4NLSA

Poliovirus polymerase - s288a loop mutant
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPAGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein, hydrolase
molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 140
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nlsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nlsA02
1SUQB 2OPPB 3PZPA 4ZPCA 3H5SA 3KK2A 4PWDB 1DTQB 5DG9A 3I0RA 2RF2B 3RBDA 1FKPA 4FBUA 3MEEA 5F8IA 1S6PB 4ZVFA 1RTJA 1JLCA 1JLBA 3OHBA 3I5BA 2V9WA 2AWZA 3DM2B 1RT1A 2C28A 3DYAA 1S97A 1S1WA 1TKTA 2WK4A 4H4MB 4IH6A 3NAHA 5T14A 4TN2A 1RT6A 5C24B 1S1VA 4J9PA 4Y2CA 4URSA 3DOLB 3C6TB 5KFOA 3DDKA 4O4RA 4DL2A 1S9EB 4WFXA 4DG1B 3C6UA 3V4IB 4NLSA 3HVAA 4NCGA 3ISNC 4RW9B 3BSOA 3V6DA 3V6KA 3DRRB 1KLMA 3TAMA 1JLQB 4WE1A 4PQUA 5HROB 2JEIA 1C0TA 5DQGA 4ZHRA 3H98A 4RW4B 5KT7A 5KG5A 3QIPB 4EBDA 1SH2A 5KFPA 1LWCB 3CJ5A 5KFTA 5L9XA 1EP4B 4KSEB 3Q8QB 3T5HA 1T05B 3PW7A 5KFEA 3LP1B 2HNDB 4QW9A 2XCPA 3M9OB 2AGQA 2ILYA 3CJ4A 2VA3A 5DLGA 4H4OA 4O44B 5L1LA 5I3UA 4XPCA 1S1XB 3NGDA 2XI2A 4IG3A 3BQ0A 1TP7A 2I5JA 2C2RA 2GC8A 5KT4A 2W9BB 3E01B 4F4XA 1QE1B 3ISND 4ICLB 2VG6B 1I6JA 2UUTA 2V0NA 1W25A 4KAIA 5EWEA 1LWFB 1RT4A 1HYSA 2HMIA 3H4BA 1C1CB 4ZMMA 5DQIA 1XR5A 1JLAB 2B5JB 5KFVA 5KG6A 3M9NB 4ECTA 3H5XA 1HNVB 2DPIA 4NLVA 4TXSA 4URGA 1C2PA 3FFIB 1TV6A 3ITHA 5KG4A 3KJVA 1N5YA 1UWBA 4R8UA 3FDSA 5HLFB 3NAIA 1IKWA 5CYQA 3KNAA 4EO8A 1S10A 5F8LA 2YKNB 3MECB 2W8KA 3DLKA 2AGOA 4MFBB 3CWJA 3IGNA 5J2MB 2YNGB 4MH8A 4EYIB 1RTHB 4LSNA 5C42B 4QPXA 4O3PA 3SFGA 4IRDA 5HBMB 1NHVA 1XR6A 1SV5B 1FKOB 3CDWA 4J9RA 2B6AB 3DMJA 4F4WA 3PW4A 5KG2A 1S1TB 3DRPB 4J9NA 4DL4A 4IG0B 4KKOA 4J9OA 3QGGA 4KO0B 2OPPA 3M8PB 2OH2A 3UPFA 2UVVA 3GIKA 2D3UA 4PWDA 1C0UA 1DTQA 2RF2A 2R8GA 4RUAA 4ED1A 5KFIA 4O3NA 1S6PA 4IFYB 2ILZA 4K4ZA 1VRTB 2OPRB 4ZVEA 3OSNA 2ASDA 2R8JA 1TQLA 3Q8RB 4TY8A 4ECUA 5KFHA 1ZTTA 3SI8A 3DM2A 3JYTB 4Y3CA 4J9SA 4H4MA 4WXWA 3KK3B 5CYMB 2DPJA 4RUCA 4KHMA 5C24A 3QZ8A 3DOLA 3C6TA 3LAMA 3NBPB 1IKVB 1S1UB 1S9EA 2C2DA 2BRKA 3IRXB 3BQ1A 4Q8EA 4DG1A 5KFZA 3V4IA 2J6SA 4GC6A 4WFZA 3NL0A 1DTTB 3DRSB 4G1QB 4HYKA 4HKQA 5J2PB 3UDLA 4XO0A 2UVWA 3GIJA 1JLQA 4ID5B 3TQ1A 5HROA 4NLDA 4F4ZA 1DLOB 5DG8A 3V6JA 3N6NA 4RW4A 2FVPA 2E9TA 4QWEA 4H54A 1N6QB 2JEJA 2FVSA 1LWCA 3T1AA 1EP4A 4URQU 3KLGB 3VQSA 2E9RX 1N56A 4ZP9A 1T05A 3DOKB 3LP1A 2HNDA 4R0EA 2WCXA 2R2RA 5C5JA 4U6PA 3RAQA 4ECXA 1N4LA 4NLXA 3BSCA 1TVRB 4RNFA 4O44A 1KHWA 1BQNB 1S1XA 3MR2A 2HWIA 2ZE2B 3PJWA 3H2LA 3I5AA 4IH5A 2ALZA 1BQMB 1SH0A 4WYWA 5KT2A 4LQ3A 3KHGA 3G6VA 1MU2A 2W9BA 3E01A 3I0SB 1QE1A 3DLEB 2VG5B 3SFUA 4ICLA 5JUMA 2VG6A 1IKXB 2GIQA 4R5PB 5L1IA 3PW0A 2FLLA 3OL7A 1LWFA 1SH3A 5F8MA 3MEDB 4O3OA 5KT6A 1C1CA 3MFIA 3H5YA 2ASLA 4Y34A 2B5JA 1JKHB 1JLAA 1JLGB 1REVB 1TL1A 4K4UA 3G6XA 3OL6A 1LW2B 1HNVA 1LW0B 1J5OB 4Q8FA 5F8JA 4ECZA 5FDLB 3FFIA 4QWCA 2YNIB 4NLGA 1R0AB 5K14B 1IKYB 3KHHA 2VA2A 1GX5A 2OPQA 1HPZB 5HLFA 4MK7A 3EPGA 2XGPA 3MECA 5EUHA 4QWAA 4MIBA 4MFBA 3KK1B 2IMWP 3OL8A 1QAIA 4QWBA 2YNGA 4WZQA 1EETB 1RTHA 5C42A 4ECYA 1JLEB 3N6LA 1Z4UA 2FLPA 5KFAA 5HBMA 3IS9B 1S6QB 3QYYA 5L1JA 1SV5A 2ASJA 3I5CA 2BR0A 3CJ0A 2B6AA 1HQEB 2BANB 1C1BA 4KFBB 1S1TA 3DRPA 5KFLA 1D0EA 3KLIB 4J9LA 4IG0A 4KO0A 3HKWA 2XI3A 3M8PA 4MK8A 5J2NB 4K4WA 4WYLA 1T03B 1S9GA 1NHUA 1HQUB 1RA6A 2HNZB 4U7CA 3KLVA 2IAJB 4NLUA 4IFYA 4WZMA 2OPRA 4NLRA 1VRTA 4IH7A 4LSLB 4RW6B 1MMLA 2CKWA 1QAJA 1RT5B 5KFGA 3JYTA 3QIDA 5F9LA 3QGHA 2HWHA 4JV0A 1IM4A 4NYZA 3ICLA 5JXSA 5KFCA 4J9MA 1HMVB 3KK3A 5KFFA 1RAJA 2D7SA 2HAIA 3CDEA 4RZRA 2YNHB 4YMEA 4QWDA 3KMQA 3RB0A 3NBPA 1IKVA 5F8GA 4X2BA 1S1UA 5KFJA 3T5JA 3IRXA 4ED8A 3BR9A 4ZP6A 1RTJB 4KE5A 3G86A 5KG3A 1DTTA 3DRSA 4G1QA 2BE2B 1XR7A 2IC3B 5C25B 2WONB 1TKTB 1HNIB 4YQWA 2RKIA 3CO9A 2WB4A 4I7FB 3KLFB 4ID5A 4ED0A 3LAKA 5DLFA 1DLOA 4IOBA 1TKZB 4YR2A 3Q8SB 1N6QA 3CDUA 5KFYA 2JC0A 2AU0A 4O4GB 5KFKA 2R2UA 1VRUB 3OSPA 4ZP7A 3KLGA 4K4XA 2W7PA 4O3RA 4O3QA 3OHAA 3DOKA 4NLWA 3D5MA 1SUQA 4I2QB 5KG0A 4Q44A 2FVRA 4OL8A 2RDIA 1TVRA 1BQNA 2HNYB 2XC9A 1TKXB 4IRCA 2ZE2A 4RU9A 3KHLA 4G3IA 2RDJA 1BQMA 4YR3A 4ED2A 2QV6A 3I0SA 3EPIA 3UR0A 3N6MA 4K4TA 3OL9A 2VG5A 1IKXA 4MK9A 4R5PA 3GV5B 4NRTA 3LP2B 3BJYA 5KT3A 1RTDB 1FK9B 3FQLA 3MEDA 4K4SA 1JKHA 5F8NA 1JLGA 1REVA 3HVTB 3IG1B 4YP3A 3KLEB 2BRLA 2W9AA 4FBTA 1LW2A 5I3UB 4XPEA 1J5OA 2FVQA 5FDLA 3GQCA 2XGQA 2YNIA 3DI6B 3KLHB 1R0AA 5KG1A 5K14A 1IKYA 4DL7A 3PVXA 3MF5A 2YKMB 3RB4A 4RW9A 1HPZA 1D1UA 4LQ9A 4Q0BB 5DG7A 3QO9B 4RNHA 4DEZA 3DRRA 4TLRA 4TYAA 3T5LA 1S0MA 2E9ZA 4RNOA 3KK1A 4TQSA 4RNMA 1EETA 4IQXA 3M8QB 2O5DA 3QIPA 1JLEA 3MR5A 3MEGB 3LALA 1TV6B 1JLFB 3IS9A 3Q8PB 5KT5A 1N5YB 2FJXA 1TL3B 3PW2A 5DGBA 1HQEA 5EWFA 2OPSB 1ZTWA 2BANA 2ZKUA 2J6TA 4KHRA 1RYRA 5D3GB 3IGVA 3KLIA 4EBEA 3FQKA 4ECVA 1RT3B 4TYBA 4JUZA 5DGAA 5J2NA 4I2PB 2R2TA 1HQUA 1RTIB 2HNZA 3IN5A 4PUOB 3BGRB 4KV8B 4ECSA 2IAJA 5EWGA 2IM2A 4LSLA 4RW6A 4ZPBA 4ZP8A 3OLAA 4RW8B 1WNEA 2I1RA 1RT5A 3RAXA 1S0OA 5KFDA 4DL5A 1RT7B 2IJFA 3BREA 4EO6A 4IFVB 5J1EB 5I42B 4NLYA 1JIHA 4KB7A 5HP1B 1HMVA 2WTFA 3V81B 3CVKA 5KFBA 