4NLSA

Poliovirus polymerase - s288a loop mutant
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPAGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
molecule keywords RNA-directed RNA polymerase 3D-POL
total genus 140
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nlsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nlsA02
3CJ3A 2AQ4A 3KNAA 4R8UB 4KBIA 4TY9A 3UQSA 2UVWA 4ZP9A 4RW6A 4DEZA 3OSPA 3RAQA 3V6HA 2UVVA 1FK9B 3MFIA 1MMLA 3QIPB 4NLOA 2FLPA 3DRPA 1DTQB 1RT3A 3V6JA 5JXSA 1RTDA 3G6VA 1CSJA 2V9WA 5KG7A 1NNDA 2F8EX 1T94A 5KT7A 5KFVA 4DL3A 4RNFA 4J9OA 3PW4A 1TKZA 4J9MA 5KFJA 1S1XA 5KFIA 1HMVA 2WONB 4JUZA 2WOMB 4KE5A 4K4ZA 3MEGB 3QO9B 3PW5A 1R0AA 2IBKA 3DYAB 3GILA 4RUCA 4NLWA 2D41A 2FVCA 1T05B 4MKBA 4RNMA 2BRLA 1TVRA 2R8HA 4FBUA 5J2NA 1RTJB 2BE2B 2IAJA 1JLGB 3C6TB 4O3QA 1DLOA 2D7SA 1C1CB 4IKAA 3FQKA 3KHRA 3CJ5A 1S48A 5F9LA 1ZTTA 4WFZA 4IQXA 1RT7A 3JYTB 3BQ0A 3IRXB 3H4DA 3KLIA 1KHVA 3HVTB 1BQMB 1TKTA 4ZVHA 2BANA 3H5YA 3CO9A 3M8PB 4RW8A 5C25B 3E51A 5L1JA 4J9LA 2O5DA 4G1QB 3LAKA 5HBMB 5KFKA 4EYIB 3IS9B 4WXOA 4MFBA 3OSNA 1IKWB 2R8KA 3OLBA 2BR0A 3IG1B 5DG9A 2IM0A 1LW2B 4U7CA 4KAIA 4RW9A 4G3IA 5F8IA 1NHUA 1SUQB 3LAMA 3CWJA 3EZUA 2ILZA 4WZMA 2JLEA 3DOLA 3MEEA 2WHOA 4IG0A 5KFTA 1JLBA 4H4OB 1HNIB 4ZPDA 4RW7B 1QUVA 2R2RA 2ASJA 4PUOA 3SI8A 3KHHA 1RTIB 4MKAA 2RF2B 3DOKA 3I0RB 4KHRA 1KLMA 4MH8A 5J2MA 3KLEB 3FDSA 2XCPA 4IRCA 4I2QB 4ZVEA 1JLEB 1LWFA 1S1UA 3ITHB 4ZHRA 3GV8B 3V6DB 4JV2A 5L1LA 4ECYA 2IC3A 2YNHA 1HNVB 3QIPA 1S0NA 2VG7B 2YNGA 4RW4B 3H5UA 3MEDA 1EETB 4LSLA 5J1EB 3LP0B 2B6AA 1C0UA 2AWZA 1S0OA 3DRSA 5HP1B 4DL4A 4ECUA 3DLKB 1JLAA 2HNDB 2DPIA 3KK2B 1S9EB 1MU2B 3DI6B 4URGA 1JLQA 3CDEA 4TY8A 5L1KA 1RA7A 2QE5A 3T1AA 1HQUB 1QE1A 1RT5B 1S1WB 2YKMA 2OPRA 2YNFA 3DM2A 4O4GA 4I2PB 2J6UA 3HVWA 3NAIA 3RBEA 5FDLB 4TYBA 2W9CB 2IM1A 5I3UB 3MF5A 5KFNA 1BQNA 2IAJB 5KFZA 5F8LA 4ECVA 1S6PB 2B5JB 4WE1B 3SFUA 3Q8RB 2YKNB 2W9BB 4J9PA 1LWCB 2FLLA 2FVSA 3QLHA 3PVXA 4ECWA 5EDWA 1RAJA 1N56A 4ZPCA 3IRXA 3PZPA 5HROB 4MK7A 4ECTA 1RT6B 5L1IA 2ZD1A 2AU0A 3KLFA 2W8LA 4KO0B 1JLFB 4KV8B 5HBMA 4TQRA 3KLGA 2HNZA 4Q0BB 3M8QB 4O3RA 2UUTA 5KG1A 2C2DA 4DL2A 2B43A 5KG6A 1GX5A 3OL7A 1TKXB 3TQ1A 1N6QA 1S1TB 1LWEB 4ICLA 4ECZA 3H4BA 4IRKA 1UWBB 1D1UA 1SUQA 1SH2A 4NRUA 3DRRB 3C6UA 3N6LA 1RT2B 1HMVB 2AGPA 4K50A 4K4WA 4B3OA 2XGQA 3V4IA 2I5JB 3BSCA 2GIRA 3MEGA 1R0AB 1RYRA 4F50A 3PW0A 4QW8A 1VRUB 4WE1A 3LP2A 3I0RA 4ZP7A 4J9QA 4LSNB 3RB3A 4PWDB 5KFCA 4WFXA 1C0TA 3BQ2A 1S10A 4MK9A 4QWBA 1S1UB 4ZHRB 1VRTA 3PJXA 5DGAA 2VA3A 4PQUA 4QWDA 1SV5A 3ISNC 4F4ZA 4NLXA 3DRPB 3BGRB 3MECA 2J6SA 3H5SA 3FFIA 2YNIA 5F8NA 4NCGB 2VG5B 2XWYA 2OPQA 2UVRA 1TL3B 4IFVB 3MR6A 1S6QB 5F8GA 2E9ZA 3H98A 3TVKA 3M9OB 1ZTWA 2OPPA 1J5OB 4IR1A 2R8IA 2IJFA 4G1QA 4YR3A 3HHKA 2RKIA 3MR2A 1JLCB 2JEIA 3KLHA 3FRZA 1S1VA 5CYQA 5C5JA 2BQUA 3BJYA 4I2PA 1SH3A 3FSIA 3H2LA 1TVRB 1DTTA 2CJQA 4H4MA 4EEYA 3GIKA 5HLFB 4IFYA 4O4RA 5KFHA 3RAXA 4O3PA 1I6JA 4K4TA 3BQ1A 2VA2A 1JLBB 4WXWA 4K4VA 5EUHA 5K14A 1FKOA 3JSMA 4MIBA 1RTIA 3JYTA 3G6YA 1LW0A 1JKHA 2W7OA 2XI3A 5L9XA 1FKPB 4O44A 1RDRA 4IH6A 1TV6A 2ASLA 1JLEA 3ITHA 4J9RA 1HQEB 2XI2A 2AGQA 3GIJA 2C2EA 1EP4B 2AX0A 3E01A 2HNZB 3RBDA 1HNVA 4KSEB 4DL5A 4ZVGA 3I5BA 4IG3B 3RB6A 5KFXA 5KG2A 2WK4A 1XR5A 2VG7A 1IKVB 4RW4A 3V81A 1IKXB 2FJXA 3KLIB 3HVTA 1LWEA 4ICLB 1S97A 2RDJA 5D3GB 3MR3A 3QIDA 4NLYA 4XPEA 2WONA 2VG6B 2GIQA 3KHGA 3BSNA 3GQCA 2ZKUA 1RT3B 4TN2A 4HKQA 3KMSA 1REVA 2XC9A 2HMIB 3QZ7A 2C2RA 3NMAA 5KFEA 2FVQA 1JLGA 3C6TA 2ATLA 4JV1A 4NLUA 3N6NA 4ECRA 3D5MA 2JEGA 2JC0A 1RT1B 1HYSB 2D3UA 2V0NA 5F9NA 5DQGA 5KFDA 4ED8A 5J2QA 4Q8FA 4TXSA 3DYAA 5F8HA 5F8JA 2B6AB 3UDLA 3KJVB 2FJWA 4NCGA 4EBCA 4ED0A 1JLAB 3KLEA 2BANB 5J2NB 4KFBB 1BQMA 4WFYA 3G86A 4YP3A 2OH2A 4WYWA 1S9GB 2ZE2A 5F8MA 1HARA 4O3SA 5DLGA 2CKWA 1RT5A 1S1WA 4NRTA 1YVFA 2YKMB 2YNHB 1C2PA 1S1VB 4O4GB 4DG1A 2UVUA 1RT7B 3LP1B 2C28A 4GC6A 4ED2A 1QAIA 4ZPAA 2AX1A 3BSAA 3KK3B 4RW9B 4H4MB 1T03A 3DLKA 3PW7A 2OPSB 4QWEA 5DGBA 4FBTA 5KFBA 3DOLB 5DQHA 3RB4A 3MEEB 3ICLA 5C24B 4NYZA 3BSOA 4NLGA 3IS9A 1HNIA 4I7FB 4PUOB 2UUWA 2I5JA 1LWCA 3GYNA 4MIAA 3CJ4A 4IH7A 4NLSA 3FQLA 1C1BB 4ID5A 4R5PB 3EPIA 3IG1A 2WCXA 4NLDA 5CYMB 3TAMA 3I0SA 3DDKA 3PHEA 1BQNB 1IKYA 3V6DA 1DLOB 4NLTA 1XR7A 1JLFA 2RDIA 4IDKB 1RTDB 3NGDA 4Q44A 1N4LA 2YNIB 2FVRA 1TKTB 4QWAA 2R2UA 3GIIA 4I2QA 2HNDA 3PR5B 4RW6B 4ED3A 1S1XB 1JLQB 4K4SA 1MU2A 3T5KA 4DL7A 4KO0A 2WOMA 4KV8A 2XCAA 2VG6A 1IKWA 4MFBB 1RA6A 3LP2B 2HWIA 4LSLB 3LP0A 5J1EA 5FDLA 5J2PA 3CDWA 1RTJA 1HPZB 4U6PA 3OHAA 1N5YB 4FS2A 2HMIA 1UWBA 1S0MA 5C42B 3OHBA 3KK1A 3I5AA 4F4XA 4FS1A 4Q8EA 4ECQA 2JEJA 3HKWA 1S6PA 1RTHA 2B5JA 3QO9A 3KHLA 4EBDA 3DM2B 2R8JA 3QGGA 3NBPB 4KHMA 1FKOB 3JSMB 1TL1A 3KOAA 1TQLA 3OL9A 2RF2A 2VG5A 3DOKB 3UR0A 4JV0A 4R8UA 5EWGA 2BE2A 2HNYB 4HYKA 2BQRA 3CIZA 2IC3B 4M94A 4EBEA 5DG7A 3I5CA 5I42A 4XPCA 2D3ZA 5KFLA 3ISND 4RNNA 3BREA 5EWEA 2W8KA 3BR9A 4ED7A 3T5JA 5KFOA 1D0EA 4GC7A 1XR6A 4IOBA 4MK8A 4Y2CA 1TKZB 4YMEA 5KG4A 3M8PA 5C25A 1T03B 3N6MA 1U09A 2IA6A 5KT4A 5JUMA 2FVPA 1RT2A 