4NLSA

Poliovirus polymerase - s288a loop mutant
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
457
Chain Sequence
b'GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPAGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
total genus 140
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nlsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nlsA02
2YNFA 4RNFA 1HMVB 3KOAA 1IKWB 2O5DA 4ICLA 1C0UA 3JYTA 5F8HA 2HNYB 4ECUA 4FBUA 1JXLA 1JLEA 4EYHB 1JX4A 2WONA 5DQIA 4KFBB 5KG0A 3QO9A 2WOMB 3DRSA 1SV5B 5KG2A 1RT6A 2AWZA 4NLDA 4KKOA 4ZPAA 1TL1B 1JLQA 1TVRB 5CYQB 5KT3A 5J2MA 3D28A 2W9BA 1FKOA 1JLFB 4TYBA 2ASJA 3UR0A 1S0MA 1J5OB 3RBEA 3BGRA 2V9WA 4PWDB 4IDKA 3QYYA 4ZPBA 1RTIB 4URQU 3KK3B 2I5JA 4I2PB 2ZE2B 3KMQA 4NLWA 1MU2B 3KLIB 4YP3A 3M9NB 3T5KA 4MIBA 4O4GA 3FRZA 2OPPB 1SUQB 2XGQA 1S1UB 1RT2B 4RW4A 4QW8A 5JXSA 2JC0A 1JLGB 2BQRA 4O44B 2EC0A 2W7PA 2XCPA 3GQCA 3LAMA 4XPEA 1RTDA 2RKIB 1KHWA 3G6YA 3CDWA 1Z4UA 4H4MB 2V0NA 5KFQA 2HNDB 3QLHA 4TYAA 3LP1A 1S1VA 1S49A 4ECQA 4RW8B 4G1QB 3V4IA 1S6PB 5J1EB 2C2DA 1QE1B 4WXOA 1DTQA 3KK2B 2AGPA 4EBEA 2WK4A 4TQRA 5DQHA 1HQUA 5FDLB 3KK1A 3DOKB 3QGHA 2OPQB 1S1WB 3KLFA 2RF2B 4ECRA 1FKPB 5F8GA 3H59A 3MEDB 5HLFA 3QGIA 4KSEB 4MKAA 3V6KA 4DL5A 3DLEA 3CIZA 4U6PA 1TKXA 2YNGA 5KT5A 5C25A 4NLOA 4LSLA 4J9OA 5KG5A 3DRPA 1OS5A 4ZPCA 3HVWA 3LP0A 3H5YA 2B5JB 2WRMA 4LQ9A 3DOLA 3Q8SB 3IN5A 3BR9A 1D1UA 2W9CB 4IR9A 3I0RA 3KLGB 4KHMA 3FSIA 4K4VA 2B43A 1C1BB 3JSMA 2J6SA 2IC3B 4Q0BA 2ASDA 3RB0A 1RT4B 3T1AA 2FLPA 5KFNA 3IGVA 4ECXA 4ZVGA 5K14B 3DM2B 3PHEA 4R0EA 4QWDA 1ZTTA 2FVSA 4YQWA 4KO0B 4R5PB 4NLGA 3N6LA 2R2SA 3IS9A 4PQUB 1IM4A 2HMIB 5KFWA 2ATLA 3N6NA 3BSNA 5I3UB 2VG6A 4QWCA 2XI3A 3M8QB 4ECSA 4JV2A 3OL9A 5KFZA 1LWEB 2AX0A 3LAKA 1BQNB 2V4RA 1RT5B 2C2EA 1LW2A 2R8GA 4WYWA 1RA7A 2HNYA 4R8UA 5KFHA 2FJXA 1JLAA 3MFIA 3DLGB 2YNHA 5DLGA 4RW7A 5C42B 4QWBA 1VRUA 2HWHA 1IKYA 3MEEA 4NCGA 4O3OA 3Q8QB 2OPRB 4ZPDA 2R8IA 1JLFA 4IOBA 3H5SA 1GX6A 1S6QB 3M8PA 5HP1A 4ED2A 2UVWA 2B6AB 4RW6B 5KT6A 4MIAA 4K4ZA 1TKZB 4K4TA 5KFPA 2UUTA 3V6DA 1JLBB 4K50A 1HNIB 5KFCA 4I2QA 3D5MA 4IG3B 4ECYA 4ID5B 4TQSA 1S9EB 4O44A 2CJQA 2JEIA 3QIPA 2R8KA 2BANA 1S1TB 5DQGA 3E01A 3IRXB 3V81A 4EBDA 3DRRB 4WZQA 2R8HA 3MR6A 3T19A 2HNDA 4J9SA 5J2NB 4WE1A 3IG1B 1TKTB 3BSCA 1LWFB 3GIIA 1T03A 2BQ3A 3MTKA 4KE5A 3KHRA 2VG5B 5I42A 4PUOB 4MFBA 3KLEA 1FK9B 1UWBB 1QE1A 2FJVA 1XR5A 5F8JA 4EO6A 1QUVA 2HAIA 5HROB 1D0EA 1TV6B 1HQEB 1VRTB 2GIRA 2IAJB 4QWAA 1EETA 1I6JA 4ZVFA 3DMJA 4IFVB 4X2BA 1C1CB 3GV7B 4IG0B 4ECVA 5J2PA 2UVRA 2WB4A 4KHRA 5KG3A 1TL3B 1ZETA 2DPJA 4HKQA 1REVB 4ZVEA 4IH6A 3V6JA 2XI2A 5C5JA 4WYLA 1RTJB 3NL0A 2YNIB 3CDEA 5F9NA 5KFKA 4J9LA 4LSNA 4ED8A 1HYSB 3MEGA 2D7SA 1N6QA 3PZPA 1S48A 1JKHA 5KFIA 1RT1A 4ED7A 4K4XA 2HNZB 3NGDA 3M9MB 1K1SA 4RNNA 3QZ8A 1C1BA 1N5YB 3HVTA 1JLCB 3MECB 2IC3A 4RUAA 3DLKA 4WZMA 3ICLA 3KJVA 3TVKA 5T14A 4NLSA 1DLOB 4F4ZA 3DM2A 4DL6A 3C6UA 4FS1A 5D3GB 4ZHRA 1DTTA 1JIHA 4IFYA 5KFEA 5KG7A 1RYSA 4JV1A 4NRTA 3H5XA 4O3SA 4H4OA 1K1QA 4NYZA 3M8QA 4B3OB 3CJ0A 1LWCB 3I0SA 2C22A 5KFTA 4RNHA 2C2RA 4O3RA 1KHVA 2BE2A 4Q44A 4RW9B 5DGBA 4I7FA 1EP4B 2YKNA 5DG7A 2V4QA 3Q8RB 1S9FA 4NLXA 1C0TB 3TAMA 3PJWA 5L9XA 5HBMA 1S1XA 2OPSB 1IKXB 3KMSA 2YKMB 2W9AA 1T05B 3MF5A 4MK7A 3N6MA 3OL8A 4URGA 3GIJA 4ED0A 1NHUA 1KLMB 3ITHA 3NBPA 1R0AB 2D3UA 2IBKA 2VA2A 3G86A 5L1LA 4DG1B 5DLFA 2WTFA 3GYNA 4F4YA 5DG9A 4IR1A 4OL8A 2FVPA 1RT7B 2WHOA 2I1RA 4DEZA 1RT3A 4K4UA 4KV8A 1WNEA 5CYMA 1TKZA 3BSAA 4QWEA 4IH5A 1JLBA 2ZD1B 3QGGA 3PR5B 1GX5A 4NZ0A 1IKVB 2FLNA 4H54A 3LP2B 4J9PA 1BQMB 2YNFB 3CVKA 2UUWA 3H40A 3KHHA 4Q8FA 4ICLB 3E51A 3JYTB 1C0UB 4DL2A 5KFVA 5DGAA 2E9RX 1JLEB 4KB7A 2WONB 5JUMA 5KT2A 2ASLA 2VG7A 3MR5A 3BSOA 3DRSB 4O4RA 4TY8A 5L1JA 1RT6B 2FJWA 1HPZA 1LWFA 4KKOB 2R2UA 1JLQB 5J2MB 2UVUA 2W9BB 1FKOB 2VG5A 4TN2A 1S9GA 1RTHA 4EBCA 3OLBA 3BGRB 5EDWA 2CKWA 4IDKB 3CDUA 2RDJA 3TQ1A 2ILYA 2I5JB 1HMVA 3DYAB 2F8EX 1IKWA 5L1IA 4Y34A 3UQSA 3FFIB 4O4GB 3G6XA 2C28A 2FVRA 3PW0A 1N4LA 3OSPA 4MK8A 4KFBA 4ZP9A 3H2LA 4RW4B 5KG6A 3GIKA 2WOMA 4DL4A 2R2TA 1SV5A 4QPXA 2XWYA 2QV6A 3FDSA 1TL1A 1TVRA 5CYQA 1HYSA 1RTDB 1T94A 3EZUA 1XR6A 1RAJA 3C6TB 3T5JA 4GC7A 4ZP6A 1J5OA 4PWDA 2E9TA 2HWIA 2W7OA 3QLHB 1RTIA 3KK3A 4NLTA 3LP1B 5KFFA 1S1VB 4I2PA 3KLHB 3V4IB 2ZE2A 3KLIA 1MU2A 3DDKA 4XPCA 1QAJA 2OPPA 1SH3A 1SUQA 1S1UA 4NLQA 1RT2A 2W8KA 1HQUB 3I5AA 1JLGA 3QIDA 3KK1B 2W8LA 4TXSA 1U09A 1RYRA 4IRDA 3FQLA 3KLFB 3NAHA 5D3GA 4NLPA 2RKIA 3PW4A 2QE5A 5HLFB 4H4MA 5KFRA 3DLEB 4O3QA 3GV5B 2D3ZA 1TKXB 2YNGB 3RAQA 1TP7A 5C25B 4RW8A 4G1QA 4LSLB 1S6PA 2RDIA 4ZMMA 5J1EA 3DRPB 4J9NA 4GC6A 3GIMA 4ED1A 3LP0B 3KK2A 2ZKUA 3DOLB 5KFAA 2JC1A 3I0RB 3BQ1A 5FDLA 4NLVA 3DOKA 2OPSA 1IKXA 2OPQA 4URSA 3JSMB 1S1WA 2R2RA 2RF2A 4QW9A 1FKPA 3MEDA 2FLLA 1HARA 4J9QA 4Q0BB 4Y2CA 5KFXA 3CWJA 1S0OA 4J9KA 1KLMA 2ALZA 4IRCA 5KFYA 3M9OB 4F4WA 1XR7A 3PW5A 3HVAA 5KFUA 3I5BA 5F8IA 4Q8EA 2BRLA 3VQSA 3CJ3A 5C24B 3LANA 2R8JA 3IS9B 4U7CA 3OLAA 2AGOA 5EWFA 2B5JA 2VG6B 1ZTWA 3SFGA 2BR0A 2W9CA 4JUZA 3KLGA 5F8MA 3HHKA 3LP2A 2D41A 5KFSA 