4NLXA

Poliovirus polymerase - g289a/c290v loop mutant
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
461
structure length
458
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSAVSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein, hydrolase
molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 138
structure length 458
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nlxA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nlxA02
2VG7B 3FFIB 1JX4A 1RTIA 2YKNB 3M9MB 4ECVA 1RA7A 2EC0A 2JEFA 5KG1A 4ICLA 2WRMA 3ITHB 4RW7A 1C1BA 3GILA 4ECSA 3DMJA 3TAMA 4WYLA 2W9CA 1S1UA 1C0TA 5KG3A 3BSNA 1FKOB 2D41A 2R8KA 5KFUA 1TKXB 1EP4A 3UR0A 2AGPA 4TY8B 3PVXA 4IFYB 3C6TA 4KHRA 5D3GA 4WFZA 3G6YA 3BQ0A 3N6MA 1RTIB 4YR3A 1HNVA 5KT2A 3H98A 3I5BA 4ICLB 3DLGA 5C5JA 3BJYA 4NLSA 1C1BB 1S9EA 3GYNA 2HAIA 3DMJB 1RT3B 4RW4A 4Q44A 4LQ3A 1C0TB 1S1UB 3M8PA 3DRRA 1MMLA 4MH8A 4TYBA 4TN2A 5KFRA 1SH0A 4X2BA 3MF5A 2HMIA 1KLMA 3GV7B 1S0NA 2AX0A 4Q0BA 3M8QA 3C6TB 2FLLA 2FVQA 4K4VA 2AX1A 1IM4A 1S1TA 1TKZA 4ZHRA 5KG2A 4NLGA 1RT5A 2B6AA 4TYAA 3DLGB 4RNNA 4Q8EA 4ED2A 4ID5A 4KBIA 5HLFA 4RW6B 3DLEA 2BQUA 4TY9A 1LWCB 2FJVA 4F4YA 3SFGA 4PQUA 1S48A 2AQ4A 2W7PA 4Q45A 2HMIB 3LP0A 4KE5A 3DOKB 1KLMB 3V6JA 3M8QB 2IJFA 2GC8A 3V4IA 4GC7A 4WE1A 1IKVB 4DEZA 1TKZB 4NLYA 4ZHRB 5K14B 5KFEA 3KLFA 1RT5B 4ZVHA 2B6AB 3RBEA 3G86A 2IA6A 1QAJA 1MU2B 5KFXA 3NBPB 5KFPA 4ID5B 5HLFB 3CDUA 4U7CA 3DLEB 4IR1A 2BE2B 5I42A 1TKTA 1FK9B 2IM2A 5KFAA 3PW0A 2VA3A 4KHMA 5DGBA 1S9GB 3LP0B 2XGPA 1FKPA 4O4GB 2R2TA 4ZVEA 1N6QA 4EBEA 3DLKA 3H5SA 2YKMA 1HMVA 3FQKA 3KLFB 4YR0A 3KHRA 3LALA 3OLBA 2XI2A 3HVTB 4IRDA 4RW8B 1TKTB 4KSEB 4RNOA 2E9ZA 1TQLA 1FKPB 5T14A 4WXWA 4ED1A 4OL8A 2XCAA 4TXSA 2UUWA 3UQSA 2E9TA 4O3OA 4ZP7A 4ZPCA 4NCGA 1C1CB 2YNFA 3DLKB 3HKWA 2YKMB 2DPJA 5KG6A 3M9NB 4XPEA 4ZPBA 3DRSB 4NLQA 4RZRA 4J9RA 4KB7A 4JV2A 4PWDA 1TVRA 1S49A 2IAJA 2HNYA 3FQLA 1S1VA 1TL1B 3Q8QB 2I5JA 1HPZB 4M94A 3PW2A 2ASJA 3N6NA 4NLDA 2BR0A 3KMQA 2YNFB 3C6UA 5J2MB 3EPIA 5JXSA 1JKHB 3KLIB 5L1JA 1T03A 4G3IA 2F8EX 2V0NA 1K1SA 2BRLA 3E51A 4PWDB 4F50A 4K4WA 1TVRB 4I2PA 4MK9A 4QWEA 2HNYB 1S1VB 3IRXA 5F8NA 4I2QA 3GIMA 4YP3A 3BR9A 2BQ3A 4IG3A 1K1QA 5C42B 3KMSA 2OPRA 4DL7A 3IS9A 3MEEA 3PW5A 2W9CB 3MR5A 5HBMA 3C6UB 1S10A 4QPXA 1T03B 3OLAA 3GIKA 3KNAA 5CYMA 2YNHB 2W7OA 4TQRA 4QW9A 1EETA 4K4YA 1TV6A 3QO9A 3NL0A 2ATLA 3IRXB 4I2QB 4PUOA 3DYAA 4IG3B 2V4RA 3CO9A 2OPRB 4LQ9A 3IS9B 4J9NA 3I5AA 3MEEB 3KLEA 1RT6B 2OPSB 3DI6A 3IGVA 2AWZA 5HBMB 3FDSA 4TY8A 3KJVA 1S9FA 1LWEA 5EWFA 4EO8A 4MK8A 1EETB 1TV6B 3QO9B 5DQHA 2AGQA 1D0EA 2B5JA 4GC6A 2HNDA 1HQUA 3BGRA 4WFYA 3RB0A 1RT7A 1S6PA 1S97A 2HNZA 4QWAA 3DI6B 2XI3A 3KJVB 4O3SA 1RDRA 2RDIA 4DG1A 3BSAA 1LWEB 1REVA 5L1LA 5CYQA 2IBKA 4IRCA 5KG7A 3RAQA 4RNHA 3IG1B 4ED0A 2HNDB 1HQUB 2WOMA 3CDEA 2HWIA 4NLRA 4EBCA 1S6PB 2XC9A 2ASLA 2HNZB 2RKIA 3PHEA 1S4FA 1S1WA 4MKBA 4DG1B 4QWBA 4RW7B 5KFGA 1QUVA 4MIAA 3TAMB 2JEJA 4RNMA 5CYQB 2FVRA 5EWEA 2RDJA 4RUCA 1EP4B 1IKWA 5KT3A 2WOMB 5DQIA 5D3GB 2IM0A 4IFVA 3TVKA 4YQWA 5L1IA 1HNVB 3Q8PB 4URSA 3BQ1A 2OPPA 2R2UA 5DG7A 2ZE2A 1S0MA 2J6SA 1S1WB 2UVWA 5J1EA 4J9OA 1S9EB 3KLGA 4RW4B 1JLBA 3M8PB 3QIPA 5KFDA 3DRRB 3DRPA 4IOBA 1QAIA 4KFBA 1KHVA 5KT5A 1IKWB 1SH3A 1S1XA 3Q8SB 3EPGA 2ALZA 4Q0BB 2D7SA 1TP7A 1UWBA 4K4ZA 4IFVB 3BREA 3DM2A 2XGQA 2V4QA 1S1TB 5F8LA 2OPPB 3OHBA 3KOAA 2ZE2B 4URQU 5J1EB 3LAKA 5KFTA 1JLBB 3QIPB 5KT6A 3DRPB 5EDWA 5KFWA 4XO0A 5DG9A 2D3ZA 4ZMMA 4KFBB 3MR2A 2W9BA 4FS2A 1S1XB 5KFVA 4QWCA 1GX6A 1JLAA 4MK7A 3V4IB 2IM1A 1UWBB 3JYTA 4QW8A 3DM2B 2J6UA 3LP1A 4WE1B 1TL3A 1I6JA 5KFYA 2D3UA 3QGGA 4ECYA 3QYYA 1XR5A 3OL8A 1IKXA 5J2NA 1JLGA 4O4RA 5KG0A 3IN5A 2VA2A 2JLEA 3MECA 5I42B 3BSOA 3PR5B 5F8JA 1RA6A 3LAMA 5KFHA 2V9WA 1JLAB 1RYRA 4ED8A 2IMWP 4JUZA 4H4OA 3JYTB 1N6QB 3MEDA 3LP1B 2J6TA 4K4UA 1HMVB 4F4XA 3KK1A 4ZPDA 4LSLA 4PQUB 5J2NB 1RT1A 1IKXB 1JLGB 4O3QA 1JIHA 4G1QA 4EBDA 1SH2A 3VQSA 4WZMA 2RF2A 3KK3A 1R0AA 2VG5A 1N48A 2DPIA 3RB6A 1KHWA 3DOLA 3CWJA 3T5JA 5KFCA 3T5KA 4H4OB 4NCGB 2JEGA 1DTTA 4RNFA 2W8KA 2R8GA 1RT4A 2BANA 4FBTA 4QWDA 3IGNA 3QGIA 5KFKA 4O44A 1RT1B 2R8IA 4ED7A 3H5XA 4G1QB 2IAJB 3KK3B 2RF2B 3HVAA 3MR3A 2VG5B 4U6PA 2I5JB 4J9MA 4NRUA 4EYIB 4ZP9A 1C0UA 4NLPA 3DOLB 3KK2A 3NAIA 4IH6A 1S6QA 2C22A 1NHVA 1JLEA 5DQGA 1RT4B 4K4SA 1NHUA 2BANB 2ILYA 3H2LA 2JC1A 3PJWA 4DL3A 3H5UA 4O44B 3BSCA 5J2QA 4NLOA 2ASDA 3RAXA 5HP1A 4RW9A 4EYHB 4I2PB 3ICLA 4Y2CA 4WYWA 3I0SA 3H4DA 4R8UA 4EEYA 1RYSA 1C0UB 5FDLA 4KAIA 1N56A 2I1RA 2YNGA 1HYSA 4KV8A 4MKAA 3EZUA 4HKQA 2FLPA 2WTFA 4DL4A 1JLEB 1JLQA 4IG0A 4ECUA 4KO0A 3M9OB 3T5HA 4R5PA 5CYMB 3V6HA 2OH2A 5HP1B 1QE1A 4RW9B 2WONA 5KFLA 3GV5B 3I0SB 2FVSA 3QIDA 5C24A 4PUOB 3DYAB 2IJNA 5FDLB 3NAHA 4KV8B 4O3RA 3T19A 3KLEB 1JLQB 4IG0B 4KO0B 5KFFA 2VG7A 1RTHA 2HWHA 4R5PB 1LW2A 4ZP6A 2ZKUA 4EO6A 2YKNA 5DLGA 1JXLA 4DL6A 1QE1B 5KFOA 1VRTA 2C2DA 2WONB 5F8IA 5F9NA 4TLRA 4WFXA 3H4BA 2B5JB 3MFIA 3BGRB 5KFZA 4ECQA 1FKOA 3UPFA 1RT7B 4K4TA 3OHAA 4YMEA 5HROA 5KFNA 3LANA 1JLFA 2R8JA 2UUTA 4ZP8A 5F8MA 4IFYA 4Q43A 4FBUA 1RTHB 1YVFA 4IH7A 2B43A 1LW2B 3BQ2A 