2I1RA 4TY8B 3H5XA 2RKIB 5KFPA 2C22A 2OPRB 2YNFB 1JKHB 5KT6A 1RT4A 1C1BA 3DLGA 4ID5B 2ILYA 4URQU 5J2MB 5DG8A 4R5PA 4ZP6A 4WZQA 1TKXA 4XO0A 1N48A 4IFYB 3LANA 3RB0A 4NZ0A 4O3NA 1HQEA 2WB4A 3QYYA 4J9NA 3CJ2A 4H4OA 3V6KA 4IG0B 3QLHB 4TYAA 1IKXA 1LW0B 5DLFA 1OS5A 1T05A 1JX4A 5KT3A 4RNHA 1FKPA 1TL3A 4NLPA 4IFVA 2OPQB 4O44B 2XGPA 2DPJA 1LWFB 1S9EA 1JIHA 1J5OA 4OL8A 2OPPB 3M9MB 1KHWA 5KFWA 3H40A 4IH5A 4Q0BA 3KLGB 5KFRA 4TLRA 1DTQA 4TQSA 1ZETA 4K4YA 2YNGB 5KFSA 3CDUA 3QGIA 1JXLA 3LP1A 3DRSB 5HP1A 2FLNA 1C0UB 5HLFA 2V4QA 2WTFA 2W7PA 1NHVA 2E9RX 5KT5A 3G6XA 4KKOA 2BQ3A 3QZ8A 4QPXA 5C24A 2R2SA 1IM4A 2YKNA 4RNOA 3H59A 5T14A 4I7FA 4IRDA 2J6TA 2JC1A 3KJVA 1KLMB 5KG3A 4QWCA 1S4FA 5KG5A 2E9TA 3NKYA 2W9CA 2IM3A 4LQ9A 3DLEB 4PQUB 5KT2A 3DMJA 2BRKA 4NLVA 4YR2A 1C1CA 1SV5B 3M8QA 4NLQA 3T5HA 1SH0A 1K1SA 4IDKA 4DL6A 4YQWA 3V81B 4M95A 3VQSA 4ED6A 4X2BA 4KFBA 3OL6A 1TV6B 4H54A 3KK2A 4RZRA 1RT6A 3DRRA 2ZD1B 3IGNA 3PR4A 5KFGA 1TP7A 1FK9A 4B3OB 1HQUA 1QE1B 5KFQA 5CYQB 1JLCA 1Z4UA 2GC8A 3PJWA 3KLHB 2EC0A 4J9SA 4ECSA 5KG0A 4NLRA 3D28A 2V4RA 3OLAA 1IKVA 1LW2A 1REVB 5J2PB 1S1TA 2WRMA 1WNEA 3KK3A 4EYHB 1N6QB 1IKYB 2OPSA 1QAJA 3C6UB 3Q8PB 4Q43A 4RW7A 4K4UA 3GV7B 1RTHB 3BGRA 3IN5A 3V4IB 1T3NA 5J2QB 3KLVA 3NBPA 4EO8A 1S9FA 3T5LA 3MFHA 3EPGA 3PW2A 5HROA 3CVKA 5KFFA 2HAIA 1C0TB 4LSNA 4PWDA 5KFYA 2HNYA 1VRTB 2QV6A 4ECXA 3NAHA 3NL0A 2ZE2B 5KFUA 3KLFB 4IR9A 4KB7A 3M9NB 1RT1A 3MR5A 3KMQA 4O3OA 5KFAA 1HYSA 5I42B 3MECB 4ED1A 3MEDB 4ZVFA 4K4XA 1EETA 3FFIB 4DG1B 1DTTB 2IMWP 4J9KA 1K1QA 3Q8QB 4F4YA 2JEFA 3T19A 4EO6A 5D3GA 4QW9A 4RW8B 1S6QA 3CJ0A 4ZMMA 4ZPBA 3DI6A 4KKOB 1GX6A 1RYSA 1S9GA 3UPFA 2R2TA 5KFMA 2R8GA 4F4WA 1S49A 3HVAA 3GIMA 2W9AA 1TL1B 5DQIA 3Q8SB 2ALZA 1RT4B 3DLGB 3LALA 4Y3CA 5CYMA 3TAMB 3I0SB 3GV5B 4ZP8A 4LQ3A 1HPZA 5I3UA 1N5YA 4URSA 1W25A 3DLEA 3IGVA 4RU9A 4YR0A 3QGHA 3SFGA 5C42A 2IJNA 4Q45A 3KK1B 3DMJB 3OL8A 1EP4A 3E01B 4Y2AA 4WYLA 2W9BA 5K14B 2ASDA 4IG3A 2AGOA 2IM2A 4Y34A 2HWHA 4R0EA 5EWFA 1VRUA 2FJVA 3MTKA 4RUAA
chains in the Genus database with same CATH superfamily
3D4JA 2AQ4A 3KNAA 4R8UB 1M5PC 1WI6A 2FHOB 2MQOA 2ZH5A 4KBIA 3UQSA 2MTLA 5LL6d 2PMHA 4RW6A 1WC4A 4DEZA 3TX0A 1WTFA 4FKXA 2IDEA 2H5EA 1MMLA 3QIPB 2FLPA 2DNLA 4ILRA 2QO3A 4MMOA 3N9UC 3V6JA 2V9WA 1KONA 3HMJG 2MZSA 2MQPA 5KG7A 4NE9C 3G6VA 1NK0A 1WEZA 5LM7E 4RNFA 3UDCA 3J80U 4B3RJ 5KFJA 1JJ4A 4B3SF 2ZVSA 3M8WA 4UZCA 2DB1A 2LA6A 2VV5A 4YEAA 5MAOA 2WOMB 2R9LA 3PYGA 3QO9B 2D3O1 2OHDA 1N52B 3GILA 4YFUA 2COLA 2K7JA 3JSRA 2D41A 4W98A 2BRLA 5GAEU 1P1LA 2QC3A 3TO8A 1OMSA 4LF1A 1R8PA 2ZOGA 1UTAA 4PAAA 4JI5F 4LF6J 2DT9A 4P2FA 1NBEB 2BDPA 2D9PA 4P52A 5ETSA 3KHRA 2NXJA 1TU0B 2LA4A 1GK8A 4FBTA 2DHGA 4FPIA 3BQ0A 2LQ8A 3PO4A 2HHQA 1KHVA 2Q43A 3HVTB 2DVIA 1BQMB 2CZ4A 5AXNA 4P6QA 4IO1A 3H5YA 1IXKA 2DH8A 3CO9A 3VQTA 4EMDA 2XZ2A 1V9OA 2HHXA 1V3SA 4DV3J 4G1QB 3LAKA 5HBMB 1QVGR 4EYIB 5CHCB 1WF1A 2R8KA 1U0SA 1WKJA 3C16B 3ENAA 4OZ0A 1QLNA 1XWLA 3W2VB 4DSLA 2B7BB 2GZOA 4G3IA 5B0BA 4UW2A 1D8YA 3CEDA 4IO9Q 2HPUA 3CWJA 3EZUA 1B7YB 2M9KA 3PEJA 5D78A 4WZMA 3DKDA 1SQGA 3DOLA 1U2FA 2KM8C 3VGUA 4ZPDA 1FCAA 1QUVA 2XS7A 1RAAB 4QZVB 4MKAA 3L4BC 4ZOSA 2VDHA 1DRZA 2R7RA 3I0RB 3R9LA 1KLMA 2CJXB 5J2MA 2IHR1 3FDSA 1VMBA 3M32A 2HBYB 2XCPA 2MSSA 3J7A1 5AE3A 1JLEB 3ITHB 4ZHRA 1WD6A 2VBYA 4LF9F 1F60B 4JV2A 5EN1A 1CJUB 5L1LA 2AYBA 2IC3A 1IQZA 5BJRA 1QSSA 1EJ7L 1R6YA 1RBAA 1WACA 2PT0A 3D66A 3IR7B 4RW4B 4LSLA 4TVAB 3LP0B 2B6AA 1C0UA 2DH9A 3GG0A 2RJZA 3SZ2A 3PJ9A 4DUZF 3DLKB 3NGUA 2PI4A 1NHKL 4ER8A 1RAEB 1U0HA 5HMWA 3DC2A 2CQGA 2G1DA 4AD6A 4TY8A 3TUZC 1RA7A 2DRDA 4OX9J 2GJIA 1Y3KA 2J9DA 2V94A 4O4GA 2YKMA 1WWHA 2VPYB 2YNFA 4OV1A 2ZDPA 3RAMA 4C8LA 2PA3A 4USTA 2ZUAA 3RBEA 2K06A 4WFNQ 4TYBA 3G96A 1T9TA 4OI2A 1UVKA 1HHTP 3S7RA 3IAS9 5L8RC 2WBRA 5KFZA 2E1AA 1I51B 4FXVA 1UFWA 2MLXA 3UW1A 4TU8A 1VBXA 3ENWA 3DDIA 3W8PA 1RHKB 4WE1B 4F02A 3Q8RB 3UWTA 1WHXA 4JI0J 1RU1A 4FXDA 3BBFA 2W2OP 2W25A 5IC6B 1GT8A 2FLLA 4YUDA 1JJHA 4HT7A 4LF8F 3THVA 4DR7F 2YKQA 5EDWA 1RAJA 1RE1B 3PZPA 1JXVA 1RADB 1WDDA 1FVSA 3I32A 3X1LB 1IBLJ 1GMUA 5L1IA 1URNA 5A8RB 3OPKA 3NGSA 1ICEB 3KLGA 3BGUA 1UETA 2ZH9A 3M8QB 4M5DA 4FVCA 2RRAA 3DGPA 4OJHA 2KHDA 3ZZ0A 2B43A 5D4PA 5KG6A 1PSDA 3TVYA 3AFGA 1TKXB 3TUIC 4CT8A 3TQ1A 4HT5A 3W5YA 1LWEB 3CCZA 3FKBA 1SUQA 1SH2A 4WP8A 3FEYB 4C11A 3PV8A 3RR8A 3C6UA 2XMVA 5SZTA 4Y2IA 2GVDA 2YVSA 4USHA 3BSCA 3UDVA 2MZQA 2GAGC 2HZCA 2VPWB 3PW0A 4ZCIA 1CJTB 1VRUB 4WE1A 1D9DA 3KDOA 4LF5F 4J9QA 4PWDB 2G0JA 3M2VB 5KFCA 3MAAB 4CO4A 3RB3A 3R97A 4QWBA 1S1UB 3J81j 2ZHBA 1X60A 1RWMB 3M7VA 4MIWA 2VA3A 4PQUA 2LEPA 2E5GA 4F4ZA 4A8SA 4NLXA 1WF0A 2CQIA 2MJUA 1C4AA 4ZIWA 1U2CA 1RLDA 2BX6A 1RJJA 3L7OA 4NCGB 4I67A 1FX4A 1A0OB 2OPQA 4JI8F 3THTA 1TL3B 1SL0A 1N6QB 2BE9B 2UVRA 2E9ZA 4EZ6A 3TVKA 1EQMA 4LF7J 1J5OB 3K8VA 5D8HB 3FSYA 4WP9A 4B9TA 5G0RA 4L74A 1WC6A 3HHKA 2N4DA 3HSZA 1YG0A 1YRTA 2DCLA 3D0HE 2FY8A 2YX1A 3NCRA 5CYQA 5C5JA 3EYZA 4I2PA 4UF4A 1NJXA 2DR8A 1RWXB 2HG4A 3H2LA 2ZBCA 4LVOP 5D0EA 5FLXU 4H4MA 3SV4A 3OT9A 3GIKA 1HBNA 1T02A 1XMBA 1KS2A 4EEYA 2FUG9 3IR6B 