4NLSA

Poliovirus polymerase - s288a loop mutant
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
457
Chain Sequence
b'GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPAGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
total genus 140
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nlsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nlsA02
4J9QA 1TKXB 3SI8A 2B6AB 3RB0A 1RTJB 3TAMA 2OPQB 3DOKB 3PJWA 4MK9A 4RU9A 4IDKB 3Q8SB 5DG9A 4TLRA 2AX0A 1TL3A 2F8EX 5HROA 4TYBA 3Q8RB 4QPXA 2FLNA 5KFDA 3RBEA 1ZETA 1FKPA 5KG7A 1T05B 3CDUA 4KV8B 5C25B 3BJYA 1IKYA 2B5JB 5L1KA 3T5KA 1RA6A 2IMWP 2V9WA 3DLEB 1QUVA 4DEZA 4TY8B 4Q43A 2J6SA 1N6QB 1RTDB 1KLMB 4F4ZA 3QO9B 2AQ4A 1MU2A 1NHVA 2GIQA 2HNZA 4K4SA 3PHEA 4KB7A 1W25A 4RW4A 4DL6A 4YP3A 4K50A 4RW9B 2E9ZA 4WFYA 5F9LA 1S1XB 3FSIA 1SH2A 4JUZA 4O3RA 2ZKUA 1TKXA 5EUHA 2B6AA 3DOLB 4KAIA 5HBMB 2CKWA 3KMSA 1RTJA 5DGBA 4RNHA 3KJVB 2ASJA 2OPQA 4K4VA 3DOKA 1RA7A 3ITHB 4IDKA 5EWGA 2HAIA 1S0NA 1JKHB 3N6MA 5KFOA 4ZPCA 3I0SB 4ID5B 2IM2A 2FVSA 4QW8A 5L1JA 2EC0A 4RNOA 1EP4B 3H40A 4EO8A 1T05A 3RAQA 4IOBA 3KMQA 4NLWA 4KV8A 5C25A 3M8QB 4G3IA 4ZP9A 1C0TB 4WYLA 2BQUA 2ILYA 2YKNB 3DLEA 2XI3A 3NGDA 4TY8A 2R8HA 2FVQA 2RF2B 1RT3B 1N6QA 1KLMA 1RTDA 3QO9A 2I5JB 2XCPA 4ECXA 1RT2B 3PZPA 4RW6B 3LP1B 1IKVB 3FRZA 5KFSA 3QYYA 4FBTA 3V4IB 3VQSA 5KFIA 4FS2A 2XI2A 3RB3A 1S1XA 4XPCA 5HBMA 1N48A 4MH8A 3DOLA 3KJVA 3MR6A 2E9TA 2D41A 4LSLB 1Z4UA 2UVRA 2OPSB 3ITHA 3GYNA 1JKHA 4JV1A 1T94A 2WOMB 3I0SA 4ID5A 3LALA 3MEEB 5KFUA 1FK9B 5J2MB 3IN5A 1EP4A 1JLGB 3DI6B 2IA6A 3T5HA 4WXWA 4KKOB 5FDLB 3M8QA 4ZVFA 1C0TA 2W9AA 2YNFB 2RDJA 2YKNA 2DPJA 4M94A 3OL8A 1RT3A 2RF2A 2R8GA 2I5JA 1RT2A 4RW6A 4F4WA 1S6PB 3LP1A 3QLHB 1DTQB 4J9MA 1IKVA 5F8MA 1RDRA 5KFNA 3V4IA 4Y3CA 3H59A 4MK8A 5DQHA 3LP0B 3HVAA 3MR5A 4U6PA 3NAHA 3V6KA 2WCXA 4LSLA 3EPIA 1TL1B 1BQNB 2O5DA 2OPSA 5KFCA 2WOMA 1RT6B 3FQLA 2J6TA 1FK9A 3FDSA 4R5PB 2BANB 3DI6A 1JLGA 3CJ2A 4MIBA 1LW2B 4IG3B 1WNEA 4KKOA 2FVRA 5FDLA 5F9NA 3IG1B 5KG1A 2D7SA 2QE5A 4ECQA 2YNFA 5KFKA 4EBEA 4WFXA 4HYKA 3PW4A 3DRRB 5KT5A 3E01B 3H2LA 2AWZA 3KLFB 2W7PA 3Q8PB 2AGPA 3MECB 1S6PA 2GIRA 2W8KA 1DTQA 5JXSA 3DYAB 4YMEA 4ECTA 3T5JA 1HNIB 3PW0A 5DG7A 3SFUA 1S6QB 2ZD1B 3CJ0A 4R8UB 3Q8QB 2HWIA 5DQIA 2YKMB 5KG2A 4H4OB 1S48A 4YR3A 3LP0A 3M8PB 3H5SA 4NYZA 4DL7A 1HQUB 4J9KA 3I5BA 3CDEA 1LWFB 1BQNA 1TL1A 5K14B 2BQRA 4O3QA 1FKPB 3PW2A 1S9EB 3OLAA 1TKZB 4KFBB 3OLBA 1RT6A 4WXOA 4EYIB 2OH2A 1IM4A 1EETB 4R5PA 1IKYB 1C1CB 1JLEB 2BANA 3MFIA 4IG3A 2JC1A 4NLUA 3IG1A 3JYTB 4NLQA 4KHMA 3G86A 4NLRA 5JUMA 1RTIB 5J1EB 1S1UB 5KFTA 5KT7A 4YR0A 4F4YA 3DRRA 4RW8B 3KLFA 4ECZA 2VG5B 3MECA 3BREA 4J9SA 3DYAA 2WTFA 2WB4A 4WZMA 1HNIA 4RZRA 4FBUA 1S6QA 2ZD1A 4R8UA 1C1BB 2ALZA 3I5AA 2YKMA 4H4OA 4KE5A 4DL3A 2QV6A 4URQU 3CWJA 3M8PA 3GIIA 2VG6A 1HQUA 4ECUA 1LWFA 4KSEB 5K14A 2YNIB 5KFXA 5I42B 1HQEB 4ZMMA 4ECRA 2AX1A 1S9EA 3KNAA 1TKZA 4KFBA 4IRCA 4ED1A 1EETA 4IG0B 1JLEA 1C1CA 3DLGB 1SH3A 2IM3A 2XC9A 3C6UB 3JYTA 3BQ0A 4Q8FA 1GX6A 4IKAA 2YNGB 2BQ3A 3H4DA 1RT5B 2D3UA 1RTIA 3KHGA 5J1EA 1S1UA 2IAJB 1JXLA 3LANA 4NRTA 4RW8A 2AGQA 4ED7A 2E9RX 2ILZA 2IJNA 2VG5A 1D0EA 4Q0BB 2V0NA 4YR2A 3PR5B 4JV2A 1C1BA 2JEFA 2HMIB 1K1QA 4MKBA 4JV0A 4H4MB 3QGIA 4MIAA 1TQLA 1RT4B 1TP7A 3LAMA 3MFHA 4RUCA 2YNIA 5I42A 1HQEA 1R0AB 4LSNB 2JEGA 4NLVA 3HVTB 2AU0A 2FJXA 3KLIB 4IG0A 1JLFB 5CYQB 1J5OB 3UDLA 3DLGA 4DG1A 3C6UA 1N56A 3H98A 2YNGA 4Y34A 3BQ1A 2RKIB 4ECVA 1RT5A 4ED2A 1S0OA 3H5XA 3IGNA 3OL7A 1NHUA 2IAJA 2C2DA 3DDKA 5KFMA 2ZE2B 4XO0A 1N5YA 1XR5A 1S1WB 4Q0BA 3QIDA 3PR4A 3V6JA 3BR9A 2GC8A 4K4TA 4ZHRB 3EPGA 1FKOB 5J2NB 1LWCB 1VRUB 2FLLA 3KK3B 2HMIA 4ED8A 3M9MB 4MFBB 4H4MA 3OSNA 3DM2B 5KG3A 1RT4A 1JLQB 4Q8EA 2UVVA 4IH6A 4RW7B 3G6VA 3RB6A 3BGRB 3T1AA 2HNDB 2ASDA 1R0AA 4LSNA 2B43A 2WK4A 3H5UA 3HVTA 3QGGA 2AGOA 3NL0A 3IRXB 3KLIA 2WRMA 1JLFA 3DRPB 3CJ5A 4TY9A 5CYQA 4URGA 4QWAA 3JSMB 5KT6A 1J5OA 2R8JA 1IKXB 4QWDA 1HYSB 4KO0B 4EBDA 2RKIA 2FVCA 3RB4A 4X2BA 2WHOA 3GIJA 3GV7B 4ED6A 3KOAA 5F8NA 2FJVA 2FJWA 2ZE2A 1S1WA 3E51A 4J9PA 3KHHA 1S49A 4ZHRA 1ZTTA 3NAIA 4PUOB 1FKOA 2I1RA 1LWCA 2IJFA 1VRUA 5J2NA 1NNDA 4IFYB 3KK3A 5I3UA 4MFBA 4O4GB 2IM0A 3ISND 2UVWA 3DM2A 1JLQA 2R2TA 4RW7A 4F4XA 4MKAA 3UR0A 3BGRA 2HNDA 4I7FB 3UPFA 3BSCA 4J9NA 3FFIB 3IRXA 3DRPA 3OL9A 3JSMA 4RNMA 4G1QB 1N4LA 1RYSA 4WYWA 2JLEA 1IKXA 1HYSA 3N6LA 4ZVHA 5KFYA 1S1VB 4KO0A 3QZ7A 2HNYB 3CVKA 2XCAA 2UVUA 2HWHA 5L1LA 5J2PB 3NMAA 4F50A 2BE2B 1XR6A 2WONB 4NLDA 1RTHB 3V6DB 5F8HA 3CJ4A 2VG6B 1REVB 4PUOA 3MF5A 4NLYA 5C24B 4QW9A 3G6YA 4IFYA 4O3SA 3GIKA 3BSAA 4K4WA 4O4GA 3KHLA 5KFFA 3D5MA 1LW0B 1S0MA 4ZP7A 1S9GB 3OL6A 4U7CA 2W9BB 4URSA 3GILA 4I7FA 1K1SA 5DLGA 3FFIA 1YVFA 4TXSA 4G1QA 1JLAB 1U09A 1HARA 3CO9A 5C42B 5EWFA 4NLTA 3EZUA 1MMLA 3MEGA 4TYAA 2W9CA 2XGQA 1S1VA 3KHRA 4O44B 4PWDB 4IR1A 2HNYA 2R8KA 1HNVB 3QIPB 5KFVA 1T3NA 5J2PA 2BE2A 4DL4A 4WFZA 4XPEA 5HLFB 5KFPA 2WONA 5D3GB 1RTHA 3OHBA 3V6DA 4Y2CA 5KFJA 1S10A 3H4BA 1REVA 4J9OA 4QWBA 3HHKA 3UQSA 3TVKA 4LQ3A 5C24A 5KG0A 3I5CA 4IH5A 2C28A 3LAKA 1LW0A 5DG8A 1S9GA 