3CIZA 2YNHA 2WRMA 5J2QB 1C0UB 4WXOA 5F9NA 5KFQA 2YKNA 2F8EX 5KG7A 2CJQA 4TY8B 5KFNA 3GILA 2W9CB 4TQRA 1S4FA 4JV2A 2BE2A 4KBIA 4IKAA 4MIAA 2IC3A 5J2MA 3BQ2A 5C25A 2WONA 1HNIA 4I7FA 3KLFA 2BQRA 1LWEB 4J9KA 3PR4A 1TKZA 3JSMB 4ECRA 3MTKA 1FKOA 3QLHB 1RA7A 5EDWA 3G6YA 1HARA 3HVWA 4ECWA 4O4GA 3UQSA 4FS1A 1VRUA 3GIIA 4Q43A 4GC7A 2IM1A 2WOMB 4RW7B 4EEYA 3RB3A 2QE5A 2YNFB 2R8KA 3LP0B 4I2QA 4ED3A 4IR1A 3OLBA 4NZ0A 3H5UA 3PR5B 3HHKA 4IDKB 2HNYA 1TKXA 4ZPDA 2ZD1B 2IJNA 3CJ2A 3T5KA 4K50A 3DLGB 1K1SA 2GIRA 3FSIA 1QUVA 1NNDA 2XCAA 4B3OB 3GV8B 3LP2A 2VG7B 4EBCA 2IM3A 4NLQA 1RT2B 4TY9A 2IA6A 3D28A 1RTDA 1FK9A 5CYMA 4J9QA 4F50A 3FRZA 1KHVA 3HVTA 2B43A 1RDRA 3NKYA 3IG1A 4RNNA 3KLEA 3KK2B 2R2SA 3PW5A 3I0RB 2AX1A 4ED7A 1FKPB 2JLEA 3MEEB 4YR0A 3RB6A 3RBEA 4MKBA 3KOAA 4EYHB 4NLPA 3NMAA 2D3ZA 3DI6A 3KLHA 1MU2B 1JLCB 3GYNA 1JLBB 4K4YA 3LANA 2V4RA 2YKMA 1RT1B 5J2PA 3DYAB 3QGIA 1S0NA 4Q0BA 3QO9A 3PJXA 1S1WB 3H4DA 3BSAA 2W8LA 1RT6B 3H59A 3QZ7A 2XWYA 4IRKA 1TL1B 5KFMA 1S1VB 4M95A 5KFXA 4ZPAA 3M8QA 1JX4A 2IBKA 2J6UA 3MEGA 4MKAA 2IM0A 1JLFA 3C6UB 1TL3A 2BQUA 4NCGB 4FS2A 4DL3A 2OPQB 2OPSA 4ZVHA 1K1QA 3V6DB 3EZUA 1KLMB 1U09A 3TAMB 2C2EA 4WE1B 3GV7B 1S49A 5D3GA 4PQUB 1C0TB 2WHOA 1RT3A 3KHRA 3H40A 4ZHRB 2V4QA 5L1KA 2ATLA 4I2PA 3DLEA 4PUOA 2EC0A 1RTIA 3BGRA 4KV8A 4ECQA 3V6HA 3MR6A 4Q45A 4M94A 4RW8A 4ZVGA 4ED6A 2JEGA 1C1BB 2C22A 1RT7A 5J1EA 2UVRA 4IFVA 5I42A 4H4OB 1LW0A 5HP1A 4IG3B 3V81A 2I5JB 2FJVA 3KMSA 3GIMA 5KFWA 1ZETA 5J2QA 3PHEA 1S9GB 1S48A 2FLNA 5KFRA 1N48A 4DL6A 1OS5A 2UVUA 1HYSB 1RT4B 3T19A 1RYSA 4NRUA 4JV1A 2HMIB 5KFSA 5KFUA 4NLOA 5DQHA 2W9CA 4F4YA 2AQ4A 3MR3A 4K4VA 1LWEA 2W7OA 2R8IA 1T3NA 3JSMA 1S6QA 3ITHB 3KJVB 1UWBB 3E51A 2UUWA 3QLHA 4QW8A 2FVCA 4R8UB 1JXLA 4KFBA 5F8HA 1IKWB 2AX0A 5CYQB 2FJWA 3DLKB 2WOMA 4RW7A 2YNFA 4Y2AA 3LP0A 3MFHA 2JEFA 1T03A 2RKIB 4IDKA 4LSNB 2BQ3A 2ZD1A 3BSNA 2R8HA 2D41A 4WFYA 3DLGA 4IR9A 3TVKA 1GX6A 1YVFA 2AGPA 4B3OA 3DMJB 2VG7A 1CSJA 1RT2A 2JC1A 1T94A 3M9MB 1S9FA 4NLTA 3CJ3A 4KKOB 4O3SA
chains in the Genus database with same CATH superfamily
1T9TA 1VRQC 3RBDA 2KVIA 2WVEA 2Z0GA 1UFLA 3NCRA 4M5KA 3L4BC 2F4FA 2E66A 4DV5F 2LXIA 5JVHQ 4J9PA 2KU7A 4DL2A 3TAQA 2ZC3A 2XULA 4DV6J 5D0RA 1RWWB 4X4PA 3N4WA 2K3IA 3C16B 4P9SA 5EN1A 3PEJA 4OZ5A 2H1YA 5KFPA 3FGVA 2ZH6A 4HHJA 2XCPA 1VBYA 2AGQA 3M6WA 1OY8A 4DU8A 2DHAA 1NDPA 2FHJD 2HS0A 3KUEA 3C19A 2XMUA 3P6YC 2HMIA 2CQPA 4URGA 3ITHA 3FDSA 3ILOA 4M5DA 3KNAA 2IVYA 4KQZA 3ILJA 2GJIA 4MH8A 2EI5A 4OHXA 4QPXA 2D3OR 3Q86A 2PMHA 4NXMJ 4PZVA 1HR0J 4NEZA 5T7LA 3PO4A 3CCTA 3HJFA 2OPRB 3HSZA 1BE4A 4ECUA 3Q8RB 3RYLA 3ADAC 1G1XA 4C6AA 5DS7A 1VC6A 3CJKA 1U8WA 1K9MT 3VAJA 4Q8EA 4NA2A 4ELVA 2B4VA 3NWGA 1I51B 1YHQS 2A2DA 3UCGA 4W90B 3ISZA 1XQIA 5C7PA 4ZIVA 4A48A 4U6PA 2DISA 2G0CA 3G9CA 3R8YA 3G6VA 3KHGA 1QE1A 4ICLA 3MPDA 1AT1B 3GTYX 1NSPA 1VHIA 2GMHA 2M70A 1J5OB 4CLFA 2KZZA 2YKOA 2VA2A 4MK7A 1RWUA 4C11B 2HQIA 4HEA9 1E6YB 4U67Q 2FLPA 3EXYA 1UVJA 5HBMA 2KHDA 1Q8KA 1ICEB 3DRYA 2EPIA 2KG1A 1U1MA 5D4OA 2MKJA 1X4GA 3CD0A 2NXUA 1QAJA 2C2ZB 3BM7A 3EGVA 2AW0A 3KMQA 1S1UA 2VC1A 5KFJA 3ZZTA 1JWWA 3H2VE 4GVBA 5K5MA 4I7FB 2FTRA 3DOKA 4DV0J 3W1YC 4IRCA 4RU9A 2VG5A 3GV5B 3M1VB 1HI1A 3IR6B 4K4SA 3H90A 3SDEB 2QLFB 3VGUA 1FRKA 5DG7A 3T5LA 1KS2A 2ZBPA 3IS9A 1T0TV 4LBIA 4ZVRB 1TL3B 4OYXA 4UT4A 4KHRA 3CUNA 5D3GB 2HS4A 2P8IA 5B0EA 4YY3J 2DHSA 4ZVSB 1WC5A 2V8GA 1CEZA 3GMGA 4C8KA 5E3PA 4NLYA 1ZM2A 2ZBIA 2J7UA 3IRWP 3SCJE 2V50A 4BBYA 2UXBF 3ENAA 1VJWA 2KXNB 4ECWA 2ZBCA 2DD8S 1SC6A 2WOMB 2QE5A 3PRBA 4IR1A 2AYBA 2BEFA 1U1QA 2YX4A 1YZ6A 1CVJA 1Q16B 1RZMA 3HVTA 3SCKE 2W2PP 2JLEA 3GFHA 4DN9A 4NLPA 2CQDA 3KLHA 2C2KB 2A10A 1WI8A 1NPRA 1BQXA 3F56A 4ZPAA 4KTQA 1Q5YA 3TJ8A 1UVIA 3TVZA 4RBUA 4I2PA 1NBEB 2W7AA 3C2PA 1OY6A 1FVSA 3UD4P 3TARA 2GA7A 5J2QA 2K7KA 2FLNA 3R5CA 5CA5A 1WHYA 4JV1A 5HJYA 4WK3A 3TA1A 3W2WA 3OV7A 2D3O1 2MB0B 4HDHA 3BBFA 3PX6A 4PCQA 2FB0A 2ZZTA 2O66A 3K8VA 4C48A 2FJWA 3THPA 1SJQA 3TNVA 3RTVA 3AWRA 1HHSA 1S99A 4WPAA 4CO1A 4ZPWR 4NXNF 2ZH8A 2GGPB 3UWTA 2L9DA 4YDXA 2AJ4A 2BM1A 4P7TA 4ZPCA 1DTQB 2M3DA 3MPVA 3OHBA 2XZ2A 1UFKA 3BPDA 1Q82T 2WK4A 3AB2B 1B3TA 1B64A 1W26A 4B9UA 3DDKA 4PYDA 2KFNA 1MN9A 3V2UC 4NI2A 2CYYA 2XS7A 4RW9B 1RWXB 2OAUA 3HM9A 2QSWA 2MGZB 2OLWA 4HACA 3O5TB 4XPCA 1VQOS 2QIFA 2MLZA 2MZSA 4MTPA 2IYIA 2G0JA 4A8KA 1C2PA 1TV6A 4FPRA 5A8WB 4DFMA 2MHEA 1NK7A 3NNHA 2QGFB 5ADZA 3UN3A 4JI7F 4OIXA 2B6AB 2GVDB 1N33J 3KKFA 1RKIA 3OSNA 5AE3A 2ZH9A 2BJEA 4LF6F 3PHTA 1ZZNA 3GB0A 3CCRS 5GAGI 1JJ4A 2LQ9A 2BRKA 1YBUA 5LMUF 3W7BA 3K8WA 3GIJA 2GV1A 4ID5B 3MEKA 1WSVA 2JEJA 4URQU 2Y1LB 3MCOA 4ZP9A 3D0IE 3IBCB 1LQ9A 2HWIA 3PJWA 1WDTA 5JUMA 1FTRA 1XBWA 1NZAA 4USWA 2B5JA 3OL6A 3VALA 3T1HJ 1KTQA 1T02A 4QWAA 4QR2A 3SZ2A 2YNGA 3TX0A 4B9LA 2DR9A 1PSDA 1RQ0A 2MQQA 4F36A 1U0SA 3OTOJ 4ZPVR 2BJ9A 4RW6B 2DNLA 2CKWA 2LXFA 3S8SA 1NK5A 1IWAA 1PBUA 3RB0A 2F8HA 1KWMA 4CT9A 3VVUA 1QY7A 3G71S 5J1NA 3DU6A 4I69A 2R2UA 2K2PA 3MWBA 8AT1B 4LFBJ 4X66F 2HWTA 3UCUP 4OL8A 4CP5A 4G3IA 4F0HA 1MG7A 4DQPA 2A6MA 3I31A 2QTWA 4WK1A 2FZGB 1EIYB 5KG1A 3RB4A 