4NLSA

Poliovirus polymerase - s288a loop mutant
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPAGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
molecule keywords RNA-directed RNA polymerase 3D-POL
total genus 140
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nlsA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nlsA02
3T19A 4ZVFA 4Y34A 1HMVB 2OH2A 5KFGA 1S97A 1RTDB 1LW0A 1REVA 1XR6A 3RB3A 5EDWA 4TXSA 1SH0A 1LWEA 1RDRA 2ZKUA 1S1UA 2BANA 2IAJB 5DG8A 4IFVA 4R5PB 3FFIA 3N6LA 1RTHA 1RAJA 5KFQA 4IH6A 3MR3A 3G6VA 1FK9A 4DL4A 4IRDA 3KMSA 5DQHA 3C6UA 2VG5B 3DRRB 1KLMB 4B3OA 4WXOA 1HARA 3IGNA 1BQMB 3ISNC 3MFHA 4Y2CA 1GX6A 1TKTB 2IJFA 3DMJB 3KLGB 3GQCA 3V81B 3OSPA 2BQRA 2HWHA 3QYYA 2YNHA 2FVQA 3TVKA 5EWEA 5JXSA 3JSMA 4RW7B 5HBMB 1HMVA 5L1JA 1SV5A 3NBPB 3QIPB 3VQSA 3UPFA 2IM0A 3KNAA 4H4MA 1S48A 5JUMA 4J9OA 2ZE2B 3KLFA 4O44A 5KFRA 5KFNA 4KBIA 3CO9A 1N4LA 3IG1A 4HYKA 3H4DA 1JLCA 2ZD1B 1TL3A 1J5OB 3M9MB 4IH7A 3MEEA 2YKMB 2UVWA 1JLFB 1I6JA 1NHUA 3H40A 1S0OA 4FBUA 1DTTB 5I3UB 3KLHB 4NLPA 5F9LA 3DRPB 3QO9A 1T94A 1JLEB 2BRLA 4QW9A 4MH8A 4Q44A 2BE2A 3D28A 4ZP7A 3MFIA 4EEYA 1RTJA 3DLEB 3NKYA 2B6AB 5KFEA 2R2RA 3M8PA 4O3QA 5D3GB 2UVRA 2GIRA 5KG5A 4NLRA 3GV8B 3I5BA 5L1KA 3DLKB 3G6XA 4WE1B 4DL6A 4I2QB 1RTHB 4TLRA 3V6DA 4ZP6A 5T14A 5EWFA 3FDSA 2C2RA 4I2PB 1C0UA 5I42A 4Q0BB 3I5AA 1LW0B 4DG1B 1HQEA 4Y3CA 3FRZA 1N6QB 1HQEB 5KFTA 3V6DB 4TY9A 4I7FA 1S10A 3KJVA 4WFZA 1C0UB 2V0NA 4RW8A 5KT4A 1N56A 4RNNA 3CIZA 3RB0A 4R8UB 5HROB 2J6UA 2R2UA 3DRRA 2YNGB 3H2LA 2JEFA 2HWIA 3M8QB 4RUAA 1TV6B 2W9BA 4ECXA 4QPXA 1C0TA 4TYBA 4RW9B 2GC8A 3E51A 2W9CB 1JLFA 3V6HA 2I5JA 4XPCA 3KK1A 3PVXA 1JX4A 4NLGA 1D1UA 3DRPA 3KLIA 1S0MA 4EO6A 1T05B 5KFSA 1IKXB 2YKMA 3DOLB 4RW4B 2HMIB 4O4GA 1RT3A 4KHMA 1S6QB 4OL8A 3MECA 4G1QB 3JYTB 1S4FA 3QGIA 3V6JA 3QIPA 3DDKA 1S1VA 4IR1A 3DOLA 2XCPA 4FS1A 2WONA 5DQIA 2YNFA 2ILYA 3PJXA 5KFWA 1QAJA 3D5MA 5CYMA 4IR9A 2JEIA 4IKAA 2R2TA 4IRKA 2RF2A 2VG5A 2V4QA 1JIHA 3BGRB 1NNDA 4DL7A 2FVSA 3CDWA 2C2EA 3LALA 3KHLA 2F8EX 1BQMA 4ED7A 1EP4A 3FFIB 2R8IA 2WB4A 4QWCA 2ASJA 4Q8FA 5KG3A 2YNIA 1D0EA 4X2BA 1S1WB 3PW0A 4ZP9A 2W7PA 1FKPA 4QWEA 2BR0A 4EO8A 1JLGB 1QE1B 3LP1A 3MECB 3TAMA 2XC9A 3DM2B 5KFPA 4WE1A 1BQNA 1LW2B 1RT1B 2VA2A 4TYAA 4DL5A 1IKXA 3RB6A 4IDKA 1HNVB 4ECQA 3MEGA 2FVPA 1RYRA 5J2MA 4NLXA 3G86A 2XGPA 3PW5A 2I5JB 5CYQA 1TQLA 4K4SA 3T1AA 3Q8RB 5C25A 3LP0B 4MIBA 1HNVA 2W9BB 4NCGA 1OS5A 1UWBA 3PHEA 3I5CA 1QE1A 4RNMA 1SUQB 5HLFB 2XGQA 1RA7A 4PUOB 3H5UA 1BQNB 1LW2A 4MKBA 3OL9A 2B5JB 4JV2A 3FQLA 2VG7A 4YMEA 5KG6A 4YP3A 4M95A 3SFUA 1TVRB 4H4OB 1C1BA 1JKHA 1S6PA 5J1EA 3CDUA 2B5JA 1S1XB 2WOMB 5KFHA 5KFFA 4YR2A 4O3OA 1DTQA 3I0RA 4RNHA 1VRTA 3BR9A 4ECYA 1EP4B 4DEZA 4GC7A 1T3NA 2J6SA 5KFXA 4LQ9A 3UDLA 1HQUB 1JLQB 4QWDA 2OPPA 1S1XA 5EUHA 4NLUA 4J9NA 3DOKB 3KK2A 3BQ2A 2D3ZA 2IAJA 1RT2B 4KKOA 2UUTA 4URGA 5CYMB 1TP7A 4O3PA 3KK3B 3IRXA 2FVRA 2IA6A 4ZMMA 4FBTA 1Z4UA 4TN2A 2UVVA 4ID5A 1K1SA 3CJ4A 2OPSA 1FKOB 4ID5B 1T05A 3T5KA 4O4GB 2R8GA 2HMIA 3BSOA 4KO0A 5HBMA 2DPIA 3GV5B 5C5JA 3OHAA 4PWDA 2FLNA 3V6KA 1JLQA 3PR5B 3V81A 1MMLA 2WCXA 4F4WA 4NLWA 3DOKA 1RT6B 3KK2B 2C22A 1S9EA 1LWCA 2XWYA 2E9TA 4R8UA 5HROA 4KSEB 2O5DA 4NLDA 2IMWP 4K4UA 4MKAA 3KJVB 2ATLA 4IFVB 4G3IA 2QE5A 3BQ0A 4J9RA 2BQ3A 4O3NA 1LWEB 4HKQA 4RU9A 5KFOA 4Q43A 4O4RA 1ZTWA 1T03B 3MEDA 5J1EB 1C1BB 1JKHB 1S6PB 3KLEA 4QWAA 2W8LA 5F8HA 4ED6A 3NL0A 2IM2A 4U6PA 2VG6A 2JLEA 4G1QA 4KB7A 3NAHA 3T5LA 4F4YA 1TKXB 5DQGA 4EBDA 3OL8A 2IM1A 4K4WA 5HP1B 1DLOA 5DGBA 4O3RA 3PJWA 2RF2B 4NRTA 3CJ0A 1SH3A 3Q8SB 3PZPA 4LSNB 5KT6A 3IS9A 5F8LA 4LSNA 3EPGA 4J9KA 3LAKA 4ECUA 1C0TB 1TL3B 5KFCA 3SFGA 2WONB 4TQRA 1J5OA 2FJWA 1SH2A 3C6TB 3LANA 3MEEB 5J2MB 1JLBA 3BSCA 4TY8B 3LP2A 2YNGA 5KG4A 2RDJA 3TAMB 4H54A 4IFYA 5L1LA 1RTIB 4R0EA 4U7CA 5J2PA 4H4MB 4ED0A 1HYSA 3QGGA 2C28A 1RT3B 4O44B 3LP1B 2E9ZA 2HNDA 4MK9A 3H5YA 5KFJA 3UQSA 2RKIB 3HVTB 3I0SA 1XR7A 3KLVA 2V4RA 4LSLB 1SV5B 5C24B 3IN5A 3MR6A 1C1CA 4K4TA 1QUVA 1JLAA 1KHWA 1RT4B 4IG3A 1RT4A 4IG3B 1RTJB 3DLEA 3C6UB 3FSIA 1S49A 2D41A 4JUZA 5F8MA 4ECZA 4ZPAA 1IKYA 2YNFB 1ZTTA 1HPZA 2ASLA 3NMAA 3BSAA 1NHVA 4I7FB 3KLHA 4NLVA 3I0SB 5I3UA 4ZHRB 3H98A 5F8GA 3OLAA 1REVB 5KG0A 2BQUA 3BJYA 4Q0BA 