4NLSA

Poliovirus polymerase - s288a loop mutant
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPAGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
total genus 140
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nlsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nlsA02
3KLVA 2IC3A 4I2PA 3KHGA 2W7OA 4R5PA 1S48A 1ZETA 1JIHA 2AGOA 1N6QB 4WFZA 2AGQA 1S1TB 1TL3A 3GIKA 3V81B 1RA7A 2BQRA 3RAQA 5DGBA 5KFHA 4M94A 3BSCA 3LP0A 3OSNA 4ED1A 4ZPCA 2BANA 1T05B 1RT5A 1RT1B 1S0MA 4EO6A 4ZMMA 3DLEB 4TLRA 2ZD1A 3MR3A 4O4GA 2XGQA 3CJ2A 1MMLA 4TY8A 3HHKA 5C24A 3LP2A 3DDKA 2IM3A 1IM4A 4RW6B 1KHVA 2UUWA 1RT6A 4ICLB 1IKXA 2OPQB 2RF2A 5KFIA 3PW4A 3GIJA 2W9CB 3CO9A 5J2NB 1TVRB 3I5CA 3RB0A 4NLQA 5C5JA 4H4OB 3V6HA 2QE5A 1EP4B 1NHUA 2XC9A 5EWGA 1KLMB 5I42A 4LQ3A 4EBCA 2B5JB 4F4ZA 2EC0A 3C6TB 3KLIA 3KK1A 5I3UA 5D3GA 4ZVGA 1R0AB 5K14B 1HNIB 2FLNA 4J9QA 1QUVA 2WOMA 4NCGB 4WE1B 3KK3A 3H4BA 1TKXA 4YR2A 5KFTA 3UPFA 1RT4B 4XPEA 2XGPA 1DTTA 3CDUA 1QE1A 1JLGB 1TKTB 5KFCA 5KT4A 3QIPB 5DLGA 2O5DA 1K1QA 4I7FA 1RAJA 3DMJA 3BSAA 1MU2A 4Y3CA 2HNDB 1RTIA 3KJVA 3I5BA 5KFSA 1RTDA 3CWJA 3OHAA 2HNYA 2W8LA 2I5JB 3IG1A 5KFZA 3KLHB 3N6LA 3OL7A 1VRTA 4K4UA 2JC1A 3MEDB 4RUCA 5J2MA 3PW0A 2R8KA 4ECSA 3PW7A 5F9LA 1FKOA 4RNOA 3KLFA 1JLAB 1BQNA 3RAXA 4IDKA 4DG1B 3HVTB 4RU9A 5KFVA 4ECYA 4WXOA 2J6TA 1S9GB 1S0NA 3GYNA 4KFBB 3DI6A 3NBPA 3IRXA 4RNHA 3DRRB 4ZHRA 3IN5A 5J2PA 2UVRA 3ITHA 1HYSA 1RT2B 5J1EA 1C1BB 5F8MA 5KG1A 2XI2A 2HMIB 4LSLB 3V6JA 3QLHB 3E01A 3FDSA 5C25B 4NLRA 2WRMA 5DQHA 4ECVA 3KK2A 3V4IA 1HQUB 4QW8A 2ZE2B 3G86A 1TQLA 3DLKA 3NAHA 1EETB 3QO9B 1FKPA 3QZ7A 4NLGA 2JEGA 2YNIB 1C1CA 3HVAA 3M8PB 5KFGA 1QAIA 5CYQB 5C42B 4NRTA 3ISNC 2D7SA 4TYBA 1IKWA 3I0RA 4I2QB 3SFGA 4F4WA 2ALZA 1DTQA 2FJWA 3OLAA 4RNMA 3PW2A 1K1SA 4ECUA 1S1VB 4J9OA 5KT2A 4K50A 5HLFA 4FS1A 1IKYB 1RTHB 1TL1B 3H5UA 4RW4B 4K4WA 2FVRA 5KT5A 1JLCA 4PUOA 4YQWA 1SV5A 5KFRA 1VRUB 5KFLA 4URGA 3CJ5A 2OPSB 4K4SA 5DG7A 3Q8QB 3KLGA 4WYLA 3KOAA 4O3QA 4WFXA 2VG5B 2OPPB 2RKIB 5KFEA 2RDJA 5F8JA 3KNAA 1LWEA 4J9RA 2XI3A 5KFFA 2J6SA 4ED2A 3MEEA 1RT7B 4B3OB 3D28A 4MKAA 4MFBA 4ZPAA 1SH2A 4MH8A 2XWYA 1LW2B 4H4MB 1LW0B 1S9EB 5DG9A 2HWIA 1JLQB 3BGRA 3LAMA 3UR0A 3G6XA 1T03A 3C6UA 4IH5A 3LP1B 4ID5A 2FLPA 4Y34A 1TV6A 2I1RA 1C2PA 4IQXA 1S1UB 3D5MA 4LSNA 3OL9A 4OL8A 2D3ZA 5JXSA 1RT3B 3I0SB 1HNVA 2VG6A 3DOKB 3DRSB 4O4GB 2YNFB 1TKZB 5L9XA 5CYMA 3BQ0A 5HP1A 5FDLA 2YKMA 2GIQA 4TN2A 1HARA 1KHWA 2UVUA 3DLGB 1S1XA 4IG3B 5DLFA 4O3RA 3CVKA 2WONA 4XPCA 1NNDA 4URQU 4RW7A 2WTFA 3KHHA 2JEFA 3H5YA 4O4RA 2OPRB 4RW8A 5KFOA 1JLEA 1JLFB 4IG0B 4KAIA 4KV8B 1LWFA 4EYIB 2FJXA 3NMAA 5KFBA 2V4QA 3T5LA 3JYTB 1N5YA 2AX0A 2YNHA 3MECA 5HBMA 4QWEA 2BQUA 1S0OA 1LWCA 4DL4A 3GIMA 1QAJA 1J5OB 4K4ZA 3QGGA 4FBUA 3M9NB 1HQEB 2R8IA 3E51A 2E9TA 4KKOA 4R8UA 1YVFA 4Q0BA 5KG6A 3DRPB 3ISND 3PJXA 1RDRA 4IKAA 3TAMB 1C0TA 5EDWA 3EPGA 3KHRA 3DOLB 1REVA 3LANA 1W25A 5KG7A 5KG5A 2FVQA 4PQUA 4PWDA 1DLOB 2IAJB 3OL8A 4KBIA 4TYAA 3VQSA 2HNZB 4JV1A 2B6AB 4NLSA 2WHOA 3CJ3A 4IFVB 4ECWA 4EYHB 5J2QB 1ZTWA 1SUQB 1C0UB 4G1QB 3H5XA 1S97A 2FVPA 4ZP7A 2YKNB 4KO0B 1N6QA 3NL0A 4MK9A 4J9NA 4FBTA 2B43A 1S1TA 2D3UA 3V81A 3NAIA 3MFIA 3HVWA 3TVKA 2R2SA 4ZP6A 2YNGB 3GV5B 1T05A 2IM1A 4EBDA 4Y2CA 1RT1A 4F50A 2UVWA 2E9RX 3DLEA 2IBKA 3V4IB 4RW9B 4O3PA 1CSJA 3RBEA 2DPJA 4K4XA 4RW6A 1HMVB 4Q44A 3T5HA 4IR1A 3V6KA 1D0EA 4O3OA 2UUTA 3DM2B 4ICLA 2OPQA 2XCAA 2BE2B 5HROB 3Q8PB 2W9CA 1TVRA 4GC7A 4ECQA 5J2NA 4XO0A 2AGPA 4H4OA 1JX4A 1EP4A 2W9BB 4EBEA 3MEGB 4ED3A 1T94A 3PVXA 3FSIA 3PR4A 1JKHB 5KG3A 1KLMA 3GILA 3DYAB 1S6PB 2B5JA 4MIBA 3C6TA 1S1WB 4M95A 4JUZA 3KLEB 5T14A 3UDLA 4NLOA 2GC8A 4R0EA 5KFYA 3T5JA 1R0AA 4WXWA 1S6QB 5K14A 1I6JA 2VA2A 1XR7A 1HNIA 3LAKA 3QIDA 5KFJA 4U6PA 3MR6A 4QWAA 4NCGA 4WE1A 4U7CA 2OH2A 1RT4A 2IJFA 1OS5A 1JLGA 1S49A 1TKTA 2AWZA 4URSA 4ZVEA 4J9KA 1U09A 3QIPA 5DQIA 1RYRA 1IKVB 5KG2A 3OHBA 3QGHA 3BJYA 2HNDA 2C28A 2E9ZA 4QWBA 2C2EA 2UVVA 2BR0A 2VG7B 3KHLA 4Q8EA 2W9AA 1FK9B 4X2BA 2I5JA 2IJNA 3KLHA 5KFKA 5F8LA 3T5KA 1BQMB 3MEDA 3RB3A 4FS2A 2JLEA 3PHEA 2ASDA 2R8JA 2DPIA 5KFAA 3TQ1A 1JLAA 1UWBB 4DG1A 3HVTA 1RTJB 2C22A 4ID5B 4NYZA 1HPZB 2V9WA 1S9GA 5KFMA 4KFBA 4O44B 4QW9A 3DRRA 4IFYB 3JSMB 1RT2A 4IOBA 3M8QB 1C1BA 2R2RA 4ZPDA 2FVSA 3FFIB 2HMIA 4LSLA 4NLWA 4J9PA 2RDIA 3QLHA 4NLPA 5C25A 4DL2A 3OL6A 1JLBB 3V6DB 2IC3B 4I2PB 2R2TA 1NHVA 2IMWP 1HQUA 4R5PB 3V6DA 3KMSA 2ZE2A 3EPIA 4TQRA 5L1KA 4IRCA 5KFNA 5KFQA 1EETA 3QO9A 2R8HA 2W8KA 4KSEB 4J9SA 4ECZA 1TL3B 4ZPBA 2YNIA 2HWHA 3M8PA 3LP0B 5CYQA 5C42A 2BANB 1RT5B 3H40A 1N4LA 4I2QA 2ZD1B 3H5SA 5EWFA 4TY8B 1S1VA 5C24B 5F9NA 3LP2B 1IKYA 1RTHA 1TL1A 4RW4A 4YMEA 4NRUA 4KHMA 1RT6B 5KFXA 1IKXB 2RF2B 4MKBA 2V0NA 1XR5A 1VRUA 2WB4A 3CDEA 2OPSA 1RA6A 2IA6A 4IRKA 2JC0A 3H4DA 4ECXA 2HAIA 2VG5A 2IM0A 2OPPA 5L1IA 4O3NA 5I42B 4HYKA 2RKIA 2R2UA 4K4YA 3MR2A 5I3UB 3KLIB 3IS9A 3KK1B 4ED8A 5D3GB 4IR9A 1XR6A 4IRDA 1RT7A 4Q43A 4B3OA 4NLVA 2BRLA 4ZP9A 2V4RA 2WOMB 3KK3B 4DL3A 1TKXB 1DTTB 1LW2A 4H4MA 1QE1B 1LW0A 2ATLA 4RZRA 1S9EA 1JLQA 2CJQA 3H59A 4I7FB 4DL6A 