA 2RQ4A 1Q95G 4NLDA 4CTAA 4D3GA 3K5PA 4OI2A 3R1HA 2MZSA 2X1BA 2Y0SD 3OV7A 3MI7X 5KG1A 1X0FA 5GVQA 3SI8A 1RHMB 3HVTA 4CWBA 2HFNA 4DHVA 2K7JA 4YMEA 1IXKA 2ZBRA 4J9PA 1TL7A 1U0HA 4JV1A 4ZPBA 4K50A 3AD7C 4JI8J 1RZMA 4X66F 1XMQF 1KBRA 2RQKA 1S9FA 5IV3A 3PW2A 1VR6A 2ZHAA 3GIRA 5C5JA 1I51B 3TZYA 5D6GA 1V3RA 1T8EA 3DYAB 4Y2AA 2L9DA 3I4PA 1RWWB 2HEKA 2QLFB 1HNVA 5HMYA 4PQUB 2CQCA 4HH0A 4HTIA 3QT5A 2ATLA 1RTZA 2GO8A 1S1UA 1G2EA 3C16B 1KKHA 1Q7LB 1T94A 4ZJLA 3IN5A 3M8QA 2BJ9A 3JTOA 3HD1A 3FQLA 2CJQA 3QAEA 3G87A 3PXGa 2D3UA 2B9WA 4NYZA 2HRUA 1HNIB 3BPSP 1K0TA 4LJMA 1GEHA 2E1CA 1S1WA 1M90T 4ZCMA 4H4MA 4F4WA 2VC0A 1T05A 2KTQA 2B5JA 4E8UA 2CA9A 5ETKA 4NLSA 5I4MA 1RDRA 1HD0A 3OVAA 1T9UA 1EZZB 4RW4B 4DCJB 2ZD1B 2QYCA 3J7Z5 4ED3A 1X4AA 4EYHB 1YBAA 2I9SA 1KONA 3RU0A 3K17A 1N6QB 5L46A 1VQ7S 3KTQA 4XTTA 3L7OA 3QRQA 2VIHA 3NMRA 1Q0NA 4DLGA 4KO0A 2YNIA 4KPYA 5ETNA 1FEHA 1HBOB 1ZAWA 3CJ2A 2B9YA 2CAJA 5F8IA 2LXUA 2FDNA 3N6MA 2POKA 2DHGA 1RA6A 4QYZJ 2R7OA 5HROA 3DRXA 3ILOA 3A3NB 2ZBPA 3KK2B 3TNVA 3V6HA 1S72S 2GV1A 2D9PA 4RWWA 1QUVA 3GPAA 1KLMA 2BX6A 4WE1A 3HI9A 4GO5X 1NXIA 2CVIA 2EXUA 3SYZA 3EPIA 5K8NA 4N77A 2DR5A 1TKZB 2M5YA 1PYTA 5HQLA 2HVDA 1H73A 4ETZA 2XSFA 1G1XA 2VZ9A 5KG0A 5F8HA 4PUOB 1WHVA 3KG4A 2FQQB 1T3NA 4HI1A 4HYKA 1FJGF 4JI3J 2UUBJ 2H4YB 2MPUA 4F25A 3QRPA 1A6LA 4ZLNA 3M8SA 4CO5A 4JI4F 4PPZA 1YGYA 2XSJB 1N88A 1SJRA 3RB6A 4ZCLA 3RRKA 2G2OA 2W7OA 2UUBF 1R43A 1XR6A 1FDDA 3DXSX 3FFIB 3ADAC 4ZVOB 3KLHA 2GFFA 4WFNQ 4M5JA 1NK0A 1Y11A 2XYPB 3CPWR 4OI1A 1XMOJ 4DV7J 3UR3C 1S5ZA 2HZVA 3Q22A 2ZH9A 2P9GA 2CQBA 1XNRF 1VK3A 5AXLA 3MGJA 2DK2A 1CLFA 3R6GB 2ACYA 2W4CA 2C1EB 3PO5A 3QO9B 4IH7A 2NYIA 5G4DA 1U2RA 3TA0A 1RT1A 3TJAA 1PYSB 4M5HA 4OJ3A 5AE2A 3MPYA 1LV5A 2K8GA 2ZH5A 1BC6A 5EWEA 1ULRA 4QIGA 3UD4P 4ZK7M 4DUZJ 1W2BR 2MKYA 3NOCA 5G0RA 3BZQA 3TJ9A 4RBUA 4DUZF 3MMCB 3QGGA 1YRXA 5BR8J 3GILA 3BDPA 4ZP6A 2G1HA 2FHOB 4MMOA 3D1QA 3UDVA 3VR1A 1HNXJ 3PW0A 1NAQA 2GGPB 3O5TB 3TR5A 2DH7A 2DGXA 2B4VA 4XIUA 3VHQA 4N8OA 2G13A 5E3AA 5L1KA 1RT2A 4KC5A 1DRZA 1WKKA 2R4FA 3MM9A 3ZZZA 1WACA 1HBUB 2G1DA 3GJRB 3PDNA 1D9AA 1F0XA 4O23A 3RAQA 4CM2A 2QG9B 4HR2A 2YQ1A 1CJKB 2KG1A 4QWAA 4F3OA 2XHCA 3PRBA 3LW5C 4GVBA 1P9QC 3KK1A 3GSDA 3R9LA 5CYQB 3P3DA 3DRYA 2Z4PA 4GRSA 1HHQA 3SFGA 3CO9A 3MECA 4JUZA 4Y34A 2OO4A 1VQLS 3M32B 4LMZA 4P6QA 3B54A 3TUPA 3D9BA 3I56S 4CLTA 2RMLA 1SBRA 1VC5A 4OHXA 2AYMA 4TLQA 2YXLA 4ZS6A 3BBCA 4ELVA 4DPXA 5J1EB 3N6LA 2DGTA 1T9VA 2HMIB 2GS8A 5K8MA 1PBAA 3NNAA 2KI2A 1IM4A 4OI3A 2GQQA 2VL1A 5D4LA 5LMNJ 2AT1B 1S0NA 1VHFA 2DR8A 3M8ZA 1C0UA 1OYEA 4M95A 3M2UA 4MT1A 1JKHA 1TKXA 2E1PA 5B0BA 3J81Y 2DYAA 3QIPA 1FNXH 3HZGA 1NJZA 2BE9B 4NWBA 1PGZA 1QM9A 4J9SA 2E5LF 1FFSB 3VAHA 3R5AA 4U7UK 2B43A 3AXMA 3CD5A 3KJQB 3KHHA 4EYIB 1FKOA 4X4QA 4LSNB 2WSCC 2D7SA 2HLTA 2OI2A 3JQJA 4PEOA 2FZCB 4ZVFA 3MUMP 4HI2A 2MY7A 3MCOA 1RHQB 4RUAA 3C15A 1UA0A 2BKNA 5F0UA 3WX8A 4LFBF 3FMBA 2EEYA 2OSQA 4EMDA 1JLFB 1TKTB 4C0OC 2KHDA 5KFDA 1OY8A 3PY8A 3N79A 4F3MA 1SH0A 2GAHC 4N76A 4KHPF 1ROFA 3HHNB 2OPQB 3D4JA 3MMBA 2YY3A 2IBOA 2H5JB 2DXDA 8AT1B 4DQPA 3ZTRA 1FJCA 4MYUA 1VC0A 2DGUA 4PCQA 4CH1A 2R2TA 2XY6A 4IG3A 3D0IE 4TKTA 4J91A 4FPRA 2FYXA 3BGLA 3CJ3A 2DNKA 4ER8A 5ETLA 1B4SA 1FA0A 1F6TA 2DJWA 2HBYB 1EJ7L 1RHRB 5IT0A 2AJFE 5C25B 4XAKA 1NZ8A 1WWHA 4OYMA 4ZVQB 4CTAB 3QMQA 4WFZA 4A46A 3DRSA 3DLJA 1RLDA 3HFKA 1C1BA 4LIRA 4Q45A 3FRYA 1UEKA 2Z30B 2ILYA 3HVTB 2AJ4A 4F26A 4ZDNA 1TL7B 1UFKA 2NXEA 3G8QA 1U0HB 3GJTB 4OYOA 5E41A 2QLJB 2CPEA 2ZC4A 3DGVA 2HPUA 2ZE2A 4ED8A 2FHJA 3H40A 1IQZA 4OI4A 4I4BA 1BHNA 3CJ4A 2B4OA 4GMKA 2GC8A 3RAMA 4M5MA 2XULA 3QGPA 2KXFA 2CYYA 3KNGA 3DOMA 3IFEA 5J2NA 2BV3A 1HNVB 4EZ9A 1R31A 2NUUG 2J9DA 1BLUA 4CO3A 3HKWA 4LFAF 5L1IA 3Q8UA 1S1UB 2CWXA 3CCQS 4XDDA 3AX2A 4OZ0A 3M8QB 2KU7A 1JLBA 2LEAA 2BKPA 3CCVS 3LGHA 4P74A 4GKJJ 3D1HA 1VBYA 2QMWA 1QLNA 1S1WB 2IY5B 4H4MB 4X4NA 4NPOA 2VONA 1T05B 1YKWA 2HGNA 3OL7A 2B5JB 2FJBB 2OUGA 4ECWA 3JAMY 3H42A 1QY7A 1A0OB 2JEFA 2ZC3A 1SC4B 4NLQA 4QPXA 1KTVA 