3MWBA 2O3DA 1Q78A 1XMQJ 3JTPA 4K4TA 5K8PA 3QSIA 3OTOJ 2Z2ZA 2DNZA 4YB5A 2GVZB 2DCUB 4L3NA 3PACA 4ZCLA 5DRKA 4X66J 2AEMA 3ELHA 1LQ9A 5K14A 1RTIA 3HHLD 5B08A 1U1OA 2HVIA 2DO0A 1JKHA 1PBAA 2K2PA 4O44A 4U7UK 4DR6J 2UUAJ 1ZZFA 1YJUA 3TRGA 4AQYJ 4FZVA 1LK5A 1OYDA 3GIJA 2C2EA 5K8MA 2HNZB 4P2XA 5RUBA 4ZVGA 3C16A 1CVJA 5ADZA 1OO0B 4OX6A 2FJXA 4B9MA 4F26A 1IUJA 3Q22A 3O8WA 1BGXT 3GSDA 3KLIB 3NS5A 5FJ4A 1S97A 1X4HA 4P73A 2OD4A 3MR3A 4OHVA 2DGXA 2VFUA 4ZLNA 4NLYA 1XNQF 2QEXS 3GR0A 3D7SB 1KVJA 3BZQA 2QZ8A 4P10A 3HVRA 1K73T 3CCES 3BSNA 1VBZA 3R7SB 2Q6CA 1WEXA 3GYGA 2AYEA 4NI2A 1AZSA 5IM0B 4HH0A 3CCMS 4I64A 4LRBA 3QZ7A 2C2RA 3CDAA 2QTWA 3BO3A 1Y11A 3C6TA 1GQEA 2OGUA 2JEGA 1NU4A 1RT1B 2V5HG 1HYSB 4C8ZA 1K0TA 2D3UA 2CVEA 2RILA 3GSIA 3M1VA 1RISA 3VGTA 4F4AA 4ED8A 4Q8FA 4GKJF 4TXSA 3ET6A 5F8HA 3C2PA 3MGJA 5F8JA 2B6AB 3Q89A 4L75A 3KJVB 1U4BA 3BB5A 1YTYA 1ZAXA 3KLEA 4KFBB 1BHNA 2GNKA 4QCLA 4WFYA 3CD7A 5GMKa 2OH2A 4P7VA 5IT9U 1GMVA 3ZZPA 5GAHU 1VQ9S 4O4GB 1YVFA 2YKMB 1G7CB 2Y8YA 1C2PA 1S1VB 2N3OA 1NSAA 5HATA 4W4MA 4DG1A 2XS5A 1RQ0A 3DDNA 3LP1B 4GC6A 1X4CA 1NH7A 3BSAA 2DXEA 3ETMA 3KK3B 2OEJA 3UI3A 1T03A 3DU6A 2OPSB 3FEXB 2FC8A 4OYIA 3CD0A 4QWEA 2VF3A 3C15B 2ZHAA 4DV0F 2LECA 1VQMS 3RB4A 5ETVA 1MN9A 2ERRA 1SBRA 3B6BA 2MKYA 2XO7A 2G0CA 1Y5IB 5B0AA 4PUOB 1BWEA 3CGIA 3GYNA 2FJAB 2HVDA 3CJ4A 4I6WA 4LF2A 4MIAA 1HHQA 4ID5A 1HWLA 2VKRA 1SIWB 3B78A 4I1TA 4ANDA 5HQMA 3TAMA 2KG0A 3DDKA 1KD1T 1MMNA 3HXMA 4H4KC 3PHEA 4ED5A 2JHEA 1Q53A 2X1GA 3ZZZA 4OYBA 2YH1A 1DLOB 4QOTA 4A8OA 3KG1A 3W8GA 1ZPWX 1IBKF 3DOMA 3W5XA 1FXDA 1TAQA 3AJ2A 1DBDA 1UUJA 3HDSA 1PC5A 1RWVB 2PMZD 4USWA 4C0OC 3WX4A 2F40A 4DPYA 1NKBA 1S7IA 4USVA 2OKQA 4DN0A 1VQOS 2ZWPA 4PEOA 4DU7A 1NDLA 3QWPA 4C2MA 2RQCA 1FJCA 1JLQB 2RB7A 2YY3A 3P6YC 3EICA 3HD1A 4DL7A 2XCAA 2IRYA 2VG6A 2MJNA 3GMGA 3CCQS 1CC8A 1Y0HA 2JLGA 3Q24A 2FDNA 2HRYA 2BKOA 4LSLB 1SXLA 3LP0A 3T9ZA 4FYYB 1HPZB 2HZAA 5CD4H 4FS2A 1YJWS 1UWBA 2C3MA 4KIAA 2KDOA 1KKHA 3HFVA 5C42B 5AXLA 4OZJA 4DV6J 1XTZA 3PX6A 2UUBJ 4Q8EA 3MUVP 2QLFB 1RWUA 2B5JA 2P2CB 4PYDA 4EBDA 2Y1RI 2R8JA 3JS9A 3NBPB 4KHMA 1XERA 1WELA 2IVFB 1E6YB 4JI1F 3MMBA 1TQLA 2NREA 2JRSA 2K7KA 4ZDNA 5L39A 4N5SA 3MMCB 2HNYB 1Y10A 4GVBB 2EG1A 3K58A 1NUEA 3CIZA 2C2ZB 1RI7A 1VCTA 3AAWB 4DQIA 3QMQA 3D6TB 3TEGA 2D3ZA 3A3OB 2GJFA 2GQ2A 2ZJRQ 2XMKA 3T5JA 5KFOA 3EVMA 1NSQA 4OIXA 4DLEA 2N3LA 2WAQD 2B0GA 3UNYA 2AW0A 4YMEA 2P5VA 5C25A 1F2GA 2MZ1A 2KU7A 2RHQB 4PR6A 2DKOB 2RQMA 2KG1A 4J90A 1HKAA 4PQAA 5BXIA 1PGZA 2I1RA 2HHWA 5EX0A 3H5XA 3GJQB 5E2QA 2X1AA 1TL5A 1U7LA 1JKHB 4I4BA 2VFRA 4Y28C 4OI0A 3GFYA 4URQU 3TA2A 5AE2A 1TKXA 3KUGA 2XLJA 1N48A 2AJ1A 3RB0A 4MYTA 1PJ7A 2MHEA 3M6VA 4K5RA 4LRCA 2WB4A 4P75A 1EAYC 2KI2A 3V6KA 4H4OA 2QJ3A 3K57A 3UN3A 3FJ2A 5A0YA 3QLHB 4TYAA 2OI2A 2KJWA 1LW0B 4P71A 2B4OA 2BJEA 5KT3A 3SDEA 2GIFA 1FKPA 2OFHX 4IFVA 2VBXA 2OUGA 4OL8A 2G4BA 2OPPB 3K8WA 1CJUA 3H40A 3M30B 2EFOA 1X4DA 2M3DA 4I0WA 5B0EA 2FHJA 2A1BA 1G4CA 2JOQA 3NRBA 4A48A 4K4YA 2YNGB 4TU7A 3QJJA 3AY0A 2XTCA 3DRSB 2XMJA 3FCWA 1C0UB 3F41A 5L38A 3IO1A 5LT5A 5HLFA 2FLNA 5CH7B 2WTFA 1MROA 2DK2A 3TVZA 4K0KF 1BY9A 3G6XA 1M1KT 1BMQB 3IP0A 2QL5B 2RS2A 1U49A 4B3MF 3LH2S 5C24A 4MTPA 2YKNA 4RNOA 1APSA 5T14A 3CTRA 2HHHF 1VI7A 1F3FA 2JC1A 3KJVA 2QIFA 5HSPA 5KG3A 4X4NA 1FRXA 2MGZA 3NKYA 1HBNB 1WHYA 4LQ9A 3DLEB 3OFFA 5M2RA 4Q2MA 1SKSA 2B9WA 2RRBA 4NLVA 5E3AA 5DM7Q 3QRRA 2NSCA 4PQUB 2G2OA 3WIVA 1RK8A 2GVZA 4NLQA 2CG8A 2JFKA 2XSJB 3OTCA 3PTWA 4E8UA 4DV7F 1N34F 4WTOB 4YY3J 5SUHA 4YQWA 1RHUB 2DXFA 3V81B 1XBWA 4L3KA 1VJWA 4X2BA 3OL6A 3DRRA 3D9BA 4A8WA 5KFGA 1L5UA 2VD3A 4ZA1A 3HP6A 4B3OB 1HQUA 1QE1B 1X4EA 1Z4UA 3FCVA 3K5PA 2JVOA 2K1RA 4ECSA 3VAHA 3M2UB 2R7XA 4BWMA 1SC4B 4NLRA 3D54A 4UT4A 4UQGA 1FI4A 1UWAA 2WRMA 3N5BA 3G71S 2UXDF 2YWKA 4HL9A 5KAKA 4PZVA 3IMQJ 2QRRA 2AJ0A 3D2WA 1LWXA 2CJYB 3KDNA 1QAJA 2BMBA 3O44A 2MKIA 3CE8A 1U24A 2C2MB 1SI9A 1T3NA 2HVZA 2GVDB 2RD5C 2E5IA 2LYVA 3D0IE 2MHNA 3LOUA 5J2QB 3TJAA 2ZH4A 2IRUA 4FF4A 3TR5A 2RU3A 1K47A 4F25A 4DCPB 1S9FA 2FHMA 1DHMA 5HN0A 1DFDA 1J5EF 4ANCA 5KFFA 1X0PA 4DR2J 1C0TB 3HT0A 1SJ1A 1WJ9A 3M2VA 4KT0C 3PY8A 3CMAS 1YDLA 4PWDA 3IWLA 1U6ZA 3K7RA 4ZS6A 2ZE2B 3KLFB 3R2CJ 4KB7A 2AHOB 1RT1A 3DLHA 3KMQA 4O3OA 1HYSA 1UFLA 4ZVQB 2C3PA 2H3EB 4ED1A 4K4XA 1EETA 2B4UA 3FFIB 4QIGA 3CJKB 1K1QA 2CJKA 1VLOA 1X9SA 2V8HA 1WC3A 1NK4A 1QJHA 3ETOA 1FFWB 1Z1ZA 2JEFA 4DOZA 2IJRA 1G3OA 3BV8A 4ZPWR 3RRKA 3SYZA 3CJ0A 4ZMMA 1I1GA 3DI6A 4KKOB 3MM8A 1GX6A 3ZNJ1 1RYSA 4WP3A 3K89A 1X4FA 2Y1IA 4MKYA 4FNHA 2F4VF 5A8KA 2MZTA 4HVZA 2ATCB 4YHHJ 3N0VA 1IM6A 4ELVA 2F8HA 1O51A 1GEHA 3K59A 7FDRA 5CYMA 1SIZA 3I0SB 3GV5B 1FT8A 4B9VA 2L08A 3FCHA 1RWOB 1W25A 4URSA 2X7IA 1EARA 1N0VC 4RBTA 1W2BR 4OI4A 4Q45A 2V2ZA 1Q82T 5B09A 2MLZA 3E01B 3SCKE 2W9BA 3TUJC 1QSYA 4IG3A 1F5CA 1AFIA 3UE2A 2AZ1A 4R0EA 5EWFA 1REGX 1GNKA 1Y5NB 3B8HA 4OLOA 4OI1A 2FJVA 3CIMA 3G87A 5CABA 4OQJA 3OR2B 5H9FJ 1KWMA 4TU9A 2ZC3A 3AOCA 2ZH8A 4CLWA 3OV7A 1N32J 4XIUA 2QL9B 3MFIA 3MCSA 4GKJJ 1EQ0A 4YS2A 3DRPA 5DZ6A 4LF9J 1WI8A 1DTQB 1RT3A 1S12A 2XYGB 1H2VZ 3M8YA 