1IKYA 4DL7A 1FJGF 4DEZA 1S0MA 2VL1A 1IN0A 3SMZA 4LF2A 2AJ2A 4JI7J 2HVIA 5KT5A 4MYUA 1HQEA 2CG8A 3FQKA 4CT8A 2R7XA 3K5NA 1U25A 2E5IA 2O3DA 2QA1A 4LF6J 1NB7A 5HQLA 2F3JA 1WNEA 1RT5A 1UW4A 1D9FA 1IVZA 4DSEA 2YNHA 2AYMA 1C0UB 2PEBA 3L7UA 2W9CB 1N0UA 4TQRA 3HK2A 4ECRA 3G6YA 4WTYA 3QRPA 1DAXA 3FJ2A 2YNFB 3OR2A 4O0NA 3PR5B 3CCZA 2PSZA 1QTMA 4I4BA 3CE8A 4AYBD 2O1PA 3H20A 2XLJA 2A6OA 4O23A 3MEEB 4LR9A 4A8XA 2ZC4A 1CJUA 5G4DA 2Y1IA 3U02A 2W8LA 2R3VA 4USKA 2MDAA 4FXWA 4CWBA 1VQMS 1TL4A 4A47A 2CQIA 2J6UA 1KONA 4JI6F 1S49A 3KHRA 5L1KA 4DSIA 3QBCA 3BEGB 4PUOA 1QLNA 3EGWB 1RHKB 2DGVA 4ZVGA 2UVRA 4ERDA 2HBQB 2CPIA 4GO7X 1AZSA 2X3DA 3NG8A 1IBMJ 1IJEB 1RAIB 4F3MA 2BYCA 1NHKL 4N5SA 4DV3J 3UN2A 5DDPC 3A12A 2Y8WA 1P1TA 1JXLA 4JV5F 4A46A 2AX0A 4LF4F 5F3TA 2P6SA 4IDKA 3ZFVA 3PYGA 3TVKA 1NJWA 1IJFB 4CO5A 2QMUB 3JQJA 5HO4A 2Z2MA 3H5SA 3GCXP 4FBUA 5E3AA 3K5MA 3SSQA 1SVDA 4H4MB 4TN2A 5KFOA 1S9EB 3HVAA 3MM6B 2MKIA 3FBCA 4PQUA 3FBFA 3MGJA 2F65A 3L7OA 1QUPA 1WF0A 5KFTA 3QSYB 2HNDB 4P10A 1SXLA 4DQRA 1FXLA 4QYRA 2W9BB 1HW8A 3CF5Q 2UUTA 2RHSB 2LEAA 5E3QA 5KFVA 1FVQA 1CJTB 2L9NA 3FFIB 3M30B 1UMJA 1HBUB 4B9SA 1K0VA 2VKZG 3H8YA 4C98A 4L74A 4U7UK 3CWJA 1RTHB 2CQGA 2W01A 3R2CJ 4U7UD 2MTLA 1U47A 1VQPS 1K8AT 4LF9J 4DL4A 4KO0B 4K4ZA 2DNMA 4QIEA 2NREA 2BKPA 4ZCKA 2JSXA 2IY5B 2BZ2A 4DLGA 1SJ4P 1QSSA 4IUFA 5LMNJ 1SC3B 2KT2A 4QIVA 4C8OA 3BN4A 3ZNJ1 1TUVA 1VC5A 1T05A 2ACYA 2ZE2B 3LPEA 2R8GA 5KT2A 3OTBA 4R5PB 4PG6A 2FC9A 5CABA 3RR8A 4AL6A 1NZ8A 4ECZA 1XNRJ 4L73A 4F8RA 3R5JB 4DR3F 1R0AB 1R8PA 4OJ1A 5G0RB 4KYZA 2LQJA 2MHNA 2NYHA 1SIZA 2BE9B 1CULA 3CD5A 4DN0A 4J9LA 2HHSA 4UQTA 4LSLB 1VRTA 4NA3A 4JV0A 2WVFA 1HMVB 3KK3A 2RQCA 1ZAWA 3JQKA 1DTTA 3OUYB 3AOBA 4F2RA 4I68A 4YQWA 1TKTB 3DLHA 3OT9A 3O6QA 4N56A 4DI6A 3SV4A 4W4MA 3OFEA 4PXBA 2HEKA 4CNZA 4TLQA 2RDIA 2Z2YB 3PYDA 1BQNA 3R27A 3I4HX 1MMDA 3OL9A 1REGX 2KFYA 3N28A 3PIOQ 1I1GA 2W7OA 1Y0HA 1ZM9A 2FJDB 4C3KA 1OPIA 4XPEA 1U6BA 4PPZA 1TL5A 4RW9A 1VYAA 4TLRA 4TQSA 1VR6A 1JLEA 2F1FA 3SQOP 1X5SA 4ETXA 3MEGB 2FUG9 5EWFA 1RYRA 1XC9A 5KOWA 2RUGA 1Q0NA 3OD2A 2M4MA 5AXNA 1RTIB 3R6LB 3BGRB 2PD1A 3BREA 4EO6A 2KFZA 3U27A 2UUCF 1ZH5A 4KB7A 5HP1B 2QG9B 2WTFA 2WRMA 4WXOA 1F1BB 1X4AA 2QEXS 4TY8B 2PN6A 4KBIA 2NUUG 1N5QA 4LF5F 5H9EK 1R0CB 4QIFA 1FWPA 2NUHA 3D9BA 2RU3A 3RB3A 4RW7B 4I2QA 1OQ6A 2E1MC 1VHFA 1NKBA 4LF7J 1NNDA 4C7QA 4ETZA 4J9QA 2JWNA 3D54A 1RDRA 3KLEA 2D74B 3KOAA 1L3VA 4DUZF 2DT9A 2K1RA 4Q0BA 3QO9A 3FCWA 1S1WB 5EX0A 2MZJA 2IBKA 3HCXA 2MMYA 4NCGB 2OPSA 2H4YB 2J8AA 4WE1B 2E1CA 3Q8UA 5GMDA 1HNWF 2HRTA 2QLBB 3S6EA 2V2QA 5IT0A 3MD1A 3W5XA 1HNZJ 4CH0S 4YFUA 2DGQA 1ZETA 3NGKA 2ZZMA 4I6YA 4XTTA 3JQMA 2G2ZA 2YTCA 2WZ1A 1U1RA 2AQ4A 2EFPA 5GAEI 4FKYA 3P3DA 2UV8A 1R7IA 1UEKA 3KJVB 2RE1A 1IKWB 2EFOA 2IDEA 2QJ3A 2N7YA 4P7VA 1B4SA 3CJTA 4CM2A 1GX6A 1MROA 1F9HA 4NLTA 1U0HB 2VIHA 4LREA 2Q79A 5IM0B 1JLCA 3I5BA 3DYAA 2OFGX 1HQ2A 3NAHA 1G7CB 1ROFA 3RUBL 5A8RB 3H25A 5GAEU 4EUVA 4RLEA 1QD1A 2BW2A 3MM8B 4PXEA 2O67A 1HBOB 5KT7A 4Y28C 2GX8A 4KSEB 3Q8QB 2YKPA 1KFSA 1N5VA 1E6VA 4CLKA 3HI9A 2I5JA 3PX4A 2YXLA 3E01B 2VG6B 4RO0A 3I6PA 1KQSR 2BJ8A 4QOTA 1NB2A 5DQIA 2RU9A 2E44A 1KEKA 1UW9A 1M5OC 2F40A 2N7CA 1PILA 5HLFB 4DHVA 5A6WA 2UUBJ 3HJVA 4LSNA 5C42B 4OJHA 1NHVA 2JZ5A 1SV5B 3CDWA 3S1TA 2OKQA 5A0YA 2EVZA 2HLTA 3QRQA 3M8PB 1U2RA 3UPFA 3MMJA 4OI4A 1C0UA 1QVFR 1GAOA 1X9WA 1S6PA 4DUZJ 4USUA 3NGRA 1I5OB 4GKKF 4WBFA 1FDDA 1SL1A 4C9DA 3IRXB 3BQ1A 3JSBA 4DPYA 4XO0A 1TK8A 3FNNA 4Y6IA 3AX5A 1PIEA 5DG8A 1EHWA 5HQMA 2MEWA 1LWCA 3MMCB 2CPXA 4NLXA 2VONA 1FRMA 3SQGB 2DCLA 3I4PA 3SFUA 1NO8A 3OL7A 4WU3A 1X5PA 1JKHB 2B3TB 3LF0A 2KT3A 3J81j 2GQCA 4UY85 2Z2LA 3LH2S 2IMWP 2HQCA 3TVYA 1UA0A 1SJRA 3I5CA 2LA4A 1URNA 3DLLQ 2ZM6F 1NHUA 4ED5A 4U7CA 4LRAA 3W9HA 2N82B 3AD9C 3TP2A 1CJKB 2L3MA 4BWJA 3THVA 2D7SA 3MDFA 2HGNA 3NBPA 5F8GA 4ED8A 2VJVA 2HFUA 3IMQJ 1RAGB 3VAKA 2CPYA 2HK3A 2JL9A 5C25B 3MUMP 2WB4A 4ED0A 4IOBA 3MURP 4DR6J 3CD6S 3WBZA 2E7VA 5AT1B 3CMQA 4ZA1A 4HHUA 3TR5A 3UDVA 2HNYB 3MOJB 3CCMS 3PJ9A 1BQMA 4ED2A 4GMKA 4DJBA 4MK9A 2ZH4A 2OELA 2OHDA 3CJ8A 4CM0A 2DXEA 3VGVA 1AUSL 4ZLPA 4ZDNA 3I56S 3PVXA 2YKMB 3GJRB 3OPKA 3UE2A 4I0WA 3BZQA 1YRXA 2CQ2A 5T41A 4YHHJ 2QSFA 9ATCB 5IWAF 7FDRA 4RW8B 2DIUA 2V1SA 4OX9J 1PYOB 2OP5A 1RT7B 1UAWA 1CJTA 1VCTA 1D09B 3M30A 1SCJB 3EDRB 4BCAA 3FMBA 2CJXB 4JV2A 1T9XA 2IC3A 1RWNB 1CS4A 3FZ2A 1XMBA 3QLHB 3S01A 3POTA 3MM9B 4WF9Q 3CDAA 1RK8A 3G8QA 4HHHA 2C3OA 2XTDA 4DR5J 2XCAA 1D3WA 4USTA 1TL7A 1S0VA 2VG7B 2IM3A 2Z30B 3ZTOA 5CD4H 5IS2A 3IG1A 2EFVA 5AXLA 2V4RA 2P9CA 1KQGB 5IV4A 3LQVA 2Y1JA 1RT6B 3R6GB 2HS3A 4GKJF 4FS2A 4DS5A 3AOAA 4MAKA 1KRPA 1QSYA 4ZHRB 2B0GA 4ATNA 1N32F 4QCLA 3GR1A 2FYXA 4ED6A 2JEGA 2W24A 5H9FK 2C22A 5I42A 3QFHA 3AA8A 1J27A 2QYGA 2V8PA 3BDPA 1KBRA 2B9WA 5DM6Q 2DO4A 1HBNB 3IP0A 3HHNB 3KG1A 5DETA 4PWWA 5CYQB 1VS3A 2RKIB 1IQZA 1FRJA 3M8ZA 2N3OA 4X4OA 4OYMA 4CLPA 2CDQA 2HZCA 3C15A 3I32A 2UV8G 3M9MB 4ED4A 1Y5LB 2X1FA 5DG9A 4ZVFA 4BDPA 3VAIA 1NDLA 1TKTA 4IH6A 1VI7A 4I6WA 3QNWB 4F4AA 1U02A 1VK3A 4URSA 3PEHA 5IFMA 2DNGA 4M5IA 2AYEA 5E2QA 