4MH8A 3DI6B 1S97A 4RU9A 3OHAA 1RT4A 1LW2B 4YR3A 1N56A 4R8UB 3RAXA 1JLAB 3T5LA 2IMWP 5K14A 2YNHB 4RW7B 3MR3A 4ECZA 4RUCA 5EWGA 4TLRA 4KO0A 4R5PA 3CO9A 2J6TA 4EO8A 4PQUA 2HMIA 1VRUB 1IKYB 2IM3A 3MEEB 1YVFA 4NCGB 3KHLA 5I3UA 4WFXA 1S4FA 3M8PB 3RBDA 3NKYA 5HP1B 4IQXA 2WCXA 1LWEA 3V6HA 3RB4A 1BQNA 3DYAA 4NLUA 3MR2A 2AU0A 4G3IA 1RT5A 3EPGA 3FFIA 3V6DB 4XO0A 5J2QB 2JLEA 4I2QB 3DLGA 1HNVB 5C42A 3BQ2A 4J9RA 3OHBA 4ED6A 3KLVA 4F50A 1T3NA 3QIPB 4F4XA 2BANB 2J6UA 3V81B 3E01B 1S0NA 2OPRA 5L1KA 4K4SA 3CJ5A 1S6QA 3C6TA 3H5UA 5KFJA 2AQ4A 5KT4A 2OH2A 4WE1B 1T03B 2B6AA 1LW0B 2BRKA 4JV0A 4RW6A 2E9ZA 3KLHA 3H4DA 2XC9A 5I42B 2XGPA 3PW7A 4MFBB 5KFDA 3KLEB 4HYKA 1HNIA 4NLYA 2IM2A 5KT7A 4IG3A 2IM0A 4ID5A 4ECWA 4KAIA 1S9EA 1EETB 3SI8A 4NRUA 4EEYA 3DMJB 5KFGA 5KG4A 1S1TA 5KFOA 2IJNA 3IRXA 3CJ2A 3DRRA 5J2PB 4Y2AA 2DPIA 4ZP7A 2ILZA 4IH7A 4NLRA 3QO9B 5J2NA 3HKWA 4YR2A 3IG1A 1TKTA 3MFHA 1N6QB 3BREA 2VA3A 4O3NA 4PUOA 4LSNB 3GILA 1S10A 3MEGB 1FK9A 1UWBA 1JKHB 5F8LA 1RT1B 1RDRA 5HROA 1TV6A 1HQEA 1VRTA 2IAJA 4ED3A 4M94A 1N48A 3IGNA 4IFVA 3HVTB 1C1CA 4IG0A 4DL3A 3DLKB 2AGQA 1SH2A 1TL3A 5KFBA 1SH0A 3KNAA 3ISNC 3KJVB 4YMEA 2GC8A 3PVXA 1REVA 4K4YA 4ZP8A 3FQKA 3C6UB 1RTJA 2YNIA 4ZVHA 4MKBA 5C24A 5KG1A 4ZHRB 1DTTB 4IFYB 5DG8A 4FBTA 3OL7A 3Q8PB 1MMLA 3PW2A 4K4WA 3BQ0A 3RB3A 1C2PA 4H4OB 5KFLA 2IJFA 2HNZA 3KHGA 3I0SB 4WFYA 3OL6A 2BE2B 3DI6A 1JLCA 3MECA 4I7FB 1CSJA 3CJ4A 1N5YA 1DTQB 2YKNB 4MK9A 4YR0A 3G6VA 1NNDA 3PJXA 4TY9A 3RB6A 4RZRA 3TAMB 3NAIA 4Y3CA 2BQUA 1DLOA 5HBMB 1S1XB 3SFUA 4RNOA 2XCAA 3GV8B 2GIQA 3H4BA 4RNMA 2IM1A 5F8NA 4O3PA 3NBPB 4ECTA 3ITHB 5EUHA 1QAIA 3BJYA 4B3OA 4FS2A 1LWCA 1RT3B 3UPFA 4Q45A 4KBIA 4RW9A 2JEFA 1EP4A 1NHVA 4KV8B 5CYMB 2IA6A 1C0TA 5J2QA 2FVQA 5F9LA 1TQLA 4IRKA 1HNVA 2YKMA 1T05A 4DL7A 4Q43A 3T5HA 5EWEA 2FVCA 3UDLA 3PR4A 3H98A 1R0AA 3OSNA 2AX1A 4DG1A 1W25A 3NMAA 4J9MA 3I5CA 2JEJA 2UVVA 1RT7A 2VG7B 2JEGA 4M95A 4TY8B 1RA6A 1HPZB 1LW0A 4WXWA 3ISND 4WFZA 4LQ3A 3QZ7A 1S9GB 5KFMA 1RTHB 2ZD1A 3LALA 4EYIB 1IKVA 3EPIA 4IKAA 1BQMA
chains in the Genus database with same CATH superfamily
1IKWB 2K3IA 4ECUA 4C0OC 5DQIA 3AQOA 5E3CA 3KG0A 2KI2A 2XMJA 2W9BA 4I67A 2DHGA 4CP5A 1I3OB 3GMGA 2OFGX 4NLWA 1S0VA 4FYWB 1CEZA 1XNRJ 2L48A 3QT5A 4OX8A 3OTCA 2P6TA 1S1VA 3U1MA 4P75A 4FF3A 4J9VA 1HQUA 1HI8A 2NLWA 4QPTA 3V6KA 1HR0J 3GB0A 3CIZA 2JL9A 3MUMP 3Q8SB 1SIWB 2FTRA 2DNNA 3VAHA 3TJAA 4ZLPA 3T1HJ 4R0EA 3POTA 4NLGA 4KO0B 1IM4A 2FLOA 3P8BB 3LGNA 1KONA 4ECSA 5F3TA 2X3GA 4OYPA 2AX0A 4P6QA 3PYEA 3ZZ0A 4WP9A 1PC5A 2E29A 3CJRA 4ES1A 1NUEA 2X51A 1CLFA 3QSYB 4K4ZA 1TKZB 4I68A 3VVTA 3IBFB 2XULA 2EWHA 3JB9k 1IR1A 2CJQA 1B0VA 2BANA 5KAKA 3RUBL 5I42A 2DNOA 3CCZA 5IWAJ 2HAIA 4CO3A 2R7WA 2AYMA 4ZLJA 4ELUA 2XMVA 4DSFA 1RHUB 5KFKA 1X4DA 4E0DA 4OZLA 1C1BA 2KT5A 2E1MC 3CW2C 4DQPA 3EUNA 1YZ6A 4FS1A 3NCQA 1FT8A 3M4XA 1YSJA 4RBUA 1LWCB 4A47A 3J81U 4DV5J 4QU7A 4HR2A 1I94J 1IKXB 3FGVA 3MF5A 4CDIA 3R7NB 3GIJA 2BM0A 3GWCA 1HBMB 1FEEA 2MMYA 4OYZA 5G0RA 5BR8F 1RAEB 2HS0A 2DGSA 3GONA 4IOAQ 4PXCA 3NNHA 1VIXA 4Q8FA 1W2IA 2VG7A 4N56A 1LWFA 3AOBA 3BYRA 1RWWB 1B3TA 4EBCA 1U25A 3CDUA 2BOPA 4NXMJ 2DBBA 5DDRC 4TKTA 4CO2A 3M1VA 1FA0A 3QRRA 4AL7A 2M2BA 3C6TB 2N3OA 2FHJD 3KK3A 1EHWA 2UU9F 3BB5A 2OPPA 3WC0A 5IZHA 1JLGA 4C9DA 2HEKA 1RYRA 1OSDA 1X9MA 3HFKA 4J7CA 2RKIA 2QE5A 2XY5A 3M32B 3AJ2A 1RHRB 3C16B 4F02A 1H0HB 3CJTA 4NLVA 4PG7A 3DOKA 2RF2A 3OLAA 4CCHA 2B5JA 4YY3J 6AT1B 4DR5F 5RUBA 2H5IB 3LP2A 4A8XA 3OHAA 2EC2A 3R5BA 1WEYA 3NS5A 1ZAXA 4ZLLA 1WORA 4DPYA 1KVJA 4NCGB 2WCXA 2DY1A 3CCUS 2ACYA 4PRFA 3CCWA 5EHHA 3HKZD 1G1XA 3AX3A 3DC2A 2WB1D 3ZZRA 3BO4A 2CA9A 1YWXA 5T7LA 3W64A 5KOXA 2MZRA 3CC7S 1UCNA 1U48A 3ENWA 2V67A 2J9DA 3MEGB 2GZOA 4HHJA 2IVMA 1HQEA 4FVCA 4YB5A 4M94A 4UOFA 4IFVA 2BX6A 3F0NA 5T41A 4DL3A 4F3MA 3GFYA 3DNCA 3QT7A 3LGMA 1KDNA 1A7GE 1ROFA 4B08A 2DJWA 2HRUA 4LF1A 4AQYJ 2ZBPA 1EJ7L 2OMOA 3R9LA 5JVHQ 1T11A 2YY3A 2FGCA 2IA6A 3Q83A 5EWEA 1R0AA 1OYEA 3AHPA 1ZZNA 3LWLA 4M95A 4PQAA 3ILJA 5D0RA 1AZSA 3C15B 5B0GA 3DDIA 3HHLA 2J76E 2LXFA 4QR1A 3PDNA 3TQEA 4KFBB 1O51A 3GYGA 4PXEA 2B7CB 3IA0A 1E6VB 1FKOA 4UW2A 3BGRA 1CULA 2I5JA 3SCKE 2ZE2B 4DUYF 3KTQA 3PG9A 3TA1A 3AT1B 1RT2B 1S57A 4PWUA 2HGNA 2EC0A 4LF8J 3LAMA 5EGYA 2DRDA 1X4FA 2QL9B 2KFYA 2RQ4A 3ETMA 1S1WB 5F8GA 1UFWA 1N8RT 4MKAA 5A8RB 3T9NA 2C2NA 4DN9A 3LF0A 4J9OA 1OS5A 3JSRA 3QQCD 4ID8A 2ZDOA 2PI4A 5KFNA 2ZZNA 1A0OB 2FVSA 4R5PB 2ZBCA 4M1KA 3M8RA 2JNJA 2VG6A 1PBUA 1S4EA 4LIRA 4JV2A 1LWEB 3FBCA 1X0PA 1X5PA 2DRAA 5ETQA 1RT5B 2A6OA 1F1BB 4C4WA 2K7JA 3W1YC 1VOMA 2CQHA 2RB7A 1JLFA 4GKJJ 2RRAA 1CJTB 4JI5F 5LMUJ 1RKIA 5AXMA 4E2FB 1HNIB 5HJXA 2OTJS 4M5LA 3BM7A 1HWIA 2R8HA 1VFJA 4J9SA 2QMXA 4WE1A 2X1GA 3RW7A 4MFBA 4DZ6A 2J9EA 2KM8C 2IAJB 4ZVFA 1NZ8A 4C8NA 4KHRA 1RTJB 3AX5A 3G4SS 1HNWJ 2VF3A 1XIQA 3DLKA 2H4YB 3RJMB 2JOQA 2A10A 1EQ0A 5D3GB 1YJUA 2KHDA 4ALZA 2KXNB 4O3SA 5IV3A 3W9JA 4UOHA 2NXNA 5DG7A 3NWRA 1U47A 4FZVA 2OPSB 2YKMB 3N6MA 1Q86T 2LEAA 1OO0B 3M6VA 1SJRA 1NM2A 1S77D 2OJ3A 4FXVA 2YX1A 3UDVA 3H40A 2LFVA 1AXQA 2BJ9A 5JUMA 3VHQA 4O4RA 2CJXB 3L4BC 1TFWA 