1REVB 2CJQA 1HQEA 3T1AA 3DDKA 1VRTB 4ZVGA 3HHKA 4RU9A 1DTQA 3LP2A 4LSNA 5EWGA 4J9PA 4DL5A 4K4XA 3PW4A 4ECXA 3H40A 3MFHA 1RT3A 1HARA 3V6KA 2ZD1A 2R2RA 2C2EA 5HROB 1XR7A 2FJXA 2RKIB 1JLFB 1U09A 4IKAA 2FVPA 3CJ2A 3QLHA 4Y2AA 4NLWA 4IQXA 1HQEB 1RAJA 2FVCA 2WHOA 1Z4UA 3NKYA 3I0RA 1LWFA 1N4LA 2WK4A 5JUMA 4NRTA 1DTQB 3LP2B 4LSNB 4MFBA 3TQ1A 1J5OA 5EUHA 3NGDA 1OS5A 3OSNA 2ZD1B 4RW6A 2C28A 1RT2A 1LW0A 1LWCA 3SFUA 3RB4A 4H4MA 5KFSA 1ZETA 4ED3A 3DOKA 5F8GA 5F9LA 3UDLA 3PW7A 3QLHB 3H5YA 3KLGB 4JV0A 2O5DA 3G6XA 3OL6A 3OSPA 1IKVA 3I0RB 4IH5A 2UVVA 1LWFB 5K14A 3SI8A 1T05A 1SUQA 4MFBB 1J5OB 4B3OA 1D1UA 1MU2A 2W8LA 3NBPA 2IC3A 1WNEA 2YNIA 4NLVA 1LW0B 3NMAA 1RT2B 1FK9A 2BE2A 2GIRA 3ISND 4I7FA 4H4MB 3KLHA 1VRUA 4J9KA 4IRKA 1S9GA 2FLNA 2CKWA 4NLXA 1DLOA 1SV5A 4O4GA 5DGAA 3ISNC 1W25A 4ECZA 3CDWA 3CIZA 3CJ4A 3CJ5A 4Q8FA 5C25A 3KHLA 4FS1A 4ECRA 1T05B 4ZPAA 1BQNA 1SUQB 2W9BB 4HYKA 3RB3A 4B3OB 3OL7A 3CJ0A 3HVTA 4F4ZA 5J2PA 5L9XA 2VG6A 4MIBA 2IC3B 1RTJA 2YNIB 4RW8A 5KT4A 3QZ8A 5KG4A 3KLHB 5KFQA 4I7FB 4J9SA 1C2PA 1VRUB 1T94A 1TL3B 4WXOA 3QZ7A 5L1KA 1N5YA 5KFJA 2GIQA 1DLOB 1SV5B 4IR9A 3N6LA 1C1CA 3MECB 2R8HA 3Q8RB 5C25B 1IKYA 1NNDA 2BRKA 1BQNB 1ZTWA 3DRSA 5J2PB 3V6DA 1T3NA 3FRZA 3CVKA 2VG6B 1RTJB 1S0OA 4O3PA 5KG5A 2AU0A 3MEDB 3GV8B 1TL1A 4ZVFA 1RTDA 1BQMA 1HPZA 3KK1B 1N5YB 3H59A 4LSLB 2E9RX 5F8HA 4O3NA 2UVRA 2UVUA 4NZ0A 2XCPA 2R2SA 5J2MA 3GIIA 3KLIA 1JKHA 1R0AB 1IKYB 3V6DB 4IDKA 1XR6A 3KHHA 4Y34A 2W9AA 1DTTB 3PZPA 1RTDB 1BQMB 3V81A 5C42A 4DL2A 2XWYA 5KFIA 4K50A 4JV1A 1CSJA 3T5LA 4NLTA 4NYZA 1GX5A 2OPQA 4J9LA 5KFBA 3KLVA 3MEGA 4IDKB 3KK2B 4F4WA 2YNHA 4RUAA 3G6VA 4ED6A 4ECTA 5DLFA 4XPCA 3JSMA 2JEIA 1S6QB 4R0EA 2WCXA 3OL9A 3V81B 4Y3CA 1ZTTA 2FJWA 5J2QB 3PJXA 3CJ3A 4NLUA 4J9QA 1RT6A 2OPSA 1JLCA 4M95A 4ECWA 4R8UB 2AGOA 2JC0A 5KFMA 3FSIA 3GIJA 1HNIA 2OPQB 3KHGA 1HYSB 3MEGB 2QV6A 2WB4A 2YNGB 5I3UA 3JSMB 3D5MA 2IM3A 4KKOA 3E01A 2BQRA 3HVWA 4TQSA 2C2RA 3FFIA 2ILZA 3MTKA 3MR6A 4YR2A 1JLCB 3PR4A 3QGHA 3D28A 5C24B 3ITHA 4WZQA 2QE5A 1HNIB 3GQCA 4URGA 5I3UB 5KT7A 1TKXA 4H54A 3IG1A 4KKOB 3E01B 3I5CA 3RBDA 5DG8A
chains in the Genus database with same CATH superfamily
1HLWA 2PMZD 3ADAC 1GMWD 1RTIA 2YKNB 1F5CA 3UFCX 2F4VJ 4GKJJ 4WYLA 1S1UA 1MWZA 5L39A 1U6FA 1WWHA 1QLNA 4FXWA 4ICLB 1WEXA 4B9UA 4K5SA 4MH8A 3Q2TC 1S0NA 3P4UB 1HNXF 2XZWA 4DXLA 1O5JA 5F0WA 4TY9A 3ETMA 1A0OB 3DOKB 3RR8A 2IJFA 1X4GA 2ZDOA 3TVYA 1QSLA 2QMWA 5HLFB 5I42A 1TKTA 3J7ZT 2JOQA 1HBOA 1T9VA 3JB9k 2FYXA 3BN7A 4G1PA 1OMSA 1CPZA 2V9KA 4DPYA 5D0EA 4BDPA 4KSEB 3POTB 2YWWA 4ZP7A 2Z4PA 4CO1A 4FNIA 3MR7A 1FXRA 2B3TB 3N6NA 2WAQD 1YJNS 5B0BA 5JXSA 1NEEA 2HURA 5DM6Q 1F9EB 1TVRB 2BYCA 4I2QA 2MQPA 2AYEA 4DL7A 3PW5A 1YRTA 2B9XA 2L48A 2N3LA 2ZNYA 1T03B 5A6WA 2EKYA 4ZDNA 7FD1A 3DYAA 3SCKE 2B56A 1UVNA 3H7HB 2AJFE 2VICA 1BC6A 3QO9B 3NOCA 1S99A 2CJBA 1TKDA 1R8BA 5C7PA 1RDRA 3SCJE 3EVWA 1REVA 4MYTA 4X4TA 3RRKA 4WKYA 1OYEA 3MMBA 2HNDB 2WOMA 2HWIA 2B4OA 2HFZA 1HHTP 5G0RA 3EUNA 4WIIA 1U2CA 2A18A 4IFVA 4JI1J 1P9QC 2W2OP 3QSIA 4A46A 4F2SA 5KT5A 2CQIA 2E7VA 2YX7A 4WTOB 1YJ7A 4K4ZA 3DM2A 2XGQA 5U47A 2IVMA 3TUZC 2MYFA 4M63A 3D1HA 2ZUAA 2IRYA 2YY3A 4CLSA 5JVHQ 3LH2S 2V4JB 1YHQS 5F8JA 1RA6A 3LP1B 3OT9A 2W2NP 3I56S 1NH7A 4CYUB 2OUGA 3U7JA 3D9BA 3T5KA 2BMBA 5BYQA 2MKYA 4ED7A 1JNRB 4DV4F 3V5RA 1VIOA 2VASA 2RQMA 1RWVB 4U9RA 4R8UA 1Q8LA 2E7XA 5FDLA 3EZUA 2HFOA 3BF4A 3MEKA 3Q89A 4PUOB 3O1LA 1JLQB 1VBXA 1LW2A 2VJVA 5F9NA 4RX6A 2V5HG 2CQ3A 1E6VB 1NZAA 4YMEA 2IRXA 1TAQA 4MT1A 4I4BA 2DRDA 4ILMA 4ZVGA 1FRHA 5EWGA 4A47A 3KKFA 1UAWA 4QQBA 2M8HA 2HRUA 4ZA1A 2VPXB 2Y0BB 4Y2AA 2MLYA 2FVCA 3I0RA 5JUMA 1TMJA 5HMWA 2KM8B 3H5YA 4B3RF 5IM0B 1U1OA 3SI8A 2GQ2A 4Z2XA 4B3OA 1RU1A 2QG9B 5H9EJ 1MU2A 2K7KA 2NLWA 4GVBA 5GADU 5LM7E 2V69A 1C4AA 3RYLA 1RGVA 1W25A 3CDWA 1HA1A 1U8SA 2QA2A 4JYAF 3SV3A 2VG6A 1T94A 1YBTA 3I9ZA 4IOAQ 1NKBA 4PWUA 3BGLA 3V6DA 3FRZA 4O3NA 4RL1A 2E5HA 1VQSA 1VQLS 1CEZA 1RTDB 2CQ4A 1SCJB 3OFEA 1IUJA 5KFBA 4RUAA 1DZ5A 4DSLA 3OL9A 1FJGF 3FK4A 4J9UE 1VIXA 1RT6A 2DCUB 2YQ3A 2QV6A 2WB4A 3OJUA 4X4UA 3G87A 4NI2B 4WU2A 2O01C 2C2RA 5HL7Q 2R9LA 3G4SS 4C11A 1IBLF 1RQ0A 3MM9A 3NS7B 5KG3A 4ZJOA 3C2PA 2BOAA 1TKXB 3R5JB 5T7LA 4PXCA 3BKUA 3BQ0A 3N6MA 1L3VA 1C1BB 4OX6A 2IHR1 2JFKA 3UCGA 2AX0A 2AX1A 3KFWX 4QIVA 4ID5A 4RW6B 2H9ZA 3HLUA 4Q45A 1FXLA 3M8QB 2ZITA 2BBEA 2LDYA 5K14B 1N5VA 4H4KC 1RKIA 2IA6A 5MLCV 2V67A 2BE2B 2B4PA 4YB5A 2A1BA 2G0IA 2E5GA 3FQKA 4IQMA 3LGMA 4DUYF 3EM1A 5H9FJ 4HHHA 3IAS9 2DPJA 3M4XA 4KB7A 3R5BA 3DCAA 2AYBA 3SBMA 5M2UA 2DYAA 5KOXA 4Z7CA 1QAYA 1KBRA 1X4HA 3N5FA 2CJYB 1NSPA 1S57A 2EBGA 3BM7A 3K0JA 1IBKF 2DNGA 1CJKB 2RRNA 2VC1A 5A8RA 1RU2A 4CCHA 4CH1A 1D0EA 2KZZA 2KB2A 3AJ2A 4M5IA 4EFAC 2JLGA 1RUSA 3DXBA 2KT5A 1U1QA 1WHXA 5E41A 3BKTA 3M8ZA 3G8SA 1S4FA 3SEOA 1R6YA 3JQKA 4MIAA 1KEKA 1KP6A 5DZ6A 4N41A 5KT3A 5DQIA 4X65J 2LU1A 5DG7A 3KG1A 2UVWA 4J9OA 1S9EB 2VF3A 2XTDA 1S1XA 3HP6A 1PG5B 3JSRA 3TOQA 3IXQA 2E7WA 4Z37A 4C7QA 5KFWA 1FESA 2YQ0A 4I56A 1PKUA 4X62J 3HVRA 3PRDA 4AFFA 1EQ0A 2JLEA 4DV5J 3ISZA 3T1YJ 5J1NA 3CW2C 4WZMA 3OD2A 2R7XA 4OZ2A 5KFKA 5DM7Q 