1IR0A 1U2RA 1CSJA 1WG1A 2NSBA 2Z58B 3UD5A 1NNDA 1T94A 5IQ6A 1CS4B 1JJ2R 1I94J 2EKNA 4DL3A 2JWNA 5IV3A 1FWPA 4X66F 1NXIA 4J9UE 3ILJA 5H9EK 1R6VA 2XLKA 5H9EJ 4RPFA 4DR1F 1PO6A 1NZAA 1QTMA 3G8QA 2LEAA 5J1PA 5A2QU 3PW5A 1R0AA 3I82A 2IBKA 4LFBF 4C8OA 2OELA 2D74B 2XQCA 4RUCA 4NLWA 4KH1B 2CNKB 4GVLA 4U96A 5IFMA 3CD6S 1TVRA 4X64F 2L3MA 3ZC4A 5J2NA 4FF2A 3AQPA 2BE2B 1X5SA 3W5ZA 3PFEA 1W7WA 2JFDA 1JLGB 2XY7A 2XZTB 3B4DA 3PHTA 2AD9A 4C0BA 4C48A 2MB0B 2VOOA 2ZHOA 1B64A 3ZZRA 1VR6A 3AH6A 4GRSA 2VKZG 4ZVUB 1O0PA 3IXQA 3H4DA 1NM2A 2LMIA 2XMTA 1PJ5A 2JDJA 3SEOA 8ATCB 4KYZA 1MW7A 5L1JA 2D1CA 1YJNS 3E51A 1SJ4P 1IN0A 2IRXA 1RCXB 3QPIA 5KFKA 2CQ3A 4DF4A 1UP1A 2CJ9A 4F36A 3NEKA 4MFBA 2QLXA 2V63A 4IYQA 4DQPA 1H74A 1RWKB 3LGMA 4MAKA 4LUBA 4KGVB 3PYFA 5LXYA 2R7TA 1UJ4A 2IM0A 1LW2B 3KUEA 1N0UA 4UOCA 4ZVPB 4A47A 5F8IA 1NHUA 3ILLA 1SUQB 2DGSA 2R4FA 4C11B 3MUMP 2V68A 3JTNA 3MEEA 4WIIA 3SQGB 2WHOA 2A3JA 3P5TL 2E44A 4N8OA 3AJDA 2ASJA 4A8MP 1F2HA 3SI8A 1SJRA 2HHTA 3VAIA 1JK9B 4F0KA 1S6UA 1VS3A 3DOKA 3M8RA 2JX2A 4KHRA 3WC0A 1DY3A 3R5JB 2UUCF 2M70A 4HTIA 3GG1A 4IRCA 4CO2A 3AQOA 2KT2A 4ZVEA 5DDOC 1S1UA 1R8CA 1UZHA 3BO4A 5FLXY 1NH8A 2GA7A 3MURP 2MSTA 1WOSA 1HNVB 3M2RA 3VAMA 1RXOB 4B17A 3M2UA 4OFZA 5A0YB 4CM2A 4DX5A 3H5UA 5A8WB 4DV0J 1WC1A 1NEEA 2QLJB 4AQYF 2UUCJ 2AWZA 1S0VA 5HP1B 5M2PA 1JLAA 1S6OA 2FB0A 2CA9A 2F7VA 2PE8A 2ZNYA 2DPIA 3KK2B 1NK7A 3GIRA 1PYSB 2H9ZA 1JLQA 4NEZA 5L1KA 4YOEA 2AIRB 2BUNA 3T1AA 3FRYA 1RT5B 1S1WB 3MM5B 4KH0B 5CZXA 1X5PA 1YQHA 1FDNA 4I2PB 3W60A 1EKRA 5HVHA 4FXWA 5FDLB 1N88A 4N41A 2HHUA 2PEHA 5KFNA 1BQNA 3K5MA 3J81U 2IAJB 1M5HA 2VDIA 2BJ1A 3MR7A 4ETXA 5D6GA 4I68A 4DSKA 1S6PB 4CYUA 3SFUA 3I9V9 2YKNB 1H3DA 4OJ3A 1LWCB 4J9PA 1FE4A 2HWTA 1N56A 5DDQC 3AODA 5EX3A 5HROB 2V8DA 1LKZA 4E0DA 2N7YA 1V6HA 1RT6B 2G2ZA 2ZD1A 1RAGB 3MMCA 3PRVA 2V69A 4KV8B 1JLFB 2F1FA 4TQRA 2HNZA 2ACYA 1C4CA 3M8SA 4M5GA 2Y0BB 2YWWA 2XTJP 1GX5A 3TEHB 2MQLA 5B0FA 1S1TB 2X51A 4WJBA 1QVFR 1YRUA 2BM0A 2B3TB 1YGYA 5EHHA 1UVIA 3DRRB 1U1RA 3N6LA 1IR2A 1HMVB 4M63A 2CQHA 4K50A 2MZRA 4CLSA 5HL7Q 4B3OA 3V4IA 4UUXA 4OX9F 3MEGA 1RYRA 3G9CA 4F50A 1RP5A 3MM6A 3HCXA 2HQ3A 1U1KA 1K44A 2KKHA 5D4LA 3OTOF 3GONA 4QU6A 4QPTA 3N28A 3WQPA 4CO5A 2DGUA 2FHKA 4EU0A 3BQ2A 2DRAA 1NPPA 4NMLA 3H2UB 3MCMA 1VRTA 4CZCA 1Q7LB 5IT4A 1HWJA 2E7XA 2HBQB 2VASA 4HEA9 3ISNC 1FX2A 1M5KC 3OTEA 2HBRB 3DRPB 4DV4J 1YJVA 5IOLA 1DQ8A 3KKFA 1SKWA 2J6SA 4B3TF 2YNIA 1MN7A 4QBUA 4CO0A 2DISA 2ZUGA 4IFVB 1GXTA 3BKFA 4N47A 4DJBA 2NLWA 1P27B 3H98A 1ZTWA 2WBMA 3ENQA 5K8OA 1OJ4A 2RKIA 1JLCB 3FGVA 3KLHA 3OJSA 1S1VA 3K5LA 1CBKA 1D9FA 2JEIA 2Y8WA 2YX4A 1TUVA 1TVRB 4P2SA 3CJKA 2CJQA 4C3MA 5LMNJ 3IWXA 5HLFB 2QMUB 4O4RA 4IFYA 2M8DB 5JVHQ 2QN6B 2VIHA 1Y4ZB 3QBCA 5HO4A 1KVIA 2MQMA 3W62A 4K2JA 2CJAA 3I6PA 3UCZP 2V1TA 1JLBB 3MPDA 4K4VA 4WXWA 3LUYA 4L73A 4BWJA 2C42A 5EUHA 5A8KB 3JSMA 3M6WA 3PKMA 1KFSA 3G6YA 1OPZA 1XJWB 2ZH2A 4JV5F 1EKSA 2XI3A 1GH8A 1MNEA 2RE1A 1S79A 2ZM6F 4X64J 1ZM3A 3R5BA 1UKUA 1OQ6A 2RIJA 1ROFA 5IT0A 3FC9A 2ASLA 2Z57B 1NK5A 4J9RA 3A8KA 1HQEB 2G1HA 4A8YA 2XI2A 2OJ3A 2CJBA 3S6EA 3E01A 3HHDA 1ZPVA 3FBFA 3MM7B 1T3OA 2LVWA 1VQSA 4KSEB 4B9LA 1MWZA 2HFZA 2XG8A 4IG3B 5KFXA 2L41A 2VG7A 4JV5J 2Q3PA 4ZVRB 1S7HA 4N7TA 1I94F 1GTEA 1WG5A 3I31A 3RTVA 3HVTA 4P74A 2LDIA 4P2MA 5D3GB 3THPA 1XNRJ 1HD0A 2DHAA 3B82A 3W64A 1ZBTA 3QIDA 1H6KX 4DPOA 4LFCF 3HLUA 4U95A 2WONA 3D1HA 3IBFB 2VG6B 3AJ1A 3D0GE 2GIQA 3D3CJ 4CO1A 3C8YA 1XN9A 1O6XA 1S57A 3MUTP 3KHGA 1RKJA 4NXNJ 1MMDA 1RT3B 1RACB 5CQGA 4ZCKA 3H25A 1X4AA 3JB9k 3B54A 1WF2A 3F56A 3NMAA 4JV1A 3N6NA 2B56A 3D5MA 5E3PA 3NMRA 4A4JA 4BBYA 4DS5A 2XZDB 5F9NA 5KFDA 5DQGA 1SC1B 1CJKA 3HT3A 3UCGA 1TL7B 4DPTA 1X5TA 1S72S 2RVJA 2NYIA 3BF4A 4LF7F 4KPYA 2EFPA 2NCKL 5B0CA 3AB2B 4M5HA 4ALZA 5A76A 3CC7S 2DGWA 2MQ8A 4ED0A 1JLAB 2DXDA 2BANB 2O01C 2IYGA 5J2NB 4OHXA 3U1LA 5CAAA 3G86A 3KFWX 1FNOA 3TYTA 4AL7A 1F6TA 4LF4J 4LVNP 2ZE2A 4R0JA 4E2FB 2CKWA 1RT5A 1S1WA 4NRTA 1Y7PA 2XHWA 5D4NA 5DLGA 4YP3A 3R5AA 2PO4A 3AB4B 1VHIA 2UVUA 3CCVS 2VHGA 4ED2A 1SL2A 5CZVA 3TANA 4LRFA 4UTGA 1GFWB 2F3JA 4RW9B 1AUDA 4LF5J 2R3VA 2YXLA 3DLKA 3MAHA 1DURA 3MCOA 4OYZA 5DDPC 2EK1A 1IBMF 5DGBA 5KFBA 4WK3A 2F9DA 3AWRA 2YPZA 3ICLA 3TZZA 3BSOA 4XDDA 3MDFA 1HNIA 3AD7C 2I5JA 1LWCA 3BBBA 3KWMA 4IH7A 1RUSA 1TELA 3FQLA 2RU9A 2UV8A 1RZMA 3IR5B 1MWQA 2WCXA 2QA2A 3TWZA 3DRYA 2ALYB 3IM8A 3EGZA 3GFZA 2QG9B 3T1HJ 2DNOA 4CQ1A 3R27A 2OAUA 4NLTA 2F5GA 4HDHA 4KQZA 1JLFA 4U8VA 1WUUA 4D3HA 4K59A 5K5MA 4JI2F 4IDKB 1TAUA 2CNOB 2IVMA 4DR3F 3FZ2A 2OEKA 1R0BG 1KOHA 3ZTQA 2EEYA 2DGVA 1TKTB 4QWAA 2HNDA 2J0QD 4LF8J 4RW6B 2OSRA 1S1XB 3BKUA 4ED3A 4DX8H 1MU2A 2FD2A 3J7YI 1JNZB 2OSQA 3P45B 1IKWA 1X4BA 2C3YA 2RMLA 2J0XA 2NXNA 3P8BB 2BOPA 3BR8A 2IDLA 1RA6A 2CQ1A 3TZXA 2HWIA 2B4VA 4DUTA 5J2PA 4ZITA 2G13A 3CDWA 1CS4A 1WHWA 2FZKB 3A3PB 4HI1A 2GGPA 4QIFA 1KOOA 4U6PA 1N5YB 2HMIA 1S0MA 1IQTA 2HFNA 3OFGA 4ES1A 3I5AA 3OHBA 3KK1A 4F4XA 1TKDA 2DNGA 4ECQA 2EFVA 2JEJA 4LMZA 2GO9A 1RTHA 3QO9A 3SXLA 3TAPA 5E3RA 3OUYB 3MM5A 3QGGA 3IFEA 1FKOB 2E66A 1FA0A 1SQEA 3O1LA 4OZLA 