4AT1B 1RACB 3T9ZA 5A6WA 3QGHA 2X3GA 3BN7A 3MUTP 4X64F 1TL4A 2JFDA 4A47A 3T1HJ 2LP4A 3KJFB 2QSFA 2MZQA 4KO0B 2YNIB 1OJ4A 4LF4F 4J37A 3FDSA 2DGOA 4RNHA 3HD2A 1YZ7A 3TQEA 1OQ3A 5HROB 3QATA 3D6TB 3BBFA 3PVXA 1RYRA 4B3SF 4IDKA 1APSA 5KOXA 2M8DB 1KLMB 3CJKA 2QLXA 4WE1B 2UXCJ 3M8WA 3MD3A 3GYNA 2XS2A 4QZVB 1QAIA 3EGWB 1LKZA 1IJEB 3WBZA 1BY9A 3IP0A 3A4TA 4KGXB 4Q2MA 3UD3P 3R8YA 3Q2TC 3HLUA 4IFYA 3NGTA 3R7BB 2BRKA 2ALYB 1R89A 4DV3F 4DDFA 5D77A 5L9NA 3PACA 5KFTA 2V68A 5A8RA 5AE1A 3OHBA 3CCTA 2KYZA 3D2WA 4IO1A 3OR2A 3KLHB 4Z37A 4IH5A 1ACMB 5IS2A 1OSCA 1FDNA 2ASJA 3KUHA 3CJ0A 1OWXA 3K89A 4DUYJ 3O6QA 2XY7A 4FYXB 1YBTA 2E1MC 1DURA 2D69A 2GVZA 1CC8A 1NSKL 3KLVA 4QR1A 1UCNA 2AZ3A 2C2ZB 3SQOP 3OTOF 1RT1B 2KT2A 5B7WA 2ZH7A 3FRZA 5A8WA 2KJWA 4U7CA 2HGLA 5FIIA 4S0MA 1K8AT 2W7AA 1RKJA 3L7PA 1M5VC 1MN9A 1VK8A 2WB4A 3IR6B 4R5PA 2XMVA 4O3NA 5D15A 1PG5B 1IUJA 4I6YA 4KB7A 3KJNB 5G0RB 3ELHA 3ZNUA 2CPHA 3GB0A 1UVKA 1VIXA 1CG2A 2VUGA 4OIXA 4Y28C 2CNNB 3GWCA 2W24A 4MIWA 4NLVA 4C11A 4YP3A 4ZN1A 2GMLA 3IC1A 1NDKA 4LR8A 2AYGA 4PYAA 4ICLA 3C8YA 3KHRA 3NLCA 1KOHA 1OY9A 2ZITA 2R7VA 1N0VC 4I68A 1RT2B 4DJBA 4JI0J 5AT1B 3OL9A 3MM9B 1KD1T 1KDNA 3GZ7A 3LAMA 1HWKA 1K1SA 1JJ2R 4JI0F 1RI7A 2VQFJ 4NLOA 1VQPS 2W7PA 1NJYA 1B0VA 4GVBB 1T9TA 3KK1B 3VF0B 2V8PA 4IG0A 2MQOA 3GCWP 3D3BJ 3EZOA 4UT4A 3PEHA 1ZTTA 3BSAA 3MECB 5B0AA 2JDJA 2HBZB 2HHTA 1CBKA 3I6PA 1UVMA 4LFCJ 1N34J 4Z7YA 2CJAA 4EI2A 2KRBA 1XC9A 4V19J 1QTMA 2RDIA 2RJZA 4QWDA 1M1GA 1N34F 4L3NA 3LTOA 1TUWA 2EFPA 1WEYA 1WHXA 1PIEA 4JBCA 3KDNA 1HL6A 2Z57B 1JQGA 4ANEA 1C0UB 4HVZA 2XZ2A 3M2UB 1I94J 1JKHB 1TKXB 4F4AA 2RU3A 3OUYA 3QIPB 1QVGR 3EGZA 2JC0A 3DLEA 1Q5VA 1K44A 4IO9Q 4Y2CA 3A3PB 1JLCA 4P71A 2H9ZA 2WBMA 3KHGA 2NSCA 3FSYA 3VVUA 2D3O1 2RUGA 4P2MA 1SJ3P 4EGLA 4CRJA 3L7UA 1RWOB 4KV8A 1Q79A 1Z2ZA 4K2JA 3C15B 1BD6A 1VQ6S 3GYGA 4KR0B 1SKUB 1FRXA 2GNKA 1WG5A 1RT4A 1KVJA 4BWJA 1X5SA 5JVHQ 5MAOA 2HFSA 3DLGA 2NR0A 3H59A 1FRIA 4DFPA 3SEOA 3MMBB 3G2XA 2W2QP 5D4PA 4M5NA 5IQ6A 1K1QA 4URQU 2HSEB 4IG3B 3H90A 1PILA 1QVFR 1F5CA 3EGVA 1H0HB 3TUIC 2DO4A 1KQGB 5I3PA 4DV0J 2YKMA 3R27A 2N82B 1HNWJ 2NXUA 2DO0A 2XMWA 2VQEJ 4FF3A 3DRSB 1RTDA 2E5IA 4OYIA 1PJ7A 1C1BB 3BGUA 3L3CA 1HNWF 2LQ8A 4NCBA 1AROP 2N4DA 3M8PA 2HHVA 1UFLA 1LOUA 1NJXA 2UU9F 4UY8T 2EFQA 3CDEA 1ZA1B 1SV5A 3UPFA 5L1JA 4Y65A 3MEKA 5DDQC 2HHWA 2ZE2B 3I0RA 1K73T 4C3LA 3AJ1A 1VC6A 3HFVA 4FF1A 3FNNA 5FLXY 4P73A 1F9HA 1RT5A 2ZNZA 4C8OA 2ZM6F 5HMWA 4TNOA 4DWIA 2XTEA 1JXEA 4P7VA 3FCVA 4ETXA 4IRKA 2V2ZA 3DOMB 2A3JA 2BJ8A 5J2NB 2HVZA 4QU7A 1VFJA 3MR5A 4LVOP 3B4MA 2DITA 1SCJB 4DR5J 1KNZA 2Y1RI 1TK8A 2NLWA 3K2YA 2OJ3A 1X4DA 3C46A 1AZSA 2ADBA 4YEAA 2UUAJ 2G2YA 2DH8A 3N9UC 1JLBB 1UZDA 2JHEA 2LLZA 4LSZB 2HHHJ 1RLCL 2IHR1 2ZWOA 4DN0A 4AL5A 4OJHA 3CCZA 3W64A 2QIFA 4O4GA 5A8KA 3JSRA 4DI6A 5C42A 4I2QA 2OMOA 1CVJA 2K06A 3FCHA 1IBKF 2ADCA 2R7RA 1FT8A 1YVFA 1NPPA 3POTA 2CZVC 4UZCA 1I1GA 1MNEA 1I6JA 1H72C 3G96A 1CJTA 1CJUA 3S6EA 4H4OA 1B7FA 4UOCA 4CLFA 1FNOA 1ZM9A 4EO6A 3FSXA 4NZ6A 3BO4A 4NL5A 1KN6A 3BS9A 4ATNA 2RQMA 4WU2A 1SKRA 3EPGA 3QZ7A 4QQBA 2W9AA 3PV8A 2CQ1A 3OT9A 1EP4A 3JTPA 2AKWB 2B6AA 3CC2S 5DZ6A 4K4VA 2PFDA 2KM8B 2DGWA 4K4ZA 3DFEA 2CKWA 2QA4G 4DR7J 3ZTPA 4IDKB 3UDEA 3ETMA 1NK4A 3R5GA 4XPCA 1A9NB 2GJFA 3CJKB 4FKXA 1NRKA 4HTJA 1RAHB 2E5GA 3Q86A 3GG0A 3D6HB 1O6XA 4LSLA 2ZH6A 2VFTA 1EETA 2Y3YA 1QAJA 3EZUA 1V5VA 4DF4A 2VDHA 2WRMA 3SSSA 4IFYB 5CYJA 1X9SA 1ZS6A 2F1FA 1VISA 1U1RA 5A8RB 1XN9A 4TQSA 4LBPA 5HJYA 5B0FA 2BMBA 2MQMA 3CIMA 3OR2B 3V6DA 3M05A 5BYRA 3W1YC 5K5MA 2KXNB 3A1YG 3GYXB 4Q44A 3W2WA 3BSNA 2XS7A 3PO4A 4F04B 1AW0A 4G1PA 4DCOB 1REVA 2PN6A 2GVZB 1KVKA 2VC1A 2GIQA 2FHMA 1X60A 2NYHA 4DV5J 2VBYA 1Z2LA 4B3OB 3I9V9 5A8WB 4EFAC 5K20B 1TFWA 4NRTA 2V63A 2HVIA 1DQ9A 4N8NA 4Q7AA 2NCKL 1UFWA 2DXFA 1N33F 5E3PA 4R5PB 4HHJA 5C2GA 3MM6A 4IYQA 1LK5A 5IWAJ 5F8NA 3GR0A 2YPYA 2PEBA 2BANA 3QIDA 4CH7A 1F3FA 1ZPWX 1AUSL 2VBWA 3CO0P 4L73A 1RT3A 1WOOA 1T02A 3HMJG 4JI5F 1P6TA 4C11B 1WC5A 2U1AA 4ICLB 2B9XA 4U7UD 4C8LA 