3FEYB 4G1QB 3DC2A 4NRUA 4UZCA 1KKHA 4DU8A 2ADCA 1NHVA 4I2PB 2E1RA 4A8SA 2DISA 3L95X 2VB6A 1H72C 5CYMB 1U25A 2QMUB 2HVIA 4EU0A 2HHHJ 3MPDA 1LNQA 2VG7A 4R5PB 1FA0A 4ZP6A 3W64A 1EARA 3TEHB 2GGPB 4PRFA 5F8IA 3EGVA 3RAMA 5I4MA 2HHXA 4M5HA 2Q6BA 4IH7A 7FDRA 1L3SA 1VRTB 1N0UA 4ECXA 2RKIB 2R7OA 3MM7B 1XERA 2QO3A 2MGZA 5AE1A 5BXIA 4K2XA 4LMZA 2EW9A 2ZD1B 1LW0A 5HATA 1ZETA 3PTWA 4NZ7A 3I9V9 5IFMA 4ZJQA 1D1UA 4OZJA 2LQ9A 2W8LA 4F3QA 2YNIA 2EG1A 1VRUA 3ISNC 3UD4P 1T9UA 3HJFA 4MIBA 4RW8A 3TA2A 4WXOA 1VK8A 2F7VA 1SV5B 1LXJA 3W9IA 3HHLB 2MLZA 1JJ2R 3JTPA 4EK2A 3KG4A 3CJKB 3KLIA 1R0AB 1N32F 1X4EA 2MHNA 4DLEA 1H38A 4DL2A 2EC2A 2JFDA 1DURA 2MZRA 3FJ2A 2DO4A 4ZPTR 1GX5A 2I9SA 3ZXWA 4LRFA 4ZOSA 1S6QB 2GQCA 3A3PB 3KNGA 1MN7A 4J9QA 2OPSA 4USHA 3KHGA 3SQGB 1SQGA 1DRZA 2Q6CA 3PR4A 4C8YA 3LOUA 2ZH7A 3FVYA 4LF4F 3QAEA 2R7QA 4WK1A 1WI8A 3PVXA 4IFYB 4YR3A 4XAKA 3QWUA 5A0YB 3SV4A 3L3CA 3LPEA 3LTOA 2ASYA 3CSKA 5D0GA 3GV7B 4FXDA 1A7GE 3BH7B 1OM2A 2KVQE 2KO1A 2BJEA 2HMIB 1AYEA 4WE1A 3R5AA 1RT5B 4Y2KA 2B6AB 1KQSR 3RBEA 1URRA 3DLJA 2UP1A 1B3TA 1YJUA 1HBMA 2XBPA 4KGMA 2D1CA 3BO4A 5A2QY 3HSJA 5IWAF 3HKWA 1Q79A 1U1KA 1XNRF 2DR5A 4RZRA 2YWHA 1LKZA 1S49A 3PO4A 4NLDA 1QY7A 4RUBA 4LT6A 3ENWA 2HVHA 4B9MA 4G3IA 4P2FA 4JI4J 3M6WA 1VQ6S 3QRPA 3M32B 2L08A 2HNYB 3IRXA 3W66A 4IG3A 2L9NA 4JI8F 2OPRA 3MR5A 1S10A 3DRXA 1EETA 4X4OA 2M52A 3IGVA 4U95A 1SPBP 4DR5F 3VGSA 2MKHA 1TUGB 3H20A 2YVSA 5D4OA 2IJRA 4DQQA 4JI0J 1EIYB 3KWMA 1HBUB 1P1TA 1SJQA 3J7A1 4JI7F 4QWBA 2KRRA 3GONA 3HD1A 4RNMA 3LGNA 5EWEA 3VZHA 4QR1A 4QYZJ 2XMUA 2QLFB 1AA1B 3B82A 2MKKA 2J6SA 1S1WB 5B09A 2CYYA 3PRVA 3UNYA 2PGCA 2QJ3A 3A12A 1DAXA 3AXMA 1VQPS 2ZZTA 5J1EB 2QLWA 1NKCA 3D7SB 4ZMMA 2YH1A 1GX6A 4ES1A 2GVDA 4B9NA 3TWZA 2J8SA 2QSFA 4AQYJ 1RAHB 1SQEA 1BE4A 1KVIA 4PQUB 1U45A 2IYGA 4DR2J 1IKXB 4M5KA 5AT1B 1R8CA 4F4AA 2C2KB 2DHXA 2BANA 2ZBRA 4QWDA 3IGNA 1RT1B 1SI9A 3M2RA 4UQTA 3H5XA 1NAQA 2E44A 2NSCA 3AD8C 2C22A 3FCHA 2MZ1A 4RW9A 3H4DA 4KAIA 5HJYA 4DQIA 5IV3A 4KGKA 1XMQF 5BR8F 3V6HA 4ELUA 5KFLA 4M5JA 3LUYA 2DITA 4KO0B 1NJZA 1XQIA 3K2YA 3MFIA 2XLJA 2MSTA 2M0GB 3H90A 4FF2A 3F44A 2F9JA 2V1SA 1FDDA 2LMIA 3HHNB 2GCFA 3QGPA 1EKRA 3M30A 1VBYA 4LREA 1QSYA 4DV7J 3QLHA 2KI2A 3NKYA 5GMEA 3NGDA 2HBRB 3MUTP 3E2EA 1U1NA 4USWA 2M70A 4P71A 2X1GA 5E33A 1A9NB 4MFBB 3FRYA 1M5SA 2MY8A 3HSDA 5E3RA 2A2DA 2QYGA 3D2WA 2PA3A 3HZGA 4CLPA 4DQRA 1E6YB 3HVTA 3HHLD 1BD6A 4NPOA 2YQ1A 4JBCA 2O67A 2LXUA 5D8HB 2BRKA 3I4PA 3DRSA 2FGOA 1NJXA 4P7VA 3G2XA 4DPXA 3W62A 4IDKA 2QFIA 2KXFA 5LMUF 2ZJRQ 1X60A 3WBZA 4MIWA 3AOAA 2WCXA 2B4UA 3N5BA 1M0SA 3AAWB 5I3PA 2H5JB 2BV3A 3M2UB 3MEGB 3R1LA 2CQPA 4J91A 2QX0A 1XMOF 4KKOB 3I5CA 2LQ8A 3FFIB 1H2VZ 2PFFB 4ECVA 3OUYA 3TI0A 2DXEA 2CPHA 2VV5A 4CT8A 1FKOB 3QRQA 5KFUA 1VLOA 1LV5A 4KHRA 3UWTA 3B54A 1PO6A 2OHDA 3D0GE 2I6WA 3BJYA 3TJ9A 1YGYA 3VHQA 2HAIA 3M8PA 2RUGA 5KFRA 4PCQA 1R8PA 2ZC4A 1U0SA 2FLLA 1RWUA 2BZ2A 4NMXA 2BQUA 2DNOA 4PG6A 5IT0A 3V4IA 3D0IE 3TUJC 1TKZB 2DXFA 4UUXA 2W2MP 1V9OA 3OQ2A 4U7CA 3Q2SC 3DLEB 2D3OR 3D0HE 4CLTA 2YKMA 4DV2F 1TK5A 4GMKA 4OL8A 2EFVA 3OJSA 2CQ2A 2XWXA 4DQSA 2HFVA 2I5JA 2F3JA 3PW2A 2ASJA 5J2MB 4YY3J 2KHDA 2DNNA 4YS2A 4DV3J 2XSJA 3M05A 2LKZA 2RQ4A 1YJWS 1AUSL 4Z7YA 4L3NA 2UUCJ 5HBMA 5AJ3F 2EK1A 1JJHA 4QW9A 2ATLA 3PYEA 5DO2A 5GAGU 3VGTA 4DQPA 4DDFA 3GG1A 4HLBA 2V2KA 1VQYA 2ZZNA 4F7VA 5HMZA 3QRRA 5HK4A 2KG1A 2RDIA 1LWEB 1XWLA 4CRJA 3CCTA 3A4TA 3RAQA 4RBTA 2VHGA 2LEAA 4B02A 4PAAA 3KTQA 3P8BB 2IDEA 2D3O1 2Q1LA 2RDJA 4LFCJ 1YDLA 2E5JA 2XM3A 3UVJB 2CZVC 4B3TF 1R27B 2ZE2A 1KQKA 3RRGA 4FKXA 4EUVA 2JVRA 1NK0A 3K8WA 1QAIA 4DR1F 2LVWA 4KPYA 3BREA 2OPPB 2V34A 1N54B 3LAKA 5LSRA 1ZOTA 4BWMA 1TL3A 5ETLA 3MHYA 2FJEB 1Z2ZA 4OFZA 2MQLA 1SKSA 2I38A 1NJWA 3CCVS 4J90A 2RF2A 4YDXA 2DO0A 3MMAB 2R8GA 3AX3A 2IAJB 4J9MA 3M1VA 4DPWA 1Y4ZB 4LF5J 5DQGA 5D6GA 4X66F 5HP1A 4J9VA 1PGZA 5CA5A 3IR6B 5H1SV 5LSLA 2FGCA 1NKEA 4DL4A 5EX3A 2ZH2A 1H2TZ 4NCAA 3K8VA 2XEXA 1IJEB 4KV8B 2H5IB 2VFSA 2ZKUA 3HO1A 1G1XA 1JXLA 4U7UD 2LEBA 1Q8IA 5KFZA 2VDHA 1RT7B 1YQHA 3LANA 2GMLA 4FBUA 1YVFA 4K4XA 5ETOA 4ED5A 1JLFB 2K1RA 1U09A 2GW8A 3W8PA 2WHOA 1HNWJ 4LSNB 1LWCA 3IBFB 2EFOA 4NEYA 5HMYA 2UXCJ 3PW7A 3KLGB 2HS0A 3IMQJ 5B7WA 3EX7B 1WOOA 1RTZA 3UNGC 1J5OB 2MY7A 2KFZA 1WNEA 4I7FA 3U1NA 1I51B 1ZM2A 5D4PA 4UOCA 4DBQA 2KDOA 3KHLA 4ECRA 4LF2A 4FF3A 3O2IA 5LJ3Y 1BQNA 3OL7A 2HHUA 3KLHB 1N8RT 2RDDA 2DR6A 2GIQA 4CT9A 3NP5A 3AB4B 2NXEA 3CD5A 5J2PB 1RTJB 3TX0A 4QU7A 4A8FA 2R2SA 2DNKA 4UY85 3DXSX 1HKAA 2E66A 3CCJS 2Q43A 1DTTB 1RLDA 3NGUA 1GQEA 2J9DA 3T5LA 4NA1A 2HZCA 3ET6A 2K8GA 2NXCA 2OJ3A 4U8YA 3JSMA 3SSQA 2FJAB 3N0VA 1CJUA 2AGOA 3K5MA 4W98A 5I3UA 5IQ6A 3BGOP 2RQCA 2QLXA 3C14A 3K17A 4YR2A 1EZZB 2JLFA 2M4MA 3I31A 4DJBA 1CC8A 3S8SA 1HNIB 2HLUA 4MMOA 1X5OA 4NCBA 2DRAA 1GMWA 1YITS 2AJ1A 2W9CA 1WG5A 2C2NA 5K8OA 4A8QA 1GXTA 1HI1A 2GMHA 3OFFA 1BWVA 1RHMB 3DLGA 3GYNA 2VQFF 4ZN1A 3NCQA 3S1TA 4Q0BA 3QWPA 4OYWA 2ZH5A 2LA6A 1JXVA 2KKHA 1KRPA 1TZ0A 3M8WA 1RAOA 4GC7A 3UDEA 2B51A 2IPOB 3NGRA 5KFXA 2JRSA 4RR5A 4DFJA 4DCPB 1TL7B 3LP0B 1FKPA 1NH8A 4F3MA 4P2MA 3DLKA 2DHSA 1NK9A 