2RKIA 2VG7B 5KFMA 4MIAA 4ED1A 3KHRA 4PQUA 4IFYB 1RT5B 3H5SA 4I2QA 5KFZA 3Q8PB 2ZE2A 3KLFB 4PUOA 1HYSB 4K4YA 4EBEA 3C6TA 2IM3A 3N6MA 3KLIB 1MU2A 4J9MA 2FVCA 2JC1A 1RT2A 2IJNA 2YKNB 4KKOB 3QO9B 3LP0A 3RAQA 2FLLA 2YNHB 3MF5A 4EYIB 4GC6A 3BQ1A 3CJ5A 3KK1B 4URQU 3DRSB 1N5YA 1MU2B 4MFBB 4K4XA 1JLCB 2ZD1A 3H4BA 4IDKB 3KHHA 2VA3A 3G6YA 2CKWA 3NGDA 5KG7A 4EBCA 5HP1A 1JLAB 4ED2A 5KFKA 4KAIA 4IRCA 5DG7A 4QW8A 2VG6B 4NLSA 5C24A 3NBPA 4LSLA 2DPJA 1TKZB 3LAMA 4MK8A 3OL7A 4ZVEA 4IH5A 1EETB 4ED8A 1XR5A 3CWJA 5KFIA 1HPZB 4ZP8A 3PW2A 4NLOA 5D3GA 4WZMA 4KE5A 5J2NA 1N5YB 3RAXA 2D7SA 2GIQA 4FS2A 2R8KA 2W9AA 1TL1A 4R5PA 5F8IA 3MTKA 3IGVA 4KFBA 4JV0A 4ECSA 2BE2B 2ALZA 2E9RX 4NRUA 4WFXA 2FLPA 4YQWA 4PWDB 2YKNA 2WRMA 2HNDB 3KOAA 4IG0A 1RT5A 3HHKA 2OPSB 4ECRA 1JLGA 5L1IA 2UUWA 2WHOA 3JYTA 1JXLA 2XI2A 1S9FA 4DL3A 5J2QA 2IBKA 4IG0B 3DLGA 4K4VA 3KMQA 2AX0A 4ZPCA 3HVAA 5EWGA 3OSNA 1GX5A 4WZQA 1IKVA 1IKWA 4ICLB 2QV6A 4MK7A 3KK3A 5KFAA 3JSMB 2HNZB 3ISND 3DI6B 2JEGA 1KLMA 4B3OB 5KT2A 1IKYB 3BSNA 2FJXA 1TV6A 3PW4A 1FK9B 3BGRA 3RBEA 1LWFA 5FDLB 2IC3A 1LWCB 5F9NA 3RB4A 3GV7B 3DI6A 4NLYA 2HNZA 1DTQB 3I0RB 3BREA 3OHBA 3M9NB 2AWZA 4KV8B 4WXWA 4RW6A 1RTDA 4IOBA 3KLEB 1EETA 3QGHA 4J9LA 4JV1A 5J2QB 4WFYA 5KT7A 2ASDA 3HVTA 2AU0A 5KFVA 5HLFA 2OPRA 2ILZA 3CDEA 4J9SA 3QLHB 1HNIA 1UWBB 1JLBB 3HKWA 2OPQA 4RNFA 2HAIA 2C2DA 4ECWA 4Q8EA 3OL6A 1RTIA 2AGOA 2V9WA 3EZUA 3T5HA 4WYWA 5CYQB 5DLFA 2HNYA 1IM4A 3SI8A 4ZVGA 2HNYB 1K1QA 2XI3A 1S1TB 4J9QA 1N48A 4RUCA 5F8NA 1S1TA 2OPPB 2R2SA 3M8QA 4KO0B 5KFYA 1RT1A 3V4IA 2WK4A 1TKXA 4KHRA 4ECVA 1DLOB 4RW8B 1C2PA 3H59A 3ICLA 1HNIB 3EPIA 4ED3A 2OPRB 1U09A 4PQUB 1S1WA 3KHGA 1S0NA 1RT7A 1TVRA 2D3UA 4H4OA 1VRUA 4RW6B 1FKPB 1R0AB 5KT5A 1VRUB 3RBDA 5I42B 2W7OA 4RW7A 4F50A 3ITHA 1YVFA 3DYAA 4KV8A 1T03A 3DLKA 2W8KA 3H5XA 3DMJA 4O3SA 1TKTA 3KLGA 2AGQA 4K50A 4WYLA 4ZPDA 5KG2A 2AQ4A 1S9EB 2IC3B 1RT6A 4ZPBA 5KG1A 4ECTA 3DRSA 1JLEA 4ZVHA 5C42A 5C25B 3CJ2A 2FJVA 2B43A 3T5JA 1W25A 4F4ZA 4YR3A 3GIMA 3MEGB 2I1RA 1S9GB 3E01B 1KHVA 1RT7B 3MR2A 3M9OB 3DLGB 2JEJA 3QLHA 1S1VB 4QWBA 4RW4A 1FKOA 5KFUA 4TQSA 4RNOA 4NLTA 3CJ3A 3E01A 5KFLA 1S9GA 3PW7A 3LP2B 4ZHRA 2WTFA 3MR5A 2W9CA 3IRXB 3FQKA 3GIJA 5C42B 3Q8QB 3IS9B 4K4ZA 4KFBB 2CJQA 3NAIA 1LWFB 1ZETA 2RDIA 3QZ7A 1HQUA 2AGPA 2OPQB 3GILA 2WOMA 4IQXA 3DM2A 3DYAB 5KFBA 3UR0A 1VRTB 1N6QA 1S1UB 2BANB 5K14B 1C1CB 4F4XA 1TKZA 1R0AA 3TQ1A 2R8JA 2EC0A 3CVKA 3ITHB 4XPEA 2YNIB 3MEDB 5DG9A 4M94A 4DG1A 4EYHB 4URSA 5DLGA 5KFDA 3GYNA 4I2PA 4Q45A 5K14A 4LQ3A 3PR4A 5J2PB 4DL2A 3N6NA 3V4IB 3M8PB 1S6QA 4NYZA 2JC0A 5FDLA 2XCAA 2R8HA 4TY8A 1WNEA 4NLQA 1SUQA 2J6TA 4MFBA 1CSJA 2B6AA 4Y2AA 2BRKA 4RZRA 4NCGB 3QZ8A 1IKVB 1IKWB 4ICLA 4RW9A 4J9PA 1TL1B 1DTTA 3HVWA 5KT3A 3GIIA 5DGAA 1QAIA 4XO0A 3OLBA 3IG1B 5L9XA 3GIKA 2UVUA 2AX1A 1RA6A 5J2NB 4YR0A 1RYSA 3QIDA 4NZ0A 5F8JA
chains in the Genus database with same CATH superfamily
1OQ6A 3R3TA 5HMYA 2FD2A 2VOPA 4Y34A 4OYXA 1YKWA 1U7LA 1VK8A 2FHJA 2XSFA 3HD2A 3NOGA 4EGLA 2O01C 3LW5C 5A76A 1S97A 2MPUA 1VC5A 3RB3A 1L5UA 3HULA 1LWEA 3MM8A 2B4VA 2J0WA 3D54A 2IAJB 4NX9A 4C3LA 4AE5A 3NGUA 4R5PB 4DR2F 1RAJA 1N5QA 4IH6A 3L7PA 2F63A 3T9NA 3G6VA 1QAYA 4DLGA 2P5VA 5DQHA 3DRRB 2IRXA 3FUYA 3MOZA 1S4EA 3HSGA 1BQMB 4KPCA 1TKTB 1T95A 4X62J 5DDPC 3UO0A 2HWHA 3QYYA 4NI2B 2RHQB 1R6VA 3T1HJ 2ZKTA 4DWIA 3EGWB 2QSWA 3H7HB 5CAAA 1RKJA 4KGMA 4RW7B 2CQ2A 4E2FB 5I4MA 1N33J 1UMJA 3UPFA 1OJ4A 1T9TA 3PRDA 4L74A 4OJ1A 4PAAA 1RHKB 1S48A 2D1CA 5DZ6A 5JUMA 4X64J 1VHFA 2HGNA 1XNQF 4O44A 2ZZTA 4P71A 4ZVRB 3CCLS 4NCAA 4KBIA 3QMQA 1KP6A 1N4LA 1NJZA 2ZD1B 5C7PA 2VHGA 1SL2A 1P8GA 1B7YB 4P73A 4WP3A 4HTIA 4IH7A 2LA4A 3LPYA 4J9UE 2A2DA 3KJNB 2UVWA 2HVZA 1JLFB 3H40A 2BM1A 1H3DA 3ZZUA 1DTTB 2FY8A 3H25A 5F9LA 4YDXA 4FBUA 2YH0A 3DGPB 4W98A 2BE2A 2ZJPQ 1Q8IA 2FC9A 1N56A 2R2RA 4P75A 5KFEA 1WHXA 3VHQA 4B02A 5D3GB 1OYEA 3S8SA 4TU9A 1U45A 4NLRA 1ZM2A 5L1KA 4WE1B 4DL6A 2FHMA 1RTHB 2AIRB 3AXKA 3BM7A 4CLKA 3V6DA 3JTPA 1U1RA 4HI1A 5T14A 4W90B 4I2PB 4K5RA 4PPDA 5I42A 4NPOA 2D9OA 3OXGA 4CYUB 2FJDB 4DR4F 1HQEA 2DY9A 2GMJA 2XZTB 2LDYA 1HQEB 3L4BC 1N6QB 1NHKL 2FY1A 2DEIA 2HZAA 5F3TA 1S10A 1TL7B 3TAPA 3JTOA 1C0UB 5KT4A 4RW8A 1T3OA 3RRGA 4OZLA 5HROB 1PBAA 2E29A 3MGJA 5AE2A 