3PIOQ 4JI7J 1RBLA 5CHCB 3TEHB 2V50A 2HHQA 4QR0A 2XMTA 5IM0A 2J76E 3CJTA 5EWGA 4DL4A 4FXWA 4ZCKA 2WVCA 2LU1A 3G8TA 1J5EF 4CT9A 4F4ZA 2FLOA 3H5XA 4ZHRA 3H4DA 4USKA 4ZPVR 3NEKA 2HZAA 4BCAA 3Q89A 4IG0B 3LH2S 3JTNA 2W8LA 2AX1A 1Y3JA 2YKOA 2XNQA 2LA4A 4WZMA 1VJWA 1M1HA 3U02A 3W5XA 3DOLA 1PCAA 4DL0C 1X31C 2UVVA 2DNMA 2OELA 1HMVA 1ZM3A 1MWYA 3M2VA 2ABYA 3T3FA 5SZTA 4G1QA 2OMLA 3KHLA 3P45B 4C4WA 3PTWA 1YIJS 1EKSA 1UW9A 4WU3A 4DR6J 3BM7A 4ZIVA 1DBDA 3BR9A 4ILRA 1WC4A 1XTZA 5M2RA 1SIWB 3PM9A 1HR0J 2KG0A 1EQMA 1ZM4A 4USIA 3OUYB 3C14A 4LF9J 4J9LA 3AOBA 2FVCA 5ETMA 3DLEB 3IG1A 3RR8A 2Y8YA 1JLCB 2ERRA 4DSFA 3AJDA 3KG1A 5KFYA 3GV5B 4WIIA 2FJXA 2FC8A 1E6YA 2QN6B 4BC9A 2HURA 4G3IA 1R8HA 2G9OA 2KFZA 2DRAA 4ELTA 4KV8B 1H38A 2M7SA 2UP1A 1R0CB 2M0GB 2GHWA 2M4MA 1RT4B 2CPJA 2DNRA 3DLGB 2EFGA 1Q1KA 1U1MA 4NOHA 1FHTA 2MKJA 4KE5A 3EDQB 1NNDA 1AB8A 3H2LA 4QIWD 3G6XA 3NGSA 1X4EA 3HULA 4RNFA 1UJ6A 1BQXA 2WTFA 1FKAF 4GC6A 1KHWA 5KFLA 2A1BA 1U45A 5DG7A 2B3TB 2KH9A 3R6LB 2HIYA 4LR7A 4RNNA 1JJ4A 2YKMB 3D1OA 2QFJA 2LYVA 4NLGA 4OL8A 5DM7Q 1S7HA 4U95A 3T1AA 1RTDB 5LXYA 1LWCA 4OV1A 2EBGA 3IBWA 2UUCJ 3QQCD 2PMHA 4RW7A 3M8PB 3SCJE 4YDDB 1U2CA 4FYWB 1SV5B 5GAGI 3KKFA 1HNZF 4OMFG 3JQMA 3LWMA 2MQNA 1N5QA 1OMSA 2JNJA 1NSQA 4LF6J 4X62F 2OEJA 2QEXS 3I0RB 2W2PP 1LXJA 5DS7A 2H1YA 3ZZTA 3DHWC 3J7ZT 4RNMA 2HK3A 2BUNA 2HAFA 2KT5A 4QIEA 1RT5B 4TU8A 2NPFA 4LT6A 4EU0A 1WKLA 3LP2A 5KFPA 3PW7A 3UN5A 1C4AA 2MGZA 4QIVA 2R8GA 3SCLE 1HHSA 1XEZA 1XBWA 2C2DA 1RGVA 4UOGA 3TRGA 4OZNA 3CCJS 5KFCA 2XLKA 3KLIA 4MIAA 4HT7A 2GZOA 2HW3A 5GMEA 1AZSB 4PG6A 3SZ2A 2ROEA 2ZH3A 1JWWA 5DLFA 4HL9A 1X4HA 1U02A 5DQHA 3CMES 4B9LA 4O4GB 5A8KB 3K0JA 3GIMA 4C8NA 4I2QB 5C42B 3SQGA 5ETRA 4ILLA 1BQNA 2FUG9 3OBIA 1Y00A 1TAQA 1P8GA 2YWKA 4KBIA 3POTB 1JX4A 1S6PB 3GLJA 1N5SA 4NLPA 1QSLA 4KKOA 1FRJA 2HRYA 1CJTB 1CJUB 3HHDA 4ED2A 2KDOA 4H4OB 3PYDA 3UDCA 3PCOB 1M1KT 2W01A 3ZTOA 1UVIA 1PO6A 4DX5A 4B3RF 2XMAA 2CQ3A 1SH3A 1JXVA 2W2NP 5KT7A 3K5MA 1EP4B 5SUHA 2JLFA 4NXMJ 2B6AB 3EXYA 2XBPA 3IXQA 2OKQA 2FJAB 4ZPAA 1EX8A 4NXMF 4B02A 2ZKUA 5GAEU 1LWXA 2L41A 5E0OA 2MHNA 2BE7D 4DUTA 1PC5A 3CJ8A 4NLUA 1OO0B 4LF7F 1S76D 1U6ZA 3CCUS 3CD0A 1Q53A 4LSLB 2N7CA 3KNAA 1EETB 2VJVA 2J5AA 5F9LA 2IM0A 1O51A 1FEEA 1VBZA 2OGUA 4B3TJ 1YQHA 1DJ0A 5KFFA 5HBMA 3ONQA 1XK8A 3D6FB 3BQ1A 4DL6A 2P5VA 1WJ9A 4ID8A 3RR7A 2DNOA 1FI4A 2CQGA 2DY9A 2Z2YB 3OTBA 2RDDA 2VA2A 3V6DB 1S57A 3KLEA 4DFMA 3PX4A 5DG9A 2XZDB 4A8SA 3L4BC 1JMTA 5K8PA 3W2WB 1YJRA 1EHWA 1U47A 1PKUA 2M70A 1REVB 3A3OB 2PA3A 2VBXA 1U8SA 1TL1A 1YHQS 2QRRA 1W2IA 3TVKA 2EKYA 1UWBA 4KHMA 1LWFA 3VGSA 4F36A 2BW2A 4RWXA 1U6BA 4C8YA 3W5YA 1U1NA 4EZ6A 2KM8C 2R2UA 5CZXA 3DHXA 2VFRA 2OLWA 1Y0HA 3MM6B 2OD6A 4DR1J 1VQ9S 4LRFA 4JV5J 4DPTA 2BANB 3KWMA 1FE4A 3W8GA 5T14A 2IDEA 3D3CJ 1TV6A 3OVSA 1RT3B 2DNHA 2KHCA 2AJ2A 4LREA 2YH1A 1XERA 3JB9k 4HACA 3RB0A 1IWGA 4X65F 3QWPA 2BJEA 2ZH1A 4AL6A 1REGX 1HIYA 1D0EA 3VAJA 2OD4A 2Y9HA 2J0WA 2DBBA 1RHUB 4DR3J 2MLZA 2Y1IA 3DLLQ 5IM0B 1BWVA 3ZO7A 3MMJA 3NNCA 5KFNA 5A2QU 1B3TA 2W2MP 2RILA 2BA9A 4ANDA 5GMKa 2OEKA 2BQ3A 5KT5A 4ZHRB 1RCXB 3CJRA 5FJ4A 4UF4A 2XEXA 2ATCB 3H98A 1NMEB 3ZZOA 4JYAF 5KFKA 2VJUA 4NZ0A 1BE4A 1Y5LB 4PG8A 4DV1F 3S8SA 2G4BA 2AD9A 3I31A 2AGQA 3DOLB 5BYQA 2AX0A 3CE8A 3D54A 1HMVB 3T5JA 3AQOA 1EAYC 4NLXA 2ZJRQ 3C2PA 1SQFA 3M2VB 3BO2A 3UR0A 4ANCA 4O3OA 4G1QB 3M30A 4YFUA 1U2FA 4USJC 4PXEA 3MR2A 2GMJA 3HHKA 3NCPA 4PWWA 3FEZA 3CJ5A 3DCAA 1N48A 2HFOA 3AX5A 4EEYA 2F7VA 1S9EA 3MR6A 1UETA 2ACMA 4DV4J 2AU0A 2B51A 4WXWA 4AE5A 6FDRA 1ZETA 2FIUA 3C14B 1ELOA 4ECZA 4MIBA 3I5CA 4UY85 2AJ1A 1M5HA 1NBEB 3IG1B 3LOUA 4LF5F 2H5EA 1KP6A 1NPRA 4OX8A 2HVHA 2B7BB 1P9YA 2R7QA 1SI9A 1AFIA 3TQ1A 1E6YB 1LNQA 2AYBA 1UEVA 4C3KA 3CT9A 4PXDA 1FXRA 2LCWA 2M88A 3D0GE 2HQFA 2YNHA 3V81A 2AZ1A 2R9LA 2F4FA 4FPIA 1ZTWA 2Q6BA 4IRCA 3MCNA 1T03A 4K7QA 1D8ZA 1TELA 4ED1A 2ZBCA 2MQQA 3NGRA 1OS5A 2BW7A 4OX6A 3DOKA 5D0RA 1U09A 4ZP8A 1L3SA 4A8KA 1RHKB 3BEGB 3D6MB 1FKPA 4ZVEA 3CMAS 1FE0A 1FNMA 3OLBA 3RJMB 4Q5VA 