4NLXA

Poliovirus polymerase - g289a/c290v loop mutant
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
461
structure length
458
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSAVSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
molecule keywords RNA-directed RNA polymerase 3D-POL
total genus 138
structure length 458
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nlxA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nlxA02
3V6HA 1RT5B 2R2SA 1HQUA 1HMVA 4QPXA 4NCGA 3I5AA 3DMJB 4R8UA 5KFUA 4ZVEA 3GYNA 5KFWA 4RZRA 4ED2A 2AGOA 1IKVB 4K4VA 1TVRA 3Q8QB 2IM2A 1DTTA 1RT3A 3CJ0A 1J5OB 2W9BB 3QIPB 2XGPA 1KHVA 1DTQA 4MIAA 2VG5B 4WFZA 1TKXA 4ZVHA 4DL2A 4ED1A 3PZPA 1FKPA 2OPSA 5DLGA 4KV8B 2AX1A 1LW2A 5EUHA 5F9LA 3RB4A 4H4OB 5K14A 3M9NB 3T5HA 4RW6B 2FVQA 1WNEA 4OL8A 2R8KA 2UUWA 4XPCA 3MFIA 3FQKA 4G1QA 3KLEB 4QWDA 3BQ2A 4O3SA 2UVRA 2R8HA 3I0SA 2C22A 1RT1A 1JLBB 3RBDA 3DDKA 2AGQA 2RF2B 1REVA 5HBMA 2GIQA 2RKIB 3ISNC 3QLHA 3MR2A 5F8MA 1RTIB 3DOKA 3IGNA 5I42A 1S1XA 2IC3B 5CYQA 1HYSA 4ID5B 4F50A 2HNZA 2RDJA 5CYMA 3G86A 3SFGA 3GV5B 3PW5A 1N48A 1KLMA 5KT7A 2D41A 4DG1B 1C0TB 2CKWA 5KFMA 3PW0A 3MEEA 4IDKB 3OL8A 5J2PA 1RDRA 5J1EA 2AQ4A 1T3NA 3Q8RB 3V6DB 3N6MA 2OPPA 3KJVB 4IFVB 3LP2B 4URGA 4GC7A 4I2QB 1VRTB 3LP1B 1SUQB 3E51A 5C42A 3KLHB 2HNDA 2HNYA 5FDLB 3CJ2A 2AWZA 1HQEB 3CWJA 2W9CB 3RBEA 4IH6A 3ITHB 4WE1A 3H2LA 2O5DA 1TKTB 1TV6A 4Q44A 1TL1B 4YP3A 3JYTA 4ECRA 4Y2AA 5DG8A 3EPGA 1JLEA 2ZE2A 1XR5A 3T1AA 1ZTTA 5JUMA 5DG9A 2UUTA 1LW0A 1S48A 3HKWA 3IS9B 4NLXA 4WFYA 4EO8A 1MU2A 1C1CA 3MR6A 4ECSA 2BE2A 3M9MB 5KFLA 1HNVB 2BANA 4LSLB 3KLGA 5HP1A 1FKOA 4JV0A 2EC0A 1XR6A 2HAIA 4Q43A 1W25A 3MEDA 5KT2A 3IG1A 4ECVA 1HPZB 4YR2A 1T05B 1S1TA 1S1TB 3DI6A 2JEGA 2WRMA 3MEDB 4TQSA 4TLRA 2DPIA 2C2DA 4ZP8A 3GIMA 1K1QA 1TKZA 1QE1B 3BJYA 3CVKA 3KOAA 5DLFA 1C1CB 1BQNB 3V6JA 4O3QA 4X2BA 3ICLA 1JLAB 3UDLA 1NHVA 2CJQA 5DGAA 4GC6A 4NLDA 1LWEA 1SH0A 2JEIA 3NKYA 2W8LA 5KFXA 2E9RX 4WXWA 5KG2A 5KFHA 3JYTB 4YR0A 3V4IB 3CDUA 3LAMA 2OPQA 3H5XA 4O3NA 4J9KA 4KAIA 1YVFA 3T5KA 3PW7A 4G3IA 5FDLA 3NAHA 2HNDB 2HNYB 4RNHA 4LSNB 5KG0A 4EBCA 5C42B 5F8HA 4Y2CA 4O4RA 3PJWA 3CJ5A 2VA2A 3LP2A 5KT4A 2YKMA 3DRRA 3DLGB 4EEYA 4KE5A 1S6QB 3C6TB 1VRUB 4J9OA 3V6DA 2W9AA 4NLWA 3QGHA 1SH3A 4RU9A 4QWAA 5J1EB 3CDWA 2IAJA 1JLCB 4ECYA 4IDKA 3RB3A 4KHRA 2ASDA 2RDIA 3FRZA 5F8GA 5KFVA 1R0AB 1IKYA 1FK9A 4MKBA 1BQMA 4ECTA 4NLRA 1KLMB 4WFXA 4K4XA 5DG7A 4PQUA 1T03A 2VG7A 4MH8A 5J2QA 3MTKA 5EDWA 5D3GA 1RA7A 1U09A 1RT2A 4RW7B 2IM0A 4I2PA 4J9PA 4ECWA 2QE5A 3KK3A 1REVB 2RF2A 5HBMB 4NRUA 4IFYA 3JSMB 3RB6A 1JLBA 5KFOA 3I0SB 2FVSA 3LP0A 3NL0A 4K4ZA 3BGRB 3BGRA 4U7CA 1S0MA 2I5JB 4ED8A 1RYRA 4RUAA 4NLGA 2XI2A 5HROA 3I5CA 4WZQA 4R5PA 1D1UA 3KK3B 2FVRA 4K50A 2JC1A 2FVCA 3H59A 4TQRA 4MKAA 4F4WA 3MR3A 3MFHA 5J2QB 2QV6A 1FKPB 2OPSB 2C2EA 2YNIA 2R2UA 3KMSA 5KT3A 2VG5A 5I3UA 3OSPA 1T03B 4H4MA 3QIPA 1BQMB 1LWFA 1DTTB 1RT3B 2D3UA 1IKYB 3G6XA 2R8GA 3KLIB 5JXSA 5DQIA 4RNNA 1N6QB 4K4SA 3T19A 4F4ZA 3E01A 2IMWP 3QGGA 4DL5A 1S6PB 2B5JB 2WOMB 1VRUA 3C6TA 5KFAA 1S9GB 5L1IA 1D0EA 2YKMB 3DRRB 3UPFA 1IM4A 4DL3A 2ILYA 4DL6A 4J9LA 2GIRA 1IKWA 3KHLA 4WYLA 1ZETA 2WONA 4IRDA 3PW4A 2V0NA 2XI3A 3MEGB 3KMQA 3KK2B 1N6QA 4NLQA 2E9TA 3KLIA 4KBIA 4RW8B 4WXOA 1S49A 4WZMA 2YNGB 4NLUA 4IH5A 4EO6A 3OL9A 2JEJA 2YNIB 5KFFA 5I3UB 1JLAA 4ZVGA 3DRPB 4URSA 3ISND 2R8IA 1S1WB 4ZHRB 3DM2B 4FS1A 2ZKUA 2J6TA 1K1SA 1RTJB 1S9EB 3IRXB 4QWEA 1N5YA 4Y3CA 3QIDA 2YNFA 4ECZA 5KT5A 4LQ3A 2R2TA 5F8NA 2UVVA 4NLPA 3KLVA 4PWDB 2I5JA 2HMIB 1EETA 3H40A 3UQSA 1HPZA 2IJNA 1JKHB 2WB4A 2YNHB 3DLKA 4H54A 1I6JA 2UVWA 3HVTB 4RNFA 3PHEA 3IGVA 3NAIA 4XPEA 3OHBA 3GIKA 3C6UB 3KLFB 2FJVA 3MF5A 5KG5A 2B43A 1LW0B 3IS9A 2BR0A 2WTFA 5KFZA 3DYAB 5KFPA 1R0AA 2V9WA 2V4QA 5L1KA 4I7FA 1TV6B 2IAJB 3ITHA 4WE1B 1UWBB 1N4LA 3EZUA 3BSOA 1S6QA 2J6SA 1SUQA 5KFJA 5KG3A 3OLAA 4IFVA 3M8PA 4K4UA 3T5LA 3MR5A 4IKAA 4TYAA 3PR5B 1UWBA 4Q45A 2OPQB 5J2PB 4M94A 3QZ7A 4PUOA 5KFEA 3V4IA 3PVXA 4YQWA 4I7FB 2F8EX 4MFBB 3GIJA 4NLYA 1JXLA 2AX0A 3BREA 4DG1A 3QO9B 4O44B 1LWEB 3RAQA 3KHHA 4R0EA 3NMAA 1S0OA 5EWGA 2FJXA 2I1RA 2AU0A 2HNZB 3KLFA 3C6UA 1BQNA 1S1XB 2IC3A 4F4XA 1S1VA 1HYSB 1Z4UA 3VQSA 1RT4A 3BQ0A 1QE1A 4DEZA 2BQUA 4FS2A 5KFSA 4DL7A 3DLKB 4PUOB 1RTDB 3DI6B 3HVAA 1JIHA 1EETB 4G1QB 3KLEA 4EBEA 3IG1B 3OHAA 2DPJA 2HMIA 4PWDA 5KG7A 2ASJA 5HP1B 3D28A 4FBUA 2YNFB 1C2PA 3IRXA 1NHUA 2BE2B 2JC0A 1S1WA 3N6LA 4ZHRA 2D7SA 3GIIA 1SV5A 3DRSA 2IBKA 3LAKA 2FLPA 3IN5A 1DTQB 2YNGA 1RT6A 4ZVFA 2ATLA 4JUZA 4RW8A 4ECXA 1TL1A 3GV7B 3MEGA 1TKTA 1KHWA 5F8IA 4KSEB 2WONB 2B6AA 3LANA 4TY9A 2OPRB 4ZPBA 1IKWB 5L9XA 2WCXA 3KHRA 4NLVA 4IG0A 4KB7A 4DL4A 1S9FA 2R2RA 1VRTA 3LP1A 4O4GA 4ED3A 1JLGA 2YKNA 5KG6A 5C5JA 4JV2A 4Q0BB 4QWBA 3N6NA 3TAMA 1S9GA 3KJVA 2IA6A 2UVUA 3FSIA 2BQ3A 1S6PA 2B5JA 2IM1A 4U6PA 1QUVA 3E01B 4EYHB 1RTHB 4ED6A 3DOLB 3FFIA 3I5BA 4RW9A 1EP4B 4QW8A 5KFDA 3TQ1A 5C25A 1C0TA 3CJ4A 1HARA 1LWFB 3KK1B 4J9NA 4IG3B 4ZPAA 1TQLA 4H4MB 4TYBA 2BQRA 1S97A 3H5SA 4K4YA 1S1UB 4KHMA 5CYMB 4KO0B 4ID5A 5T14A 2OH2A 1GX5A 5F9NA 5I42B 1HNIB 1C0UB 