1C0UB 4HKQA 2BRKA 2R2SA 2W9BA 3NBPB 2JEIA 4DG1B 4ZVEA 5KG5A 4M95A 3PW7A 2JEJA 4EYHB 5DLFA 3OSPA 4O3NA 1JLAA 4RNNA 1T03B 5C42A 4ECWA 4PQUA 1DTTB 4R0EA 4TN2A 1S97A 2V4RA 1SV5B 4O44A 3H5YA 4ECSA 2XWYA 3IS9B 3GV5B 3IGVA 1QAJA 4PWDA 1TV6B 3V6HA 1N5YB 1HNVA 3QIPA 4TQRA 4K4ZA 3MR2A 1JX4A 3C6TB 3G6XA 1LWEB 5HLFA 5F8JA 5D3GA 5EDWA 5L9XA 2R2RA 5J2QB 1IKWB 1C2PA 1S9FA 1KHWA 5F8GA 4PQUB 4O3OA 3M9NB 2V4QA 2BR0A 4IRKA 2OPRB 1VRTB 1C0UA 2IC3B 4QWEA 1RT7B 4I2QB 3GV8B 3LP2B 3NBPA 4ED0A 3CDWA 3QGHA 4NZ0A 4NLGA 1JLBB 3KLHB 5KT3A 3HVWA 1T03A 1S4FA 3DRSB 4NLXA 4WZQA 3MR3A 3I0RB 1DTTA 1RT1B 5T14A 1SV5A 1DLOB 5F8LA 3IS9A 3GIMA 4ICLB 3D28A 4ECYA 1TV6A 3C6TA 1LWEA 3V81B 1TVRB 4ZPAA 2IM1A 3BSOA 3QZ8A 4RNFA 5I3UB 1BQMB 4NCGB 1OS5A 1IKWA 3MEDB 2CJQA 4EEYA 4IQXA 5J2QA 2FLPA 4IRDA 4ZP8A 1S1TB 4DL5A 5KFAA 2UUWA 1XR7A 2B5JA 2R2UA 5KFQA 4J9LA 3KLGB 2R8IA 3DMJB 5DQGA 5KFBA 2OPRA 1VRTA 2IC3A 3RBDA 1UWBB 3BSNA 1RT7A 4I2QA 3LP2A 4NLSA 3KLVA 4K4YA 1QE1B 4ZPBA 1JLBA 2OPPB 5F8IA 4RW9A 5KFRA 3KLHA 1JLCB 3DRSA 5KFLA 3I0RA 1GX5A 1RT1A 5KFWA 4KBIA 4WE1B 1DLOA 4ICLA 3T19A 5EWEA 4ZP6A 2YNHB 4Q44A 3V81A 5HP1B 1HMVB 2C2RA 1TVRA 4ZVGA 1BQMA 4NCGA 3MEDA 2BRLA 3SFGA 1S1TA 5DGAA 2W8LA 5C5JA 1HPZB 2JC0A 3KLGA 3DMJA 3HKWA 1RYRA 4GC7A 1D1UA 3CIZA 1CSJA 4O4RA 1KHVA 1UWBA 4GC6A 3PW5A 2DPIA 3PJXA 1QE1A 4I2PB 1ZTWA 3MEGB 4NRUA 2OPPA 3KK1B 2W9CB 1JLCA 3BQ2A 4Y2AA 1JIHA 4IFVB 4IH7A 4WE1A 2ASLA 3KLEB 2VG7B 3FQKA 4B3OB 4EO6A 4MK7A 5KG6A 1TKTB 2YNHA 4NLOA 1HMVA 3MEEA 3M9OB 5J2MA 5HP1A 4LQ9A 1SH0A 4IR9A 4DL2A 3ISNC 5KFZA 3OHAA 3ICLA 4RUAA 5KT4A 1HPZA 2C2EA 2VA3A 3KK2B 3GQCA 1SUQB 2RDIA 5CYMB 2D3ZA 3DLKB 2C22A 5KFEA 5KG4A 3QLHA 1RAJA 4I2PA 2FVPA 3RAXA 4O3PA 2XGPA 3NKYA 2UUTA 3TAMB 3KK1A 5KFGA 3TQ1A 2J6UA 4TQSA 4QWCA 1TL3B 4H54A 4ZPDA 4IFVA 4NLPA 5HROB 3KLEA 4ED3A 5KT2A 1I6JA 2VG7A 3N6NA 4B3OA 2ATLA 1TKTA 4FS1A 2IBKA 5L1IA 4Q45A 3MTKA 3CJ3A 4EBCA 1LW2A 4KHRA 4J9RA 2VA2A 5KFHA 1QAIA 2W7OA 3PVXA 1MU2B 4YQWA 2HNZB 4RW4B 4K4XA 3KK2A 1SUQA 5CYMA 3E01A 4K4UA 3T5LA 3DLKA 4OL8A
chains in the Genus database with same CATH superfamily
2XS2A 2B6AB 4ELTA 4IDKB 1JJHA 3K59A 5DDRC 5C25B 2HHSA 2OGUA 3F56A 4HT5A 4YP3A 2OHDA 4RW9B 1XMOJ 2ZKUA 4KAIA 4JI2J 4NMLA 4CM0A 4YB7A 3NXZA 3UE2A 2K8GA 1QSLA 4USKA 3KMQA 4NLWA 4P2FA 4ATNA 4DUZF 4DV7F 2JHEA 2YWWA 2K1RB 1R8AA 4MKYA 2MLYA 3BO2A 3FRZA 3M2VB 3OV7A 2OFHX 5IOLA 1A7GE 2X51A 4JOUA 1VQ5S 1RB0A 2OPSB 1T94A 2ACMA 4HACA 2ZUAA 1N52B 4M5JA 3M8QA 4J37A 1VBZA 3OFGA 3OL8A 1T3OA 1KFSA 1R8BA 1WACA 3JSBA 1NAQA 2LU2A 4DU8A 3V4IA 4DFMA 3A12A 3NAHA 3V6KA 4LFBJ 3DI6A 2D69A 2CWKA 1S7HA 5BYRA 1CJKB 1TKDA 1KP6A 1NKBA 1DAXA 1DTQA 1F9EB 5DG7A 1RWXB 4YDDB 2F1FA 4DR4F 2QEXS 1C1CB 3IG1A 3JYTB 4KHMA 3ZZRA 5KT7A 4IUFA 1B7FA 2OKQA 3MECA 2YKPA 1VC0A 2QSWA 2VG6A 2GJFA 2ZH8A 3RRKA 5A8WB 4E2FB 4IRCA 3TA0A 1EETA 1PIEA 4V1Ak 5A8KB 7FDRA 2IM3A 4Q8FA 1SQEA 3KHGA 3LO3A 2WVEA 2ILZA 1C1BA 3MUMP 2VJUA 1CBKA 1FCAA 5AXNA 2JVRA 3LAMA 5I42A 3CDAA 1TZ0A 3C6UA 4B9NA 1PC5A 3NWRA 4QR2A 1AW0A 4CQ1A 1N5YA 1QTMA 1UFKA 2G4BA 4MFBB 2H3EB 4E0DA 2YX4A 5KG3A 2V67A 2KN4A 3G6VA 1VJWA 3RB6A 3C3LA 1N56A 1JLFA 4ZCLA 1J5OA 1HYSB 3AB4B 4EBDA 1WDTA 3M2UA 2WHOA 2B4PA 5DZ7A 1Y5LB 3NAIA 3W8PA 3PIPQ 1JLQA 1X5PA 1FEEA 4DPOA 4DV0F 4ZLLA 3NNHA 3QSYB 1CG2A 1WC1A 1FXRA 1RU1A 3DOMA 3TVYA 5J2PB 3NMAA 1NSPA 2WVCA 1RBOB 2H54B 3BKTA 4HT7A 2MZRA 3L09A 2GVDB 3NGUA 4DS5A 5BR8J 4X4OA 3H20A 4DSLA 1LFWA 1UVLA 5AT1B 3UQSA 2GCFA 2C1EB 4KIAA 4YOEA 2G0JA 2W9BA 2JEIA 3T6BA 2GHPA 2MQMA 1T03B 2K3KA 2RRNA 1J27A 1S97A 4O44A 3IGVA 4IOAQ 1P27B 3ELHA 2DNKA 1R6YA 1UKUA 5IWAF 5F8GA 1I51B 3JS9A 2UXBF 3S01A 4GMKA 1FESA 2CJAA 4FF1A 4JYAJ 5B7WA 2E1PA 3C14A 2X7IA 3CB4A 5D4NA 1R0CB 3KUGA 2RU9A 1U6BA 2B5JA 2MEWA 2DNHA 4HH0A 1RT7A 3VAMA 2YXLA 2KZMA 3HHLA 3PKYA 1VQKS 4QU6A 3MUVP 2QA4S 5AXMA 4TU8A 4GC7A 5CZXA 3L4BC 1ULRA 3FQKA 4MK7A 4QOTA 4Y65A 2KYZA 2YKQA 3IA0A 4OJ1A 4Z7YA 2HFNA 3KK2B 2LQ9A 2R7QA 5KFEA 2CNKB 2KU7A 4C8NA 3N5BA 4LMZA 3CUNA 3R1LA 1XIQA 2V8GA 3CJ3A 1UA1A 4CCHA 4OYAA 1QAYA 4TLQA 3GJTB 2CQ3A 3M05A 4P52A 2VJVA 1QTNB 4O0IA 1Q5VA 3AQPA 1RTJB 2IRXA 1MLAA 1NEEA 3CDUA 3T5KA 2V9WA 2K06A 1IBKF 1SH2A 1H73A 5B0AA 3W7BA 3ITHB 2OEJA 3VGTA 1ZAXA 2EC0A 2ZNYA 3AQOA 2HQFA 3NGDA 4KHPJ 3HULA 4P2MA 4XDCA 2E7WA 1N48A 4M5GA 1ZPWX 3MZIA 4A48A 4Q5VA 3IBCB 2ZWPA 4WXWA 2IJRA 5FDLB 1HNXJ 1IR1A 3LP1A 3NRBA 1Q7YT 2XNQA 4DS4A 2W7AA 2C3MA 4CI0B 1GQEA 4Z37A 3FUYA 3DU5A 4K2XA 1I5OB 4MIBA 2RAQA 2FVRA 1K0VA 4FVCA 3ZZPA 5EX3A 2HFUA 3W2VA 3LP0A 2P8IA 4UF4A 1HQUB 2E5GA 4DBQA 1FT8A 1URNA 3OLAA 1RT6A 2QFJA 4KY3A 3OXLA 3BGOP 1FEHA 4ECZA 2EEYA 4PEOA 4R8UA 4HHJA 3GIIA 3QBCA 4LF2A 1HQ2A 1QSYA 2FY1A 2IDLA 4X65J 4P74A 1SH3A 4OI2A 1RT5B 2AJ0A 2QL5B 1PO6A 3MPUB 1UAWA 1Y5IB 2DNQA 4U67Q 1KFDA 3UCUP 3MDFA 5B0EA 1WC6A 1B70B 1P6TA 1ZM4A 3AX2A 3NLCA 5E2QA 2C2DA 2CJ9A 4Y2KA 1RAOA 4DMZA 1XR5A 1FKOB 1XNQJ 3HSZA 3K5NA 3K7RA 2HZCA 2Y9HA 2M3DA 4ALZA 5GMKa 4OHWA 3BGRB 1R0AA 4FNHA 2AGOA 4DV2F 1KS2A 3EDRB 2FVCA 1VK8A 2H1YA 3CF5Q 3M6VA 1ZTTA 2YTCA 3CDBA 2UVWA 1HI0P 3BYPA 5HMWA 4GVBB 2CVEA 4RWWA 1SJ3P 3OL9A 