3DLKA 4IFVA 2XO7A 4I69A 4ZVRB 4B17A 5HP1A 2AIRB 3U1NA 1S0MA 2CJKA 1FX4A 2LQJA 1IM6A 2RUSA 3B78A 2F4VF 4LRAA 3KYLA 1RTHA 1YWXA 1LWCB 3FC9A 4RUBA 3BREA 2WW8A 2IRUA 5LMUF 1WF0A 3FGVA 4RW7B 4DZDA 3OHAA 2HFUA 3X3UA 4DMZA 2FLLA 3UO0A 3VGVA 3FMWA 4ILMA 4CO4A 3LANA 5I42A 4I7FA 5IOLA 1G7CB 3N28A 4OYPA 3ZZYA 4URGA 3OR1A 4MKBA 3ZNJ1 4M94A 2CADA 1DFDA 4ZKAA 1V3ZA 3LP2B 2MGZB 3MFIA 2A0FB 1RWVB 1GMVA 4CLZA 1FX2A 3PZPA 4F7VA 5K14A 2R7TA 3KLIB 1RE1B 4Y2IA 3AX3A 4OFZA 4DXLA 4EBDA 2HS4A 3SDEA 2Z58B 2V4JA 2J7KA 3CVKA 2H5IB 2FVSA 1Q16B 4TY8A 1CQNA 3DI6A 2HIQA 3AWRA 4EK2A 4A8YA 1K47A 4IR9A 1LFWA 2OPRA 3J7YI 2IM3A 2CZ9A 4RO0A 3W3SA 2VICA 3SQGB 3ZZ0A 1FXDA 3VVTA 2MY8A 3H20A 1RT6A 1BQNB 2YH0A 1YBUA 5KG3A 4BC7A 2DPIA 4KKOB 2KJVA 2XC9A 1X9WA 5L9XA 5GMDA 2IRYA 5T7LA 4NEYA 2EC0A 1YJ7A 2K2PA 1WHWA 4WZQA 2R2RA 2PMZD 5ETTA 2EFOA 3M2RA 3ICLA 2CPZA 2YWWA 2K3IA 3ET6A 2C2EA 1JJCB 5D3GA 3F56A 3NGKA 4DSLA 5BJRA 3G6ES 1K9MT 5D0HA 4ZLJA 2F40A 4GC7A 4K0KF 4NZ7A 2EVZA 3BF4A 5KG4A 1Y9OA 4C0HA 4YHHJ 1LEOA 5LT5A 4RL1A 2U2FA 5A6PA 4FVCA 3R3TA 3VV2B 1YZ6A 3ZC4A 3J80Y 2V6AA 1URRA 5IC6B 2GHPA 1N52B 1D9FA 1N32F 5ETOA 4F0HA 3UCGA 1NJIT 1S9GA 3K57A 2YPZA 5M2UA 1FF2A 1KLNA 3IO1A 3RZAA 3NRBA 3G82A 1VI7A 3MM8A 1IKVA 5HBMB 5H1SV 2WSFC 1JLEA 2UVRA 4I0WA 4UOFA 2KKHA 2FLNA 3TI0A 1RAJA 1BMQB 4IUFA 4DL2A 3KLEB 4U8VA 2EK1A 1X0PA 2LQ9A 4LF8J 1OPIA 1GXTA 2BJDA 4P72A 2ROPA 3T1YF 2FJEB 4JI6F 2C3YA 4KPCA 4W98A 4V19X 4QYRA 3TVYA 1RWXB 1TL1B 4LF8F 5I3QA 2WCXA 1MWQA 4O3QA 5H9FJ 5J2PA 1UWBB 1N36F 5EN1A 1NCLA 2XS5A 1LWFB 4J9NA 1FXLA 4ECSA 2ROGA 4OHVA 3CCRS 4ED0A 1Q81T 2VFSA 4IOBA 1HYSA 2V2QA 2MLYA 4CLUA 1X4GA 4NA1A 1X4CA 3BQ0A 1YITS 2LQ5A 3U1MA 3W9JA 5DO2A 2ZJQQ 3SFUA 4L72B 1UAWA 3T19A 3HVAA 4WFAQ 1TV6B 1IR1A 5F0WA 1NB7A 4DR4J 1ITPA 3OSNA 2V8VA 4HACB 3GCXP 5J1PA 2PFFB 2R2SA 3IAM9 1IVZA 3Q8PB 2LQBA 4IQXA 1RQ0A 3Q0AA 2GMHA 1I5OB 4YQWA 1F5BA 5FLXU 4ITSA 2QA4S 2K1RA 3OD2A 5KG6A 2AV5A 2FZKB 4H54A 5J1NA 4K4TA 2ZOGA 1FVQA 3TA1A 4DV2J 4PWUA 2JFKA 4D3HA 2IA0A 1I3OB 4JI8F 3KG0A 1R8AA 1SC1B 4LBIA 2ZUAA 2VBZA 3LGNA 5D0EA 4WTYA 2DNQA 5JUMA 5A0YA 1VOMA 1H2VZ 5E3CA 1VLYA 3NOGA 4KGKA 3ULHA 3HSJA 5CCMA 2MQ8A 1GAOA 1FCAA 2AHOB 1NK8A 3O8WA 1TUVA 2JRSA 4I6WA 3EDRB 2O67A 3LO3A 4CLLA 1LXNA 5FDLA 2D1CA 3ZFVA 5DG8A 2I5JA 3M30B 5GAHU 2Q43A 4O0IA 2GHVC 4C7QA 1SJQA 5DDPC 1NDPA 1F9EB 1JB0C 2HRTA 2C42A 1S7IA 1IBMJ 1N5TA 4ZJQA 1FD8A 2C28A 1S9EB 3I9ZA 1D1UA 2GJIA 2LXIA 2DIUA 4E98A 3GQCA 1IBMF 3JYTA 3BBBA 3UW1A 2DIVA 2XTJP 4Y3CA 1GK8A 2LDYA 3DKDA 1YX2A 3QYYA 4YN3B 1LWEA 3THPA 4PQAA 4TYBA 3DLBA 2VASA 3FJ2A 1T7PA 1Q8LA 2CWKA 4F0MA 2L08A 5D4OA 5BXIA 2YNHB 1IBCB 1UZHA 4C98A 1MMDA 3V81B 3NWRA 4BLGA 2QYGA 1F1BB 2PGCA 3NXZA 5KFZA 1T03B 4X4TA 1H6KX 1NUEA 1PSDA 1D09B 1RABB 3D0HE 1ZM2A 3CXCR 2KZMA 3ZTSA 3DOKB 3EXCX 4NLTA 1R0AA 1NK6A 2OAUA 3SV3A 1FKPB 3T9NA 3BKUA 1UEUA 4ZPDA 2VU5A 3DLKB 2AYEA 4IFVB 3J81j 2KYXA 3AA9A 4OI0A 3GIIA 1Y4ZB 2NPIA 4RW8A 2YWHA 2RRNA 3OFEA 3ENWA 1TP7A 5HP1B 2IM1A 3AJ2A 2V34A 2DHSA 3HM9A 2V8GA 2R42A 2H51B 1F3VA 1RAAB 2AEFA 5M2PA 3MF5A 3TARA 1NDCA 1RTHB 1TKDA 3M7VA 4JI3F 2F8MA 2CQHA 1R6YA 1SJFA 4B9TA 2R8IA 1XR7A 1KSPA 3FEXB 3TOQA 4F02A 4N47A 5KG5A 4M1KA 5I42B 4I7FB 4RW9B 4J9UE 3OR1B 1F60B 4R25A 4ECTA 1XMOF 4DV7F 4QU6A 1MW7A 3Q23A 4OJGA 4J7CA 2CDQA 1G3OA 1BGXT 3A8KA 3B4DA 4F4YA 1HW8A 4CLPA 2CQ4A 1FFGB 2ZKTA 4WIQA 5K14B 3GTYX 1EB0A 5EHHA 5F3ZA 1L5UA 4I56A 2HGMA 3ENAA 3IR5B 2W25A 2LFVA 4C8ZA 3SDEB 1R8CA 2V4JB 3KUEA 2E1AA 3RUBL 2MEWA 4FP9A 4TY8B 2DEJA 3KFWX 1X4BA 3DI6B 2ZUGA 3TX8A 1D8YA 2CPIA 3H4BA 2EC2A 3V6JA 4ZVPB 2OPRB 2BRLA 2AMCB 2MJNA 1YJNS 5BR8F 2COLA 2G0JA 4WP9A 5F8MA 4ZMMA 2FB0A 2C2RA 1RT6B 4FS1A 3MMAA 2MKKA 1HNXF 3BB5A 4ES3A 1FRMA 2HAIA 1B64A 2W9CA 3T41A 2GVDA 5T7LB 2VHGA 4UUXA 2OTLS 3M2RB 4DQSA 1GT8A 2X1FA 1RU2A 1HI1A 3W2VA 2MZTA 4KGMA 3D68A 4BBYA 1C0TA 2MJUA 3P5BP 3IS9A 3ET6B 5IV4A 5D3GB 4OX9J 1X4FA 3FEYB 3AAWB 1O8BA 2IMWP 3ZZPA 3UN3A 1O0PA 5HI7A 2DXEA 1FRLA 1D9DA 2Z2MA 2FZGB 1VRQC 5F8LA 3BH7B 3EM1A 4U96A 