4ZCLA 2FHMA 1Q86T 3MZIA 5GAGI 3PM9A 3M9NB 1N52B 4XPEA 4JV2A 2R7SA 4HI1A 4P10A 2ZH1A 3QT7A 4UOFA 2ZNZA 4M94A 2BR0A 2MKJA 3K7RA 3C6UA 2ZM6F 4HL9A 1K1SA 3E51A 5LJ5Y 2UXDF 2HHVA 4LFAJ 2EXUA 2EI5A 3OLAA 2F4VF 2W7OA 3NL0A 2VPZB 2CJ9A 3MPVA 3KJVA 3U27A 3WIVA 2R7TA 3RB0A 2HNZA 3DI6B 4A8XA 4ED0A 2ROPA 3DGVA 3CDEA 1CQNA 4C9DA 1TL4A 4BLGA 2XLKA 1IKWA 2XZDB 2B8QA 2R2UA 1B0PA 4DV1J 2AZ1A 1D8ZA 4X4RA 3MCMA 2HQDA 3KOAA 2OIHA 2P9EA 3PX0A 1JLAA 4MK7A 3OTOJ 3GJRB 2D3UA 1JLGA 1RCXB 2BJ1A 4F36A 5GMDA 5I42B 1HR0J 4NX9A 1HBOB 4ZN3A 2HGNA 2EK6A 4NYPA 3OR1B 3CMES 1YKWA 2FB0A 2VBZA 1M5HA 1QVGR 4EYIB 1C0UA 1XNQJ 1RT4B 1NHUA 1AZSA 3G82B 1VISA 4DL3A 1FDAA 4O44B 1VRQC 2EG2A 4WYWA 2KJWA 1T9YA 1HYSA 2ALYB 4MKAA 1JLEB 3M9OB 1U7LA 4OLPA 2V50A 3DYAB 2OLWA 1FJEB 4JI1F 3C46A 1BQXA 5HI7A 5D78A 3I82A 4K7QA 4TLRA 2MZTA 3OTBA 2C2ZB 5HROA 2WSFC 2XO6A 4ZP8A 1RTHB 1CULA 1REVB 1FFSB 2J0XA 5HSPA 3HHKA 1RAIB 3VCDA 3MFHA 1J5EJ 3FCVA 5G0RB 1LWFA 3JAMU 5EUHA 2HHQA 3NY0A 4ENOA 3CC2S 3OL6A 4C8ZA 1SUQA 2IC3A 4OZLA 1FK9A 1S9GA 1LWXA 3GG0A 4OI1A 2ADBA 3N6LA 3Q8YA 3VVTA 1KWMA 2OTLS 1RACB 1T3NA 3IAM9 1S0OA 1U26A 4PXDA 3W5YA 2AU0A 3T6JA 2OSRA 4ZVFA 5AXLA 2DHHA 2XLIA 4CQ1A 1TR0A 4LF8J 1MROA 3NOGA 3TUIC 2F63A 4RLEA 1GK8A 4XDDA 1PYTA 3L7PA 1UFKA 4JI6F 3AJDA 1ZPWX 1W2IA 3VAHA 3F56A 4XPCA 3V81B 4Y3CA 2WZ1A 1SJ4P 2KFYA 4M95A 4R8UB 3WX8A 4R25A 5CAAA 4TQSA 2ILZA 3MTKA 3CB4A 3OTEA 3GZ7A 1YZ6A 4G6VB 1W2BR 1JX4A 3CUNA 5CQGA 4QU6A 4ICLA 1FNOA 2MPUA 3PG9A 5JVGQ 4BS2A 4TY8B 2RVJA 2RMLA 1X4AA 3QT5A 1G7CB 3CCQS 4B3MJ 2OEJA 1X4FA 2WVFA 1FTRA 4K4VA 2HGMA 3M6UA 4NLGA 1Y5IB 2HHTA 5HLFA 1IJFB 2FJVA 3W2WB 3N01A 1WKJA 2HQFA 4DR4F 3MM5B 3K58A 4BCAA 1MU2B 2GS8A 5B0EA 5B0FA 3GFHA 3POTA 1HNXJ 3D6FB 4YR0A 3AH6A 5KTQA 3OLBA 2C2MB 1OIAA 3OPKA 3OR2B 1FCAA 2AEFA 5ETMA 1PAEX 4QIWD 4ZCMA 1TVRA 2J0QD 2WVDA 3PHTA 2DGXA 3RTVA 2DT9A 3MOJB 1T03A 5EX0A 1FXDA 5IS2A 4PWDB 1QDUB 1F2GA 2AJ0A 4L76A 2A2CA 4YN3B 5HANA 3MM8B 2CPJA 3QO9A 3KLEA 1RT6B 4HACB 2AWZA 1Y0HA 1R8AA 2N7CA 1TV6B 2B5JA 2HNDA 3PX6A 2O66A 3SYZA 1FRMA 2Y1LB 4OZ5A 4U96A 2QT7A 3GJTB 1SKRA 1HQUB 4NLRA 1S6PB 3W5ZA 3PHEA 4L74A 3VF0B 1SC6A 1K44A 1KD1T 1RCOB 3HI9A 3MUVP 3BQ1A 1UL3A 2RD5C 3R1HA 2RU9A 2ALZA 3IWLA 3OHBA 5B0CA 4URQU 2F4FA 5KFTA 5KT6A 3LPYA 2XHCA 2L3MA 4C8NA 3LP1A 3D54A 3TJAA 4O4RA 3MPWA 3TZXA 1D9DA 3LAMA 2KXHA 5AXMA 4OJHA 4U7UK 4ZPDA 4LSLA 5J2NB 3NG8A 3ELHA 4QPTA 2DPIA 4DN9A 2XNQA 1ZYQA 4UT4A 3EWGA 1IR0A 2OAUA 2B7BB 4CH0S 3EGWB 4BC9A 3R97A 4NLPA 1RHQB 1UFLA 3ZZZA 3ICLA 4Y2CA 3GCXP 1GMVA 2GMJA 1JLQA 3SIPB 5K8PA 4WFNQ 4DV4J 3I0SB 2Y9HA 1R31A 4X65F 4DR3J 3LWLA 4PZVA 1B0TA 2LXFA 3MCNA 2N4CA 4RWXA 1FDNA 3DFEA 1HARA 3BN4A 2R2RA 4Y65A 1VBKA 4IQXA 5BYRA 3J7Z5 5IM0A 1N4LA 1G4CA 3DDNA 2X51A 3J7AN 3W2VB 4CM2A 4K0KJ 3WZ0A 1AT1B 2O5DA 2G2OA 4LVNP 1SJRA 4AUKA 5CZXA 1H7XA 3T1YF 1X4DA 3KYLA 1NJIT 4O4GA 1VQ4S 3X3UA 3MI7X 2XY7A 5KT4A 4KH0B 4L6V3 2D74B 5KFQA 3J81U 1MWYA 5F3TA 3GSDA 2AMCB 3W63A 2AIRB 5E5NA 3Q8RB 1X5TA 4Q2LA 2AD9A 2UV8G 4ZCIA 5KG5A 1RTDA 2CPIA 3B4DA 2QL9B 1N5YB 1S0VA 4OX7A 3G8TA 2V63A 1BQMB 3MTJA 4NYZA 1EB0A 1O51A 4DR7F 3BGUA 5DLFA 2EFPA 1WOSA 2HS4A 2D68A 1MMNA 3KJNB 4DFKA 5CCLA 1H3DA 4DV6F 2GHPA 3FSIA 2COLA 3D5MA 1CS4B 2NPIA 1VGYA 3HVWA 1R89A 1AROP 4XDCA 2E1PA 1TKXA 1FJGJ 4EGLA 2VG7B 4RW7A 1C1BA 1T8EA 2WBMA 3TAMA 2PEHA 2J5AA 1HNVA 1YSJA 2DH7A 4ZCKA 5KT2A 3J7YU 4FS2A 4RW4A 3M8RA 4LQ3A 2VDIA 2XMMA 1VDHA 2HEKA 3M8QA 3MCSA 4KR0B 1S1TA 4AT1B 4ETXA 4OZ0A 1RADB 4QOTA 3UD3P 1S79A 5RUBA 3KUHA 2J9DE 1YLXA 3OXGA 4EZ6A 1UUJA 4OX9F 1WTFA 4C3MA 1GXUA 1Q95G 4PR6A 5L8RC 3KLFB 3KHRA 3HHDA 3LALA 3P6YC 4RW8B 4DUTA 2WBRA 4RWWA 2W1BA 1WUUA 1QAXA 1IWAA 2YNFB 4M5MA 3KLIB 2JH3A 4P2XA 1UKUA 4DUYJ 3QSYB 1A6LA 4I68A 2V8HA 3C16B 2V6AA 1CJVB 3NMRA 4TQRA 1OQ6A 2CPFA 3U1LA 1RSCA 2OPSB 2DGTA 4OYZA 3AD9C 3W7BA 4XK8C 1T11A 3BR8A 4GVLA 2E1CA 4LVOP 3MXHP 1FWLA 4O3SA 5LL6d 4DL0C 2OGUA 1YIJS 2IIHA 2XQCA 2XY5A 2ZHAA 3PYFA 3QT8A 5IOLA 3L9ZA 5E2QA 2AYGA 4OX8A 2A6OA 3HD2A 2IBOA 4LFBJ 1WJ9A 1OQ3A 3Q8PB 8ATCB 3I6PA 4KTQA 5A76A 4F0HA 4AXIA 3EPGA 1ZM9A 3T9ZA 2ZH4A 1ZBTA 5CABA 2DEJA 4KFBB 2KL8A 1N34F 5FJ4A 3NS6A 3BDPA 4WE1B 2VFRA 4M1KA 1Q7YT 5K5MA 3DU5A 4F04B 2Q79A 4ZVTB 3PKYA 2A3JA 1RYRA 4K4UA 3KK1A 2H51B 1HBMB 3CJSA 1DQ8A 4O3QA 3TR5A 4DSFA 4G1QA 1EKSA 4DSIA 1B0VA 4H4OB 2IA0A 2JEGA 4DS4A 3DHWC 3RRHA 3MCOA 4KIAA 1PCAA 3NNCA 4C48A 3DOLB 3CD0A 1HFEL 3PJWA 5E0OA 4EEYA 4JI0F 4PWWA 2G1DA 3MAAB 3T5HA 2DR8A 2FHKA 4R5PA 2APOA 2GGPA 3DLLQ 2JZ5A 3QPIA 2RHSB 4NWBA 3BZQA 2FC9A 1DFDA 4UZBA 5LOQA 1QE1B 1VRTA 2C2DA 4BBYA 3H4BA 1SBRA 3OHAA 2RILA 2P8IA 1NM2A 2XS2A 1NK4A 4HR2A 5DDQC 4X4PA 4Q5VA 2HRTA 3MM7A 3BQ2A 1TK8A 4JI2J 1FRXA 3NWGA 1V5IB 3LO3A 1I5OB 1SIWB 2QGFB 3CF5Q 2ZD1A 3D3BJ 1RWWB 2R4FA 4DN0A 2RHQB 2IMOA 2I0XA 4AQYF 4ED3A 2QFJA 5ETSA 1R43A 1NBEB 3AODA 5FIIA 4DR2F 2G9OA 5KOWA 1WDTA 2HG4A 3W3SA 1SV5A 2H54B 5DGAA 3PX4A 3A1YG 4HT5A 3HHLA 1U2FA 4J9SA 4O0NA 1FF2A 2GVDB 2GZOA 3EZOA 3R5GA 1UP1A 3CJKA 1C1CA 1UPMB 4FZVA 1HI8A 4O3PA 3ZZPA 4DR6F 2GQQA 1HPZA 3TVZA 3MUMP 3JQJA 3ZZOA 3GIIA 3H8YA 3S6EA 4GRSA 1U48A 4ALZA 4M5DA 3PZPA 