3D3CJ 3MM9A 1HBOA 2V4JB 2OMOA 3NGSA 2DT9A 2ZJPQ 4ES3A 4PUOA 1UL3A 3G6YA 4KGVB 1AFJA 4LF4F 2I6WA 3T1HF 5EWFA 4NLTA 1HI1A 2QG9B 2AJ4A 5D78A 4X4QA 3QT8A 2XO6A 3HM9A 2UV8G 5KFJA 4IH5A 3D4JA 3GU0A 1RAFB 1CC8A 2HHPA 2N3LA 2VIHA 4JI1J 2B9WA 1TUGB 1JX4A 1W7WA 4ZLJA 1PJ5A 1KQGB 3NCRA 1MN7A 3NCQA 3T9NA 2M0GB 2RQKA 2F7VA 2ADBA 1VR6A 2DIVA 3R97A 5KT3A 3RW6A 2DH8A 1PJ6A 2COLA 5DDPC 4N56A 1MN9A 3CD5A 3MWBA 1Q1KA 5SZTA 2CJXB 1GH8A 5KFQA 2RS2A 5BYSA 2EG1A 5EX0A 4MT1A 3VZIA 4QR1A 3LGHA 2C42A 1DLOA 3NEKA 1KLNA 2YNHB 1FTRA 4YY3J 4AL5A 1ZAVA 2QLXA 2FHMA 4QIEA 1BWEA 4I68A 3W2WB 3C46A 4BS2A 2V1TA 4M5DA 2HQ3A 4FF2A 1WDDA 3JQJA 3CJTA 2HIQA 5CYMB 4NXNJ 1WEZA 2MDAA 4I2PA 1N34F 4ILLA 3CCUS 2ZC4A 3D6MB 2ZZTA 1HBUA 4H54A 4NLPA 1FKAF 3KLEA 1Q81T 2RHQB 4AXJA 2M9KA 3NOGA 4GO7X 4WIQA 1LWXA 5L1IA 1M5SA 1LW2A 1M0SA 2W7OA 4K4XA 3ZTOA 4N77A 1F2GA 3D0IE 2VICA 2QA4G 4J9UE 2CG4A 1PC4A 3BJYA 1IKYA 3Q89A 2M7SA 4ZVOB 3RR8A 4RNHA 2QN6B 2OPQA 3N6MA 1Y3JA 4A4JA 1F9FA 4MTPA 4EO8A 1AB8A 3EYZA 4UT4A 2VFRA 4JV5F 2RNEA 1NM2A 3Q2SC 5LMUF 1UW4A 3L3CA 3L95X 5DDOC 4FBTA 1PG5B 4YFUA 2MLZA 2ABYA 2BMBA 1VFJA 3AXMA 3K8WA 1B7YB 2IRYA 5L39A 4A46A 3GYGA 2ZH2A 4OV1A 2W2NP 1C0TA 2RDJA 1MMNA 2YKNA 3GFYA 3BH6B 2D9OA 2HRYA 4DLGA 2OTJS 4C8ZA 4U6PA 1TL1B 1FD8A 4DR7F 1FRIA 2BANB 2ZM6J 2XSJB 4ES1A 2RE1A 1IWGA 3PW4A 2W7PA 4OI3A 1ZBTA 3DYAB 2CA9A 3FCVA 1XTZA 2VFUA 4DL7A 2BQRA 6FD1A 4PCQA 3TZXA 1HNZF 2JC1A 4OHVA 3GFXA 1VQ7S 3W64A 4KQZA 3UD3P 2Z2YB 4J9SA 2RJZA 4B3TJ 2IA0A 4M1KA 4ZVRB 4DSJA 4ECRA 1LEOA 1S9EA 2HFSA 1M1KT 4ZVUB 2ROEA 2V9KA 2YWFA 1RTIA 3POTA 3LANA 1OY8A 1MSWD 1SIZA 1A9NB 1HQEA 2DY9A 2JEGA 3P96A 3A3PB 3CCSS 4NL5A 1R43A 4AL7A 1RWWB 4ED2A 3OL7A 4OYZA 3J81U 4XO0A 3QIDA 4RBVA 3V6JA 2MZ1A 1X7VA 1KDNA 5BJRA 3OSNA 1FDNA 1N5VA 1KNZA 1SQFA 1URRA 3VF0B 2E5LF 1RHKB 1HBNA 4KO0B 4CLSA 2G0IA 3HHLC 3HDSA 4NEYA 5HI7A 4I67A 1SQGA 2E1MC 3KHHA 1JQGA 2IJFA 1Q8IA 4CO1A 5I3UA 4Z7CA 5GAHU 3BSCA 4DCOB 1UPPA 2R7TA 3OR2A 2PN6A 4EUVA 1CULA 2C2KB 2CNOB 4OZJA 3CVKA 4OI4A 1VQ8S 1HBMB 3MAHA 3WHIA 4KRWA 4ZP7A 4I7FA 2VONA 1WHWA 1TUVA 5I4MA 3ZNUA 2QMUB 4PWDB 2HNYA 3HHDA 5KFVA 3PTWA 5KFPA 1KTVA 3V6DA 2RT3A 2XQCA 5D4LA 2MLXA 2FQQB 2CUYA 1SI9A 5KG5A 1O6XA 1DTTB 2GX8A 3TNVA 2ACYA 1FHTA 1QUPA 3WBZA 1FFSB 5D3GA 3HT3A 3SSRA 2V4QA 1U47A 4DV6F 4NZ0A 2EFNA 4ZKAA 2J9DE 2G1DA 1U1KA 1TVRB 3M8SA 1O8BA 1BQMB 1WHYA 3MEDB 4DL5A 3MM5B 1V6HA 4J9LA 3GFZA 4X4NA 2V63A 2HZVA 5KFRA 4ZPWR 1FJEB 4BC7A 2IDEA 3G9CA 2PA8D 1P1LA 2PO4A 2ZNZA 2PMHA 1P9QC 2BRLA 3SFGA 1T9UA 3HKWA 3OTBA 2KZZA 1NLKL 2ZOMA 3KK1B 3QWPA 4ZDNA 4I56A 1XERA 1TKTB 1Z1ZA 1P8GA 2CZVC 3OHAA 1NDLA 5KT4A 3MMBB 3R2DJ 1DURA 3HX9A 1CJVA 1IM6A 1CJTB 2EW9A 1Z2ZA 2ZHAA 2XGPA 3NKYA 4C98A 2FJBB 1N8RT 4JI4J 2QIFA 4B3OA 3AD8C 1QAXA 1SIWB 1QY7A 2G2OA 4KHRA 2HG4A 2HNZB 4DV3F 2RU3A 3VAIA 1Q95G 3AX5A 3IR7B 1YK9A 1HKAA 3ENVA 3TVZA 5HROA 1T05B 3MGJA 1LKZA 2O3DA 4CIOA 1QUVA 1RTDB 4B9VA 2GIQA 4K4SA 4L3KA 1W25A 2DNMA 4DCPB 1FRLA 3I32A 3UCGA 2B6AA 4QCLA 5A6WA 4ZK7M 4IDKA 3UCZP 4QW8A 5M2PA 5C25A 2HVZA 4YB5A 3RGIA 3MMCB 1IKVB 1KQKA 4B9UA 2FHOB 2YKOA 3MXHP 1Z4UA 3EICA 1F3FA 4JV1A 2VUGA 3NS5A 1B4SA 1GMVA 3TX8A 2DNGA 2K1RA 4DPXA 4J9MA 5E3QA 1WF0A 3M2VA 3SXLA 3H59A 3R2CJ 2WCXA 3EPIA 1BQNB 2OPSA 1TL4A 2P6TA 1WNEA 2HZAA 5MLCV 4U7UD 3ZFVA 3C15B 3H2LA 3FMBA 4MKVA 5JXSA 1S6QB 3CDEA 4DV1J 2VODA 3W3SA 2XZTB 1CJKA 4NLRA 2IVYA 4B3MF 1IR0A 2VG5B 1FX4A 3S6EA 4RZRA 1RHMB 2VPYB 1KVIA 2JJ4D 1R6VA 3BBCA 3HFKA 1C1CA 3DLGB 1H74A 3JYTA 1UPMB 3H4DA 3K0JA 2IAJB 1XMOF 4NRTA 2IJNA 3O2IA 1YZ7A 4JI2F 1IVZA 2HK2A 3AX3A 1U45A 2RB7A 1TP7A 1FD2A 5A8WA 3M7VA 1U4BA 5A8KA 3EGWB 3VAJA 2NYHA 1S0OA 2BJ8A 2NR0A 1RAGB 4BWJA 2VKZG 2C2OB 3R5DA 1VRUB 2YVSA 3DM2B 2DRBA 2HNDB 2UV8A 3D68A 3IRXB 3G4SS 2FUG9 4URGA 3P5BP 2VOPA 2KHCA 2FJVA 4EZ6A 1GMWA 2FHJD 1RLDA 4K7QA 4DSEA 4WIIA 1FDAA 3CSKA 4LFBF 4MFBA 2BJ7A 3KFWX 2SXLA 4U8VA 1K73T 3Q0AA 1YI2S 3NGRA 2O67A 1HYSA 4ZVHA 2G13A 1FERA 4F50A 1XR6A 2BACA 3CO0P 3V2UC 5C24B 3UR3C 2CFXA 3JTNA 3MPVA 1LW0B 1S0MA 3W9JA 3D6TB 3SBMA 4QZVB 1UVIA 2CQHA 4PQUB 3OTDA 4F02A 2R8KA 1T3NA 2XMTA 1R3NA 5J2PA 1SL2A 3UDVA 4ETXA 1S10A 2H4YB 4PRFA 1FWPA 4JI0J 4C8MA 1AUSL 2GVDA 3X1LB 4H4KA 2JEJA 4M63A 4LT6A 5BYQA 2XWYA 1LWEB 2QYGA 2GS8A 1R8CA 5L9XA 1NJXA 2WSEC 1CPZA 3IR5B 2D9PA 3WQPA 1VRQC 3TRGA 4I2QB 4DPYA 4YN3B 3WC2A 3HVWA 4ZLNA 1T03A 3D66A 2W4DA 4FYXB 3WX8A 2IM1A 2FTRA 4NCGB 4USHA 2DRDA 1IJFB 1UWAA 5D4PA 2H5EA 1RACB 2CQPA 3K5OA 5KFWA 2APOA 4PG7A 1W26A 3OUYB 4WPAA 5HP1B 2C2RA 4JI7J 3EJMA 1KHVA 1JJ4A 3B54A 4KGKA 1ZTWA 2W9CB 2MKYA 4KTQA 3OFHA 2ASLA 2X3GA 5EHHA 4PABA 2VBWA 5GMEA 3QLHA 5BR8F 2HQIA 1RCOB 1WSVA 1N33J 2CPJA 4B9MA 2AD9A 4IYQA 4FS1A 2IBKA 2DNZA 4PKDB 4J9RA 1X60A 5SUHA 3PVXA 4C0HA 1Y3KA 2J7KA 3KK2A 1K44A 1VBKA 5D6GA 4NYPA 2KYXA 1OPIA 3PKMA 2FLNA 3Q24A 1HHTP 3CCLS 3RBEA 1TK5A 4P7TA 4KV8B 2J0QD 2E1RA 4USIA 2J6SA 3BBFA 1X8DA 1NHVA 3FBFA 4JYAF 1S1XB 5ETTA 4JUZA 5HBMB 1RTJA 3MAAB 3ZC4A 3GCXP 4PZVA 1LXJA 4DX8H 1EP4B 4UTGA 1GTHA 2FC9A 1U8WA 2E5IA 2PE8A 2I5JB 1XMQJ 1ROFA 5KFIA 2XI2A 4XIUA 4Y00A 4JI3J 1YJTA 1GMWD 