4HEA9 1P1TA 1GTHA 1HQ2A 3SSQA 2LDIA 2E7WA 2H4WB 3UCUP 4TYAA 1YDLA 5DJBA 3ZZRA 1S9GB 2RRBA 1QSYA 1RADB 3X1LB 3UI3A 3P8BB 4O44A 3G82B 4JOUA 4JP8A 5F9NA 4G6VB 3AT1B 3W9IA 1DARA 4C9DA 3MM8B 1IKVB 4USVA 1XJWB 5LMNF 2PI5A 1ZZFA 1JLEB 4U8YA 3DLHA 3I4HX 2DPJA 1M0SA 2Z56B 1YJVA 2WVEA 1U24A 2APOA 2JEJA 4CM0A 5JVGQ 2FJWA 3LQVA 4RZRA 4QIFA 5IC4B 4F3QA 3OXLA 4OLOA 3CB4A 1C2PA 1WF2A 4W90B 3NS6A 2UVUA 2F9JA 2JWNA 3VWSA 2AWZA 3TO8A 4P7TA 3H5SA 5LJ3Y 1NDLA 3JSMA 4X4SA 4ECVA 1VBKA 1HKAA 3WC0A 1HI0P 4A8FA 3AD9C 4F2SA 5J2PB 1LW0A 2WHOA 4JI2J 2HNZA 2P9CA 3IRXA 2MMYA 2PO4A 5D8HB 1S4FA 1Y10A 4ZOSA 1IJFB 1R7IA 3HT0A 2JC1A 1KTQA 1HYSB 2V9WA 3HHLD 2VKRA 2H54B 4B9UA 5EDWA 1GMWA 2VV5A 3FUYA 4WP8A 4DX8H 4KH1B 3M6UA 2F65A 5B0GA 5KFAA 1MLAA 3KDOA 2BOAA 3SBMA 4PPDA 1FWPA 1NEEA 3PX6A 2F63A 5KFJA 4YR2A 5E7OB 3R5DA 2D68A 1JNRB 2K7KA 1UVNA 2JEIA 2C3MA 4OI6A 2FY8A 4EBCA 2DHXA 1TR0A 5IT4A 2K1RB 4KRWA 4WPAA 2QLBB 1VQOS 2BYCA 2XO6A 4WXOA 2HS3A 1RWNB 2DHHA 3HVWA 1F2HA 1TVRA 4XPEA 4OZ2A 3V4MA 4ECXA 2CG4A 3O1LA 5B0EA 4K59A 1AXQA 3DN9A 5A0YB 1PAUB 5A2QY 3FZBA 3LGMA 4TLRA 1QSSA 4B3MJ 2IJRA 3V4IA 3NP5A 2ZHBA 2IVFB 1S97A 3P49B 3LP1A 3BQ2A 1VQSA 4N5SA 5FDLB 1IBLJ 5KFIA 1FWKA 2I5JB 1ZBTA 1S1TA 4P9SA 2CQ2A 3K7RA 3C66A 2ZVSA 2QE5A 4X4PA 2R7WA 4GKJF 4CIOA 3CMQA 4TVAB 2HLUA 3JYTB 5A76A 4YDXA 3AB4B 4HLBA 5CZVA 1WSRA 1KFDA 2DCUB 3HVRA 2OH2A 1LWEB 3E8OA 2UXBJ 3CEDA 1SIZA 1Y3KA 3QRRA 3TJ8A 1NK7A 2C2KB 4OYAA 2CNOB 2BXJA 4RR5A 2NXCA 2XY5A 1HWIA 1HQUA 3LP0A 4QPTA 1KS2A 3KMQA 4OV6A 4ECYA 4F50A 1RB0A 3T1HF 2E7XA 2UVWA 3T5LA 4L3KA 1WG1A 1B7YB 1XMBA 3A8IA 1N5VA 3QT8A 2KRRA 3CJQA 1R0AB 5CCLA 4LBHA 2DH9A 4WKRA 2H65B 2E44A 2XI3A 2RS2A 2X3DA 3HKZD 2WBRA 2UZAA 5KFGA 5J2QA 4A8XA 3M9MB 1JXLA 5MLCV 2BACA 4FZVA 4DR2J 4RW8B 3OL6A 3LPYA 1CPZA 2UXCF 4NCAA 4PYDA 4CCHA 2WAQD 4C0BA 6FD1A 3W5ZA 1FFWB 4DR2F 2HS0A 3C6TA 4AXIA 3CGIA 2VG7A 2JVOA 4L75A 2HNYA 2HG4A 4ALZA 2B4UA 4DV6J 2Q1LA 1UJ4A 1QUPA 4KGZB 1RTJA 3IWXA 1WOPA 2JH3A 3NAIA 5HATA 2DD8S 2J9DE 2X51A 2KN4A 1NK5A 2XMUA 1MU2A 4NLRA 3BKTA 3EJMA 5KFEA 3QLHA 4HH1A 1UL3A 4USUA 3OFHA 4DUYF 4B3OA 2B4PA 4FF2A 2JJ4D 1QAYA 3H5YA 4YY3J 2Y0BB 1TFYA 2V1TA 4N41A 2KL8A 1PJ5A 2YNFA 3DU6A 4DCPB 5IT9U 4RW6A 3DM2A 4HT5A 1WOSA 2PSZA 1VQ8S 1NJWA 1RTIA 1HHTP 2LEBA 3GFHA 4KYZA 5KFHA 4LRDA 1XNQJ 1OQ6A 2BJ7A 1S48A 2D9OA 3DGPA 1WC3A 3L95X 3MMAB 3CC7S 1HA1A 3SCKE 3OQ2A 4BWMA 1XNQF 2H3EB 1VCTA 2W9CB 3C3LA 2W4PA 3MOZA 2QL7B 4ENOA 1VBXA 2GVDB 3L09A 3OXFA 1SPBP 4NMXA 4U6PA 2V8DA 3KK3A 3W2VB 4UW2A 3OJUA 1WF1A 1C0TB 1Y7PA 1E6VA 3IS9B 2VQFF 3AXKA 2MSTA 4HHUA 4C2MA 4OZ3A 3R5CA 3S01A 1EQ0A 2EWHA 3MM5A 1D3WA 4FVMA 2RVJA 4AL7A 3EWGA 1N5YA 2CVEA 2XCAA 3NG8A 4Q2LA 4MKAA 4DN9A 3TAPA 4LFCF 4PXBA 1IKWA 1S49A 4MJKA 4UUWA 2E9TA 2FHJD 2XYGB 3FBFA 1EARA 2L3MA 1S59A 4KSEB 2SXLA 2CJ9A 5ETVA 4OHZA 1F2GA 3BYPA 5J2MB 1SKSA 3HPOA 2XHWA 4O44B 3BSOA 4FBTA 1OY6A 2IJFA 3TWZA 4YUDA 1FRHA 3IWNC 3FBBA 2GA7A 1I94F 3ETOA 4KTQA 3SMZA 3IRWP 4C3MA 3ISNC 3MR7A 1VRUA 4X66J 1XMQJ 1JIHA 5F3TA 2FLPA 1VMBA 1YJ9S 5KFVA 2AP6A 1X5PA 1JLGA 2IYGA 2A18A 5AXKA 1N8RT 1S1XB 1VRTA 5KT2A 4ZCIA 3EX7B 2XTCA 1RAGB 4YB1P 2IVYA 3JSMB 5KFUA 3A8JA 3HJVA 2WONA 1Q8KA 3B8HA 4YB6A 2Q6CA 3PJWA 2F5GA 1LW0B 3QT7A 3MEEA 3F0NA 2HNZB 3IRXB 5HN0A 2GQCA 3CCMS 1Q8IA 1JNZB 1VDHA 2BJ1A 3D66A 1WC6A 3AOCA 2JLEA 4KH0B 2C3UA 5LL6d 3UDLA 3CSKA 2DNPA 2ZOMA 5EX0A 3DDNA 3FVYA 2MKHA 2LECA 1NLKL 2RHQB 4DV0F 5EX3A 1PAEX 5HQ8A 5HQMA 3MAQA 5CAAA 1YJTA 4MH8A 3W61A 4IQMA 1U1LA 4MFBA 3SV4A 4MK7A 2HWHA 2VQEF 4JI1J 2YNGA 1R3NA 1B70B 3R5JB 3PIPQ 3CWJA 4TU7A 2DNZA 2R8JA 4CO1A 2CPXA 3H2VE 3DRPA 2WB1D 4JI1F 2C3PA 1VLOA 1YK9A 3HHLA 1ZZNA 4RU2A 2HQCA 3I0SA 1TVRB 3VGTA 3JS9A 5CQGA 1QJHA 4B9SA 2OPPA 2HQ3A 1DQAA 2PC6A 3BKFA 2OHDA 3ILIA 3C6UA 1ZYQA 1VQ4S 3AHPA 1HD1A 4RU9A 1KEKA 4NEZA 4NYOA 2MSSA 2J9CA 1XWLA 3V4IB 1YLXA 1NKBA 4TY9A 1TL3A 2IBKA 3LP1B 2EBEA 3ZTQA 2YX7A 3W7BA 3J7A1 1S1TB 3PJXA 2Q3PA 3M8YA 5CD4H 4DR5F 3TUZC 2BOPA 3HT3A 3LAKA 1FJGJ 1QE1A 3QSYB 1VQMS 4Q0BA 4JI4J 2UUAF 1OPZA 