3GILA 4R5PB 5HROB 3H98A 3BQ1A 4ZP7A 4TY8B 4XO0A 1RT7B 3LP0B 4ZPCA 3BSCA 1C1BB 4ICLB 4TY8A 5KFBA 3JSMA 4IFYB 2W8KA 4RW6A 4YR3A 4QWCA 1C0UA 4ECUA 1N56A 4I2PB 3SI8A 4RW7A 1RT2B 3CO9A 4ZMMA 4KV8A 4K4WA 5D3GB 2VG7B 1TKXB 4PQUB 2E9ZA 1RYSA 3KK1A 3KHGA 1J5OA 1FK9B 4LQ9A 5KFYA 4RNMA 2V4RA 4WYWA 1S10A 3EPIA 5C25B 5J2NA 1S0NA 4RW9B 3FFIB 3DMJA 4RW4B 4R8UB 4M95A 1JLCA 1RTHA 5KFIA 1HQUB 3DLEB 1OS5A 3DLGA 3I0RA 3FQLA 2YKNB 1JLGB 3G6VA 2ASLA 2VG6B 4Q0BA 2ZD1B 3CJ3A 4B3OB 4LSNA 5KG4A 2JEFA 1RAJA 4RUCA 2B6AB 3PJXA 5DQHA 3SFUA 3NBPA 3H4DA 3NGDA 4J9QA 3T5JA 2XWYA 3PR4A 1QAIA 1TP7A 3CIZA 4NLTA 3MECA 4EBDA 1LWCB 2XCPA 1RT6B 2BRKA 3RB0A 3M8QA 3BR9A 2C2RA 3M9OB 1SV5B 3DRSB 5C24A 2XC9A 4TN2A 2ALZA 1NNDA 3G6YA 1DLOA 1JLQA 5DQGA 5HLFA 4ZPDA 2FLNA 2VA3A 1TKZB 1JLFA 3QYYA 4KKOB 1CSJA 4EYIB 2IJFA 3GQCA 3Q8SB 3QGIA 3RAXA 2XGQA 5EWFA 1T05A 5KG1A 4IOBA 1RTDA 4KFBA 3UR0A 5L1JA 4IQXA 4IR1A 4HYKA 1FKOB 4KKOA 2BANB 1HNVA 4LSLA 3KLGB 2IM3A 4ZP6A 1RT4B 3V6KA 5HLFB 4IR9A 1S1VB 1TL3A 3H5UA 1MU2B 2FLLA 2XCAA 1RA6A 3OSNA 5F8JA 3OL7A 3KNAA 1XR7A 1LWCA 1JLEB 2ZE2B 3LALA 3QO9A 4O44A 4F4YA 2W7OA 4ED7A 4JV1A 3OLBA 1SH2A 4MFBA 1IKXA 3NBPB 1HQEA 2W9CA 2FVPA 4HKQA 4NYZA 3KLHA 4MK8A 4Q8EA 2HWHA 4TXSA 2WHOA 3M8PB 2VG6A 4I2QA 3V81B 2AGPA 2D3ZA 2OPPB 3TVKA 5KFRA 3BSAA 4ED0A 3Q8PB 3DLEA 3D5MA 4J9RA 4IH7A 4URQU 4RW4A 3MEEB 5KFTA 4QW9A 1IKXB 4YMEA 5J2NB 4NRTA 3QZ8A 2JLEA 2R8JA 4Q8FA 5KFQA 3DYAA 2FJWA 4K4TA 1ZTWA 1JX4A 3HVWA 4Y34A 3V81A 3GV8B 3CDEA 5CYQB 1TL3B 3H4BA 1RTIA 3DOKB 3H5YA 5KFGA 4FBTA 2RKIA 4NZ0A 3QLHB 4MK9A 3PW2A 4ECQA 3HHKA 1S4FA 1RT1B 2BRLA 3HVTA 4RNOA 5L1LA 1C1BA 5F8LA 4ICLA 4MIBA 1JKHA 2YNHA 4NLSA 3OL6A 1RT7A 4KFBB 4J9MA 5KFNA 1JLFB 5KFCA 4H4OA 5K14B 4MK7A 1HNIA 1S9EA 1RTJA 5DGBA 4NLOA 1DLOB 1JLQB 1LW2B 4J9SA 3DM2A 1N5YB 3DRPA 2ILZA 5C24B 4KO0A 1MMLA 3M8QB 1S1UA 5KFKA 1QAJA 3BSNA 4IG3A 2W9BA 1T94A 5EWEA 1GX6A 1TVRB 3MECB 1IKVA 1EP4A 2W7PA 3KK2A 4O3RA 3DOLA 2HWIA 4NCGB 1HMVB 2C28A 4O3OA 2WK4A 1RT5A 2J6UA 4IRCA 5J2MB 5KT6A 2ZD1A 4B3OA 3TAMB 3FDSA 3I0RB 4O4GB 4IRKA 4ZP9A 4IG0B 5J2MA 2WOMA 2GC8A 4O3PA 2OPRA
chains in the Genus database with same CATH superfamily
3V6HA 1RT5B 2OELA 3VVUA 3GE9A 1NRKA 3I5AA 2P5VA 2ZH1A 2VPYB 5KFWA 3T3FA 4N5SA 4EZ6A 2V4JA 2VPWB 4K4VA 3C15A 4ZA1A 1TVRA 4Y65A 4JI8F 4UY85 4A8SA 1HWLA 2YX7A 4ATNA 2ZJQQ 2VG5B 4ZVHA 2MZSA 4KJIA 4OJ1A 3CE8A 2DXFA 4KV8B 4X4RA 5EUHA 1UWAA 4C7QA 2MHEA 3NEKA 1M5PC 2XS5A 5KAKA 4MIWA 4DR3J 4WWSA 1MWYA 3E8OA 4CO4A 4PG8A 3R5CA 4Q5VA 2R8KA 2E1CA 4GKKF 2H5JB 4DQSA 4LR8A 4CIOA 3NGSA 4A8KA 4G1QA 1UW9A 2G1HA 2FHJA 2NXNA 4QWDA 3BQ2A 1VMBA 1YJTA 3I0SA 4DV7J 3M7VA 5HMYA 1UJ4A 3MM9A 2AGQA 2GS8A 1REVA 2CQ3A 4PXCA 4C48A 1IJEB 1IN0A 5LXYA 1HYSA 3ZO7A 5CYQA 4QIWD 4ID5B 4UQGA 3MTJA 2PC6A 7FDRA 2WVDA 2RDJA 3ZNUA 5CYMA 3G86A 4F50A 1KNZA 3SFGA 3GV5B 3FEXB 1N48A 1KLMA 1OQ6A 4OMFG 5KT7A 3CUNA 4DG1B 2YKPA 4OYBA 2UP1A 3MM5A 4DV3F 1HWUA 4ELTA 3OL8A 2KG1A 2C2KB 1FE4A 2AQ4A 2AHOB 1QLNA 5AXKA 3HHLA 3EDQB 3MHYA 4PQAA 1VI7A 2YWFA 2BKNA 2MPUA 2D1CA 2J7WA 2B4OA 4URGA 5K8PA 2PSZA 4PG5A 1SUQB 3VGTA 4UT4A 5C42A 1KFDA 4LT6A 3PYEA 3KKFA 2HNDA 2HNYA 5FDLB 2FD2A 2AWZA 3CWJA 5C7PA 2F9JA 4JV5J 4IH6A 2CNLB 1F5BA 1F5AA 2O5DA 4HACB 4Q44A 3AX5A 4DDFA 2WSEC 4YP3A 1UVLA 4Y2AA 1LK5A 1U47A 3DC2A 2K7JA 1VLOA 3IAM9 4DX8H 1QVGR 1JLEA 2ZE2A 2RT3A 3T1AA 4WU2A 1LW0A 1S48A 3MMCB 1WKJA 4V19J 3AX3A 4LFBF 4NLXA 1NLKL 3HVRA 1VC6A 4OHYA 3MR6A 2DXDA 3I82A 3B4DA 1W2IA 3M9MB 3HDSA 4F7VA 3DLLQ 2ZH9A 4DV1F 1RWNB 4ER8A 3KLGA 3CB4A 2EFQA 4G1PA 2KJWA 2VH7A 4KRWA 4JV0A 3UN5A 5HP1A 2VDHA 4Q43A 2LQJA 2ZNZA 2QT7A 1FRMA 3WQPA 5KT2A 3H25A 4DFMA 1S1TA 1T05B 1N8RT 2Z2LA 3KYLA 3O6QA 4C0HA 2VDIA 3PRBA 3AJDA 4ZIWA 4ZP8A 3Q0AA 4FP9A 1TKZA 1BQXA 2LCWA 1SL1A 4K7QA 1VQSA 1WJ9A 4AL6A 3KOAA 3GCWP 2M7SA 2GAHC 1Y9OA 1WUUA 3LOUA 4RPFA 1JLAB 4EMDA 3V6JA 5HROA 2F63A 3GR1A 5A8RA 2WAQD 4GC6A 1YDLA 1LWEA 3NKYA 2MY7A 2J8SA 2PMHA 3IWLA 4OQJA 5KFXA 4RU2A 2FVRA 3R3TA 2GQCA 2LDYA 1X0PA 4LJMA 3W1YC 2FY8A 2MLYA 4WU3A 3CDUA 2ZKTA 3LAMA 1FT8A 3T5KA 2MHNA 4OI0A 1NDLA 2B9WA 2V69A 2DNMA 4IQMA 5FDLA 4F3MA 3BO3A 3KJNB 4N47A 1T9VA 3ULHA 5C42B 1U1KA 4Y2CA 2Y8WA 2R7QA 3PJWA 2H5EA 3BBFA 3CJ5A 4J37A 3LP2A 5KT4A 3HULA 1RAGB 4LF4F 4KE5A 1S6QB 4J9OA 1U1PA 3V6DA 4F2RA 3ETMA 3L7UA 3VGSA 3ZTPA 3CCSS 3QGHA 1R6VA 4QWAA 1VIXA 2IAJA 3FMBA 1F5CA 3CEDA 2ASDA 1CVJA 2RDIA 1R7IA 3FRZA 2YH0A 3TW0A 4X64J 1KRPA 4P75A 4JI2F 4NLRA 1SKUB 2YH1A 4WFXA 2FHOB 1I94J 2KFNA 3V2UC 2NYHA 2E29A 2NUUG 2W2QP 3MURP 2OAUA 1HHTP 1WHWA 1EKRA 1P1LA 2XY7A 3LTOA 5B7WA 1PYTA 4RBTA 4AUKA 4J9PA 4I2PA 1T9TA 4CLLA 3G96A 1U4BA 4X4NA 2DO4A 1XIQA 2E7XA 4IFYA 2NPFA 2KHCA 1YZ7A 2I0XA 4NA1A 3LP0A 5IWAJ 2BJ3A 1S0MA 2XTJP 3BGRB 2LQBA 2I5JB 2VHGA 1S77D 2F4VF 1FD8A 4XK8C 4BHQA 3I5CA 2H4WB 4WZQA 1T0TV 1WF0A 2VBXA 2JC1A 3AY0A 4OYXA 3S01A 4GVLA 3KK3B 1FX4A 3H59A 4PWUA 4MKAA 1WHYA 4DBQA 3HM9A 2F8HA 4NYPA 3EICA 3NP5A 2GGPA 2CQ1A 2OSQA 1FKPB 5J2QB 2C2EA 1Y4ZB 2YNIA 3KMSA 1RWWB 1VJQA 2VG5A 3GR0A 3HD1A 5I3UA 2FDNA 1T03B 4NXMJ 1FDDA 1HBMA 1LWFA 2DNRA 1FXRA 3QJPA 3GU0A 1ZZNA 2RAQA 4PG6A 1N6QB 4F04B 