5IOLA 5IWAJ 1AYEA 3WIUA 2E7WA 3H7HB 3CJ5A 1Z1ZA 3CJ4A 2PEHA 1CC8A 4PRFA 2Y9HA 1RT4A 4ECTA 2V8HA 1KD1T 1NU4A 2OJ3A 2VV5A 2YX7A 3QATA 2ZUAA 3SBMA 3MECB 5HMYA 1NPKA 1PBAA 5BJRA 4DQSA 5HMWA 2M52A 2HFVA 2OPPA 1M5SA 1BGXT 4PWDA 1U6ZA 4YN3B 5DDRC 4DV4J 2WW8A 4K2JA 2R8JA 4TY8A 2ZNZA 4PABA 3QT8A 2OTJS 1AXQA 3QAUA 3X1LB 4NE9C 2UVWA 2KRRA 5DZ6A 1OMSA 3KUGA 4RW4A 1UTAA 4JI4F 2WCXA 3RAQA 1CJVA 4KGVB 3G96A 4V1Ak 2V8DA 2P2CB 4USIA 4B3TF 4UOHA 1C1CA 1Q86T 4M5NA 2ASLA 1JLGB 3PACA 1WC0A 3G6XA 2GO9A 5F8JA 2HQFA 3W9IA 2EK6A 3TAPA 1EKSA 2BJ1A 4MFBA 3NCQA 2BKNA 4OI3A 4HTJA 2YKAA 4A8MP 1R8BA 1S1TA 1D0EA 3J7YI 3HKWA 1F3VA 1T03B 4KPYA 3LWMA 3FBBA 4NLUA 4JYAF 3MUVP 5KFGA 4C97A 5F9LA 1IM4A 5JXSA 2FZCB 3OR1A 1R27B 1ZM4A 1IKVA 1I94F 2AJQA 2MXYA 3CMAS 4PG7A 3T1YF 3KLFB 5AJ3J 5KFKA 4EFAC 3OHAA 4CLWA 2G1DA 4ZJOA 1LV5A 4USJC 3J7YU 4YR3A 3LP2B 4DSKA 1FK9B 4YP3A 1REVA 5I3UB 2EBGA 2OTLS 3JAMU 3MF5A 2E1PA 2XMKA 3DOMB 1IXKA 3OTEA 4RNMA 5CH7B 2KJWA 1DFDA 4AQYJ 1KQFB 5A2QU 1WC6A 4DL5A 4DPWA 1WC3A 2GAGC 1UFWA 2LU2A 2FY8A 1HNIA 2N3LA 4J9KA 2VZ9A 1TKZA 2VBXA 2CPDA 3UQSA 4FS1A 3T3FA 1Y9OA 3T41A 1RKJA 2L41A 4NZ0A 2W25A 4OYWA 1TKXA 3AQPA 2IJNA 3GZ7A 2X1AA 1Q5VA 3M2UA 5D4LA 5B0BA 1RTDA 3FRZA 2RIJA 1FRLA 2BXJA 4WP8A 3GYNA 1JLBB 5HMZA 3TEHB 1TL1B 3BS9A 5KFXA 1WHVA 4BLGA 2UZAA 1XNQJ 2C2EA 2PGCA 3GV7B 1R0BG 2AEJA 1D8ZA 5F0UA 4DV2F 3FC9A 4LVOP 3UNYA 1I94J 5CHCB 3PXGa 4PAAA 1M1HA 4WKRA 3TX8A 2BUNA 3T19A 1K47A 5HSPA 5D0HA 4C8MA 3A8EA 3LWLA 1UWBB 3FVYA 3O1LA 2IRUA 3IM9A 2KJVA 3T9ZA 1VQYA 3MPUB 1SL0A 2AGPA 5L9NA 1ZPVA 3RR7A 1CJKA 3I9V9 3KYLA 2XNRA 3M6UA 1J5EJ 2NQPA 1SUQB 3SCIE 3I0RA 1UEUA 2KXHA 3F73A 1LK5A 2H5IB 2GHVC 1ZM3A 3L7PA 4WFXA 2BX6A 3OFHA 3BSOA 1WKKA 3D6MB 3QWPA 1LOUA 3UD3P 4CYUB 3E2EA 4DQIA 4XK8C 1SIWB 5L1LA 3HKZD 2R4FA 4IG3A 1C4AA 1PG5B 1FT8A 3ISND 3JS9A 1R43A 1MSWD 3NXZA 4WWSA 3J7Z5 4QYZJ 2DPIA 4X4NA 5KG4A 2V2VA 3JTOA 2B56A 4JP8A 4F04B 4L3NA 4JI8F 3OJUA 4L75A 2V9KA 3ZNUA 3BKFA 3HP6A 1Y10A 1WD6A 2XZWA 5CYJA 3TO8A 5B0DA 2ZWOA 4Y00A 4Y3CA 1U24A 2DB1A 4Z7YA 4L76A 3WIVA 4C4WA 3DOLA 4CLYA 2C2DA 2CPZA 4K59A 4HKQA 3GWCA 1IR1A 2V2KA 4NLDA 3MAAA 3ENQA 1N6QB 1T8EA 2RB7A 1B99A 3UR3C 4PYAA 3R5GA 3LP1A 3NGTA 4O44A 4DCOB 1T9VA 2FDNA 4LR7A 3VCDA 4JI1F 4ZVQB 1RHRB 3H5YA 3HHLD 1LW0B 1F5CA 1URRA 2BM0A 3TANA 3W66A 3AHPA 1FXRA 3CNQP 2CQ1A 2M5YA 2ASJA 5DJBA 5GMEA 1BC6A 1NJXA 3MXHP 3KUHA 2EFGA 3MM5A 4LBPA 5HJXA 3QGHA 4YB1P 2LECA 1BD6A 1RAJA 3D3BJ 6FD1A 2P6TA 3KJQB 4DZ6A 3ENVA 3GG1A 3G86A 2FJAB 4G1QA 4OX6A 2RKIA 2OMOA 3DXSX 3HF5A 1KC8T 1X4BA 5E33A 4B17A 2W7PA 1H3DA 2F5GA 2GO8A 1TVRA 2VFSA 4O0IA 2XC9A 1VGYA 4ES3A 1XTZA 2QV6A 3BKUA 2ZFHA 1IKXA 2UXCF 5LL6d 2Z4PA 3MEDA 2GZOA 1U4BA 2V34A 2XZTB 3DI6B 4BC7A 1HPZA 2ZH7A 1F60B 2G1HA 2X7IA 2XYGB 2ZOMA 4UOFA 2IAJA 2HKEA 2MZTA 1XIQA 2V1TA 2LQ5A 5SUHA 1UZHA 3IC1A 3V81B 4N76A 5LSLA 2CQBA 1FFWB 2R7RA 1HI0P 4IKAA 1HBMA 2HFZA 3JSYA 2XQCA 3DCAA 4ZCMA 1FDBA 3JSMB 3M2RB 5KTQA 1RA7A 1YJTA 2V4JA 5LSRA 4GC7A 2E5GA 4ED3A 3OLBA 5DM7Q 8RUCA 2ZD1B 2A1BA 1B7YB 1YQHA 2IA6A 3DNCA 2CWXA 1MWZA 2HAFA 4KY3A 2ZZNA 1YI2S 2K3KA 5K8NA 3KK2B 3RBEA 4EZ6A 3PNIA 5B09A 3Q8VA 3PJXA 2XSJB 3IBFB 1GTEA 1OSCA 3AY0A 3QMQA 3M8QA 1JX4A 3VQTA 1WWHA 4DL3A 1D9DA 2CXEA 4X84A 3R7BB 1RT3A 3SEOA 2VB6A 2E7XA 3HT0A 4IFVA 4H4OB 2GFFA 3D68A 3QAEA 3MMBB 4CH7A 2F4VJ 5DQHA 1S59A 3M7VA 2C1EB 3RRHA 4ZLLA 2R8IA 2LXUA 1YBAA 4OJGA 2ZWPA 5FJ4A 2DH9A 2GQQA 1KVJA 4LT6A 3LP0A 1T03A 3EUNA 2BQ3A 3MMAB 3E3XA 1PAEX 4WFYA 4XDCA 4P6QA 1RLDA 1UZDA 2J7WA 1RT2A 5ETQA 3EGZA 4XIUA 2CPFA 1WELA 1R31A 2RF2B 1FKPA 1AUDA 2E5LF 1GTHA 4P2SA 2HFSA 3PIPQ 5EX3A 2X1BA 2JFKA 3KDOA 1S1VA 2ZUGA 2DY9A 2RQMA 4LRDA 3J7AN 4HDGA 1AW0A 4ZJQA 3V6DA 3TAMA 1JLQB 2MSSA 4ZVPB 2ZH1A 4FPIA 4BC9A 3H98A 1VQKS 3HO1A 1IBKF 4QPTA 3HVRA 5I3UA 1S1XB 3NP5A 1O51A 1WEYA 2RH3A 3A3PB 1HWJA 2V0NA 2QL9B 1JLAB 1N36F 1TFWA 3FEXB 3QSIA 4OZ0A 2JOQA 4OI0A 2Y8YA 1VQ9S 1S10A 1G6BA 2H4WB 5IT9U 2Q6CA 4HVZA 1F0XA 1YRTA 1V5VA 5E0OA 5KFIA 2ASDA 1UVMA 2J76E 4DS4A 3B4MA 3DM2A 2SXLA 4P71A 5E41A 5CYMB 2YWWA 1YJRA 5C24A 5THWA 4JI3J 3M2VA 4IYQA 5BYSA 2GCFA 3K57A 4LFAJ 4OI1A 2NXEA 2PI5A 1XJWB 1U1NA 1EP4A 2GVZA 2JJ4D 3UI3A 4DV6F 2I38A 2POKA 3I5AA 2QMWA 2LDYA 3ETOA 3WC0A 1NDKA 1WC1A 3I0SB 3PW0A 1ULRA 2Q6BA 1SH3A 3W65A 1LXNA 4Y34A 1TL1A 1HNVA 4WFAQ 4I1TA 4J5OA 5K14B 4E8UA 3QWUA 3PKYA 1BWEA 4QYZK 2VPWB 3KK1B 3HSDA 5K9FA 2V8VA 4ECYA 2BJ3A 3CCVS 3CJ0A 2VJUA 1XMQJ 1NSKL 2CWKA 2XI3A 5J2NB 3NS5A 4M5HA 4FYYB 2D1CA 4IH7A 2AP6A 4NLRA 2OSQA 2LFVA 4NXMF 1HR0F 1TTHB 4FYDA 4ZLJA 1F9EB 4DR4J 2R7SA 4B08A 1YJVA 1CBKA 3EVWA 1K0TA 4LIRA 4OHYA 2HFOA 3SIPB 1Q79A 2CVEA 3CC2S 2W2NP 2XSFA 1VBZA 3HFVA 3UVJA 2MJNA 3OSPA 4ZP7A 5ETMA 3IO1A 1SUQA 3OXFA 5F3ZA 1W7WA 3DXBA 3HX9A 3D1OA 2PO4A 3HZEA 3NWRA 4WP3A 2Z2ZA 4TU8A 1D1UA 1WEZA 4DV1J 4OZLA 3W5ZA 4PXDA 4C0BA 1RHQB 4DR1J 3OQ2A 4IQMA 4K5SA 2W1BA 1HIYA 2HVZA 5L8RC 4TYBA 5DGAA 1M5HA 2HNZA 4X4SA 1RHMB 1RU2A 3MCMA 3TYTA 1FDNA 1R6YA 1NK4A 1HW9A 3HD2A 1CQNA 1WC4A 4LMZA 2WONA 1ZPWX 3PR4A 4DDFA 3L09A 2W2MP 4FKXA 1VRUA 1X4EA 4JI0J 3T5KA 3K58A 4LF8J 5I3PA 