1H72C 3M32B 3PX0A 3ITHA 3MEEB 3T5HA 2BEFA 1H7WA 5ETQA 4M94A 3IM8A 4X64J 5D0HA 4F4WA 4Y3CA 4MK8A 1QD1A 1HWUA 3EZOA 2QMXA 2AEJA 3LPYA 4IG3B 3PYDA 5FDLA 5F9NA 5KG1A 4LFCJ 3M8RA 3RBXA 4EU0A 3DRRB 4DSFA 2G2ZA 2ZD1B 3CJ0A 2HWIA 2JVOA 5K14B 5HMYA 3UN5A 1D8ZA 4YDXA 2BABA 1SJ1A 2GV1A 3TR5A 1NMEB 4CP5A 4DXLA 3OW2R 1HQUA 4ECUA 1H7XA 3CC2S 3RR7A 2RDDA 2XSFA 2B9XA 4DQSA 4ZA1A 2ZHBA 3I31A 2HQGA 1OM2A 1N32F 2AGQA 5ETMA 1FXDA 5KOXA 2YKAA 2JEFA 1IUJA 3HD1A 2FJXA 4KHPF 3L9ZA 2BJEA 1FJGJ 1RT5A 1TAUA 3DDKA 1RAEB 1X9WA 4K4TA 1WI6A 2M70A 3TZZA 4ZOSA 1HNXF 4UZBA 1UP1A 4QBUA 2GJIA 1R31A 1SBRA 4X2BA 4A8QA 4ED6A 5F8NA 1RHQB 1FKOA 2W1BA 1B3TA 3ISND 2BYCA 3BGRA 3W9HA 4ZCMA 1RI7A 1DBDA 4G1QB 1RYSA 2R9LA 3DGPB 4OZNA 4L72B 3DRXA 5L1LA 3L7UA 2LXUA 4ZVPB 4OMFG 3QRPA 2F3JA 3KHLA 2K3IA 4GVBA 5DLGA 3GE9A 4CRJA 2GMHA 1YVFA 1JWWA 3N79A 4NA1A 3LTOA 3M8WA 4LRCA 2V4JA 4PWUA 1RP5A 2C2MB 7AT1B 2HRTA 4I6YA 1FRKA 4USUA 3I5CA 5L9NA 1T7PA 2LA4A 4DR1J 1C0UB 1WHXA 1U1LA 2PA3A 4RNNA 2KVQE 4RBUA 4ECSA 3GV5B 1TV6B 4EMDA 4C0BA 5EDWA 4WK3A 2DGTA 1FRXA 2R7XA 5GAHI 4OZ1A 2ZBQA 3DRSB 2XZWA 1XNQF 5IM0B 5IT4A 2NSBA 4C8KA 2V5HG 1C4AA 2UUWA 2HKEA 3KLGB 2R8IA 4NLSA 1YBUA 2CZ9A 4ZPBA 3GSDA 5KFLA 3VAKA 4WK1A 5CAAA 3QJJA 3CGIA 5DM7Q 2CNNB 4MMOA 1HPZB 3PY8A 3CMES 2OMLA 3PW5A 1UW9A 3U1LA 4DSIA 1M5HA 1BWVA 2YNHA 2FZGB 4WKYA 1Y10A 2WB1D 2O66A 4HVZA 3MI7X 4QWCA 3W2WA 4C0OC 3ULHA 2EFPA 2DR7A 4LF8J 3VV2B 2X1AA 2UUBJ 4LF4J 3A8JA 2VBXA 3PRVA 3TW0A 5CYMA 3E01A 4JI1F 1H3DA 4J9QA 3SI8A 3PEJA 2OEKA 2VZ9A 2RD5C 2XMVA 2W01A 4QPXA 3Q8RB 5BXIA 4WCEQ 2UXCJ 2OUGA 1HR0J 2F9DA 3WX4A 3NMRA 1NZ8A 2DR9A 3FSIA 3RJMB 4WP3A 2D3O1 5DGBA 4F4KA 2AZ1A 3HSJA 2P9GA 4LF5J 1FJ7A 2QTWA 1SL0A 3U02A 2NYIA 3PFEA 2BQUA 2IFXA 2I8EA 2R8HA 4ECXA 4LRAA 1IWAA 2NXUA 2Q6BA 5G0RB 3HJVA 2BV3A 2E9TA 1XNRF 1RHRB 4YY3F 2F4VJ 1GAOA 4Z2XA 2EFVA 1FE4A 4RLEA 2YNFB 3NWGA 2DPJA 2R8GA 4F36A 1GTEA 1RADB 5CHCB 5CABA 4X4RA 2IYIA 4DPWA 2P5VA 2FJDB 1S77D 1JMTA 1ZOTA 3HXMA 2GNKA 2XZ2A 4FNIA 1H98A 1U6FA 1KEKA 1NSKL 1M1HA 1T9VA 5A6PA 2UP1A 1TL1A 3LPEA 1L5UA 1FKPB 2R7UA 3B8HA 2BANA 3I6PA 3MEKA 3I87A 4CLFA 3DYAA 3KXDA 4AE5A 2YNIB 1YJNS 3D54A 5L38A 1TL7B 2B7CB 2XC9A 1XK8A 1EARA 1JXLA 4H4KC 1X4AA 3D2WA 1VCTA 2BXJA 4F0MA 1RT4B 1T9YA 2QLFB 2Y1IA 4YHHF 3HVTB 3UDLA 3HI9A 1RCXB 3BN4A 1NHUA 2HVHA 2CQ1A 3THPA 4X4VA 4BWMA 3ZTPA 4B17A 2NXNA 3W62A 5J2NB 4JV5J 3DRPB 2L9WA 3FEXB 1T95A 3JSRA 2HS0A 3HO1A 3LWLA 3PJ9A 3G2XA 3GV7B 3FCWA 4F3QA 1FJCA 2YQ3A 3ZXWA 3E51A 4J9PA 2ZM6F 4LR8A 3Q23A 2VL1A 3OFFA 3G71S 1IBMJ 3UR0A 3HJFA 2Q79A 1F6TA 1NBEB 1R8PA 4QYZK 4KO0A 4HDGA 2CWXA 1YJ7A 3E8OA 5F8HA 5K8PA 3PCOB 1VOMA 5CA5A 1F9HA 4TXSA 1JLAB 2A6MA 1BXNA 4B3TF 2CQIA 2AP6A 1HBMA 3IWLA 5LM7E 1BE4A 1SKWA 2YX1A 1NKEA 1JXVA 2DXDA 2Y8YA 4P75A 2V2ZA 4ITSA 2VC1A 3CD0A 3J81Y 1Q86T 4PWDA 4Y2MA 3CD7A 2EFGA 2R2RA 2C2NA 2OLWA 3SV3A 1RWMB 2Y3YA 3BKUA 2QT7A 1VRTB 1DJ0A 2A2DA 2FIUA 4C3MA 3UN3A 1DTTA 3GIMA 4ICLB 4N8NA 3ZTRA 4V19J 2E29A 1HHQA 3OJUA 1B0TA 3MTJA 2F4FA 3UD4P 3RBDA 1N5QA 3KLVA 1QE1B 4QR0A 2AJ2A 1ACMB 3PYFA 4MIWA 1PYOB 1TVRA 4ZVGA 2DNPA 5K8OA 2VB6A 1BQMA 4WP8A 3MEDA 3MM5A 3Q22A 5HQMA 1DQ9A 2NCKL 4ELUA 1V5IB 4IH7A 3SQOP 2DITA 3CJSA 2V69A 2OAUA 2I0XA 3ICLA 4DQPA 4S0MA 4MYTA 1KBRA 2RDIA 3PHTA 3FEZA 3KK1A 2A3JA 3UD5A 2Y1LB 1PYTA 1FE0A 2BOPA 1TKTA 2H5JB 1VK3A 2XULA 2RH3A 1CJTA 4K4UA 3I4HX 5F3ZA 2M8DB 5CZVA 2J7WA 3ETMA 1JK9B 2YQ1A 3IWXA 4XTTA 1OJ4A 3G82B 2LCWA 1N6QB 1KLMB 1Y7PA 2HNZA 1WKLA 4R25A 5D0EA 5EWGA 3CULA 5F0UA 3J7ZT 2IM2A 3CEDA 1V3SA 4RNOA 4KGZB 4NEZA 4L74A 1T05A 4K5RA 1RTDA 4U95A 4OYBA 2XS7A 3VQSA 1X9SA 4GO5X 4BDPA 1VIOA 3MR6A 2ZDOA 2CQ4A 3AD7C 2XY7A 5J2MB 4FPRA 3JQKA 2V2VA 1JNRB 2ROPA 3MMCA 1IKVA 3OQ2A 5GAEU 4NCBA 3H42A 3IO1A 2J6TA 5ETPA 1SJRA 2Y8WA 3IAM9 4L76A 3SCKE 4JI4F 1TMJA 1KQSR 4H4OB 4NYZA 3HF5A 4J9KA 2DGXA 1BQNA 3HSDA 2C3YA 4O3QA 4WXOA 3MFIA 1JLEB 3N4WA 3SYZA 3UO0A 2KG0A 3B78A 3CMAS 3DLLQ 5KFTA 3C15A 4QIGA 1S6QA 2ALZA 5HK4A 1OY6A 4KSEB 5HANA 3P45B 1O5JA 4WTOB 4PG6A 2LXIA 2HFOA 2DH7A 3G8QA 5HN0A 2KRRA 3QATA 3LOUA 5LOQA 1XN9A 1NK8A 2VG5A 1UFLA 3PR5B 3TO8A 3AODA 1RHUB 3OVSA 3D1QA 4MIAA 2DNOA 3VGSA 4RUCA 4LSNB 4CDIA 4DPUA 3KDNA 1L3UA 5CYQB 3RG6A 4OI0A 2J9DA 3DLGA 4HH1A 1FNXH 1PAEX 3IGNA 2IAJA 4QU7A 2GA7A 3BR9A 2NUUG 5E7OB 1VQLS 1OWXA 1JJ2R 2ZH4A 1FNMA 2XWXA 4Q8EA 3O44A 3UFCX 5CCMA 2BVZA 2DNRA 2WK4A 3MM8B 1VQ4S 4W92B 1V5VA 2GGPB 1REGX 4HEA9 1YJUA 2KT3A 2M4MA 1VRUA 2NLWA 3DM2A 5C7PA 2CRLA 4MKAA 1YBAA 2HNDA 4A8SA 3UPFA 2UXDJ 3IRXA 4E98A 2JLEA 4C3KA 1NSAA 4CLTA 2DISA 2L41A 4P6QA 2XCAA 2UVUA 3DNCA 1SC6A 4JI8J 2HVDA 4GKKF 2VG6B 4DV1F 3TEGA 3M6UA 4TKTA 4U7CA 3IC1A 3TP2A 5C42B 1MMLA 3MEGA 2DXFA 1YQHA 5LXYA 1XEZA 3GZ7A 4XPEA 3EVWA 1HA1A 4CH7A 3HHKA 5C24A 1Q8LA 1U0HB 1LW0A 2JZ5A 2MQNA 3MM7B 1G2EA 4RPFA 3MHYA 2D3OR 3PW7A 5DS7A 1HNWJ 2KT2A 4PQUA 3A1YG 4TN2A 2V4RA 1SV5B 1QAJA 3FVYA 1N5YB 1AYEA 2CPZA 3K17A 4V19X 1RHJB 3ZZUA 1ICEB 1M1GA 3M9NB 2OELA 2BR0A 3H2UB 2IC3B 1I1GA 2BW2A 1NK7A 2B4VA 4CH0S 2E7VA 4P10A 2V2KA 3H2VE 3KLHB 1OIAA 2M8HA 3G96A 1LWEA 3A3NB 1OS5A 1HD0A 2N3OA 1XR7A 2ZBIA 