4FN5A 2RH3A 5JVGQ 2IMWP 1N33F 1XMOJ 2ZWPA 2KL8A 4G1IA 4LMZA 4LR7A 4LF1A 2WOMB 1Q16B 1XQIA 4ZVOB 4R25A 8RUCA 3SQGA 1RQ0A 3BGLA 4DL3A 2WBMA 3PRVA 2L41A 4J9LA 3GJSB 2WSFC 5A8WB 5CA5A 2HFSA 1IKWA 2LYVA 3EVOA 4Y2IA 3D0GE 3QWUA 2WONA 3QAUA 1KEKA 1ZETA 2V0NA 1RWVB 3M30A 3A13A 2AJ1A 3KMQA 2P9GA 4OYPA 4MT1A 3KK2B 2C3YA 4RWWA 4NZ6A 1N6QA 3KLIA 1LFWA 1U6ZA 2K1RB 3O8WA 4WTYA 3SSSA 4V1Ak 1S49A 3RTVA 1LWXA 1X31C 2DR6A 4TU7A 4IH5A 2JEJA 2JSXA 3VQTA 1U02A 4RX6A 1GNKA 5KFFA 1FRHA 1XK8A 3K5NA 2FJEB 2R8IA 4CH0S 4F3QA 2XSFA 1FJGF 1B99A 4QWEA 4P73A 1N5YA 4IR9A 1U2FA 2ZDOA 4O0NA 2R2TA 3HX9A 4J90A 4WKYA 1WHXA 2UVVA 1NM2A 3CJQA 1R6YA 4NA2A 2QO3A 5B0AA 3SCLE 1XNRJ 3J80U 3NS5A 2MQLA 2IJNA 1FFWB 3DFEA 3HVTB 1HFEL 3BM7A 2B4PA 3IGVA 1JNRB 1XTZA 2JX2A 3EE3A 1IBLF 1HA1A 1TK5A 3IA0A 1VYAA 2I38A 3LF0A 1N32J 5AJ3J 3N9UC 1UW4A 1LW0B 4PKDB 2WTFA 3FCVA 1HNWJ 4C8NA 1CJVB 1X4FA 1A9NB 2GHVC 2V4QA 3KWMA 1U1MA 2WW4A 2XTDA 4I7FA 1TL7A 4DPUA 3K5MA 2JEGA 4WE1B 1F6TA 1UWBB 3G2XA 2HFVA 1NZ8A 4KGZB 1GAOA 2EBGA 2HGMA 3A3PB 1WOOA 3BYPA 2XM3A 1GXUA 2X1FA 3CCUS 2KXNB 4JI3J 3M8PA 3AB4B 3TZXA 4DUYF 3T5LA 2RS8A 4X66J 3VV2B 2RHQB 2XS7A 4IKAA 3PR5B 1KDNA 4PG4A 4DPOA 2FB0A 2H51B 2ZUAA 1Y0HA 5KFEA 4A47A 4PUOA 4DOZA 4I7FB 2F8EX 3T6JA 3GIJA 4NLYA 5A76A 3NMRA 4ILMA 3C46A 4PABA 3UCGA 3P5TL 4QYZJ 1LWEB 4YOEA 2RMLA 3D3CJ 3NMAA 1PKUA 2IFXA 2KU7A 1UCNA 3EZOA 3QWPA 2I1RA 1KS2A 1ITPA 3EGNA 4F4XA 1S1VA 1Z4UA 3BQ0A 1MW7A 4NPOA 4DN0A 1IBMF 1VBZA 3K5LA 1MROA 3GB0A 4PUOB 1VCTA 3DI6B 1K0VA 4EBEA 1EETB 2J9DE 4QJVA 3OHAA 4DV4F 4I0WA 6FDRA 4WK3A 1Y3KA 1ZM2A 2E1AA 2ASJA 4NXNJ 4OI3A 4KIAA 4FBUA 2YNFB 2LMIA 2V2KA 1WWHA 1T02A 2KXHA 2JJ4D 2JVRA 2ZUGA 1S1WA 3N6LA 2RRNA 4CWBA 1SC6A 2E7VA 2E1RA 3PHTA 4QPTA 3AQOA 3FZBA 5HVFA 3IN5A 5D4OA 4ZS6A 4B9UA 2UXBJ 2VPZB 2HQIA 4ZJQA 4WKRA 2HS0A 3MUMP 4X4VA 2N7CA 2ACMA 3GV7B 4LFCJ 2ROGA 5F8IA 2O1PA 2ROEA 4KSEB 4CO2A 1T9XA 4DR4F 3LANA 4ZPBA 1IKWB 5IT0A 2WCXA 4X4OA 4NLVA 4IG0A 4KB7A 3KHRA 4DQRA 1SKWA 1FRJA 2KFZA 5KG6A 3TANA 2J9CA 1YITS 2CWXA 5DM7Q 4CH1A 1S6PA 2B5JA 2IM1A 5HJYA 2FIUA 3TOQA 2DHHA 4U6PA 3DLBA 3HHLC 4CT8A 4F3OA 3R27A 1QM9A 3R5GA 3RUBL 1B70B 4WFNQ 4ED6A 2CNOB 2B4UA 3HZEA 4NCBA 2VODA 1EP4B 5KFDA 5C25A 3OJUA 3J7AN 2VBZA 4ZPTR 4AXIA 1XN9A 3BO4A 1LWFB 2EEYA 1KBRA 3RJMB 4G6VB 2ERRA 2BQRA 4ITSA 3SSQA 3IO1A 5GMDA 3R6LB 5CYMB 1I3OB 4CP5A 1NK5A 4ID5A 3G82B 1ELOA 5F9NA 5I42B 1VQNS 3QGPA 4ES3A 2CPXA 3TJ9A 5ETSA 1VDHA 2FLOA 4K59A 2DR5A 1D9FA 3J7Z5 3QPIA 4CO1A 4ZP7A 2VIHA 2C2NA 3AHPA 1M1HA 2ZFHA 2MTLA 1REGX 3LP0B 3DRXA 3QJLA 1B0VA 1PJ7A 3J7A1 2O3DA 2W4PA 3W64A 5KFBA 2W8KA 2LXFA 1RWOB 2KRBA 1C0UA 4PAAA 4ECUA 2V67A 4OYMA 4I2PB 4OZ5A 5CH7B 1N56A 2NREA 1RBOB 1PBUA 3CJSA 2L9NA 4DFPA 4UW2A 1FI4A 3HHNB 3MOJB 1U49A 2H9ZA 2DRDA 1HL6A 1OM2A 2OMOA 1DRZA 2E5LF 2DNQA 2YVSA 1YI2S 2IRUA 3U7JA 2M9KA 3KK1A 3KHGA 1RGVA 4I6WA 5KFYA 4KT0C 1QAXA 4C0OC 2CQDA 3AT1B 3UR3C 4HTJA 2WVBA 3H20A 1Y7PA 3A3OB 1MWQA 1FD2A 2FZGB 2LQ5A 5FJ4A 4FDFA 5KTQA 1ULRA 4KQZA 1R43A 2OTJS 3I0RA 3JXOA 1X9WA 2YKNB 4JI0F 1U8WA 2ZBPA 2DNZA 3MMJA 3MPUB 2I8EA 4DCPB 4Q7AA 3EYZA 4JI6J 5KG4A 1T9UA 2DIUA 4W92B 2UXDF 4DLGA 5L39A 4F0MA 2MKJA 2PDAA 2A1BA 3MOZA 5D0GA 4YY3F 3D0HE 3H4DA 4J9QA 3PR4A 2KHDA 2QLJB 2QRRA 2RU9A 4DV1J 2UUAJ 3MECA 2DH8A 2HRUA 3IXQA 1SJRA 2LDIA 2P8IA 5U47A 4F8RA 2AT1B 3W3SA 3SCKE 4ERDA 1SKSA 1GXLA 2BVZA 4B3MJ 1P9QC 1FRIA 1LOUA 3BR9A 1SV5B 5C24A 1FDNA 2YPZA 3C14A 3SYZA 3G6YA 1SKRA 1DLOA 1JLQA 4ZPDA 3CJTA 4X4QA 1TKZB 1WELA 2PEHA 4I6YA 1U6FA 1CSJA 1EX8A 2YWKA 4DV6J 2F4FA 2W7AA 1UFKA 1JK9B 2FPHX 4FXDA 1T05A 2W2PP 4KFBA 1NDKA 2YKOA 1YRUA 5K5MA 2PA3A 4WP9A 2JH3A 3EVMA 3QFHA 2DR7A 4DQPA 2KZMA 2C2OB 2ZHBA 4CM2A 4E0DA 1TL3A 3H5UA 4P7TA 2FLLA 4ILRA 4EGLA 5LMNF 2HHUA 2CDRB 3TNVA 1FEEA 4C8MA 2CQBA 3HT3A 3EWGA 3OSNA 1WACA 1HBNA 2VF3A 4CLTA 4DUZF 4IOAQ 3CTRA 3I56S 2K3IA 3QO9A 4FZVA 2WVEA 3OJSA 4F4YA 4JV1A 3L7OA 3WBZA 3WX8A 2MSSA 4NCAA 1H98A 4KPCA 1F2HA 3O5TB 3Q89A 1S7IA 4L3NA 3BKFA 3ETOA 2BEFA 3Q24A 4Q8EA 2HWHA 2EK1A 4DR6J 4OJGA 5CD4H 4B9NA 2AYGA 5E5NA 3W5ZA 2OPPB 2OI2A 5KFRA 4BLGA 3Q8PB 4HHJA 1WDTA 2X7IA 1UFLA 1HQ2A 2IDEA 3GFHA 4K0KJ 3SSRA 2HQCA 3M6VA 1RBLA 2QC3A 5KFTA 4QW9A 2BW7A 1XJWB 5GAGU 2JLEA 2HBYB 3T1HJ 2R3VA 2DGVA 4K2XA 1WF2A 4LF7J 1H7WA 4J7CA 2FJWA 1QVFR 1J2VA 3ADAC 4USHA 3GLJA 1JX4A 1X4DA 4DQQA 2KO1A 4C8LA 1TL3B 3H4BA 5K9FA 1RTIA 1WG5A 3H5YA 2BJ7A 4U96A 2X3DA 3W8GA 5A6PA 2E44A 3HHKA 3PCOB 3PV8A 1RT1B 3B82A 2E66A 4XIUA 1JKHA 1NCLA 4NLSA 5B0CA 1DJ0A 1YBTA 2VOOA 3MEKA 1VIOA 1NJXA 2BZ2A 1DLOB 1JLQB 3DDIA 4MMOA 4DFJA 2BJEA 2ILZA 3DRPA 4D3HA 1ZAXA 1NB7A 1MMLA 5CABA 5D78A 1WTFA 3U02A 4DX5A 2XYPB 2HK3A 6AT1B 3UDVA 1QAJA 1AYEA 4IG3A 1B64A 2FTRA 1OMSA 1HKAA 1RWKB 1TVRB 1XNQF 3PX6A 2YQ3A 1EP4A 2B3TB 2KI2A 2LA4A 4FYYB 2DHSA 4K5SA 2HWIA 2PMZD 1HMVB 4DU8A 4ZIVA 3PY8A 3KNGA 3AJ2A 4O3OA 2YWEA 2J6UA 3Q2TC 4QYZK 1NH7A 2AJFE 2GC8A 1HW8A 2DGWA 2MMYA 3MM8A 4LRAA 3O3LA 4C98A 1HQUA 5BR8F 1I5OB 3V81A 1HMVA 4X84A 1YBUA 5KFUA 3DMJB 3G8QA 2QL5B 3M2VA 1YSJA 3GYNA 4R8UA 1IKVB 2E1PA 4KGKA 1KOOA 3Q8QB 1DTTA 1RT3A 2B9EA 3IBFB 3QIPB 2XGPA 1DTQA 3OFEA 