5MAOA 2R2UA 1AUSL 2RS2A 2WVCA 3CDAA 5ETMA 3CTRA 4DPYA 1T0TV 1TV6B 2M9KA 4RUAA 2VPYB 3PV8A 3K8WA 5GADI 2HHUA 1C0TA 4DUZF 1FHTA 1H73A 1JLFA 2MB0B 4DQSA 3B6BA 4WPAA 1RBAA 3OD2A 4NYPA 1IKXB 2HG4A 8AT1B 4RU2A 3JXOA 1XN9A 1YBUA 3O5TB 3JYTB 2QA4G 2AEFA 1K8AT 3V6JA 2D68A 1NJXA 4X4NA 4KIAA 1IQTA 1S1VA 1SIZA 2V1TA 3PJ9A 1SJRA 1F3VA 2BJ3A 1I1GA 2GGPB 4USVA 2B4PA 2IJRA 1RWUA 3OTOF 2VASA 2F3JA 2ZH8A 2LMIA 4Y00A 4F02A 3NGKA 3RU0A 4NXNF 4DPXA 4IRKA 4DL7A 2FGOA 2DRDA 1JIHA 2OJ3A 2QMXA 4HT5A 2XS7A 2LU1A 3LALA 1BQMA 1RWMB 1F60B 3ZNUA 1RZMA 4F4KA 4QYZK 2KL8A 4UT4A 4V19J 1ROFA 2DISA 2CJXB 3W3SA 2F4VJ 3G87A 2XYPB 5FD1A 3ZZTA 5IZHA 4NXNJ 4A8FA 4NMLA 3J7AN 4EUVA 2Y0BB 3VGUA 4QZVB 1E6YB 2N7CA 2C2ZB 3VGSA 4QWEA 4MKYA 2R7TA 1KVIA 2Q66A 4EO8A 3O3LA 3DN9A 4DV4J 2XC9A 2KDOA 2R42A 1BQNA 5J1NA 2NPFA 2IA0A 3RB6A 4PWUA 1HNVB 4Q2MA 5IV4A 5HATA 4ECQA 2ZBQA 2R7SA 1BMQB 5ADZA 5J2MA 4NLXA 1DQAA 3PW5A 3M8SA 5CYQA 1TQLA 4K4SA 3Q8RB 1IBCB 3IA0A 1S5ZA 2OEMA 2HFSA 4RLEA 2CQBA 3DU5A 2IYGA 1OPIA 4HLBA 3M6VA 1U1PA 3O8WA 1QE1A 2B56A 4PG5A 4Z37A 5DDRC 3JTNA 4RNMA 5JVGQ 1FO1A 5HLFB 2P9EA 3DLLQ 2ZUGA 2JFDA 2B5JB 1P1LA 4JV2A 1KR4A 2B4OA 3HF5A 4KGXB 4YP3A 3O2IA 2V1SA 4X66F 4QU6A 4H4OB 3DDNA 1TMMA 3Q8YA 5MLCV 5J1EA 1VC6A 2A0FB 4X65J 1C4CA 1WI8A 4LF4J 3HK2A 2B5JA 2MY8A 3TUZC 5KFHA 5KFFA 4PQAA 1ULRA 1VRTA 3BR9A 3ADAC 3MPUB 3OFHA 7FD1A 3PO5A 1WG1A 1YRTA 1EP4B 4DEZA 2KFYA 1WKLA 4GC7A 3DNCA 5KFXA 4CT8A 2HHHJ 2J6SA 3W5YA 4B3SJ 2CPXA 3UDLA 5M2RA 4QWDA 2ZUAA 3KTQA 2GHPA 2OPPA 4I6WA 5EUHA 4E0DA 1VIXA 3DOKB 3KK2A 4J9NA 2D3ZA 1RT2B 2OO4A 5CYMB 2I9SA 1SVDA 4KR0B 4ZCLA 2WVFA 2DNGA 3NOCA 3R9LA 2Y1JA 2OHDA 3ILJA 2IA6A 2QC3A 2ZH9A 3TARA 1U26A 4DV7F 5GVQA 3R6GB 1NSPA 1Z4UA 2OEKA 4K2XA 2W7AA 1MWZA 4LF8F 2EFPA 2OPSA 2V2VA 4CO5A 2K3IA 4HHJA 3T6JA 3CCVS 3TA1A 1BY9A 2DPIA 2HRUA 2MZTA 3GV5B 2KTQA 1EX8A 3AOBA 1HI0P 1FNXH 2GS8A 1Z2ZA 2VPXB 4UQTA 1JLQA 4OJ3A 3VTIA 4OYAA 1MMLA 3MD3A 3QFHA 2CPEA 3SDEB 4NLWA 5B08A 1RT6B 2R7WA 4F4WA 1S9EA 2XWYA 2HIYA 2C22A 2E9TA 1U47A 3CJKA 4YOEA 4X4VA 4KSEB 2CJ9A 5L9NA 2IMWP 4KPYA 1XBWA 2I8EA 4IO1A 3KJVB 4C8ZA 2ATLA 2IVYA 3WBZA 3H20A 3ZTQA 3HZGA 4O3NA 3TYTA 2GZOA 1J27A 2YPYA 4O4RA 1ACMB 3FSXA 4RU9A 2MGZB 4DR2J 1T03B 4QCLA 1UPMB 2QFIA 5LT5A 1C1BB 1UZHA 3FMBA 3ZC4A 3HHLC 4QWAA 5F8HA 4E8UA 3EE3A 2E44A 4PR6A 3KLEA 3AT1B 3NL0A 2CPIA 2IM2A 2LXIA 4QPTA 4GKKF 4DI6A 3EVWA 1NH8A 1MN7A 3P5BP 2R7RA 1H6KX 1WD6A 1U6BA 1TKXB 1Y10A 4K4WA 5HP1B 2K2PA 2OD4A 4OZ0A 4O3RA 4NRTA 1F3FA 4Y6IA 4F7VA 4CNYA 3CJ0A 1CJKA 1V6HA 2NS1B 3SXLA 5KT6A 3IRWP 2VBWA 5AXNA 5E33A 3HFZB 1C0TB 1KWMA 2DNRA 5KFCA 3SFGA 2V4JA 1ZAWA 2WONB 5B0AA 4B3SF 3ENWA 1JLBA 4OV1A 5KG4A 2OELA 4LIRA 2RDJA 3TAMB 4U7CA 3R8YA 4ED0A 3K57A 4QYZJ 1WUUA 2E5GA 2KG0A 4LRFA 3R5BA 4K59A 3CD0A 4M8LA 4RO0A 4DCPB 3JAMU 3AOCA 2NXEA 3WC2A 3H5YA 2J7WA 3I0SA 3KLVA 1S7IA 3NRBA 2V4RA 3FMWA 3IN5A 2KT5A 2X7IA 1KFSA 3M2VA 3E2EA 1X7VA 3OW2R 1XMQF 4LBPA 1RT4B 4IG3A 4PKDB 1J2VA 1RT4A 4IG3B 5F0UA 1R43A 1RTJB 1RLDA 2HRTA 4KGVB 1S49A 2D41A 2HBYB 2QL7B 3LUYA 1GNKA 1RJJA 1TAQA 2B9EA 4X64F 2I0XA 5GAEU 3NMAA 3CD5A 4HACB 3OQ2A 2ASLA 1T8EA 2E5LF 1N54B 1M5SA 1VQYA 1RWPB 3ZO7A 1O51A 1CS4A 1Q8LA 3CCSS 1REVB 2KXNB 5KG0A 1X9MA 1KFDA 2V6AA 5KFMA 3CC4S 5EX0A 3OUYA 4WFAQ 2DJWA 1YWXA 2HHSA 3P45B 1RHUB 2F9JA 3LQVA 4M5LA 3J7Z5 1Q82T 2XS5A 2V34A 1NDCA 1YJVA 2JLFA 2AHOB 1T9VA 2L9NA 2MQNA 4CO0A 2CQ0A 4J9MA 2XULA 2E5JA 1RCXB 2JFKA 2DGOA 2RRNA 5LM7E 4I67A 2KI2A 4A8SA 1MW7A 3UN2A 1FCAA 4PABA 4OZ5A 4RL1A 1N5YA 1VQ5S 2ZC4A 4K4XA 2ZD1A 4AQYJ 1ZOTA 4IDKB 3H4BA 3KHHA 2VL1A 1NK7A 3FCWA 2CKWA 2DO0A 4P10A 5A0YB 3G6YA 4EBCA 2AW0A 2DIUA 1JLAB 5I3PA 3RGIA 1QSSA 4IRCA 5DG7A 2HQIA 2VG6B 4NLSA 1I51B 3BYPA 3UD3P 3LAMA 3OL7A 2WAQD 1V3RA 3MM9A 3R1HA 4IH5A 1EETB 4PXCA 2J0QD 2QJ3A 4I6YA 1HHTP 3Q24A 1XMOF 1SL1A 2R7OA 2VQFF 1GT8A 5L38A 2HGMA 4O23A 3DGVA 4F0MA 5EN1A 4WZMA 2DGSA 2DGVA 4DX5A 3VAIA 1N5YB 2CJAA 5CZXA 2PGCA 4A46A 3CJKB 3BZQA 4R5PA 4OX8A 4GKJF 4FVMA 3R5DA 3PIPQ 2E9RX 4WFXA 1IUJA 3HKZD 1PC4A 2VZ9A 2OGUA 4I4BA 2WRMA 2F65A 2HNDB 3AQOA 2AV5A 1R6YA 1FJCA 1RT5A 2RILA 2PIIA 2ALYB 1HL6A 4LREA 3JYTA 1JXLA 2XI2A 3EDRB 5H9FJ 4LF9J 5G0RA 1R8BA 5J2QA 1U1QA 2G1DA 3KMQA 2AX0A 3G96A 3CMQA 3OVAA 2HFZA 4R25A 1TK5A 3C66A 