5K8MA 4I2QA 2WSCC 2QSFA 4CO0A 2GQCA 2HHHF 5HVGA 1JJCB 1GX5A 1X31C 3EUNA 1OSCA 2AJQA 1D3WA 3BKFA 4NCGA 3MM6B 3ZO7A 1ZM3A 2BUNA 2RQ4A 5GAGI 1QVFR 2NZCA 3DKDA 3DHXA 3OUYA 2DGQA 2Z2ZA 3FK4A 5KG6A 1CQMA 3UNYA 4NLOA 1KOHA 5HP1A 4BC9A 2DNNA 4ZCKA 4LRFA 4ETZA 4TQSA 2B9YA 3MAQA 2VH7A 1HFEL 4JI0F 2BJ1A 3MTKA 1F1BB 3C16B 3KWMA 4RW4B 5D8HB 2LEAA 1IQZA 3R27A 3MCNA 8RUCA 2YQ0A 4OL8A 1TKXB 3RB0A 4LF7J 5JMNA 1ZM9A 3AB2B 4B9SA 4A8KA 4NPOA 1CJUB 4GRSA 2B5JB 1DARA 3OVBA 4M5MA 3Q83A 4DL6A 2EKNA 4CLUA 4FKXA 2E9ZA 5T7LB 4J9VA 4F0HA 3KJVB 3OTOJ 1RA7A 1S0NA 2BKNA 3I0SB 4FVMA 4YEAA 5DZ6A 5HMZA 4KGXB 2QX0A 2LXFA 5CCLA 4KV8A 1RWOB 3RYLA 4DR2J 2E7XA 4FXDA 2O1PA 2FVQA 3KUHA 1UJ6A 3H0PA 1WTBA 4RW6B 3S1TA 2QLWA 4USJC 2XYPB 4K0KJ 5A2QU 3MUTP 4EK2A 1S1XA 2LA6A 4XPCA 5HBMA 4LSLB 3MAAA 4JI7F 1NK6A 3R7BB 4ED5A 3IN5A 1EP4A 3OTCA 3PFOA 3K89A 1UVMA 2I5JA 2LQBA 3LWMA 3WIVA 3BDEA 1L3KA 2VF3A 5IT9U 3M32A 2HWTA 2CQ2A 2HGNA 3T1YF 1NJWA 3AH6A 1PKUA 1ZA2B 3KLFB 2JFDA 1HWKA 1YRXA 2YKMB 1N33F 2PC6A 4DWIA 3U1MA 3TJ8A 2N4CA 2MZTA 2B56A 4IG3A 2F40A 4NLUA 3DN9A 2MKCA 1D9FA 4ZS6A 3DRRA 2MXYA 3VVTA 2WB4A 4FBUA 2ZD1A 1S12A 3C8YA 2VBYA 3OXFA 2WAQD 3GR0A 5K14A 3SMZA 4UOFA 3BQ0A 1F5AA 2DHSA 1U1RA 2IMOA 3JTOA 3W65A 4OLOA 1FTCA 3QGIA 4NZ6A 3BM7A 1UUJA 1NK9A 3KLIB 2DGSA 2HGMA 5HATA 1XMQF 4DG1A 2JH3A 3HSGA 2WW4A 4GKJJ 1E6YB 5HMXA 1SL1A 4JI3F 1TK8A 1S1WB 1N54B 2J5AA 3EPGA 1RTZA 3QRQA 3M9MB 3GLJA 4BLGA 4IH6A 1G6BA 3JSMB 4B08A 4X64F 2B0GA 4FPIA 4RKUC 2WVDA 4WFAQ 4DOZA 2I1RA 3K5PA 1RZMA 2XLIA 3CJKB 4O4GB 1MWYA 4LFCF 4ZCIA 2HHQA 1N4LA 3N6LA 5FLXY 1ZM2A 1J2VA 5E0OA 3TAQA 3BGLA 2DO0A 4OHYA 1TL5A 3Q8UA 1WC4A 4R0JA 3D3BJ 2H9ZA 3BH7B 1EKSA 4G1QA 5E33A 2MSSA 3CJ8A 3DGPA 2XGQA 4NI2A 4DN0A 4B3RJ 2XYGB 5ETNA 2B8PA 3HPOA 4J9OA 3SZ2A 2BRKA 5IZHA 4O3NA 2UUAJ 1PYSB 3IS9B 1T0TV 4HHHA 3TWZA 2BDPA 2XY5A 1IKWB 3KUEA 1VGYA 3MCOA 1NUEA 2OPRB 1C0UA 2K2PA 2CNLB 1FJGF 3A8KA 2W4CA 1S57A 3LF0A 1N32J 1BLUA 3I0RB 1RT1B 2V6AA 5DJBA 4ENOA 1TV6A 3PYEA 3DC2A 3ILOA 4RUHA 3QZ8A 4IRDA 3J81j 1S1TB 5IXUA 1OY9A 2RMLA 4YB1P 2WVFA 1G7CB 2BZ2A 1D9AA 1UWBB 3QFHA 3DGVA 3AJ1A 2HS3A 1RAHB 3DRSA 2XG8A 4OLPA 2C3PA 1H2UX 5IM0A 2JSXA 3QNWB 5LMNF 4Q2LA 2DK2A 4A8OA 3IAS9 2BE7D 3KLGA 1H2VZ 4O4RA 2B3TB 1Q78A 3R7NB 1JIHA 1XQIA 2VG7B 4ZN1A 1GEHA 4LQ9A 2NS1B 8ATCB 4DX5A 4DL2A 2KVIA 5FJ4A 1WJ9A 1HPZA 1SUQB 3DLKB 3TAMB 3LA0A 3F41A 2AT1B 1ZA1B 2VDHA 2E1CA 4DR1F 1QVGR 1U0SA 4F67A 1QAIA 2ZJQQ 1LV5A 4K59A 1EIYB 2VQEJ 1F60B 3TA2A 4KC5A 4CLZA 4AT1B 1FFGB 1HW9A 2AX0A 3EGNA 3JAMU 2DHGA 1W2BR 1CS4B 1HW8A 2MHEA 2QC3A 4CT9A 3N9UC 3K57A 4WFYA 4FP9A 2C3UA 2CKWA 3ZTQA 1PSDA 5CD4A 2DCLA 2OSQA 1TTHB 3TEHB 1KOOA 2HAFA 4ZP9A 3FCHA 1IQTA 4OV6A 5D15A 1O51A 1U49A 3GPAA 3HHLD 1FA0A 1HWIA 1VLOA 3EVOA 3VQTA 2HHUA 1VQ6S 3NCPA 2XBPA 1VDHA 4U96A 4OHXA 4ILRA 2X1GA 5KOWA 4ILMA 5HAOA 4I6AA 3TX0A 2MQPA 5G0RA 3HVAA 3MURP 5DM6Q 2EFOA 1LW2B 3R5GA 2D7SA 1VJQA 2YNFA 2CJYB 4CO3A 4HYKA 1C4CA 2PD1A 3SQGB 2XS5A 3HT0A 2AGPA 3D0HE 2DHAA 3WDOA 1HNIB 4HTIA 2NREA 3H5SA 3NS7B 3GG0A 1IJEB 3I5BA 2NPFA 3M30B 4LF8F 4M5HA 4KFBB 2UUBF 3OLBA 2EBEA 1UETA 3DLHA 5E3CA 1IKYB 2RUSA 2WZ1A 3PO5A 2E5HA 5AXKA 1KRPA 2XTDA 4M5NA 4WZMA 3OT9A 5LJ5Y 1AUDA 5IC4B 4UUWA 2UXCF 3GYXB 5KFXA 2AX1A 2PGCA 3DCAA 1HR0F 4IG0B 2B9EA 3BPSP 2YNGB 2BQ3A 2A1BA 3EX7B 2V0NA 2VV5A 4JV2A 4LF5F 2PT0A 4OZ3A 4PAAA 5GAEI 2YNIA 2V8PA 1TL7A 5IT0A 3J7Z5 3H98A 2RKIB 5THWA 2F4VF 2DBBA 1RT4A 3ENQA 3IBFB 2ASDA 3R8YA 3H5UA 3HVTA 2R8JA 1EX8A 4FKYA 1Y5NB 3A13A 2QYCA 2H48B 3R1HA 1XNRJ 2K7KA 5AXLA 5J2NA 2BE9B 1PCAA 5B0FA 3FFIB 4C9DA 3DRPA 5I3QA 3M4XA 4RNMA 1QLNA 3DHWC 2WONB 4P7VA 2KO1A 1F2HA 1LNQA 3PACA 3D6HB 3D5MA 1S9GB 2DTJA 3QAEA 1MWZA 3GILA 3TUZC 1B0VA 2DJWA 3VCDA 3G8SA 1U09A 4I1TA 4TYAA 3EZUA 3DDIA 3NS6A 1J5EJ 2Z56B 2X3DA 3AFGA 3MCMA 5DG8A 3NGTA 1T11A 4M95A 3CXCR 1JLAA 2YWKA 3AJDA 3H5YA 3V6HA 3G6XA 4P2SA 1X4BA 3TJAA 3I96A 3PEHA 1S59A 2V50A 3UVJB 2Z8QA 5AE2A 4F25A 1BUXA 2DR6A 2IPOB 5T14A 5F8LA 4K8RA 3V81B 3QT7A 4JBCA 1AZSB 1U25A 5I3UB 2YPYA 1S6OA 2E5JA 4AQYJ 2PEHA 4ES2A 4YHHJ 1CEZA 1VRTA 4KPYA 4DSKA 5F8IA 2PFDA 2CADA 4ICLA 3NP5A 3EM1A 3CCVS 4A8MP 4DL0C 1IBMF 1APSA 3D1HA 1NK4A 1JXEA 3LGMA 2LEBA 1Y11A 1QE1A 1WG4A 3KG0A 1XWLA 3HZEA 1X4DA 3LW5C 4IFVB 2ZBCA 4C2MA 3BF4A 3TA1A 3FRYA 5AE3A 3K5LA 5KFZA 3D6FB 2Q66A 1NCLA 2RQCA 2C22A 3FGVA 4UOCA 4DV4J 3NY0A 5L46A 3ZZOA 1OPZA 2GW8A 1U8SA 2OI2A 2ZBPA 2MKSA 2YY3A 1MU2B 2YWEA 5B0BA 1WG1A 2BJ3A 1ITPA 3NGKA 3Q8SB 2ZFHA 2MQOA 3FEYB 1RWVB 3LGNA 1U02A 2ZUGA 2AYEA 2MQ8A 1WSRA 3HHEA 4F4ZA 4Q2MA 2WVBA 4OX6A 3OBIA 3GFHA 4K50A 2CPEA 2OEMA 2CIMA 3B6BA 3DOLB 4CLWA 4NASA 1Q4RA 2Z0GA 3G82A 5ETOA 4IOBA 1EB0A 2QO3A 1NDKA 4B3SJ 3KYLA 5HJYA 2CJKA 3O5TB 4XK8C 1N6QA 1KLMA 3HMJG 2KH9A 2MHNA 4YB6A 4OYWA 2DGVA 2D41A 2UVRA 2QL9B 2WOMB 5KFUA 5HQ8A 1H2TZ 1TU0B 4RL1A 5K9FA 2CVIA 4I4BA 3BV8A 1S6PB 3W5YA 2XO7A 4EFAC 3VZHA 2A0FB 1RDRA 5KFNA 4G1IA 1IR2A 5DQHA 3TJ9A 1NK0A 2XNRA 3M2RB 2EXUA 2CJBA 4O0NA 3IXQA 2MJUA 3GB0A 3T5JA 3PW0A 4YR3A 2HYIB 3DU6A 3LUYA 2W4PA 1JNZB 3SDEB 3QWUA 2ZH5A 2VHGA 3ET6B 1PGZA 5H9FJ 1S1UB 2PFFB 3BREA 