5BR8F 3KOAA 4A8KA 1S76D 3OL9A 3UR0A 1FE0A 1CEZA 2VFVA 2W2QP 2V8GA 3WBZA 1PYTA 4DUZJ 1F9FA 2BE2A 1FERA 2KJVA 4IOCQ 1FXLA 1B7FA 2CQDA 1B0PA 1FFGB 1W26A 2CWXA 2MZJA 1FWKA 1N5TA 5DG7A 4M94A 3I5CA 5DJBA 4XPCA 5KFLA 2DEJA 3ISND 4CRJA 1AFJA 1S4EA 1IJEB 3GWCA 3ZTOA 1NJWA 1D0EA 4DV2J 3TAQA 1AT1B 2HFOA 2LXUA 4HKQA 5AJ3J 5KOWA 4Y2CA 2KVQE 1TKZB 2LKZA 3K17A 5KG4A 1MWYA 2OD6A 3MPYA 1TUWA 2IBOA 1HNXF 2HHPA 3VVTA 2IA6A 4DWIA 2AP6A 4KPCA 2FVPA 3UNGC 1RT2A 4TY8B 3QATA 3UD4P 5KFPA 5IWAJ 5IC4B 4UOGA 1FRMA 4QIEA 2DY1A 1H72C 1EZZB 2YNFB 2C22A 1V5IB 5KT6A 2KH9A 1FDBA 4CLLA 3Q8YA 4ZP6A 3CCLS 2CPFA 2W24A 4NA2A 4C0HA 3I55S 2CPEA 3R5DA 2A0FB 2YWEA 3OVBA 1HQEA 4J9NA 3H8YA 2MMYA 2MKHA 5E3CA 4M5LA 4M1KA 5KTQA 4X4VA 2J7WA 4IUFA 2HQCA 1VJQA 4C8KA 3HHEA 1NMEB 1R3NA 3BYRA 4MKVA 4O44B 4RNHA 4NLPA 2M0GB 2B7CB 4OHZA 2ZNZA 1NLKL 3GB0A 4ITSA 3ZZUA 1KHWA 3GYXB 4IH5A 4DHVA 1LEOA 2XZWA 5KFRA 3KLGB 1MSWD 2BJ8A 2CPHA 2CUYA 4LBIA 1H73A 3SSQA 3CJRA 3PYEA 5KFSA 4C3KA 4TQSA 3LWMA 4NZ6A 3DNCA 2MKKA 2V1SA 1OY9A 2O66A 5LMNF 1FO1A 4USUA 2KZZA 4DCOB 2PD1A 2E9RX 3LGNA 1NPKA 4PG5A 4KKOA 4A46A 4DBQA 6FD1A 3OR1B 3QZ8A 1T8EA 1YZ7A 1IM4A 2CZVC 3B4MA 1NZ8A 1TL7A 2ACMA 1D3WA 3DN9A 4I7FA 4X84A 1HBMB 3TP2A 1VQPS 3QT5A 1V5VA 2CQCA 1FTRA 4HTJA 4OZ3A 4TKTA 2CVIA 4RBVA 4A8QA 3C14B 2AYGA 3PRBA 1TK8A 1GAOA 2KFZA 1I5OB 3DCAA 3RJMB 2OLWA 1TMMA 1PG5B 2A2DA 4DR1J 2HQGA 1WSRA 2XB2D 4WF9Q 2ZBRA 5ETPA 1VC6A 2ZZTA 1K1SA 5H1SV 3T5HA 1IBCB 1Y00A 2VL1A 4DL6A 4OYXA 2KYXA 4OLPA 3FEZA 1SVDA 4USKA 3S1TA 1YLXA 1VGYA 3A12A 3VQSA 5GAHI 2VJUA 3RBZA 4RJVA 4KFBA 5HQLA 1KFDA 4Q5VA 3TOQA 1RT6A 4WU3A 2ZD1B 2HGLA 4RL1A 1RTZA 3PR4A 1IBKJ 3BDPA 1M5VC 1FFSB 3TJ8A 2W01A 4PG7A 4YB7A 2GHPA 1AYEA 4NEYA 5K9FA 4J9SA 1NJZA 2EC2A 1K8AT 4AL5A 2EBGA 5KG0A 2DNHA 4RR5A 1L3TA 1X8DA 1FF2A 1KDNA 1REVB 4DUYF 3CMES 3KK3A 4C98A 1ZA2B 1KQSR 3NNHA 2M4MA 3PIPQ 2EW9A 3RUBL 2OPSA 1X31C 2ZWOA 3C6UB 4OZ2A 2PC6A 4ZIVA 3ENVA 5DETA 4Q43A 4FF3A 1FXRA 4NL5A 4K4UA 1H7WA 3GV7B 2V4JA 2ZH7A 3HSDA 4ETZA 3CC2S 1PCAA 3VZIA 3JAMU 2UXCF 2VOPA 4FKYA 4FP9A 3TX8A 4CO3A 3MFHA 3HM9A 3EPGA 2CADA 3CVKA 2RNEA 3BKTA 2HAIA 1KLNA 4JP8A 1VIOA 4KGZB 3R6LB 5KFYA 4HR2A 4EGLA 4ECXA 4Z7YA 2GHWA 3H20A 2HFUA 4IR9A 1WC5A 3M9NB 5KFAA 3R8YA 4DR2F 5I42B 3CULA 3NP5A 1XNRF 4DFKA 4B3RF 1H2TZ 4MT1A 3SBMA 1HI1A 5ETTA 2IMWP 2UXCJ 1VBYA 3Q8QB 4F4YA 1FD2A 3T19A 4G1IA 1WTBA 1XMOF 5C2GA 2VC0A 4OYPA 4QW9A 3BN7A 1X9MA 1VQ5S 4CLZA 4ZPBA 2HHHJ 5G0RB 3QJLA 1SJFA 4WTYA 5KFMA 1F1BB 3OUYA 1HIYA 3SQOP 3MCNA 1WC0A 4CM0A 4HH1A 3HVAA 5IXUA 1DQAA 1SKUB 2W1BA 4C97A 2Z0GA 2A2CA 5DQIA 2GMJA 5ITHA 2E7VA 1RT4B 3DLGB 3LALA 4G1PA 4NI2B 4GO7X 2NPIA 4QIWD 4ILLA 3BGLA 2B9YA 1PIEA 2X1FA 2E5HA 1HPZA 2LQJA 2DO4A 2WVEA 3CDBA 3MMJA 4J7CA 2DR9A 1Q4RA 3DXSX 2H51B 3QGHA 3SFGA 4H4KA 2IJNA 4PXCA 5C42A 3DMJB 5I3QA 4DQRA 4LBHA 3HD2A 1EP4A 1JXEA 5DS7A 4WYLA 1LFPA 1M1HA 5K14B 2K8GA 3F0NA 3EZ5A 1Q86T 4Y34A 2BEFA 3EUNA 4HACA 2HWHA 3ET6B 1NKCA 1LXNA 2K3KA 1OIAA 2K3IA 4DFMA 2HIYA 4CH0S 1KBRA 4FDFA 1QDUB 3NG8A 2CG4A 1B3TA 2UVWA 3CJQA 3OSPA 3PO5A 3V6HA 2IPOB 2UVVA 1HBUA 4Y00A 3GCWP 3M2RB 4DFJA 1NSKL 3GTYX 1I3OB 2R7WA 4ATNA 2L9NA 4DSJA 1QAXA 5JXSA 4DV6F 2UUBF 2W2PP 2OTJS 3RG6A 1H2UX 5KFVA 4J9OA 2HK2A 4L6V3 1OQ3A 3K5OA 2LFVA 3QGPA 1GXUA 1J2VA 1S1XA 5KFIA 3V4MA 1LNQA 2C2KB 2GFFA 3OTBA 4NWBA 4KE5A 4K4ZA 4JUZA 2F4VJ 1RHMB 1WSVA 3VCDA 4EFAC 4X65F 1HI8A 2EG2A 3WC2A 4MKBA 2R8HA 3CMQA 3Q83A 4JI4J 1EIYB 2Z2YB 2SXLA 3J80Y 2IAJA 3C6TB 4LIRA 1N34J 1UVJA 1B0VA 1DLOA 3MEKA 2E1CA 2D7SA 1C1CB 4IKAA 2CPDA 3DOMB 3FQKA 4WBFA 3CJTA 1Q5VA 2IA0A 3MAQA 3W2WB 4EI2A 5F9LA 1RT7A 4IQXA 1NAQA 1WORA 3D68A 4CP5A 1VQ6S 2CAJA 3CJSA 3HHLA 3JSYA 4ZVSB 1BWVA 3R5GA 3VALA 3BGFA 4ZVHA 2QA4S 2BANA 4JI3F 4NCAA 2MY7A 2XBPA 3NGKA 3M8PB 1XQIA 1WEYA 4RW8A 4J9LA 1GMWD 2D68A 2BBEA 2ROGA 3GP9A 4U67Q 3VAKA 1ELOA 2EKYA 3OW2R 8AT1B 2BACA 2J8AA 3MOZA 5B7WA 1VC5A 3NXZA 4JI2J 3OLBA 2HYIB 3Q8VA 2OTLS 1S59A 1R27B 1DAXA 5DG9A 2F63A 4PCQA 5D77A 3I4PA 4RW9A 4F04B 3Q2TC 3JSBA 3JXOA 2ZZMA 1FKAF 3LF0A 3VWSA 2YTCA 4NX9A 1PAEX 2HFVA 1WOPA 4PUOA 4RW7B 1RLCL 2DIVA 3QT8A 1VK8A 4B3SJ 1RTIB 3MM6B 1ZM4A 4LF4F 1UZDA 1CJVB 2RF2B 1E6YA 3MMBB 5HVFA 4MH8A 4EK2A 2XNRA 4ZJOA 2KB2A 1SJ3P 1RCOB 4LRAA 3OFEA 2U2FA 1VQ8S 1LWFA 3NY0A 5IV4A 4X4OA 1UW9A 1ZZNA 3RW6A 2BABA 2W2MP 2YNHA 4DFPA 2AKWB 1U8WA 1HR0J 2QA4G 2OMLA 3MEDA 1S0OA 2DNQA 5E41A 5A2QY 3HULA 2NUHA 3E2EA 2HAFA 4ECUA 1UA1A 2RRNA 3VVUA 5LSRA 4YHHF 1Q7YT 5GMEA 3LA0A 3EGNA 3L7UA 2KVIA 4AFFA 1U1PA 5MLCV 2QE5A 2KTQA 1HQUB 1QE1A 3DM2A 3GIIA 2J6UA 2OPRA 1GTHA 2DITA 2YWHA 3CB4A 2Q6BA 3UN2A 3HVWA 3NAIA 3OXFA 2PIIA 5AJ3F 5LSLA 2IM1A 3T9NA 5I3UB 1WHVA 2PGCA 1U1MA 3MMAA 4V19J 3IAM9 5GADU 1Y5LB 1NDPA 2OO4A 4ECVA 2AV5A 3R1HA 2B5JB 3LWLA 2JL9A 3HPOA 1QD1A 4JI8J 3WX8A 1RBOB 3L09A 3QLHA 5DZ7A 4ECWA 2VQFF 1U26A 2VQEJ 4ZPCA 3IRXA 1VOMA 3ZTRA 3PCOB 1YKWA 3A4TA 5BR8J 3AX3A 3AX2A 5GMDA 2U1AA 3CCJS 2AU0A 2CWKA 2KXFA 3KLFA 2LXFA 2W7AA 4HHJA 4KO0B 2NXUA 4Q0BB 2LU2A 3M30A 4JI0F 3FK4A 2FY1A 3RZAA 4O3RA 4V1Ak 2CQ2A 3ZZYA 2FC9A 4AXIA 4CLKA 8RUCA 4WKYA 4DL2A 5BYQA 4WCEQ 