1PSDA 3AA8A 3M2RB 3FBEA 2MZQA 1YBUA 3SQGA 1B7YB 1NDPA 1IWGA 4PEOA 3J7YI 1N32J 3CC4S 3VAIA 3AWRA 3VVUA 3C15B 2JL9A 3CE8A 1SL1A 4WF9Q 2OD6A 4DV7F 5B0AA 1ZS6A 2Q66A 5CD4A 3GQCA 5AE2A 3K59A 5CH7B 3PACA 1H0HB 5A0YA 3R2DJ 3JS9A 1EP4A 3IM9A 1MLAA 2QLBB 3G6YA 3FC9A 1LK7A 3PIOQ 2DEIA 3DMJB 3RBDA 1OY6A 3BH6B 2HMIA 2H65B 1WF0A 2QSWA 4ELVA 1RT5A 4OJ1A 2B6AA 1RK8A 1RXOB 4CI0B 2H4YB 4IYQA 5KFPA 4IR1A 3PW0A 3W5XA 1I94F 1HWJA 1N5TA 3HVTB 1HBNB 4ED1A 1XMBA 3DRSB 3M32A 2ZFHA 2HNYA 3MOZA 1WC5A 1TUVA 1AW0A 4PXEA 3KMQA 2Z0GA 3EPIA 3FBFA 4DI6A 1KN6A 4USUA 4QWEA 1S1VB 2W25A 3KMSA 3QJPA 1NSAA 2HS3A 2M5YA 1FD8A 1SL0A 1SL2A 3AT1B 3ILIA 1U47A 1JXEA 2R7VA 3B8HA 1EJ7L 3M2VA 4C4WA 3MD3A 1FHTA 1WHYA 3QQCD 2BACA 1UA1A 4LF6F 2H4WB 1HBUA 3H42A 1ZAWA 3K57A 3ILOA 1UZDA 2XMKA 3L09A 1FJCA 2V8GA 2PI5A 2HHWA 3TNVA 3OUYB 1S1WA 1RI7A 4RUCA 4DR5J 4ANEA 2HVDA 2F8MA 4USIA 3IR5B 5J1EA 1Q8BA 3M8PB 5KFDA 2SXLA 4MKVA 4JI7J 4HDGA 2CZ4A 2CQ1A 1JJCB 1JLBB 2D3ZA 3MR2A 2MQMA 3ILJA 3V4IB 5IQQA 1UWBB 1J27A 2RE1A 5F0UA 2YKPA 3GPAA 4B9VA 4PQUA 4OI3A 1IKXA 1NCLA 1GTHA 1JB0C 2HZVA 3MECA 1WF1A 4DV3F 1ZM4A 3SSSA 2XHWA 2KU7A 2J6TA 2VPWB 3TAQA 2P2CB 1RT1A 5ETNA 4Y2MA 2LEPA 3L4BC 4HHUA 5FLXU 4RNFA 1IR1A 3MAQA 4TKTA 2VG5B 4U6PA 2I5JB 1KVJA 4P75A 2UXBF 2HIYA 1OYDA 5F41A 3ZTSA 5DETA 4UY8T 4PXBA 1JJ4A 1HHSA 4P6QA 2P9GA 4KO0A 2KHCA 4N77A 4FF1A 2C3PA 4QJVA 2QRRA 5C24A 1UJ4A 2M9KA 4OMFG 1CC7A 5SZTA 1XMQJ 3P5BP 4DSKA 4OHVA 2RS8A 2PI4A 3HT3A 4IO9Q 1AUDA 3TYTA 4WTYA 1Q82T 1XR7A 3D1QA 4TNOA 1DJ0A 2BJ8A 3VR1A 2AJ2A 3TQ1A 4KRWA 4MFBA 2KM8C 3EVMA 2C3YA 2CADA 4UF4A 3N4WA 1R6VA 3KXDA 1U1MA 3G6XA 4K2JA 1XBWA 4Q7AA 2UVVA 1U0HB 2GJ2A 4IH5A 1SJ3P 3CCUS 1E6YA 3NBPA 4QIFA 4WFAQ 3W8GA 2DIUA 2VBXA 3F0NA 3NS5A 3PIPQ 2R42A 1J2VA 1F9FA 4LF5F 1TL3B 3RBZA 1DLOB 4IR9A 2NUUG 5C25B 3CVKA 4NXMF 1WD6A 2O3DA 4WP8A 5F8HA 1Y9OA 3DDIA 3RJMB 3ZZRA 2F8HA 4JP8A 3R6GB 4UOGA 5C42A 4K50A 1RLCL 2MZJA 2IFXA 2KFNA 2G13A 4NA2A 3MEGA 3G6VA 1P1LA 3H2UB 4NEZA 1ULRA 2XS5A 4NLUA 3M6VA 2RAQA 2JC0A 1IM6A 5LMUJ 2CQHA 3UCZP 4DX7A 4KKOA 3QJJA 4U67Q 3D6TB 2LLZA 3FFIA 2E5LF 1M5KC 1I3OB 1HNWF 3D28A 3PEHA 4WZQA 2QE5A 3VAJA 1B70B 4G65A 1R3NA 4H54A 3JAMY 3GWCA 3G71S 5D3GA 3PY8A 2J7KA 4I67A 4YHHJ 1VOMA 1XMOJ 3DRRA 1MMLA 2Y1RI 3VAFA 3MF5A 2K1RB 5AE3A 3C6TB 1TKZA 2AF6A 4RNNA 1Q78A 1AB8A 3DLEA 5CD4H 1LWCB 2BJ7A 2ZBCA 4ZHRB 1U6ZA 1FI4A 3OVAA 3Q0AA 5KFAA 4KHMA 1JMTA 1N6QA 4LR9A 1XTZA 1HMVA 2NREA 3NGKA 5DDRC 2BJ9A 4OV1A 1CJTB 3UCUP 2E9ZA 2GX8A 2UUWA 1LK5A 4JI5J 3J80U 2DNHA 4HTIA 3LF0A 1D3WA 4LF7F 4ZPBA 4FPIA 2G0JA 4DV2J 5CCMA 5IC6B 4F50A 1SJFA 4MK9A 2P6SA 5F8NA 3BR9A 2VFVA 4I0WA 3HX9A 4QZVB 3BO3A 3BBBA 3ET6B 1APSA 2MZSA 1VYAA 1VC6A 4I6AA 1AFJA 4NZ6A 4J7CA 1VLYA 5DDOC 3I5AA 4G1IA 1S9FA 3AHPA 3R3TA 1LWEA 2QA4S 1GTEA 4C2MA 1UVMA 4D3GA 3GFXA 2U2FA 2XI3A 2Z2ZA 4YDDB 2ERRA 3BS9A 2RRBA 2WVCA 4NMLA 2C3OA 1WSVA 3Q8UA 3SDEB 4DG1B 4DX5A 1QUVA 1U8WA 4JV5F 2QTWA 4D3HA 4YQWA 4LR8A 2OPPA 4BC7A 1WC1A 1NSKL 2Y1IA 4I6YA 2CG8A 3CCRS 4Q0BB 2CNNB 2ZH6A 3QIPB 2Y0SD 3DRPB 3ZTQA 4QR2A 4GKKF 4B3TJ 3MURP 1H7WA 1RWMB 3QGGA 4KYZA 3OL8A 3CULA 4GO5X 2Z8QA 4Y28C 2MKIA 2V9WA 2OP5A 1EAYC 3PCOB 3JYTB 3MEDA 4RUHA 5ADZA 1LQ9A 3T5JA 1KLNA 2XZTB 1P27B 2R8IA 5ETKA 1WACA 3ILLA 4DS5A 3HK2A 2MB0B 2VZ9A 4MJKA 1SKUB 3UR3C 2YNGA 4DZ6A 4KV8A 5D0HA 6FDRA 4ECUA 1Q1KA 1RISA 2EEYA 3SXLA 3GV5B 2PN6A 2VONA 4IG0B 4X66J 5KFFA 2UU9J 5KFOA 4DV1F 3JTOA 2LXIA 2JNJA 5LSOA 2DNLA 4C3KA 1JLFA 2R8JA 2CJQA 3T1AA 2XYPB 4LSNA 3H40A 3HPOA 3AD7C 4DUZF 4TU8A 3M8YA 2DTJA 1DTQB 1J5OA 3BYRA 1HR0F 5LMNJ 3OSNA 4DMZA 4DV0J 1YI2S 5LXRA 5F8GA 5F9LA 3UDLA 2BJDA 1IKVA 2BVZA 3UO0A 1Q5VA 2LDIA 4NLVA 1RT2B 3NMAA 3KLHA 1HWUA 1BLUA 4H4MB 5E3PA 5I3QA 4L75A 4OYMA 3HDSA 4N8OA 1REGX 4ECZA 3CIZA 4OHZA 1LEOA 1HHQA 4C8MA 4HYKA 5J2PA 4F4ZA 2Y8WA 5E3QA 1RTJA 1B64A 1L3TA 2MMYA 1NPKA 2DGVA 1C2PA 1G6BA 3HHLC 2W2QP 4USKA 1GMUA 2R8HA 2FY1A 2DH8A 4GO7X 1S76D 1SJ1A 4R0JA 4ZIVA 1UEUA 2UVRA 3H59A 3RU0A 2GVZB 1X9MA 1JKHA 4FVCA 2LCWA 2MKSA 2FJBB 2W9AA 2DNQA 2XMWA 1PBUA 3EICA 3WHIA 2HYIB 1YRXA 5GAHU 4Y00A 4C3LA 5JMNA 2W01A 3UE2A 1NB2A 3MM6B 1UVIA 1AZSB 3GU0A 4YUDA 4OYAA 4UUWA 4FYDA 3AX2A 4F3OA 1YX2A 1HNIA 4HT7A 1HYSB 4OJGA 1F1BB 2XNRA 2IM3A 2CPDA 3P45B 5THWA 1WORA 4MKYA 2Z56B 4URGA 3J81j 3IG1A 3GIKA 1N36J 4ECSA 4J5OA 5HO4A 4UTGA 3AOCA 5KAKA 2A6MA 3NGTA 1GEHA 2W24A 1X4BA 2F9DA 3WC2A 5M2PA 1DQAA 4WK3A 5A6PA 2FVQA 1VCTA 1Z1ZA 3OVSA 2ZOFA 1TFYA 3G6ES 3Q8VA 3J81Y 2CPEA 3IM8A 3LP0A 3NNAA 4E2FB 2VFUA 2JX2A 2VQFJ 2LQ5A 2JDJA 1FK9B 3TJ8A 2G4BA 1RAAB 1S9GB 5M2RA 4P74A 2YPZA 5D4NA 3OFGA 4ILRA 3HJVA 1VK3A 1T9WA 4RNOA 2I8EA 1TQLA 2E9TA 4ES2A 4NCGA 1WF2A 4CLKA 2ZJPQ 4FDFA 4LF9F 2NYHA 3OTDA 1MROB 2N82B 2V0NA 3PKMA 2V8VA 1T95A 4V19J 1VMBA 1VQOS 3SZ2A 2WSEC 2BKPA 1LOUA 2Z57B 4LQ9A 3IS9B 2Y1JA 2ZM6J 3ETOA 2VBWA 3DI6A 3HFKA 3AA9A 4OI4A 5BJRA 1JWWA 5EWFA 4KH1B 1RWKB 3BGRA 2ZC3A 3GFYA 1S97A 4LF1A 3TO8A 1Q4RA 1RZMA 5EN1A 2IY5B 4IRCA 2EPIA 2POKA 1YWXA 1S7IA 1D09B 2ASLA 1U1LA 2MQ8A 3EJMA 4PG8A 1F2HA 2N7YA 3L7UA 2A0FB 4ZPWR 1YK9A 3AFGA 2UUBF 3WC0A 2MQNA 4PYDA 4B3SJ 3TW0A 5AXKA 2VOPA 1L3KA 5EDWA 