4AYBD 2QZ8A 4H4OA 5H1SV 2QJ3A 1TAQA 4PG4A 4X66J 2E44A 1XBWA 4ED1A 4FYWB 4CNYA 3GJQB 1JLEA 5LSRA 3TYTA 3JSYA 3R6GB 4ED7A 2E9RX 1D0EA 2ZBRA 1IBLJ 3US5A 4NZ7A 2BM0A 4ZIWA 4HL9A 3VHQA 1L3TA 4JB8B 5T41A 4NLVA 3NNAA 2C3OA 3FJ2A 4K5SA 1VHFA 1SKSA 2RS8A 3QAUA 3ONQA 1EHWA 3MPWA 1FDDA 2LEPA 3U7JA 4ZHRB 4ANCA 4WFNQ 1SXLA 4W4MA 2FLLA 3QJLA 2XTEA 3P4UB 4OX8A 1FDBA 5E41A 5J1PA 2LQ5A 2N7CA 4LSNA 2D74B 5CYQA 4LRDA 3HK2A 1LK7A 3RB4A 2FJWA 3UDEA 1NNDA 4IFYB 2JX2A 3OR1B 4OJ3A 1X0FA 3MM8A 1X4GA 5KFYA 4RO0A 4N7TA 2A18A 2HWHA 1ZZFA 2ZVSA 2GGPA 5ETKA 1RTHB 4NMXA 1REVB 1AFIA 2NPIA 4IO1A 2H65B 4FYVB 4DZ6A 2JLGA 2VPWB 4URSA 4I0WA 2ASYA 3D7SB 5K5MA 3N5FA 2N4DA 2CQCA 2GAHC 1HNVB 1RU2A 4EI2A 5E3RA 1N36J 1YGYA 3TVKA 5E5NA 1RJJA 5HVFA 2Z4PA 1NDPA 2B7BB 1E6VB 4HKQA 4EZ9A 2IVMA 5C42A 3UDCA 4NXMJ 5F8JA 3M8ZA 3R5CA 2MZSA 1U0HA 2AYGA 3MM7A 2M88A 3GV8B 1Q82T 4NLGA 2AKWB 1U1PA 2Q1LA 2DR8A 1SV5A 4WTYA 3I55S 4QJVA 1D8YA 4ZPAA 1YKWA 4NCAA 2BW7A 5DQGA 2AV5A 2IC3A 1V3ZA 3PYGA 3KLHA 4RW9A 2D1CA 4KBIA 4CZCA 4D3HA 3T19A 3ILJA 1ZZNA 3MMJA 3L7OA 2UXDF 2JC0A 4CLLA 5EN1A 1CSJA 4JI8F 4USTA 3NOCA 4EO6A 1U24A 3KTQA 1YSJA 3FSYA 3EZ5A 3CCWA 4A8WA 1Y0HA 1WWHA 3MM6A 3VAGA 2H4WB 2V94A 3GQCA 2LKZA 2RUGA 2E66A 1S72S 1Q79A 2UUTA 3RW7A 2PI5A 4ED3A 3VALA 2JFKA 4GKKJ 2AYMA 2FDNA 4KYZA 4HLBA 1HNWF 1F5CA 1VYAA 3W66A 4M5LA 3PO4A 2P2CB 1YDLA 4QQBA 1ZETA 4PXBA 4LFAJ 2LQ8A 4DR3J 3DLEB 3C16A 4TY8B 3PHEA 4RW4A 1BY9A 2DGWA 4QIFA 1TKXA 3MOJB 5B08A 4OFZA 1XJWB 4DDFA 4DN9A 2R4FA 3W5XA 1FRHA 4DFKA 1RABB 1CJUA 2VDIA 2CQGA 2ILYA 3HD2A 2ERRA 1RT2B 5CH7B 3ZZ0A 5KFSA 5T7LA 4LIRA 3KJVA 3M1VB 1U2FA 4DX7A 4DQIA 1TELA 3I0SA 1FK9B 2GAGC 2VOOA 2HBQB 2GIFA 4AXIA 4RW6A 4L6V3 2BJ9A 3QLHB 5K20B 2HHHJ 2P9CA 4WBFA 9RUBA 1VBYA 3MR5A 4LSLA 2O5DA 1KR4A 4OZ5A 3LH2S 4R5PB 4KPCA 1DHMA 1D09B 2MKJA 1KONA 2R3VA 5IS2A 3TZWA 3AHPA 5HVHA 3FBBA 3RAQA 3QQCD 3DLJA 4F3OA 1VIXA 3F73A 3VGVA 4P72A 1EKRA 1IM4A 1LFPA 1NRKA 2FHKA 3BGFA 1RQ0A 3B82A 3TUPA 4HHUA 1DQAA 5J1EB 4DQQA 2GO9A 1HD1A 4RW8B 3KLFA 4LF7F 2HQCA 3KJNB 2F8MA 2YKMA 4DL3A 3CWJA 1YRTA 4F2RA 1MW7A 2AW0A 1G3OA 2F8HA 5J1NA 3VR1A 2BKOA 5A76A 1UVNA 2K7JA 2FGOA 2MKIA 2BKPA 3OPKA 4UUXA 5A2QY 3IWNC 3IFEA 3OTOF 4Q0BB 4YR2A 4PXCA 4I69A 3JB9k 3M6WA 2J0XA 3PRDA 1RUSA 3GG1A 4LREA 4DR2F 4ZPVR 1HHSA 1UEKA 4RBTA 1P1TA 1YTYA 4K0KF 3H7HB 2VD3A 3OFEA 5A0YB 3OVAA 2ZE2B 4UZCA 2W2PP 5IT9Y 1SVDA 3KK3B 2CAJA 4ED8A 4NOHA 1I94J 3VGUA 3JQMA 1BHNA 3KLIA 1U6ZA 1OQ3A 4QWAA 5B0GA 1VQYA 3BGUA 5KT6A 2RSQA 1SCJB 3PDNA 6AT1B 2B51A 1E6YA 2KB2A 4FF3A 3PG9A 2YWGA 2LDIA 1S1WA 1S49A 4LR7A 4CO2A 3JSMA 3QT6A 1Y4ZB 2I2YA 3VWSA 2HEKA 3CJ4A 1BMQB 1VQ9S 4QW9A 1H38A 3CJKA 4O4GA 2J9EA 2EKYA 4ZITA 4CWBA 1TFWA 3T1YJ 1LOUA 4ZPTR 1EQ0A 1U2CA 3HZGA 1SKUB 1K8AT 2EG2A 3QIPB 4OYIA 3OHBA 1YZ6A 4LQ3A 3LAKA 4HI2A 3NBPB 1WC3A 2J0SD 5ITHA 1WD6A 3E3XA 3NG8A 3C6TB 4QYRA 2WW8A 3HFZB 3M8YA 3QSIA 4JI6J 4GKJF 1UJ5A 3EGZA 2EI5A 5JVGQ 3T6JA 2LQJA 2KFZA 3IS9A 1DQ8A 4L73A 1IBCB 1IKWA 5KFAA 1Z2LA 2OPRA 3OTEA 1GK8A 4X62J 4K4YA 3W61A 2DKOB 4C11B 1YRUA 3I0RA 3A8EA 1RT1A 2HVIA 1QJHA 4WE1B 1F0XA 4P73A 2D68A 1S1TA 5C5JA 1TR0A 1ZYQA 1M5VC 3W63A 1UWBA 4D3GA 4NRUA 3D9BA 3BQ2A 4Y2AA 2KKHA 2KT5A 2VPXB 3KJFB 4I6WA 2KI2A 4RU2A 2VA3A 3HP6A 2ZEJA 5KG4A 3HHNB 5HL7Q 3DXSX 4B3RF 4J7CA 3G6ES 1TL3B 2VG7A 3N6NA 4OZ0A 2I9SA 1LK5A 4DV5J 3SIPB 1OMSA 1RISA 3N28A 4EGLA 2UUAF 3H25A 2UU9J 1SUQA 5FLXU 2FC8A 2RQMA 3DLKA 5EGYA 3V5RA 5M2UA 2KXFA 1KD1T 3TAMA 4WFBQ 4MK9A 4TLRA 2QA2A 3IBWA 4UW2A 5L1KA 5D77A 4DEZA 4Q43A 2RRAA 3MD3A 5LL6d 3ZZTA 2KFNA 4K4VA 4B9LA 5KFOA 4P2XA 4ID5B 5L1JA 1RE1B 4G3IA 2GVZB 1CS4A 2XI3A 4DUYJ 2RF2B 2E1AA 4Y2IA 4W98A 2MMYA 3UWTA 1Q7LB 1NXIA 3EMTA 1KVJA 3KG4A 2W2QP 3ISZA 5KFCA 5LMNJ 2VQFJ 3FDSA 1NU4A 2DEIA 4ECQA 2XB2D 1YJWS 4NA3A 3E01B 3S8SA 2DGUA 2POKA 3CIMA 3UN2A 4DL4A 5DQIA 3M8PB 1LWFB 4DCJB 2MY7A 3A3OB 4DR6J 3PW2A 3JXOA 2OH2A 3JAMY 5AE1A 2QA1A 5IV4A 2VQEF 3G86A 3IMQJ 3SQGA 1U1MA 1MNEA 1HNIA 4X4PA 4KE5A 2KM8C 4HTJA 2YBVA 1RBLA 1FNOA 3PNIA 3M30A 4KFBA 3QJPA 1KN6A 3K58A 2ZHOA 2YH0A 4USVA 2HMIB 4JV0A 4DLEA 4RUBA 4DQRA 4IG0A 2FY8A 2LECA 3BO4A 5ETRA 3QPIA 2YNGA 5GMDA 2BBEA 3BQ1A 3RBZA 5KFMA 3J7A1 3PR4A 2HBZB 1UEVA 3VTIA 2ZH1A 1U1QA 5GADU 1TUWA 3CW2C 4RW7B 1WEYA 1NJZA 2XHCA 1B99A 1IKXB 2AEMA 1LQ9A 2RKIA 3KOAA 3UI3A 1X0PA 3FBEA 3D0GE 4OQJA 1WOOA 1SC1B 2OD4A 2CG8A 4F4XA 2OTLS 1NH8A 4ZVQB 1S1VB 2Z2LA 2CXEA 1OYDA 2BE2B 1MMDA 4OYPA 4NLDA 2EPIA 2FLOA 4NLYA 3S7RA 2AIRB 3VAHA 2RVJA 2A10A 4YUDA 4E8UA 1WEXA 3FFIA 4F2SA 2ZJRQ 1HARA 3T3FA 1SJ4P 3EXYA 1FF2A 4FXVA 5HLFB 2WONA 5FD1A 2C28A 1WF1A 1S9GA 1SB6A 2R2SA 3K2YA 2NUHA 4LF9J 1FWLA 4ECWA 3F44A 4ED4A 4TQRA 4Q7AA 2IHR1 1PILA 3WIUA 4NYOA 4WKRA 2WBRA 2ZH3A 3ADAC 3CDWA 2KRBA 1JLBB 1AXQA 5A8RB 3ILLA 1UZHA 1WKJA 4NLXA 4XAKA 3CCJS 2EBGA 4ECYA 1Q0NA 1VC6A 1U7LA 2ZZNA 2GMJA 4PXDA 4EEYA 1Y00A 3TAPA 2JL9A 3DMJB 5KFBA 2KJWA 2ATCB 2LP4A 3UVJA 2DVIA 5C2CA 4Q44A 3V81A 1HMVB 3AJ2A 1AZSA 2DXEA 3PV8A 1WOPA 1VI7A 1X5SA 3P3DA 3BDPA 3GTYX 2HHWA 2HSEB 2IYGA 3GJRB 4DR5J 2RILA 1UCNA 3F0NA 4F4AA 2RHSB 3PXGa 3AD9C 5KFGA 3UNGC 