4KHRA 3LP1A 1RYSA 1TP7A 1SH0A 3DMJB 4NLDA 2AU0A 2FJVA 1MU2B 3CIZA 5KG4A 3SFUA 1RTIB 4MIAA 3KJVB 1S1UA 3GQCA 4ED0A 1RTDB 5KT7A 2HNYB 1RT3A 2ILYA 3IG1B 3I0SA 3DOKA 1VRTB 3DRSA 5J2MB 1S9FA 1N48A 3BREA 2YNFA 1T3NA 5KFDA 1TKZA 4KB7A 1FKOB 5F8GA 3KLFB 2ILZA 1BQNB 3IGVA 4IDKB 1S4FA 3MFHA 2AQ4A 4TXSA 4O3SA 3DLGA 5EUHA 4IG3A 4ZHRB 3DI6B 3NBPB 3IRXB 4EO8A 5J2PB 1HYSB 3ITHB 5KT3A 4ZP8A 5J1EB 1Z4UA 2OPRA 5KFPA 4WZMA 3RB6A 1JLFA 4IG0A 3G6YA 4KV8A 3N6MA 4EEYA 3E01B 4GC6A 3GV8B 3JYTA 3FQLA 2XCPA 3QGIA 3KK2B 3PZPA 5F8IA 4Y2AA 3CDWA 3IGNA 3DLKB 1FKPB 3QYYA 1J5OA 3N6NA 4TQSA 4QWCA 3T1AA 2FVCA 1HQEA 1C1CB 2WCXA 5EWEA 5JUMA 3DRPA 3TAMA 4ZVFA 3BQ2A 4KE5A 1IKWB 3I0RB 3M9OB 3GV7B 1DTQB 3DOLA 2AX1A 3RBDA 3KMQA 4NLUA 5HLFB 1DLOA 2IAJA 3PJWA 2CKWA 4WFYA 2GIRA 2HNZA 2B6AA 3MTKA 4IFVA 5J2QA 5F8HA 1JLCB 1SUQA 1C0UA 1SV5B 4H54A 4QPXA 3PW5A 4G1QA 4DL5A 4PUOB 3ICLA 3MF5A 2J6UA 4ED6A 2YKNA 3KLGB 3RB4A 2C2RA 4NLXA 4KO0A 4HKQA 3PR5B 3HKWA 4Q45A 2JEJA 2JEIA 1LWEB 4NLYA 3T19A 3MEEB 2YNGA 4LQ9A 3M9MB 5DGAA 4MK8A 1GX6A 3NGDA 2D41A 2ZKUA 4MFBB 5KG0A 2R8GA 4RW9A 4RNNA 1N56A 1ZTTA 4G3IA 4RUAA 1HMVA 3FRZA 1S10A 4WYWA 5DG8A 3BGRB 5F8NA 4WZQA 5DQGA 3DM2A 1T03B 3C6UB 4TY9A 4DEZA 3CJ0A 1TV6B 2BE2A 5HROA 4LSNB 2W9BA 4NLTA 1HNVB 2VG6B 3MEGA 3NKYA 1JKHA 1D1UA 3G6VA 4J9MA 3DYAA 1S6PA 4IH7A 3Q8SB 5CYMB 1S1WA 5HP1B 3KLEA 5FDLB 5L1JA 2IM2A 2YKMB 2W7PA 1S6QA 3EZUA 3H98A 1WNEA 1S1XB 1SH3A 1JXLA 2WONB 4RW7B 4YR0A 3BQ1A 3SI8A 2VA3A 4RW8B 3BSNA 1JLEB 4ECTA 2FLLA 3UQSA 3BSOA 1LWFB 5KT6A 3GIIA 4K4VA 2C2DA 1IKVA 4F4YA 1N5YB 3IS9B 5KFUA 4K4TA 3OLBA 4DL7A 3OSPA 2YNHB 3MECB 3BR9A 5HBMB 4YR3A 2VG7A 2WK4A 3CJ4A 4RNFA 1LWCB 4MK7A 4QWDA 2ASLA 1FK9A 3FQKA 3LALA 1BQMA 3QZ8A 2QV6A 4F4XA 4ED7A 3Q8RB 4KKOB 4R8UB 4Q0BB 4ZVHA 1GX5A 4J9LA 4NZ0A 4ECRA 1UWBA 4JV0A 4YP3A 1C0TB 2F8EX 1RTJA 3I5AA 2ASJA 5KFWA 4IH6A 1HPZA 1REVB 4O44A 4JV2A 4PQUB 4PWDB 4IFYA 3JSMA 2BRKA 3M8QA 4Q8FA 3MR5A 3H2LA 3FFIA 2BQ3A 1JLBA 5L1LA
chains in the Genus database with same CATH superfamily
1CPZA 3BH7B 3N79A 2DGWA 2ACYA 5KOWA 4F04B 3OSNA 4ED1A 1IBMJ 1TL5A 4ZMMA 3I55S 3RZAA 3HHKA 3DDKA 3W5YA 1KWMA 1IKXA 3KDNA 2ZOFA 1S0VA 2CQ0A 3PCOB 1IBLF 1CQMA 2MZSA 4DUTA 2EEYA 5I3UA 2YWEA 3MPYA 5L9NA 1URRA 1LK7A 4OHWA 4I7FA 1L3UA 3BSAA 1JJ4A 3TZWA 4DV5J 4P2MA 4Z37A 3PW0A 1VRTA 4DQPA 3EDQB 4F25A 3MCNA 2F5GA 2MJNA 3KUHA 1I1GA 2GHPA 4OYOA 3QZ7A 3TP2A 4LUBA 3J7Z5 1AW0A 3HHEA 3B8HA 3M2UB 2D7SA 4F4WA 1S12A 2CPDA 1SJ1A 4ECUA 3TW0A 1KLNA 3H5UA 5K20B 2F8HA 2PFDA 2RQKA 3CCJS 2ZBIA 3K5NA 2XS2A 3Q23A 1LW2B 3UD3P 2V2KA 1T03A 1CJVA 3UNYA 1IJEB 2I1RA 2HHUA 1KQGB 2VG6A 2BJ7A 1OQ6A 1GNKA 3LGNA 3DLGB 5B7WA 3S8SA 3CVKA 4DN0A 1WELA 3K5PA 1SXLA 1JLEA 2IYGA 3CF5Q 3NMAA 2HRYA 5A6PA 3VV2B 3QRPA 2GVZB 3PIPQ 2CQDA 2F4VJ 2L08A 2AYGA 2GS8A 1G2EA 4KBIA 4NLSA 2V50A 1H38A 1VIXA 4G1QB 1CJTB 4OIXA 4YUDA 1FJCA 4CZCA 1HBOA 2YNGB 2FDNA 3CCTA 3DLEA 4W98A 1SC1B 2RQMA 4PWWA 4DPUA 2ZHBA 4DS4A 5J2NA 4EBEA 1ZAVA 1S6QB 1FD2A 4B3RJ 2PMZD 2PMWA 3MD1A 3P5TL 1RT4A 4ALZA 1NUEA 4V19J 5KG2A 3CB4A 4KGZB 1FDBA 1FK9B 5A6WA 1P9QC 3T5KA 4YB6A 3W7BA 3PHEA 2MZRA 1UFWA 3POTA 1YLXA 5D15A 1UETA 3C46A 1RTJB 4L73A 1E6YB 1S9GA 3TX0A 2F9JA 2BUNA 3BN4A 3M8QB 3CCLS 2H65B 1IBCB 1HBMA 3TAPA 3IR7B 2U2FA 2RHQB 3DGPB 5E0OA 5D4OA 1GMVA 1QSYA 4A8QA 4JI4F 2NXCA 3OUYA 3HPOA 3CNQP 4EZ9A 1YJUA 1X0PA 1RA6A 2LECA 1WDDA 3KLIB 2JVOA 5CHCB 4YDDB 2E5HA 2ZM6F 3QAEA 1MROA 1RTIB 2GZOA 5IZHA 5J2MB 2YNFA 4X4PA 5F8GA 3N5BA 1X5PA 2CJBA 2UXBF 1UFLA 2A3JA 4N47A 2GJIA 3ILIA 4TQSA 2FB0A 3W62A 3D0IE 4V19X 1RHUB 5JUMA 5LSOA 2DTJA 2VODA 1APSA 1RAIB 2MGZB 3ZZUA 3MURP 5A0YA 3H42A 3Q83A 1KTQA 1VC0A 2HFSA 1IUJA 2DEJA 3DDIA 5SZTA 4QCLA 4OYAA 2CYYA 2Q66A 4C2MA 4DV5F 1VQ8S 2KTQA 1QSSA 1R8BA 1UEVA 3JAMU 4ITSA 2KFNA 4GKJF 3BSOA 4K4VA 2DO4A 3G82A 5IT0A 1LWCB 5D4NA 2OMLA 4CI0B 2MTLA 1NPRA 1NPKA 3R27A 2ZBRA 1Y3KA 3I5AA 3P8BB 5H9FJ 4PG8A 4RLEA 3KLVA 1PJ7A 1RXOB 4ZCLA 2N4CA 3RAQA 4KH0B 4E2FB 3CJ2A 5A2QU 5KFIA 1M1GA 3SQGB 2XC9A 3F0NA 2DIUA 3C6TB 4M5LA 4V1Ak 5I3QA 4DPXA 3GJSB 4DSJA 5KFTA 3MAAA 1JLGB 1Y4ZB 2ADBA 3W61A 2O5DA 2RSQA 5AT1B 2JSXA 3JSBA 2H9ZA 2J0WA 4W90B 5HJXA 1LK5A 3MM9B 3GYNA 4ZPWR 1RT2B 1SCJB 1X31C 1WOSA 3GIRA 3R5AA 4ECVA 2VBYA 2IPOB 2XLJA 3QFHA 5C42B 1DQAA 3ISNC 4TYBA 3OFGA 4M5GA 4FVMA 2Z58B 1U1QA 3AQPA 2I0XA 1O8BA 4W4MA 3Q8QB 2AW0A 3D4JA 1QM9A 6FDRA 3FZ2A 5FIIA 4WJBA 4K8RA 4PXEA 1S9EB 1EKSA 3CCQS 3C6UA 1RBAA 1NBEB 4QBUA 5A2QY 1SPBP 2CWKA 3P6YC 2CPFA 2XMVA 1S1XA 3K57A 3KUEA 2KVQE 3CD7A 4E98A 1U2RA 2KH9A 3BGLA 4QWEA 1W2IA 2ZZTA 4UUXA 4DL4A 5D0HA 1UTAA 2K3IA 4AT1B 3LPEA 4PG6A 4DPOA 4FNHA 2XMKA 4JI3J 2Z2LA 3FVYA 3MR7A 4FBTA 4G1PA 4BHQA 3NAIA 4LT6A 4ZP6A 1FT8A 2P9EA 4DV2F 5HI7A 4O3PA 1CSJA 4PKDB 2F9DA 3QQCD 4MMOA 3R7BB 2HURA 4ECQA 3N9UC 3PEJA 5CA5A 3S6EA 1AUSL 1EAYC 5KG3A 5GAGI 1S1WB 2CPIA 1XMQF 4U6PA 2IY5B 1P27B 5KOXA 4ZDNA 5D77A 3PX6A 4URSA 3TOQA 2DGUA 1PAUB 2HNDA 2CPJA 3HO1A 2MQOA 2JLEA 1ZOTA 2UXCF 2MDAA 3NGRA 1Q95G 5KFMA 2LQ8A 2RDIA 2Y3YA 1REGX 1OIAA 2HZCA 2RUGA 2VPXB 5KFQA 4FF1A 5L39A 3OFEA 2ZD1B 1N54B 2Z2YB 