1Q86T 4BS2A 4B3MF 1ZPWX 4WZQA 1IKWA 2HFUA 1VQSA 4ICLB 4MK7A 1VQ6S 2HLUA 5KFAA 5KFWA 3D3BJ 3JSMB 3ISND 2KKHA 4CWBA 3T1YJ 5KT2A 1WF2A 1QLNA 4OX9F 2W4DA 3FVYA 4NZ7A 4OHXA 3PW4A 2Z2YB 5A6WA 3AWRA 3BGRA 1LWFA 3GMGA 4KC5A 4NEZA 1HNWF 3BH6B 1OSDA 2H54B 2OSQA 2JH3A 4F2SA 4Z2XA 4DPTA 4NL5A 4NMXA 4U8YA 2W24A 4WXWA 4IOBA 3QGHA 4J9LA 2FPHX 5LXRA 3HSDA 5ETPA 5G0RB 5J2QB 1RHQB 3JSYA 5KT7A 3HVTA 3RRHA 5HLFA 2OPRA 2BJ7A 5J1PA 3GFHA 2VFRA 4F3QA 2CQ1A 3PFEA 4RNFA 1NKEA 2HAIA 3MPDA 5DS7A 4Q8EA 2BZ2A 2JJ4D 3PACA 4WU2A 1YBAA 1HI1A 1M5HA 2VFVA 2B7BB 3GJRB 5HJXA 2GVDB 1IM4A 1T9WA 2HNYA 3HHLB 4FVCA 4RUBA 5DLFA 2R8GA 1K1QA 1S1TB 2VPWB 4ANEA 5HANA 1S1TA 2KVQE 2KXFA 3IM9A 3W7BA 3DLJA 3M8QA 4KO0B 3TOQA 3MUMP 1Q78A 5IOLA 1KNZA 3B82A 2DXDA 1DLOB 2RNEA 5LSRA 4YUDA 5BYRA 2OPRB 3AD8C 3M6WA 4PQUB 5HN0A 1PYTA 3AA8A 5B7WA 1VBXA 1TVRA 4RW6B 5HI7A 1VRUA 3FNNA 1GK8A 1VI7A 2D74B 2HBQB 2JNJA 4L3KA 4ELUA 1TL4A 3VAGA 4WKYA 1FE0A 2HLTA 1FE4A 4RW7A 4F50A 2P6SA 2W2OP 3MTJA 5DETA 4TNOA 2VD3A 3GR1A 1JJ2R 2E1PA 2XS2A 3DLKA 4HR2A 3H5XA 3W9HA 1Q8BA 1TKTA 2OFHX 4C7QA 5RUBA 1M5PC 2HYIB 2YX7A 3K17A 4WYLA 2GFFA 4PEOA 4B08A 2AQ4A 1S9EB 1WC1A 3MAAA 3DRSA 5AXKA 4M5JA 3CW2C 3U02A 2XO7A 4C98A 3TJ9A 4CLZA 5C42A 2EBGA 1FRLA 5C25B 3FEXB 4EZ9A 2B43A 3T5JA 1L3UA 4F4ZA 4ILRA 4YR3A 2UXCJ 1IR1A 3MEGB 3OR2B 3Q89A 4DV2J 2XMVA 2HHXA 3MR2A 3GG1A 2DHGA 2EPIA 4FYXB 2CIMA 2HEKA 1A0OB 2JEJA 3QLHA 5T7LA 4QWBA 4DR7F 1GH8A 4ZPTR 3M32B 2DITA 3M8RA 3NXZA 1FWKA 3CJQA 5E0OA 4NLTA 3E01A 3HO1A 1S9GA 1FD2A 1SXLA 3D6HB 3PW7A 2CAJA 1CC8A 2KZZA 1LKZA 2POKA 2H48B 2WTFA 2FHJD 2Q43A 4F36A 2PA8D 2IDLA 3MR5A 2W9CA 3CCQS 4JI6J 3EGZA 5A8WA 3P6YC 3IWXA 3EX7B 4ZLNA 1DY3A 3Q8QB 4K4ZA 3HXMA 1RTZA 2QTWA 4OZJA 1T02A 4ZIWA 2OPQB 4GKKJ 3GILA 4ZVOB 5KFBA 2DNKA 3M2VB 3PRBA 3W5XA 1DURA 1N6QA 4BWJA 1C1CB 3CULA 3NS5A 1YBTA 2HZCA 2LEAA 2WW4A 2G2ZA 2XLKA 3HD1A 4LSZB 3SEOA 7AT1B 4ZPVR 1HBNB 2YNIB 3MEDB 2Q6BA 3HCXA 4EYHB 3C15A 3WDOA 2AT1B 3N01A 1YJWS 1R0AB 1FTRA 4I2PA 1IBLF 2CQDA 4LQ3A 4DS5A 2GCFA 3V4IB 3CSKA 4DHVA 4L75A 2SXLA 1WSRA 2YWEA 3PYDA 5D0HA 5GAHU 4DCJB 2R8HA 4CNZA 4DFKA 3IBCB 2EG2A 4KQZA 1KQGB 3E3XA 2B6AA 2CDQA 3P4UB 4LF5F 4USUA 4QIEA 3QZ8A 2RB7A 3K2YA 1CJKB 1IKWB 4ICLA 4ZDNA 4DZ6A 4OIXA 5KT3A 1RWXB 3QT5A 2M88A 3AD9C 4DQIA 4DV5J 4CLSA 1RYSA 2GMLA 4HHUA 2Q6CA 3MUVP 3QIDA 1FDDA 5F8JA 2W2PP 4KH1B 4AL5A 1JWWA 4V1Ak 3TVYA 1X5OA 4DR5J 1YI2S 4YFUA 2YWWA 5ETKA 4ZVFA 4DV6F 1E6YA 1Y5NB 4QQBA 3Q86A 3BKTA 1RQ0A 1XMBA 5KFGA 4DX7A 3LF0A 2ZWOA 2OH2A 4M5IA 1RTDB 4JP8A 3SCLE 2BABA 1LW0A 3PG9A 1REVA 1XR6A 2EFNA 2V9KA 4TXSA 1FDBA 1JJ4A 3OVSA 1S1UA 3KFWX 1VBKA 2EEYA 5DO2A 5A2QU 2HBZB 1PBUA 4USTA 3QJPA 1PSDA 1UJ5A 4USJC 5HVHA 1FK9A 4ANCA 3KJFB 1X4AA 1HBUB 2W2NP 2VG5B 3ET6A 3K89A 1KLMB 1BE4A 1FFWB 4WXOA 5KOXA 4C11A 3UFCX 4LF4F 4CH0S 1NH7A 1FTCA 4Y2CA 4ZVUB 3KLGB 3DMJB 4ERDA 2R7UA 1EKSA 1LFPA 4OYPA 3SSSA 3G8QA 4AYBD 3TVKA 2VB6A 2E5HA 5JXSA 3MAHA 3MCNA 3JSMA 1CJTB 3KKFA 5L1JA 1T9UA 4I1TA 4OX6A 3QIPB 4LVNP 3Q2TC 1M1HA 2IM0A 4H4MA 2G9OA 5E5NA 3M32A 4ZA1A 4DL0C 3KLFA 1FRJA 1X4HA 4OZ2A 5KFRA 1Q0NA 2XNRA 2DEJA 3IG1A 4MJKA 3H4DA 4P72A 1J5OB 2RIJA 2RE1A 4MT1A 3A8IA 3MEEA 2HSEB 2YKMB 1CPZA 3IXQA 4U7UD 5I3UB 1PC5A 1FVSA 4HDGA 1Y5IB 1YRXA 2HKEA 1T94A 3J80Y 2WW8A 5IWAF 2XQCA 4EEYA 4Q44A 3D28A 1KRPA 4ZP7A 1MROA 3D68A 2QLJB 3DLEB 1RISA 3M8PA 3IM8A 3W5ZA 1CULB 3CMES 2GIRA 1R8PA 3M2UB 3GV8B 3I5BA 3NGTA 4M5KA 3G6XA 2F9DA 1GMWD 4DN0A 4HT7A 1PO6A 2NYIA 5EWFA 3IWLA 2C2RA 3I5AA 4C48A 2R9LA 3K59A 1CJTA 3MOJB 3FRZA 3KYLA 5A8KB 2DNHA 3HT0A 3OTDA 5KFTA 4TY9A 4HACA 4CO2A 3V6DB 3CO0P 4JI1J 1VIOA 1X5PA 3VCDA 2CNLB 4YY3F 2ERRA 3RB0A 3CIZA 4R8UB 2VF3A 2J6UA 1VDHA 2YNGB 3H2LA 1D8ZA 2NLWA 1HWKA 2HWIA 2KYXA 1WOSA 1HW8A 3LA0A 4ZVPB 4LR7A 2VQEF 4QPXA 2NXNA 2FVSA 1NZ8A 2EXUA 2MSSA 3E51A 3J7ZT 1SQEA 3HFVA 2QG9B 2W9CB 4JI1F 3UD5A 1D1UA 3G82A 3KLIA 4EO6A 1H2TZ 5KFSA 1VQ8S 3Q8UA 4KGZB 4C2MA 5D6GA 1NM2A 3PX0A 4OL8A 4KHMA 3WX8A 1I94J 3M6UA 2AZ1A 1K0TA 1MWYA 4B3MJ 1NCLA 3OTCA 1KTQA 5JVHQ 3DXSX 3W63A 5M2UA 4IR1A 3QWPA 3R2DJ 4CO3A 3Q2SC 3G8SA 2XMJA 4FS1A 1XQIA 2V4JB 2WONA 3JQJA 4J91A 1X60A 2B8QA 3TEGA 5JJBA 1WEXA 2YNFA 4XDDA 4OX7A 3GZ7A 5IS2A 1PILA 3D5MA 5CYMA 4ANDA 1QAJA 3W61A 2HQ3A 5H1SV 3RR8A 3BPSP 