1ZOTA 2HHHF 2CQDA 4DBQA 1S6QA 5HK4A 3PW4A 5FD1A 3AD8C 2IIHA 1DLOA 1S6PA 4I64A 3P5TL 5F41A 1SL0A 4FNHA 3HZEA 1B0PA 1XNRJ 1FJEB 3VAIA 2ZH8A 2Y8WA 4ZPWR 3HJFA 1XR5A 2FTRA 1M5PC 1NH7A 4R8UA 1HQUB 3Q8SB 2ZNYA 5EUHA 3THVA 3LP0B 1SC6A 5DETA 2MQLA 3AA8A 3Q8RB 1NO8A 3UN2A 1S1VA 4O0NA 1RP5A 3NWGA 4C97A 4J9KA 1X7VA 3J80U 2KVQE 1R0BG 2F8HA 2HK2A 5DRKA 4ZP9A 3GFZA 5DLGA 5IQQA 1UA1A 3CULA 3JSYA 1H7XA 1BWEA 4DPOA 4CYUB 5J2QB 2P9EA 3PFEA 1YG0A 4I67A 1W26A 2LA6A 3HO1A 3MM7A 4DR7F 4AD6A 3RBEA 2P6SA 3MURP 4DEZA 1S12A 3S7RA 1OYDA 3PR5B 3C6TB 2VFVA 2EFVA 2VG7B 3CD6S 2RD5C 2HNYB 3RG6A 1PYOB 2YKNA 4LF2A 2KXHA 4O3RA 1RTJB 3K5LA 5RUBA 1RAFB 5C24A 3BO3A 1L3KA 2CNLB 4J9VA 4I1TA 3HX9A 4W92B 2XZTB 2RSQA 2V5HG 1MU2B 2BZ2A 4Z7CA 4KQZA 4PAAA 2I0XA 1N4LA 4HHHA 4IH6A 3RBXA 4NXNJ 1IN0A 3QLHB 3EZ5A 3PW5A 4PG7A 1ICEB 4DPWA 4WJBA 5DQGA 2X1GA 1FTCA 4C48A 2VODA 3GMGA 4BDPA 5ADZA 4NXNF 4DS5A 4DV5F 3E01A 1SJ1A 1SC3B 2ASDA 2YNFB 1VQNS 8ATCB 4NA3A 3AODA 3AQPA 1RAEB 1SXLA 2CJBA 4RW6B 3QNWB 3DM2B 4R0JA 5IWAF 4ES2A 3ENVA 4L74A 1RTIB 2YWGA 3QBCA 1OM2A 2E5LJ 2H48B 2EI5A 2PD1A 3NY0A 2PIIA 4ZN3A 4LRBA 1WC0A 4M5IA 2RNEA 2JZ5A 2HQDA 2NSBA 4M5GA 1TTHB 4FBUA 3DGPB 2XNRA 3UWTA 4MAKA 3NS5A 4X4OA 3WX4A 3IM8A 4WF9Q 1HFEL 2WW4A 1WC1A 5T41A 1NHUA 1RBAA 4JI7F 4LFBJ 1BXNA 2YTCA 2A6MA 3TAQA 4PR6A 3K8WA 3KK3B 4O4RA 1S0VA 2ZWPA 1BUXA 1VQYA 4KHPJ 5EWFA 2VDIA 3DNCA 1E6VB 1ZAXA 1HI8A 3LWLA 1FK9A 1RCOB 1UPMB 1GNKA 3MM5B 2CQ0A 2J6TA 1S6UA 2WK4A 1N5YB 2J8AA 1TMJA 4LRCA 4F67A 1GXUA 3R7NB 2E9ZA 3F41A 3HCXA 4M63A 1M5SA 1YI2S 4PG4A 1IKWB 2LKZA 3OTDA 3BDEA 1T9YA 4USMA 1DHMA 4QW9A 3B6BA 4DR6F 3KJVA 3OSPA 3RBZA 2XB2D 2XWYA 2ZVIA 1NSPA 4HDHA 1F9FA 5LOQA 2CG8A 2JX2A 3GU0A 2KZZA 1HR0F 3HFZB 3PKYA 5EGYA 2PEHA 5CA5A 4K8RA 2VB6A 3LUYA 1U7LA 4LF9F 3GFYA 4WK3A 4FDFA 3BGRA 1VRUB 5KFQA 5H9FK 4DG1A 7FDRA 3PEJA 2ZFHA 3IM9A 5DDOC 3IMQJ 4DX6A 1JLGB 2RF2A 4G1IA 1FTRA 1U1QA 2QT7A 1VRTB 3RRGA 3P96A 4A8OA 2LMIA 1LQ9A 3O44A 2IC3A 1RA7A 4F8RA 2FGOA 2JEGA 5H9EJ 4JV0A 2WONB 3QAUA 4LFAJ 1Y5IB 4QJVA 2OPSA 2DR6A 3MEEB 5KAKA 4XDCA 3B82A 3G6VA 5HVHA 1A7GE 3FBEA 1UMJA 2J9EA 5U47A 4FN5A 1QD1A 3KLGA 4QOTA 4OJ1A 2I6WA 3RYLA 4DL3A 5DGBA 3Q8VA 3R2DJ 2HQGA 2VPWB 2CXEA 2ZH4A 4NX9A 3RB3A 2WOMA 5GADI 3LF0A 2ZDPA 4MFBB 1RSCA 1WEZA 3N01A 1SKWA 1B99A 1VGYA 3TUJC 4P2SA 2YNGB 2GQ2A 1RWUA 1KFSA 3NKYA 2W2OP 4FKYA 2Q79A 4UTGA 2UUCF 3DRPB 2BR0A 1WKJA 3UE2A 4X64J 1S4EA 3HHLB 3WHIA 3H7HB 1R27B 3H25A 2GAGC 3GE9A 1MMLA 2C2NA 3I0SB 4PWDA 4LF4J 2HHSA 2A2CA 4LF6F 1DQ8A 4LQ3A 2YX4A 2OPPB 4DSKA 4LIWA 4CP5A 2QMXA 3MPDA 2IDLA 2G2ZA 2FY1A 3C6UB 4B3SJ 4M5DA 3FZ2A 1OIAA 2ZZNA 2J7UA 5L8RC 5B08A 1HBMA 3LA0A 3CDUA 5IZHA 4MKYA 3QJLA 1TL3B 1U25A 2GIRA 1WORA 2E5HA 1CS4A 1R6VA 4QW8A 4DQIA 5DQIA 4RPFA 2PMWA 4KAIA 3TAMA 1LW2A 2R7XA 4P52A 2ASLA 6AT1B 3WDOA 1V3SA 2ZEJA 3QT6A 5DDRC 4LVNP 1QE1B 3OW2R 4DV3J 4Q0BB 4FXVA 2CPFA 4DPYA 3V5RA 2BDPA 1H2UX 1CC7A 3FBCA 2ZJPQ 1S6QB 3ITHA 1V9OA 1GX5A 4K5SA 3BJYA 1HLWA 3CJSA 1DLOB 4FYYB 4KT0C 3DU5A 4YB7A 5F8JA 1CJVA 5B0CA 2B0GA 3DC2A 2N7YA 4OZLA 2DRBA 3CC4S 3I87A 3EMTA 4I2PA 2AJ0A 4R8UB 3ENQA 4DL5A 2WZ1A 4NA2A 3D67A 4LF1A 4L76A 3OTOJ 5L38A 1T95A 4USTA 1S1VB 2YKQA 2J6UA 2NS1B 2E9RX 2L9NA 4P10A 5KFWA 4F2RA 3UNYA 3F44A 3K8VA 4DSIA 2LVWA 5KG7A 2M8HA 4ZLLA 3BGFA 4IOAQ 2ILZA 2BJ3A 1J5OA 1VHIA 5E33A 3OLAA 3OJSA 5JMNA 3U7JA 2I1RA 3MM7B 2KO1A 2XWXA 4AXJA 4FYVB 2A6OA 1S99A 1VYAA 2IAJA 2V94A 4CLYA 1P27B 2HHPA 3K5OA 1V6HA 4H4KA 4KIAA 2XGPA 3RAXA 4CO0A 8RUCA 2IFXA 4B3TF 1IR2A 1RHJB 3IA0A 3RGIA 2YKNB 5KFBA 1KOOA 3I32A 4A8MP 1KWMA 4YS2A 4WYWA 1TK5A 3W9HA 1U1KA 3TZZA 1WSVA 1NB2A 5C24B 3GIKA 1HW9A 1ZPVA 5HVGA 2WVDA 3NBPA 4PG5A 4Y6IA 2KFNA 5CXTA 3M1VA 2YKAA 5DGAA 4A48A 1FRKA 3Q8QB 4XO0A 1NKCA 2DR7A 2O1PA 3PFOA 2AW0A 4KHRA 4OLPA 3G8SA 3N0VA 3Q83A 1JLAA 1W7WA 4ZITA 2CFXA 4MKVA 1RT7A 2J6SA 3E01B 2V1SA 1EIYB 4USWA 4K4WA 2D3ZA 2DGQA 3QWUA 1JLQA 1U8WA 1AYEA 5E2QA 1KQSR 4DR1F 4QBUA 3GV8B 4JV5F 3VTIA 5IT9Y 4NE9C 4E2FB 2RT3A 4DF8A 2HNDA 1DY3A 2HFZA 1Y5NB 2GW8A 