2QA2A 2RF2B 3CDEA 1WDTA 2W1BA 2OFHX 3PYDA 4K4YA 3AA9A 4LF7F 1FTCA 3QBCA 4Q43A 4NLVA 2WOMB 2JVRA 2V69A 2ATLA 1TP7A 3CE8A 2FHMA 3I9ZA 3OVBA 3DRSA 5KFDA 1J2VA 2ROEA 3DDNA 1BWVA 1S59A 4UZBA 5BR8J 3RB6A 3UDEA 1WC1A 1SJ4P 5GAEU 4Y2AA 3CDWA 2MZTA 3VZIA 1S4EA 3SYZA 1HQEA 5LL6d 4ZVFA 4A8OA 1S7HA 2AX1A 4DQSA 1B70B 3PV8A 3AD7C 2NPIA 3ICLA 5HVHA 4DUYJ 2XMTA 2HQDA 3BM7A 1M0SA 3OJUA 4RW9A 3Q2SC 1R89A 2V68A 2D1CA 1K8AT 2XTCA 1ZM2A 1MLAA 3U7JA 2M9KA 3PM9A 4FF3A 3DHWC 4LFBF 2MHNA 3DGVA 3H98A 3J81j 2R7OA 2MQQA 3BSNA 3UQSA 1AA1B 2G4BA 3IS9B 5HBMB 3CTRA 1FX2A 4DPYA 3LALA 2QLJB 2WAQD 3CJSA 3EGNA 4NZ0A 3CEDA 4ECRA 4IH6A 4I4BA 1VK3A 3UVJB 4ZIWA 1UFKA 3H2LA 3DFEA 3FFIA 4YN3B 5MAOA 3G4SS 1JIHA 4WFZA 1S1TB 1TL3A 2O67A 2LQJA 4MYUA 4ZVPB 1G1XA 2XHCA 4TLRA 4DL0C 2QLBB 1IM4A 1D9DA 2FQQB 2RE1A 2BA9A 2QE5A 3LUYA 1U1MA 4K59A 2I6WA 4KGXB 1RB0A 4HHUA 4CDIA 5K14B 4QU6A 3P4UB 2C3UA 3OTCA 1BE4A 2XGPA 4P74A 3CW2C 5BYRA 1FWPA 3T3FA 1U02A 1XNRJ 1HHSA 2G0CA 4DWIA 5AJ3J 1KVJA 3HVTB 5KFVA 5L8RC 4IOAQ 1Z2LA 1KC8T 1BHNA 4ZKAA 5F8MA 4X62F 3E01A 3FDSA 5DQHA 2F40A 4I69A 1RWWB 3MM6B 2H54B 5HJYA 3BV8A 1EETB 2WVFA 3WZ0A 3ZTQA 1QAIA 1EJ7L 1Y5LB 2ALZA 1NB2A 2NYIA 3HHDA 2VOPA 1IKYB 1TL1B 2Z8QA 1FRHA 2NLWA 4IUFA 2O1PA 3DHXA 1FRLA 4RO0A 5A8WA 1U49A 4X4VA 1NRKA 2OPSB 2DK2A 2BV3A 3KKFA 2PD1A 2RKIB 2AD9A 5F8JA 3W8PA 2XB2D 2QJ3A 2KG1A 2QA4S 3GFZA 1M5HA 1JLQB 2E1RA 4OYPA 3R97A 1KTVA 3PYGA 3TEGA 3KTQA 5E3QA 1NMEB 1HNZJ 1VI7A 2VU5A 2JEFA 2W2QP 3TJAA 1J5OB 3NNAA 4CTAA 4ID8A 1HBUB 1YVFA 4IKAA 3W9HA 4AXJA 1XIQA 2QL9B 1N0VC 2ZH8A 3UDCA 1GMWA 2B6AB 2WHOA 1S97A 1XMOF 2RHSB 3TWZA 1RGVA 4JI0F 2UU9J 2RB7A 1KDNA 1ZH5A 3DOMA 4RW6A 3T5HA 3A8EA 3GFHA 1QY7A 3C19A 1T94A 4R0EA 2YX1A 4ZVEA 1RYRA 4YB1P 1U6ZA 3NXZA 1X8DA 5LMUF 2J9CA 2B9EA 1HW9A 3PTWA 3MEDA 3LH2S 2CNLB 2Y8YA 4KFBA 4O44B 3GCXP 1C1BA 4RU2A 2JH3A 1NSPA 4NLPA 1UEKA 2A10A 2LA6A 1YTYA 1F3FA 5KFNA 1NZAA 2AEFA 4KSEB 3F56A 1P6TA 3IBWA 4ZPTR 3TUIC 5K9FA 3SMZA 2I9SA 3ZTSA 2KI2A 2CA9A 2QLWA 4OV6A 5L1IA 3IS9A 2B9WA 4H4MA 4C3LA 2DB1A 1SH0A 4NLDA 2H3EB 2AU0A 3CIZA 1NKBA 1RT3A 3I0SA 3BREA 4KB7A 4J91A 3KLFB 4NASA 4IDKB 1B7FA 1PCAA 5J2PB 2YPZA 1YHQS 3SQOP 2XQCA 3N6MA 3CC7S 5EWEA 1EQMA 2IBOA 1YQHA 2KJVA 2EI5A 2PEBA 1DLOA 2ZBPA 4N5SA 3TA0A 1H3DA 3ET6B 3K5OA 1VC6A 1SUQA 1LEOA 4F36A 3R9LA 1RWNB 3OTBA 2OMOA 1UEUA 1NKCA 2RRBA 3GP9A 1HI8A 3CJ8A 1UUJA 1U48A 1YKWA 3BGRB 1RZMA 3M2RB 1XNRF 3RU0A 4B3SJ 1JWWA 3S1TA 3MEGA 4ELTA 2DH8A 4PXCA 4X66J 2YKMB 1U0HB 3RG6A 2H5JB 5JVHQ 4Y2KA 1LWFB 4PQAA 2PI5A 4MJKA 2EFOA 1N5YB 2VG7A 2ASLA 2DHSA 3FK4A 3VAGA 4F4XA 2NPFA 5B0BA 2QO3A 3QRRA 2PE8A 1C0TB 3PHTA 2ASJA 3N28A 2A1BA 3JSMA 1FRIA 3D68A 1VQMS 1UA1A 3V6DA 2W7OA 4X4SA 1F3VA 4J90A 2V4JA 1UVLA 1VJWA 4OFZA 4TY8A 4GKKF 1QJHA 1YBTA 2DCLA 2BMBA 2J8AA 4WP9A 3THPA 1V5VA 3BKUA 4C4WA 2DRBA 1WTBA 2BJDA 4TU7A 5M2UA 4ER8A 2VV5A 3MD3A 2P8IA 1M1KT 1HR0J 3EZOA 3KJVA 2JC1A 1JLAB 4NXMJ 1MWQA 2XI2A 2HMIB 3QLHB 2XEXA 4F3MA 2XYGB 1SKUB 2JEGA 2IRYA 4M5DB 3UR3C 2FVRA 1LQ9A 3HHLB 3MM8B 3MZIA 3HSDA 2W01A 4C0HA 3OJSA 3C15B 2R9LA 1EIYB 3LW5C 3GR1A 1MW7A 3VAJA 1S1UB 3DOKB 4ES3A 3HLUA 4L76A 4DV7J 4XPCA 2KU7A 1JLFB 4LR8A 2YNHA 3MECA 1FRXA 1PYOB 2WVDA 1QAJA 1KQFB 4EWTA 4FBUA 3MMAA 1SIZA 3PJXA 1V9OA 2FGCA 3LANA 5IS2A 4DHVA 4JI8J 3OL8A 4TYAA 4LFAJ 4ZVUB 3R5BA 4K5RA 5D0RA 4WTYA 1GMWD 2G0IA 2DR6A 2Y1IA 4UOCA 2YKOA 1KSPA 2IBKA 2M5YA 1Q8IA 1MSWD 2IVFB 4K4XA 2WW8A 1T9WA 1S7IA 2B4OA 5CD4A 5D8HB 1JX4A 2W9BB 3WX4A 4C8LA 1Q8KA 2RQ4A 3D3CJ 4JUZA 3UDLA 3CMAS 5E3CA 2LXUA 4OX7A 4NCGA 1UWAA 3P3DA 1TKTA 2NZ4A 3UE2A 1LNQA 1NM2A 1H6KX 2BVZA 1SQFA 2LEAA 2V9WA 3DRRA 4MKVA 4AUKA 1DBDA 3OBIA 1T9TA 4F7VA 2BANB 2ATCB 1N4LA 5EWFA 1IR0A 2F65A 2M70A 1PO6A 1XR5A 2WB4A 1Z1ZA 2Q43A 2VG5A 1U0SA 4QYZK 5I42B 3CDAA 3R5CA 2HHPA 4LRBA 1VIOA 4B3OA 1TKXB 3AAWB 2CRLA 1VK8A 1FA0A 5IFMA 3DMJB 1OQ3A 1MU2B 5KG4A 1RTDB 2N82B 3OR2A 3D2WA 2I38A 2VC1A 3P96A 1SL0A 4IG3A 2CZVC 3QAUA 3DRXA 5J1EB 1O6XA 2YXLA 4DFMA 4N41A 1RWVB 3JXOA 1C1CB 5AXMA 3DRPA 1IKWB 5B0CA 3DOLA 5HLFB 4PYAA 4MTPA 4B3TJ 4DFPA 1C0UA 3SSSA 2KKHA 3A1YG 2HPUA 4F02A 3RR8A 2ZBCA 4OZNA 2YWGA 4WK3A 1LWEB 3M8RA 2HWTA 3MEEB 1JXEA 2MPUA 2IDLA 2ZKUA 3U27A 4WYWA 3UCGA 2G13A 4NXNF 4NWBA 5HROA 1F1BB 1HNVB 3MCOA 1WSRA 2BX6A 5HP1B 5L1JA 5LT5A 1SB6A 1QAXA 1JXLA 4JI1F 4ANEA 2LXIA 4RW8B 3ZNUA 2A6OA 5KFUA 3OSPA 5CCLA 4I68A 1BQMA 3EGVA 5E3PA 4JV0A 1Y0HA 3QATA 1IJFB 4DLEA 4JV2A 4PQUB 1UJ6A 3T1YJ 4I2PA 1ZPWX 2KJWA 2OTJS 3LP0A 4ZPCA 1RT5A 3GZ7A 3MR3A 1E6VA 3PRVA 3CXCR 1FXRA 3ZC4A 1DAXA 3M8YA 1PBAA 3D6MB 2AP6A 4KRWA 4L6V3 2VOOA 2NSBA 4X4OA 1HWUA 4F4KA 1D09B 1QUVA 4OYWA 3KK3A 4WE1B 2KFZA 3GMGA 4XPEA 2OKQA 1DTTA 2P2CB 2R7UA 3P5BP 1T11A 2RS8A 5IQ6A 1K1QA 3JB9k 2I5JB 4DX7A 2DHHA 2Z0GA 3QJJA 2RU3A 8AT1B 4M5NA 4ZJOA 1WWHA 1R6YA 3QGPA 1OO0B 4DG1B 4RU9A 3ULHA 2XM3A 4H4KA 5F3TA 3RW6A 5C25B 2QLFB 1VDHA 3SCJE 5H9EK 4DXLA 2IRUA 3VVTA 1X4HA 1B4SA 4J37A 3AX3A 5CYQB 1OJ4A 1RU1A 4HVZA 2FJWA 4DUZF 1S1VB 3IWNC 2RIJA 4K4SA 3IWXA 1FNXH 5KFEA 3ZTOA 1SH2A 1DFDA 2PA3A 2IMOA 4X65F 1TV6A 4O23A 2GMHA 3OL9A 3RRKA 1YDLA 4GO7X 