2I38A 4ZLPA 4C8NA 2CNKB 4KYZA 4Y28C 1NNDA 1WC5A 1WC4A 3G4SS 2FZGB 3QSYB 2KJVA 2C2EA 2F8EX 2WVEA 4OYMA 3OV7A 4ED7A 1EP4A 2DRAA 2GVZA 2R8IA 2WB4A 5I3QA 4H4KC 1NAQA 1NO8A 5D8HB 5KG3A 5ETRA 1D0EA 5A8KA 1AFJA 2V5HG 2EFGA 1L3KA 2NZCA 2OEJA 4KT0C 1X8DA 4ZP9A 2DIVA 1Q53A 2M7SA 3D0IE 1QAXA 3SQGB 1SJ4P 2UZAA 2J9CA 3LP1A 1KLNA 4OI3A 3NNHA 5KFPA 4AL6A 1B0PA 1RT1B 4DL5A 1IKXA 3T41A 1U2RA 1RHRB 5LXYA 4FXDA 4ES1A 5KAKA 2YBVA 2ABYA 1V9OA 2IBOA 4LRDA 3VGVA 4BHQA 4DBQA 2FVPA 4BWMA 4ZIVA 3VR1A 5EGYA 4DV5F 2OLWA 3KG1A 4DPUA 3HHNB 1TAUA 4WTYA 3UD4P 1N5SA 4ZVQB 2V69A 2L48A 1VBZA 1OS5A 2RVJA 2J9DA 2ATCB 5HQ8A 1KQKA 1LV5A 1D3WA 4OZNA 3A12A 1H98A 1X4CA 2HVIA 2XGQA 1PJ6A 2XMUA 1N33F 4B9TA 1BQNB 1LXNA 2AJ4A 3OL9A 1DRZA 4R0JA 2H51B 1S6OA 2L9WA 3FQLA 4G6VB 1Q7YT 4LIWA 3THTA 1Q81T 1TK8A 1ICEB 1TVRB 1YJUA 2U1AA 3SSRA 5GADU 1C1BA 4DR3J 1NMEB 1GTEA 5F41A 5ITHA 2WOMB 2ZITA 3I82A 4O3OA 4TKTA 3I0RA 1KKHA 3U27A 2PFFB 3EDQB 1KQFB 1T3NA 1LXJA 2Z0GA 1UVKA 1GXTA 2BV3A 3TW0A 4LQ9A 4B3TJ 3O1LA 4NA1A 3KUEA 2ZBCA 2ZBPA 1S1XA 2RD5C 4LFAJ 4PG8A 1YSJA 3M8WA 4CIOA 5FLXY 2PMZD 4DX8H 4LF8J 4URGA 2HVDA 1LEOA 2DR6A 1SIWB 3J81j 3MMAB 1TP7A 3W2WB 5HVGA 2CJKA 1TUVA 4OI2A 2IDEA 2PEBA 3AOAA 3MI7X 2HPUA 2HFOA 1RLCL 2F4VF 4ID5A 1BHNA 4DS4A 1Q5VA 2LYVA 3CJ4A 4ID5B 1FKOB 1N5VA 4WCEQ 2ZZNA 2P9GA 2H5EA 2Z2ZA 4MAKA 2BKNA 3AXMA 2EK1A 4K2JA 5C5JA 1NJIT 3MXHP 5LMUJ 3NS6A 3VAKA 3PX4A 2KXHA 3CE8A 4MKVA 1SKSA 5BR8F 4J90A 4C0HA 4C97A 5BYSA 4WBFA 2DGUA 2AD9A 1N36J 4U9RA 3SCKE 4R8UA 2FJAB 2O5DA 1N32J 2XZDB 4N77A 4MKAA 4PG4A 1TU0B 2RAQA 3K8VA 2D69A 4RWXA 2DGXA 2RRBA 2V68A 3MEKA 2GW8A 1NUEA 2KO1A 4IFVB 4IQMA 3JAMY 2HFNA 1S7HA 1LWEB 1YX2A 3FBFA 4USMA 3ISZA 5KFOA 1F5CA 1FJGF 1GMUA 2DHXA 3THVA 2C1EB 3PKYA 4ILMA 4OI4A 4LF7J 2W8LA 4A8MP 1OY8A 1XEZA 3LOUA 1FWPA 2ZDOA 1FRKA 1N88A 4U96A 4ED6A 3DOMB 2NYHA 5ETSA 3IAM9 4U6PA 4LFAF 5CH7B 2JLEA 3AFGA 1PKUA 4G1QA 5CHCB 4X66J 3T5LA 2DRBA 4KHPF 3NG8A 4I64A 4JI5F 3L95X 2DT9A 4P2MA 2ZHAA 3DRXA 2M8DB 1X4BA 4LSNB 3IS9A 4J9KA 4LSNA 2LEPA 2GA7A 1T7PA 3LAKA 1WJ9A 2X3GA 1J5OA 4TQRA 3QAUA 6AT1B 4QR1A 2FJWA 5E3PA 4ED5A 3DDIA 3LANA 3B4DA 1BLUA 3MEEB 3MR7A 4FN5A 4TY8B 4UQGA 1FVQA 3DRYA 5B09A 4H54A 4Y0FA 1RTIB 1RAEB 4H4MB 1FA0A 1NLKL 2K8GA 3QGGA 1IM6A 1RT3B 2B3TB 4Q7AA 4YY3J 4O44B 3LWMA 3LP1B 2HNDA 4MK9A 4RBVA 4KY3A 4ENOA 2QO3A 2OTJS 5KFJA 2RKIB 1HBOB 4JBCA 4UZCA 4DF4A 1VLYA 4JOUA 4J9VA 4W92B 3UDVA 2W4PA 5GAGU 1X0FA 3WIUA 3I4PA 1N34J 1U6FA 3TVZA 3R6LB 3Q23A 1NK6A 4DV6J 2YKPA 1OWXA 2LECA 1JLAA 4QIWD 1YITS 1D9DA 1UVMA 2R8JA 4NWBA 2K06A 1Y3JA 2W2MP 1HNXF 4PCQA 1D9FA 2EC2A 1B0VA 1FF2A 1GQEA 3NCQA 2L41A 2JL9A 5D4NA 2D3OR 5AJ3J 1RUSA 4AFFA 1NDLA 4RKUC 4ZPAA 1F2HA 1FESA 4DU7A 1U0HA 3KLHA 1NHVA 2XHWA 2GQ2A 3BR8A 2X1GA 3I0SB 1DZ5A 3KUHA 1VQLS 2GNKA 3U1MA 3KG0A 1SCJB 3H98A 5F8GA 3W9IA 4DSKA 2BQ3A 2VG7B 2XNQA 4J9RA 4MIAA 4JB8B 3B4MA 4CZCA 4ED1A 4PQUA 4IFYB 1ZZNA 1U48A 2M52A 3H5SA 4I2QA 5AE3A 2BOPA 3Q8PB 1HYSB 4K4YA 1NPRA 4EBEA 2XTEA 5IT4A 1KD1T 2IM3A 1SKUB 4EFAC 3ZZYA 1CLFA 2DNPA 1SKWA 3N6MA 4WK1A 3FBBA 5LJ3Y 1UVJA 3PRVA 1WOPA 1RT2A 2IJNA 2UV8G 3LP0A 2YNHB 3MF5A 4GC6A 3KG4A 5E41A 1OMSA 3EYZA 1F0XA 4YHHJ 1SBRA 3BQ1A 4URQU 5K20B 2VOOA 4KHPJ 2AYMA 3R5JB 3HMJG 3T3FA 2BMBA 1CC7A 4M5NA 3W8PA 3TA0A 3R27A 2MZSA 3QT7A 5KG7A 3NGDA 3W64A 2MTLA 5K8MA 2DHSA 3CCZA 4A8QA 2XSJB 3ZNJ1 2DD8S 1LFWA 2BW7A 1SQFA 2N4DA 1MWQA 4PYAA 5D0RA 2CWXA 4ZVEA 4GMKA 4USKA 2BUNA 3FZBA 3CD6S 2KRBA 2XTDA 5H9EK 1B64A 4XK8C 2MSTA 5BJRA 2J9EA 2OTLS 3PW2A 5IXUA 1K9MT 4KGKA 4WTOB 1PJ7A 2YY3A 2MJNA 5IV3A 4PPZA 2K3KA 3MTKA 4L73A 3IGVA 3MM6A 4RPFA 2VH7A 2ALZA 1JMTA 4NRUA 5FLXU 4NA3A 2FQQB 1XMOJ 2P9CA 4IOCQ 3IBFB 2F8MA 1UAWA 4YQWA 1U1NA 2MLYA 1YTYA 1UCNA 1RU1A 4PWDB 1IWAA 3DLBA 4PRFA 2YKNA 2Z57B 3KOAA 3TA2A 2W2QP 5ETNA 2B8PA 1H2UX 2GQQA 4DR1F 2ZHBA 2BJDA 5L1IA 3VAFA 2FC8A 2MQMA 2V2QA 1Q1KA 3HSJA 4DL3A 1S9FA 1IBLJ 3QGPA 4JYAJ 3UW1A 1MN9A 2CQPA 2LU2A 3BGLA 3MPWA 5SZTA 4AQYF 1QVFR 3C16A 1WTFA 5EWGA 3KK3A 3CCJS 1YLXA 1W26A 1JNRB 2HNZB 1WF1A 2Q3PA 3DI6B 4FXVA 2ACYA 3MAQA 2ZH2A 2JEGA 1EAYC 2BEFA 4B3OB 2HHQA 1IKYB 3BSNA 4OHZA 4YB5A 3W8GA 2GJIA 3T9ZA 3CMAS 1VQPS 1FK9B 2ACMA 3AA9A 1TZ0A 5FDLB 5F0WA 3SZ2A 1U49A 3IR7B 3NWRA 1HR0J 1DTQB 2MLZA 2GJ2A 2MZ1A 3OHBA 