1SI9A 2W9BB 4UQTA 3OLBA 3FMWA 3GR1A 3DYAB 2RQKA 2MJUA 3UQSA 1N4LA 4M5JA 5E3RA 3O44A 2BVZA 3B82A 2ZM6J 3MR7A 4LBPA 2JFKA 2WSEC 2J5AA 5ETVA 1S1VB 4ZIWA 3HLUA 1HQUB 5HQLA 4IRDA 3TI0A 2R4FA 4H4MA 1X4AA 2U2FA 2I38A 3KK2A 2ZKUA 2JC1A 3IBCB 1T9WA 4PR6A 4CNZA 5J1PA 2RS2A 2BW2A 3PYDA 1S0OA 5KFYA 3POTB 3VQSA 3GPAA 1FDDA 2BA9A 3H42A 3GIRA 3OPKA 2CPHA 2IMWP 1ZA1B 1E6YA 2XZ2A 3R1HA 2IM3A 4CWBA 1URRA 2Q3PA 5DJBA 5AT1B 1WSRA 3TZWA 1U1KA 2G2ZA 4HL9A 4X65J 4I69A 2BANB 2EK6A 2UUBJ 4CH7A 3H5UA 1GMWD 5IC4B 4F26A 3H4DA 5I42B 4JI3J 5BYQA 5GAEI 4X4UA 2MKSA 4ZCLA 2ADCA 1XERA 2DD8S 2IJNA 3MCMA 2VKRA 5LSLA 3X1LB 2IA0A 3G9CA 3DHXA 1OM2A 4PUOA 4L6V3 2DK2A 2RD5C 3W61A 5LOQA 3MM8A 1C1CA 1S59A 5HL7Q 5C24A 2Y9HA 4YS2A 2ZWPA 4EU0A 2X7IA 1FFGB 2HNZA 3CJ8A 3OL6A 4CLKA 4RZRA 3DRYA 3MPWA 2CQ0A 3FJ2A 1RK8A 3GG0A 4FXWA 4WCEQ 2HHPA 1MN9A 4NI2A 5G0RB 3KG1A 4EMDA 3QT6A 3H98A 1SL1A 1P9QC 2VG7B 3K58A 4A48A 4M5IA 1RADB 1WF1A 4JV5F 3HFVA 2Q79A 3EPIA 3PYGA 3EMTA 4UUWA 3M1VB 3IWNC 3P5TL 5D4OA 1RT6A 3FBEA 2RRBA 4ZPAA 4DV2F 1B4SA 1UW9A 3KK3B 5DZ6A 4YEAA 2OPPB 2H65B 4N8OA 1JLGB 2RKIB 4O0NA 3TVYA 1SJFA 1DBDA 3DOKB 2RF2B 4JYAF 3AH6A 3R7BB 3DRPA 3SYZA 2B5JB 2WRMA 4UUXA 3I0RA 2HBYB 1WHYA 2CG4A 3S01A 2BABA 3HD1A 5C2CA 3N6NA 4QWCA 2CWXA 4LFCJ 2C2EA 2MKIA 3FEXB 1JLAA 4CLUA 5A6WA 5D0GA 4DXLA 4MJKA 2QTWA 2M8DB 3T6JA 3D5MA 1SC6A 4A8FA 5T7LB 4CLWA 3E01A 2LCWA 4P10A 3OTOF 4LF9J 3FEYB 3BSCA 4XTTA 1M1HA 3MTKA 3DCAA 2F4VF 1U1MA 4LIWA 3NS6A 1HQEB 4UQGA 4IFVB 2V94A 3AWRA 3GJRB 4BC7A 3RRKA 1KN6A 2XI2A 2NREA 2VC0A 3IAS9 4LSNA 1N54B 5HATA 1MMNA 1KOOA 2ROGA 3SBMA 1XMOJ 2MY8A 4OHWA 1QDUB 1FJGF 1VK8A 4PABA 1OPZA 2I2YA 1VBZA 5JJBA 4L76A 5HO4A 5KFEA 2ZHOA 1XNQJ 3VGSA 2GX8A 1FNMA 2C2RA 5DGBA 3CMQA 2HFVA 2NCKL 3QWPA 3TAMA 1V9OA 5L9XA 4OHZA 2KH9A 1R0AB 1X5OA 5DG9A 2PFDA 3OJSA 4K4UA 1ZS6A 2QZ8A 1AZSB 4QWEA 3O5TB 1KFDA 4H54A 1Q82T 3HHLB 2XMWA 5KT2A 1HPZA 3ZTPA 2LQ5A 1FKOB 1YJVA 4DLGA 3BGRB 2RDJA 1CULB 2I5JB 1M1GA 2OIHA 3FZBA 3ZZUA 2LP4A 1FWPA 2DH9A 2PMZD 4QPXA 1RABB 2X1FA 1J5OA 4PXDA 4XPCA 3TUJC 4WWSA 1NRKA 1U09A 2ZH8A 3PRVA 5AXLA 1APSA 2FUG9 1YJRA 2NYHA 1FKPA 1AW0A 2E44A 3MGJA 4CYUB 1C4AA 1R8CA 2I9SA 2GNKA 3I56S 2VG6B 4DX7A 4LREA 2B8PA 2HRYA 5ETTA 1IVZA 3RG6A 4A8MP 3MR2A 2UXCJ 3IC1A 1Q8IA 3CJQA 3HMJG 2MHNA 5ADZA 3HI9A 3K2YA 3K7RA 2KXHA 3A4TA 2KJVA 4WE1B 4MFBB 3Q0AA 2WSCC 3D68A 2JVOA 4QCLA 2Z57B 4W4MA 1YDLA 4Y2AA 4OX9J 4IH7A 4CH1A 1QSLA 3Q86A 1J27A 2XMMA 1RKJA 1UPPA 1UFKA 4JI8J 1H7WA 3DLKB 3TVZA 1CJUA 3CCLS 2AJ1A 4X64F 1H38A 1FRIA 3I32A 3EZOA 5KFLA 4OHYA 2EFPA 4RBTA 4B3TJ 2J8AA 4C3MA 3C66A 1ZPVA 1UAWA 1OY6A 3H4BA 4RUBA 4PYDA 2VIHA 4B9LA 3HD2A 3T6BA 5CXTA 2LDYA 4M5NA 2WW4A 4IRKA 4FF2A 2BE9B 3CJKA 5DETA 1NLKL 1O6XA 1VJWA 2AKWB 1IBKF 2YNFA 4RNFA 3CCQS 3DRSA 2ALYB 2UV8G 3ZZZA 4DU7A 3RBEA 1RLDA 4ZPBA 4WP8A 5THWA 2PEBA 4OZ0A 2XSJA 4DR6J 4TU8A 1BC6A 3RTVA 1CPZA 3UCZP 4H4MB 4QIEA 5IT4A 3F44A 1UUJA 4TYAA 1S49A 3V4IA 3RRGA 1JJHA 4WXOA 3KK2B 4TQRA 3KK1A 2QA4S 2W25A 4KSEB 1U1PA 2A3JA 4DL5A 4U6PA 5C25A 1HWKA 3CD6S 4USUA 3HVWA 3IN5A 1D1UA 2QN6B 2CPFA 2GS8A 2X3DA 4Q0BA 1U1LA 1CQMA 1E6YB 2RAQA 2XI3A 1T9UA 3OL9A 4ILRA 1XMBA 3LPEA 3W3SA 3W8PA 1EKRA 3G8QA 2H1YA 3Q8QB 4CLTA 4NE9C 2XHWA 4MIAA 2CQCA 3SQGA 2UUTA 1JLBB 2Z2YB 3OFFA 3PCOB 1RHJB 3MZIA 4F2RA 1L3KA 3DKDA 2GMLA 5DO2A 4DV0F 3D3BJ 4PUOB 4USWA 4F7VA 3ZTRA 5KTQA 1C1CB 3UFCX 3A13A 1KOHA 2XM3A 1R6YA 1YBTA 3R2DJ 4DX5A 3LUYA 1RT1A 1RJJA 1X4BA 2HNZB 3C3LA 3QZ8A 3QWUA 2IJRA 2GQ2A 3N01A 4RO0A 3TVKA 2YWGA 4DV7F 3A12A 2CJ9A 4FXDA 4NYOA 3IO1A 4KHPF 2IMOA 4NI2B 2UZAA 2W9AA 4HT5A 2VICA 3BBBA 4DR4F 4P9SA 2MZTA 5FLXY 2FVPA 1NK5A 1QUPA 2OUGA 1S7IA 3KFWX 2I8EA 5CD4H 4J9PA 1D8YA 4IQMA 1H3DA 2YPZA 4BCAA 3MR5A 4TY8A 1RT6B 3AOAA 4A8KA 2OHDA 3D4JA 1HMVA 2UUAF 1WI6A 3FFIB 2C28A 1HNZF 1Q81T 3GIKA 3FDSA 2B56A 3THVA 2A18A 3ILIA 3AX2A 1A9NB 3H90A 3C2PA 2E9TA 2HFUA 3FRYA 3I5AA 3BN4A 4AXIA 2HBQB 4KPCA 1B0TA 3FZ2A 1PJ5A 1URNA 2QFJA 1UJ6A 3DRPB 4J9NA 2E66A 3I0RB 2OPQA 4Y2CA 1BWVA 1KLMA 1IM6A 2AHOB 4WF9Q 1XNRF 2UU9J 2VBYA 4OJGA 2ZWOA 4HDHA 1LQ9A 1RWPB 1TZ0A 3RAXA 1JLAB 1DURA 2AV5A 3CO9A 2J6TA 3RU0A 1IR2A 1S4FA 1UEUA 3K59A 1PG5B 1VQ4S 4CT8A 2GJIA 2HQDA 5C42A 2UXBF 1T3NA 4OZ5A 2W1BA 3E01B 1N0VC 4DR5J 1YLXA 3KLHA 2F9DA 4H4KC 3BGLA 2IM2A 4OV1A 3BYPA 1FJCA 2YWWA 2F63A 4WBFA 3DRRA 5M2RA 5D6GA 3CUNA 4CTAA 5J2NA 4N5SA 1TKTA 1WKJA 4LSNB 5F8LA 2Z58B 1L3VA 1HWJA 3UCUP 2FJAB 5ETLA 4NOHA 3EVMA 1UP1A 5GAHI 5AXNA 3ZZOA 4C8OA 4ZPTR 2QRRA 4MK9A 1ITPA 3TAMB 4Y3CA 3L9ZA 2CG8A 1H2VZ 1RACB 1HA1A 2NQPA 2HLUA 3DXBA 4DF4A 2EXUA 3I4PA 1MNEA 1M5SA 1IXKA 2R42A 2JEFA 1NHVA 4QIFA 1IBMF 2V1SA 1M1KT 3ZXWA 1IBLF 1HNVA 1NK0A 2RIJA 2UVVA 2WW8A 3D6MB 3FVYA 1YJWS 4EZ9A 1HPZB 3A8KA 5H9FK 4EYIB 3D67A 1NDKA 4C11A 2DNYA 4OI6A 1NK9A 4NMLA 5KG2A 2AWZA 1U1OA 2KG0A 1J5OB 5ETOA 4EGLA 3OTBA 4URQU 2GVDA 3BGOP 2VDIA 1K0TA 1U7LA 2V0NA 5KFQA 1V3RA 3JXOA 3QLHA 1X4GA 4G65A 3BKUA 2EBGA 3PKMA 1QE1B 1HW9A 4EBEA 2RHSB 3UNGC 1FKPB 4DR1F 2J0SD 3FSXA 2BBEA 2ZOGA 2W2MP 4Y00A 1Z1ZA 4OZ1A 3DOLA 1SCJB 2JJ4D 4IR9A 4UZCA 4KTQA 1RCXB 5A0YA 1YGYA 