1TKZB 1HBNB 5HN0A 2C2MB 2GMLA 3U1MA 3JYTB 1MG7A 3W60A 2MLZA 1Q78A 4F0HA 4KKOA 2MQLA 1VQSA 5ETMA 3W2VB 3KHRA 4JYAJ 1REVA 2FVQA 2CPXA 5CZVA 3FZBA 2V8PA 2YKNB 2VICA 1JNRB 2KM8C 1QAYA 3MI7X 4DV0J 2ZKTA 3HMJG 3MUTP 3GV5B 3DCAA 4I6YA 1Y11A 4IR1A 5DS7A 1D0EA 4MAKA 2OPQA 2XCAA 1ICEB 1O51A 3ZZPA 3M2VB 4IYQA 2R7XA 5HVGA 2IJFA 4K0KF 1CC7A 1OS5A 3ENQA 4PG7A 3QIPA 4Q2MA 3CCVS 1IKVB 3CCUS 4DQQA 2GVDA 4DI6A 1NK6A 4F26A 4FS2A 5H1SV 4X84A 4NYZA 3CJQA 4FXWA 4JOUA 4WU2A 1WORA 1JLBB 3R2DJ 2ZE2A 4M1KA 4OJHA 3VAFA 1T3OA 4PPZA 5CD4H 2HWHA 3P49B 1PAEX 3RGIA 4UY8T 3IXQA 1RTHA 4LF6F 3BYPA 1NJXA 1RT6B 2YQ3A 3TQEA 1LOUA 2Q6CA 3MWBA 2J0XA 5EN1A 2YX4A 2Q3PA 1FRJA 3KK1B 5D3GB 3UO0A 2RAQA 3B82A 2V4RA 4DL3A 2X3GA 1SI9A 2FJVA 3EM1A 3R7NB 1YJVA 4IO1A 3U1LA 1N34J 1S4FA 4C98A 3MFHA 3BGOP 3HT0A 3THVA 4ZHRB 3DI6B 3NBPB 3IRXB 3I32A 3BO4A 3ZZZA 5KT3A 4ZP8A 2MQMA 2EFQA 4O0IA 3T1YF 4UUWA 4C6AA 2EWHA 2FHKA 1WJ9A 2PT0A 3UDVA 4KE5A 1SKSA 4LF9F 1P1LA 2KRBA 2QFIA 2NUHA 1NZ8A 3LGMA 4KO0A 4MFBB 4N8OA 3CSKA 1ZTTA 1U45A 5DQGA 1G6BA 1RQ0A 1DRZA 4QR2A 3GB0A 3EGZA 1W7WA 3G6VA 4Z7CA 2R3VA 2MKKA 3TI0A 3DC2A 4LIWA 2UUCJ 2BJ1A 1NSKL 2C2DA 5LSLA 3O2IA 4FF2A 2WK4A 4USHA 4QWDA 2RNEA 3EVOA 2HS4A 3NMRA 1WEXA 3VAHA 4PWDB 3VWSA 2KFYA 3HHLD 1FX4A 3C16A 5CCMA 3D6HB 1RT1B 4Z7YA 2KXHA 3BBCA 2ZH7A 4LF5J 1TVRB 3M6UA 5C5JA 1FKAF 2C2OB 2JJ4D 3DNCA 2XNQA 2B5JB 1YRUA 2DEIA 5E41A 4NX9A 4IOCQ 3Q2TC 1HNIB 3H4BA 3BPDA 4LSZB 4K2XA 4OZ1A 5KFCA 2DNYA 1RSCA 3T9NA 4WKYA 1FXLA 4Y3CA 2XMAA 2R8KA 5G0RA 5A76A 4B9NA 4WPAA 1FKOA 3EYZA 2GAHC 4OI1A 3GONA 1GEHA 1Q82T 3NNCA 5KG1A 5HVFA 3QT7A 4WTOB 2E1PA 4M5JA 6AT1B 3AB4B 3B54A 3NAHA 4OYXA 4KYZA 3HVAA 5KFGA 1U8WA 3SFGA 1HQ2A 4HHJA 3T41A 2OFGX 5A8KB 2GA7A 2ROGA 4URGA 4G6VB 5DG7A 4OZ5A 4UQTA 2HGMA 2HVZA 4OYMA 2HHSA 1VBYA 2V2ZA 3LPYA 4RUBA 2VF3A 2UUAJ 4F0KA 4IQXA 4LSNA 3V2UC 4EUVA 4AL5A 5FDLA 3EGWB 4Y0FA 3R5DA 1YJ9S 5DLFA 1T9YA 4KAIA 2LA4A 2G2ZA 3A3NB 4NA3A 4OJ3A 2AX0A 3FCHA 3ZXWA 1FJGJ 3ZZ0A 2HG4A 4YHHF 4UTGA 2E5IA 1OSDA 4KGKA 4OHXA 5KG5A 4FKYA 1VBZA 2MQNA 5GMKa 3CJKB 1S57A 3CJ3A 5J2QB 2DGXA 3G9CA 1U24A 4XIUA 4FZVA 3AWRA 2XSFA 2VFUA 2HBYB 3NLCA 2UVWA 2FY8A 3HD2A 1Q7LB 3RJMB 4DCJB 2RILA 2E1AA 4OQJA 1F0XA 4ICLA 2UV8A 4A8YA 1KLMA 3NOCA 3T5JA 5KFYA 1I6JA 3MR6A 1N34F 1YZ7A 1Q1KA 3AXMA 3R8YA 4N56A 4E0DA 5LXRA 2MQ8A 2N7CA 2UVVA 1AYEA 2OEJA 3RYLA 5DM6Q 1U6BA 5KFKA 4IO9Q 2YWFA 4CT9A 4DX6A 1JB0C 2Z2ZA 4DSEA 2CQGA 4DS5A 4C9DA 4ZCMA 1PYTA 4QW9A 1FRMA 4NEYA 4Y65A 5H9EJ 3AJ1A 5HMXA 5AXLA 2CQ2A 3MGJA 1WD6A 4R5PB 3GFYA 1CULA 3QO9A 4CYUA 2YNIA 2J5AA 5T7LB 4I2QA 5IM0B 4DPTA 2KL8A 2J9DE 1OY8A 3J7AN 4OX9F 3UCUP 1FTRA 1XNQJ 2IM0A 2V8DA 2QN6B 1RT7A 4FKXA 4Y6IA 4KHPJ 3AX2A 3IP0A 4DV4J 2HVDA 2ZDOA 2UUCF 2Z56B 4ED0A 3BPSP 2BEFA 2E7XA 4QU7A 3M8ZA 2ZH3A 3MM5A 2MKJA 3ITHB 2D68A 4IG0A 4OX8A 4KV8A 5LMNJ 1HKAA 2HAFA 4B9UA 3DLKB 2CPHA 1RABB 3CJTA 1FFSB 2HFVA 1HA1A 2WSCC 4OI6A 1N0UA 5HK4A 4QPXA 1IR2A 4ES1A 2KDOA 3CIMA 3W2WB 2QL7B 4Q2LA 3GR0A 3KWMA 3AA8A 3G6ES 1Q8LA 5IWAF 1N8RT 4WZQA 1P9YA 4DPWA 4A8KA 2D9OA 2DISA 1JKHA 2HBRB 3KLEA 2FYXA 3BDPA 4DV1F 3MPDA 1Y7PA 1H73A 4YFUA 2OHDA 3D1OA 4C0BA 2VQEF 3AHPA 4YY3F 3MMBA 4JB8B 2JWNA 1YX2A 1IBLJ 4LJMA 3Q22A 2M2BA 5AE2A 4RPFA 1ZZNA 2C3YA 1DQ8A 2LFVA 2CVEA 3V81B 2XZWA 1VBXA 1O0PA 3SZ2A 1T05B 4KTQA 4EO6A 1HIYA 4ANDA 3LP2A 4NI2B 2N3LA 2FIUA 1FNOA 3PW4A 3GIJA 2EK1A 3I5CA 3W9IA 5K8NA 1EP4B 4C8NA 4N7TA 4I67A 4EBCA 1YJ7A 4A8FA 1O5JA 2R2UA 1R6VA 1OWXA 1RHJB 1H72C 3PYFA 4PAAA 2EKYA 3VGTA 2W2OP 3X3UA 4IQMA 3IG1A 2QLXA 3IWLA 1FJGF 2R7RA 4HT7A 3L9ZA 3KNGA 3Q8UA 2UVRA 3ETMA 3RBZA 2ZHAA 4OI2A 5JVGQ 4YDXA 3FSXA 4QOTA 4LSLB 3NS7B 1YBAA 1VQ4S 3C14B 4QW8A 1YG0A 3NGUA 2GGPB 5AE1A 3W5ZA 3OLAA 4K50A 1WI8A 2BKNA 2OELA 2MEWA 1VRUB 2GX8A 2XZTB 2FC9A 4DX8H 2AJFE 2RDJA 2HZAA 4J9RA 1VOMA 4ED2A 1MMNA 2HHQA 1X4EA 4I6AA 1NCLA 3LP1B 4GVBA 2XY5A 4YEAA 1DJ0A 4CO5A 3W3SA 1S6UA 2VD3A 2B7BB 3MM7A 2EK6A 2W24A 1HARA 1KHWA 3LWLA 4DMZA 2CG8A 4O3RA 1NNDA 2RD5C 3EICA 2XHWA 2R7WA 4JI2F 2BQUA 4JI6F 5SUHA 3PNIA 2E9TA 4Q0BA 1N5VA 5KG7A 3NGKA 1RACB 1FCAA 2V2QA 2HNZB 4F67A 1F2GA 2B51A 4EYHB 1ZTWA 1VQOS 3H5XA 2CNNB 2XMWA 2XTEA 3DLHA 3FC9A 1XMBA 3AOBA 1P1TA 2LYVA 1HMVB 4RKUC 3FGVA 2BE2B 4CO4A 4XO0A 2RDDA 3M1VB 1CJUA 1U6FA 2I8EA 4H4OA 3G96A 2HHHF 1KN6A 1PKUA 1VMBA 3PR4A 2NXEA 3DYAB 4MIBA 1D8YA 3LQVA 1RCXB 4I1TA 5T41A 1CLFA 4DR7F 3M30A 2OEMA 3KDOA 3TRGA 4ANCA 4FPIA 1CJKA 5LMNF 3IBFB 2GJFA 4JI4J 4DQRA 2HK2A 4QIFA 3QT8A 2BW2A 2ASDA 2UXDF 3GE9A 2DRAA 4CM2A 3PKYA 2SXLA 3IBCB 3FMBA 2G1HA 3GFXA 2MKYA 3K8WA 1IQTA 4R25A 4CLTA 3O8WA 2GW8A 4U96A 4B17A 1FJ7A 2ZM6J 3ILLA 4P9SA 4ETXA 3KJFB 1YK9A 2V8GA 5A8RA 3UN5A 5KFXA 4HH0A 1N36F 1TUGB 3C2PA 4ECXA 4J7CA 2OPPA 2UXBJ 4HYKA 4OYZA 1KRPA 1TFWA 4OYBA 4DX5A 3SFUA 2DXFA 2HBZB 2HNYB 5JMNA 3SBMA 2KRRA 1PG5B 1N48A 2BXJA 1T3NA 2NXNA 3LWMA 1TAQA 3AXKA 5DRKA 2CXEA 1HYSB 3HSZA 5BYSA 2OPRA 1H0HB 2FHOB 1CS4A 1TMMA 4OI4A 3AODA 1AZSA 4ZLNA 3L4BC 2FVCA 3M32B 5D0EA 4R0JA 2OD4A 2PMHA 3TAMA 4QZVB 4X4TA 4ZN3A 4DR2J 1RKIA 3AQOA 4TLQA 2IAJA 1SC4B 1D9FA 4IFVA 1NEEA 3JQMA 1EZZB 