3L4BC 3SQOP 4DL2A 3PZPA 1FKPA 1UEUA 2IIHA 2QSFA 4CH7A 2ZJPQ 3MPYA 4LF2A 2DT9A 3IBWA 2BXJA 5HI7A 3RB4A 1HHSA 4H4OB 5K14A 2HVIA 3D1QA 3OUYB 2VICA 1IR1A 2UUWA 3MFIA 1UKUA 4YHHF 3CCES 4HI2A 4X62F 1VC0A 2HK2A 1MROB 3FBFA 4F36A 2C22A 1H0HB 3MMBA 5EX3A 3HFZB 2G4BA 4USTA 4ES2A 1DHMA 2DY9A 4DV3J 5E3CA 1RHKB 1RTIB 1KVJA 4CM0A 2IC3B 2JDJA 1WOSA 4RJVA 2HZVA 1QAYA 2R7OA 3WIUA 3B6BA 3W2WB 2FHKA 1N0VC 2DBBA 5DDPC 2OSRA 3TVYA 4L72B 3DGPB 2HFZA 3BV8A 2R7SA 2LA6A 1KC8T 1HNZJ 1UMJA 3QT6A 2CKWA 3PKYA 2HGLA 3MEEA 2R7TA 2G0JA 2A2DA 4LBIA 3W7BA 1Q7LB 5LOQA 1B0TA 4KR0B 3W2VA 1X0FA 1T3NA 4OYZA 1R8PA 3N6MA 2Z2ZA 2CUYA 2M0GB 2BACA 3SV3A 5LT5A 3HP6A 2AJQA 4GC7A 1VRTB 3LP1B 4C0BA 1R8CA 2ROPA 3T6BA 5GMEA 3CJ2A 3TZYA 1HQEB 3LWLA 2W9CB 4QIVA 3RBEA 1H73A 1UP1A 3PNIA 3H2LA 2YWWA 4CTAA 4ZCLA 4CLSA 4CYUB 3JYTA 1UA0A 4ECRA 1K8AT 2DNLA 3VVTA 1LXNA 2WSCC 5DG8A 1H3DA 2VPXB 3WC0A 5HVHA 4I4BA 4TU9A 1UA1A 2Q6CA 1LXJA 1T9YA 3O2IA 3EGWB 1XR5A 4BWMA 1TK8A 5DG9A 1SJ4P 1UUJA 5D4NA 1R0BG 5A6WA 1WDDA 2FHJD 2ZVSA 3HZGA 3WIVA 1UPPA 2HG4A 4HVZA 4BWJA 1IBCB 2AYBA 2V8PA 4KTQA 1BC6A 2BE2A 2DB1A 2XZDB 3H42A 3PXGa 2HFUA 1H7XA 1BXNA 3QSYB 4NZ7A 7AT1B 1XR6A 1FEHA 3W65A 4YR2A 3DI6A 3RBZA 1QY7A 2P6SA 4TQSA 3QAEA 2DPIA 3BKTA 2BM1A 1CJTA 1VLYA 4EK2A 5H9FK 2GX8A 1VK8A 1HBUA 1BE4A 3M2UA 3S1TA 3VGUA 4DR5J 1RXOB 4JI5F 3HO1A 5DLFA 1BQNB 3GPAA 5ETKA 1SI9A 4DR4J 2NQPA 4QCLA 1PG5B 1NAQA 4C3MA 4UOHA 2ZH7A 2JEIA 1GEHA 1BLUA 3TUZC 2HHPA 2W8LA 1R31A 4NI2B 5T41A 5KG2A 5KFHA 3JYTB 1ZAWA 1CJUA 2BABA 2L9DA 2OD6A 3CT9A 3MGJA 3PG9A 4KY3A 3H5XA 1SQFA 1YWXA 4KAIA 3S7RA 1E6VA 4C3LA 2HSEB 4E2FB 1SJFA 1ZM9A 3NAHA 4OZJA 1A0OB 1SL0A 4JI8J 4X64F 1L3SA 4O4RA 3SQGB 2JRSA 3OPKA 2YKMA 3I6PA 2AJ2A 3DLGB 3N0VA 5HVGA 4OJ3A 4EEYA 1VRUB 2K3KA 4NLWA 4GMKA 3R7SB 3VAHA 4QZVB 5J1EB 3R1LA 2HRTA 5HAOA 2XHCA 4ECYA 1MG7A 2ZC4A 3VAIA 2H48B 5F8GA 2XS2A 1KSPA 2GO9A 1R0AB 1IKYA 4AYBD 2XSJA 1BQMA 4DV7F 1KLMB 1ZPWX 4O23A 4K4XA 2RS2A 4RBUA 4PQUA 1P27B 1T03A 2VG7A 3D1HA 3W9HA 1DY3A 2EKYA 3MTKA 4GO5X 2MDAA 1RT2A 4WBFA 3SIPB 1RHQB 1TUGB 2IM0A 3M8WA 2Z58B 1RWUA 3KK3A 3PYFA 1A7GE 2J9DA 3ZTSA 2MKCA 1SBRA 2IYIA 2YWHA 3I0SB 1TUVA 2BDPA 4DZDA 4ZJOA 1RYRA 3NLCA 4DJBA 4ED8A 4RBVA 4NLGA 4A8YA 1VK3A 2A6MA 2XI2A 3AD8C 1KONA 4YN3B 1Q82T 3OV7A 2DD8S 3NS6A 3HFVA 1H6KX 1HIYA 1D1UA 4TLQA 4CCHA 2COLA 2Y3YA 1L5UA 4TQRA 2Y8YA 4P2XA 5GAEU 2QL7B 3N28A 1N33J 4U7UK 3R9LA 1VS3A 2OPSB 3ENQA 3UDCA 4LBPA 2G2OA 5KT3A 4O3SA 1KTQA 2J0XA 5CQGA 9RUBA 2ZBQA 1S72S 2NXCA 1YJ9S 1CS4B 2L9WA 5BYQA 4OJHA 2CPIA 4F26A 4CNZA 2V63A 1M1KT 4K4SA 3B4MA 3EVWA 5MAOA 2CZ9A 4KGVB 4QR0A 3QGGA 1IM6A 1NSAA 2EVZA 2LVWA 3D68A 3U1MA 4YY3J 4DL5A 3HI9A 1YTYA 1NK7A 1BUXA 3N5FA 2MKKA 1AZSB 2LU2A 2N3LA 5GADI 1IM4A 2HKEA 4HDGA 3UDEA 1NBEB 1C4AA 1N5TA 1AFIA 1X9SA 1RBAA 2CNNB 2ZZNA 2Z0GA 4A8FA 3WDOA 4BCAA 5GAHI 3PW4A 3CC4S 1F3FA 2LEPA 2DIVA 1WG1A 1EIYB 1U2RA 3NNAA 2RB7A 2C2MB 2BJ8A 3THVA 1X4CA 1GMUA 2CJYB 4P72A 1TELA 3NGRA 4NLUA 1Z1ZA 4EO6A 2YY3A 3CCLS 5A8RB 4ELUA 4ZCMA 4X4SA 4L3KA 5H9EK 4ZVGA 4LF6J 3DRPB 2CAJA 4AL5A 4ZHRB 3DM2B 4FS1A 2ZKUA 1K1SA 3IRXB 1HWIA 1S9EB 4PCQA 3RAMA 3QIDA 1F3VA 2YNFA 4USJC 4ECZA 2V6AA 1R89A 4OI4A 1APSA 5F8NA 4DX6A 2XLKA 4NLPA 4OHXA 2ADCA 4LF5F 3DU5A 1VRQC 2I5JA 3D67A 1EETA 5AJ3F 4C97A 2YNHB 5ETOA 4A8QA 4HT5A 2HQGA 3EJMA 2PMWA 1AROP 1X4BA 3MAAB 2GW8A 2HZAA 4XAKA 3R2CJ 4C8ZA 1R8AA 3OHBA 2DNKA 4CRJA 3GIKA 1Q95G 2VJVA 2FJVA 1YJRA 2MSTA 1PJ6A 2MLZA 3I87A 5KG5A 1EARA 2XG8A 3IFEA 2BR0A 2H4YB 5KFZA 4OX7A 2GAGC 3DYAB 5A8KA 1AUSL 5KFPA 3RW6A 2V2QA 3OTOF 3CIMA 3R1HA 1HI8A 1TV6B 2CQIA 2G1DA 3H8YA 1NKCA 3R5AA 5D77A 2R7XA 1N4LA 3EZUA 2NXEA 2E1MC 1S6QA 2ATCB 5KFJA 4DV5F 3T1HF 3JQMA 2ZOFA 2ZVIA 1YLXA 4K4UA 2J8AA 3FGVA 2ZDPA 3BS9A 1TU0B 1RADB 3GTYX 5AXNA 3EX7B 1H38A 1UVJA 2W2NP 2VQEJ 3GJQB 4M94A 3W9JA 2RU3A 3BDPA 4MFBB 2XTCA 4KGXB 3DGVA 4A48A 1ZZFA 4LVOP 3ZZRA 4DV2J 1JXLA 3AFGA 3GYXB 3BDEA 2HVEA 3RAQA 3SCIE 3KHHA 2FHMA 4DV0J 4DR7J 3C16A 4P71A 3VR1A 4ZLLA 3FEYB 4OZ0A 4M5DA 2AU0A 3Q86A 3KLFA 3C6UA 1VQ9S 3HT0A 1HYSB 1GXTA 2KB2A 2M5YA 4Y00A 4B3SJ 1QE1A 2GQQA 1UZDA 1U0HB 2W2OP 2V68A 3AOCA 4ZVUB 4ZN1A 4OYAA 4DL7A 4CLUA 3DLKB 2QTWA 3FRYA 2D9PA 3HVAA 5K8OA 2DPJA 2AJ4A 5AE3A 2HMIA 1UETA 2XMUA 1DARA 1G6BA 2BE7D 5ETPA 2N82B 2DEJA 4LREA 3BGUA 3SCJE 2MKSA 3LGNA 4OZ2A 5ADZA 3J7ZT 1D9DA 1UJ6A 1X5OA 2A6OA 1L3TA 3C3LA 1VC5A 1H74A 2NXJA 1NHUA 3IRXA 5E3QA 3TJ8A 3T9ZA 3GIIA 3M2RB 3DRSA 3KG4A 1NK4A 4D3GA 3CMAS 2D3O1 3LAKA 2FLPA 1JQGA 3P49B 1OYEA 4O0IA 2ATLA 1RT6A 3MUVP 4USKA 5ETVA 2Q3PA 2OEMA 3CCZA 2C42A 3NOCA 2VC1A 2HIYA 3RG6A 4B3TF 2V4JB 2AIRB 1TKTA 1F1BB 1KHWA 2J76E 3THTA 2GO8A 3M8RA 2NYIA 5L9XA 2KM8C 3W62A 2HLUA 5CZVA 2ZH8A 4ED3A 2MGZB 2YKNA 1KWMA 4JV2A 2XULA 1RCOB 3OQ2A 1KQSR 3TAMA 5DDOC 2UVUA 3UO0A 2MZRA 5D4LA 1FNOA 4JOUA 2DH9A 1NMEB 1U1LA 1WF1A 1TUWA 1RTHB 3R7BB 4OLOA 2AV5A 1I1GA 3K5PA 4I56A 2HYIB 3TQ1A 1C0TA 2YBVA 2A10A 4J9NA 1A6LA 2H5IB 2KYXA 2VFVA 4CYUA 4A8MP 3HHDA 2CQGA 1S1UB 2YX4A 4BC7A 1LEOA 3NNCA 2V2VA 1UTAA 2OH2A 5FLXU 4CO5A 4DSEA 4P2SA 3UD4P 4A8OA 2FJDB 5AXMA 1X5TA 1HNWF 4S0MA 4I67A 5K8MA 2ADBA 4CNYA 