4LR8A 4GVLA 5A6PA 2EG2A 2R7RA 5FLXU 4OX7A 3UDEA 3PEHA 4AYBD 2XWXA 4IOBA 2BKPA 3Q2SC 2WSFC 4K4TA 4YY3F 2ZDPA 2XLKA 3IMQJ 4QIGA 2V6AA 3OVAA 3MR6A 2OMLA 3KUGA 5GAEU 2HZAA 4C8LA 4B3RF 2YQ1A 1D0EA 5J2PA 5LMNF 1CJUB 4JI5J 2M70A 1N6QA 4J9LA 3NL0A 3FMBA 1VISA 3DRXA 1S48A 3NGDA 3NEKA 1JJ4A 5E33A 3HVTA 2ZEJA 4JI4J 4F4AA 3ZO7A 4FYVB 2ADBA 3OTDA 1ZM4A 1QVFR 2OEJA 4O3RA 2CQIA 2POKA 1HBNA 1S9FA 2XHCA 2G1DA 3MUTP 4B9TA 1X0FA 5DLFA 1FXRA 5CH7B 4A8YA 3CJKB 5DDQC 2WZ1A 1WNEA 1TELA 1NSQA 4DSJA 4IH5A 3AOCA 2YNFB 1YTYA 4AE5A 2QEXS 3CCTA 3SEOA 4AQYF 3DRSB 3BEGB 4KGKA 1RU2A 2XS7A 2UV8A 5MLCV 4QYZJ 4OYOA 2N4CA 4FYXB 1MW7A 3X3UA 1SV5A 2V9KA 1U1RA 1T94A 3TRGA 4GC7A 1JNRB 3V4IB 3KNGA 5DRKA 2CQ3A 3KK1B 3OW2R 1AFJA 2MQLA 4DF8A 5KFRA 1BLUA 3GV5B 4CT9A 5C25B 1S6PA 2YKPA 4R0JA 1U2FA 2QGFB 2MLZA 2C2MB 3D7SB 2DGXA 2R2RA 4Q0BB 4K0KJ 2MSSA 1YQHA 1XR7A 2MZQA 2NS1B 2Z2ZA 4B3SF 1NSPA 2AGOA 1ULRA 2BKOA 3SFGA 4XAKA 2W9CA 4JUZA 2HKEA 3HCXA 1YRUA 2DXDA 3OXGA 2VJUA 2J7WA 1W26A 3NRBA 5HVGA 2YWEA 1SB6A 3SQGB 3P6YC 1Q4RA 1RGVA 1DQ9A 2JLEA 5DDOC 2W2PP 2ZFHA 3J7ZT 1NDCA 1MLAA 4JV0A 3D6FB 2XGPA 3IWLA 4HYKA 1R43A 3HXMA 4IG3A 3WHIA 4EFAC 2CRLA 2D74B 2RT3A 4PAAA 4I64A 1EB0A 3RR8A 1HQ2A 1YI2S 1RT1B 2CPXA 4F0HA 4XK8C 1N48A 5LMUF 2ABYA 4ZJQA 2RMLA 2AGQA 1TFYA 1REVA 4ZP8A 1FF2A 4HI2A 4UY8T 1NKEA 2N4DA 3LQVA 2NUHA 2HURA 2IRUA 1R0BG 3SIPB 2BQUA 1VBXA 3HHLD 1REGX 2HHQA 4ZPWR 3OFGA 2DHAA 1F5CA 3K8VA 3CTRA 3K0JA 2HBRB 5J2QA 3I9V9 1F60B 1PBAA 3LO3A 4RUHA 2N7YA 4TY8B 4A8OA 1LW0A 4GVBA 3B4DA 2KG1A 4YHHF 1IKVA 1HMVB 3JYTA 4FBUA 2HNYB 3TZXA 1Z2ZA 5K8PA 1JX4A 4XDCA 1S99A 2Z4PA 2UP1A 2CZ9A 3DLLQ 2B9WA 2GHPA 3UI3A 2V8HA 1O5JA 2WVCA 2YQ0A 4RW4A 2BQRA 4JV5J 1Y3JA 2HNDB 4LRDA 2HHUA 2C2DA 3I6PA 3EZ5A 4OI2A 2OPQB 2HLTA 4NA2A 2QT7A 5A8KA 4DV2J 2GGPB 2VH7A 1KVIA 1N5SA 5KG5A 1YJ7A 3LP0A 3H5YA 1VCTA 3KG4A 1NK7A 4K4VA 1FWLA 2J6SA 2J9CA 4DPWA 3EVWA 2XLIA 3J80Y 3T1AA 2FLPA 1FERA 2R2SA 3IS9A 2ATLA 1BHNA 3M8QB 1HIYA 5KFZA 1JNZB 2R7UA 1SC1B 2XTDA 4JYAJ 5C42B 3D2WA 4NX9A 2MXYA 3MUVP 4Y2IA 1Y00A 1GX6A 4FPIA 2UVWA 4YB6A 3C14A 2XTCA 2ZH2A 3SDEA 2AYEA 2GO9A 3D0HE 4EK2A 3PRBA 2JFDA 3DRRB 1KVKA 2NUUG 5J2NB 1WOOA 1TKTB 3KHRA 2FC8A 4G6VB 3KLEA 5AE3A 2RRNA 3GJQB 4U7UK 4HTJA 3NGKA 5IFMA 4DV4F 4DPUA 1KNZA 4ED7A 3M9MB 2DVIA 4QBUA 5AXKA 4AXJA 5CABA 4JI3F 3OTOJ 2BDPA 1RBAA 1H6KX 3HF5A 3GYXB 5KG7A 2F4VJ 2K06A 3CJ0A 1CC7A 1KHVA 5IT0A 3US5A 2YKNA 4WP3A 4LRCA 4F8RA 5IQQA 1U1QA 5L1LA 5CCLA 3OBIA 3EVOA 4KV8A 1ZH5A 1TKZA 1FJGJ 3CMAS 4P7TA 3LGHA 4C11B 4FNHA 5I3PA 2G13A 3GFHA 2GMHA 2FJWA 3KJFB 4TN2A 2VZ9A 1J2VA 3JSYA 2WVBA 2HYIB 2GVDB 2BUNA 2P6SA 3B6BA 1FJEB 5HAOA 2CPYA 3T5JA 7FDRA 4AD6A 3QLHB 5KFFA 1FX2A 4TLQA 3UN2A 4ETXA 2YVSA 4PYAA 2XYPB 1IQTA 3NAHA 3PW4A 1RI7A 1M90T 2VL1A 4GC6A 4G1QA 4BHQA 1WSVA 1RXOB 4EI2A 2GQCA 3DOLB 2MY7A 5FDLA 4FN5A 1IKXA 4URSA 4OI0A 2YH1A 3K5OA 1MWYA 5A0YB 3MPUB 3I5BA 3CJ3A 1L5UA 4MYUA 4Q2MA 1ACMB 2CYYA 5CZVA 5HQ8A 3KLGA 1WTFA 2D41A 2Y1RI 1RT4A 4DBQA 2CZ4A 4CLFA 3SQOP 2HQ3A 2HFNA 2JDJA 3JS9A 1QVGR 4DOZA 4ILLA 3K5PA 3S6EA 4ZVSB 2BV3A 2J6UA 4S0MA 3C6TA 5KFJA 2R7XA 5D4NA 1VQ8S 2MKYA 3ZZYA 2AJ2A 1NKCA 2XNRA 4NLYA 3QNWB 2HFOA 2VB6A 4ECWA 5KG4A 1S1TA 5J2PB 2K1RA 3QO9B 2AW0A 1N6QB 3W62A 1F5BA 1G7CB 1FDAA 3G6ES 4KT0C 1UWBA 3C16A 3QATA 4ED3A 3RYLA 2BKNA 3HVTB 3ET6A 2CUYA 5F0UA 1IN0A 1VBYA 2RSQA 4IO9Q 2EFNA 3Q8PB 4OI1A 3BQ0A 2W4PA 1FRLA 3WQPA 1XMQF 4FYDA 3S1TA 1A6LA 1JLCA 4HACA 1HBNB 1D9DA 3PJXA 3BPSP 2DIVA 2ERRA 1SC3B 1DLOA 2MKCA 3W9IA 4DUZF 1SC4B 3BJYA 1CG2A 4B3OA 4C97A 3CCRS 3J80U 1EP4A 1C0TA 1NJYA 4ED5A 4GKKJ 3G8TA 4X64J 2FY8A 4K7QA 2X1BA 2LXIA 3V2UC 2AYGA 3KDNA 1BQMA 3DFEA 3KOAA 2E1CA 2AJ4A 1SV5B 2GAGC 4C8MA 5J2MA 3B8HA 1D9FA 3CNQP 1NB7A 1KRPA 4IDKA 3TAQA 2FPHX 1HI1A 1PKUA 9RUBA 3BF4A 1I5OB 3DLJA 4J37A 2XCPA 2OO4A 2ZUGA 2ZH1A 1VHFA 2QLXA 1IBKJ 1TL5A 2OEMA 1S6PB 3ETOA 1N36F 3HDSA 2WK4A 1UVKA 1HBUA 1W2BR 3IXQA 2VBWA 2DNHA 3QGIA 4PPZA 2YNGA 2FQQB 1CVJA 1SKRA 1N34F 2W9CB 4KHMA 3FSIA 3TAPA 3D0IE 4ES3A 2RDDA 2PMHA 1K44A 4ECXA 2V2ZA 4HH1A 4QWDA 1R8BA 2HZVA 3OXLA 2HHWA 2ASYA 2CJKA 1GH8A 4B9UA 1LW2A 4R8UA 4YB7A 3EDRB 2FJXA 3CCJS 2H5JB 1D09B 3K5LA 4JBCA 4KH0B 3UCGA 4L73A 1U4BA 1Q5VA 2KN4A 5KT6A 3HSGA 4IG3B 1U2CA 4WZQA 2YKAA 2FYXA 2VODA 2YWFA 2MZJA 2NXEA 1CQNA 2HS3A 2KM8B 4QWAA 1G6BA 5K8NA 3GFXA 3R5GA 4X62F 1REVB 3CB4A 3HP6A 4OLPA 2YWHA 1SXLA 3DN9A 2HGLA 2QLJB 4P71A 2DTJA 1SIZA 5GAHU 1TMJA 4DV0J 4RU2A 4ZN3A 4H4OA 2ZNZA 5ETMA 5GMEA 3MPVA 4NLXA 2ZJQQ 4P2XA 2FDNA 1U6FA 1QAYA 3OL8A 3NBPA 2IBKA 1VQ6S 1YBUA 1Q79A 3GU0A 5I4MA 1HBOB 4GVBB 1IKVB 2RVJA 2ZZTA 3PM9A 2UUWA 3W66A 3JYTB 4DV7J 4LVNP 4B3TF 1PC4A 2Z8QA 2ASLA 3IFEA 1ZBTA 3TEHB 3VZHA 1S9GA 3HSJA 1GXUA 2O67A 3ENAA 4DR4J 1RWVB 2RUSA 4RW4B 4DL4A 4DU8A 4OIXA 4ZIVA 2J7KA 2XY6A 2F65A 1RTIA 2V4JA 2PD1A 1MG7A 2G1HA 2Y0SD 3DU5A 3B78A 2W8LA 1GNKA 5D3GA 5GAGI 2M52A 5A8KB 2UUAJ 3LP0B 1HNZJ 2PGCA 3HJVA 2OPSA 3W8GA 4WU2A 2FLLA 3CWJA 4WPAA 1NK4A 1SKWA 3CIMA 5E41A 1NHKL 2QSFA 3PIOQ 3IS9B 5EWFA 1T9TA 2IYGA 1WG1A 3PKYA 1AA1B 2H54B 1WDTA 3DI6B 1GMVA 1R6VA 3ISZA 2OI2A 2KXFA 1UA0A 