1FKOB 4X84A 3NL0A 2MQPA 4B9NA 2XQCA 2X1AA 4DR3F 3VCDA 2QL5B 2Z8QA 1MG7A 5D0GA 1KR4A 2IPOB 1C1CA 2L9WA 2ASYA 4DPUA 3OFGA 3N4WA 2C22A 4DSEA 2CPYA 3H2UB 4AYBD 1UKUA 2RHSB 1FK9B 1FWLA 3R97A 1S0OA 1FD2A 1SH2A 3AFGA 1WTBA 5KG2A 1RWMB 4Z2XA 3DMJA 1T9WA 3EVOA 2F9DA 3SSRA 3MFHA 4MK8A 1SL1A 4P2XA 2HFVA 2UUWA 5HLFA 1DAXA 5AE3A 3BYRA 4WBFA 3W8PA 2DNLA 4X4UA 1IQTA 3UQSA 2FD2A 4W4MA 2HVEA 3KJVB 3TW0A 1M5OC 3VZIA 2QX0A 4LUBA 2QA2A 4B9MA 4OHWA 4A4JA 3FCWA 2A10A 2UU9J 2JL9A 2DVIA 1KC8T 3PYGA 4DV4F 4CLWA 3M8RA 5K8OA 4Q8FA 3BGRB 3TX0A 3JQKA 3MOJB 4N7TA 3CCLS 2DR9A 4DG1B 4XK8C 3OVBA 2PT0A 2VPYB 4WTOB 1PJ6A 4ECUA 4MTPA 5B0DA 2RF2B 4UZBA 2CZ4A 2ZM6J 1CULA 3E51A 3WZ0A 1EKRA 2EG2A 1V5IB 4OHYA 1RYSA 2IC3B 1IKXA 3I82A 4J5OA 4ELUA 2VD3A 2OPSB 3MTKA 1N54B 2FVQA 3MR3A 5HVFA 9ATCB 2A2DA 1ZA2B 4FS2A 5HL7Q 4O3SA 3TA2A 4CNZA 3KLGB 5GAEI 2XMKA 2I38A 1RJJA 2M3DA 2DEIA 2OEMA 4JB8B 3M6WA 3W65A 2QA1A 1WI6A 1Q7YT 2P2CB 1IBKJ 3U1LA 2WOMB 3MHYA 2BVZA 1NKEA 1HWLA 1TMMA 2E7VA 4ZVSB 4NMLA 3UVJA 4IKAA 2VA3A 4NRUA 2RB7A 2EPIA 3K58A 1Q86T 5AXNA 1YRUA 4UQTA 3MWBA 1VS3A 5L1LA 3CDAA 2MKIA 4OZ1A 1J2VA 3V2UC 3R7SB 1HPZA 2GX8A 4RW9A 2QJ3A 4HKQA 2L48A 2HQIA 4PWDB 3W66A 1T3OA 2E66A 2CNKB 1UJ5A 2JSXA 3M9NB 4ID5A 3HSZA 4J9MA 3RTVA 2FPHX 3G6YA 2NXNA 3T5HA 3R2CJ 1UW4A 4NASA 3MXHP 1CQMA 4M5DB 1S79A 3HF5A 2VG5A 4Y2KA 2JLGA 2PI4A 1HQEA 1HBMB 3CF5Q 1LFPA 3MZIA 2ZOFA 1RKIA 1CS4B 2IJNA 1VQKS 3BGOP 4KFBA 1TU0B 4ECQA 3FKBA 3NS7B 3TAMB 1LW2B 4WFBQ 2HHUA 3WQPA 2R8HA 3WC2A 4TN2A 1H7WA 3BV8A 5GADU 3GSIA 4DFJA 4J9QA 2M2BA 4EO8A 3PRVA 2CJYB 3S1TA 3GONA 1T9XA 2AQ4A 3ITHB 3QGIA 1MWZA 2J0QD 3US5A 5GAGU 3VAFA 3OFFA 4NCGA 3HK2A 1IKYA 2Z2ZA 3G71S 1MSWD 3THTA 1CJVB 2LXFA 5LSRA 2IRXA 5LJ5Y 2HWIA 4C8MA 1U48A 4I2PB 2WSEC 1NM2A 3KOAA 3GJQB 3HHLC 4IRDA 5IFMA 2W8KA 4QWBA 2VF3A 3E2EA 2X7IA 2BE2A 3PHEA 3K5NA 2RU9A 3RW7A 3BN4A 3HSGA 4AUKA 4WFXA 1HBNA 1N33J 2WVBA 4WKYA 1H98A 3RB4A 5JXSA 4ES1A 4UQGA 4KJIA 3WIUA 4C8KA 2G0IA 1J5OB 1GQEA 4YHHF 1FESA 1M5KC 2N3LA 3BH6B 3OXGA 1X9MA 4NLWA 2UV8A 2BBEA 4JI5J 2DGSA 1GMUA 2XYHB 4EBEA 1Q8BA 2IAJB 4DZ6A 1U4BA 1AFJA 3MUVP 4OZJA 1L3VA 3Q8YA 2FVRA 2ALZA 1RWPB 1QTNB 5JJBA 3H8YA 1UVLA 1NSAA 1G6BA 4UOHA 3MEDA 4BS2A 1HWUA 1X5OA 2NZ4A 3CD7A 4OYBA 3BR8A 2DTJA 1J5EJ 3A12A 1JK9B 1KHVA 2MYFA 2UUTA 4DOZA 2N3OA 4M5KA 4CDIA 4RJVA 5HMXA 4L6V3 1RISA 2N4CA 1GXLA 2VG6A 4TXSA 2BQUA 3GP9A 2DT9A 3TZXA 2Q66A 1J27A 3NBPB 3CTRA 3P4UB 4M5LA 4B9VA 3M1VB 3T6JA 1NZAA 7AT1B 2EK6A 4YR3A 3FK4A 3VAKA 2E5JA 5KFXA 2MZ1A 1JLAB 1RT7B 4E0DA 1FDBA 3OTEA 1SUQA 1WDDA 4YR0A 2O3DA 2XMJA 4JV2A 3KLFA 2DISA 1JLQB 2QMUB 4ZPCA 4NLYA 2W1BA 2MXYA 1RXOB 3TANA 5LXRA 3FSIA 5KFMA 2MB0B 4AQYJ 1U1OA 4DR4F 1JJHA 3W63A 2HNDB 3EICA 3MDFA 4RLEA 1QAXA 1UUJA 4AQYF 1VIOA 4DU7A 4U67Q 4AFFA 2B9EA 3TP2A 3J7AN 2MDAA 3EVWA 3KMSA 2E1RA 4PKDB 2DKOB 4DU8A 3E3XA 3RW6A 3RRHA 1C1CB 2XI2A 2PDAA 1MROA 4G65A 2YQ0A 4QWCA 4DV2F 5KTQA 4GO7X 1TUGB 3SCIE 3H5UA 2BABA 3CDBA 2ZZTA 1H3DA 2C2OB 3PYFA 2MKCA 2D41A 4WK1A 3A8EA 3DMJB 4ZP7A 5C7PA 3NGUA 2XG8A 3CCES 2C2MB 1B0TA 2C3OA 3VQSA 1KQKA 1IWAA 2KT3A 5HLFB 4ZVGA 2P6TA 2RKIA 1FVSA 2M9KA 2O01C 1TZ0A 3D28A 1C4CA 3RBDA 2V0NA 3AH6A 3IBFB 1L3UA 3DRRA 3W60A 5ETQA 4RX6A 1GFWB 4RKUC 2YVSA 3Q24A 2VH7A 1HNZJ 5I3UA 1URNA 1AA1B 4X62J 2ZZMA 2CDRB 2D3OR 1FO1A 3KUGA 5LSLA 3WIVA 1R8PA 1WNEA 1U6FA 2XGQA 2UV8G 5ETPA 2E29A 4WYLA 2RH3A 5HSPA 3PHTA 1UVJA 4ECRA 2JVRA 4B08A 1CULB 3O3LA 4K5RA 3QJPA 4A8WA 5LM7E 1IKXB 1Q5YA 2DY1A 3IGNA 3MPWA 3ISND 2RRAA 3HSDA 2XLJA 2OP5A 3SXLA 4DFKA 2R3VA 1AUDA 3NAHA 5CH7B 1RUSA 4U9RA 5HJXA 1NU4A 2R8KA 3MD1A 3C19A 4GVLA 4NI2A 3VAMA 4YB5A 2EKNA 3VQTA 4ZIWA 2OSRA 3TEGA 4ZVTB 3VGUA 3CIZA 3KXDA 1HARA 4J9OA 1DTTA 1N0UA 2LEPA 3UVJB 1S10A 5IXUA 5D4NA 2GCFA 2OFHX 2V2KA 4ERDA 2DNNA 2J8SA 3NMAA 3HDSA 2RE1A 3IR7B 4URSA 3FQKA 4QYZK 2V2VA 2DNGA 4B3RJ 1HPZB 1WD6A 1BQMA 1W25A 1RWKB 3OPKA 5BYSA 4ZPTR 2O66A 4ID5B 3M6XA 4CH0S 4KGVB 2UXDJ 1N56A 1DZ5A 2PE8A 1UTAA 2CPDA 2VG5B 4K2XA 1HQEB 3PRDA 2QSWA 2UXDF 2F3JA 4LF7J 4KFBB 3F73A 