3M9NB 1XC9A 2ZH3A 5LMNJ 1R3NA 2VFSA 2YQ3A 1AROP 3KLEB 2GGPA 1S57A 4F25A 2CYYA 5B0FA 4USIA 3N0VA 4WFYA 2PI4A 1UEUA 4ZN3A 6FD1A 3HZEA 2JWNA 2XZ2A 1HBOA 1CJVB 3A1YG 2BKPA 3A3PB 3KXDA 3MCOA 5KFVA 2V94A 2G0JA 3VVTA 3ZTSA 4A8OA 4G1IA 2RQMA 3IWNC 5THWA 4J9SA 4DR4J 2MHEA 2ZNZA 3M8YA 4A8YA 1KTVA 3OL6A 4KH0B 4MIWA 5BR8J 1M5KC 1H7XA 1YG0A 2V9WA 3SBMA 3EZUA 5CYQB 3TX0A 4ZVGA 2FJBB 2LCWA 4K0KF 5IT9Y 4J9QA 3H2UB 1N48A 2OPPB 4HEA9 2EKYA 1ZH5A 1NEEA 1RWOB 2AZ3A 4N56A 1TMJA 2PMWA 2L08A 2M0GB 2WK4A 3MZIA 1XK8A 1M5OC 2NREA 2ZM6F 1WC3A 3I9V9 1RCOB 1C2PA 3H59A 3EPIA 1UPPA 3CCMS 2UU9F 2GO8A 2F7VA 1AW0A 2B7CB 3KHGA 1S0NA 3FKBA 1RT7A 2D3UA 4H4OA 4DN9A 4X4OA 4FYDA 1FKPB 3MMAA 1HBMA 3RBDA 1U1LA 4FNHA 4PXBA 4YS2A 4CP5A 1DBDA 4B3TF 4Y65A 2C3MA 5IQQA 4U95A 3I4HX 1MG7A 2RMLA 2XTJP 3ENVA 4FPIA 4AXJA 1R7IA 2O3DA 5KG2A 3RJMB 4O0IA 4IOAQ 5CABA 3TP2A 3CNQP 4HVZA 1BWVA 2C2OB 1AYEA 3GJSB 3CJ2A 2WSCC 2XEXA 4ID8A 1SC3B 4LFBF 2Z58B 3GIMA 2DGQA 1NK8A 3E01B 1KHVA 1V3SA 2DNQA 3M4XA 3C3LA 3OTBA 1L3VA 4I69A 4I6AA 3AY0A 2A18A 2COLA 4RW4A 5KFUA 4FYWB 4DMZA 3CC7S 2ZBIA 3SMZA 3KJQB 5K8OA 1KVKA 4C9DA 1EZZB 4ZHRA 1O5JA 4DV7J 1HLWA 1Q79A 1VK3A 2QX0A 3HHEA 3FQKA 5AXMA 4Z7CA 1SKRA 2ZJQQ 2UUCJ 2VQEJ 1ZPVA 4DV1J 1FDAA 3ILIA 3IS9B 2V8PA 4X4QA 2OKQA 4DUTA 2CJQA 4JI0J 1U25A 2JHEA 2RDIA 3QZ7A 2AYBA 2AGPA 4DR6J 1FDNA 3TJ8A 2DGWA 3J7A1 4IQXA 1FD8A 2CUYA 2O66A 3UR0A 3MDFA 2PMHA 1S1UB 2HRYA 1HBMB 1R0CB 2BE7D 3PYEA 1WHVA 1OY9A 2KT3A 3ITHB 4Y2KA 4NA2A 1CQNA 3CJ8A 4F4AA 3M6XA 4XPEA 4DG1A 2MEWA 1JXVA 4URSA 5KFDA 4BLGA 3CDBA 3GYNA 2LKZA 3MM7A 3UN3A 2I6WA 3MUTP 5J2PB 3N6NA 1SPBP 3R5GA 5E3QA 2L3MA 1O0PA 2ASYA 2E5IA 3LGHA 3IR5B 4A8WA 2J6TA 2QZ8A 2E1MC 4RZRA 2MDAA 4NCGB 3SV3A 3UWTA 3JSBA 1FWLA 3MURP 3HT3A 4XDCA 2QIFA 4CLPA 3FBEA 3GIIA 4YN3B 1UWAA 2MQLA 4J9PA 2ADCA 3IAS9 5L9XA 3GR0A 1UJ4A 3GIKA 4OFZA 2UVUA 2AX1A 1RA6A 4H4KA 5J2NB 2JSXA 2RH3A 4KRWA 5K8PA 3GU0A 3QWUA 1RAHB 3V4IA 1JX4A 2CQHA 1X0PA 2RU9A 1EARA 2HK3A 3FSYA 3RAMA 3RZAA 3TX8A 2MQPA 4A8KA 1XMQJ 3K5OA 2ZHOA 1WORA 1B4SA 2WSFC 1GMWA 2IIHA 3UE2A 4DV4F 4LRAA 3AX3A 1S12A 2LVWA 4NASA 5EDWA 1SH0A 3G2XA 3BKUA 1X5TA 1Y3KA 5KFQA 3N6LA 4IRDA 1VQMS 4DL4A 5GMKa 2KFNA 1RGVA 3KMSA 4I68A 4B3OA 1HARA 3IGNA 3MMCA 3MFHA 3ISNC 3A8JA 2H5IB 3G8TA 4DCOB 3V81B 3GQCA 1WELA 4CM0A 2BQRA 3OSPA 2FVQA 1J5EF 2YNHA 4UW2A 5EWEA 2NCKL 3D0GE 2FZCB 2Y3YA 1CQMA 3DKDA 4DSIA 4FF2A 2VDIA 5HBMB 1NJWA 3C19A 1HQ2A 1WEZA 1YQHA 2IRYA 3PYGA 1YZ7A 4WJBA 3ZFVA 4C6AA 2EBEA 2HQFA 4N7TA 3OTOJ 1RADB 1W2IA 2ZE2B 4HL9A 2CXEA 4P7TA 5KFNA 4DFJA 2JZ5A 1VQKS 3CO9A 4OHYA 2PSZA 3CJSA 4JV5F 4HYKA 3EICA 5IWAJ 1JLCA 4CO1A 2KYZA 4DX6A 2RDDA 2Z2LA 4Q5VA 3G9CA 3QJLA 1XNQJ 1TFWA 3W66A 1I5OB 1CBKA 1NHUA 2IRUA 3DFEA 4ALZA 3SYZA 3DRPB 3QO9A 2AMCB 3HLUA 1FXDA 2MZRA 4QW9A 2CZVC 4LJMA 4MH8A 2FDNA 1U6ZA 2ZFHA 4QR0A 2DHAA 4WWSA 4LF9F 4LFBJ 3PFOA 4O3QA 3M2RB 1X4GA 1HIYA 1NPPA 1IJFB 5LOQA 4Y2IA 3UCGA 5KG5A 3DLKB 4ZLLA 3NMRA 1ZAVA 1WACA 2V8GA 2B51A 4QOTA 4ZP6A 3GSDA 4U67Q 2XY5A 2DBBA 3FDSA 4N8OA 2V67A 5CCLA 4F8RA 4LF6F 4ELVA 1LW0B 3JB9k 4DG1B 4A48A 4C8OA 2HS0A 1H7WA 3IO1A 4I7FA 4GKJJ 2V8VA 5BXIA 4UUXA 2KRRA 3BO2A 4WFZA 1FXRA 2V0NA 1FJ7A 1ZM9A 4DQPA 2H4YB 2VBZA 4RNNA 3HHDA 4EZ6A 1X9SA 4DLEA 4BDPA 5HK4A 2JEFA 3M8QB 2W9BA 1MMDA 2CWKA 2KB2A 4TYBA 3L09A 2ZM6J 2XHCA 2GC8A 2MKSA 4RW9B 2B9XA 1NU4A 4ETXA 3V6HA 3UNYA 3PVXA 2CZ9A 3EXCX 2P2CB 3DRPA 3EZ5A 5B0CA 2C42A 5LSOA 1UFLA 4DR5F 2YKMA 3ONQA 1G2EA 1KBRA 4FXWA 3PIOQ 4O4GA 4UY8T 5D77A 2FZKB 1WKKA 3MECA 4UF4A 1Q7LB 1S4FA 4NOHA 4WU3A 4WFNQ 3QGIA 2RUGA 2QA1A 2VC0A 4CLFA 5C2GA 3D1OA 2MZQA 4NCBA 2JDJA 1FRMA 5DQIA 3NP5A 4FKXA 2XCPA 1UW9A 4LMZA 2VPZB 3TJAA 4B9LA 4F3MA 4IR9A 3ZTRA 2JEIA 4IKAA 3MMBB 3CGIA 2XTCA 2LLZA 4FYVB 5L46A 2AP6A 2RF2A 2V4QA 4CLTA 3BGRB 4OLPA 2EW9A 3BS9A 4AXIA 1QDUB 3KHLA 3Q83A 1RWWB 4X65F 2R4FA 3AD7C 3FFIB 3O44A 3UVJA 2IPOB 3J81Y 4B9NA 3GWCA 4QWCA 3EM1A 4RUHA 4ZKAA 2YNIA 4L76A 2DR9A 1OSCA 1DAXA 3QBCA 3PW0A 2VJUA 1FKPA 2ROPA 4OV6A 4DSFA 2BR0A 3GTYX 1P27B 3U1LA 5D0EA 2DTJA 2NXJA 5LSLA 2CVIA 3MECB 3RRKA 3BGUA 4C8MA 2HQDA 1QSLA 2X1FA 4L72B 2VA2A 2W1BA 2Z30B 4NEYA 1Y0HA 2G4BA 2RQKA 4YB1P 5U47A 3ILLA 3MEGA 1VJQA 1R31A 2CA9A 3G86A 4Q2LA 2XGPA 2I5JB 3NCRA 2AEMA 2J7UA 4QR2A 2D3O1 