1WOSA 2F3JA 1YVFA 3KHLA 3MPDA 2F7VA 3NKYA 3L7OA 3V6HA 3RB4A 3DYAA 4NLUA 4OZJA 3C14B 1YJ9S 3PEJA 2E7WA 4X4QA 4J9RA 3SDEB 3QAUA 1RTZA 1GTEA 3KLEB 2RU9A 1FD2A 4ZDNA 2ZC4A 3AA8A 1AROP 2QG9B 4KAIA 2MQMA 2QLFB 3NY0A 1PJ6A 1NSKL 1K8AT 5K20B 3IG1A 3R6GB 1IJEB 2VA3A 1QM9A 5HMYA 1QY7A 2BMBA 5K8OA 2UXBJ 3D66A 3IGNA 1DJ0A 3M8WA 3KUHA 1SH2A 3SCLE 5KFBA 3MM9A 2W24A 2ZBRA 3TJ8A 5KG1A 4Q7AA 2HHVA 3ADAC 2EFOA 4K4WA 1C2PA 2IJFA 1VQPS 4UOGA 3MECA 5CD4A 2YKNB 4YR0A 4DFPA 2C2KB 2DR6A 4X4TA 2V8PA 1WC1A 3K5MA 3UPFA 4KV8B 3DXSX 2OAUA 4B02A 3I55S 2ZH7A 3EGZA 1FRJA 1GQEA 2AX1A 2Q66A 1ZOTA 2JEJA 2JEGA 1N0UA 3JQKA 4K2XA 3ISND 1AFIA 5D0EA 2ZD1A 3BDPA 1H98A 2GO8A 1UEKA 5DM6Q 2YXLA 1DQ8A 4FNIA 4LFBF 2BYCA 4P72A 1IBMJ 1IBLJ 2WVFA 1EIYB 3KDOA 1LK7A 3VR1A 3FRZA 2XGQA 1TK0A 4CLLA 4QW8A 1W7WA 2E7VA 3G96A 1RTDA 4WIQA 5M2PA 1MSWD 5LSRA 3MM5A 4ECQA 4G1QB 3HVRA 4OJ1A 1UWAA 4U8VA 4UOCA 5DQHA 5FDLB 2B4PA 3M8ZA 3M8SA 1CS4A 2HFSA 4A4JA 3BO2A 4DI6A 1SKUB 2AZ3A 9ATCB 1EQMA 2B3TB 3KLGB 3I87A 1RT4B 3C19A 4OHXA 1Q7LB 2KVQE 1RBLA 3AFGA 1RAHB 1CBKA 1FRXA 3LAKA 8AT1B 4DR1J 3A8IA 1P1TA 2LQ9A 5L38A 2B9EA 4PXBA 2FJBB 1M5VC 2ZUAA 3H5SA 4FPRA 5HP1A 1QSYA 3Q2TC 4Y2KA 4DCOB 3AD9C 4I2QA 2GVZA 4TQSA 1S1TB 2K1RB 3CULA 4USTA 3BGUA 8ATCB 4H4KA 1GXLA 1UWBB 3C8YA 2IYIA 3LTOA 2BW7A 1I6JA 1EARA 2OLWA 2OP5A 3ET6B 4P7VA 2WB4A 1ZPWX 4ZVEA 3SXLA 1SJ4P 4ED8A 2GHWA 4LR9A 3PZPA 1SJQA 4DV6J 3V5RA 1JLCB 3R2CJ 3TA0A 4HACB 2CAJA 1DLOB 1J5EF 1F0XA 4B3RJ 3H5XA 3W65A 2HFZA 4B3OB 4DDFA 1EP4B 4O0IA 2LU2A 2V4QA 3QJJA 1C0TB 1GTHA 5LMNJ 1FWKA 5HBMA 2NXUA 3R27A 1D9AA 3ITHA 5K8MA 2YKOA 5JMNA 2WTFA 4F4YA 1NPPA 4W90B 3PR5B 1P1LA 1BQMB 3UVJA 1WC0A 5KFVA 2XMKA 5DGAA 2HZCA 3FSYA 4MT1A 3VGVA 3CT9A 1WKLA 2CNKB 5A76A 5H9FJ 5J2MB 3GCXP 1HI0P 3UW1A 2CKWA 4IDKB 3R8YA 2FZKB 4Y34A 1U26A 2VFTA 3CO0P 3Q22A 4PKDB 4YDDB 4DV1J 4ANEA 4I2PA 4X4OA 1Y5NB 1RP5A 1SH3A 1HBUB 3QIDA 4DR2J 1VQ9S 1N32F 1FVQA 2YNGB 3ZC4A 1VHIA 2Q1LA 1T3OA 3BQ1A 1S76D 3EICA 1F9EB 1JJ2R 2K8GA 5HMWA 2BRLA 2DNZA 3W9HA 4ZS6A 2E5HA 3BZQA 4PCQA 2LYVA 2EW9A 4KY3A 1WHWA 1LW2B 4R8UB 4HI1A 2MKJA 3QMQA 1SL0A 4ECZA 4I56A 5EWGA 2HMIA 5B0BA 3THPA 7AT1B 1RB0A 4OJ3A 1B70B 4GMKA 4DR7F 1BQNA 2EKYA 3H8YA 3DLGA 2AYBA 2F4FA 4BC9A 2UXDF 3OHBA 2G2YA 4KGMA 1KS2A 4B3SJ 2GJ2A 4ERDA 1S0NA 5D15A 1KQGB 4F4KA 3D1HA 2B6AA 2E9ZA 4RBVA 2B9YA 2D3O1 4EEYA 1WF2A 2HHTA 5DDPC 4JI0J 3MFHA 3JTNA 4K2JA 4QR0A 3MD3A 2HQGA 2PE8A 2O01C 4JI6F 4J90A 2L9NA 3UN3A 4IG0A 4P73A 4LMZA 3KNAA 3V4MA 4CYUA 3A8EA 1B7YB 3QRPA 4PEOA 1FE4A 3MWBA 4Z7YA 3OL7A 4H4OB 4P2FA 3W5YA 2BE7D 4OZ3A 2A2CA 1DTQB 3G6VA 2QJ3A 3Q23A 2DGVA 3QFHA 3SFUA 2GIQA 1TAUA 3N5FA 3NBPB 2K7KA 1IR0A 2MSTA 3CCVS 4C98A 4YOEA 2FVQA 2HK2A 4F0KA 2CADA 4LT6A 4JI4F 3I9ZA 2APOA 5ETPA 2DGQA 1S9GB 2XQCA 3AD7C 2G0JA 1MN7A 4BBYA 5A8WA 4WIIA 1XEZA 5F8HA 1JLEA 3HFZB 4RX6A 5KG0A 4NZ6A 1H74A 1MWQA 3QYYA 1RTIB 2V4JB 2AF6A 3DDNA 2LA4A 1XN9A 4DQRA 4G1PA 4NPOA 1S6OA 1Z4UA 1ICEB 1PAEX 3NLCA 4YHHJ 4C0HA 2ZNYA 2FZCB 4ATNA 2KYZA 3P45B 2PI5A 1PSDA 3FCVA 4TNOA 2XZWA 2FHOB 5KT5A 5E2QA 4ZPCA 1TU0B 3ONQA 5E3PA 2ZH4A 4K5SA 3IGVA 1OQ3A 3P3DA 4ANDA 1EAYC 3J7YU 1U02A 2G2OA 4F25A 3KJNB 3WX4A 1KQKA 2IVFB 1FNOA 3JSBA 3L09A 2XTEA 4K0KF 1NH8A 3HJFA 3U02A 2Y3YA 1VQKS 2HIQA 1V5VA 5K5MA 3FBBA 5KFCA 2AEJA 1U6ZA 1XK8A 3IG1B 1BUXA 3BO3A 2P9EA 1XR5A 2M3DA 4KJIA 1QUVA 3K5NA 1RBOB 3JQMA 1PIEA 1ZETA 4M5DA 4MIWA 3FK4A 4HVZA 3MM9B 4HKQA 2H5EA 1YRXA 4RNNA 3M6UA 2XSFA 3KYLA 3MECB 3SCIE 4WZMA 3KJVA 2DR7A 2EBEA 2DISA 1KWMA 4IFYA 3CF5Q 4P2SA 2MEWA 1K1QA 1IWAA 2KB2A 3WC2A 3NCPA 1V5IB 2EFQA 4IYQA 2HVEA 1UTAA 3A3NB 1SKSA 2V2KA 3G86A 4DV4J 3J81j 2QA1A 4M5MA 4DEZA 2I1RA 4DQQA 1HD0A 1YRTA 2VOOA 1JLBA 2ZD1B 1Y7PA 4NZ0A 1PYOB 2ROEA 1JXEA 3BSOA 3VAIA 2MLXA 2CQDA 3U7JA 4L72B 2FVRA 1OPIA 2KZZA 2E7XA 5KG6A 3T3FA 1TVRA 1RTDB 2HQCA 1PYTA 2W7OA 1OJ4A 3MM5B 3DDKA 3P5BP 3PRDA 2N3LA 4NLPA 3ZNUA 1N33J 2OFHX 4ZVRB 3ZFVA 1CS4B 3RAQA 4WFNQ 2BJDA 3PX6A 2QLBB 1UZHA 2DIUA 4QW9A 3MEDA 3UDCA 4J9KA 4X4NA 4B9NA 2VQFF 4FKXA 1D8ZA 5MAOA 2GAHC 1VC0A 5KFSA 4W98A 7FD1A 2F40A 4N7TA 2DR9A 2VFVA 3MR3A 2R7OA 1FFWB 3Q8UA 2AEMA 4USHA 2VFRA 1K47A 5HP1B 4IQXA 2IFXA 3CJSA 3EPGA 3FFIA 5HSPA 1P6TA 4I2QB 2GVZB 2FHMA 2XMAA 2E1PA 3OQ2A 1MWZA 1FO1A 3PFOA 3GZ7A 2ROPA 3R3TA 3F73A 3PW7A 3MD1A 3L7PA 2WVDA 2ILZA 4KC5A 1WDDA 1ELOA 2PMWA 3P49B 1U6BA 1B99A 2DKOB 3ISNC 4BWMA 1UW4A 4E8UA 2HHXA 5DG8A 2R7VA 1HD1A 4ZLNA 2E5GA 3BGFA 3WIUA 5HBMB 1VQYA 1Q5YA 4U8YA 3TO8A 4ECTA 3ITHB 2DRBA 3H2UB 1N88A 4QIWD 1GMUA 2QFIA 3VAFA 2CQPA 5L8RC 1MMDA 5CA5A 4J91A 2E1AA 3PR4A 3UVJB 4RL1A 1NO8A 1XMQJ 1F3VA 1IBCB 3CEDA 5G4DA 2KVIA 2VPXB 2VPYB 4TU7A 2FB0A 5L9NA 3E3XA 3VZIA 4DUZJ 2HW3A 4NZ7A 5F41A 4EYHB 3OJUA 3EM1A 2EVZA 1WHXA 3D6TB 2KT3A 3VCDA 3R97A 3KUEA 4I2PB 5B08A 3M9NB 4YP3A 2O1PA 1T9VA 3BR8A 1X7VA 2IBOA 4O44B 3SV4A 1RISA 2C2OB 4Y65A 3H20A 2E5LF 1FRMA 4USMA 3GJTB 5HANA 2MPUA 5GAGU 1WEZA 3ELHA 2LU1A 1KP6A 5BXIA 1TKXA 3VGTA 3CCSS 4LSLA 2H4WB 3QGPA 4LBIA 2YKQA 2QLWA 2M8HA 2RH3A 2HQFA 2IC3B 2ASDA 1PAUB 1F3FA 2C1EB 5EX3A 4N76A 4F0MA 4V19X 5GADI 2HMIB 3BSNA 1N36J 4AFFA 