2J6UA 2V68A 3R5BA 1J5EF 4IFVA 4DF8A 1CVJA 3R6LB 3TI0A 4X4SA 2DIUA 2XSJA 2XTCA 4QPTA 2MKKA 3MMAB 1K9MT 2MZJA 2GHVC 3TZYA 1NK5A 3DOKB 3PJWA 1HLWA 1YBTA 1M5OC 1H6KX 1YX2A 4TYBA 4DUTA 1TFYA 3ETOA 4JI5J 2IMWP 1RA6A 4FDFA 1L3SA 4PG8A 3QO9B 1MU2A 4KB7A 1UVKA 2EK6A 1WKKA 3CNQP 4RX6A 2U1AA 5D0RA 2HW3A 1EJ7L 3KMSA 3C19A 5RUBA 1JKHB 4AQYF 3J7YU 4CO5A 5MAOA 2J9CA 2HFZA 1M5KC 1RT3B 5AJ3J 4IO9Q 2L9NA 2Z30B 2XCPA 5ETSA 1D9DA 1NHKL 4ER8A 3RB3A 4MH8A 2Z2MA 3DOLA 4CYUB 2MPUA 3GYNA 1WC5A 3C66A 1SJQA 4X84A 1JLGB 1UTAA 1QDUB 3HVRA 1QM9A 4KKOB 5HJXA 2ZVIA 2KG1A 4OX9J 2LFVA 3ILIA 1OSDA 4W90B 3U27A 4LVNP 3R3TA 2FHJA 1X4EA 3HCXA 2NXJA 2WOMA 3GONA 3DFEA 5KFKA 5KT5A 3BS9A 1S6PA 4DV4F 3SFUA 5L8RC 1MWQA 2A2CA 3M2RA 4NWBA 1TKZB 1GMUA 4M8LA 1ZAWA 4ERDA 1R27B 3KKFA 5JUMA 1YHQS 4YR0A 4Y28C 4DF4A 1PBAA 1F3VA 4GVLA 4P9SA 4U8YA 1NJIT 3CC4S 4ELVA 1WC0A 3SDEA 3I56S 1FVSA 4OI6A 1RBAA 4CTAB 4OYMA 3ET6A 2D3UA 1S1UA 3IM9A 2CDQA 3BEGB 2CYYA 4F3MA 4H4MB 3MFHA 4B3SF 1WF2A 3AT1B 2F63A 2PDAA 1RWPB 2MYFA 3ZZYA 4ECVA 2NXEA 6FDRA 4N5SA 1X4CA 2GC8A 5CQGA 1LWCB 2DY1A 2KXHA 4XDDA 2HFVA 3KDOA 3ZNJ1 1Q8KA 1VQNS 2WRMA 5JVHQ 4F4YA 2FZCB 3SEOA 5JJBA 3J80Y 1X4HA 2V8HA 2W2OP 4DJBA 4N47A 2FJAB 4ZHRA 2UUCF 2MZQA 5LXRA 3BN7A 5B0DA 4L3NA 2OSRA 2KHDA 4WYWA 4FYYB 2ZWOA 1KTQA 2G1HA 4ZVSB 3QZ7A 2VU5A 5ADZA 3CCQS 2XMWA 5CYJA 2N7YA 2XMKA 5F0WA 4IFYA 4O3SA 5ETVA 3OR1A 2FYXA 2IIHA 4NX9A 2AHOB 3EE3A 3CO9A 1RSCA 1OYEA 2QFIA 4DZDA 4WFZA 1RTHA 2ROGA 4X66F 2Y0BB 1REVA 4LJMA 3ENWA 5KG0A 1YITS 5LSLA 3I9ZA 1GT8A 3FZBA 3MMBA 3AOAA 4Y6IA 1BC6A 3JTPA 4ZVEA 4FZVA 4LF6J 1S5ZA 1IBLF 1YJVA 4WU2A 1OQ6A 1HWLA 3RRGA 4O23A 1HNVA 2F5GA 4PPDA 5FIIA 4LUBA 2HPUA 3AWRA 5J2QB 1E6VA 1NPRA 1JB0C 3LP2B 2LMIA 1R8HA 4LBHA 1Q5YA 3TUIC 4CO4A 4KH0B 3D28A 2PEBA 2FLPA 2MGZB 1N5SA 4N76A 2R2UA 3R7SB 4DUZJ 1UFWA 4DV7J 2OPPB 1JLCB 4WF9Q 2JWNA 2XMJA 2RIJA 3Q2TC 3O8WA 4CT8A 2MQLA 5HQLA 4LIWA 3BR8A 2W8LA 3PIOQ 2ZDPA 2Q6CA 4KH1B 1PAUB 2IRUA 3CD6S 1MROB 3MEGB 3HLUA 2VFSA 4C48A 1UA0A 2AYBA 2J0WA 4OJHA 3O3LA 2FZKB 3EXCX 4IQMA 4FXWA 5IC6B 1U2RA 3MD1A 1T02A 4HI1A 3TQ1A 1N36F 4NE9C 1YJRA 4B9TA 3L7PA 1WORA 4DR4J 4BBYA 4DX6A 1S4EA 1VQSA 3T5LA 4HDHA 2XTJP 3BPDA 4RU9A 3SV4A 4NXMF 3SCLE 3R5AA 1CLFA 3FSXA 4C97A 1SPBP 5E3AA 1I3OB 2ADCA 3DRYA 3C2PA 2FGCA 2JOQA 4K2JA 3R9LA 1NB7A 5EUHA 1S79A 3IP0A 1CC7A 2FB0A 4ZPCA 2HGLA 2HK3A 3G8TA 3H90A 2Z58B 4HACB 4BCAA 3H40A 3RRHA 2H5IB 3M8QB 4ANEA 2C2ZB 2LYVA 3G87A 3DLEA 1N88A 4TY8A 4ZJLA 2HIYA 3V4IB 2MY8A 4AUKA 3W60A 2R7RA 2QLJB 2CPFA 3GR1A 1S76D 4HR2A 3O1LA 1Q53A 3LALA 3DI6B 3B4MA 2M52A 3EVMA 3TUJC 1RT2A 1DTQB 5F8MA 2PMWA 2PMZD 4C8OA 3M1VA 4NA2A 5LJ3Y 4J91A 1FK9A 4WWSA 1NB2A 3CCMS 1KSPA 3IG1B 4DV0J 4EBEA 4WFXA 2AWZA 3MECB 2GIRA 2KM8B 4ECTA 4YMEA 3TQEA 3FMWA 2LU1A 2XMAA 1IN0A 1FWKA 2JDJA 4DI6A 4EYIB 4OYOA 1EETB 4R5PA 3THTA 3DLBA 1X5TA 3CCTA 2WTFA 1C1BB 3GMGA 4URQU 2EC2A 1M90T 4UY8T 2OP5A 1FVQA 2V8VA 4LFAF 2QL7B 5I42B 4DR3F 4AD6A 4CLYA 1U26A 3QGPA 3C6UB 1GX6A 2X1FA 5J1EA 2W25A 4RW8A 4ZIVA 2AMCB 1K1QA 4MKBA 3Q8VA 2NZ4A 2DD8S 5M2RA 2AU0A 4QIVA 5IWAJ 1JLFB 1J5OB 5GVQA 3THVA 2UXBJ 4Y34A 3M2UB 2QMWA 1NJYA 4LBIA 4Q0BA 1JLQB 4L75A 1L3VA 3OD2A 3EWGA 3R5JB 1P9YA 4F04B 5DRKA 3DOMB 5A0YA 3GIJA 2ZE2A 4MJKA 2CPHA 3KG1A 3KK3A 1RGVA 2DO4A 2G0CA 2X1BA 2XZDB 1CQNA 3X3UA 2CPIA 4A8XA 4USMA 5LT5A 2JLFA 4UQGA 5IV3A 4KR0B 1FO1A 2J7UA 3MF5A 2A6OA 4J5OA 3BSAA 4K4WA 2ZH7A 2R7OA 2JNJA 2W9BB 1K1SA 3OJSA 3E2EA 2W9CA 4O44B 1U48A 1VQMS 1YG0A 4TNOA 3PM9A 3GCWP 4G65A 2I38A 1NPKA 4DG1B 5GADI 5DLFA 1ZS6A 3OSPA 2CPDA 1GXLA 2MSTA 3AAWB 2EVZA 2IVFB 4YS2A 3QIPA 3C14B 3CJQA 2XLKA 2EWHA 4F26A 1NPPA 2PSZA 4C7QA 1S9FA 2RRBA 4O3OA 4IRKA 1RT7B 3N0VA 3BO3A 3NBPA 4OX7A 3HHLB 3MR3A 2ZKTA 1IBKJ 3A8IA 2KL8A 4C6AA 3C6TA 1I94F 1UMJA 4OI1A 3HKZD 4IQXA 4DU7A 1ELOA 3V4MA 1SJFA 5B09A 2CQBA 4UQTA 2W24A 1FFWB 1T9WA 2VPZB 4OZLA 2HRUA 2FD2A 3HFVA 5EWEA 2Q43A 2MTLA 4OIXA 5K8NA 2HHVA 2Z57B 1D1UA 1GFWB 3MOZA 4NI2B 1LXNA 4C11A 4F0KA 4USWA 1HIYA 4WE1A 2PI4A 3MCSA 1DRZA 1N5TA 3A4TA 3M9OB 2YWHA 3MEEA 2ZH6A 4F7VA 1W2IA 4A47A 4WJBA 1T9XA 4RUAA 2WSFC 3FBCA 8AT1B 1T8EA 3GWCA 2DNLA 3FC9A 3AXKA 3DXBA 3RTVA 2HBYB 4LBPA 3PX6A 4ZPDA 4M5KA 2ATLA 4C8YA 3DDNA 2DR5A 4X65F 4EBCA 2L08A 3GSIA 2VA2A 1V9OA 2EFQA 5GAGU 2DGOA 4YQWA 1T9TA 2KFYA 1VQOS 4WU3A 4CLKA 2IBOA 4A8FA 1U1OA 5DG9A 1TL3A 1VLYA 5KG7A 4J90A 3D67A 4JI6F 2QRRA 1G4CA 5KTQA 2QLBB 4OYXA 3AOBA 4O3RA 3P5TL 4PXEA 4KJIA 2ASJA 1BD6A 1NH7A 1PJ7A 2XMUA 1EQMA 5D0GA 3AA8A 1WHVA 4M5IA 2M5YA 1Q8BA 2G2YA 2CPXA 4X62F 3P8BB 3PZPA 2H51B 3LP1B 3BBBA 3QYYA 9ATCB 4PQAA 1R7IA 4ID5A 1VQPS 2OFGX 1QSSA 3I9V9 2B8QA 4ZVFA 2GVZA 2P6SA 2ALYB 4DV2J 1DZ5A 2RF2A 3FNNA 1R89A 2FJEB 3W2VB 1AA1B 5KAKA 1AROP 3RU0A 3LP0B 4RR5A 1YWXA 2MKHA 2U2FA 3MPDA 1RT6B 1FI4A 2BJDA 3FQLA 3KNGA 2GMLA 3CJ2A 1G1XA 1VISA 2CDRB 2CPYA 1VMBA 1GXTA 2EK1A 4R8UB 5KG2A 1S48A 1KQFB 2YPZA 1A6LA 1SC4B 4DV5F 2XM3A 2F65A 2J8SA 3IR6B 2BX6A 1NDCA 2HS4A 2UU9F 4NLQA 2AZ3A 3J7YI 3VAFA 3T1HJ 2QV6A 3M8PA 5HSPA 4DFJA 2KJVA 1LWFA 4ZMMA 3KNAA 1R0BG 1FXLA 3CCES 3VVUA 4QIWD 2DH9A 4RJVA 4F8RA 4UOHA 