2CRLA 5J1NA 2QMXA 2HHXA 2PO4A 2UV8A 1JXVA 3GZ7A 3CCQS 1C1BB 4ICLB 2NPIA 2QGFB 2VU5A 3N5BA 4P52A 3JSMA 1K0TA 2GZOA 1RHJB 1IUJA 5A2QU 5MLCV 2ZH2A 2Y9HA 1TMMA 3R5BA 3CO9A 4RW7A 3SI8A 4K8RA 5D3GB 3FK4A 2VG7B 3CJ8A 3J81j 4PQUB 1RYSA 3HHEA 1OWXA 1Q8KA 2ZNYA 4YS2A 4AQYF 1FK9B 1NO8A 2V4RA 1QD1A 4WYWA 3EPIA 1SQGA 2Y0BB 2GVDA 3OBIA 1S0NA 1K73T 2NXUA 2LLZA 1FRKA 2YPYA 1N36F 4M95A 1JLCA 5KFIA 3JTPA 2B8PA 1MWZA 3OR2B 3ZZZA 2AKWB 1NUEA 1L3KA 1UVMA 1EKSA 2X3GA 3POTB 2AJ0A 4N77A 4BS2A 1R27B 3MPVA 3TR5A 1U24A 1JLGB 4LIRA 4F0KA 2VG6B 3G6VA 2DNPA 3TA1A 3T1YF 2ZD1B 2ASLA 4B3OB 4GVBA 4LRDA 3X3UA 1HNXF 2BOAA 2D3OR 2B6AB 3HD2A 5DQHA 1XC9A 3SFUA 3OFFA 3NBPA 3D6HB 3RU0A 1NU4A 3NGDA 3T5JA 1YJ7A 2PI5A 1NK9A 1TP7A 4B9LA 2VJUA 4NLTA 3C19A 2CPEA 1GMWD 2F7VA 4N7TA 4EBDA 1LWCB 4LF8F 1RT6B 1WI6A 4RR5A 1BWEA 2FY1A 3M6XA 1P9YA 2JNJA 2XEXA 3VAKA 2FGOA 1XMBA 2E5LJ 3BEGB 2OGUA 4AT1B 1F2GA 1IXKA 3BYRA 1XEZA 3A4TA 3GWCA 3HLUA 4IUFA 5B0GA 1HBUB 2A3JA 3HJVA 1JLFA 3G4SS 3L3CA 1S6OA 4USWA 5B08A 2IJFA 3GQCA 4JYAJ 3Q8SB 2C2ZB 3QGIA 2BW2A 2XGQA 5LMNJ 2HHWA 4IOBA 2D68A 1RTDA 1QTMA 4IQXA 4ZLNA 4HYKA 4IR1A 1MLAA 1FKOB 1Y5IB 3PIPQ 4LFCF 1GTEA 4B9VA 2KXFA 4J91A 4QR1A 2BYCA 5F41A 1RT4B 1WSRA 2CFXA 1EB0A 1S1VB 4M5GA 2BA9A 3CMES 3IBCB 3PYGA 2JZ5A 2YQ0A 2QLWA 4FNHA 1V3ZA 4XDCA 2DRBA 3C16B 3MAQA 2V8DA 1O8BA 4WPAA 1R0CB 1OYDA 3M8ZA 4C6AA 4OYWA 5ETNA 4O44A 2XZ2A 4QIEA 1NEEA 3TX8A 4E98A 2W7OA 2VQFJ 3NRBA 1GT8A 5LSRA 3TAPA 1IKXA 2QEXS 3TARA 3FCWA 3C2PA 1HQEA 2FZKB 2W9CA 2FVPA 3KLHA 3OXFA 4DCJB 1VQYA 4C4WA 1H2TZ 4C11A 1YHQS 1S99A 2AGPA 1RP5A 3MMAB 3UFCX 2LKZA 5CXTA 2HRYA 3DLEA 3D5MA 3GMGA 3W2VB 2EG1A 4X4UA 3BKUA 1FWKA 4YMEA 4LIWA 4Q8FA 2XMWA 5F0UA 5KFQA 3G71S 2HFOA 5SUHA 2B7BB 3NG8A 1OQ3A 4Z37A 2B7CB 4OV1A 5M2UA 2HVHA 1W26A 3VAJA 4P2FA 2CXEA 5HMXA 3DOKB 1Q8BA 1XMQF 5KFGA 1U1RA 4U7UD 4NZ0A 2EBEA 4MK9A 3AX2A 3LGMA 4IYQA 3HF5A 3MM9B 2JWNA 3TZWA 4J9KA 4ECQA 3UCZP 4JP8A 2BRLA 3HVTA 3IM9A 4P10A 4BC9A 2ACYA 4PXEA 2DGQA 3W8PA 3OL6A 1O5JA 1RT7A 2X51A 3CCTA 4NMXA 4P6QA 3JB9k 3EGZA 1R8BA 1IWAA 4TU8A 5KFNA 5KFCA 1XNQJ 2IRYA 2JVOA 1HNIA 5D15A 1N5YB 2QA4S 2VBWA 3C14B 4ZCIA 2NZCA 1OPZA 3R7NB 4DQIA 5AXLA 3M8QB 1S1UA 4JI6F 5KFKA 2DNNA 2W9BA 5EWEA 1RISA 2V2ZA 3GP9A 1GX6A 2W7PA 4M5KA 3KK2A 3DOLA 2C28A 2HHVA 3TVZA 1EJ7L 4KHPF 2YX1A 5BR8J 1YX2A 1IBKF 2WK4A 4LRBA 4GVBB 2DVIA 5J2MB 2G0IA 2GNKA 3NCQA 1TKDA 3F56A 3DHWC 1QDUB 3LUYA 5HL7Q 2MGZA 4ZP9A 4IG0B 5J2MA 1HD0A 2OPRA 2V34A 2ZEJA 5E0OA 4O3PA 5IC6B 1RKIA 2IVMA 2VUGA 3OR2A 5D0HA 4RZRA 4ED2A 2V8GA 4DV6F 5IM0B 2Q79A 4F02A 1T8EA 2DISA 3T9NA 1V9OA 2GJ2A 4PZVA 4DCOB 2W9BB 2HVZA 4MIAA 4V19X 1TKXA 1RU1A 4X62J 2OPSA 4IOCQ 5DLGA 5D8HB 1UFWA 2LQ8A 5AE2A 2MZJA 3OTDA 2HURA 1Y3JA 3FSYA 2L08A 2AZ1A 3L9ZA 5DS7A 5F9LA 3J81Y 3J7YU 3DLJA 3M9NB 4ZITA 2BOPA 2FVQA 1WEYA 2N4CA 2EFGA 1U7LA 1QTNB 2Y1RI 1V3RA 4XPCA 1VQMS 3FQKA 1W2BR 3OFGA 1JWWA 2AMCB 5LJ3Y 3NS7B 2KVIA 2V50A 1KOHA 4G65A 4WP3A 3KLEB 4M5LA 5ETRA 4CT9A 2R8HA 4U9RA 1M1GA 1RT1A 1JLBB 1S12A 3RBDA 3BB5A 4QYRA 3R2DJ 1N34J 1U0HA 2BX6A 3QLHA 3TA2A 5K8NA 3MR2A 1SC1B 3DOKA 3KG0A 5AT1B 3R97A 1S1XA 3W5YA 3PJ9A 4UZCA 3TAQA 3CD6S 1OY8A 2W4CA 3MR7A 3QATA 1P6TA 2CVEA 3PW5A 1NKBA 5DRKA 2D41A 4LVNP 3PDNA 2UXCF 2IY5B 1N54B 1WOPA 1C0TB 2EK6A 5CZXA 5KOXA 3EUNA 1RJJA 3VCDA 5HMWA 3KJQB 4IDKB 5KFMA 4DPWA 4HL9A 3MUTP 2R9LA 1TL5A 5J1EA 5J2PA 1T7PA 1KVKA 2VQEF 3B8HA 1Y00A 1SC4B 2NCKL 4N8NA 2OPPA 3JSYA 3F73A 1GH8A 3V4MA 3LP2B 4ZDNA 3RBXA 3M8YA 4DV2F 3M32B 3E51A 2UUCF 1FXLA 1FRXA 1KFSA 3GG0A 3M6UA 1WC1A 3MWBA 1RAEB 2O67A 2MZQA 4WJBA 1N0UA 4WE1A 3A8IA 2LXUA 2CWKA 1WSVA 4USVA 1TL1B 1FJEB 1X4EA 4ANDA 2QLBB 1NPPA 2H1YA 3TI0A 4EWTA 1AW0A 2B9XA 3L95X 3KUGA 1OIAA 3SEOA 1VBXA 3BR8A 3W60A 2QMUB 1HBNB 3AA9A 2Y1LB 3FKBA 3IR7B 2UUTA 2Z2YB 1AA1B 3HKWA 1CG2A 3IS9B 4HEA9 4RUBA 2DNGA 4F4AA 1JJCB 4EO8A 1NB2A 2J9EA 3CF5Q 1RHRB 4ECSA 3EZ5A 3MXHP 3EXCX 1MMDA 3MAAA 1UVKA 2BANA 4L74A 4LSLB 1EZZB 2EPIA 3FJ2A 4P9SA 2EFVA 2ZM6J 2U2FA 4C8YA 2HAIA 1W25A 5B0DA 3IG1A 4ZVPB 1VQ8S 3FCHA 1S1TB 4NWBA 1G4CA 4Y28C 2B4VA 4B08A 2VL1A 3MEDB 4Q2LA 3K59A 4TLRA 2XWXA 3TJAA 1RAFB 4LUBA 9ATCB 2C2DA 5IZHA 4PRFA 4B3TJ 1X9MA 1QE1B 3H0PA 5IT9Y 1HLWA 4PPZA 2E7WA 3CVKA 3FZ2A 3H2VE 3BJYA 4DSLA 3DCAA 3OR1B 4ZLJA 4AE5A 4X2BA 1PAEX 3ICLA 1FTRA 1WD6A 2IJRA 4M5DB 4OX9F 3UDLA 4DN9A 3O44A 5DGAA 4U8VA 4NA3A 3JSRA 3M1VB 3UNGC 1SH0A 2F40A 3MCNA 2ZBIA 7FD1A 3RRHA 2XBPA 4DF4A 2J7KA 1WC0A 2KT5A 2DGSA 2W25A 2XZTB 4WXWA 1B3TA 3V4IB 4CTAB 2GIFA 1CULA 1DQ9A 4O3NA 3UI3A 5JMNA 1BHNA 1M5HA 4M1KA 1N5SA 4RNHA 4EBCA 4LSNB 1VQOS 4LF9J 2CYYA 5F8HA 1BGXT 2M8HA 4PPDA 2VA2A 3CDAA 5D0EA 3DRRA 3TYTA 4M5HA 2HAFA 4ANCA 4WFAQ 3C6TB 1JJ2R 1PC5A 5E3AA 2W9AA 3CW2C 4KC5A 3ENWA 4PG7A 1Q8IA 4RU9A 2ZBRA 3CDWA 2CJ9A 5ITHA 4J9VA 5CHCB 4IDKA 1J5EJ 1WG4A 4KHRA 1M5OC 4Q0BA 3MDFA 3O1LA 2VASA 4CQ1A 5EN1A 1CJVA 3P8BB 1FK9A 5I3PA 2VBYA 2QIFA 3MCOA 3SDEB 2ZH5A 2HBQB 4ILLA 2HQFA 3IWXA 2P2CB 2HQDA 3VTIA 2QA2A 3RGIA 2GGPB 2YQ1A 8AT1B 1U2CA 1RA7A 3MCSA 4AXJA 2PIIA 4ECWA 2HHQA 2QE5A 1KN6A 2CJKA 3KFWX 2RF2A 5HBMB 4NRUA 1QSYA 1ZA2B 3EGVA 1JLBA 5B09A 3CO0P 