3UN2A 2W9BA 4N5SA 1Y3JA 2OMOA 3EMTA 1MSWD 2V1TA 4ECYA 4CP5A 3OR1A 1D9AA 3BSOA 3JTNA 3VGUA 2QEXS 5EGYA 4ED8A 2IVYA 3EE3A 4AYBD 2V2VA 1EHWA 3N9UC 1NHKL 3GP9A 1N48A 2X1BA 1QTMA 1FFWB 1RT4A 3G82A 2YX1A 2M7SA 4O44A 4PG7A 1S77D 3WIUA 1BUXA 3KK2A 1W7WA 1JLEA 2HHPA 3H2LA 3H5UA 1X4CA 3BSCA 1U1RA 2LQBA 2IRUA 2LYVA 4DF4A 2DGOA 3FZBA 4V19X 1RYSA 1OPIA 2FLPA 4AL6A 1N33J 5IXUA 3A8IA 4HHJA 4AE5A 2WSCC 1YBAA 2FVSA 1NRKA 3KLEB 2DNMA 1RTHA 3TANA 3V2UC 1WOPA 1KFDA 1FJ7A 3TARA 2B5JB 3HT0A 5F8MA 1HWIA 2XS7A 1PYSB 2ZEJA 1K8AT 2FHJD 3TX8A 1TMMA 3DGPB 1RT3A 2J9CA 2ROGA 3I96A 2FJXA 3CT9A 2FUG9 3A8JA 1HNZJ 4NLWA 1HQEB 2CQDA 3TQEA 1OJ4A 4NRTA 2VFTA 3LP2B 3ZNUA 1OS5A 1VJWA 2RNEA 3R6LB 4AL7A 1T7PA 2HVZA 2E1MC 2GIFA 4J9KA 3DKDA 4E0DA 5GAHI 3IWNC 3CJ4A 2VIHA 4PYAA 3RB3A 2W7AA 4OI2A 1U2RA 3CJ0A 3UN3A 4FYWB 5KFJA 3QNWB 1IQTA 2OSQA 3BGFA 1B7FA 3O5TB 3CMQA 3GV8B 2VQEF 4LSLB 4NZ0A 3NGSA 1IKYB 1KR4A 2FPHX 3D1OA 1FE0A 1XN9A 1YRUA 3V81A 3DHXA 3P49B 4DR3F 4C98A 4ERDA 2JEIA 1IBMJ 2HBYB 2AEMA 3T1HJ 4I69A 4ZVRB 3C19A 2BE9B 3SCLE 5KFMA 2OPQB 3FMWA 5H9EK 2OTJS 3B78A 2BQRA 1FKAF 2LP4A 4JI6J 1M5PC 3CDBA 3QGHA 3CCES 2MHEA 2YWFA 3PO5A 4TY8A 4C8OA 1QUPA 1KQGB 2BDPA 3FCWA 4K0KF 1OO0B 3I87A 1RA7A 3QFWA 2F65A 3ITHB 3KJFB 2DHGA 1NPRA 2Z2MA 4B17A 1Y11A 1KQFB 5C5JA 2GJFA 4FYXB 2ASDA 4Q44A 2M88A 1C0TB 3W2WA 1SH0A 3MM5A 3V4MA 1EX8A 4ITSA 2BEFA 2DHAA 2ZH9A 3SFGA 2CZ9A 1S48A 1KLMB 2ZUGA 1F0XA 2Y8YA 5L46A 2KH9A 1FEHA 5IV4A 2KYZA 2VA3A 4DLGA 3OR2A 4O4GB 2DBBA 2DGQA 4UW2A 1IBCB 1NK5A 4DR4J 2CUYA 5K8NA 1QSSA 2L9DA 4KJIA 4UQGA 2XMAA 4RO0A 3F41A 4NLQA 4PWDA 4DPUA 3HSGA 4A8OA 1RHRB 1X5SA 5L1JA 3TEGA 3MM8A 2AT1B 3U02A 4N56A 4HACA 3GMGA 1BXNA 2A10A 2GA7A 4USVA 1TV6A 1YJRA 4WP9A 1F5AA 5EHHA 5A8WB 2JSXA 3MEEB 3CD6S 3MD1A 4N47A 4F02A 4EO8A 2G2ZA 4X4QA 3AQPA 1HQUA 2RUSA 1S6PA 2OMLA 3MMCB 4F25A 5L1LA 3R9LA 2ZJQQ 3IFEA 5H9FK 5SUHA 1Y5LB 3LQVA 4RW7B 2QZ8A 3TAMB 2VC0A 5CYQB 4LIWA 3VAGA 2FVRA 2QA1A 1HI0P 2CQBA 4YOEA 4CNYA 3Q86A 1HNVB 4URSA 7AT1B 2VL1A 1SC3B 4O0IA 4OV6A 4RW4B 5T41A 1HD0A 8RUCA 3UDCA 1Q8KA 1S1TB 2MJUA 4X64J 4W90B 2G2YA 4DWIA 1NK6A 4XO0A 1ZAVA 5KFVA 2BA9A 5J2NA 5CHCB 2VA2A 3LGHA 2BW2A 2CNOB 4CIOA 4NL5A 2B4VA 4F4XA 1WC3A 2CQCA 4E8UA 3IRWP 4NA3A 3G9CA 1DBDA 4FBTA 4RU2A 3R27A 2AW0A 3KK3B 3MR3A 4ZP9A 3GYGA 4K59A 2DIVA 3NAIA 5ETQA 3CJ8A 5J2QA 4NLOA 3RAXA 1K73T 2M3DA 4KQZA 3I0SA 3T6BA 2E29A 2WW4A 2XZ2A 3CCLS 4CTAB 3DOMB 1G2EA 2ACMA 6AT1B 3JXOA 4LSZB 3I55S 5A8KB 5HJXA 4LFBF 1VQ7S 1TAUA 3MAHA 4HDHA 1WC6A 2HWHA 2XB2D 1H73A 3NCPA 1QTNB 2WONB 2K3IA 1CQMA 1FVSA 2UUTA 2B43A 1UVJA 3W2VA 1WKKA 3AQOA 3PXGa 3VZIA 1HIYA 3GJQB 2J76E 2B0GA 4B9SA 2P9CA 3UW1A 4YEAA 3TUPA 2DRBA 2RJZA 5JJBA 3IBWA 2X3DA 2B7CB 5B08A 2UUAF 3CIMA 1Y5NB 2FLNA 5IT9U 3NEKA 1T05B 2QL5B 3QZ8A 5FLXY 1UCNA 4PPDA 1N5YA 4NXNF 2G1HA 1RB0A 3QBCA 3OXLA 4KHPJ 5DDPC 2Z2LA 5K20B 1TL1A 1BQMA 3KK1B 1M5VC 1ZZFA 3HSZA 1P6TA 1M5OC 4JI3J 8AT1B 3MDFA 3KHHA 3MPYA 1NPPA 2BOPA 4JV1A 2HW3A 1VQ8S 3ZTRA 4F4WA 2YNHA 3K5NA 1CS4A 2FJWA 4JI2F 4NASA 1KVKA 3GE9A 4GKJF 2D69A 2I2YA 3ZO7A 1JLCB 3O44A 4DR7J 3M8SA 3CJQA 5GADI 3IR7B 1PAUB 4DV6J 3E01B 1WSRA 3NWRA 3M7VA 2HQIA 2VD3A 2HFUA 2D41A 2HZAA 1X0FA 3JQMA 4QIEA 1ICEB 3UR0A 2KT3A 5IC4B 4ZVSB 1RTIB 3CDAA 1M1GA 4P7TA 1S1UB 4RBVA 3TZYA 5J1PA 4ED2A 3GR0A 2NUHA 4IO1A 2YKAA 3BV8A 2YWEA 3KLFA 1QAJA 3D4JA 3MMJA 3Q23A 3KG0A 2R2TA 2HAFA 1H74A 4EWTA 2HQCA 3H5SA 2N3OA 2LECA 2HHSA 1TKTB 2ZHBA 1Q16B 1XJWB 3UQSA 1C1CB 2YNFA 4OX9J 2PE8A 2NYIA 1YZ7A 1HPZB 3C16A 3THPA 1CJVA 4FYYB 3B6BA 4TU9A 3TRGA 3ZTOA 1NZ8A 4LRCA 4OYPA 4M5DB 3GIMA 5ETPA 2PA8D 1NK7A 2KZMA 1RP5A 4DU7A 2R7WA 2QL7B 4I2QB 2JVOA 3VV2B 4J9NA 1XK8A 1Q0NA 3W9JA 1HW8A 2HBZB 5DQHA 4GC6A 2UZAA 2YTCA 3BSAA 5F3ZA 2GHWA 4WJBA 4E98A 1OSDA 1GNKA 2LFVA 5L38A 1EP4B 2HPUA 3MMBB 2WOMB 3TVKA 4Q2MA 2ZBPA 2AZ3A 1FWKA 4ZVOB 1ZPVA 4KFBA 1RHUB 3Q8SB 1OY8A 2D7SA 4IFVB 4USMA 2CDRB 2FZGB 2EWHA 3BBFA 5K9FA 5IZHA 4OYOA 4QW8A 3DM2B 2X1FA 3J80Y 1OPZA 1WI6A 5KFYA 2VJUA 2VBYA 3PFEA 1SIZA 5KFHA 4H4OA 1X7VA 2OELA 4A4JA 4OIXA 3HFVA 4EBDA 1D9FA 1N34J 3GJSB 3DOLA 2MQQA 4A48A 2FY8A 2NPFA 3QGIA 4NYOA 2XO7A 3Q22A 4QYZK 3HXMA 1OWXA 1RHKB 3FZ2A 3MAAA 2MJNA 3CC7S 4WKRA 3CCZA 4ZLJA 2NQPA 1YG0A 1X5PA 4WU3A 4HKQA 2NZCA 3W9HA 4KGXB 3RZAA 1QE1A 1DARA 5DZ7A 4Y0FA 1P9YA 5FDLB 4FF4A 2YWKA 3T19A 3M2VB 2FZKB 4EO6A 2YKNA 2K2PA 2RS2A 2UV8A 3PRBA 4Q43A 1LW2B 3DDKA 4DL5A 4CH7A 4MTPA 4M8LA 3S7RA 2YXLA 2YWGA 4P72A 4MYUA 3SQOP 4DF8A 1YJTA 4IUFA 2C28A 2FD2A 4N7TA 2KJVA 4X4VA 1N5QA 1XEZA 3DOKA 2CJXB 2XMTA 4LRDA 3I0RB 5GMKa 1ZM3A 3ISND 5D0RA 1ITPA 2DGUA 4DFPA 3UI3A 4FVMA 3CXCR 4Q8FA 4B3OB 2ZBIA 4USJC 2NCKL 4ZVUB 4GVBB 3EXYA 3FBBA 1LFPA 3MECB 1ZTWA 4KGZB 2K06A 3QJLA 2VG6B 6FD1A 1PILA 3QAUA 1SC4B 3CCWA 3GYXB 4J37A 2CPYA 2EFNA 1FNXH 4AL5A 1YTYA 3UDVA 3V6DB 4Y34A 4DFMA 1VHFA 1N88A 3W65A 5KFIA 1AFIA 3RG6A 2IYIA 1HW9A 3ZZUA 1FX4A 3KLVA 4DR6J 3BYPA 4DHVA 2Y3YA 3D67A 4R0EA 3C15A 4DOZA 3PJXA 1FDBA 4ECWA 1R7IA 3GIJA 1MG7A 4F2RA 2W4PA 1GXLA 4C0OC 2PC6A 4RBUA 4C8LA 2Q3PA 5ETVA 5C24B 4DX6A 1FX2A 2V8PA 5KT7A 2CDQA 1VFJA 3M9MB 2OO4A 4ZKAA 4TLQA 3E3XA 