3NP5A 1WWHA 3TWZA 2CWKA 1BQNB 2D1CA 3NG8A 3DU6A 3DLGB 2B51A 4F67A 3MEEA 2R8IA 5J1NA 3PYFA 3M8PA 1N34J 1JWWA 2RUGA 3HSDA 4LSZB 5D77A 2B6AB 3CD5A 2M7SA 4LF5F 4ECYA 1X9WA 2CNLB 1K9MT 1UA1A 2P5VA 4Z37A 5LJ3Y 3TZYA 3D54A 2VG5B 1QE1A 5F8JA 4EO6A 2DNGA 4X2BA 2RQCA 3W7BA 4IG0B 1UEVA 3SMZA 3JTPA 3V6JA 3VAJA 3HZGA 1QSSA 3J7Z5 1UVNA 2Z2LA 4DX8H 1YJNS 3DOMB 4F4ZA 3RAMA 2EK1A 3C6UA 1UFLA 2DXFA 2P2CB 2H48B 1RYSA 1VJQA 5C2GA 2ZH3A 2FC9A 3EJMA 1T95A 3W5ZA 4X62J 2VA2A 1NHUA 1EZZB 5LSOA 2DNLA 4OL8A 2AEFA 2XS2A 2Z30B 4KIAA 4A8SA 3QGGA 4UY85 5LT5A 5A8WB 1Q8LA 2L3MA 2G4BA 3ILLA 1U49A 5H9EJ 5E5NA 1JLEB 2B4VA 2U1AA 1Y0HA 3OT9A 2DGUA 3F41A 2HIYA 1WJ9A 5GMKa 4CLYA 3J7A1 2ILYA 2JH3A 1SQEA 3FEZA 4GKKF 1TL1A 1VQOS 3NMRA 5ETSA 1RAJA 2HVHA 2NPFA 2D9OA 1TK5A 2D68A 4DR3F 3T1YF 3OUYA 2IRYA 1M5HA 1TMMA 3A3OB 2X1AA 2M0GB 4MAKA 2ZVSA 1YIJS 2ZOFA 4C7QA 3PX4A 1HARA 2KHCA 3HVAA 4DMZA 1LKZA 5F8MA 1S97A 5EX0A 1ZZFA 2D69A 4ZPVR 2J9DE 1SQFA 2MJNA 1RHMB 4DPOA 4IO1A 1XJWB 4DPXA 2AMCB 5E0OA 1HWUA 3GTYX 1FXLA 4CO0A 2LLZA 3QJLA 1Q0NA 3KLVA 1NPKA 5IV4A 4F50A 2OPRA 3IRWP 1H2TZ 2OH2A 3MOZA 2OSQA 3OTEA 2PC6A 2P8IA 2CDQA 4DSKA 3SI8A 3PACA 4ZVUB 4M5DB 4ZP7A 2XZTB 2C3UA 3I82A 4A46A 4CO5A 3NS7B 3KWMA 1Q53A 1JXVA 3KJVB 2ZKTA 2C3PA 2YNIA 4IFYB 3PW2A 5D4PA 2N82B 1Y5LB 1HFEL 1QTNB 3CJ4A 3WX8A 2FJDB 1U8SA 4AT1B 4RNOA 3NXZA 4RNMA 4KH1B 1R0CB 2VFUA 2KTQA 4Q45A 4FF4A 2B7BB 3S7RA 5D78A 2LECA 2HHHJ 3OXFA 4LF4F 4DL7A 4M5KA 2FVCA 1U45A 4J9MA 1RWKB 5B0DA 3U1LA 1KFSA 2R9LA 3QZ7A 3NOGA 3PO5A 1OY9A 1HWLA 1C0UA 4U67Q 5KOWA 2WONA 4ZJLA 1NKBA 1TVRB 3HM9A 4QIVA 3G82B 1NK8A 1IJFB 5HQMA 2IDLA 3KMQA 1RSCA 4U95A 4CM0A 1M5KC 1UMJA 1RAOA 3ZTQA 4DHVA 1WUUA 3F56A 4DUTA 4DFKA 3RGIA 2LQBA 4LFBJ 3MEDB 3NGTA 4V1Ak 2NPIA 3VAMA 2EFGA 2J0WA 3UD5A 4ELVA 3QBCA 3DM2B 2MQ8A 2YTCA 4X4RA 3N6LA 4JI2F 1OSCA 2FGOA 3DGVA 1R31A 4JI7F 1WI8A 1RA7A 2HNYA 1X5SA 4ZITA 3FCWA 1IKYA 1LWXA 2EG1A 4P52A 3CCMS 4K50A 3T9ZA 2JVRA 1FXDA 4X4PA 2HNDA 4WFAQ 3GIIA 5CCMA 4NMXA 3TOQA 4YUDA 2JLGA 3EDQB 2O3DA 1QJHA 4QYZK 1M0SA 2GGPA 3CDEA 1HYSB 5GMDA 1QLNA 2W7AA 5AE1A 3HHDA 2HVZA 4KPYA 1WC3A 1TR0A 1QAXA 2JRSA 4NLSA 1XQIA 3SZ2A 3AODA 3VVUA 3N0VA 1HW8A 3M8QA 5KFTA 1U0HA 5B0CA 3OR2A 2BE2A 2QL7B 4Q44A 3Q8RB 3NGSA 3D1QA 3SSQA 1S1XA 3KMSA 3B4MA 4URGA 3P96A 3MTJA 4IR1A 2ZHAA 2RHQB 1DHMA 1Q7YT 3UNYA 1CJKA 2LXUA 1NJIT 1J5EJ 4WJBA 5HK4A 2WBMA 1NB2A 1HHSA 4RPFA 2L9WA 2R2UA 1HHTP 1RTHA 3RBZA 4LF7J 2CNNB 2KFZA 2VD3A 2CQ1A 3GSIA 4Y2MA 4CM2A 5L1IA 1RAFB 4K59A 3OSPA 1WF0A 1VMBA 4NEZA 2GMJA 2DGWA 5CYQA 1XR6A 4MKYA 1LXJA 3RBXA 1NU4A 1V3ZA 5LM7E 3ZZPA 1S1UA 1T02A 4NLQA 3FQLA 2HG4A 4I4BA 2ATCB 3B54A 3FNNA 3M2VB 4NL5A 1TKXB 4QQBA 2K3KA 4LSLB 4ZMMA 5CQGA 4DWIA 2C2ZB 2RJZA 4QOTA 2QSWA 1OQ6A 1BXNA 2ALZA 4B9MA 1EKSA 2PN6A 4Q8EA 1Q78A 4AUKA 3LANA 2R8JA 4YN3B 4BWJA 4PZVA 3QT8A 1ZM3A 5B0AA 1Y3KA 3TUZC 2HWTA 1LXNA 1N32J 3CGIA 3TARA 3ENVA 2MZ1A 2MKKA 2H9ZA 2EEYA 3O1LA 3MEEB 2CQGA 3CC2S 3M8PB 3NOCA 2AU0A 1T8EA 4B17A 3CDBA 4K5RA 2CPJA 1YBAA 4LFAF 4JI1F 2H51B 4UF4A 2NR0A 3IWXA 2YWKA 4HDGA 1S6QA 5KT4A 1RAAB 2W4CA 2IM0A 1S9EA 4NRUA 5KFGA 2GW8A 4DR7J 5LXYA 1KSPA 4KYZA 1RDRA 1TV6A 2UXDJ 1VYAA 1SH0A 4ZVTB 4U9RA 1DZ5A 2CNOB 1AT1B 3FQKA 3C6UB 2E5IA 1K0VA 6FDRA 4N47A 2V69A 3RB3A 1DY3A 4FVMA 3O2IA 4WFYA 3L7UA 1HNXF 4DPTA 3NAIA 1R89A 4OYMA 1NPRA 2HVIA 4I0WA 4ZA1A 1AB8A 2A2DA 4DS5A 2R3VA 4JI6J 2V2VA 3K17A 4KBIA 1FJ7A 3RZAA 4DV6F 1NDPA 3E8OA 1RT7A 4B9VA 2P9CA 4LQ3A 4BLGA 1X4HA 2OD4A 3TNVA 3TA2A 3PHTA 5FIIA 2IY5B 2IRXA 3QO9A 2HVDA 2GJFA 1TL1B 1JLQA 3D28A 4TYBA 4OLOA 4ENOA 2E1RA 1FRHA 3T5KA 3I31A 4I6YA 3HT3A 3OUYB 4U7UD 1TL4A 1B7FA 3EGVA 3IM9A 4XPEA 2CXEA 1PJ7A 2VOPA 2AGPA 3KLFA 5HLFA 5H1SV 2P9GA 3DLEA 4P2MA 1NBEB 1RAGB 4NLOA 2XYHB 1GT8A 4USIA 4JP8A 3A3PB 4DV1F 2V8VA 1C1BB 4G1IA 2CQ4A 2Y1IA 4YQWA 4DR2F 5ETKA 3MURP 1OIAA 4RLEA 2D9PA 2CDRB 4WYWA 3D3CJ 3BKFA 1ZM2A 3TP2A 3R6LB 1M5PC 2HWHA 2OPRB 4ED2A 4I6WA 1NSAA 2Q43A 3K89A 2ZH5A 5KFPA 1R8AA 5FJ4A 3MMAA 2R8KA 3NNCA 4YFUA 1UKUA 4IUFA 3L95X 3RRHA 2BACA 3T19A 2MB0B 1T03A 1LWFB 2DNMA 4DN0A 1Q95G 3MOJB 2LEPA 5BJRA 2FJVA 1VDHA 2HSEB 1FVSA 2GIRA 1EETA 4AL5A 1XC9A 3A1YG 3OFEA 3AXMA 4UT4A 2A0FB 3GG1A 1YG0A 2MZSA 4WYLA 2YNIB 1VI7A 4K4XA 1K1SA 3NCRA 4F3OA 2GQQA 4RUAA 1U1NA 2DR8A 4L74A 2R7SA 2UUCJ 2OKQA 1DTTA 2V34A 4C3LA 3BS9A 3UD3P 4A8QA 4JI0F 2HGMA 4RNHA 1LFPA 3PJWA 3LA0A 2AIRB 2CPIA 3TJ9A 3K57A 4X4VA 3UO0A 2MTLA 2WHOA 4A8WA 2DGOA 5I3QA 3LP2B 3KHHA 1C0UB 1VQSA 2E9RX 4KB7A 2WONB 3MMBA 5L1JA 4U96A 4OQJA 2NXJA 5EDWA 1G4CA 4MK8A 3Q8YA 2QV6A 2J0QD 4ZP6A 2HWIA 1XTZA 3KLIA 1MU2A 3P4UB 1SUQA 3HPOA 4HEA9 3O8WA 2BOAA 2Z56B 5M2UA 4O3QA 2D3ZA 1P8GA 4RW8A 1FESA 5J1EA 3GE9A 4DJBA 1XWLA 3PNIA 4OFZA 3K8WA 3N79A 5E3QA 3EE3A 1CJVA 2PIIA 5KFXA 4IRCA 5LL6d 1F6TA 4OI3A 3MM7A 4ZCIA 4OYAA 4U7CA 1HBOA 1VK3A 2BJ7A 4MH8A 3G71S 1KQFB 1N56A 3PIPQ 4YR3A 1VC6A 5GADU 3N9UC 4M5HA 2DNKA 4EO8A 1H72C 1IKYB 1ZM9A 2ZBIA 4NCAA 4YB1P 3RBDA 3JAMY 3SCJE 2OD6A 2PSZA 1F5AA 4XO0A 1YHQS 3QJPA 2VQFJ 5L1KA 2FZGB 1R8HA 2YH0A 1HLWA 1PGZA 1Q8BA 4ID5A 1T7PA 3NNAA 3AB4B 1KEKA 1PCAA 4DFMA 