4P2FA 4C4WA 2MKIA 5C25A 1PJ5A 2W4CA 3LP0B 4FPRA 4MIBA 1BC6A 2W9BB 1FFGB 4NCGA 3K58A 2LQ9A 1UWBA 2DXFA 2X51A 3P49B 2BJ1A 3M05A 3PHEA 1KVJA 1VYAA 4O0NA 3BPDA 2EFQA 3D3CJ 4K8RA 5IT0A 3LH2S 5SUHA 3VQTA 1M1KT 3H5UA 1LW2A 2EK6A 1SJ1A 2PC6A 2ZH1A 4PUOB 5F3ZA 1R8HA 3W65A 1OIAA 1K73T 1UVIA 2VG7A 4YMEA 5KG6A 1MLAA 4CT9A 4DSLA 3M1VA 2MKJA 3QSIA 3AODA 4UUWA 2HHTA 4DV0F 2YWHA 3L7UA 4QYRA 1LK7A 3MM5A 5HVFA 4HTJA 5B0EA 3PX6A 3CDUA 2EI5A 3TUJC 2G2OA 2NSBA 3DC2A 1X4FA 3NGSA 1ELOA 1B3TA 2NQPA 1JK9B 3GFYA 2DNZA 4RNHA 2YKOA 3BN7A 1M90T 2MLXA 4C11B 3D9BA 4ECYA 1TKDA 1A9NB 1GXLA 2Z56B 5JMNA 3S1TA 3N4WA 1JLQB 1AA1B 1WG4A 3FZ2A 2H3EB 2CNNB 2A3JA 4YB6A 4F0KA 4N5SA 3FEZA 4HDHA 3RR7A 2UUTA 1WG5A 2QA2A 1V3ZA 1LOUA 2FVRA 2DR5A 2J8SA 3ZZPA 1E6VA 4FBTA 3BO3A 2RQCA 4TN2A 3R5CA 2UVVA 2PEHA 5CD4A 1IN0A 5CQGA 3OUYB 5D78A 5IC6B 4BC9A 1S77D 2DXEA 1S0VA 1U0SA 2YKAA 3VAJA 3T5KA 1WI6A 3I6PA 2A6MA 1NZAA 3ILOA 4KO0A 5CA5A 3L3CA 4DR1J 1MMNA 3OHAA 4PWDA 4CTAB 2V50A 3CPWR 3PYFA 2VKRA 3V6KA 3PR5B 1FJEB 3D0HE 3V2UC 3Q0AA 1X5SA 1NJYA 3DOKA 3KK2B 1JJCB 1EKRA 4ZITA 1Y11A 3IFEA 5HROA 4NLDA 4WK3A 2C3PA 2N7YA 3NY0A 2B4UA 1HI8A 3HHLD 3QAEA 2DH9A 4D3GA 2QE5A 5K5MA 3US5A 3AH6A 2A10A 1RHMB 3SIPB 5HQLA 3BQ0A 1HNZJ 3QRPA 1V5IB 9RUBA 4HKQA 2JLGA 4LFCJ 3K7RA 4WP8A 2VDHA 3MEDA 3OPKA 5J1EB 4IUFA 1JKHB 1S6PB 2NUUG 1PIEA 4CYUA 3GIRA 1U8SA 1K47A 1RE1B 4AUKA 3CF5Q 2XSJA 4B9MA 1C4AA 1YJTA 5HL7Q 2NSCA 3KUGA 4KB7A 4XAKA 3NAHA 2UXDF 3AB4B 4YDDB 4F4YA 1YJ7A 3OL8A 1I3OB 2GQCA 4EBDA 1DLOA 2JVOA 4ZVTB 3PJWA 2YPZA 5HSPA 4A47A 1CEZA 2ZOFA 3D7SB 4TVAB 1SH3A 1IBMF 2UUAF 1N0VC 4PWWA 1RU2A 5F8LA 2EWHA 5ETOA 2PFDA 3RW7A 1OM2A 3PM9A 4ECUA 5E7OB 2XYGB 4DUZJ 1URNA 3C6TB 3CD7A 1DFDA 5J2MB 3BSCA 3OFFA 1ZAXA 2YNGA 1GAOA 5A8RA 3QNWB 3IMQJ 2RS8A 4AT1B 4R0EA 5KOWA 5L1LA 1F9HA 3VAMA 1RHJB 1NDKA 3KDNA 1S6UA 3A8KA 3UNGC 3W60A 3MCSA 1UEVA 4EMDA 1LNQA 1SJFA 3PTWA 3HVTB 3AB2B 4F04B 4LSLB 4C8LA 4JI3J 2F5GA 3OFGA 2F4FA 4OQJA 5D4LA 3MR6A 1UL3A 2HAFA 4PG6A 4K4TA 2EKNA 3IR6B 4UTGA 2HW3A 4P52A 1KHWA 3TUIC 1NSAA 4RWWA 4X4SA 5LMUF 4P74A 1UP1A 4EU0A 2H9ZA 2GHVC 4LT6A 3DLEA 3PXGa 3OR1A 3FSIA 5F8MA 4GRSA 3CCES 4ECZA 2ROEA 1IKYA 2YNFB 4JI0F 1HPZA 1ZTTA 3BSAA 2VIHA 4NLVA 1HNXJ 4GVLA 2MQOA 1DQ8A 1NK0A 2J5AA 2APOA 3FJ2A 2ZH5A 3OLAA 2BXJA 3S01A 4DQRA 1IVZA 2AJ2A 2QSFA 3ZZ0A 3BJYA 4Q0BA 2DCUB 4OI6A 4E98A 3KHRA 2UXCF 4JI2J 2XM3A 1DQ9A 4DV3J 5KFZA 2ZE2A 4PUOA 1UZDA 1S79A 4P9SA 2HHVA 2V2ZA 2LEBA 2QT7A 3G82B 1MU2A 3KLIB 4OHWA 5HQMA 1UA0A 5E3RA 3AAWB 2FVCA 2YKNB 4KKOB 1KONA 6FDRA 5DM6Q 1X31C 4JYAF 2FLLA 2DK2A 3KDOA 4EYIB 2A6OA 5IM0A 1L3TA 1XWLA 3GG0A 1Q16B 1AB8A 4MFBB 1JLCB 2OMLA 3TR5A 2D9PA 2FYXA 1HA1A 2VV5A 3LWLA 4OYOA 2HBRB 4KJIA 3GFZA 4ED2A 4FF3A 1GTHA 1NXIA 1WDTA 4QW8A 1UKUA 2P8IA 3D66A 3NBPA 4UOFA 1TKZB 3VVUA 2Z4PA 3RTVA 2MKYA 4DXLA 2DPJA 4ED8A 3MM9B 2LDIA 4B17A 4LRBA 5KFIA 4X62F 1EHWA 4ZP8A 4FYYB 2KH9A 3TO8A 2EG1A 4Y2MA 3VZIA 4NLOA 3WIVA 5GAGI 3C14B 4NZ6A 3TNVA 5J2NA 4ES3A 1D9AA 1ZS6A 3D1QA 2D7SA 2GIQA 4FS2A 2W9AA 3LO3A 5F8IA 1ZM4A 4ECSA 4KFBA 4JV0A 2NR0A 2BE2B 4JI7J 3O6QA 3PY8A 3AX2A 1N32F 2R7VA 2MJUA 2IHR1 2PN6A 2WSEC 2LQ5A 4DF8A 1NB7A 4DR7J 4X4TA 2MQQA 4CLUA 3HPOA 3TZWA 1U4BA 1KOOA 1NSQA 1OQ3A 3DHXA 3HHKA 3F41A 2QGFB 4ECRA 1KOHA 4YB7A 1JLGA 2HQGA 2ZNYA 2RJZA 3K5PA 4K4VA 1R89A 1WHYA 4IG0B 1SL0A 4ZPCA 3EVMA 1VS3A 3VWSA 1Z1ZA 3M30B 3OSNA 1IKVA 3F0NA 5EX3A 2QV6A 2UP1A 2XB2D 2WBMA 4TU8A 1KLMA 4HHHA 1NDPA 1UA1A 2FJXA 2NXUA 2BJ9A 3S6EA 2Y8YA 2CZ4A 2R3VA 5D4PA 3GV7B 4WKRA 3DI6A 4NLYA 3ZTOA 1APSA 1DJ0A 3I9ZA 1VGYA 3OFEA 5EHHA 8ATCB 3FC9A 3OTEA 1RAOA 2AWZA 1T11A 2KVIA 4RW6A 1VBYA 1RTDA 5A6PA 2W01A 1EETA 3D6TB 4JV1A 4ATNA 3TZXA 2FTRA 1U8WA 3UCZP 2ASDA 1FFSB 2AU0A 3WHIA 2ILZA 1JNZB 1DHMA 2CQ3A 3QLHB 1HNIA 2UXBJ 1QM9A 2C2DA 1H2VZ 3DHWC 3M2UA 3W9JA 4ECWA 1U1MA 1RTIA 2AGOA 5DDQC 2R7XA 1I94F 3VV2B 2G1HA 2GVDA 2HNYB 1OYDA 3HHLA 2M2BA 1F9EB 5F8NA 2IVMA 2R2SA 5IFMA 1P9YA 1B70B 3N79A 3CEDA 3UCUP 1WEYA 1FRIA 5L8RC 2KG1A 4MMOA 5HMZA 2ZOGA 2UUBJ 4KHRA 1IBKF 4ECVA 1Q4RA 3BV8A 1AT1B 3CJTA 2PD1A 2CPHA 4RW8B 1PAUB 5GMDA 3RBZA 1HW9A 4CQ1A 3C15B 5B0BA 4ED3A 1ZYQA 1P9QC 1WF0A 1U09A 3NWGA 4PG7A 1S1WA 3S7RA 3L7OA 2YX4A 3WC0A 5L39A 1CG2A 4P7VA 2BOAA 3A13A 2Z8QA 1B99A 3SQGA 