3DMJA 2GO9A 4C11B 1TL5A 4ER8A 2K7JA 4WFZA 4CO2A 1FNMA 1K47A 3MM9B 3I5BA 3EDQB 3FSXA 4EBEA 1ACMB 4X2BA 5T7LB 1Y00A 3AY0A 1IM4A 2PFDA 5KG2A 4DCOB 1DY3A 1SXLA 2FQQB 3W1YC 2BM0A 4L72B 2CAJA 4WBFA 2V4JA 2GC8A 2XTEA 2RH3A 3IA0A 3K5OA 1Q81T 3IP0A 3NBPB 4ID5B 2XSFA 2DR9A 1HBNA 1RWOB 3O8WA 2ZZMA 3G8QA 4DPOA 1IQZA 2BABA 1NMEB 3TA0A 4CYUA 3KUEA 1SB6A 1V3SA 4WXWA 1SKWA 4ZITA 4ZPCA 1WEYA 1UVKA 4M5GA 5ITHA 5DJBA 1I94J 4DX8H 1S1VA 3VAMA 4PPZA 1GFWB 3WDOA 2JJ4D 1TTHB 2BRLA 4K4WA 1DQ9A 2DKOB 3MPUB 1X9WA 2DR7A 1OY9A 5C42B 3ENAA 1I1GA 4QPXA 4A8KA 4ZLNA 1Y3KA 4PUOA 1VR6A 4KC5A 2B9YA 3GR1A 2MTLA 2MDAA 2V8DA 4YHHF 2QIFA 4WP3A 3ZC4A 1ROFA 1E6VA 3W61A 4WFYA 3BO2A 1FEEA 4QWAA 2KT2A 1CVJA 5A8RB 2IBKA 2DB1A 1G3OA 1XIQA 1JK9B 1RWPB 3BEGB 2XC9A 1MW7A 1VJQA 1FE4A 2JEJA 4LF6J 3SCIE 4OLOA 2ZBQA 3NRBA 5D3GB 5L1IA 1S0MA 4X62F 9ATCB 1JLBA 3DRRB 4IOBA 3W60A 2BKNA 4ZVPB 3FSYA 3TA1A 1TP7A 1UWBA 2H3EB 4JI5F 2FHOB 2Z58B 1IR2A 2XULA 4DV5F 5DG9A 4CDIA 1S1XB 2IM1A 2NSBA 1F60B 5C2CA 3FNNA 1XR5A 5KG0A 3IN5A 2XY6A 1FRKA 1KNZA 2PO4A 3PR5B 3CJRA 3JSYA 1N6QB 2HRYA 1HMVB 4OJ3A 4B3RJ 2ZKTA 5HMXA 2E5IA 2EKNA 3VGVA 1QM9A 2VG5A 3NNHA 3EYZA 5KFCA 2MQOA 1HD1A 4OQJA 4DSJA 4JYAJ 3Q24A 1VHIA 3HVAA 4FKYA 4NE9C 2HHHF 2YBVA 1U02A 4L3KA 2JHEA 4DSEA 4A8YA 4ZPVR 1N56A 4X4NA 1URNA 4NI2A 2WTFA 5AXNA 1VS3A 2ATCB 3QIDA 2OD4A 4ID8A 1SQFA 2HFSA 1KSPA 2UXBJ 1QJHA 2MSSA 4YB7A 1LFWA 4CZCA 4CLLA 5DLGA 1X9SA 3KUGA 5DRKA 4USTA 3VQTA 3UPFA 5GVQA 3RGIA 1V6HA 3HMJG 1VQMS 1S59A 2PMWA 3HF5A 2NXNA 1SVDA 1U49A 2C2EA 4WWSA 3S01A 4BWJA 1NSQA 3BPDA 1RAJA 1U0HA 1IBLJ 3BB5A 3K5LA 4RW6A 1FRLA 3NCRA 4OI0A 4ANDA 2MGZB 5K14A 3KDOA 1LW0B 2BE2A 2PT0A 1DLOA 1PJ6A 2L41A 2NXUA 1HL6A 1BHNA 5C25A 4ZPAA 3TZWA 2YNIB 3ZFVA 1UZHA 1VRUB 4OHWA 3H25A 3OVBA 3HM9A 2BW7A 3FEZA 3RW7A 4NOHA 3MEDB 2GHVC 5CZVA 4LIRA 2H1YA 3TZZA 1XR6A 2HVEA 2DCLA 2LU2A 3G96A 1NO8A 4OZNA 3CCSS 2AJ4A 2UU9F 2EFGA 4NXMJ 1CJKA 2NZ4A 5HQ8A 4OZ1A 5CXTA 2J8AA 2YNGB 4LRBA 2X7IA 3T9NA 3MR6A 2CA9A 3HULA 1OSCA 2F5GA 2QLJB 5LMNF 3OW2R 1M1HA 4DV0F 1R0BG 3T41A 3QT6A 3AOBA 2JEFA 4PABA 2WRMA 3GILA 1KTQA 1H98A 1IBKJ 3OXFA 3BSNA 3H0PA 3BKFA 2E5LJ 2VUGA 3C6TA 2CXEA 3DN9A 3H98A 1S9EA 3FBCA 3TP2A 4TYBA 4TN2A 2DK2A 2C1EB 1RWNB 4KY3A 4ZHRA 1KOOA 2GV1A 3TAPA 1KONA 2OFGX 2UVUA 2W7PA 4KE5A 3V6JA 3D68A 1IKVB 3HKZD 5KFEA 4ZVHA 1CJTA 2XGPA 2RU3A 2YKOA 1W26A 2MKCA 2XI2A 2P5VA 4JI4F 3C3LA 2ZDPA 3HFZB 2PIIA 1YJVA 2H48B 2B9WA 1ELOA 2DNYA 4F0MA 3FQLA 3THVA 4OHYA 2L9WA 1NK8A 3RUBL 5K8MA 3D6MB 1JKHB 3GFZA 2FC8A 4BHQA 2ZVSA 3A8EA 4I2PA 3HHEA 4X84A 1N36F 3AX5A 4LF7J 4ZS6A 1PC5A 1WG1A 5CYMA 4P73A 1FRJA 4K4YA 1Q53A 3IRXB 4CO5A 4IG3B 2OPRB 3FDSA 2DNRA 5HVHA 4ES3A 3US5A 1LXNA 2MEWA 4QR0A 1UW9A 1EETB 4MK8A 4F67A 4AXJA 3SDEA 4DG1A 2V2ZA 2ACYA 5KG7A 4RNHA 3IG1B 4QYRA 1T9TA 2EFQA 4EBCA 1MMDA 2RKIA 3F73A 4MKBA 1JQGA 4F8RA 3PV8A 2C3MA 3RBXA 1CBKA 1PYOB 4CO0A 1UW4A 1WC0A 3QIPA 3DRPA 2VKRA 2R7RA 3CGIA 2WB1D 2ZHOA 1SH3A 4M5NA 2OI2A 4JV5J 5HQMA 3E8OA 1BWEA 4W4MA 2VPYB 4F26A 3JYTA 2J6UA 1NLKL 2CVIA 2AEJA 1B4SA 2IMWP 1T0TV 2FTRA 1T02A 1UTAA 1NUEA 4RKUC 1R0AA 1KTVA 4GKKJ 3CWJA 2QA4G 3THTA 4NCGB 2W8KA 1PIEA 2MLXA 1MWQA 3L7OA 1T3OA 5D4LA 1S6QA 3P5TL 2HLTA 2BANB 1V3RA 3WQPA 3EGNA 2FZCB 2HK3A 3M6XA 2I1RA 4CWBA 1HWKA 2KG0A 4OZ3A 4IG0A 1RHJB 1S12A 2FLOA 1M90T 3CMAS 4RW9B 3SSRA 4B9LA 1HWLA 2IJNA 3NAHA 4O3RA 1AXQA 3DRYA 2CJKA 2YPYA 2CG4A 4P9SA 2AKWB 3BGRB 4ECQA 4K4TA 4F0KA 1PJ7A 2W2PP 4B3SF 3BPSP 4IFYA 3R2CJ 2FHJA 3N79A 1DTQA 3V6KA 3K5PA 2ZVIA 2WVEA 1PC4A 5HAOA 4IKAA 1Q7LB 1FVQA 3KDNA 2WK4A 3M30B 2CNLB 1RT2A 2PD1A 4PG5A 5DS7A 4H4MA 4LF4J 3QLHB 2F1FA 1RKJA 1UJ5A 4JB8B 1H6KX 1S5ZA 1RBLA 4DUZJ 2DNZA 4FP9A 5G4DA 4LR7A 1R8HA 2PSZA 4CLFA 3LW5C 1WTBA 2W9BB 5L9XA 2ZOGA 1X31C 5KG4A 1FRIA 5L1KA 1F3FA 2GVZA 3R7SB 1FTCA 3GSIA 4ZLLA 2YX4A 1WHVA 2XG8A 3FUYA 4MAKA 2V94A 1N33F 2KVIA 1UA0A 2XCPA 2BUNA 3C66A 2ZH3A 1WEZA 1N5SA 2VODA 3MM6A 3HZEA 1N0VC 1CSJA 2C2OB 2CQ0A 1HQ2A 1F6TA 4IDKB 3KK2B 2W4CA 3CEDA 4ECTA 1PJ5A 1RBOB 4B08A 1ZTTA 5IWAJ 5C2GA 9RUBA 1XNRJ 2KN4A 5B0DA 2LQJA 4JOUA 2KXNB 1RABB 3GLJA 1NB7A 5HVFA 1QD1A 2CVEA 1HNZF 4K5RA 2J0WA 2GFFA 2OKQA 1F5BA 5LT5A 4I1TA 4JI8J 3QFHA 3EXCX 1IXKA 2EC0A 2BX6A 4LRAA 2R8KA 1ZAXA 2ZH8A 2AGPA 1O8BA 2J7WA 2AJQA 2RRAA 1ZZNA 1RT3B 3ENQA 4PQAA 5IT9Y 5LXYA 4TYAA 2DNPA 4Q8EA 3ULHA 1F3VA 1VQNS 2ZOMA 2AQ4A 3JSBA 1O0PA 3GIRA 4B9TA 1MN9A 3BDEA 3CDUA 3IC1A 2U1AA 4CLWA 4HEA9 4WIQA 3ZNJ1 1YJ9S 1IVZA 1WC4A 4P2SA 4ELTA 1T9XA 3LWMA 5B0GA 4YY3F 2YKQA 1FWPA 4EZ9A 3QMQA 1IBMF 5T14A 3T1HF 2XCAA 4YB6A 4O3OA 2UUCF 1U24A 2YKMB 3EGZA 1GH8A 4J9RA 3D3CJ 2QN6B 3B4MA 4DZDA 2RIJA 3CNQP 3P3DA 1F9HA 1TELA 4YP3A 2BQ3A 1K1QA 4DPTA 4XIUA 1BGXT 3IS9A 1WKLA 5D15A 4S0MA 2CIMA 3A13A 3KNAA 4CO4A 2XSJB 2XMJA 4LF9J 5HBMB 3RR7A 1L5UA 2B9EA 2GAGC 2AGQA 4LFCF 1XC9A 2YH0A 3NXZA 2M2BA 2KRBA 2C3UA 3VWSA 1EQMA 2DY1A 2HQGA 2J0SD 5BR8J 3R5CA 5KFGA 2GO8A 2X1AA 2LA4A 3CCMS 1P8GA 3K89A 4KT0C 2VKZG 3PEJA 2WVBA 5D77A 1QVFR 5CYJA 2HQ3A 4RJVA 2ZE2B 3AJ1A 2CPZA 1UVLA 1S6UA 3DLBA 4QWCA 1I6JA 2UUBJ 3QYYA 4QIGA 3D66A 3PDNA 2DJWA 1TU0B 5ETTA 3OBIA 4JUZA 2IDLA 