2KTQA 1YLXA 5LSOA 1K0TA 3ZZZA 3TANA 3RAMA 4N8OA 2AJ1A 3W5ZA 3O6QA 3UW1A 1R0AB 2GJ2A 2BA9A 3CMQA 4DUYF 4CH1A 2DCUB 2NXCA 3CT9A 2B4OA 5DDQC 2BM1A 3CTRA 2F9JA 2OD6A 2OO4A 3FKBA 2HMIA 2UVVA 3T1AA 4C3LA 4LVOP 3QGGA 1WI8A 3CJ5A 5IFMA 4QWDA 3MM9B 1HBOB 3IRWP 1B64A 2FPHX 2L3MA 4AL6A 2CQDA 2AEFA 1GXUA 1GNKA 4PUOB 1S6UA 3ENAA 2VQFF 3CE8A 2IM0A 2DNYA 2VFVA 2R2TA 5U47A 4RW7A 1RLCL 4NXNF 1IKXA 4TVAB 4DFPA 1VHIA 4PG5A 2ZOGA 1IXKA 5IQQA 3PX4A 4DR6F 1N0UA 4OHZA 2VC0A 5KFFA 4WP9A 1H0HB 4MAKA 1EAYC 2R7SA 5IQ6A 1FRJA 3CCRS 3CCZA 2V8DA 3KHRA 1S1VA 2YX7A 1S7IA 4IR1A 1N34J 1SC3B 4CNZA 1VC5A 2VASA 4FYDA 2BE2A 3H4BA 4QWBA 4BHQA 2HHXA 3MPYA 2WBMA 3LQVA 2GFFA 3EGVA 3RZAA 3QFWA 3K5MA 4EYHB 3AA9A 3GIRA 4ID8A 2GQ2A 2V34A 3MR2A 5HLFA 2IY5B 1KHWA 2ZC3A 1WOSA 4QWEA 1TK0A 4ED0A 3QGHA 4WZQA 3AOCA 1DLOB 3BSOA 4G1PA 4ZP8A 4KT0C 1DFDA 1BGXT 1UJ4A 5LMUJ 1JLBA 5A8RA 4B02A 2Q3PA 3GP9A 1TMMA 4M5DB 4ZP6A 2Y1RI 1EZZB 3P49B 2ZZMA 5DGAA 3DMJA 3MR7A 1KC8T 5I3PA 2GZOA 4GC6A 4A8YA 1XC9A 3PJXA 4I2PB 1RKIA 1HBUB 3KLEB 2Y1JA 4EWTA 5F41A 2G9OA 3BB5A 1HMVA 4DR7J 1SH0A 2V2QA 3ISNC 1NZAA 1WG5A 2C2EA 3NNCA 3QT5A 2D3ZA 3FZ2A 4U7UK 3SCJE 4OZ2A 1RK8A 1I6JA 1RWKB 1WUUA 1RWNB 5C2GA 4N41A 2GQQA 5H9EK 4C4WA 5KFHA 1HNZJ 4LF9F 2HBRB 2VFTA 2OPQB 2F8EX 1HWJA 5KFDA 1FKPA 2DB1A 2NQPA 3CJRA 1O0PA 2AQ4A 2HURA 1HI8A 5F9LA 3MMAA 1A0OB 4TU9A 3DOKA 2HAIA 2FVSA 1FX2A 1C0TB 1VS3A 4WYLA 1U1NA 1S0VA 5G4DA 2CZ4A 2YKNB 2HHTA 1KKHA 3QMQA 3QO9A 4FS2A 4PPZA 1VBXA 2MJNA 2AJFE 3T9ZA 1JKHA 2HLUA 2IA6A 2ZOFA 4UOGA 2W9AA 1UEUA 1Y9OA 1ZH5A 1UZDA 1RT3A 2E5LJ 4P71A 4X4TA 1S99A 2JRSA 1X5OA 4CYUA 3PRBA 4DR5F 1JLGA 4KKOA 2QE5A 3Q86A 2ZH9A 3Q8PB 2W8KA 3Q8QB 2GO8A 5F3TA 2Y0SD 4PWWA 2VKRA 1S9EB 3K8VA 1NSQA 2B4UA 5CD4H 2DEJA 5D4OA 3BYRA 4PYDA 1RTIB 4ZLPA 3POTB 1RWUA 4FN5A 1HL6A 3I5AA 2W2MP 4OJGA 2R7VA 1RXOB 3OXGA 4RWXA 3SSQA 4JI5F 5B0CA 1HQEB 4PR6A 1TKZA 4ANDA 4ZN3A 1WELA 2QGFB 4LRBA 4U9RA 4IKAA 4CM2A 2GHWA 1DY3A 1OO0B 3J7AN 3TOQA 3B4DA 1NKCA 2LDYA 5E3PA 3U1NA 1RAAB 4ZJOA 3QRRA 1TQLA 4QYZJ 3CPWR 1AT1B 5AJ3F 1HBNB 4DV6J 4CTAA 3H5XA 3Q8YA 4FF4A 3GJSB 5CXTA 5H9FK 2AF6A 4H4MA 4LSZB 4OX9F 3I82A 2B43A 3NL0A 4TY9A 1B0PA 4KGMA 3OR2B 1CULB 4G6VB 4LR9A 3W9IA 5H9EJ 1KVKA 1LWCA 1ZPVA 3T41A 4TU7A 1KWMA 4I7FB 4J9NA 1MG7A 2NSCA 1RKJA 4DPTA 3WZ0A 2HLTA 1K47A 2HNYB 3V6DB 4ZVTB 2DYAA 2MQQA 2DHHA 3GIKA 2HVEA 2UZAA 2ZITA 2V1SA 3OL6A 1N0VC 4AFFA 2YH1A 3AY0A 2BOAA 2OJ3A 5DO2A 3EDQB 4X4UA 3SSSA 4MYUA 3M6XA 1SKRA 5D3GB 1RAIB 4Y2CA 3RUBL 2CQ0A 4PYAA 5ETLA 2VBZA 4UY85 1FRMA 4DV3J 1WTFA 2XMMA 4R0EA 1BQXA 4K4ZA 2LLZA 1C2PA 2O01C 2R42A 2KXNB 1YJ9S 3P6YC 1M5PC 1NO8A 1S4FA 2HQDA 5DETA 2KDOA 4RNFA 5J2QA 3WC0A 1F5BA 2CJQA 3D1OA 3BSNA 3LP2A 4I64A 3CC7S 2XYHB 4JP8A 3TARA 4LF1A 3W8GA 1Q16B 4C8LA 2XY6A 2DHXA 3BZQA 2XHWA 2J76E 1YIJS 2MGZA 2MB0B 2XLJA 2XEXA 1RYRA 1CJVB 3N01A 2R7WA 3CIZA 2DRAA 2DPIA 2L48A 2OPPA 2N82B 1JLCA 2M2BA 1XMBA 2LVWA 1PBUA 4Y0FA 4B3OB 2UUCJ 5J2MA 3W1YC 1UVJA 1X4FA 4IR9A 4ZJQA 7FD1A 4IOCQ 3J80U 3H8YA 4DHVA 1RAJA 2FVPA 3RAXA 1MROA 4O3PA 3SCIE 2J8AA 4CLPA 5HROB 5KT2A 2P9EA 3KJQB 2L9DA 3I4PA 4Q45A 2PIIA 3ZTSA 1V3RA 2OIHA 4LF6F 5HO4A 4B3MJ 1X9MA
chains in the Genus database with same CATH topology
2MZJA 2XS2A 2GHVC 2B6AB 5D6GA 4NYPA 1NK5A 2KYXA 4ELTA 3DOKB 1OPIA 3PJWA 1HW9A 4IDKB 1JJHA 2AX0A 3PKMA 1M5OC 1H6KX 3K59A 2FLNA 4TYBA 5DDRC 3Q24A 1HHTP 3CCLS 3RBEA 1TK5A 4P7TA 1TFYA 4KV8B 3EGNA 5C25B 3ETOA 2DHGA 2J0QD 2E1RA 2IMWP 2HHSA 1RA6A 1W2BR 4USIA 1HW8A 2MHEA 2J6SA 1L3SA 4PG8A 1X8DA 3QO9B 1MU2A 1NHVA 4KB7A 4CT9A 1UVKA 3F56A 3N9UC 4HT5A 2EK6A 4RX6A 4YP3A 3K57A 2U1AA 4RW9B 4WFYA 4JYAF 1S1XB 4FP9A 4JUZA 2ZKUA 2C3UA 5HBMB 4KAIA 2HW3A 2CKWA 3KMSA 1PSDA 1RTJA 2DCLA 3ZC4A 4NMLA 1JKHB 2OSQA 1LXJA 4DX8H 4YB7A 3UE2A 1EP4B 1KOOA 1GTHA 2K8GA 4CO5A 3J7YU 2FC9A 4AQYF 1QSLA 3KMQA 4NLWA 5MAOA 2E5IA 4ZP9A 4ATNA 2PE8A 4DUZF 4DV7F 3FCHA 2JHEA 2J9CA 1IQTA 2HFZA 1M5KC 2K1RB 1O51A 1U49A 1RT3B 1R8AA 4IO9Q 2I5JB 2L9NA 2XCPA 4MKYA 1D9DA 1ROFA 3BO2A 3FRZA 3HHLD 1FA0A 1HWIA 3M2VB 5KFIA 2XI2A 3RB3A 4XIUA 3VQTA 3OV7A 4MH8A 2OFHX 2Z2MA 1A7GE 3DOLA 4Y00A 2HHUA 2X51A 4JOUA 1YJTA 1VQ5S 3M32B 2OPSB 3PX0A 2MPUA 3ITHA 1VQ6S 3NCPA 3GYNA 2XBPA 1T94A 3C66A 3MEEB 1SJQA 4X84A 1JLGB 3HVRA 1QM9A 3T5HA 1N52B 4KKOB 3M8QA 4J37A 1VBZA 2KG1A 4OHXA 4ILRA 1H7WA 3OFGA 4M94A 3OL8A 1T3OA 1KFSA 1OSDA 1R8BA 2X1GA 1WACA 5KOWA 3JSBA 4F4WA 4ILMA 1NAQA 2LU2A 3V4IA 4I6AA 4Y3CA 4MK8A 2MQPA 4W90B 3U27A 5G0RA 4DFMA 3HVAA 3NAHA 4LVNP 3R3TA 1HWUA 2FHJA 3V6KA 1X4EA 3MURP 2WOMA 5DM6Q 2QMXA 3LPYA 2EFOA 3DI6A 1LW2B 4IG3B 5FDLA 5F9NA 5KG1A 2D7SA 1S7HA 5BYRA 2YNFA 3M8RA 3DFEA 5KFKA 1TKDA 4CO3A 4HYKA 1C4CA 1NKBA 1DAXA 4EU0A 3DRRB 2PD1A 3SQGB 5KT5A 2XS5A 4DSFA 2AGPA 3BS9A 1S6PA 3D0HE 4DV4F 1DTQA 2DHAA 3WDOA 1HNIB 4HTIA 3SFUA 2ZD1B 3CJ0A 5DG7A 2HWIA 2NREA 3H5SA 5L8RC 3GG0A 1IJEB 2JVOA 3I5BA 2NPFA 3M30B 4LF8F 4YDDB 5K14B 5HMYA 2A2CA 3M2RA 4KFBB 1TKZB 4NWBA 3OLBA 2F1FA 2UUBF 2EBEA 4DR4F 1UETA 1D8ZA 2QEXS 3DLHA 5E3CA 1IKYB 1C1CB 4YDXA 2BABA 4M8LA 1ZAWA 1SJ1A 4ERDA 3IG1A 3JYTB 4KHMA 1R27B 3KKFA 2GV1A 3TR5A