3HHLC 1KQSR 1WHVA 3NG8A 3RB4A 3OV7A 4CH7A 1R43A 2RRAA 3W5XA 4GKJJ 4NLYA 2DXDA 3FNNA 2QMXA 2B9XA 5KG0A 3BZQA 4F2SA 3HZGA 4ATNA 3TEHB 3CJ0A 2MB0B 4NMXA 2GV1A 2E5LF 3FBCA 1TUVA 3CJ4A 4ED5A 3OR1A 4AL7A 4QIGA 4HACB 3Q8RB 1B7YB 1UWBA 4B08A 4AE5A 1U7LA 1CVJA 1WF2A 2HQ3A 4H4KC 1J27A 2IC3A 3KHGA 1PC4A 2QZ8A 2R7QA 2C42A 4ZK7M 2AZ1A 3OXLA 2DNKA 2E1MC 1R7IA 2EFPA 2MLXA 1NHKL 1NO8A 4P6QA 2W9CB 3QJPA 1QLNA 1ZAWA 2MY8A 1Q16B 1Y00A 2ZEJA 2RUSA 1H7XA 2AYMA 1ZA2B 4ED4A 3VGVA 2Y1RI 3D54A 4ECSA 2DHAA 2YVSA 1NH7A 1G3OA 1K0TA 3DXBA 1WACA 2VFVA 4LF1A 4UQGA 1YBUA 4FF4A 4P2FA 3SDEA 1BLUA 5M2RA 1HQUB 1NB7A 2KXFA 4USWA 2CVIA 4PPDA 5ETPA 2ZH1A 1SJ3P 1WTFA 1DTQA 3SCLE 4RNMA 2M52A 2X1GA 1YRXA 1EB0A 4GRSA 4PUOA 1SV5A 3KUGA 3R5JB 2YKAA 4KGMA 9RUBA 2B4UA 3DU6A 3EXYA 2QMUB 5J1NA 2A2DA 4HI2A 5B0EA 4IH5A 2H51B 2CJKA 5JXSA 4WIIA 1UL3A 5CYMA 3K5LA 3M6WA 2QYGA 1F60B 2WONA 3UFCX 4RW7A 3W66A 3CCSS 2IDEA 1LV5A 5ETQA 1RHQB 4DV2J 3EE3A 3GIMA 4M63A 5ETKA 4R8UA 2ZJQQ 2BJ3A 3DRYA 3BGUA 1ZA1B 1RLCL 1WKLA 1XMQJ 1RHKB 2ZBQA 4PG5A 1PIEA 1LXJA 3K5MA 2XSJB 4Q7AA 3C3LA 1XK8A 2IM1A 4OZJA 4DZDA 2EFGA 4LBIA 1A0OB 1ROFA 4M5HA 2AJ2A 2UXCJ 2AGPA 3PVXA 2ZUAA 3ZO7A 1AROP 4DU8A 2GC8A 3MCMA 1XR7A 3E8OA 2FC8A 2P6SA 2DHXA 5CYJA 1YGYA 4KQZA 4XAKA 1GTEA 4DDFA 1F5BA 3OVSA 2EVZA 2YBVA 4ID5B 1HPZB 4OZLA 4IFYB 4DR2F 2GMJA 5DDPC 4LF7J 2DO0A 1T9UA 5L1KA 2HHTA 2R8HA 3CT9A 4WFAQ 3TZYA 3M2UA 1FFWB 1L3TA 5C24B 2HQFA 4OZ2A 4JP8A 1Q7YT 4YB7A 3QFWA 3EJMA 3H4DA 2L3MA 1AB8A 2JFDA 1LW2A 1QE1B 4FXDA 4RZRA 1GFWB 2ZITA 4OLPA 1UVMA 2MQPA 1URNA 1VHFA 3HJVA 3AT1B 5BYQA 3IRWP 1GMUA 2X3DA 2YKQA 1ZM3A 2F1FA 1BQNB 2AQ4A 3K0JA 3DLGA 5EUHA 3ZTPA 2QIFA 3GSDA 3OQ2A 4GVLA 5FJ4A 2PO4A 4X64F 3D6FB 3KK2B 1FKPB 2GVZA 2WCXA 3N0VA 5ETRA 4OYIA 3I0RB 3MMCB 1X9MA 2HGLA 5ETNA 3RBDA 3MAQA 3CULA 3GTYX 4B9TA 2EKNA 4NLUA 4LFBJ 2DR8A 3MTKA 1JLCB 4G1QA 1CJTA 4ED6A 3KLGB 4MKYA 1KOOA 2YNGA 5DGAA 1WHYA 3FBFA 3Q86A 2LVWA 1R27B 1RBOB 3V5RA 4JI7F 2JX2A 4RWXA 2MZ1A 4FPRA 4X4NA 1S6QA 3NRBA 4C11B 5BJRA 3TANA 1V3RA 3I82A 2XO6A 4RNFA 1FK9A 3EMTA 3FQKA 4K2JA 4ZVHA 2HLUA 4HI1A 1L3KA 1RTJA 2KVIA 3IA0A 1E6YA 3HDSA 3M8QA 1T95A 1HHTP 2BQ3A 2M3DA 1N6QB 1WC3A 4RX6A 2W25A 3DGPA 2HZVA 2XLKA 3MCSA 4WU3A 1FDDA 1RP5A 2H4YB 5EWGA 3W65A 5CABA 2JL9A 4X62J 3KLIA 2XZDB 4ZVGA 5GMEA 5K8PA 1R0AB 2FLNA 2FJEB 3BF4A 2BJ8A 5KT4A 4B3MF 1RTIA 1KQKA 3KLHB 5J2MA 4RUCA 3FEZA 3Q89A 3VF0B 4B9LA 1UVIA 1FERA 3AH6A 3Q8YA 3R3TA 1FDNA 4P73A 2W2MP 2GIFA 1X60A 4JI5F 4USKA 3HJFA 3M8PB 1LFWA 4LVOP 2MGZA 4J9VA 4RW4B 1EQ0A 1TMJA 5KFLA 1TL7B 3FKBA 3UI3A 2OIHA 3JQKA 3KG0A 4P10A 2HRUA 5KFFA 3R2CJ 4MH8A 2XWYA 3A13A 1LW0B 3UR0A 4ID5A 2ZH4A 2D3ZA 4O4GB 2V34A 1U2CA 5B0FA 5CXTA 2GIQA 3NS5A 4OI0A 1XMOJ 1U1LA 3HFZB 2WTFA 3O1LA 1NAQA 4DSKA 4K5SA 4EYIB 2DGQA 2ZH9A 4JI0J 2YX7A 1LWCA 1U1NA 2LP4A 3UW1A 2XMMA 1GH8A 4WBFA 2H4WB 1W25A 3TX8A 1FEEA 4JV1A 2DNMA 4D3HA 5HMWA 2RT3A 5D4LA 4DZ6A 2YWKA 3PY8A 2B56A 3MFIA 3TVKA 2XLIA 1AXQA 4X4RA 5LMUJ 2MSTA 4FYWB 4CLPA 1VFJA 3DM2B 3SQGA 4A8SA 4ED3A 4E8UA 1S6PB 3C6TA 2ZFHA 3GLJA 1RAHB 2AWZA 1JLGA 3CO0P 5DQIA 4QIVA 3BJYA 2ACMA 2KXNB 2ZOGA 4A8MP 2QGFB 5AE3A 3HK2A 4OZ3A 3EDRB 3BR8A 3MM9A 2C22A 3MPUB 2CQIA 1CC8A 3QWUA 1RT2A 4DR5J 2PN6A 3V4MA 3GJRB 4DL2A 2OTLS 1N32F 1XEZA 4P7VA 4ILRA 1HL6A 4ZPBA 2HQIA 3X1LB 2YWHA 2BDPA 4BC7A 3J81Y 3TARA 2DIVA 4I6WA 5C42A 4L74A 3TYTA 4GO5X 1IKXB 1RUSA 2JC0A 2HAIA 5I3UB 2BRLA 3KJNB 3NY0A 4QIEA 3DN9A 1S9EA 5IXUA 2HQGA 4LFCJ 4I7FB 1RYSA 2AEJA 3FBBA 3FUYA 1U2FA 1VRTB 1X5TA 2AT1B 4C48A 5EHHA 2C3PA 5F41A 1RK8A 2K2PA 4NCBA 2VC0A 2V94A 2F8MA 4LF8F 3OFHA 3IGNA 2M7SA 2VQFF 4WP8A 2UP1A 3GG1A 4PXBA 2DD8S 3M9OB 2N7YA 4LF2A 1C4AA 4CCHA 2OEKA 3D0GE 3MF5A 3HFVA 4HKQA 1XQIA 1TL4A 5FD1A 3T19A 2X7IA 1M5OC 4RNNA 4ELUA 1S10A 4OMFG 3ETOA 4KIAA 1U1KA 3K2YA 1T03B 1CJVB 3Q8VA 1ZZFA 2VG6B 2MKIA 1M5KC 2AJ1A 2D69A 1S1WA 2V5HG 2W7PA 1KD1T 3FRYA 1YJNS 2ZH2A 1JLEB 2FLLA 3D66A 3NCPA 5IV3A 5KT6A 3QSIA 2LCWA 2ADCA 4DQIA 4GKKJ 1H98A 2W7AA 4DF4A 1HNXF 1TKDA 3EVMA 4JBCA 4YP3A 2F8EX 3D67A 1KR4A 1U1OA 2DGTA 2F63A 1RBLA 4QYRA 1NK4A 2VBWA 2CPEA 5L46A 2GFFA 4L72B 5DDRC 1RA7A 4CO1A 1HBOB 3BSCA 3DLEB 2ZD1A 4O4GA 3TA2A 1OPIA 1KHVA 2RF2A 3MMJA 5J2NB 1X4CA 3V6HA 2E7WA 3BDEA 3H0PA 2QA1A 3VTIA 1WC4A 4CLWA 4F4ZA 4NCAA 4J9QA 2WOMA 4YR2A 1RT4B 1KFSA 1WC0A 5KFSA 2G2OA 3POTB 3LOUA 3IAM9 1XERA 3D6TB 1S9GB 3MOZA 4UOFA 3V6JA 3ZNJ1 3IAS9 1HBMB 2WRMA 1XC9A 4DU7A 3AOAA 3M4XA 3TJ8A 1GK8A 1H2UX 3PW2A 3OUYB 4EZ6A 2KT5A 1K44A 1P8GA 1EHWA 2DGVA 1J5EF 3L7PA 3GJTB 1IVZA 2DYAA 4C3MA 5ETSA 2BZ2A 2KYZA 4CLYA 1A6LA 3AJ2A 3C66A 3A8KA 4ZVRB 4NMLA 2J76E 2MXYA 1SL1A 4EGLA 4LF4F 1MROB 1G7CB 4Y34A 2W4CA 1NSAA 2YNFB 1WHWA 4N8NA 4DR5F 1Q5YA 3KJQB 5HBMA 1KVKA 2MJUA 3G8QA 3E3XA 1UJ4A 4K4ZA 3M9NB 3M8WA 3PRBA 1XN9A 4USUA 4PXDA 3EPGA 1FESA 3UVJA 2FZKB 3OT9A 5A0YB 2LDIA 4F2RA 3ZFVA 3WDOA 3ZZYA 4BBYA 2B43A 1S1TA 3QSYB 3GU0A 5EGYA 3HULA 1UW4A 2XS7A 3V4IB 2XZ2A 1MWZA 1VHIA 2NR0A 3IC1A 4LFCF 4YOEA 2LMIA 2XYPB 3OXFA 1XBWA 2WZ1A 1WKKA 5K14A 3EWGA 2EXUA 2OH2A 3MDFA 1HLWA 2IJRA 4WIQA 1HD0A 3G82B 3KHLA 2PI4A 