2A18A 3NGRA 1VQ7S 2XSFA 1N6QA 3H4BA 1UPMB 3KJNB 2P8IA 1HNWJ 3HK2A 1UCNA 2FJBB 5CD4A 1KSPA 1AXQA 1HA1A 2F9JA 4K4WA 4YDXA 2Y9HA 3GE9A 2BW7A 4OV6A 1X4GA 3EXCX 3I87A 3P96A 5ETMA 4QW8A 2HVEA 1NDKA 1MG7A 3EMTA 4DI6A 1T0TV 3J7YU 1OY6A 2E1RA 3NWGA 4LSNB 4WFXA 2AJQA 4MK9A 1M0SA 2DRBA 1N5QA 2F4FA 3C66A 4ID8A 2VODA 1SV5A 3EVOA 2R7OA 2NZ4A 2V4JB 2QA1A 3MECA 2R7SA 3T1HF 2UU9J 4L72B 2BYCA 2VG5B 2PA8D 3MPVA 1B99A 2XWYA 1YBTA 2Z8QA 3FZBA 3R7NB 4OX7A 3U1NA 3UN5A 3TZYA 5F8GA 3MR6A 4IR1A 2OPPA 2VQFJ 2GW8A 2IJFA 2IFXA 2KYZA 4KC5A 4G1QA 2R8IA 1KNZA 1HNZJ 2RT3A 4NMXA 4LREA 3FRZA 4MJKA 4ED4A 4FN5A 1LOUA 3VV2B 4JB8B 7AT1B 1RWWB 2XY6A 4QU7A 4D3GA 5KFHA 3RAXA 1FRJA 1CULA 2RSQA 2JVRA 3AXKA 4DPXA 3RW7A 2VA2A 3OR1A 4F2RA 4GMKA 4DQQA 3BM7A 1AROP 2Z30B 4MIBA 2ZH1A 5LSOA 3QAEA 4DUYJ 2V2VA 3FBCA 3EDRB 4ZPTR 3M32B 5D0RA 1TV6A 4DR5J 4F0MA 3T6BA 2A6MA 5HJXA 2ADCA 1JLEA 3ITHA 4WIQA 1R8BA 4XK8C 1T7PA 2DJWA 3M8ZA 2YKOA 1EP4B 1LK7A 1UEUA 2AX0A 5K20B 4DL5A 3RB6A 1NDCA 2IIHA 5KG2A 2YKPA 2WK4A 3V81A 4RW4A 1IKVB 1IKXB 5THWA 3ONQA 3IC1A 1M5SA 4ICLB 1M1GA 1HR0F 2PN6A 3P4UB 4JYAF 2IMOA 6AT1B 1F3VA 4XPEA 1Q8BA 1HI0P 1KN6A 2GMLA 4G65A 4ANEA 4NPOA 1WDTA 3KTQA 2QL7B 3GQCA 2JSXA 4TN2A 4NYOA 3PDNA 1R31A 3KMSA 2XEXA 2ZH6A 2HURA 4MYUA 5E7OB 2BKPA 2XO6A 2XC9A 2HMIB 4ILMA 5DO2A 2PFFB 3EZOA 3FUYA 1F9EB 2FVQA 4ELUA 4NLUA 1S77D 3HSGA 4B08A 2P9EA 4I6AA 2VJVA 1M90T 1FEEA 2V0NA 2UXBJ 5J2QA 1XMQF 4Z7CA 1HL6A 4Z2XA 4JI7F 5ETOA 4PG8A 4U7UD 3K2YA 2FJWA 4EBCA 5T41A 4ZLLA 2I0XA 4ZVOB 3EVWA 1BQMA 3LO3A 5ETQA 4RKUC 1ACMB 2XY5A 1T11A 5F8MA 1HARA 2CQ0A 2AJ4A 4O3SA 1P9YA 3CCWA 2WVFA 5E5NA 4DZDA 1RT7B 2YH0A 1FNXH 4TLQA 1QAIA 3TA1A 4M5NA 3ZZOA 5A6WA 1NB7A 3UR3C 3H0PA 2DGTA 2M52A 3PW7A 3OXLA 3OVAA 5DQHA 2WVCA 1KP6A 1CQNA 1UJ5A 5C24B 2JNJA 2WSFC 4M8LA 2MEWA 2DHHA 4YN3B 5LOQA 1HBOB 4NLSA 3EPIA 4CNZA 4ZJLA 5CYMB 1G6BA 3I0SA 2VZ9A 1NO8A 1FEHA 5JVGQ 3MAAA 1ZM9A 1BQNB 4B3TJ 1L3VA 4UZBA 4YY3F 3V6DA 2H54B 1VLYA 2O67A 1XR7A 4F3MA 3TA0A 5A6PA 3CSKA 2HHSA 1T9WA 2DH7A 5ETKA 1YRXA 3FBEA 2HRUA 2F65A 2KM8B 3EX7B 1XMOJ 2V67A 1CQMA 4HACB 1RTDB 2KL8A 4DR7J 1Q8KA 5HVGA 1N4LA 3N01A 2RQ4A 1RHRB 2B9EA 2J9EA 2FVRA 4I6YA 1F5BA 1VBKA 1QTNB 5DM6Q 1IWAA 2VPZB 1BE4A 4LR7A 4K4SA 1KQKA 3T5KA 4FYDA 4KV8A 1A9NB 2I8EA 1ZAWA 4OI6A 4MFBB 5IQQA 3WIUA 3TUPA 4NXMF 4OYMA 4CLFA 1Q5YA 3WZ0A 3HJFA 3W61A 4CI0B 4JI3J 1HWUA 4L76A 1H98A 1RTJA 2W4DA 3G82B 9ATCB 5IZHA 3A8EA 2OFGX 2JJ4D 4J9VA 3EDQB 4FS1A 2VBWA 4KGKA 1R43A 3QWUA 2E5LF 2QMWA 5GVQA 4LR8A 3QSYB 3KHLA 3Q23A 3ZFVA 3DM2B 1J27A 2NS1B 4RX6A 5CA5A 1F9HA 2XLIA 1GXLA 2CNNB 1CPZA 2XYHB 4BC9A 3DOKB 2H65B 2VG5A 4DPWA 4ZLJA 4R8UA 3PX0A 3D6HB 1JMTA 2FGCA 3CW2C 4X65J 2HFSA 2APOA 2ZOFA 3MTJA 3VAGA 1YWXA 5BYSA 2BQRA 2IC3B 4HDGA 5A8RA 4EBEA 2HW3A 1ZS6A 2ZFHA 3H90A 3ZO7A 3BREA 3BS9A 4I69A 3FBBA 4RWXA 5F3TA 3UVJA 7FD1A 3G8TA 2W8KA 4ED7A 2WVBA 2YQ3A 1XR6A 2JZ5A 2QT7A 2WW8A 3IBWA 4MK8A 1YJ7A 3FSXA 1OWXA 3U1MA 3W1YC 3U02A 1U1QA 3ZNUA 3N6MA 1U09A 3ZTPA 4NXNF 3SCLE 2M5YA 1KTVA 3FVYA 5AE1A 4CDIA 2H5IB 1FWLA 2RKIB 3HZEA 2E29A 4WPAA 2EI5A 1C1BA 5LJ5Y 5DG8A 4R5PA 1YI2S 4HLBA 3AX5A 2HLUA 4XO0A 5F3ZA 3G2XA 4IFYB 3IM9A 4NZ0A 1UA0A 4CLPA 2DNKA 4X4TA 1CG2A 4DZ6A 3JQKA 2ZBQA 3QYYA 1RGVA 2J7KA 2RUGA 3L9ZA 1ITPA 5LMUJ 3NS7B 3M1VB 2E1PA 1AW0A 2MY8A 5J1NA 1IKXA 1JNRB 1YX2A 1OS5A 1T05A 1HFEL 3GCXP 2HGNA 2QFJA 2A10A 2C1EB 2OPQB 3FMWA 3SCIE 2XGPA 2DPJA 1S9EA 1JIHA 3D67A 3GZ7A 4NA1A 3UFCX 2N7CA 3OJUA 3M9MB 3J7Z5 2ZJPQ 3MI7X 2W2NP 4C6AA 3TZWA 3QT7A 1TMJA 4TLRA 1DTQA 2AT1B 2X3DA 1ZETA 3R2DJ 1UVNA 2H5JB 3CDUA 3QGIA 3OD2A 3M6UA 3IBCB 3LP1A 5HP1A 2KRBA 2RS8A 1VYAA 2V9KA 2XYPB 3A13A 5ETLA 3SV3A 4ES2A 1SB6A 2OP5A 1Q81T 2R42A 2R7VA 5KT5A 2X1BA 4W92B 3GFHA 4BCAA 4QPXA 2HEKA 3Q8UA 5CXTA 2CXEA 5JJBA 3H59A 5ETRA 2UZAA 4IRDA 3DHWC 1E6VB 1X5OA 3NNAA 1U8SA 5CCMA 1KLMB 1S4FA 4NASA 2ZEJA 2E9TA 1WKLA 3DRXA 4NA3A 3O6QA 2IM3A 1JB0C 1N8RT 4CWBA 3MMAB 3POTA 2BM1A 1VQ4S 3IWNC 1RU2A 2BRKA 3DMJA 1P6TA 4E98A 5D0HA 3QFHA 4B3MJ 2V2KA 4BLGA 2MDAA 2Y1LB 2YQ1A 1JJCB 2B9XA 2G9OA 2M7SA 3T1YF 5D0GA 4CIOA 3R5CA 2ZVIA 3NGTA 1U1NA 1YBUA 2JH3A 3RRGA 3NCQA 4ED6A 1RAHB 3S01A 3CNQP 3HFKA 1UEKA 1T9UA 1TV6B 2J9DE 4H54A 5ETNA 4JBCA 3RYLA 3MPUB 4RZRA 3IGNA 3QQCD 2YWFA 3SSRA 1HBUB 1A7GE 2I2YA 2QGFB 2CYYA 5CYQB 1JLCA 2AMCB 2GC8A 5L9NA 3KLHB 2EC0A 3MHYA 3R6GB 3VAJA 1KC8T 2IYIA 4PPDA 1B0TA 3D28A 3QAUA 3OLAA 2CQPA 1IKVA 4M5KA 1LW2A 3W65A 1S1TA 1WNEA 2B8PA 1CC7A 2HQDA 4S0MA 3HHLC 4Q7AA 1ULRA 3BPDA 5AT1B 4DLGA 3HHNB 5LJ3Y 2GJ2A 4FYXB 4ES3A 3AD9C 3ILOA 1HLWA 2LU1A 3V4IB 3BGRA 3IN5A 3KG0A 1R8AA 4OJ1A 4PRFA 5HI7A 5B0GA 1Q8LA 3NBPA 4YB6A 2GQCA 3W9HA 3OXGA 2FJEB 4CT9A 3PW2A 1DARA 1U25A 4LSNA 2BJDA 4B9SA 1OSCA 2HNYA 1VRTB 1QY7A 3CUNA 3NL0A 1URRA 3BH7B 2EWHA 5LXRA 1BD6A 4ZN3A 3MR5A 3R1LA 5HAOA 1OYEA 4DQSA 2IVYA 3MM7A 1TK0A 1TUGB 5A8WA 4DG1B 2J9CA 2XMWA 3DFEA 1DTTB 4X62J 1RABB 4DV1J 3CCTA 3LTOA 1HD1A 2HHVA 1HW9A 2W4CA 3Q0AA 1SCJB 2BJ7A 5F41A 3UO0A 4OZNA 4EO6A 4RW8B 2Y1JA 2QYCA 4AT1B 4C7QA 2RUSA 3N4WA 4Y6IA 3UPFA 4K2XA 3ZZTA 1FRLA 2J0SD 2VB6A 2YBVA 1SPBP 2W9AA 3Q8SB 