4G1IA 4B3OB 4F3QA 2VDIA 4F50A 1KHVA 1T9UA 2NS1B 4M5JA 2DNYA 4DV0F 2J0WA 4ED7A 2DNKA 3R7NB 4WFNQ 1HNXJ 4X64J 2DGOA 2XWYA 4Z37A 2EBEA 1KKHA 4MKAA 3C6UB 3EM1A 3PFEA 4RPFA 2PA3A 1KLMB 3WHIA 3A4TA 3TZWA 1Y3JA 2FLOA 1Y7PA 3QT5A 2QLXA 3QT7A 1LW0A 2VOPA 2B4OA 4YY3F 1N48A 4FYWB 1GXLA 4DR7J 3BO2A 4JOUA 2CZVC 2XLIA 3HZGA 1LWEA 2ZVSA 2QX0A 2CNKB 2QL5B 5GAHI 4J90A 2MQPA 4X4UA 2D41A 3DLGA 3ZO7A 2Y0SD 1T94A 1ZAXA 1RT1A 1S97A 1RHJB 3L95X 5T14A 4Y2CA 4DZDA 2VPXB 2MKHA 4CQ1A 4DV7J 4NASA 1SB6A 5D8HB 4FF4A 2HHTA 1HI8A 2JEIA 2CA9A 3HHLB 2JX2A 2LLZA 4HL9A 4U95A 2RVJA 3BQ0A 2GC8A 3KG0A 1UETA 1LWFB 3B82A 3GSDA 3H4BA 4FF1A 2JVOA 4ITSA 2HG4A 3ELHA 4TXSA 3A8KA 1KVKA 3H0PA 2XTJP 4R8UA 1SC4B 3IA0A 5J2MB 4RJVA 4DCJB 1SQGA 2XWXA 4NZ6A 1X5TA 4J9RA 3DMJA 3DRPB 4KKOA 3CCLS 1KVIA 2D3UA 3GG0A 4O3NA 4IFYB 2ILZA 2HVDA 1U26A 3UN5A 3CJQA 3K59A 4RUCA 1L3SA 4F4KA 3QZ8A 2DJWA 3C6TA 1ZOTA 2MKKA 4K7QA 3IWNC 2LYVA 4DG1A 3PG9A 3W8GA 2DNRA 3V4IA 5M2PA 4GC6A 3HMJG 3UDLA 3GYGA 5HROA 3TQ1A 2M9KA 1SC1B 4PG4A 2OUGA 4DXLA 1UJ5A 3EMTA 1TU0B 2CJBA 5A8KA 1HD0A 2LU1A 1SH0A 2BR0A 1SI9A 2XSJA 1APSA 1S57A 1CQMA 4BWMA 1LW2B 3K17A 3AQOA 2YNIB 4C3MA 2PMWA 4KT0C 3W64A 2ZBQA 5EUHA 2VDHA 2R7QA 3VGTA 4QWBA 2GAHC 1S6QB 3M32B 1LWXA 1L3UA 2BANB 4KFBB 4IG0A 1W2BR 3ZTPA 2KI2A 2AF6A 3R7SB 1HQUB 2ATCB 5BR8J 2IJRA 2KO1A 2EK1A 5I4MA 2DBBA 3JYTA 1OJ4A 1Q1KA 3ICLA 3QRRA 2HHHJ 2CIMA 1N33F 1JJ2R 2VFUA 2GJ2A 2QFJA 3DRSA 4CTAA 3TZXA 3HSJA 4S0MA 3DDIA 1XMOJ 3IAM9 4CO3A 3G82B 3LAKA 2HZAA 1DLOA 2U2FA 3CDUA 2AU0A 2PC6A 3KLGA 4UF4A 1SL2A 3GU0A 2WVCA 4ZKAA 2VQEJ 3BV8A 2CQ4A 4CLZA 3TA2A 2VUGA 2F9JA 1VK8A 4N7TA 4UUWA 4CIOA 3JAMY 5FDLA 3GQCA 1B7FA 2XGQA 2H3EB 5I3QA 4ZVUB 4DSLA 2G13A 2RUSA 5A2QY 1EETA 3GIRA 1JLFB 1S72S 3PM9A 3T1HF 5B0AA 2CADA 4EBEA 3KLIA 2G2YA 2FD2A 4AD6A 2ZH5A 3VAHA 4ECSA 5EWGA 4WIQA 2LKZA 3SSSA 2W2OP 3EGNA 2KB2A 1EQMA 2MYFA 3OTOF 5F9NA 5CAAA 2DGSA 1SKWA 1GMWA 2BE2A 4MIAA 2MJUA 1H38A 2UUAJ 1J2VA 3SSRA 4O4GA 2IM1A 1V6HA 4EEYA 2CPHA 3HHKA 1NRKA 1V5IB 2YY3A 1K1SA 1XEZA 4ELUA 4ZITA 1NPPA 4NLQA 2HK2A 5CYMA 2XM3A 4LFBF 4AXIA 4MKBA 3C14A 2D3ZA 3NNAA 1H98A 3ENWA 1KP6A 1YDLA 2XBPA 1NAQA 3ULHA 1S79A 2P9GA 4RU2A 3ETMA 2IM0A 2HHQA 2BQUA 4P52A 5ETRA 2U1AA 1N52B 4P75A 2I2YA 2EC0A 4I67A 4KV8A 3W2VB 3CC7S 4PXCA 5J1EA 2FJVA 1XWLA 1KFDA 3PHEA 4EI2A 1G3OA 3A3NB 1RJJA 1RYSA 2HMIB 2IVMA 1MLAA 2OFHX 3ITHB 2MY7A 3E51A 1TMMA 4M5DB 2AT1B 2PT0A 1Q8LA 2IRYA 4DX6A 3TJAA 7FD1A 2QN6B 1GK8A 1YVFA 4M5MA 5KAKA 3MTKA 3KWMA 5T7LB 1Z2LA 1SQFA 4BHQA 2EKYA 2NSBA 2GS8A 4DU7A 3R97A 2VBWA 3ZZPA 3DLBA 3CJKB 1GNKA 2DNPA 5GAGU 4V19X 3CIMA 4USMA 1C0TA 1DARA 2ZHBA 4E0DA 3RAMA 4YOEA 1KOOA 4OI6A 5JMNA 2YBVA 2F63A 1QE1B 5M2UA 4ICLB 2R42A 4Y65A 1HYSA 1PJ7A 2CNOB 4FP9A 4OJ3A 5KOXA 2J0QD 3ZZUA 2XYHB 5H9EJ 1HKAA 3V4MA 2W8KA 2YKNB 3DLKA 3K0JA 1IBMF 4EYIB 2IYGA 1UP1A 4DFKA 4IRDA 5HBMB 4DV3F 1FKOB 2AJFE 2VFRA 1KQKA 2OH2A 2PDAA 2KHCA 3GIKA 1JJCB 2FC8A 4KR0B 3OVBA 3C46A 3DN9A 3KG4A 2B8QA 1MWYA 1JB0C 2DPJA 2YH1A 1S1UB 2QA2A 5AE2A 2HBYB 4WFZA 3BYPA 4YB5A 1PAUB 4X4RA 4ES2A 4J37A 1T9YA 4KIAA 4X62J 3Q2TC 3C16A 3ZZOA 1FRIA 2QZ8A 2FVSA 3T1AA 1P8GA 3VQSA 3DOKB 4R0EA 2H9ZA 3I9ZA 2XMJA 4B3RJ 1HWIA 3MR2A 2KL8A 1EZZB 5RUBA 2VG5B 2C42A 3ZTQA 1FRXA 3MFIA 1VIOA 3VZHA 4R0JA 2YQ1A 2ZOFA 2DRDA 2DR6A 2V68A 2VU5A 3IS9B 3OFGA 5B08A 2W2QP 3J7ZT 2RS8A 2VFTA 2OPRA 3R1HA 4LF9F 4X4QA 4KE5A 5KG3A 2GMJA 1LXJA 4WP9A 3ZZ0A 4DR2J 4ZN1A 5IZHA 2RILA 1DRZA 3C66A 1UA1A 2ALYB 1JNRB 1Z2ZA 2FVRA 5GMKa 3LPYA 4I64A 5LMNF 3CGIA 1U2CA 2GIFA 2DR5A 3PV8A 3VR1A 3D0HE 3BDEA 3HVTB 4FBTA 2BRLA 1J5OA 2ZDOA 2B7BB 3KLHB 1OWXA 2IMOA 4GO5X 4F0KA 4RNOA 4C11A 2GHWA 4HH1A 3PFOA 4AXJA 1E6YA 3HHLA 2FJXA 1U49A 1XNRF 1ZTWA 2LCWA 2YVSA 3AD7C 3DGPB 1FNXH 4I2PB 2CPEA 3R3TA 1FE4A 4HR2A 3RAXA 4Q2MA 1WJ9A 1CC7A 2H54B 1ACMB 5J2QB 4X65J 1IWGA 4CO0A 5KFQA 1NCLA 1UUJA 1U8SA 3W2WB 5J2MA 4I7FA 2BQRA 4N47A 1K44A 3G8TA 3NLCA 2XY6A 2LQBA 1C4CA 4KGMA 2HFNA 4K50A 1YRUA 3FSIA 2HURA 3M1VA 4DPUA 1ZZFA 4ID8A 1TMJA 3N9UC 3NKYA 4YR0A 3SDEA 2OD6A 3J81U 2RRAA 4CO4A 3EJMA 2AMCB 4NI2B 3L9ZA 1TL3A 5D3GA 3CEDA 2OI2A 4JI5J 4CZCA 2C2NA 1JNZB 1KDNA 1AFIA 2CRLA 3RU0A 4HACB 1VQ5S 3HHEA 3W8PA 5ETNA 5DDOC 4M5LA 1DJ0A 4TKTA 4F4YA 1X4HA 4ZVTB 1S6QA 4EMDA 2NYIA 3GJSB 4KFBA 3CCWA 2VASA 2WOMA 1Y11A 3K5PA 1VBXA 4I6AA 1A9NB 3HT3A 2K8GA 3CCQS 3B78A 3HDSA 1CSJA 1S9FA 2DXFA 5K8MA 2AJ1A 2YPYA 1BWVA 2C28A 4LF7F 4NMLA 2VQFJ 1ZYQA 4L72B 1YJ9S 4DPTA 3EE3A 3PCOB 1S4EA 5GADI 4UTGA 4EBDA 4LFCJ 2L9WA 3CCJS 2GW8A 2L08A 3T5HA 4E98A 4B9NA 3R5DA 1HHTP 3BGUA 1VQ4S 1NSAA 4QIGA 3BO3A 1I6JA 4KRWA 3OJSA 3RJMB 5KG6A 1X4DA 2B5JB 3BGLA 3EVOA 1YG0A 1HNZF 3CB4A 1L3KA 5HVFA 3Q0AA 3TZZA 1GT8A 3J80Y 2GJFA 4W92B 1H6KX 4OMFG 2AGOA 2E1RA 2YNGB 2M0GB 4KHPF 2RS2A 5GADU 5IT9Y 3QT6A 1OPZA 1NJZA 1RABB 2CFXA 1AB8A 5KG2A 1TK5A 2GGPA 3RRKA 1SJ3P 2UVVA 1DTQA 1T11A 4ZVEA 4FF3A 1TQLA 1WSRA 3M6VA 4WXWA 3VV2B 1S76D 3VAGA 5ETLA 1VISA 3QFWA 1YSJA 1PYSB 1YITS 1WEXA 5J2PB 5D4NA 4B9TA 4UW2A 2HRUA 2G9OA 2UU9F 3B6BA 2AHOB 2HGLA 1FEHA 1Y5IB 2MGZA 5HVHA 4ECXA 3LA0A 5H9FJ 4PG8A 3Q22A 4RZRA 5DRKA 