4Q8EA 3N4WA 3RB3A 2OLWA 2R8JA 2HRTA 2HFUA 2EFVA 1WG5A 2CADA 3HVTA 2C2KB 1VRQC 2WSEC 2VPWB 1GTHA 2K8GA 4PWUA 3MM6A 3UN2A 1EETA 2EBEA 2DHGA 2JNJA 1X9WA 3DLJA 4QJVA 2AKWB 2VZ9A 1WKJA 2DY9A 1IKYA 1TL1A 2CPYA 4YMEA 1WOOA 2V0NA 4KC5A 1U47A 2CAJA 3G2XA 2XS5A 2ERRA 1M5SA 2OPSA 3W9JA 2LQ5A 2RKIA 4IRDA 1I3OB 1WEZA 4DCPB 1U4BA 1YI2S 1R8HA 3MAAB 3UD4P 3G8SA 1JLQA 2HLTA 2IFXA 3H59A 2ASYA 4USJC 2C2ZB 4WF9Q 3G71S 1HFEL 2J0SD 1F9EB 4MYTA 4P71A 1RHRB 3G8TA 4ZCIA 3TR5A 1UW9A 4EO8A 4HT5A 1Z4UA 1R8PA 2HHXA 4EEYA 4CLUA 2XCPA 3QGIA 2AYBA 1B0PA 2Y1JA 1TK8A 1J5OA 4CLLA 2KO1A 1HBUA 4NXNJ 3GV7B 3ADAC 5DJBA 5HATA 1QDUB 3SXLA 1I51B 2B6AA 4LBHA 5MLCV 5IV4A 2IVMA 2BACA 2J6UA 4WCEQ 4JI1J 2VKZG 1RI7A 4DFJA 3PR5B 2O66A 2PEHA 1Q81T 1TAUA 1SJQA 1OPZA 1RJJA 4FNIA 2D41A 1PSDA 1S5ZA 3FRZA 3VVUA 5DG8A 3C6UB 3CD0A 2HS0A 3JTNA 2B0GA 1YWXA 1RTZA 1S1XB 3ELHA 1DARA 7FDRA 3R6LB 4F0MA 2VHGA 2G0JA 2XO7A 1FJEB 3BR9A 3HKZD 4PEOA 2AF6A 2QV6A 3THTA 4ED7A 3A3OB 2VONA 5KFWA 4TNOA 3K8VA 4O44A 3MR5A 1LXNA 1SJFA 4BS2A 4PRFA 3GJQB 2ZWPA 3O3LA 4BWMA 5DGBA 3HXMA 3JTPA 2ZNYA 1QTMA 3CGIA 1VC5A 2CQ3A 2HS3A 3H90A 3BKTA 4P2XA 3PIOQ 2MKHA 1NDCA 7AT1B 5E3AA 3OPKA 4C7QA 4A46A 4P72A 1BC6A 1IBMF 1RAJA 3I6PA 2HNDB 1BXNA 2B4PA 3CDBA 3NOGA 1F5CA 2GHWA 4DUZJ 4P2SA 2FJBB 4RNOA 3KLFA 5GAGU 4IDKA 2RRNA 3HSJA 5K8MA 3BO2A 5J2PA 2MKSA 3FJ2A 1HWLA 2KM8B 2BOPA 3VGUA 2YWWA 4NLRA 3V4IA 4EK2A 1NDKA 1TQLA 1U1PA 2DRDA 2EG1A 4X65J 3KG1A 4NRTA 2DR9A 4K4WA 3A3PB 3ET6A 5F0UA 4MT1A 2CNOB 3J7A1 3NCQA 2H5IB 4HDGA 2V2VA 3D28A 4MKAA 2V67A 2AIRB 4USVA 3WQPA 2A0FB 1Q8BA 1BGXT 2HWIA 3BGRA 3M2RA 2M8DB 2OAUA 2LLZA 2U1AA 2ZVSA 3DRSB 3AB2B 1PGZA 4A8WA 3I56S 4NYPA 2YKMA 1U0HA 2IYIA 3I9V9 4URQU 3U02A 3H5YA 4LVNP 5IQQA 1LWFA 2M8HA 5KFBA 1VLYA 3JSRA 2X1BA 2V9KA 1N5YA 3HZEA 3BBFA 1S0OA 1JNZB 1S99A 3QGGA 3VHQA 1HQEB 2OSQA 1UVJA 1C0TA 5EDWA 3PG9A 4NA1A 3JS9A 4HEA9 3T1HJ 2DH9A 4ECWA 4CO2A 1K9MT 1NKEA 3VAMA 4K0KJ 4HTJA 4J5OA 3HVWA 2R2SA 4X4UA 4FYXB 1RWXB 3M6VA 4RW9B 3VZHA 2DR5A 1RAAB 1UJ5A 4O3OA 2COLA 2F4VF 1BD6A 2L48A 3QT5A 3JAMY 4DSFA 5F3ZA 4M95A 5GADI 3KYLA 1OYDA 1RLDA 4U7CA 2K7JA 1MMDA 2HFNA 3UD5A 4WP3A 5GMDA 2KHDA 3CCWA 2F3JA 2W9AA 4WKRA 2VBZA 2MMYA 2OUGA 4LF6J 1JLAA 2QC3A 1FEHA 3FMWA 5IOLA 4IOBA 4OHZA 4ZPDA 4B02A 3FFIB 2HMIA 4NLWA 1YRTA 3AOCA 1JJHA 4ZJQA 3QLHA 4B3RF 2IMWP 1ZPVA 4Y00A 4TQRA 4YB5A 2MZQA 1TL3B 2J9EA 4CO0A 2R42A 5DO2A 2JLFA 1UZDA 1WG4A 2DNRA 4M5DA 5F9NA 4KJIA 1QVFR 4N77A 1DY3A 2BABA 4CH1A 2IA6A 3MXHP 2E44A 3PO4A 3HHLA 2MY7A 3H2UB 1XTZA 3MM8A 1R31A 4DR3J 4I0WA 2IIHA 3C15A 5DM7Q 1X7VA 3HF5A 4XDDA 2CJQA 4KHRA 3GQCA 1S1UA 1TR0A 4LF9J 2CJYB 4HDHA 2ZOMA 3DOKA 4P7TA 4ZLJA 1VS3A 4DFKA 1LFPA 2LEPA 4O3SA 2EW9A 1T02A 5G4DA 3C8YA 1JLFA 3E01B 3FQLA 2MKCA 3ENWA 1NK5A 4BWJA 4LRDA 4FDFA 2BKPA 3TJ9A 2BW7A 1N33J 3PJWA 4OHYA 5E3RA 5A8WB 3PX4A 2C2RA 4JV5J 4Q45A 2JEIA 3DXSX 3M9MB 1B0TA 4XTTA 4TY9A 4DEZA 3BS9A 1YJWS 4CLSA 3WX8A 1BUXA 2W9BA 3UCZP 1RAOA 2F4FA 4C8ZA 3WBZA 4USMA 5HANA 1ZAXA 1RAGB 1VJQA 4YR0A 3OTOJ 3GIIA 1L3VA 1U26A 4CTAB 1Q0NA 3WIUA 1X4DA 1GXTA 4Q5VA 4Y2IA 2HHWA 3B4DA 3DLLQ 1RE1B 2QL5B 4I56A 3BBBA 2WB1D 4RBUA 2J9DA 4ZPVR 1Q4RA 3I87A 4G65A 1DHMA 2P9GA 3GG0A 3TAQA 1HD1A 4NA2A 1SVDA 4CNYA 4RR5A 3PDNA 1HWKA 3VALA 2BANA 1FO1A 3TVZA 3B6BA 3DOMB 4RW6B 4OJGA 1SBRA 1ULRA 2DNGA 1F9FA 4NLQA 2DKOB 3UNGC 4EMDA 5I42A 4AL6A 3MHYA 1VYAA 2UVUA 1TKXA 2E5GA 4K7QA 3CDUA 5C2GA 2ZDPA 4CP5A 3D0HE 3CC2S 5ETVA 3DMJA 1MU2A 4USIA 1RTDA 1UAWA 2HBQB 4U8VA 3CWJA 3I31A 3MEDB 2KN4A 3CPWR 3JSYA 1S77D 2Y0SD 4KFBB 4RNHA 5J1EA 1C1BB 3M8SA 4NZ6A 4HR2A 2DNZA 3T1HF 2GO9A 3G86A 4TVAB 2ALYB 1FI4A 3AFGA 3H8YA 4NLGA 1C1CA 2DXEA 1M5PC 3CCMS 1IKWA 5HLFA 3CJRA 4ZN1A 1NJIT 5AXNA 1ELOA 2K06A 2CNKB 4WYLA 3KOAA 4O3QA 1LWEA 3N5FA 2VDIA 4NYOA 2J6SA 1A9NB 3MEEA 4PR6A 1FF2A 3A4TA 4H4MB 3IM9A 4YHHJ 1VQPS 2AJ4A 2RJZA 1QSLA 1RT3B 2XYHB 3I0SB 1HNVA 3B4MA 1WOPA 5JJBA 3BQ0A 5HP1A 2ZC4A 4DBQA 1OMSA 4RW8A 3IR5B 5KFOA 2GO8A 2V4QA 1N88A 2OI2A 2D74B 2RQCA 2V8VA 3R7SB 2DNOA 5GVQA 3TZZA 1FFGB 4PQUA 1DLOB 2HIYA 3VQSA 4Y2MA 2BKOA 1Y10A 2YY3A 4M5MA 1SUQB 2VFSA 1NK7A 4DR1J 3WC2A 4C97A 6FD1A 1NXIA 3Q24A 2QYCA 4PYDA 3HCXA 1H2VZ 3ILJA 1F9HA 4FN5A 4F8RA 4Y2CA 1LWXA 1DURA 4DR3F 3PFOA 1TELA 2DPJA 1UMJA 4GC7A 1VLOA 2KYXA 1FD8A 2I2YA 2FD2A 4XDCA 3MEGB 2POKA 1S76D 3CMQA 2YTCA 4JI3F 4WXWA 3LAKA 4U95A 4WE1A 3BKFA 4J9KA 1R0BG 2P9CA 3IR6B 4QPTA 3QGHA 2E9ZA 2VG7B 2I5JA 4DG1A 1RWUA 1GXLA 4OX9J 3JSMB 1TTHB 1N33F 4UZCA 5C25A 3WIVA 3V6DB 3KMSA 4UOGA 1UVNA 4JV5F 1X4BA 2R7VA 3P45B 5CYQA 4AQYJ 2MHEA 2V4JB 1WF0A 4TY8B 2GCFA 1S1VA 5LXYA 2KHCA 4ZVSB 2M0GB 4NRUA 2FUG9 4MKBA 5D78A 4DN9A 1Y5IB 1V3ZA 4CO3A 3MR2A 2LQ9A 3MPVA 4ERDA 1PJ6A 1X9SA 1V6HA 1AFJA 3RW7A 2XY7A 1Y5NB 3MPWA 3OTOF 2MYFA 2P6TA 2ABYA 3KJVB 2ZWOA 1TKZA 3HD1A 1NJWA 1HBNA 4TXSA 5GAHI 2CPZA 2Z2MA 4ENOA 3G6YA 2QSFA 3GV8B 3JYTA 3PZPA 1KS2A 3T9ZA 3T1AA 3HT3A 4HHHA 5IWAJ 3W2VA 3H2VE 2VPZB 2AJ0A 2XMUA 3UN3A 1FDAA 1NH8A 3HM9A 5F8HA 2XTJP 3VQTA 2YKNA 3B78A 4DV1J 1WHXA 5BR8F 3HKWA 2RMLA 1MWYA 4AXIA 3NNHA 1M90T 3NGDA 2VQEJ 5HQMA 4YY3J 2LEBA 