2DCLA 5KFOA 1FFSB 2A18A 2DKOB 2FVSA 3QBCA 1Q53A 3UD3P 3NL0A 1YG0A 2B8QA 3BGRA 4U7CA 3W61A 1GK8A 2FC9A 1RUSA 2HIQA 2R7VA 3OUYA 1U1NA 4HH1A 4R5PA 3A3NB 4DR2J 4JI1F 2M52A 4K50A 2PA8D 2FVCA 1S7HA 2CQPA 4ED4A 2XMKA 4FPIA 2O01C 1GFWB 3OXLA 2BV3A 1Y11A 2DHGA 4GRSA 1YBAA 2DH7A 4H4MA 2UU9J 3QIPA 2VD3A 1BQMB 2XSJB 4OYIA 3UN3A 3CCWA 4A8XA 1TZ0A 3M6WA 3G6XA 2CQ0A 2C3UA 3KLIB 4CO3A 5SZTA 2FUG9 5DZ6A 2HW3A 4CLPA 2CIMA 2C3MA 3DXBA 4NL5A 3ZNJ1 4YB7A 2IPOB 3I55S 3CPWR 2RUSA 3KXDA 1FFGB 1S6PB 2B5JB 2XLIA 1VRUA 3C6TA 1R3NA 1S9GB 2CQ4A 1TAUA 1D0EA 1SIZA 2OEKA 2YKMB 2CPDA 3RYLA 5IV3A 4LF8J 4DL6A 2NZ4A 5RUBA 2R4FA 4IRDA 4LF6F 2EKNA 1DQAA 1I51B 5D6GA 2QLXA 3MEGB 1CPZA 2JFDA 3QJJA 4NLQA 1YJVA 4KBIA 3OFHA 4ENOA 3RR8A 1TTHB 3S6EA 2XO7A 4WZMA 3ILIA 1EHWA 3D4JA 1RU2A 3KUHA 8ATCB 2CZVC 2YNIB 5I3UB 1JLAA 3BF4A 2R7WA 4URSA 2JOQA 1CBKA 3DXSX 1PIEA 4DS5A 2LEBA 2J7UA 4LFAF 1RTJB 2ZZTA 2KZZA 3QNWB 1VJWA 4ZKAA 2VOPA 3ONQA 1FWLA 4LQ3A 4KYZA 5KT5A 4UZBA 2RQKA 2R7RA 2OFHX 2RQ4A 4PYAA 5HJXA 3QT7A 2KTQA 4PWDB 2YKQA 3U1LA 3GSIA 3UQSA 1HPZA 1JKHB 1URNA 4F25A 1RAOA 2M8DB 5C2GA 3MD1A 2B56A 4RWXA 2QJ3A 4TKTA 3CJKA 2DR8A 3NGUA 3A1YG 3PHEA 3CCMS 3LH2S 1K47A 2HZCA 1FVQA 4DSKA 4IO1A 2RJZA 3NAIA 4HH0A 1X60A 1PO6A 3C6UB 3KLFB 3PEJA 4LRCA 3W9IA 3MF5A 3CD5A 2B43A 3IS9A 3CCRS 3AWRA 4GKKJ 2GVZB 2W2MP 1B7YB 4DV5J 2AD9A 2ZHAA 4K0KF 2G13A 3NY0A 2V9WA 1UVNA 1UJ5A 4N56A 4WCEQ 5L46A 1TFWA 2IAJB 1L3UA 3ITHA 1K44A 4P74A 4QR2A 3OW2R 2CPYA 2DGXA 3DOMB 5ETMA 2ZBCA 2F65A 3RW7A 1LFPA 4LF7F 3BSOA 2P9EA 1SUQA 2AYMA 4DSFA 1X4GA 5I3QA 2PD1A 4NE9C 1NK6A 4DLEA 3OLAA 3F41A 1NDPA 4DV0F 3PO4A 4DR7F 3G8TA 4Q45A 4C8KA 5LMUJ 4GKJF 1CULB 5J2PB 2GHPA 1UZHA 2J5AA 2Z4PA 1CJUB 3P3DA 3F44A 3QZ7A 4M5JA 3PVXA 1RZMA 1VOMA 3PM9A 4A8WA 2AX0A 2DEIA 3QO9B 4C3KA 2HHTA 5HQ8A 4R0EA 2CQ2A 2HHHJ 1PJ5A 2I6WA 5C2CA 5EHHA 1G7CB 3D54A 1S0OA 3ET6B 3ZTRA 1BQNA 3JAMY 2IC3A 2C1EB 1JJHA 3VQSA 4DPYA 1RT4A 3MAHA 4HDHA 4JV5F 3G8SA 3BGFA 2QMWA 2FYXA 5M2RA 4DEZA 4FS2A 2BQUA 3MMBB 3QMQA 1CC7A 2Q6BA 3K7RA 5EX0A 1RTDB 5DETA 3KLEA 1JIHA 5IT9U 3T41A 2V1SA 3IG1B 4PWDA 2DGUA 5E2QA 1ZYQA 2DCUB 2QL9B 1BMQB 1RABB 4NX9A 5HP1B 3D28A 1LK7A 2IBOA 5LJ5Y 2EFNA 2YWGA 2ZOGA 3IC1A 1FTCA 1VFJA 2KT3A 4FKXA 4ZHRA 1SV5A 4OI2A 2IBKA 1TL4A 4AD6A 1DFDA 4B02A 1DTQB 4ZVFA 2HBRB 3WX4A 2DNOA 2KN4A 4JUZA 1NJIT 1RB0A 2FC8A 2K1RA 4J5OA 4RW8A 1PAUB 2BJDA 3TUPA 1DBDA 3M2VB 2BM0A 4ED5A 4HACA 2E5JA 5B0FA 4B3RF 2AP6A 4TY9A 3V81B 5ETTA 4DL4A 2IVYA 1S9FA 1U48A 4O4GA 3SMZA 4CLKA 4Q0BB 5IS2A 5C5JA 2GQ2A 2H54B 3N6NA 1AZSA 2PE8A 4WP8A 4FF2A 2SXLA 3HHLD 4PR6A 4EYHB 1AXQA 2Z8QA 2U1AA 3IR5B 4RW9A 2EWHA 2JHEA 4QW8A 2V8HA 4YHHJ 3CJ4A 2G9OA 3FNNA 1YJNS 1HARA 3QSIA 3UVJB 1S57A 1HBOB 4ZPAA 2HGNA 1VHIA 4TYBA 2OMLA 4ZVSB 4DPTA 4K4YA 2DO0A 3HSDA 3KDNA 3L7PA 4KHMA 4N76A 1V3SA 4LBHA 5T14A 4ALZA 5JJBA 2QYCA 3B78A 1GX5A 4NEYA 1SC3B 2J0QD 1F60B 1HNIB 4FVCA 2VFTA 1C0UB 1NHKL 1N34F 3GILA 2XB2D 2OFGX 4R5PB 1AT1B 3IMQJ 2XMMA 4WIQA 3ZZPA 4FF1A 2ZOMA 1ZM4A 4OHWA 2GJIA 4XO0A 3ZC4A 2Q43A 4LF4J 1HNZF 1ZPVA 3HFKA 1NH8A 3BSCA 4Z7CA 4HLBA 5I4MA 3D6FB 1I94F 3NCRA 1S79A 5BXIA 3ISZA 4IFYB 1VBKA 5BJRA 3OVAA 1HR0J 4QWCA 5AE1A 1U8SA 3RRKA 1N36J 1RT2B 4W4MA 4KV8A 2AW0A 3MM6B 3ZTQA 3WC2A 3UWTA 2V1TA 1PSDA 2MEWA 3FEZA 1PC4A 1WKKA 2FZCB 1SIWB 3MM7A 5LXRA 3PIOQ 5THWA 1J5OA 3E2EA 4LQ9A 1LNQA 3T1YJ 2WB1D 2QA4G 4WF9Q 1F0XA 1X4AA 5J2NA 2UUCJ 4RW9B 4X4TA 2F4VJ 3R5JB 5FIIA 4DX7A 4DUTA 1RTHA 3KJFB 1D8ZA 3VAFA 1HNXJ 4FYDA 5IT4A 1HQUB 4I64A 2VKZG 3SV4A 3GIRA 2VV5A 3MM8B 2CA9A 5H1SV 3IAS9 2XTEA 5L38A 3FQLA 1L3VA 1F9FA 2DR9A 1DQ8A 2APOA 2M4MA 4W98A 4NXMF 4ZJLA 2JEFA 4Y2KA 1FJ7A 1RAJA 5D0RA 4ZPVR 3PJXA 1QAIA 2QYGA 3PX4A 2XWYA 1C4CA 3CIZA 2DK2A 3CDBA 1NK8A 1SPBP 4UY8T 2BRKA 3TX0A 3M8QA 4MYUA 2C2RA 4FXVA 4CZCA 2XO6A 4M5NA 1IWGA 1Y5LB 2WW8A 3ILJA 2MQMA 1FNXH 2FLNA 2VA3A 4JI5J 3GONA 4TVAB 3H90A 3QYYA 4KKOB 1Y5NB 1CJTB 5E3RA 4EYIB 3N79A 2MJNA 2K2PA 4PXBA 3SXLA 5H9FJ 5EWFA 1PCAA 1M5KC 3UR0A 1FVSA 2VQFF 1T11A 1HNVA 2BANB 3AD9C 2F9DA 1SXLA 4LSLA 3VHQA 2IM3A 4DHVA 2XMAA 3V6KA 5HLFB 1W7WA 2NS1B 2RQMA 3G9CA 2OO4A 1RE1B 1MU2B 3AH6A 2AF6A 3BZQA 1N88A 1UL3A 2C3OA 2XCAA 1EQ0A 2OKQA 3Q22A 1FXDA 4LF9F 3OL7A 1XR7A 1LWCA 1Z2ZA 3OT9A 2KVQE 4ED7A 3KUEA 1UEKA 2OUGA 1SH2A 4MFBA 1UVIA 4Y2MA 1Q79A 5L8RC 3NBPB 2W4DA 3JS9A 4DR1J 5F3TA 2UUBF 2M70A 5L9NA 1LV5A 4L76A 1WORA 2HHHF 1ZH5A 4TXSA 2WHOA 3M8PB 1KKHA 1NJZA 1GMWA 5HN0A 3CNQP 4R0JA 2DXEA 3P96A 4FXWA 4Z2XA 4PXDA 3K57A 3TVKA 3BSAA 1Q5YA 3Q2SC 4ED0A 3H2UB 2RUGA 3CSKA 1RAIB 2XYGB 4NEZA 4QIFA 1PYSB 4FF3A 1TL7B 1KQFB 1IKXB 4I68A 2GVDB 3QZ8A 2R8JA 3PO5A 2RD5C 3I96A 5J1PA 3DKDA 2OJ3A 2E5IA 1HD1A 2CADA 3DGPA 3DYAA 2GVZA 4NOHA 4EU0A 5A8KB 2Y1IA 5HO4A 4K4TA 2UV8G 4FYXB 1ZTWA 2BBEA 4Y34A 2N3OA 2B51A 3GV8B 2KG0A 3CDEA 1OPIA 3MM6A 5CYQB 4DUYJ 1RK8A 5E3PA 4JB8B 5DJBA 3HPOA 1EAYC 3QLHB 4DU7A 4E8UA 2CDQA 1CC8A 3PW2A 1YJUA 4RNOA 5L1LA 1C1BA 5F8LA 2OD4A 4ICLA 4MIBA 4KFBB 4AQYJ 4ZVRB 1CQMA 5JVHQ 1RWXB 2L48A 2BE9B 4J9MA 1PGZA 4QQBA 3Q8YA 2F5GA 3HSZA 4H4OA 5K14B 4DMZA 1VHFA 1UAWA 2UZAA 3HSJA 1S9EA 3I31A 4L6V3 4NLOA 1WC6A 1LW2B 