1BXNA 3I55S 3FEYB 1GH8A 3E8OA 4B3SJ 4FDFA 2DTJA 1LEOA 4IO9Q 2FY1A 3KHHA 1IKYB 2Y3YA 2IRXA 5A8WA 3Q23A 2HQGA 5CXTA 3R2DJ 2BW7A 3W2VA 2LQ8A 2EFQA 2MKSA 3IAS9 2BVZA 5CD4A 2B6AA 1HQEB 2GVDA 1DURA 5KFLA 7AT1B 2XHCA 4MK8A 4K4WA 1PJ6A 1ZAVA 2UUBF 1FJ7A 1EX8A 1RI7A 5HANA 1JK9B 1RT5B 4NYZA 2ZJQQ 4MKYA 1UJ4A 2RRNA 2KKHA 2YNHB 3A1YG 2L48A 3GJQB 3N5FA 3V5RA 4ID5A 5FLXU 4NA1A 1TUWA 5KFYA 4TNOA 1OM2A 1TELA 4O3RA 4K4XA 3O44A 4O3QA 3OR2B 2QMXA 1S77D 1FA0A 3TI0A 4N41A 4OYBA 3EPIA 3N6MA 2DNOA 2VOOA 1LKZA 3AJDA 3US5A 4DCPB 1P6TA 4F67A 1SPBP 4NX9A 3A3OB 4D3HA 2BKOA 1CJUB 3C3LA 2JRSA 1H0HB 4OHZA 4JI2F 4KHPJ 1YJ7A 4ILRA 2JHEA 5ETSA 1B0PA 2AEFA 3MPWA 3D1QA 1RWPB 3NOGA 2RNEA 4OZNA 1UPPA 4RWXA 4PUOB 4PQAA 4RW6A 1PO6A 5LJ3Y 1VOMA 4I56A 1VFJA 1GXUA 1AZSB 4FZVA 2PE8A 1CG2A 2YKNA 2F8EX 2CJQA 2G4BA 4WFBQ 2UXDJ 3RW6A 2UU9J 5HVGA 5CZVA 4H4KC 1FKOA 1HARA 1FO1A 2VPZB 3B8HA 1YZ7A 2DNNA 4IDKB 1WKJA 3FBEA 1SKUB 1QUVA 4DV5J 4C8YA 5LT5A 4DR6F 3D28A 2XMVA 2PFDA 1H73A 2R2SA 4C0HA 2AX1A 1QVGR 2ZOGA 3ILLA 2J9EA 5IQ6A 5L39A 2X3GA 1F2GA 3QGIA 4RBVA 5LOQA 4DMZA 4M95A 4C3LA 2W4CA 1B0VA 2JLGA 1RACB 6AT1B 4PQUB 5LXRA 3QGPA 2ADCA 4DLEA 2YQ0A 3K2YA 3DGVA 1GEHA 4QZVB 1C1BB 3CD7A 3GIMA 2A2CA 4OYIA 4YHHF 2H5JB 5KFSA 2W9CA 2Q66A 2PFFB 1X9SA 4MYTA 4YDDB 4OX9F 1HWUA 4JB8B 3EX7B 1WG1A 2FGCA 2YNFA 3PRDA 1OY9A 5ETVA 4PR6A 1N88A 3S7RA 3PZPA 1U7LA 2C2OB 3MEEA 3Q8YA 1WACA 4FNIA 4JI2J 3LW5C 4DR5F 1PGZA 3JTNA 4LRFA 3HD1A 2FHJA 5IXUA 1Q81T 2HBZB 4G6VB 2FPHX 3ISNC 2QT7A 4ZPTR 5DQGA 4M1KA 1YBTA 2ROEA 2JLFA 1S6OA 5L9XA 1U1KA 1T05B 2MSTA 3W63A 4F4XA 2V69A 1M90T 4DX8H 2NLWA 5EWEA 1NSQA 1Y4ZB 3FCHA 1OSDA 3M9NB 2CNNB 2WBRA 3I87A 1H7WA 1QDUB 3DGPA 3EDQB 4O3PA 4DL0C 2DR8A 3AOCA 4FVCA 3AH6A 2J9DA 1CULB 4F4WA 2E29A 4J9NA 2XO7A 2YKQA 2ZITA 5B0GA 1X31C 1VRTB 2HW3A 4WU2A 5KFHA 3ZTSA 4H4MA 4UOCA 3KK3B 5IC4B 4KHMA 1S9EA 4LR8A 4FXVA 2CJ9A 2RSQA 2KZMA 1DTTB 5HQ8A 4YB6A 3MM6A 2J0XA 1TZ0A 3N6NA 2FVPA 2B9YA 3HHLC 4K0KF 3NCPA 1K73T 4B9VA 2E9RX 1N56A 2R2RA 2HNDA 5C5JA 3FCVA 2F8MA 1BQNB 3D3CJ 3BBBA 1JXEA 2DIVA 2W9BA 2FZKB 1KN6A 3T9NA 3N0VA 4DSFA 1WTBA 3PKMA 3DLJA 3MPYA 3MR7A 3FFIA 4QWCA 1HBUA 2XGPA 4MIBA 4N8OA 4WZQA 1TAQA 1RTHA 1JLEB 3N6LA 3QYYA 5L1JA 2FHOB 4Z7CA 5H1SV 1KLNA 2B7CB 4KO0A 2B8PA 2XO6A 2UXBJ 1G2EA 2YWGA 3QJLA 4J9MA 5KFFA 4ILLA 2HAIA 3LOUA 2GHPA 4X2BA 1RTJB 4DV4F 1XR7A 3BO4A 3CO9A 1VLOA 4OX8A 4F25A 5D78A 4LJMA 3MM7B 4C0OC 4I2QB 5KG0A 1AFJA 2ZE2A 4A8YA 2EFNA 4QBUA 4K4TA 4R5PA 4TU9A 3FQLA 3QQCD 4YUDA 3K5LA 3KLEB 1UVNA 1YLXA 4LF1A 1S7IA 2NZCA 1R0AA 3MOZA 3P49B 4G65A 2K1RB 4Q0BB 3QO9B 1D8YA 5G0RA 4A8WA 3MR5A 4QIWD 3Q8PB 1NK8A 1IM6A 2OPSB 2JNJA 2WAQD 2VC0A 2R7WA 2R7VA 3EVMA 1DY3A 3IN5A 1SJFA 4AL5A 1O0PA 3EZOA 4LSLA 2MLYA 3OLAA 3UDCA 1OO0B 2COLA 1HMVA 3CIZA 2JFDA 2EKNA 3ZZYA 3K89A 5KG7A 2C3YA 3U1LA 3OUYA 2NXCA 2DR7A 1HL6A 4NXNJ 4K0KJ 4Q5VA 2QYCA 2Y1RI 2V94A 1Q7LB 3GIIA 3FSXA 1OYDA 4Q43A 1Q8BA 4KGXB 4B02A 3GV8B 5AJ3F 1MROB 4Y2MA 1JLCB 2BBEA 1FWKA 5J2PA 3DYAB 6FDRA 3H4DA 4OI2A 3HFZB 1U2FA 3THTA 3MEGA 4ANCA 1K1QA 4J9UE 2WHOA 3WC2A 3GONA 2XMWA 2ROGA 1RAFB 4IO1A 1RTIA 2CZ9A 3BGRA 1P1LA 4AQYF 3CMES 1D9AA 1E6VB 1N34F 5HP1A 2H48B 3F44A 2I5JB 5KFWA 3RBZA 3IR5B 4OYOA 1S48A 2JH3A 5K8PA 4DL6A 1QAYA 2BDPA 2CJAA 3J7A1 4ER8A 2R9LA 1LFWA 2YWFA 1KOHA 3CW2C 3VHQA 4RW7A 1A6LA 4LSNB 2BE7D 3VZIA 2VHGA 4IR9A 3UD5A 5A0YB 2ZH3A 3AJ1A 3BYRA 1NK6A 5LMUJ 4AL7A 5D0GA 4FYXB 1S6PB 3ZC4A 3Q89A 1VQ7S 3IWXA 1S1WA 2M8HA 2DK2A 1Q4RA 4NLSA 1MW7A 4NCGA 4CLSA 1EJ7L 3BBCA 3V6KA 1Y00A 3IM8A 4WE1A 5F0WA 2ZVIA 1SJ1A 2QLJB 3QIPB 1LWCB 4Y2KA 3PW7A 5KFEA 4QW9A 5DLGA 1WTFA 4TVAB 3D0GE 3NGDA 3KXDA 1YJUA 1XNQF 2IA0A 3CT9A 1W25A 2PA8D 4ELTA 4NWBA 1BY9A 4RL1A 1M5PC 4DPOA 4WTOB 3KJVA 2V67A 2BMBA 1IKWA 4DX5A 5F8LA 4ANDA 5ETPA 3HSGA 4NEYA 3M8RA 4V19J 1VQ6S 3OVSA 1RU1A 3CCES 1U0HA 3QGGA 4ZN3A 2ZJPQ 1X7VA 5IM0A 4IOCQ 3MAHA 1RB0A 2V5HG 1FE0A 1DQAA 1FCAA 4PEOA 4CH1A 3MTJA 1U45A 2XMMA 2HGMA 5A8RA 1J5EF 3NBPB 3JTPA 2D68A 2ZNYA 4U9RA 4X66J 3GYXB 2B9XA 2WSEC 3BR8A 3Q83A 1RBOB 3OTCA 1TUGB 3MM8A 1HBOA 2XNQA 1T7PA 1KSPA 3W61A 1N34J 4MIWA 2AV5A 1N4LA 2NR0A 4LUBA 2I6WA 4IH5A 3H2LA 1BQMB 1FJGJ 4LQ3A 4OHWA 3E01A 5L1IA 2VG6A 5E7OB 2GIQA 4ENOA 1GXTA 4DUYF 4K4UA 4DFJA 2HHUA 4K8RA 2EG2A 2DEIA 5HLFA 3EPGA 1R6VA 3GP9A 4FN5A 1NEEA 1NLKL 3OL8A 5F41A 3DKDA 5C42A 1RP5A 1N8RT 2HIYA 3KFWX 2VF3A 1SV5A 3C8YA 1HHQA 2RQ4A 4EWTA 1C1BA 2H65B 4ANEA 2OIHA 3M8PA 3KLVA 3HXMA 4WZMA 1MMLA 1R8CA 1UEVA 1WOSA 2DKOB 3Q2SC 3AXMA 1NJYA 3IRXA 2MKCA 1V3ZA 4ZOSA 2BV3A 2NPIA 2IC3B 1CS4B 1R3NA 2BJDA 2CQ3A 3R9LA 3MMCA 3POTB 3W60A 2VBZA 2ZH2A 1ELOA 2C3PA 3SQGA 3G2XA 4NRTA 1TL7B 4NZ7A 3G8SA 1FD2A 1JKHA 4JI6J 3IG1B 2W9AA 3VGSA 1H2UX 1NK0A 2FQQB 3OBIA 4LQ9A 3A8JA 4RNHA 3LUYA 2E9ZA 9RUBA 4IQXA 3TQEA 3B4DA 1Y5NB 3OTDA 2ERRA 3LO3A 1MMNA 1QJHA 1U1PA 2CJYB 3GE9A 1H2VZ 3WQPA 2HRYA 4OLOA 5I42B 5KFBA 4JV5J 3CC4S 1BUXA 1U6FA 1R89A 4LF4J 4AFFA 3DHWC 3IR7B 2VPYB 5C25A 5M2RA 1AROP 3U1MA 1FD8A 3CCSS 2APOA 3H5UA 4YEAA 2DNZA 2HNYA 4DOZA 2KG0A 2D69A 1T9WA 2DHHA 3C15B 4TY9A 4DUYJ 1HWKA 2CG4A 2AIRB 1KR4A 5EHHA 