2JRSA 4B9SA 3M2VA 2YH0A 5DDQC 2DCUB 3Q8SB 1V3SA 5L38A 2UZAA 4DUYF 3EZUA 1WNEA 2FTRA 2NXJA 3SV3A 3BQ1A 2H5EA 1Q79A 1IKVA 4FXVA 2KG0A 2DNHA 2YNHB 3MECB 8ATCB 2AEMA 3MMAB 4J9LA 1B0VA 2XNRA 4PG4A 4FP9A 1CQNA 1AUDA 1JLBA 1S48A 2RVJA 5E2QA 3LTOA 2QEXS 2QA4G 1UP1A 4ELVA 1RT6A 3R5GA 1T9VA 5ETOA 2CZ9A 1D8ZA 4QR1A 4ZVQB 5D0GA 3KK1A 5D3GA 4U67Q 3NP5A 1JJCB 2A2CA 3QT6A 4NCGB 1TKTB 3RTVA 2QSWA 2QMWA 1NK8A 5K5MA 5HL7Q 3PO5A 3I5BA 2KB2A 4M5IA 1ITPA 3PW7A 1NK9A 3CUNA 3TUPA 5HMZA 4LR7A 2J6TA 4ZHRA 3DI6A 3NBPA 3IRXA 3DLBA 3DRRB 2PFFB 4XK8C 3PXGa 3FEXB 5K8OA 4DR1F 3M7VA 1FVSA 4F3OA 1HWIA 4M5KA 3EXCX 3LGHA 2DJWA 3L3CA 1S72S 2GQ2A 5AJ3F 4M8LA 4P75A 5KT5A 2R7SA 3PJ9A 3VAKA 1NDLA 4LBPA 1WEYA 2VG5B 2XI3A 4U8YA 3N01A 3K58A 4B3OB 2AV5A 2VFRA 4MFBA 4ZPAA 4JI2J 2X51A 4JI6J 2CFXA 2FJAB 3LAMA 2FLPA 1FXDA 3W1YC 2JFKA 2CQ4A 3OR2B 2GNKA 3MAHA 3KXDA 2LQBA 4IG3B 3D7SB 1IN0A 3ISZA 3J80U 4DR4J 3L95X 1W26A 1UVKA 1RCOB 2NSCA 3DRPB 1OSCA 4AQYF 3DOLB 3K59A 2B3TB 2HHHJ 4PWDA 1SC6A 5ITHA 2W4DA 3HP6A 1UA0A 1C0UB 1HNZF 2FVPA 2L9NA 3ENVA 2D3OR 3NL0A 4MK9A 2D3UA 4DR7J 2NREA 4PABA 3A12A 1RT1A 2HVEA 2E9RX 2HQCA 3F73A 2HSEB 1HHQA 4NE9C 1S6OA 4Q44A 2UUTA 2UXDJ 3BYRA 5HQ8A 5GADU 5HROB 1TVRA 2AMCB 2C1EB 2MLYA 2B5JA 4CRJA 4UT4A 2VA2A 1HNIA 3GYXB 1X5OA 5IC6B 1OY9A 4A4JA 2UU9F 3S01A 4AD6A 2HGNA 4QWBA 1BQMB 1I5OB 1VBKA 1I94J 1N36J 2BBEA 2XG8A 2NS1B 2APOA 2NUUG 2FVSA 2RU9A 3OL6A 3BEGB 3J80Y 4I2PB 1NHVA 1TZ0A 1YSJA 3EPIA 2IRXA 3MOJB 3LP0B 1RT5B 3H7HB 3H5SA 1E6VB 3FCWA 5A8KA 4NPOA 1U8SA 1M5VC 3KK3B 2K1RB 1WC6A 1DTTB 2PC6A 1WG1A 1V5IB 5KT7A 4GMKA 2QG9B 2WSFC 1VQ5S 2DGSA 4WFNQ 1S9FA 2ILZA 2EFNA 8RUCA 2BE7D 4TKTA 2HVIA 3AY0A 1X0FA 3PX0A 3MEKA 2J7UA 3RRGA 3NCRA 1X4GA 3ONQA 3CJKA 2E5LJ 4WFYA 5HO4A 5J2QA 2VKRA 2OSRA 5IT9U 1WSVA 4QR0A 2BE9B 4KY3A 4CT8A 4LQ9A 4PCQA 1NSQA 2A6MA 2R8GA 4CQ1A 4LMZA 2D3O1 3HSGA 4EU0A 1H2TZ 5THWA 1XJWB 1TV6B 2NXUA 2YQ0A 3HFKA 3MUVP 4Y28C 3NKYA 2Q79A 1WF1A 2W2NP 3JQJA 1T7PA 2CJAA 4QQBA 4Z2XA 2CJXB 3FBEA 4BLGA 3EZ5A 3KFWX 4KGVB 3QZ8A 4KKOB 1VQNS 4B3SF 4C8MA 2Z30B 1REVB 3E2EA 2GQQA 4X66F 4TU9A 4R5PA 2HYIB 4B9VA 2BQRA 2BJEA 3OVAA 5T7LA 3RAMA 4HTIA 5IM0A 2YPYA 1S79A 2JLGA 2DGOA 1VISA 5LJ5Y 2UUWA 2XULA 1ACMB 2OPQB 3RRHA 3CO9A 2CWXA 4FVCA 3RB0A 5EX0A 5IT9Y 2N4DA 3RBXA 4CLZA 3OTEA 2EC0A 1UCNA 4LR9A 2GHVC 1RAEB 3UPFA 3OFFA 3M6XA 3QIPB 1F2HA 1NJYA 3OD2A 2GVDB 2CUYA 4DR4F 2W8LA 1DQ9A 5D4PA 1UZHA 3OL7A 4K4UA 3CCES 1L3SA 5F9LA 1RADB 1B99A 3TVYA 1U1RA 3ITHA 1H7WA 2DH7A 2V6AA 1KOHA 1KP6A 2ZE2B 3DLKA 2GQCA 2WVBA 4DF8A 1ZYQA 1HR0F 3CMES 1K1SA 1KNZA 2IHR1 2VASA 3GSIA 2N3OA 3IM8A 4FS1A 1RTHB 1VCTA 3T6BA 4TU8A 2V63A 3I4PA 5CQGA 4YQWA 5KFRA 5LSRA 4NXMF 3W2WA 1X4FA 3KNAA 2YH1A 4HH1A 2RH3A 2Y9HA 5DG9A 4CH0S 5LJ3Y 1A7GE 4DSLA 2MZJA 5L9XA 4ZIVA 1BY9A 4ILMA 4TN2A 1I94F 2VPYB 2H48B 4NZ7A 1SKRA 3SIPB 4EI2A 2AZ3A 5KG6A 3VR1A 1QD1A 5F0WA 4DLGA 5B09A 2ROPA 4YS2A 2Y8WA 3L09A 3CCRS 2K1RA 4ZP7A 4DV7F 2AHOB 1IQZA 3M05A 4KO0B 2WVEA 3V81A 3EX7B 5ETTA 2CJ9A 1T05A 3ZTRA 5ETLA 4LRFA 3RBEA 5AXKA 4NI2A 1KBRA 1U25A 4A47A 1RWPB 1EP4A 4JI8F 2ZH6A 3ZZOA 4LFAF 3GILA 2FY1A 3QIDA 1FHTA 3TZXA 4DV3J 2B8QA 3D3BJ 4EFAC 4CLFA 2C28A 3Q0AA 2BM1A 1SL2A 1M1HA 1WC5A 2HFOA 3J7ZT 3IO1A 4OZ0A 2K3KA 5C7PA 2UUBJ 4LSLA 4J9PA 1TK0A 3C14A 2JOQA 2ZZNA 4J9SA 3C16B 1YITS 2GGPA 2QFJA 3QRQA 2MSSA 1AFIA 2DNNA 3J7YI 1VRUA 4U9RA 2VH7A 1JJ2R 2WVCA 2EC2A 1XR6A 4X64J 1IXKA 2FLOA 3HHNB 1CBKA 3UWTA 1DZ5A 3LP1A 4C8OA 3DU5A 2L41A 1LKZA 3TNVA 5GAHU 4KPCA 5G0RB 1FKOB 2VB6A 5LM7E 1FE4A 2XMJA 1HNWJ 2CIMA 5C2CA 3LF0A 2QTWA 1B64A 1UPPA 5KFPA 4WWSA 2PSZA 2V1SA 2HEKA 2VBXA 3G87A 4DCOB 4OLOA 3QYYA 3N6NA 4QWCA 1UPMB 5HQLA 4DOZA 3VCDA 4JI7J 2H1YA 5E5NA 1F6TA 3IFEA 2HNZA 3PW5A 4KH1B 4NLXA 3QMQA 2C3OA 1F5AA 4X4QA 2L9WA 2VJVA 1GX6A 3FEYB 3FCVA 2PGCA 1C4CA 4G3IA 1HMVA 5F8NA 1GT8A 2VDHA 2BE2A 3M1VA 4LSNB 1Y3JA 3AJDA 1IBKJ 2O3DA 4NLTA 1YJTA 4J9MA 2O01C 3DYAA 5FDLB 4B3TF 4C8KA 4HL9A 2IM2A 4N76A 5D6GA 4LREA 1SH3A 3PEHA 2WW4A 3SI8A 2E29A 4F4YA 3OLBA 2CZ4A 4UY85 4MK7A 1N5SA 3SSQA 2M88A 3H20A 3LA0A 5M2PA 1X4AA 4WFBQ 2V8HA 4ZCKA 4DR6J 1MNEA 4CLKA 1D3WA 1GAOA 5CZXA 2FPHX 1ZETA 2AGOA 2FHJA 4B3MJ 5KFHA 4M94A 1PYSB 2B9YA 2FGOA 1R8AA 3ZZTA 5U47A 3FSYA 2LXFA 4L3KA 1RWOB 4ICLB 5B0AA 2ZNZA 1JMTA 1KLMB 4LQ3A 2R4FA 3OXGA 2P5VA 2DVIA 3DKDA 4JI5J 3AD8C 2DR7A 2UV8G 5DLGA 2HFZA 5J1PA 2DBBA 2FZGB 1SQGA 2HNYA 1QTNB 3N6LA 3HI9A 2CQHA 4ECYA 1S0NA 5DZ6A 1HYSA 1TUWA 1JQGA 2OGUA 1T8EA 3PYEA 1CG2A 1SIWB 2LU1A 3VAIA 1BMQB 1CULB 4OHVA 3QO9B 4ZLPA 3M32A 4CYUB 2YNIB 2CQ1A 3IMQJ 4QIWD 4I2QB 4ZVTB 3T6JA 4FYYB 1XWLA 4AFFA 3CJ5A 2XTDA 4WFXA 2G1DA 1BQXA 2RS2A 1RT7B 3CC4S 3R1HA 3A8JA 3O5TB 2JDJA 2DT9A 1RHMB 4DV3F 3PRDA 1T0TV 4RWWA 1UKUA 1VQKS 3G6XA 4KPYA 1SKWA 1C2PA 1IR1A 2QX0A 3SSRA 3D1QA 4BCAA 3CD6S 2DNLA 1PJ5A 4P52A 1X5SA 3RR7A 5E33A 3MM5B 4NOHA 4OJ1A 4IG0B 4KV8B 2FJXA 2OD6A 2AJQA 2UUBF 4ZVOB 3SCIE 3BH6B 5IT4A 1MN7A 2NZCA 3E51A 4HACA 3ENAA 1TFYA 4QYZJ 4ZOSA 1TU0B 2W2PP 1G4CA 3U1NA 2VUGA 5B0GA 2CDRB 2PIIA 1QVGR 1H74A 3PKMA 2J0QD 4C0OC 2ZVIA 4LRCA 4F50A 1WI6A 1EARA 2BJ9A 