1RWNB 1R3NA 2W2QP 3PY8A 2QMUB 4NLRA 1UZDA 2NXCA 3TZZA 4Z7CA 1TL3A 4NXNF 2GC8A 4K4YA 3NGRA 1P27B 3CC4S 4KGZB 1VQ5S 3CCES 1U0HB 3OR2B 2BE2B 4WKRA 3DI6A 4OYXA 4TY9A 1S1XB 2XCAA 4PWWA 4DS4A 3HT0A 5ETNA 3IAM9 3SSRA 1QAIA 1JB0C 3PV8A 2XS5A 4D3GA 4ZCKA 4F04B 4RW9A 4TVAB 1CJKB 3VV2B 5F9LA 5E3AA 1RWXB 3W63A 1VC5A 2F8MA 2RU3A 1RTHB 1OYDA 2XMTA 2NSBA 2O5DA 3OD2A 2R7QA 5CYQB 1JLFB 5IC6B 1L3SA 5B7WA 2K2PA 5K9FA 2I6WA 1X4EA 4WK1A 4O4GA 2FIUA 1S1UB 3D0GE 1HL6A 2Y0BB 3R1LA 1GXTA 4WKYA 3OR1A 3KXDA 2Y1JA 3LP1A 5D8HB 3MMCA 1G3OA 4TU9A 4XDDA 2C3YA 1RZMA 4ETZA 3VAGA 2B4UA 3G2XA 3M8YA 1WD6A 5C7PA 2V2QA 1X60A 2J8SA 2LDIA 4ITSA 5IS2A 3AJDA 2BJ8A 4LRBA 5CZXA 4CRJA 4DV3F 4QJVA 3RB0A 3IM8A 3PHEA 2A1BA 2E5LJ 1H2UX 5KFWA 1N33F 1X9SA 3R5DA 5D4LA 4PG8A 3EXYA 2R8GA 3THTA 2EI5A 4B3MF 4E98A 2YNHA 1VRUA 4O3OA 1F9HA 4Z2XA 1S6QB 3D1OA 1ZYQA 2V1TA 5AJ3F 3D9BA 2XBPA 5A2QY 3BH7B 1S9EB 4WK3A 2JEIA 3QIPA 3OVSA 1AYEA 3DGPA 1P9YA 2DH7A 1TV6B 2BZ2A 1Y4ZB 3GV7B 1VQMS 2VBZA 2UVRA 1ZA2B 4RR5A 4C48A 4IH6A 1NXIA 3T41A 3IP0A 5HJYA 1JKHA 1RHKB 5KFIA 4LF5J 1VLOA 2NZCA 2YX4A 3J7YI 4FDFA 4EUVA 1N5TA 3FCHA 1JIHA 4JV1A 4ZJOA 3I0SA 2C22A 2V8GA 4I7FA 3TX8A 3MMJA 1H7XA 2B8QA 1SPBP 1DAXA 4QU6A 4MK7A 3CD0A 1RT7B 2AJQA 3M6WA 3GR0A 3PTWA 1L3TA 2C3MA 2CVEA 3JAMU 5HN0A 3AB2B 1N5QA 3O6QA 1T0TV 1MROA 1JLQB 1AUDA 4N77A 2HS4A 4OJHA 1TUGB 2DHSA 3EYZA 3PW0A 2WOMA 1FEHA 1LOUA 2XWYA 2PT0A 2GFFA 2BEFA 3W5XA 4DCPB 3EZUA 4PWDA 1TTHB 4K8RA 2HK3A 4C8KA 1QAJA 1TKDA 2W8KA 4LF6F 3ILOA 3KLFB 5HLFB 3DLEB 1PILA 3DLHA 2HHSA 1KLNA 2XLJA 4PG5A 5KFAA 1F9FA 3MM8B 2FHJA 2MLYA 2DT9A 4F4WA 3VTIA 5C24B 3KKFA 4DR3J 2EPIA 2FJEB 3T1YJ 2L41A 3HHKA 4X66F 1NH7A 3MI7X 1FCAA 1WG5A 5K14A 1UJ5A 2WBRA 3M2UA 4RUCA 4PG6A 2VU5A 3LW5C 3HX9A 4ER8A 3R7SB 3VALA 2QX0A 4USKA 1UVLA 2W4DA 3QAEA 3BQ2A 2PDAA 4W92B 3MMAB 2Z2MA 4F4XA 3H25A 1UPMB 3MM6A 1NMEB 3FBFA 1S79A 1BGXT 1T03B 3RR7A 2MQNA 3AQPA 2XC9A 2PA8D 5F3ZA 1EETB 1Q16B 2M9KA 4ZN1A 4PG4A 4C2MA 4YR2A 3A8JA 4LF2A 1FK9A 1VRTA 4NWBA 1U2RA 2ZJRQ 2RNEA 3UD4P 4V19J 1B0PA 2VQEF 4NCBA 4MKBA 1DTTB 1FI4A 4DQSA 3MPYA 5BR8J 4M5GA 1X31C 2F5GA 1N5YA 3IBWA 1C4CA 2XB2D 3GV8B 2IIHA 3QFWA 2HAFA 4O3PA 4N41A 4NASA 3H0PA 1S7HA 4GO5X 1H73A 3BN7A 2KT2A 5L46A 1U0SA 2VONA 1T05A 1BE4A 3UDLA 4HT7A 1SL2A 5HVFA 4DG1A 1W25A 3M05A 3MMBB 4OZNA 3O3LA 5D0HA 1AUSL 3LALA 4JOUA 1VR6A 3MEKA 2VBXA 3JTOA 3L3CA 2V68A 4NLDA 4KKOA 2GA7A 1OY8A 4BDPA 3MXHP 5A2QU 1HR0F 2QYGA 3Q8VA 1S0MA 2V9WA 4LF4J 3KLIB 1MU2B 2KL8A 3I96A 1SUQB 2DY9A 4RWWA 4O23A 4Q5VA 2W7PA 4C6AA 1KHWA 2Y8WA 3T1HF 1Q8KA 4LR7A 3G87A 3R5CA 4RW8B 5J1EB 3M7VA 2R7TA 1DTQA 2KDOA 3MAAA 4X84A 3M2RA 3TX0A 4NA1A 2CJBA 1I51B 1CJVB 3QPIA 3PX0A 1PO6A 3MM7B 2IVYA 2CZVC 1RQ0A 3JSMA 3EWGA 1X5TA 2NZ4A 2XY7A 2XMUA 2C42A 4MMOA 5SUHA 4CI0B 2VUGA 4ZKAA 3MFIA 2JHEA 5IWAF 4RW7A 2V63A 4OHVA 3AAWB 2RS8A 3NGUA 2KU7A 3TW0A 4QR2A 1Q1KA 3Q24A 3BV8A 5IT9Y 1NDLA 3V6DA 2VDHA 4I1TA 4ED4A 4ID5B 1DFDA 2AJFE 3V81A 4JI2J 3LH2S 1YK9A 4OYBA 3H2VE 4RJVA 4JI7J 5IM0A 4LRAA 6FD1A 2QMWA 4DV5F 2CQBA 4ECVA 5KG3A 3GP9A 1TL3B 2Y1LB 1I94F 4OX6A 2GHVC 2OELA 2D7SA 3SV3A 2XNQA 4DLEA 4OMFG 2JX2A 3UWTA 4HH0A 5BYRA 5T14A 4DL6A 3R5JB 4ZHRA 1RLCL 3BKTA 1YX2A 1Y11A 5HMXA 1WTBA 4NYZA 3PJ9A 4JB8B 2QA4G 5CYJA 4RW9B 5DZ7A 4NXMF 1NEEA 3NWGA 3MCSA 2CPZA 4DUYJ 1X4CA 1NK6A 3BSAA 1VQLS 1WG4A 3ZNJ1 2FLNA 3HHLC 2RILA 3E51A 4IOCQ 2ZBQA 3CXCR 2UVUA 4GRSA 1U8WA 1QTMA 1KKHA 2JZ5A 2Q6CA 2F8EX 1R7IA 4O4GB 1KQSR 2HHHF 2R2TA 1DARA 5EN1A 4CNYA 1NJXA 5AE2A 3OR1B 3LP1B 3MMCB 2IPOB 4L75A 4LUBA 4HLBA 1CC8A 1VS3A 4P74A 3TR5A 1VGYA 1FDNA 4CLPA 1KR4A 2D3OR 2SXLA 3IR7B 2AD9A 4KGVB 2FHKA 1NCLA 2YQ3A 3MCOA 3M9OB 3LPYA 3UR3C 3PW5A 3PFEA 3W2VA 2G0IA 1ZTWA 2BR0A 2MHEA 2B4OA 2Q6BA 3JQJA 2PO4A 4LJMA 2OTLS 4J9UE 3W2WA 1KD1T 2YNHB 1FFSB 4PQUA 1VRUB 5HVHA 5I3UA 2C3OA 2XYGB 1O0PA 3CPWR 4USVA 3QIPB 2DXEA 4K4SA 3DGPB 4Y28C 3E2EA 3G8SA 2KYXA 4RW6A 4Y0FA 2LMIA 3DLBA 5FD1A 2VHGA 1NJZA 5KFOA 4FF1A 3IRXA 3CJ2A 2G0CA 4CO4A 2DPIA 3SSSA 3LWMA 4O3NA 3GILA 4OYWA 1Y5IB 1JKHB 4HHHA 3FUYA 5F0WA 5HROA 2GIFA 4OYIA 2ZJPQ 4LFAJ 1UVIA 4JI1J 2BJ1A 2XSJB 3VQTA 1TUWA 1GMWA 4YMEA 3PVXA 2KZMA 3IR5B 1DQAA 4FBTA 3H7HB 4MKVA 1BD6A 5DM7Q 3KHGA 3I0SB 5CHCB 3WIVA 4I7FB 1VBKA 3CD7A 1UJ4A 2IM1A 2O66A 5E7OB 3VF0B 4WTYA 3ULHA 4FS2A 1SJ1A 1RAIB 3M30A 4Q43A 2F8HA 3Q89A 5B09A 4ZVQB 3W60A 3OSNA 4XIUA 5DS7A 3I4HX 3NMAA 3I5CA 2A6MA 4LF8F 1RA6A 1MROB 2RQMA 1HNXJ 5CAAA 5KFMA 2QYCA 1RUSA 2DR5A 4L3NA 4ICLA 4CH0S 3BPDA 1U24A 2WOMB 1LNQA 4CO1A 5KT3A 5IT9U 3UR0A 1VQNS 4PWDB 1I1GA 2MGZA 2AT1B 2PFFB 5JXSA 2JC0A 3VGUA 3GQCA 1FNXH 3G6YA 2L08A 1NZAA 2F9JA 1SJ3P 2VKZG 2AJ0A 3EGWB 4LF7F 1WHVA 4L3KA 4ZCMA 2BJ3A 4ZOSA 2MYFA 4LQ9A 4GKJF 2PA3A 2B43A 4DSLA 4NEYA 2MQPA 4ZVGA 5K14B 2E5JA 3M2UB 1SQGA 3EXCX 1BMQB 1HHQA 1YITS 2CIMA 2V4RA 5DLGA 4QWBA 3QSIA 2PEHA 2LQ8A 3MM6B 4GO7X 2DO4A 3MCNA 5GVQA 5IQ6A 1HNWF 4O44A 5DQGA 1IQZA 1RE1B 2XZDB 1DRZA 4KE5A 1WOPA 1FK9B 1VRTB 3AJ1A 3DMJA 1WC6A 1UETA 1JK9B 5F9NA 1FKAF 3TEGA 4ZK7M 1N5YB 4DFJA 1FRKA 2IC3A 2CJAA 3ICLA 2DH8A 3AXKA 1GAOA 3AA9A 1LV5A 3MAQA 4DX6A 2KKHA 1OMSA 