2C3UA 4C8ZA 3J81Y 1RAOA 1RXOB 4K4YA 2YKMA 1UKUA 4MT1A 2VKRA 4OFZA 2DEJA 5KFMA 1AA1B 2YWHA 3EZUA 1U09A 3F41A 3A13A 2V4QA 2FIUA 3P4UB 1LK7A 4RW8A 3AD8C 2A0FB 3KJFB 1OQ3A 1RT7A 2YPZA 4KPCA 2DHXA 4P2XA 3PY8A 2FHMA 1S9GB 2K06A 2QC3A 2E5HA 3BKTA 1RT4B 4NRUA 2KM8B 3RG6A 1T3NA 1GFWB 3QLHA 5LM7E 4QW8A 2XG8A 1QM9A 5F8HA 4GRSA 5HN0A 2GMLA 3MM9A 2OO4A 1HD1A 2VG7A 5K8OA 2OPPB 2P5VA 1L3TA 4OZ1A 4PWDB 2AZ1A 5F8IA 3PDNA 1RTJA 2AWZA 4KH0B 2D9OA 1RT6A 2DYAA 2IBOA 2E5JA 1FF2A 3A8IA 4D3GA 4OHVA 3MM7A 2HPUA 5D0EA 2D9PA 1H2TZ 2J8SA 2MZQA 1IR2A 4HI2A 4ZHRA 4RW4B 2ZDPA 2HHPA 1CJVB 2Q3PA 2DXDA 2VA3A 1NJIT 4DR3J 2Z58B 3FKBA 1FWLA 5KT4A 2HBRB 3O3LA 3AJ2A 2DNHA 1C1CB 1KTVA 3X3UA 1HBNA 3JB9k 2OEJA 4NLVA 3MD3A 4Q7AA 4QR0A 3TZYA 1B70B 2LA6A 4N8NA 5CYQA 1Q7YT 1MN7A 4NYPA 4KGZB 1S6UA 4MFBB 4UUXA 2F4VF 1RAHB 3EYZA 4B3MF 5IC6B 3EWGA 1S1TB 3D66A 1NK9A 2WVDA 2CZ4A 5BXIA 4ED1A 3FZBA 2XHWA 5GVQA 1ZTTA 3NY0A 1RBLA 2KXFA 2WBMA 1YGYA 4J9SA 2QA4S 3OR1B 4J9VA 4M63A 1IKVB 1P9QC 4AUKA 2ZHAA 2J6SA 3NL0A 2OSRA 3RRGA 4OV6A 1UCNA 3UNGC 2N4CA 2X1GA 3V6JA 4DF8A 2AYGA 3ZZRA 4QWEA 4WIIA 2YX1A 1YX2A 3TUPA 5B7WA 3BSCA 2AZ3A 4RNFA 3D6TB 2ROPA 2ALZA 3DLEB 2FLLA 1HA1A 2A18A 1YWXA 2IHR1 1REVB 3MAQA 4DF4A 2DRAA 4YS2A 1CLFA 1FXDA 3AX2A 1H7XA 3IXQA 1WOOA 1TKDA 3MECA 2B4PA 1IQTA 3NGUA 1Z4UA 2LP4A 2YQ3A 5AE1A 2AD9A 4ZLNA 2CAJA 4U96A 3M8SA 2UUCJ 3BGOP 3NS6A 3MUTP 3VVTA 2VD3A 3AX3A 1WDDA 5CQGA 4LF5J 3G87A 3L3CA 4NMXA 3P8BB 3T5JA 2H5EA 1HNIB 1F5BA 5FLXY 3WX4A 1TKZB 5K20B 2JC0A 2MQNA 4JI3F 3OW2R 1TKXB 4QQBA 4DX7A 4LFAF 4ZIWA 2RAQA 3M2UB 3OFFA 1V9OA 4EK2A 3PYFA 1RTDB 4OZ3A 1JLGA 1EQ0A 3TJ9A 2HVHA 5ETKA 3PRVA 4PG5A 2RDDA 3LTOA 3RGIA 1HNWJ 1H72C 1GMUA 4WKYA 3QIPA 4B3MJ 2JDJA 3PW2A 4KJIA 4CLUA 1XERA 1VBKA 3GR0A 1EB0A 4F02A 3GFXA 4F26A 4ZPBA 3M8YA 2DITA 3U1NA 1XMQF 3CVKA 2IFXA 4Y2IA 1EAYC 2BOAA 1S4FA 1A0OB 3BQ2A 3KLFA 1TAUA 3AT1B 2FGOA 4OYAA 4DR4F 2OEMA 3P5BP 2R8KA 3HLUA 3CJ2A 5E3CA 2NSCA 4ILMA 2JVRA 5BYQA 4Y0FA 3LP2A 1RWOB 3FRYA 1FK9A 3K7RA 3BGFA 3TUIC 2EWHA 3I0RB 3RB6A 4DWIA 3NRBA 3RBXA 1MU2B 3LANA 4RWWA 1S0NA 2XMAA 4A8QA 2CQHA 3DOMA 1X0PA 2KYZA 4DPXA 2OPQB 2NXJA 1O6XA 4OQJA 1FFGB 3J80U 2ACMA 5D77A 4DV1F 2ATLA 2XMTA 5HK4A 2BOPA 3V6HA 4DR1F 3AA9A 4IG3B 1H74A 3KMSA 2G0IA 1OS5A 5U47A 2DGWA 3P5TL 2DVIA 2VH7A 2MZ1A 2FVCA 4AT1B 4XAKA 1ZS6A 4CCHA 1X0FA 2A3JA 2KTQA 3AFGA 4GKKJ 3TUZC 4X4VA 1WG5A 4JI0F 4A8SA 3WDOA 2WSFC 2R7TA 4ES1A 2DHGA 3PYEA 1JLBA 2V9WA 2LEPA 4RX6A 3N79A 3P96A 4LF8F 2B9EA 2QL7B 2XB2D 5ETTA 3DOLB 1JXVA 4OV1A 2RMLA 3DRRB 1HNXF 1RLCL 3MAAB 2YWKA 4X64F 2G2OA 3LGHA 4L3KA 1SH2A 3CDBA 3LP1B 3M9OB 3PO5A 3R5AA 4O44B 4X4TA 2XLKA 3H42A 2FHKA 4MJKA 1WF2A 4KAIA 2IVFB 4ZMMA 1XR5A 5E5NA 2CQ0A 1UWBA 2ZM6J 1F9FA 2EEYA 4CRJA 2KDOA 3IGNA 4DR7F 2QA4G 1L5UA 2HVEA 5LSOA 1HFEL 2QLWA 3MM5B 4RUAA 4UZCA 4NOHA 1M5KC 4KC5A 2HYIB 2NCKL 5HATA 3GLJA 1T3OA 3LAMA 1NKEA 2F7VA 1RCOB 4HYKA 4G1QB 3M05A 2HLUA 4KH1B 1F6TA 1NH7A 1DHMA 1VLYA 1FHTA 4H54A 1RWKB 2Z56B 2NPFA 4CYUA 4DV7F 1YTYA 1TVRB 5B0FA 2RHQB 1IKXB 1WKLA 3MEDB 2CQCA 1WORA 1NKCA 3N01A 3MHYA 1GX5A 1HPZB 1FERA 4TU7A 2E1AA 3W5YA 3MCSA 5A76A 1WG4A 3GFYA 5KFAA 2M8DB 4MKVA 3HHDA 2KH9A 2Q43A 3CJSA 4WYLA 4NYOA 1S9GA 4P72A 1RA6A 3R5BA 2IAJB 3I96A 2DRBA 5DDQC 2DGTA 1RWMB 1DZ5A 2HWHA 3D6HB 4YMEA 2YWEA 4ZP6A 3IBWA 3CO0P 3CCUS 1HBMB 2LEBA 3I82A 3EZ5A 4P73A 4YR2A 1W2IA 2KYXA 1N6QA 3ET6B 3UFCX 2VBYA 2V4JB 5ETOA 1F3FA 3LGMA 2ZJRQ 4K2XA 1VJQA 2DGXA 1FNOA 2OEKA 3UR0A 3GFZA 1HWLA 2CPJA 3BJYA 1NXIA 4HH0A 3TEGA 5JJBA 3T6JA 4GKJJ 2FVQA 3W3SA 4J7CA 4ZJLA 1VMBA 3HFKA 3P45B 4A4JA 2MZRA 1N32J 3M8QB 3OXLA 1UPMB 3LALA 1N5YB 2WVBA 2ZKUA 3PX0A 1FRHA 4RBTA 1RT3B 2MQOA 2X51A 2R2TA 2IM2A 4NPOA 1YK9A 3FMWA 1S0OA 5CZXA 4IFVB 5BYRA 2BABA 2IDLA 1F5AA 2I8EA 1MWQA 5BR8F 3GILA 3TA0A 3RW7A 4AE5A 1FEEA 2MQ8A 4RKUC 2EG1A 2HHHF 3HVWA 1VIXA 4LVNP 1ZBTA 2WB1D 1M0SA 1PC5A 5C2CA 2FJBB 3LP0B 5A6PA 2HQDA 1NM2A 1RAAB 1XMOF 5GAHU 2GIRA 1GMWD 4FXDA 3TW0A 4EBCA 1RT2B 2KVQE 5IQQA 3D6FB 2B43A 3PW5A 1FKPB 2XTCA 2CVIA 4EYHB 3M4XA 3CULA 2XY5A 3DI6A 1NUEA 2VQEF 4HT5A 1VQNS 3QZ7A 1F2HA 2IIHA 4IRKA 1S1VB 1XN9A 1DQ9A 3KJNB 3D2WA 4BS2A 3V6DB 4DSJA 5FD1A 3TAMB 4PKDB 3AODA 3DLEA 4N77A 4WJBA 4EGLA 3MR6A 4Q45A 2VICA 2W4PA 4W98A 3SXLA 4FNHA 3HPOA 2XTEA 3V81A 3PTWA 5D4PA 2BJ7A 2DH7A 3G4SS 2QRRA 1LNQA 1WF1A 3MR3A 1X9MA 4OZ2A 3M2RA 3JSMA 2MKYA 4WCEQ 3D4JA 1S12A 4LIWA 4P2MA 5D15A 1VQLS 2ZD1A 3BSNA 1RHUB 3DU5A 2UUAF 2V63A 1RTZA 2J0SD 1RSCA 3KK2A 1FFSB 3CTRA 1U1OA 1EKRA 2K7JA 5ITHA 1WI6A 3DM2B 2ADBA 2B4UA 2V6AA 1RUSA 3QJPA 5C24B 4JI4J 3MI7X 3VF0B 3M2VB 4DUTA 3CXCR 1I3OB 1RAEB 1UWAA 1IUJA 1JMTA 1V3RA 5L46A 1N5TA 1OIAA 5KG5A 4B3TJ 1EP4B 1U1LA 1BHNA 2GVZB 2DH8A 2ILYA 4H4OA 3MMBA 4USHA 1TP7A 4MMOA 2LDIA 3FK4A 2J9DE 2NZ4A 2V2ZA 3DHXA 4HI1A 3H5XA 1HNVB 2AJ0A 2AEMA 2R7UA 3NAIA 2J9CA 4EO8A 1XK8A 2F9DA 4QJVA 2P9EA 3MMAA 4JYAJ 3SFGA 2XZDB 4ZCLA 3PW4A 5EGYA 4J9OA 4OYPA 2PMZD 2RF2A 3T1YJ 2KT5A 3SI8A 5AXKA 4OZJA 4E2FB 1HLWA 1JLQA 4OYZA 4F4ZA 2BACA 1WOPA 2DCUB 2PI4A 1SBRA 3UVJB 1KNZA 4OLPA 4QR1A 2XY7A 4DFPA 1Q8IA 1S1XA 5SZTA 2ZEJA 