2GQQA 2QX0A 3EXYA 2EVZA 1AZSB 2LEBA 1KEKA 1R8HA 2JLFA 1LXJA 2DNPA 3C19A 3TAMB 2Q66A 4ZP8A 4LQ3A 1KVKA 2HQFA 4Y2MA 1SQFA 1N5YA 5KOXA 1UVLA 4XDCA 4F0HA 4USIA 2J7UA 4YR0A 3KK1B 2ZDOA 5IWAF 2QSWA 2EK6A 1PC4A 2L9WA 2AGOA 2B8QA 1HBOA 5HANA 3CC4S 2MLYA 2FYXA 3CDEA 3T41A 3CJ3A 3PX4A 1R7IA 2FHJD 3H2VE 4TY9A 5I4MA 4BDPA 1ZA1B 2I9SA 4ZP9A 2LCWA 3I96A 4OZ1A 3RAQA 1FK9B 4NLOA 1SJQA 1EX8A 2KT5A 1H7XA 2XMMA 3TW0A 4AE5A 4ZKAA 1QUPA 1YJ9S 1RTDA 5IT9Y 3GU0A 2F8EX 4ZK7M 3GJSB 5KT7A 2AJ2A 5E0OA 3PW4A 1KQFB 1TKZA 3VZHA 1FVQA 3K5NA 4J9MA 1NCLA 3BYPA 4LFCJ 1HMVA 2WONB 4RU2A 4Y0FA 1HNXJ 2BZ2A 3MEGB 2EFNA 4DF8A 4K0KJ 3DYAB 2UUAF 4J91A 4AXJA 1KTQA 2C3OA 4N8NA 4KRWA 2FVCA 2MXYA 4RNMA 3A8JA 1T05B 4FBUA 4DSIA 4C4WA 1RTJB 2XWXA 3TNVA 4CH1A 2GV1A 3VTIA 1VHFA 4O3QA 3T6JA 4ZPVR 4DCJB 3T1YJ 1RWNB 2PI5A 2P6TA 1TL4A 2LDYA 2HKEA 3S8SA 2NXEA 5FD1A 4DV5J 1PKUA 1T9VA 2P6SA 5D3GA 2CPYA 3CJ5A 1NK8A 1S48A 3PFOA 1ZTTA 2XSJA 4WFZA 2HZVA 4NCBA 4CTAA 3OFHA 5E3QA 4F67A 3JYTB 5H9FK 1VDHA 3IRXB 1Z2ZA 2BKNA 2WZ1A 3KLIA 4FYWB 3UD3P 4FYVB 2BA9A 1TKTA 3HKZD 1DZ5A 5C25B 2PFDA 4ENOA 1VC0A 2D9OA 2O5DA 4HHUA 2CPXA 1U6FA 2D69A 4WFAQ 1NB2A 2CPZA 3IS9B 4WXOA 2Y0SD 2ZITA 3D1QA 2BW2A 4P72A 2DBBA 1UW4A 1IKWB 3OSNA 1E6VA 3UVJB 2BR0A 2E5LJ 2POKA 1SC3B 2NZCA 2BE7D 3GLJA 3IG1B 2VU5A 1U02A 4U7CA 2X3GA 3D6MB 4KAIA 2RAQA 3HI9A 2GGPB 3LAMA 3POTB 4B9UA 2BJ9A 2ILZA 2JLEA 5KFTA 1Q8IA 2GCFA 3SMZA 4IG0A 3R7BB 1JLBA 4H4OB 3US5A 1HNIB 3DU5A 2R2RA 2CNLB 3UCUP 3KHHA 4NOHA 3PEHA 4FPRA 2GO8A 2HIQA 1N5SA 2HBZB 1UVMA 4O0IA 2KXNB 4KJIA 5T7LA 1OSDA 1UFKA 3KLEB 2MPUA 2MQNA 1VQLS 4QYZJ 4I2QB 5GAGU 1PILA 4USJC 4PWWA 4BHQA 5HMZA 1ZYQA 3GV8B 4W90B 3V6DB 2DGOA 1GMWA 4ECYA 1XNQJ 1QM9A 1H0HB 3QIPA 1UPPA 1S0NA 4DR6F 1WKKA 2C2OB 4DPUA 4GO5X 3EGVA 1FHTA 1TR0A 2VG7B 2YNGA 4U8YA 4JI1J 1EETB 4DL0C 5J1EB 1QAYA 3M4XA 1JWWA 3DRSA 1X0FA 4DL4A 3W9IA 1ZAVA 1RHQB 2HNDB 4X4RA 4C9DA 1S9EB 1MU2B 3DI6B 3VGVA 2L9DA 3I4HX 4URGA 3HO1A 2MKCA 1YITS 2ASYA 1RAFB 3EE3A 4DR4F 3EJMA 2C3UA 3BPSP 2MYFA 2C2NA 2QYGA 4G6VB 4CLTA 1U47A 2W9CB 4DMZA 3P3DA 2MGZB 2BV3A 3MF5A 1VISA 2H4WB 1KR4A 5F8LA 3A1YG 2GX8A 1H38A 1RAOA 1P1TA 2O1PA 3L95X 4O23A 2W9BB 4WFBQ 1SKRA 3BBCA 3NOCA 5G4DA 3U7JA 2FVSA 3PVXA 3MXHP 1XEZA 2KT3A 4DDFA 2FGOA 2P9GA 1Y3JA 1FDAA 4MK7A 4ECTA 4TNOA 4JI7J 2W8LA 4OX8A 1HWKA 3KNGA 5LMUF 5HBMA 2HS3A 3D1OA 4OYAA 2UXBF 2RDDA 4DR5F 1F5AA 2LQBA 4PKDB 2UUTA 2DNYA 4NZ7A 4U9RA 3N5FA 3SCJE 2Z4PA 1F0XA 5KG1A 2C2DA 3OL7A 4EUVA 4DV2F 4ECZA 4ICLA 1NK6A 4IRKA 1UWBB 1D1UA 4FNIA 3PKYA 4K8RA 4LRDA 4KTQA 3JTOA 5BYRA 4NRUA 2DNMA 4PABA 1RT2B 4B02A 6FDRA 2AGPA 1FDDA 3NWRA 4QR0A 2XGQA 2I5JB 2GIRA 1R0AB 3EM1A 5EGYA 4JYAJ 4F8RA 1HBMA 2BXJA 2WB1D 4RBUA 1HNWF 1L3UA 3LP2A 2HLTA 3I0RA 4HHHA 3V2UC 1ZH5A 4ZP7A 1BC6A 2QLWA 2RQKA 2DHSA 1C0TA 3PM9A 1S10A 4PXBA 4LFBJ 4M5JA 3WDOA 4ZHRB 3J81Y 2VUGA 3PJXA 5DGAA 4QWDA 1NK9A 1A6LA 2GMHA 1RWPB 1D8ZA 2Q1LA 3BGRB 4QR2A 2LQ9A 2DR6A 3PXGa 3W63A 2ZH3A 2G0IA 3DLLQ 2NQPA 3LQVA 3H5SA 3FFIA 2H4YB 4C8MA 5F8NA 3OTDA 1BQXA 1P9QC 3CCRS 3WHIA 3OBIA 1HW8A 4R25A 1K9MT 1S6QB 3AT1B 3FMBA 2BJ3A 2FTRA 4PG6A 3M9OB 2AZ3A 4N76A 4YB1P 3EGWB 3MM8B 3AA9A 4CNYA 2XTDA 4DX7A 3VHQA 4YR3A 2FLOA 3MR2A 4FF1A 4LJMA 4IOAQ 2KZMA 2BQUA 3BJYA 3ILIA 1SH3A 3FSIA 3KUHA 4QIVA 1T9XA 1DTTA 3RRHA 3MOJB 2CQBA 3A8IA 3CT9A 4I56A 1NSPA 1I6JA 4O3PA 1CLFA 3GJTB 3QT6A 3OVSA 3KXDA 4DV3F 3D3BJ 1T95A 4XTTA 3BQ1A 1L3SA 4UY85 1U6BA 5F0WA 2ZOMA 2F8MA 2EPIA 3KJQB 1FKOA 4DSEA 1NPRA 2CRLA 4CTAB 3JYTA 4P9SA 1LW0A 2W7OA 5L9XA 1TFWA 4QYZK 4X4SA 5JMNA 1FKPB 1RDRA 1Q95G 4IH6A 3C14A 2DIUA 1BUXA 2QSFA 4C3LA 3W3SA 3OR2A 2XTEA 5AXMA 2YQ0A 3TI0A 4LIWA 2MQQA 3G4SS 1YK9A 3O5TB 4UOFA 2AGQA 1SC6A 3JQJA 3RBDA 1HNVA 1NKEA 2P9CA 3NS6A 1FJ7A 2ZBPA 3I5BA 2DD8S 2DHXA 3PYDA 1XR5A 3BDEA 3RGIA 3Q86A 1B70B 4WU2A 1X9WA 2UU9F 4OHYA 1N32F 1Q1KA 3CD5A 3HHLB 4DV4F 1LWEA 3HZGA 2RDJA 3QNWB 1FTCA 2V6AA 3KG4A 3QFWA 4OMFG 2H1YA 4C8NA 2V8VA 4F3OA 1B4SA 5C2CA 1QSLA 4OHWA 2RH3A 3MM9B 4QJVA 2RHSB 5B0DA 3AXMA 2I38A 5IS2A 2ZKUA 4RO0A 1FJEB 2EBEA 1CJTA 3E3XA 3K0JA 1REVA 2WSCC 3OQ2A 4OZ5A 2FIUA 4PXDA 1YIJS 4N77A 5AXKA 2ZJQQ 4AL6A 2EFQA 2LXIA 5KFEA 1JLGA 3PG9A 2ATLA 3I9ZA 1TZ0A 1O8BA 4ECRA 2JC0A 2VBZA 1UL3A 1S5ZA 1FESA 2HQIA 3JQMA 1EHWA 4CCHA 3CO0P 3NLCA 4J5OA 4PG4A 1FRKA 5FIIA 3DYAA 3J7AN 1N33J 3SSSA 3UDLA 2Z2LA 4NCGA 4OJGA 4CLUA 2OEMA 5CYJA 1OM2A 5HQ8A 2J0WA 4PYAA 1D9AA 4XAKA 4WWSA 4WYWA 1S9GB 3MD3A 2DEIA 3C46A 2ZC4A 2AEJA 3I56S 2YNHB 3O3LA 4DSFA 2K1RB 2QFIA 5CCLA 2HRTA 3QRQA 2FZCB 2VQEF 2C28A 1Q16B 1U45A 3KYLA 4ZPAA 1VRQC 2AX1A 2HS0A 3VGSA 4H4MB 5E33A 1PAUB 2DYAA 3MD1A 2ZKTA 2DNNA 1RKIA 3DOLB 3PRDA 1UMJA 2BOAA 3MEEB 4BS2A 2Q79A 4NYZA 4NLGA 2ZZNA 5D4OA 3HF5A 3IS9A 4I7FB 2A6OA 2UUWA 4M5MA 4Q2LA 3F44A 2AJFE 2FJDB 3TARA 1C1BB 4R5PB 1D09B 3IG1A 2ZM6J 4NLDA 1KQGB 4FVMA 2GHVC 3BH6B 2NUUG 1IKYA 2VPXB 4X62F 4DV1F 1G1XA 2FPHX 3RU0A 3NNCA 1Z2LA 1RBLA 2PSZA 3GFXA 1DJ0A 2CIMA 2J5AA 2WW4A 2RDIA 4NYPA 4JI4F 2Z2MA 1UJ6A 3NGDA 2M8HA 4Q44A 3F73A 4JI5J 4LF6F 2YNIB 3M6XA 3W66A 2R2UA 4A8XA 1TFYA 2BVZA 1TTHB 1U0HB 4I2QA 2ZBIA 1YJRA 