4X4SA 4EMDA 1JIHA 3RB6A 1KHWA 2PMHA 4WCEQ 1ZA1B 1S72S 4Y6IA 2DGWA 2HIQA 4K8RA 4YB1P 2JWNA 3MGJA 2RF2B 4A8MP 5MAOA 2QC3A 2OEKA 3CPWR 1CLFA 4IH6A 4KPCA 3HCXA 4K4SA 2ILYA 2HFNA 2E1AA 2JC1A 3M2UA 1FT8A 3M1VB 4L73A 3GCWP 2EBEA 3KJQB 2HGLA 4C8KA 3FEXB 1BMQB 5HP1B 2BM1A 2IVFB 3CO0P 2B8PA 1PBAA 1RE1B 4LBHA 1WG4A 1NU4A 1R0CB 4WFXA 3DGPA 1NDLA 1Y10A 1FKOA 5KFNA 4XTTA 4X64F 2CRLA 1HQEA 2UXCF 4ILLA 2ROEA 3LP2A 4FN5A 2BXJA 3PW4A 3ZZTA 2J7UA 2Z30B 5E3AA 5GAEU 3CJ2A 1ZH5A 1Z4UA 3ZZYA 3OV7A 3SFUA 3RB4A 2MXYA 4JV0A 1WHWA 1UJ6A 1FERA 2NS1B 1NJYA 4C0HA 4NLXA 4FNHA 2X3GA 3CJ5A 4M5LA 2XYGB 1DHMA 1FO1A 4I7FB 2M8DB 1KOHA 4RPFA 1S4EA 1IKYA 1NNDA 1BQNB 4HTJA 2HWTA 5E7OB 4HVZA 3P96A 2CJAA 4EI2A 1VQ9S 5J2MA 5A2QU 2QYCA 2XWYA 1GAOA 5HVGA 4TVAB 2OPQA 2CFXA 2AYMA 4ED6A 2VQEJ 3IBCB 3N28A 2CQGA 5J2QB 2CWXA 2D9OA 2P6TA 1SC1B 2FJDB 3R8YA 3O6QA 3JSMB 2W4DA 3PYGA 4PKDB 1CJUB 4ANCA 1VQ5S 3ITHA 5I3UB 4I6WA 3DLHA 1UPPA 2RQKA 3DU6A 5DG8A 3C14B 5BYSA 5AJ3J 4OI6A 4LJMA 5KG1A 2V68A 1C0TA 1BY9A 4CO3A 1H2UX 3UVJA 4NLSA 2W9CB 2OEMA 1V3ZA 1KLMA 2D9PA 2AHOB 2G0CA 5IT4A 4CNZA 3DLGB 2KTQA 3RW6A 4KBIA 3Q83A 1KFSA 4F4YA 3AXKA 4KHPF 1UFWA 4H4KA 4DEZA 4NLYA 3G86A 4JI3F 4HI2A 1RAFB 2IM2A 1GT8A 2H5EA 5DGBA 1K9MT 1RAEB 2DD8S 4ZVQB 2VOOA 1L3UA 4ZVEA 1Q5YA 4IRDA 4ATNA 4IOCQ 4DR1J 4U8VA 4V1Ak 2DVIA 3PFOA 3MMAA 1JNZB 1FKPB 3PNIA 3VTIA 4TXSA 4LFAF 1VBZA 3I32A 3DLKB 5KG6A 2ZWPA 2IAJA 3IO1A 4N76A 1TL1B 3Q8QB 2HSEB 1X8DA 3O3LA 4F4KA 2F8EX 1M1KT 2PDAA 2Z2YB 5A8WA 3T3FA 3MEEA 3C6UB 1VC5A 2XYHB 4Y2IA 2YNHB 2WW8A 2CWKA 1VC0A 2V4RA 3CO9A 4ZIWA 3MMCA 5ETRA 1KC8T 3PYDA 1WELA 5HQLA 1VQKS 2EVZA 4PG4A 1MNEA 1RT7A 3SMZA 3KJVB 4LBPA 5CYQA 4YFUA 3IWXA 3UD5A 3ZZ0A 2HNZB 1IN0A 1CG2A 3FMBA 3EZ5A 1UETA 2IM0A 3OTOF 3KLGA 4OYBA 1U1PA 1KHVA 5E3CA 1IKWB 1NDCA 2GNKA 3GB0A 2CPXA 2V4QA 3OTCA 3I4HX 3ENVA 5F8LA 3C8YA 2ZWOA 2AP6A 2VH7A 1U4BA 1S7HA 2F40A 3FKBA 3AB2B 4C6AA 3ONQA 4O23A 1FFGB 2NR0A 3WX4A 1NXIA 1C4CA 3MWBA 3CD7A 4P52A 2NXJA 1KDNA 3R5DA 4HH0A 1JLAB 1RJJA 1ZA2B 4ETZA 1XNQF 1JLGB 2DXDA 4WPAA 3UN5A 1SH2A 3VQSA 3KK3A 1Y7PA 3H2VE 1RBAA 4FXVA 1DTTA 4OHXA 3A3OB 4TU7A 2O1PA 2K3KA 2XTCA 1UMJA 4ED4A 2HBQB 2DH9A 2RB7A 3NLCA 4CTAA 3DOMA 4EYHB 2XMVA 5A8KA 1C0UB 1D8YA 2FIUA 4DCJB 5GAEI 5FD1A 3EDRB 2OH2A 3A8KA 1TK0A 2WONA 1O6XA 4HH1A 1J5EF 3QATA 2DGSA 4DL6A 3VAKA 4OYIA 2HK2A 1K0TA 5HN0A 3PJ9A 1S6OA 4J9PA 4RU9A 4FPRA 5HROB 2GJIA 1UWAA 4C97A 2FVPA 1CULB 2HKEA 4CM0A 2BE7D 4ZLPA 4UOHA 2RT3A 2VU5A 4OYXA 5KFSA 2ABYA 4ZK7M 3CTRA 2AV5A 4W92B 3OSPA 3R7BB 1LWFB 1T05A 3EVOA 2J9EA 2R7UA 1Z2LA 2C42A 2GIRA 4I64A 1TL7A 4IRKA 2CKWA 1B99A 1TFWA 4C0BA 4CLYA 4FS1A 2N4DA 1SUQB 4KGVB 4LF8F 2V2QA 3A3NB 2IC3B 2RSQA 2GAHC 1NDKA 3QZ7A 2OFHX 3U1MA 1UEKA 4FYVB 2UUAJ 2KYXA 1K0VA 3FGVA 1RWXB 2E9RX 3GTYX 4LUBA 4QCLA 1X0PA 3CJTA 2FDNA 1UEVA 1KS2A 4ZJLA 2XTJP 4NXNJ 4QBUA 2PEBA 5L9NA 2BKOA 2CNKB 4CLZA 4NLTA 4J9LA 3D6HB 2DY9A 4WFBQ 1RAGB 1U6BA 4A8WA 3VALA 1V5VA 3CJ3A 2BJ3A 1JLCA 3OFHA 2R3VA 3X1LB 1TUWA 3BBCA 1VI7A 3E01A 3R7NB 4LBIA 3LA0A 3ZTPA 4CLUA 3DNCA 4AD6A 1WDDA 2UXDJ 2QMXA 1FD2A 4B3MF 4N8NA
chains in the Genus database with same CATH topology
2CDQA 2PMZD 1VFJA 1RTIA 2YKNB 3M9MB 2OO4A 4ZKAA 1F5CA 1YITS 4TLQA 2AJ1A 3UFCX 3JAMY 3E3XA 3DMJA 4WYLA 2W9CA 1S1UA 2GO9A 1MWZA 4C11B 3GWCA 1WG5A 3G71S 5K8OA 5L39A 1TL5A 4A8QA 1GXTA 1HI1A 2K7JA 2GMHA 3OFFA 3PY8A 5D3GA 4WFZA 1U6FA 1WWHA 2J7KA 1QLNA 4CO2A 1FNMA 4FXWA 3MM9B 4I67A 3I5BA 4ICLB 3DLGA 1WEXA 3FSXA 3GYNA 4EBEA 1VOMA 2VQFF 4K5SA 4MH8A 3DRRA 1MMLA 4B9UA 3Q2TC 2Y1RI 3VAFA 4X2BA 2K1RB 3MF5A 5T7LB 1S0NA 3NCQA 3S1TA 4Q0BA 1Y00A 3C6TB 3QWPA 5AE3A 3AY0A 2ZH5A 1IM4A 1TKZA 2LA6A 5KG2A 2XZWA 1HNXF 2AF6A 4RNNA 1Q78A 2KKHA 1O5JA 5F0WA 3DLEA 5CD4H 4TY9A 1LWCB 1SXLA 1KRPA 1TZ0A 2ZBCA 2BM0A 4L72B 3DOKB 2V4JA 3RR8A 2IJFA 2GC8A 2XTEA 1X4GA 2ZDOA 4GC7A 1M5KC 3TVYA 2B51A 2RH3A 3IA0A 3K5OA 4ZHRB 1QSLA 1U6ZA 1Q81T 2QMWA 5KFXA 3NBPB 2JRSA 4ID5B 5HLFB 3OVAA 1TKTA 3Q0AA 4DFJA 2XSFA 5KFAA 1HBNA 4KHMA 3J7ZT 5I42A 2DR9A 2JOQA 1HBOA 3LP0B 1JMTA 3JB9k 1FKPA 1NH8A 4F3MA 3O8WA 1N6QA 2ZZMA 3BN7A 3DLKA 2DHSA 3G8QA 1XTZA 4G1PA 1HMVA 4DPOA 2NREA 3NGKA 1IQZA 1NK9A 1CPZA 2V9KA 5DDRC 2BABA 3TA0A 4ZCLA 4BDPA 4OV1A 2FHMA 1Q86T 4KSEB 1SB6A 3UCUP 3MZIA 2E9ZA 1V3SA 2GX8A 4WXWA 3POTB 2UUWA 1SKWA 1LK5A 4ZP7A 4ZPCA 5GAGI 2Z4PA 1WEYA 3PM9A 1UVKA 2DNHA 4HTIA 4CO1A 3M9NB 3LF0A 1D3WA 1N52B 4FNIA 4XPEA 4ZPBA 4LF7F 1FXRA 4JV2A 5ITHA 2R7SA 5DJBA 4HI1A 2ZH1A 4DX8H 1S1VA 3VAMA 2B3TB 4PPZA 2ZNZA 4M94A 3WDOA 3N6NA 2WAQD 1YJNS 2BR0A 2MKJA 5B0BA 3K7RA 3C6UA 5JXSA 2JJ4D 1NEEA 2ZM6F 4HL9A 1K1SA 2BRLA 3E51A 5CCMA 5DM6Q 4F50A 4K4WA 1SJFA 1TVRB 5LJ5Y 1DQ9A 2BYCA 4MK9A 2UXDF 2P6SA 2HHVA 5F8NA 4I2QA 2MQPA 1X9WA 3BR9A 2DR7A 5C42B 2VFVA 2AYEA 4I0WA 4DL7A 1I1GA 3HX9A 3PW5A 1YRTA 2B9XA 2L48A 2N3LA 4QZVB 3BO3A 2ZNYA 4QPXA 4A8KA 1T03B 2EI5A 3OLAA 1APSA 2MZSA 5A6WA 1Y3KA 2EKYA 1VC6A 4I6AA 2F4VF 2W7OA 1AFJA 4ZDNA 4NZ6A 3NL0A 7FD1A 2VPZB 4PUOA 3DYAA 1VLYA 2CJ9A 4KC5A 3SCKE 5DDOC 3I5AA 2B56A 2B9YA 3GR1A 3MPVA 4G1IA 1UVNA 1S9FA 3AHPA 3KJVA 3R3TA 1LWEA 2QA4S 2MDAA 2V8DA 4YHHF 2AJFE 2QIFA