3US5A 2GJ2A 3BGFA 2W9CA 3Q8PB 4JYAF 1VR6A 1JKHB 4F4AA 4RL1A 3KLEB 3VGSA 5T14A 4ZS6A 2BM0A 5KFJA 3OW2R 2G2YA 4QWAA 1N32J 1HNWF 3OTDA 2VIHA 5DETA 1S49A 3K89A 4DV0F 1U09A 1ZS6A 1ZBTA 3OHBA 2C2EA 1N5QA 2BR0A 4G1IA 2IJNA 3D9BA 1FVQA 2Y0BB 1QUPA 3MMBB 2X1FA 1D9AA 1TK5A 2CQBA 5CH7B 2R2RA 2XWXA 1HQUA 4HLBA 5RUBA 2W8KA 2LU2A 1FWLA 3AD9C 4O0NA 3H40A 4CNZA 5DZ7A 5HSPA 3LP2B 3PACA 4I64A 4MIWA 1HI0P 4DV6J 3NWRA 1L5UA 2VFTA 2YQ1A 3MUMP 1IBKF 4USTA 2DY1A 4ED8A 1ZM9A 2KZZA 3QPIA 3BN7A 4LF8J 4ZP9A 2VJUA 2VQFJ 4NEZA 3TA1A 4ETZA 1KEKA 4MIAA 2C2NA 3A8IA 2ILYA 3IG1B 5LOQA 4C8YA 3IGVA 4D3GA 3NGSA 4DR6F 2B7CB 4ZA1A 2E7VA 1VQ7S 4AYBD 3BQ2A 4RBTA 3KMQA 4OX6A 4DL5A 4UW2A 1R3NA 2XSJA 1HWJA 2XBPA 1AT1B 1IWGA 2ZC3A 4MK8A 3ZZRA 3NGTA 4BDPA 1HNXJ 1GQEA 4GVBB 1IM6A 2FJDB 3ILOA 1D1UA 4IH7A 1RKJA 1RAFB 2JZ5A 2YKPA 2XY6A 3MM7B 1HW8A 4ECTA 4C3KA 1NK0A 1KFDA 4YR3A 1ZM4A 1YIJS 3O6QA 3RUBL 4NL5A 2J7KA 1Q53A 4Q0BB 3LO3A 5HAOA 1HPZA 1PBUA 1NPPA 4IFYA 2FZCB 4UOHA 3EVWA 2IVYA 2HIQA 5KAKA 5L1LA 1RWMB 1FWKA 2AGQA 3GIKA 3F44A 1CEZA 1S0MA 3F41A 2A18A 3PFEA 2FHJD 3S7RA 2XGQA 1MMLA 5C24A 2IM3A 2Y1LB 4F3QA 3J81U 2M4MA 1NDPA 3BB5A 3NS6A 2HK3A 3NWGA 4H4OB 1CJUB 1NHUA 1SC3B 2ZJPQ 2OO4A 2DITA 4DJBA 1MN9A 1PC5A 3H25A 1QE1A 2R7TA 3M30B 1KONA 1CJKB 1NJZA 2LKZA 3OHAA 5KFZA 1FE0A 1NU4A 1J5EJ 2ZH5A 1BQNA 3RAXA 4LF5F 4WXOA 2DNPA 3IN5A 1VGYA 1YZ6A 2J8SA 2J7WA 3KK2A 1N52B 2B4VA 1JXVA 3SEOA 1FKPA 1KVIA 4CWBA 4LF4J 3D1HA 2WBRA 1VQLS 3I0RA 1RU2A 3MMCA 3QNWB 2HVHA 4J9OA 5KT2A 3BO3A 5A8RB 2G9OA 3K17A 2GAGC 1JLCA 4OV1A 3KLGA 2QT7A 2PA8D 1GXUA 3SV4A 2OPPB 5FLXU 2NQPA 3TUZC 2DNQA 1SJRA 3R1LA 2L9DA 2LDYA 1EKRA 3W63A 2D9PA 3O44A 2JHEA 4RJVA 3W64A 1VQYA 2ZHOA 3WHIA 4LRAA 3D5MA 4LIRA 4OL8A 4FYVB 2CDQA 4J9UE 5CAAA 4ZITA 3KHHA 2OPRB 4O4RA 4C11A 2NYHA 3JTOA 1Q5VA 3T5LA 1RISA 3I4HX 4UF4A 1CS4B 2BOAA 1AZSB 4FYDA 3CCZA 1K0VA 2R8IA 2UUAF 3GYGA 3ISND 3TAMB 2KZMA 1RDRA 2VL1A 2HHVA 5EX3A 3EUNA 5B08A 3WC0A 2IAJB 4IFVB 3QJLA 2WBMA 4DV6F 3HX9A 4A8XA 3TO8A 1N6QA 4J9NA 1VQ6S 4B9MA 4RUHA 4EBDA 1K73T 2X1AA 1B3TA 2HKEA 2CQPA 3V6KA 1VQ9S 1HI1A 1Y9OA 4RBVA 1NLKL 5ADZA 3FSIA 4U7UD 4W92B 4NLOA 5FLXY 1R0AA 5B0DA 1Q86T 2B8PA 2K7KA 4S0MA 1KKHA 2KT3A 2CQCA 5IC4B 3TUJC 5BXIA 2BYCA 5DDOC 5E7OB 3K7RA 4X2BA 3KLHA 5F8LA 3GWCA 3OR1B 3GPAA 4U7UK 2DPIA 5KFAA 3CD5A 3TQ1A 1UWBB 3L7UA 1N5TA 1SQEA 7FD1A 2E66A 5H9FK 4ZJLA 2EBGA 2IC3B 2R2TA 1EX8A 4IRCA 4ECZA 2HW3A 3J7YU 3M8PA 4L75A 2ZZMA 4ZLLA 4RW4A 3SCKE 4KHMA 1TL7A 4IRKA 4O3NA 4IR9A 3KG4A 2Q1LA 1R8CA 2C3MA 1R0CB 2IA0A 2V1TA 1BWEA 1LW0A 4DL6A 1W2BR 1FRKA 2OJ3A 2CG4A 3I96A 1OYEA 9ATCB 1FNMA 5HMYA 4OI3A 2EPIA 1OY6A 1XNQF 2E5JA 4WZMA 3QWPA 1YJRA 3SDEB 4GC6A 1Z2ZA 2F7VA 4BC9A 5F8IA 4KHPF 2EG2A 1JK9B 4DV4F 4PZVA 3MTJA 1DTQB 5GAEI 1RWKB 3R6GB 3W8GA 2CKWA 4A48A 2GIRA 2OP5A 4H54A 4PUOB 1SV5B 2NCKL 1PILA 2ZJRQ 2JEJA 2QRRA 3AX5A 5KTQA 1N56A 5I3PA 2Q6BA 4DSIA 4CIOA 1T9XA 5I4MA 4RUAA 1OM2A 4L3NA 3DM2A 4KR0B 3HVRA 3L7OA 1S6PA 5CYMB 2AYEA 2KT2A 2PDAA 2WONB 2Z4PA 2Z57B 4ILLA 4RW7B 2VA3A 3NEKA 2ZUGA 4K4TA 4DL7A 1IWAA 3GCWP 2E1CA 4R8UB 1GX5A 4KT0C 1K47A 1WUUA 2W4PA 4ES2A 2BRKA 4WK1A 4Q8FA 4CM0A
chains in the Genus database with same CATH topology
4I2PA 1S48A 2M3DA 2RVJA 1ZPWX 1CPZA 1N6QB 4RX6A 3N79A 2W25A 2KJWA 3DGPA 5E2QA 2OTJS 2XLKA 2DGWA 2ACYA 5KOWA 3MCSA 3LP0A 4WU3A 3OSNA 4ED1A 4ZPCA 2QEXS 1TL5A 1RT5A 3GZ7A 4ZMMA 3I55S 3MR3A 1E6VA 3RZAA 2QA4G 3HHKA 1FDDA 3DDKA 1RP5A 1UP1A 4ELVA 3CXCR 1FXRA 1RT6A 3ZC4A 1IKXA 1DAXA 2ZOFA 4KRWA 4L6V3 2AP6A 1S0VA 2VOOA 2CQ0A 2NSBA 4X4OA 1HWUA 5EWGA 1IBLF 1D8ZA 1CQMA 2MZSA 4QR1A 2JL9A 5I3UA 3KLIA 2YWEA 3KK1A 3MPYA 5D3GA 4ZVGA 4U67Q 1R0AB 5K8PA 3NP5A 5L9NA 2A2CA 2FLNA 4F4KA 2FJEB 1QUVA 4NCGB 3KK3A 4WE1B 2KFZA 1URRA 3BF4A 3GMGA 4XPEA 2OKQA 1DTTA 1LK7A 1TKTB 3RTVA 5KT4A 2R7UA 2RS8A 4B3MF 4OHWA 2QSWA 1K1QA 4I7FA 5IQ6A 2QMWA 1NK8A 1L3UA 5K5MA 3JB9k 3BSAA 5HL7Q 1JJ4A 1RTIA 3PO5A 3I5BA 2KB2A 1KQKA 2I5JB 4Z37A 3KLHB 3PW0A 1VRTA 2Z0GA 5J2MA 4DQPA 4RUCA 2RU3A 3QJJA 3PW7A 3FEZA 1WWHA 1R6YA 3QGPA 1NK9A 3CUNA 1OO0B 4DG1B 4RU9A 3ULHA 5HMZA 4H4KA 5F3TA 3VF0B 4B9LA 2J6TA 4F25A 1UVIA 4ZHRA 3DI6A 3NBPA 3IRXA 3DLBA 3DRRB 1FERA 3AH6A 2PFFB 3RW6A 2MJNA 4XK8C 3R3TA 1FDNA 3PXGa 5C25B 3SCJE 3FEXB 5K8OA 1I1GA 2IRUA 4DR1F 1X4HA 2GHPA 4JI5F 3QZ7A 3TP2A 4LUBA 3J7Z5 3HJFA 1AW0A 3HHEA 3M8PB 3B8HA 4J37A 1LFWA 1FVSA 4LVOP 3M2UB 5CYQB 4F3OA 1HWIA 2D7SA 4HVZA 2MGZA 4F4WA 2FJWA 4DUZF 2CPDA 1SJ1A 3EXCX 4ECUA 2DJWA 1S1VB 3TW0A 3L3CA 1KLNA 1S72S 2GQ2A 3H5UA 4RW4B 5AJ3F 4M8LA 3IWNC 2RIJA 5KT5A 2R7SA 5KFLA 3UI3A 3VAKA 4K4SA 2OIHA 3IWXA 1FNXH 1WEYA 2VG5B 3KG0A 2F8HA 2HRUA 5KFEA 2RQKA 2XI3A 5KFFA 3N01A 3CCJS 3K58A 4B3OB 2AV5A 2VFRA 2ZBIA 4MFBA 4ZPAA 1SH2A 4MH8A 3K5NA 2XS2A 2X51A 2XWYA 1DFDA 3Q23A 1LW2B 3UD3P 2CFXA 2PA3A 1LW0B 2IMOA 2FJAB 2V2KA 4X65F 3LAMA 3UR0A 1T03A 2FLPA 4ID5A 1IJEB 1TV6A 2I1RA 4O23A 2ZH4A 2HHUA 1FXDA 2GMHA 2JFKA 3OL9A 1KQGB 2D3ZA 3RRKA 2VG6A 2CQ4A 4GO7X 3OR2B 2GNKA 4O4GB 5B0FA 1TKZB 1OQ6A 5CXTA 3MAHA 1GNKA 2GIQA 1HBNB 3LGNA 3NS5A 4OI0A 3DLGB 5B7WA 2LQBA 4IG3B 5HN0A 1U1L