3VZIA 5DGBA 4J9SA 1RKJA 2PEBA 4UOGA 1X5PA 2PT0A 3R6GB 3CJRA 3OTCA 4KO0A 1Q8LA 3TUIC 4DI6A 2KKHA 5C24B 5GMKa 1IBKJ 3BSNA 4ZLPA 1YGYA 1IBMJ 1T94A 2X1AA 2ZH4A 1GQEA 2I2YA 2M3DA 1IR0A 1IKVA 2DNYA 2WZ1A 2XNQA 4CDIA 2MQPA 4O3RA 1B0PA 2FJBB 2JLFA 3QQCD 2MQOA 1RT5A 3K89A 2OEJA 3D66A 4IRCA 5A8WA 2ZD1A 2QSWA 5KT6A 4B3OA 2M2BA 3NXZA 4WTOB 3FDSA 2GHWA 5GAHU 1NPKA 4O4GB 2VC0A 2V8VA 2AEJA 3M05A 2WOMA 3BN4A 3QFWA 2MQ8A 4P7VA 2R2SA 3FVYA 1P8GA 4QPXA 2I9SA 4NCGA 4JYAF 2AGOA 4ZVEA 4M5IA 4FF4A 3QRQA 4JI7F 4CLFA 5HQLA 3GG1A 3BH7B 1CS4A 2IM2A 1LQ9A 4MYTA 3CJ0A 3OTBA 2GMJA 1J5OB 2XYHB 1KHVA 1N5VA 3K8WA 2RNEA 1M5SA 4WFZA 1WEXA 2PN6A 4ED1A 2XY5A 2HFNA 4F0HA 2BJ1A 5G4DA 1D9AA 2JL9A 2Q1LA 2AX1A 1LW2A 2IRXA 1VISA 4B9TA 2V5HG 1ICEB 2B9YA 3T5HA 3MPDA 4RW6B 1WNEA 5ETLA 4OL8A 1HWJA 1G1XA 3JSBA 3NCPA 3CC2S 3FBEA 4F4KA 2MYFA 4YUDA 2CZ4A 3TA0A 3J81U 3OTOJ 4RKUC 2UVRA 2QN6B 3RR7A 3H7HB 1S5ZA 1CQNA 2N7YA 3AOAA 2UXCJ 3DDKA 3ELHA 1RACB 2RF2B 5HBMA 1OY6A 3ENAA 3PFOA 2GIQA 2RKIB 2QG9B 3ISNC 3J80Y 2JFKA 4DR3F 5F8MA 3AD7C 3IGNA 2XY6A 5E33A 5I42A 4YB6A 1SB6A 1VGYA 2DY1A 2HNZA 4RO0A 4UTGA 2CG4A 5CYJA 4ID8A 3X1LB 3K2YA 2XMJA 1Q1KA 2FGCA 1FCAA 3DN9A 3SDEA 3TZZA 2DYAA 3DHXA 3QRRA 2OIHA 1RAAB 3PW0A 3MD3A 2BJ9A 1RDRA 1FX2A 3EDRB 4U95A 4GKJJ 3Q8RB 2BMBA 3LGHA 3V6DB 3MMAA 3KJVB 2IA0A 2H3EB 3GCXP 4IFVB 2EW9A 2JLGA 4I2QB 4OHVA 1S76D 3DNCA 2LEAA 3IRWP 2Z30B 1O6XA 3NGKA 3KLHB 4B3SF 2J0SD 3ITHB 1RSCA 1TKTB 1TV6A 2AZ3A 5E7OB 3DU6A 3GJTB 3NWGA 3VZHA 5IV4A 4ETXA 4X65J 1ZBTA 3EPGA 2ZM6F 3ILOA 1ZTTA 5JUMA 3B54A 3CXCR 4WFYA 2MKYA 1RI7A 3W63A 1MU2A 1C1CA 1JMTA 1TK0A 4HHHA 1U26A 2F1FA 2PFDA 5KFLA 2UXDJ 2PFFB 1HNVB 1NZAA 1RWPB 2MQNA 5KOWA 1FKOA 2EC0A 4ECVA 2IDLA 3MEDA 2UUAF 3ZZOA 1HPZB 4TNOA 1CJKB 1QUPA 3VWSA 1YK9A 1HHQA 2WRMA 2LQ9A 3LQVA 4FKYA 3UN2A 4N41A 3GIMA 4FYWB 1K1QA 1T95A 5A0YA 1IQZA 3GJRB 1JJ4A 3CD7A 2ASYA 2XZWA 3NGTA 2CJXB 1SJ3P 1FJGJ 2CJBA 1C1CB 2Z2MA 4O3QA 3A8KA 4B3RJ 1TAQA 1NJWA 3HK2A 3MMCA 3W66A 1NHVA 2CJQA 1FF2A 3I4HX 4Z7YA 4ZCKA 4NLDA 1TMJA 1XNRF 3BGOP 3WHIA 4P2MA 1XWLA 2E9RX 2E5GA 2WBRA 4JI4F 5IXUA 1ZM3A 2QZ8A 3F0NA 1X5SA 3TP2A 2CJAA 5M2PA 4YR0A 2OPQA 3OVBA 1KP6A 1YVFA 3PW7A 4G3IA 1PYOB 2VFSA 2HNDB 2HNYB 1U6BA 5KG0A 4YDXA 3M32A 2GV1A 2D69A 1O0PA 1FNMA 4USMA 4KPYA 3HKZD 3SBMA 3POTA 1ACMB 2NSBA 2V9KA 1LKZA 2Z57B 3VF0B 3DOMA 1SH3A 1H2UX 1OO0B 1JLCB 2C3PA 4USIA 3RB3A 4F2SA 2ZWOA 2IMOA 4X4PA 5KFVA 1VQ6S 1OJ4A 1KQKA 2EFPA 5LSLA 4MKBA 3RRGA 1HBMB 5IFMA 4ECTA 1VQ4S 1FJCA 5DG7A 3FSXA 4F67A 3ENVA 3D6TB 4MH8A 3W2WA 4FNIA 5EDWA 5J2QA 4HT7A 3PTWA 1NXIA 1U09A 4MKVA 3CC7S 5D3GA 4RW7B 2W1BA 1PBAA 1HR0F 2ZHOA 4DR2F 4CLYA 4JI1J 1REVB 4MAKA 3JSMB 3RB6A 1FWPA 4FVMA 2F3JA 4JI2J 1RLDA 3CMQA 3MPWA 4BDPA 4K4ZA 4QIGA 3U1NA 3FBCA 2MZ1A 3BO2A 3JTOA 4A46A 4RUAA 4I1TA 4CLWA 2YTCA 3PACA 3CCJS 1S97A 4C2MA 1U1OA 3CULA 3LW5C 2EI5A 1QJHA 4F4WA 3G82A 3MR3A 3MFHA 5IWAF 2QV6A 1B7FA 3J7YI 2R2UA 2GFFA 3OSPA 4UOFA 5H9EJ 3IWNC 1KR4A 1Q4RA 1DTTB 1RAHB 2D3UA 1IKYB 1RT3B 1UEVA 5DO2A 4DXLA 2R8GA 5JXSA 4DV4J 1FRLA 4PYDA 5IM0A 2RILA 5DQIA 3T19A 4RNNA 1WC3A 3JQKA 3N01A 3TUJC 4DF8A 4OX6A 3E01A 4OZ3A 4F4ZA 4NXNF 5GADU 1IQTA 4DFKA 2GJFA 2DNHA 1VQ7S 5KFAA 3EXYA 5HMZA 2RDDA 3ZTOA 5L1IA 3DRRB 3MI7X 2DHAA 3UPFA 2RIJA 3HSGA 2ILYA 2K7KA 3CD0A 4OZ1A 3GFXA 1D3WA 3V5RA 4CO0A 5ETQA 3KG1A 2GIRA 1NKEA 3KHLA 2NSCA 4WYLA 2UXBF 1SL2A 4OX8A 1AFJA 4YEAA 1XMOF 3JTNA 4U67Q 1YQHA 3G6ES 3BN7A 2RRBA 2AEMA 2XI3A 1SJ1A 2AYEA 1VR6A 1Q7YT 2E9TA 3D0IE 3OD2A 3PEHA 3ZZTA 4RW8B 4WXOA 4ES1A 1NSKL 2G2YA 2EFOA 4UOCA 2UUBJ 1X8DA 2MXYA 3C8YA 2ALYB 2YNGB 1QSLA 3OL9A 1NK0A 4WIIA 1FO1A 3M2RA 3TO8A 3BPDA 3ISND 3NOGA 1S1WB 1XBWA 3W5XA 5BYRA 4RUHA 4OIXA 3D3BJ 2L3MA 2J6TA 1UPMB 3M2UB 4J9UE 4Y3CA 4JBCA 3KTQA 4Q2MA 1URRA 2BKPA 2YXLA 1MSWD 3KLVA 5DDQC 3TEHB 3K5OA 4NYOA 5HQMA 2HMIB 3M4XA 2K06A 3H40A 3VAMA 1EQMA 2WB4A 3DLKA 4H54A 2CNKB 2H65B 3ILLA 4UF4A 5BYSA 4RNFA 1I6JA 2UVWA 4N8OA 1G2EA 1OSCA 1V6HA 2BKOA 3BBCA 2XHWA 3OXGA 1WTBA 2VZ9A 2PGCA 4CLZA 1K9MT 4XPEA 3ET6A 2RRAA 1WKLA 4QBUA 1DURA 4DR1F 3EMTA 2QFIA 3NNHA 2R7UA 2HS3A 1FE0A 4NASA 1JXEA 1R0AA 1RCXB 1IBLJ 5L1KA 1YRTA 1DZ5A 1J5EF 4I6AA 2GMLA 1M5VC 4DSIA 3P6YC 5LMUF 3GFZA 1OY9A 2WVCA 2MKHA 5F0WA 5LSOA 2DGTA 1BY9A 2DJWA 2IHR1 2POKA 3UW1A 2J6SA 1AB8A 5KG3A 3GFYA 1FHTA 4IFVA 2VFUA 4ZPWR 3MR5A 1FDAA 3I9V9 3PFEA 4OZNA 4TYAA 1XMQJ 4YB5A 1KVIA 1E6VB 1FDBA 1UWBA 3US5A 2NLWA 2OPQB 4ETZA 3SZ2A 3V4IA 4YQWA 2CQHA 3MM5B 4NI2A 4ZK7M 4ZOSA 3BREA 1N5QA 1TFYA 4DG1A 2DRAA 2EG2A 4O44B 1SJQA 3LWMA 2VONA 5DDRC 1S4EA 1V5IB 3A8EA 2RVJA 4HR2A 4X66F 1ZS6A 2PI4A 3PRDA 3AAWB 5EWGA 2FJXA 5CAAA 2LECA 2HNZB 4YDDB 3OR1A 1S1XB 2MQQA 3P5BP 3D2WA 1ZOTA 4C8OA 2O66A 3CGIA 2LP4A 4PEOA 1BWVA 4OHZA 4U8YA 5A0YB 1IJFB 2CPZA 3KDOA 4XTTA 5KFSA 2ZC3A 2UU9F 2FQQB 3PYDA 4FPRA 4UUWA 2Y0SD 1BD6A 3OTEA 4G1QB 4LFBJ 2HS4A 1H72C 2E5HA 4L75A 5A2QY 1B4SA 4BBYA 5KG7A 2DITA 4LR9A 1O51A 2BUNA 1C2PA 4EI2A 2BE2B 2JC0A 2D7SA 4OI1A 1Q5VA 4OI6A 2XNRA 1NPRA 1YJWS 1KTVA 2F8MA 2YNGA 2G0CA 4W90B 2RE1A 3C15B 3VAGA 4ECXA 1YRXA 5HATA 1M0SA 4DPXA 4IO9Q 3Q23A 1WC5A 1GMVA 1TL1A 2CPJA 3MEGA 