4DX6A 3PR5B 2Y3YA 4K5SA 2ROEA 4KO0A 2WOMA 4KHPJ 1IR1A 4UY8T 3RBXA 4Y65A 2CFXA 2D3OR 3V5RA 2OMOA 2V8PA 2H48B 3LP2B 1VIXA 1JQGA 5J1EA 5FDLA 1HHSA 3OHAA 2UP1A 5L46A 5HMYA 1S99A 2CPIA 5F0UA 1VQKS 2R7QA 1WOOA 2J76E 3SQGA 2XHCA 2XS2A 3VAFA 1U48A 3HKWA 3JAMY 4UOHA 1S6PA 4QYRA 1R0CB 1XIQA 3NOGA 1HNZF 2CQ4A 2KFNA 1IBMJ 1ZOTA 3VF0B 3JSMB 1IBLF 1TL1A 3GJRB 1CJVA 2RF2A 3M05A 4F2SA 1P8GA 4JV0A 5EWGA 2VFTA 1LV5A 3AA8A 2LP4A 9RUBA 2XM3A 2LLZA 3CXCR 2NPFA 2GAHC 1FRHA 1RSCA 2KN4A 3LPYA 4HYKA 4GKKJ 2VICA 2CDRB 5I42A 4O0NA 5EWEA 4RNNA 2HGMA 3X3UA 3ULHA 2ROPA 2EXUA 3BR9A 4WKRA 1NRKA 3TJ9A 4GC7A 2DR7A 4IOBA 3CCSS 1XC9A 1YZ6A 4Y2KA 4A8FA 1XK8A 4JOUA 1N36F 3ZTSA 1T03B 3M8PA 4DR3J 4DR4J 1EB0A 2KXHA 4CLYA 4UQTA 1N33F 5KT4A 2AF6A 2N4CA 5JUMA 4GKKF 4DN9A 3D6FB 3Q2SC 4ZVTB 2J8SA 1AB8A 4EWTA 1R89A 2YPYA 2M88A 2ADBA 1U1LA 3IA0A 3DLBA 2OPRB 3EWGA 5C7PA 2MKSA 2B51A 2KO1A 4X4QA 2YX7A 2VONA 1RT4A 1PYOB 1IJFB 3DLGA 2ILYA 2FZGB 4ID5B 4K7QA 5J2MB 4WZQA 1FD8A 2PMWA 3KJFB 3N79A 5I3PA 1N36J 4ELTA 1G2EA 3LANA 4V19X 3P49B 2GS8A 3AHPA 4LR9A 3DXBA 4KGXB 1VK3A 4O3NA 2DNRA 1CULB 4RUHA 2HVHA 4ZJQA 3IRWP 2B4PA 2CDQA 2WVDA 3CJ2A 3GR1A 4CYUB 4IG0B 3H7HB 1FJGJ 4X4UA 2PEBA 4QQBA 4DXLA 1N54B 1ZM2A 2V34A 2WSEC 4WK1A 5M2UA 5DLFA 1JX4A 2HK3A 3LGHA 5T7LB 1TL3A 1VQYA 3ISZA 3H42A 1K0VA 1LWFB 2YKAA 1J5OA 1BXNA 4KHPF 4RLEA 2E1MC 5KFWA 3W9JA 4J37A 4Q0BA 2E7WA 2QMXA 3CCUS 2CPJA 3BEGB 3MM9A 3FNNA 2I6WA 3CPWR 1NJYA 2DR5A 3RR7A 3G8SA 2XMAA 1JXLA 4QR1A 1SL1A 2E5JA 3AD8C 3ADAC 5U47A 3QRPA 2AEFA 3GPAA 2V4QA 2V50A 1WG4A 3CJ8A 4ZCMA 2W7PA 2UV8G 1NHVA 2CZ9A 4OYOA 2BQ3A 1AA1B 4F4KA 4OYWA 3A3NB 3PNIA 2KFYA 3VR1A 2R2SA 4OI3A 4B9NA 2KRRA 4KY3A 2HSEB 4F7VA 1Q79A 1YJTA 3P5BP 2J6TA 1LFWA 3W2VA 4QWCA 5KG5A 1N5VA 1M5OC 1J5EJ 2W9CA 2DGQA 2EFGA 4YDDB 3W7BA 2QLBB 4Z37A 4C8YA 4GVBA 5D15A 4LSZB 5KT2A 2LQ5A 4YR2A 1YHQS 1C1CA 1SV5B 3M8QA 4M5DB 4X4PA 3W2WA 4PWUA 1SH0A 3LPEA 4IDKA 3BGOP 3TQEA 2OIHA 4M95A 3UDEA 1VQNS 2R7UA 2NR0A 4DV5F 3C3LA 1FJGF 4NXMJ 3KK2A 1YSJA 1UAWA 1VFJA 2W4PA 3R3TA 1DQ9A 5GAEI 4M5IA 1TP7A 1YBAA 1FK9A 2AYMA 3T3FA 4DS4A 2ALZA 5KFQA 4UUWA 3J7ZT 3PJWA 2UXDJ 2N82B 3QJPA 1X7VA 3SIPB 2V4RA 5IM0A 1W2IA 3ZXWA 3AOBA 5J2PB 1OPIA 4F3QA 1O5JA 4EYHB 2DTJA 2L48A 5HJYA 5HMXA 1IKYB 1HWIA 4RUBA 2ABYA 4ZLPA 4BC7A 2HS4A 4LBPA 3Q8PB 1TK5A 1PJ6A 4RW7A 4JI6F 1RTHB 4RWWA 1IVZA 1V3ZA 1BLUA 1CJKB 1Y9OA 3KLVA 4EO8A 4EZ9A 1RB0A 2VC1A 1UEVA 3T5LA 5HROA 3SDEB 3MPWA 4KR0B 4USMA 3PIOQ 4PPZA 1HQ2A 2QV6A 3NAHA 5KFUA 4HI2A 3BN4A 4JI6J 1RHJB 2XULA 3DHXA 3MECB 2PDAA 2XMUA 2XNQA 3O2IA 3BO2A 3E8OA 3MEDB 4ZVFA 4CH7A 4N56A 5DDRC 4J9KA 2IY5B 4ERDA 4LT6A 4LFAJ 2M2BA 1MROB 4DU8A 2DY9A 3LW5C 1S6QA 1AUSL 1T9YA 2VH7A 3C15A 3DLJA 4AYBD 1S9GA 3G6ES 2R2TA 1FRIA 1L3KA 3HJVA 5GAGI 4F4WA 2G2YA 1Q0NA 2KHCA 1S49A 2FQQB 2R8GA 1PBUA 3GIMA 1TL1B 1MLAA 2NXCA 4ZN1A 3DGPB 3AOAA 3DGVA 3HFZB 4IQMA 4Y3CA 3U27A 4LFAF 1V3RA 3L7PA 4KGMA 5I3UA 2NYHA 3G82A 3HSJA 1IWGA 3MZIA 3DLEA 3NCPA 3IGVA 4RU9A 2YWGA 5HK4A 4DV7J 2MKJA 2Z56B 1NJIT 1KRPA 3OL8A 4PXEA 4P7TA 4Y2AA 1FNMA 1OY8A 3L3CA 3HX9A 2ASDA 2IM2A 1RAIB 5K8NA 2VFSA 2V2QA 5GADI 4AUKA 1VRUA 3MTKA 4RUAA 3CF5Q
chains in the Genus database with same CATH topology
2AQ4A 1M5PC 3KNAA 4R8UB 1WI6A 2FHOB 2MQOA 2ZH5A 4KBIA 3UQSA 5LL6d 2PMHA 4RW6A 4DEZA 1WTFA 2FLPA 2H5EA 1MMLA 3QIPB 2DNLA 4ILRA 2QO3A 4MMOA 3N9UC 3V6JA 2V9WA 1KONA 3HMJG 2MZSA 2MQPA 5KG7A 3G6VA 1WEZA 4RNFA 3UDCA 5KFJA 1JJ4A 4B3SF 2ZVSA 2DB1A 2LA6A 2VV5A 4YEAA 5MAOA 2WOMB 2R9LA 3QO9B 1N52B 3GILA 4YFUA 2COLA 2K7JA 3JSRA 2D41A 2BRLA 5GAEU 1P1LA 3TO8A 1R8PA 2ZOGA 4JI5F 2DT9A 2BDPA 2D9PA 3KHRA 2LA4A 2DHGA 3BQ0A 3PO4A 2HHQA 1KHVA 2Q43A 3HVTB 2DVIA 1BQMB 2CZ4A 5AXNA 4P6QA 4IO1A 3H5YA 1IXKA 2DH8A 3CO9A 3VQTA 2XZ2A 1V9OA 1V3SA 4G1QB 3LAKA 5HBMB 1QVGR 4EYIB 5CHCB 1WF1A 2R8KA 4OZ0A 1QLNA 1XWLA 3W2VB 4DSLA 2B7BB 4G3IA 5B0BA 4UW2A 1D8YA 3CEDA 4IO9Q 2HPUA 3CWJA 3EZUA 2M9KA 3PEJA 5D78A 4WZMA 3DOLA 1U2FA 2KM8C 4ZPDA 1FCAA 1QUVA 2XS7A 4QZVB 4MKAA 4ZOSA 1DRZA 2R7RA 3I0RB 1KLMA 5J2MA 2IHR1 3FDSA 1VMBA 3M32A 2XCPA 2MSSA 3J7A1 5AE3A 1JLEB 3ITHB 4ZHRA 1WD6A 2VBYA 4LF9F 1F60B 4JV2A 5EN1A 5L1LA 2AYBA 2IC3A 1IQZA 5BJRA 1QSSA 1R6YA 1WACA 2PT0A 3IR7B 4RW4B 4LSLA 3SZ2A 3LP0B 2B6AA 1C0UA 2DH9A 3GG0A 2RJZA 4DUZF 3DLKB 2PI4A 5HMWA 3DC2A 2CQGA 2G1DA 4TY8A 3TUZC 1RA7A 2GJIA 2J9DA 1Y3KA 2V94A 4O4GA 2YKMA 2YNFA 1WWHA 2VPYB 4OV1A 2ZDPA 3RAMA 4C8LA 2PA3A 3RBEA 4WFNQ 4TYBA 3G96A 4OI2A 1HHTP 1UVKA 3S7RA 3IAS9 5L8RC 2WBRA 5KFZA 2E1AA 4FXVA 1UFWA 1VBXA 3UW1A 4TU8A 3ENWA 4WE1B 4F02A 3Q8RB 3UWTA 1WHXA 4FXDA 2W25A 2FLLA 1GT8A 4YUDA 1JJHA 4HT7A 4LF8F 3THVA 4DR7F 2YKQA 5EDWA 1RAJA 3PZPA 1FVSA 3I32A 3X1LB 5L1IA 1URNA 5A8RB 3OPKA 3KLGA 3BGUA 1UETA 2ZH9A 3M8QB 4M5DA 4FVCA 2RRAA 3DGPA 4OJHA 2KHDA 3ZZ0A 2B43A 5D4PA 5KG6A 1PSDA 3TVYA 1TKXB 3TUIC 3TQ1A 4HT5A 1LWEB 3CCZA 1SUQA 1SH2A 4C11A 3FEYB 3PV8A 3RR8A 3C6UA 2XMVA 5SZTA 4Y2IA 2YVSA 4USHA 3BSCA 2MZQA 2HZCA 2VPWB 3PW0A 4ZCIA 1VRUB 4WE1A 1D9DA 4LF5F 4J9QA 4PWDB 3RB3A 3M2VB 5KFCA 4CO4A 4QWBA 1S1UB 2ZHBA 4MIWA 2VA3A 4PQUA 2LEPA 2E5GA 4F4ZA 4A8SA