1KTVA 1YZ7A 1T05B 2W01A 2DNRA 2DNPA 2NYIA 1KLMB 3VAKA 4ED0A 2D3UA 4DG1B 2WVEA 1T9XA 3GYNA 2W2OP 1RT3A 2ZM6F 1SVDA 5CYMA 3BBFA 3WDOA 2QL5B 1LEOA 1TL7A 4DL2A 3CSKA 4C8YA 1M5OC 4KKOB 2VG5A 2BXJA 4ZVPB 3TQ1A 3MHYA 1IKWA 3G6XA 4F3QA 4ZP9A 3H2LA 1HKAA 4WU3A 3CE8A 2LKZA 1RWMB 4LVOP 2LQJA 4LRFA 3KLHB 3OV7A 2MDAA 2DCUB 2CQ2A 3N4WA 3MAAB 3DOMA 1WC4A 2ZOMA 3M2RB 1Y10A 4CTAB 3HO1A 1TP7A 1WC5A 4OV6A 4ED1A 4BS2A 2ZZMA 4WFBQ 3JSMB 1WACA 2V5HG 4R25A 5F8IA 2F1FA 4X65F 1NJWA 1UVMA 3MAHA 2UUBF 1NAQA 1FHTA 4CLSA 4M8LA 3AD8C 2CFXA 3T5LA 3R5AA 2HQIA 4RW7B 3HZEA 4KO0A 1V3SA 4RKUC 4WFXA 1GFWB 2QA2A 3V6DB 3PO4A 2DITA 1HNVB 3EGNA 4ES2A 4AL6A 2BJEA 4ED6A 4RWXA 3WZ0A 1T9YA 3V81B 1RU1A 4HHUA 2MQOA 2N7CA 2JLFA 2DHHA 3BH6B 3U1NA 2NSCA 5KFDA 5IM0B 2Y8YA 1TUVA 2ZHBA 2J0XA 3HHEA 4F2SA 5HI7A 2IHR1 4HTIA 4DQIA 4MTPA 5IXUA 3TYTA 1VRQC 1BY9A 4LBHA 1IWGA 4YDXA 2DGTA 2HBZB 2VJVA 2OEKA 4ZVHA 1JJCB 4ZHRB 3QRQA 3KJQB 1V6HA 3S8SA 2QO3A 3M6XA 1WELA 4DL0C 1CSJA 3RB6A 3HHNB 3FC9A 2HPUA 3PXGa 5EUHA 4ZVOB 1S72S 1VQ7S 1WKKA 1LWCA 3GSDA 1LFWA 2KO1A 4NXNJ 1JQGA 3UE2A 1SBRA 2DYAA 1FTCA 1HBMA 1BQXA 2H3EB 2ZH9A 3C46A 2UUCF 4WXWA 2IDEA 1UL3A 1RHQB 1L3UA 2I0XA 1N5VA 2JSXA 1JXLA 3RW6A 5JVGQ 4ELTA 2ASJA 2QIFA 3GJSB 4Q2LA 1KC8T 4MIBA 2L9DA 4X4SA 2ZITA 3DHWC 3CDWA 2EKNA 3D6HB 1KBRA 2M4MA 2COLA 2VASA 2LVWA 4WTOB 2AZ1A 4I6AA 5HMZA 4C3KA 4LFCF 3QGHA 4ECRA 3H59A 1GK8A 3MDFA 2BM1A 3W2VB 3TUPA 4B9SA 3M32A 2DEJA 5IOLA 3ZTSA 1O8BA 3BR9A 4CIOA 2DO0A 1RCOB 1K73T 4KR0B 1B64A 3W2WB 1ZTTA 2FD2A 4PQUB 5I3UB 4LF9F 3GCWP 2MKHA 2RE1A 2V50A 4KGXB 1VLYA 5KFHA 1RWUA 1VIOA 4FKYA 3EX7B 3IR6B 4NCGA 4ZPDA 3G82A 4DV3J 1S12A 3ENQA 5SZTA 4RW6B 4CQ1A 1XMOF 3J7AN 5H9EK 3IRXB 4EBDA 1D3WA 2G9OA 3OFHA 4OI4A 2BQ3A 4B3MJ 1XNQF 5HROB 1LK5A 4PPDA 1ZAVA 5BYSA 2DPJA 4ANCA 5C5JA 2ZH6A 5AJ3J 3MEGA 2YX7A 3HSZA 4J5OA 1X8DA 1KTQA 5ITHA 4OZ2A 2EFVA 4DSEA 3DM2A 5U47A 2ACMA 4USJC 1FX4A 2ZVIA 3UN5A 1F2HA 2KRBA 4NRTA 4FYYB 4N8NA 1GEHA 1XBWA 3M30B 4EZ6A 2VPZB 4C0BA 2CPEA 5L39A 5B0EA 1TAQA 4DSIA 2VV5A 2HRTA 3VWSA 4FP9A 3ZZTA 1GX5A 2XO7A 3CVKA 2ZC3A 4ICLB 1FDBA 4KRWA 3N5BA 1YJTA 3GLJA 4QZVB 2KRRA 4DCJB 2KJWA 5B0FA 3C15A 1R27B 1Z2LA 1S5ZA 2MGZB 4DZDA 4CZCA 4KFBA 2V8DA 3OVBA 1RWOB 1E6VA 3TUIC 1HYSA 3BBCA 4NLTA 2Z0GA 2ZE2A 2YBVA 4F36A 1YKWA 1RT2A 1G2EA 4TXSA 3N28A 1F2GA 2RDIA 3GIMA 1PYSB 3HULA 2B0GA 1R8PA 1JMTA 3J81Y 1S1WA 2MQQA 2AP6A 2VFSA 2UXCF 4J9QA 2DB1A 5A8RA 5KFUA 2CJYB 2XTJP 4CLZA 2W2NP 4LF6J 4M63A 4RU9A 2LEBA 2GV1A 4TLRA 4R5PA 3BDEA 2DHXA 4EWTA 4OX9F 1LWEA 4KQZA 2OSRA 4G3IA 1RT5A 5J2QB 4QYRA 2FY1A 4JI8F 2DEIA 2DCLA 3CJ5A 2AQ4A 1CJTA 4X66J 1LW0B 2BRKA 2OGUA 1HNIA 5KT7A 3CMES 2VPWB 4UZBA 2XO6A 3DMJB 3WBZA 1N52B 5LJ5Y 1ZAWA 4KHPJ 3M2VA 2KFNA 4UTGA 2YPYA 3HKWA 3LOUA 4Y6IA 3BREA 4MYTA 1S10A 4NA3A 2B9XA 2IAJA 2XG8A 2DNQA 2M88A 4ILMA 4D3HA 1OWXA 3ZTOA 2QC3A 2GCFA 1RTJA 1FE0A 2VC1A 4C8ZA 4NYPA 1MMLA 1TK8A 2JWNA 3U27A 1S6UA 1NNDA 3CDAA 1FD8A 2XEXA 2M5YA 1WEXA 5ETRA 5F8NA 1BWEA 1IUJA 3FKBA 1EX8A 1RT3B 5LXRA 1FTRA 3GFZA 3HK2A 2CVIA 5CYMB 1UVJA 1QD1A 2LA6A 1TQLA 1TL7B 2YKMA 2VQEJ 3T5HA 4DR6F 2J7UA 1Y9OA 3TANA 2WAQD 8RUCA 2CPDA 4WFZA 3AY0A 4IKAA
chains in the Genus database with same CATH topology
1XEZA 1IKWB 2K3IA 2O5DA 4C11A 5F8HA 4ECUA 2DNYA 4OI6A 4C0OC 1JLEA 4RX6A 5DQIA 1NK9A 3AQOA 5E3CA 5KG0A 4NMLA 4NZ6A 3KG0A 5KG2A 2KI2A 2XMJA 2AWZA 1U1OA 2R7QA 5CYQB 2W9BA 1JLFB 1L3SA 2DHGA 2KG0A 4I67A 5B7WA 1J5OB 4EGLA 3OTBA 3GMGA 3QYYA 1RTIB 2V4JB 4URQU 2K2PA 2AF6A 3DDNA 2OFGX 4NLWA 5K9FA 1S0VA 1X4EA 2LA4A 4O4GA 1XN9A 4WK1A 4DQRA 2FIUA 1S1UB 1CEZA 4G1PA 4NPOA 3D0GE 1HL6A 2L48A 1K0TA 1S6OA 1U7LA 4OX8A 3R1LA 1Z4UA 1GXTA 3OTCA 2V0NA 5KFQA 2P6TA 1V3RA 3NLCA 4WKYA 3OR1A 3QLHA 1X4GA 4C0HA 2Y1JA 3LP1A 5D8HB 3MMCA 1G3OA 1S1VA 3U1MA 2ZNYA 4TU9A 2EBGA 4XDDA 3PKMA 1QE1B 4ATNA 1HW9A 2C3YA 4FF3A 4EBEA 4ETZA 2KYZA 3VAGA 1HQUA 2PI5A 1HI8A 1PSDA 2B4UA 2NLWA 4TNOA 3UNGC 1FKPB 4DR1F 2J0SD 1WD6A 4QPTA 2XZWA 3V6KA 3FSXA 3GB0A 3CIZA 2JL9A 2FHOB 2LDIA 2BBEA 3MUMP 4ITSA 5KT5A 2ZOGA 5IS2A 4Y00A 5E2QA 4ZPCA 3ONQA 1Z1ZA 4OZ1A 1SIWB 3DOLA 5CZXA 3Q8SB 2JJ4D 5E3PA 2FTRA 2ZH4A 2DNNA 3VAHA 4IR9A 4K5SA 4KTQA 4DV3F 4QJVA 4ZLPA 3RB0A 3IGVA 1OQ3A 3P3DA 5A0YA 3PHEA 4R0EA 3POTA 4NLGA 4KO0B 2A1BA 1H2UX 1IM4A 2FLOA 5KFWA 3LGNA 1N33F 1KONA 1X9SA 3J7YU 3R5DA 1YGYA 4ECSA 5F3TA 5D4LA 2X3GA 2AX0A 4PG8A 5A6PA 3EXYA 2EG2A 4F25A 2R8GA 4P6QA 3WX4A 3THTA 2EI5A 1KQKA 2IVFB 1FNOA 3ZZ0A 4E98A 2YNHA 2R7RA 4B3MF 4OX7A 1PC5A 2E29A 3PEHA 4AYBD 4ES1A 1VRUA 3JSBA 2XWXA 3L09A 4O3OA 2XTEA 4K0KF 4Z2XA 4IOBA 1NH8A 5A8WA 1S6QB 3D1OA 3HJFA 3Q2SC 2WSFC 3U02A 2X51A 1CLFA 1VQKS 1ZYQA 5AJ3F 2HIQA 4K4ZA 1TKZB 4K4TA 5K5MA 4I68A 5KFCA 2XBPA 5A2QY 4YY3F 2ZDPA 2XULA 2EWHA 3JB9k 2XLKA 1S9EB 2CJQA 1B0VA 4WK3A 2JEIA 3QIPA 2BANA 3OVSA 4QIGA 3OVAA 3DGPA 3MR6A 2OMLA 1U6ZA 1XK8A 2DH7A 5KAKA 5GAEU 3IG1B 3BO3A 5I42A 2P9EA 2DNOA 4C8LA 4B3RF 3CCZA 1XR5A 2M3DA 4KJIA 1QUVA 2HAIA 3K5NA 1D0EA 1TV6B 4CO3A 2R7WA 2BZ2A 1Y4ZB 3GV7B 2AYMA 1VQMS 2VBZA 2UVRA 5J2PA 4ELUA 1ZETA 2XMVA 4M5DA 4MIWA 4HVZA 3MM9B 5LMNF 4DSFA 4HKQA 4IH6A