2KJVA 1IVZA 2HPUA 3HMJG 2N4DA 2B6AA 2WONB 3K58A 2OPRB 4LRFA 3IP0A 2R2RA 1VRTA 3LP1A 2X1GA 2IVFB 1JLGA 4OV6A 5E41A 5LM7E 4AL7A 1Q86T 3AXMA 4JI7J 4QWBA 3KJVA 4DUZJ 1S9GA 2IA6A 3AB2B 2W01A 3FSIA 4LFAJ 2BQ3A 2MY8A 1D8YA 1QUVA 2DHXA 1HW9A 3E01B 1FA0A 5IC4B 2GCFA 3DOLB 3P45B 3FFIA 3I5BA 2HEKA 2LFVA 3MZIA 5G0RB 3LPYA 1WEZA 1DAXA 1PILA 3R5DA 4UUXA 1VQ5S 4ELVA 1RHUB 5GAEI 1MN7A 3KK1B 4DSJA 4IG3B 1TQLA 1X7VA 3QT5A 4H4MB 5EGYA 3QRPA 3H5SA 1Z2LA 3EM1A 2CPHA 4H4KC 4KO0B 5HANA 4QU7A 4USUA 5CCLA 1D09B 2MB0B 4B9SA 5HROB 1NSPA 3N4WA 3H98A 4FYVB 3ZFVA 4TY8B 3BQ1A 5F3ZA 1T3OA 2P6TA 4RLEA 4B17A 2IYGA 3MCMA 1RT7B 4HI1A 4ZPCA 3JQJA 4K2JA 2K8GA 4RL1A 1WC4A 1SVDA 3IR6B 4TY8A 5GVQA 4EUVA 2HHSA 4RW6A 4YR3A 1T9WA 3GYGA 3P4UB 1IR2A 2LXIA 4ZMMA 2HBZB 4K4WA 1MN9A 4OLPA 2FJAB 4XDDA 2DGOA 3I9ZA 2DTJA 1TKXB 1Q0NA 1R8HA 2VFRA 2E9ZA 1P1TA 3UE2A 3HJFA 2ZITA 3G87A 1S0VA 2ABYA 3Q8VA 3UVJA 4YB1P 1S10A 1ZAVA 2MLXA 3LA0A 4RNMA 1VQPS 1YIJS 1KLNA 5C25B 3A12A 4OFZA 3I32A 2CPFA 3FFIB 3DMJA 4MJKA 4RW4B 3TQEA 4H4KA 1SQEA 4R8UB 1FERA 2Y1JA 1OSDA 4EFAC 2D9OA 3DLEB 4B9MA 4OZLA 1OS5A 3QT8A 3D9BA 2D74B 5T7LB 3DLGA 4K5RA 3U27A 2OTLS 3BH6B 4X65F 3DDNA 2XLJA 2G2ZA 4DWIA 3AOBA 1RHMB 3CJ3A 3M8SA 4LSNA 4DS4A 4RUCA 2HWTA 4KH1B 1QSSA 4GO7X 2CQCA 2Z56B 2EC2A 3FBBA 2X1BA 2V94A 3GSDA 4HHUA 2ZZMA 1N52B 2B0GA 4JI0J 3M1VA 2XCPA 1V5VA 3RB0A 4EZ9A 1ROFA 4QU6A 5DM6Q 3DRSB 3D7SB 3I4PA 2XC9A 4TN2A 4ZVQB 3M9OB 2ALZA 3THPA 1NNDA 1Y10A 2CG8A 2VB6A 4A4JA 1E6YB 5DQGA 5HLFA 3ZXWA 4M63A 4OX9J 4DL0C 2HVDA 2A0FB 3RAXA 1F9HA 4MTPA 2P9CA 2KM8B 4B3MF 3K0JA 1CJKA 5KG1A 5CCMA 5L1JA 4KKOA 3KLGB 2GMHA 1NDCA 3FMWA 2ZH3A 1KD1T 4JI4J 2KRRA 4ZP6A 3AA8A 3DLHA 5DZ7A 2OHDA 4Y0FA 1AUDA 2AEFA 3AJ1A 5GAGI 2KDOA 1RA6A 1JNZB 2R42A 3D6MB 1U0SA 4NMLA 5F8JA 5LL6d 3KNAA 2KFYA 1RTZA 4LF5J 1JLEB 2OLWA 2ZE2B 3LALA 2QX0A 1X4HA 3OLBA 3TRGA 3C66A 2W24A 2KH9A 4M8LA 1JB0C 3AODA 2ZJRQ 4KHPJ 1MNEA 3Q8UA 3CCVS 4KGMA 3JAMU 3WZ0A 2EXUA 3AXKA 2MKIA 4HKQA 4NYZA 2J0WA 4MK8A 3BPSP 3UD5A 1VBYA 1N32F 2VG6A 4I2QA 3R8YA 3TWZA 4AFFA 4Y6IA 4C11B 1MMNA 5T7LA 2D3ZA 1J27A 5D4PA 2MZTA 3Q83A 5B0BA 3HHLB 4M5MA 2CVIA 4UQTA 4J9RA 4IH7A 4URQU 4RW4A 3MEEB 2RSQA 4ANEA 5J2NB 4DR6F 4NRTA 4KH0B 2ZH6A 4L73A 4DZ6A 3VALA 4JI3F 3LO3A 1NSQA 5HK4A 3MM7B 5IQQA 2M88A 3A8JA 1U1QA 1Q81T 3UCUP 2OP5A 2WVFA 3HVWA 5HSPA 3OVSA 1Q78A 4ZN3A 3D1OA 5IQ6A 4YFUA 1FKAF 1CEZA 1SCJB 4FBTA 1HI1A 2RKIA 1RWMB 1M90T 3VGVA 5FD1A 1VQLS 1S4FA 4MKYA 5IOLA 4PWWA 3E3XA 3CJKB 3ZZYA 1GTHA 2LU1A 2YNHA 1VQKS 3NWRA 2XMVA 1TR0A 3AQPA 3IM8A 2QA1A 4WFBQ 3L09A 2MJUA 1YKWA 1JLFB 2HQ3A 4MK7A 3DRYA 1G3OA 1NJYA 1H2VZ 1RTJA 2YKAA 1E6YA 3TEGA 3ZZUA 2RQCA 1HI0P 1WI8A 2XMTA 2A2CA 3DM2A 3PX0A 3HXMA 1HWKA 2KYZA 4C9DA 2Q66A 1U45A 3PKMA 1KQGB 3K8VA 5K20B 2NUHA 1CLFA 1RLCL 2HLTA 2GA7A 3S8SA 1HBOA 1FESA 2VKRA 3HCXA 3MECB 5B0EA 6FD1A 1F9EB 1YZ6A 2KT2A 4QOTA 2XQCA 5G0RA 3UNYA 3RZAA 2QFJA 3FC9A 3FUYA 4HTIA 4NCGB 1ZA1B 3M30B 5CD4A 1XERA 3K17A 5FLXY 3BBBA 4WK1A 4DR5F 1U25A 2RHSB 2NR0A 3TAMB 1S6UA 4LSZB 3ZZ0A 4CI0B 3I0RB 4IRKA 4ZVTB 1WHVA 1S59A 2QLFB 3LPEA 4OYOA 4I69A
chains in the Genus database with same CATH topology
3V6HA 1RT5B 3GE9A 1NRKA 3I5AA 2P5VA 2ZH1A 2VPYB 5KFWA 3T3FA 4N5SA 4EZ6A 2V4JA 2VPWB 4K4VA 4ZA1A 1TVRA 4Y65A 4JI8F 4UY85 4A8SA 1HWLA 2YX7A 4ATNA 2VG5B 4ZVHA 2MZSA 4KJIA 4OJ1A 3CE8A 4KV8B 4X4RA 5EUHA 4C7QA 2MHEA 2XS5A 1M5PC 5KAKA 4MIWA 1MWYA 3E8OA 4CO4A 4PG8A 3R5CA 4Q5VA 2R8KA 2E1CA 4GKKF 4DQSA 4CIOA 4G1QA 4QWDA 3BQ2A 2FHJA 1VMBA 1YJTA 3I0SA 5HMYA 1UJ4A 3MM9A 2AGQA 4PXCA 1REVA 2CQ3A 1IJEB 1IN0A 5LXYA 1HYSA 5CYQA 4QIWD 4ID5B 4UQGA 3MTJA 2PC6A 7FDRA 2RDJA 4F50A 1KNZA 5CYMA 3G86A 3SFGA 3GV5B 3FEXB 1N48A 1KLMA 1OQ6A 4OMFG 5KT7A 3CUNA 4DG1B 2YKPA 2UP1A 3MM5A 4DV3F 1HWUA 4ELTA 3OL8A 2KG1A 1FE4A 2AQ4A 1QLNA 5AXKA 3HHLA 3MHYA 4PQAA 1VI7A 2YWFA 2MPUA 2D1CA 2J7WA 2B4OA 4URGA 5K8PA 2PSZA 4PG5A 1SUQB 5C42A 1KFDA 4LT6A 3KKFA 2HNDA 2HNYA 5FDLB 2FD2A 2AWZA 3CWJA 2F9JA 4IH6A 1F5BA 1F5AA 2O5DA 4Q44A 4DDFA 2WSEC 4YP3A 1UVLA 4Y2AA 1LK5A 1U47A 3DC2A 2K7JA 1QVGR 3IAM9 4DX8H 1JLEA 2ZE2A 2RT3A 3T1AA 4WU2A 1LW0A 1S48A 3MMCB 4V19J 4LFBF 4NLXA 3HVRA 4OHYA 3MR6A 3I82A 3B4DA 1W2IA 3M9MB 3HDSA 3DLLQ 2ZH9A 4DV1F 3KLGA 3CB4A 2EFQA 4G1PA 2KJWA 2VH7A 4KRWA 4JV0A 5HP1A 4Q43A 2LQJA 2ZNZA 2QT7A 1FRMA 5KT2A 3H25A 4DFMA 1T05B 1S1TA 1N8RT 2Z2LA 3KYLA 3O6QA 4C0HA 3PRBA 4ZP8A 3Q0AA 4FP9A 1TKZA 1BQXA 2LCWA 1SL1A 1VQSA 4AL6A 3KOAA 2M7SA 3LOUA 1Y9OA 3V6JA 1JLAB 3GR1A 5A8RA 2WAQD 4GC6A 1LWEA 3NKYA 2MY7A 2PMHA 3IWLA 4OQJA 5KFXA 4RU2A 3R3TA 2GQCA 2LDYA 1X0PA 4LJMA 4WU3A 3CDUA 2ZKTA 3LAMA 1FT8A 3T5KA 2MHNA 4OI0A 2B9WA 2DNMA 4IQMA 5FDLA 4F3MA 3BO3A 4N47A 3ULHA 1U1KA 5C42B 4Y2CA 2R7QA 3PJWA 2H5EA 4J37A 3CJ5A 3LP2A 5KT4A 4KE5A 1S6QB 4J9OA 1U1PA 3V6DA 4F2RA 3CCSS 3QGHA 4QWAA 1VIXA 2IAJA 3FMBA 1F5CA 3CEDA 2ASDA 1CVJA 2RDIA 1R7IA 3FRZA 2YH0A 3TW0A 1KRPA 4JI2F 4NLRA 2YH1A 2KFNA 4WFXA 2FHOB 3V2UC 2E29A 2NUUG 3MURP 2OAUA 1HHTP 1WHWA 1P1LA 2XY7A 5B7WA 4RBTA 4AUKA 4J9PA 4I2PA 3G96A 1U4BA 4X4NA 2DO4A 4IFYA 2E7XA 2NPFA 2KHCA 2I0XA 4NA1A 3LP0A 1S0MA 3BGRB 2LQBA 2I5JB 1S77D 2F4VF