2YWEA 4TQRA 3J81U 4DQRA 3GFXA 2XLIA 9RUBA 1VJQA 3D5MA 2XMMA 2YQ3A 4LQ9A 2HKEA 3NGDA 2NREA 4ED4A 1U49A 3R1LA 2DGVA 3QFHA 1WI8A 5CYMA 1RAIB 3CCSS 2IYIA 2WVFA 4ED5A 1KQFB 4DSJA 1UP1A 4NCGB 1IKYB 1Q82T 3OTCA 1S77D 2VOPA 3A13A 3I96A 3G86A 5B09A 2W9BA 1KRPA 5KT4A 2QO3A 4EUVA 5CD4A 2VKZG 3PKMA 2KB2A 3ZZUA 1P1LA 1WELA 2GIFA 4RBTA 2HWTA 2MZJA 1WG4A 3VAGA 2BE2B 3QJJA 3HP6A 2DHAA 2J0XA 1DTQA 2NUHA 4OYZA 2EW9A 1QDUB 3QPIA 1IR0A 3BSCA 1HBNB 4Y2MA 2AJQA 4OX9F 1X8DA 3MEGA 2AF6A 2BEFA 2I2YA 5HO4A 3EVMA 2IA6A 4ED6A 3ILJA 3EGNA 4K4YA 3MAHA 1RAOA 2NXJA 2HYIB 5E3QA 5GAHI 4CO2A 4OYXA 3MAAA 5J2MA 4X65J 3J7YU 1YRTA 3QSIA 2RAQA 4K4XA 2GJ2A 4FNIA 3DXBA 3DDKA 3MEDB 3PNIA 3U27A 3AOAA 5F8GA 5KFOA 3G4SS 2M52A 3M4XA 2ZBIA 5HAOA 4WWSA 3VZHA 2MZRA 3I5AA 2ZBQA 2IVMA 1Q4RA 2K3KA 1NHKL 1ZH5A 2FGCA 1S1XA 1Z4UA 3N5BA 2VG6B 2LU2A 4JYAJ 2Y1LB 3TVZA 5AXMA 2R7SA 4DV1J 4F4XA 2BQRA 2MKSA 4Y0FA 4R0EA 1LK7A 2VPXB 3DYAA 4P2FA 3QFWA 2CQIA 3DDIA 4PQUA 2JOQA 4KY3A 5K9FA 3JXOA 2YKPA 5HANA 4USHA 1S6OA 1U26A 3QZ8A 5KT3A 4LR9A 2FJVA 1WTFA 4CNYA 1SUQB 3SIPB 3PG9A 4JI2F 3C16A 2B7CB 3LALA 1WUUA 4DLEA 2KVIA 3H0PA 2V69A 3KLFB 3K59A 3ILLA 2DNYA 1HNIA 2PA8D 2DRDA 4I6AA 5AJ3J 3JAMU 5KT6A 3GV7B 2B8PA 3OL8A 5DM6Q 1PBUA 4LF5J 2V8HA 1KVIA 3IGVA 1K0VA 4K4UA 1FDAA 1OSDA 2V4RA 5AJ3F 4H4KC 2J7WA 4CZCA 5L39A 4N56A 4DQQA 4Q8EA 4WCEQ 2YBVA 4K4SA 3UD5A 4OYWA 4FYDA 3TZWA 1Z1ZA 2QZ8A 3ISZA 4RW4A 2DB1A 2ZD1A 2ZHOA 1SQGA 2CIMA 3GIJA 1N6QA 2GO9A 3T5KA 4QR2A 1Q78A 3MPVA 2BM0A 2R7UA 2AGOA 1X5TA 1U0SA 2G0CA 7FD1A 1MROB 5ETSA 1MN7A 4FXDA 1HBOA 1ZAVA 2FC9A 5CABA 1TQLA 4DX7A 1NH8A 4Y00A 1SL2A 3KK2A 3N6NA 3VALA 3CDWA 1F5AA 1FERA 4B3MF 4TU9A 1GX6A 4CQ1A 2CQPA 2QGFB 1PC4A 1IBLF 1TKZA 2RKIB 4CT8A 4X4RA 2AGPA 2F4VJ 4ZLPA 2EG1A 2VFUA 1CEZA 2I8EA 4PUOA 5LMUJ 2VPZB 3M9OB 4CLKA 2QFIA 3DRRB 2NQPA 2XSJA 4RUHA 1RK8A 4ED7A 5I3UB 4GKKJ 4V1Ak 3PJ9A 4RBVA 5H9EK 3FFIA 2IM2A 4EWTA 1RBOB 4J90A 4CI0B 2BKOA 4GKKF 4RUCA 2OTJS 1YJWS 2UXBF 3P6YC 3EUNA 5KOWA 4PXCA 1SQEA
chains in the Genus database with same CATH topology
3POTA 2QLWA 3CDUA 2CZVC 3I55S 5IZHA 2DHSA 2B56A 4MKYA 3CUNA 1TL3B 3HM9A 2V8GA 3QJLA 1U25A 4QCLA 2GIRA 1I1GA 1MNEA 2E5HA 3QO9A 4QW8A 1I6JA 4DQIA 5DQIA 3G96A 4A8QA 3M6VA 5M2PA 3JSBA 3TARA 3MF5A 3NCRA 3O2IA 4KAIA 3S6EA 3TAMA 1RTHB 1LW2A 3AY0A 4H4OA 2R7XA 2ASLA 2FVPA 2J0SD 3WDOA 1B7FA 2ZH2A 1V3SA 4UOCA 1FNOA 3NCQA 1ZM9A 4EO6A 3FSXA 5DDRC 1TKDA 4OX7A 4NZ6A 3BO4A 4JI3F 4LVNP 2F8MA 4NL5A 1KN6A 2CQHA 3BS9A 4ATNA 1QE1B 1R6YA 3N5FA 3OW2R 1SJFA 2RQMA 4Q0BB 4FXVA 2R8IA 4B9TA 1XR7A 2CPFA 4WU2A 1TAUA 3V5RA 1SKRA 3EPGA 1KSPA 3QZ7A 4QQBA 2BDPA 3FEXB 3TOQA 2W9AA 3PV8A 2CQ1A 1H2UX 1EP4A 3V6KA 4F02A 3JTPA 1CC7A 2VOOA 2ZJPQ 2B6AA 4N47A 1S6QB 3CC2S 5KG5A 4K4VA 4M1KA 3ITHA 1V9OA 5I42B 4I7FB 2KM8B 2DGWA 1GX5A 4K4ZA 4K5SA 3BJYA 3MMCA 5LSOA 3CCWA 1WHYA 2HHXA 4RW9B 3DFEA 1DLOB 3OR1B 2F8EX 1F60B 4R25A 2CKWA 4ECTA 2QA4G 2RS8A 1XMOF 4KT0C 4DR2F 4DV7F 3DU5A 4IDKB 2KFYA 1NK4A 4YB7A 4QU6A 5F8JA 4XPCA 5B0CA 2B0GA 1MW7A 2YX1A 3DC2A 1A9NB 3Q23A 3CJKB 2N7YA 1DTTB 2GGPA 4OZLA 2DRBA 1TL5A 4OJGA 1HWJA 1NRKA 4HTJA 3CC4S 3I87A 2CDQA 4I2PA 2E5GA 2AJ0A 4R8UB 1G3OA 3I5BA 3ENQA 1BGXT 3GG0A 4NA2A 4DL5A 3B4DA 2Z0GA 4F4YA 1HW8A 2CQ4A 4LSLA 2ZH6A 2DCLA 5L38A 2VFTA 2ZKTA 5E5NA 1EETA 4MK9A 5K14B 1NK9A 1HBUA 3HXMA 1T95A 3EZUA 1QAJA 3Q2SC 4DV6F 1S1VB 4O3PA 5EHHA 5F3ZA 1L5UA 4I56A 2YKQA 4DF4A 1WEXA 2J6UA 2NS1B 2HGMA 2WRMA 3IR5B 2E9RX 2L9NA 3AB2B 2QV6A 3SSSA 4IFYB 5KFWA 2W25A 5CYJA 4F2RA 3F44A 4C8ZA 3K8VA 3SDEB 2HZCA 1X9SA 2RIJA 1R8CA 2V4JB 3HHEA 2F1FA 4DSIA 2LVWA 5KG7A 1U1RA 3G9CA 2M8HA 2E1AA 4FP9A 1BQMB 1R8BA 1XN9A 5A8RB 4TQSA 3BGFA 4TY8B 4IOAQ 2ILZA 5B0FA 3KFWX 1X4BA 4DS4A 3DI6B 2ZUGA 3TX8A 2EFNA 4BHQA 2MQMA 5CYQA 3TYTA 1NHVA 1J5OA 5E33A 3OLAA 1D8YA 2CPIA 3H4BA 3CIMA 5D78A 3OJSA 3OR2B 4OQJA 1H2TZ 3V6DA 3UFCX 3M05A 3T6BA 3V6JA 1CSJA 5BYRA 3U7JA 2I1RA 1FJ7A 2OPRB 2BRLA 2MJNA 1YJNS 5K5MA 5BR8F 3MM7B 2COLA 2KXNB 3A1YG 5F8MA 2KO1A 3GYXB 3M32A 2XWXA 4Q44A 3W2WA 1U1PA 4ZMMA