1MU2A 1FX4A 5DO2A 2H51B 1TR0A 4ZVOB 5KT6A 1JLAA 2MLXA 3R1LA 1TFYA 5HL7Q 4NLGA 1N5SA 5J1PA 2OPQA 1DBDA 1OYEA 3DDNA 5HAOA 3FUYA 2XS2A 3WX8A 1O5JA 4FVMA 1JQGA 2HNZB 1YIJS 4LBHA 3AXKA 4KGKA 3T6BA 3IWLA 1DQ8A 4K5RA 4QWDA 3AAWB 3BR9A 1PCAA 2EXUA 2LVWA 3UW1A 2WONB 2ABYA 4CO2A 4G1PA 1R8AA 1WUUA 2GNKA 1VRUB 5LJ5Y 4NLWA 3D5MA 3B54A 4Q44A 2HHXA 2RDJA 4X62F 4LRBA 4M8LA 3I0SA 4F7VA 4EZ9A 1N0VC 3W62A 2ZBRA 1QAXA 2CJKA 4B3RF 5K14A 2DGUA 3DRRA 3KK1A 2DY1A 2OD4A 1IBLF 4DV2J 5D6GA 1UL3A 5HI7A 1X8DA 3VWSA 4ZCIA 4OX7A 2J6TA 1MNEA 3IGVA 3D1HA 4L6V3 5J2NA 4ZP8A 2C2MB 3EICA 5DZ7A 3D67A 4USVA 4C8NA 2HHVA 2MQLA 1VQ8S 1A7GE 1LFPA 5KFNA 1YJNS 1M5VC 4CLLA 1T95A 1LWEB 2OMLA 4YB7A 4H4KA 5MAOA 1UVLA 3DRXA 5EDWA 1S7HA 3VTIA 2W4DA 1SKRA 2HQ3A 1Y3KA 1P27B 5LXYA 4DR2F 3DLGB 2VODA 4RNNA 3NMAA 4NL5A 1RT1B 2EW9A 1NH8A 3H59A 3MCNA 3BH7B 2HHWA 2Z8QA 4ZVHA 3QPIA 3RZAA 3UO0A 3CSKA 3GJTB 2KRBA 4ECQA 4M94A 4U8YA 2B51A 2RRBA 2RT3A 3OXGA 1S5ZA 3TUJC 4CDIA 1QSLA 2UVUA 3NMRA 3ONQA 4F0MA 4HLBA 4CNYA 1PJ5A 4JI8J 2UUWA 3MZIA 3O8WA 4R8UB 1Q53A 4J91A 4X65F 3GCWP 1YKWA 4Y2AA 4GVBB 3MFHA 1GQEA 1R8HA 2R8HA 1FDAA 2BA9A 4JBCA 2HSEB 1NMEB 4B3OA 3DMJB 2JC1A 3U7JA 4KKOB 1TK0A 2RD5C 2VFVA 4RUBA 3DFEA 1IBLJ 3C6TB 4O4RA 5FIIA 3ET6A 2R7OA 1UJ6A 4DG1B 3C6UA 3V4IB 2YH0A 2NXNA 1KLMA 1RBAA 5HROB 3HULA 4JI1J 3QJJA 2AKWB 3NGSA 3DC2A 4HT7A 1RGVA 1EARA 1X4FA 5A8KB 4Z2XA 2XI2A 4NCBA 2C2RA 4QU6A 1X4CA 3GSIA 3CPWR 4JI5F 1U48A 3ZTRA 2KM8C 2XEXA 4LRCA 3TOQA 1M1GA 1YJWS 1N5YA 2XS5A 1BMQB 2IPOB 4A8FA 1PYTA 4RR5A 5HMXA 1VC0A 1XR6A 4A8OA 4U8VA 3FSYA 2WW4A 2PIIA 4CI0B 3BPSP 3VAMA 4IG0B 2N4DA 4GVLA 2J7KA 1RWVB 4P2FA 3M8WA 3JYTB 2CDRB 2CNLB 8ATCB 3WZ0A 2QO3A 5KFZA 3W9JA 2ZHOA 3DRSB 4CTAB 2J5AA 5E3RA 1WHXA 1DLOB 2VQFF 1CPZA 2UXCJ 2E9TA 4F2SA 1RISA 1ITPA 2QFIA 3BF4A 3KLGB 2Y0BB 1PKUA 3NEKA 1VQSA 4DQQA 3BH6B 1KHWA 4QU7A 4WYWA 3SV3A 3SCLE 1JJHA 2FJEB 3JSRA 1LWFA 5IV3A 5F8MA 4LFCF 4HTIA 4O3OA 1BLUA 4EU0A 1ZA2B 4Q8FA 5FDLB 1X60A 2DNQA 4UZBA 5CCLA 1X5OA 1Q95G 2I0XA 1QAIA 2UP1A 1EETB 2KN4A 1O8BA 1PC4A 3D7SB 1IBCB 2M7SA 1SQEA 4IOAQ 3EXCX 3KTQA 3DRPA 1FJEB 3KLIB 3NS7B 2RQKA 5L38A 4PWUA 2WSCC 4IFYA 3H2UB 1N54B 3QIDA 4M5GA 5KFCA 4FF2A 3ILIA 3UCZP 3CDEA 1B0TA 1GMVA 1FI4A 3TWZA 3SYZA 1RE1B 5B0CA 4ZK7M 2BE2B 1V3SA 5DLFA 3Q8SB 4UOGA 4O4GB 3KNGA 1WHWA 3F0NA 4PPDA 5JVGQ 4ZS6A 3VAFA 3KHLA 2RJZA 5KT3A 1SKSA 5F8NA 1LW2A 3C14B 3BN7A 2I9SA 2YNIA 5CCMA 3O2IA 4F3OA 4TYAA 2O5DA 3N5BA 4B3SF 1TV6B 3M6XA 3M32A 4ALZA 5DGBA 2BANA 3ZZZA 1Q78A 4UQGA 4ECVA 4JUZA 2HZVA 1HQUA 4KV8B 2GQ2A 1QTNB 2I1RA 4R25A 5KFDA 2IJFA 5J1EB 5IT4A 3IFEA 4RUHA 1JIHA 3OVAA 1FX2A 5AXMA 2OGUA 4B9MA 3KDNA 2HIQA 3TRGA 3G82A 2ASYA 3FEZA 3Q24A 3G6ES 1FTCA 4XDDA 2DO0A 5MLCV 1FJCA 3NNCA 3ZXWA 1ZA1B 2E5LJ 2LMIA 4ZPDA 4C8LA 2O01C 3K5OA 2MY8A 3BSAA 1P9YA 3CJRA 1IBKJ 3JXOA 2MQMA 1JLFA 1UVKA 5C2GA 3GPAA 4C2MA 1C0TB 3BB5A 3H40A 2EC2A 4P74A 2ZKTA 1RADB 1FNMA 1FKAF 2M2BA 2Z57B 1N36J 4FYVB 1G4CA 4DBQA 1IR0A 1RCXB 2Q1LA 5KFRA 3UDEA 1HYSB 5KFUA 4NLOA 1VDHA 1M1KT 4K4VA 1NDCA 4CLTA 2C3MA 3DLKB 3LGNA 4NCAA 2XYPB 1FESA 2JEFA 4LSZB 3AB4B 2M88A 2UXDF 4UY8T 2CUYA 4Q2LA 3CJ3A 2MPUA 4O3SA 3NOCA
chains in the Genus database with same CATH topology
2OPPB 2P5VA 1L3TA 4OZ1A 2X1FA 4PWDB 4BHQA 5DG9A 3RBDA 2EKYA 2KVIA 2NSBA 2Z0GA 5F8IA 4ZVFA 3PDNA 1RTJA 1UFLA 4BDPA 2AWZA 3NCRA 3VAIA 1TKTA 2E66A 4DV5F 4IH6A 1VI7A 2D9OA 2LXIA 1RT6A 4I6WA 2VBWA 2IBOA 5JVHQ 2E5JA 1FF2A 4D3GA 3ZZPA 4J9PA 2KU7A 1VK3A 4URSA 3PEHA 3CJKB 5IFMA 4DL2A 3DLBA 4OHVA 2DNGA 3TAQA 1GNKA 3MM7A 2ZC3A 2DNPA 2HPUA 2XULA 2D9PA 5GAGU 2AYEA 5E2QA 4V19X 1H2TZ 2MZQA 3CIMA 4X4PA 1C0TA 3N4WA 1DARA 2K3IA 4HI2A 2ZHBA 4E0DA 4ZHRA 5EN1A 4RW4B 3RAMA 2E7WA 3PEJA 4OZ5A 5KFPA 3CJ5A 3FGVA 2ZH6A 4HHJA 2ZDPA 2XCPA 1VBYA 4YOEA 2HHPA 1KOOA 2Q3PA 2AGQA 1Z1ZA 3CJ4A 3M6WA 4OI6A 2VA3A 2DHAA 1NJIT 2FHJD 1CC8A 2PEHA 2HS0A 5KT4A 1QE1B 5M2UA 3O3LA 4ICLB 3AJ2A 4Y65A 4PRFA 1HYSA 1RT4A 2XMUA 3P6YC 2HMIA 2DNHA 1C1CB 4FP9A 1KTVA 2CQPA 4OJ3A 5KOXA 2J0QD 3X3UA 1HBNA 4ECTA 3JB9k 4NLVA 2V8HA 3ZZUA 3MD3A 4URGA 4Q7AA 1KD1T 3ITHA 1NU4A 4QR0A 2OJ3A 2VV5A 5H9EJ 2LA6A 2YX7A 3FDSA 4N8NA 3V4MA 4M5DA 5CYQA 1Q7YT 3KNAA 2IVYA 2YKNB 3MECB 4KQZA 1S6UA 3DLKA 4NYPA 5HMYA 2W8KA 4MFBB 2GJIA 4UUXA 1IBMF 3K0JA 2F4VF 4MH8A 4EYIB 2EI5A 4OHXA 4QPXA 2IYGA 2D3OR 5BJRA 1UP1A 3EYZA 4DFKA 4DQSA 5HBMB 5HMWA 2PMHA 4IRDA 4DV3F 1FKOB 4B3MF 2M52A 2AJFE 2VFRA 1S1TB 1KQKA 5T7LA 2OH2A 3PO4A 2PDAA 2OPPA 2KHCA 3CCTA 1NK9A 3GIKA 1M5SA 1BGXT 4PWDA 1U6ZA 2CZ4A 5DDRC 2FC8A 4ED1A 2WW8A 3HJFA 2OPRB 3FZBA 2R8JA 4KR0B 3Q8RB 4TY8A 2XHWA 2ZNZA 5GVQA 4ECUA 1ZTTA 3C46A 3RYLA 3DN9A 3KG4A 2KXFA 2WBMA 1YGYA 1G1XA 4J9SA 1MWYA 2OTJS 1JB0C 2QA4S 2DPJA 5DS7A 3OR1B 1VC6A 2YH1A 4M63A 3CJKA 1IKVB 1S1UB 1P9QC 2QA2A 1AXQA 4AUKA 1K9MT 3VAJA 3QAUA 4Q8EA 3X1LB 5AE2A 2ZHAA 2J6SA 4WFZA 3NL0A 4YB5A 2OSRA 3RRGA 4NA2A 4X4RA 2UVWA 2B4VA 4ELVA 3NWGA 4ES2A 2KRRA 4J37A 4KIAA 3UNGC 2N4CA 3Q2TC 2X1GA 1YHQS 2A2DA 3UCGA 4W90B 3V6JA 4RW4A 4DF8A 2AYGA 3ZZRA 3ZZOA 4QWEA 4WIIA 1FRIA 2QZ8A 3ISZA 2YX1A 2FVSA 4JI4F 3T1AA 1P8GA 5B7WA 3VQSA