2M8HA 5KT5A 1VRUB 1WDDA 5I42B 2CG4A 1HWUA 4N47A 2W7OA 1BXNA 1NPKA 2KU7A 2P6TA 2CJBA 1YVFA 2E7VA 4J37A 2ZWPA 1MNEA 4KV8A 3T6BA 3H2VE 3EGNA 3DMJA 2W8KA 1G3OA 2WZ1A 1T03A 4IYQA 4PZVA 1MSWD 2AGQA 4K50A 1YJNS 4ZPDA 1KC8T 2FGCA 1QTNB 2IC3B 3CT9A 4ZPBA 1OPZA 1R27B 4RBTA 1HBUA 4CI0B 4CRJA 1ZA1B 2ZOMA 3OT9A 4OLOA 4ZVHA 2MQ8A 2JOQA 1FNOA 3AJ2A 3MD1A 4ITSA 1SJQA 3VZHA 4OHVA 2G0IA 4CM2A 2H4WB 3BB5A 3GLJA 3TUPA 2F40A 1S9GB 1P1TA 4D3HA 3M9OB 4LF6J 4ER8A 4X4PA 1XJWB 3DLGB 2Y1RI 3K5NA 1TR0A 3GJQB 4C8KA 1FKOA 4C0OC 1M1GA 4TQSA 1RWVB 4RNOA 3CJ3A 5KFLA 1F9FA 1UFWA 3MCMA 2KM8B 4OYZA 1XTZA 4U8VA 4OMFG 3HDSA 1AXQA 5HAOA 2X3DA 3K5MA 3THPA 3Q22A 2XZWA 3GIJA 1YRUA 5C42B 3FK4A 2QRRA 4CH7A 1QUPA 4KFBB 2GAHC 3POTB 3NAIA 1LWFB 3K5LA 4C3MA 3G71S 4DPOA 2BJ8A 3QT8A 4DFMA 3DM2A 3DYAB 1BWEA 1VRTB 2YWKA 1DARA 1VFJA 1CJVA 4F4XA 4JI8F 2E7XA 3BF4A 1UUJA 3SV4A 3TQ1A 2EC0A 1IBKJ 3DXBA 1HBNA 3CVKA 2UUBF 3DLHA 4LF2A 2X1AA 1QJHA 3BKFA 5DG9A 2ZVIA 1GEHA 1EB0A 4B9VA 3PR4A 1FRHA 3BBCA 4EWTA 2XLIA 4UOGA 2GX8A 4A4JA 2JC0A 5DJBA 5FDLA 2AJ0A 2XCAA 4TY8A 1WNEA 5D4OA 5E3CA 4QBUA 4M5HA 3CIMA 1HFEL 3HM9A 3UDCA 3LGMA 1FT8A 2JRSA 1QSYA 3QT6A 5B0DA 1HKAA 3H90A 3UDEA 3UI3A 3BDPA 3QQCD 2Y0SD 4OJHA 1IKVB 4K5SA 5A8WB 3R1LA 1IXKA 1PYSB 1VMBA 2B0GA 2IFXA 2YQ0A 3AHPA 3C16B 2XG8A 5D0GA 2CNOB 4XO0A 3OLBA 2VBXA 4YEAA 1QAIA 1W7WA 1U02A 3VALA 4YR0A 3WX4A 4ETZA 3D1HA 3A4TA 4IO9Q 2HGLA 2MKHA 1LWXA 3T19A 3E8OA 2M4MA 3CJRA 5D15A 1L3SA 1HMVB 4ZPWR 1U1KA 4DSEA 1S59A 1PGZA 2VFUA 2DNMA 2G2YA 2X1BA 1WHWA 1WTBA 4W4MA 1RDRA 2ZKUA 2BANA 2G0CA 2MMYA 4WFBQ 5DG8A 2GVZB 4IFVA 4OZ1A 2XBPA 1RTHA 3FFIA 3IP0A 4A8XA 3MR3A 5H9FK 1ZA2B 1ZZFA 3HJVA 4JI6F 2H1YA 3MAAB 2LXFA 3C6UA 3P96A 5C2CA 2DKOB 1EQMA 2NXCA 2PE8A 4C8YA 1N5TA 2ROGA 3TI0A 3WQPA 1GX6A 3IBWA 5AXLA 2IJFA 1F6TA 3GJTB 3ENAA 3SSQA 3MHYA 1A7GE 1X4DA 2LQBA 3W2VB 1N36F 2HZVA 4JI2F 2NZ4A 1FRXA 1SQGA 2O67A 1BGXT 2HK2A 3GB0A 1VQ4S 1NSKL 1HMVA 2GMHA 3EUNA 1SV5A 3NBPB 4WP9A 4HH1A 2CQGA 2DNOA 3VQSA 3KNAA 3PNIA 3PEHA 3D2WA 1URRA 4J9OA 3RBXA 1SC6A 1RP5A 3EWGA 3J7YU 4DV0J 2DNYA 2C2KB 4UY85 3ELHA 1BD6A 1TL3A 2BW2A 3NGRA 1TUWA 5CZVA 4CTAA 3J80U 3ZXWA 1T9YA 1CS4B 2QYGA 3M9MB 2AJFE 4F2RA 3EJMA 1I6JA 2VJVA 1S0OA 2K1RB 2QL9B 1U0HB 3KLHB 4NLPA 2K1RA 3I87A 1HR0F 1JLEB 2BRLA 1TFYA 3MFIA 1AFIA 1RTJA 2MYFA 3NKYA 2B6AB 2XMWA 2V63A 2UVRA 2E1AA 2HS4A 4CLWA 4DU8A 5ETTA 1VQ7S 4I2QB 3GPAA 2F8HA 4TLRA 2O1PA 3MM5B 4FF4A 2V2KA 3MM7B 1C0UA 1WC6A 2DYAA 4M5GA 5GAHI 4Q0BB 1WC0A 2MGZA 2DR8A 2WBRA 2CPFA 3AJDA 4Y3CA 2PO4A 3DU6A 4FZVA 4OZ3A 3HP6A 1A6LA 2AYGA 4ZCMA 1NKCA 1XNRJ 2UXBF 1FEEA 4NI2A 2LP4A 4DPWA 3KJVA 4ZCKA 2HMIB 4AD6A 1AZSB 4GVBB 4X4UA 4USHA 3DRRA 4MYUA 1XERA 2J8AA 2E66A 2IY5B 4ECXA 2QFJA 2VICA 2RT3A 1Y00A 1GMVA 2DO4A 2N3LA 2QA4S 1IR2A 2GO9A 3FGVA 4DUYF 5DM7Q 5IM0B 2I5JA 4XPCA 3OXFA 4PYDA 3KK1A 4NLGA 1VLOA 1S0MA 3LGNA 1TL5A 2FLOA 3B78A 2A1BA 3BBBA 1G6BA 1Z2LA 4Z7YA 3GCWP 1T05B 2CPDA 3DOLB 3MMJA 1FJGJ 4LVOP 3GYGA 4OYWA 1RI7A 1QY7A 4RW4B 1RT3A 4ES2A 1S6QB 2N82B 4J7CA 4G1QB 3TAQA 2A2CA 4LUBA 3AQPA 4ILLA 3QIPA 3DDKA 4J5OA 5DZ7A 1E6VB 3DOLA 5HJYA 4PXEA 2HHHF 3OR2A 2F1FA 4CDIA 2ILYA 1S99A 3PJXA 4OYIA 4JI4F 1RK8A 2MKCA 4AL7A 2R2TA 3FRYA 1G4CA 2BM0A 3A3NB 4P6QA 4ZK7M 3HI9A 5LL6d 2VG5A 3ET6B 1R8AA 3CDWA 1WSVA 2QLBB 4GO5X 1YK9A 3TWZA 2YX1A 3POTA 3U7JA 1UTAA 4XIUA 3G6ES 1HWJA 3MMBA 1JXEA 3H42A 2KN4A 1FI4A 1Q95G 4FP9A 4HI2A 4U7UK 3SDEA 3DOMA 1VOMA 2OUGA 3RUBL 2ASJA 1HD0A 4Q8FA 4N76A 2V8DA 4X2BA 1S1WB 1H38A 3MM8B 4GO7X 2HQCA 2J9DE 2BE9B 2W7PA 2YWFA 5KTQA 1Q8KA 2XMKA 4HH0A 1JLGB 8RUCA 2Y1LB 1QE1B 2E7WA 2LFVA 3TAMA 3DM2B 1PG5B 2CPYA 3PDNA 1LW2B 2K7KA 3D4JA 4OJGA 1EJ7L 4WE1A 1BUXA 1VHIA 4TYAA 2UUAJ 4IDKA 5CCMA 4DFPA 2VU5A 2GHWA 1LK5A 1UW4A 1RYRA 1NB2A 3NNAA 5FIIA 4DZDA 1RAAB 2WVBA 3T1AA 5LJ5Y 1RSCA 2XWXA 1HNVA 2Z2MA 3ETMA 2UU9J 4X4RA 2U2FA 4PXDA 2Y8WA 3I5CA 2R7QA 1FEHA 2V8HA 1UVLA 1SUQB 3BYRA 3VAHA 3NNCA 1RA7A 3BGOP 4MKBA 4BC7A 1ZM3A 3CCUS 1PYOB 1ITPA 3J81U 5FJ4A 4M95A 2UXDJ 3SFUA 2RU3A 1HHSA 4C0BA 1JKHA 1S6PA 2OSRA 4DV3F 1NBEB 4JI3F 4JV5J 4DJBA 2YWGA 5AJ3F 1S1XB 1SC1B 1ZBTA 4YR2A 2RQ4A 3W1YC 3ZTPA 1DTQA 1RABB 2J7KA 2RUSA 5T41A 4JI8J 2RHSB 2QLWA 1MROB 2FHOB 4MTPA 4P2XA 4NE9C 2Y1IA 1N8RT 1S76D 1HQUB 1H72C 3D67A 3SCJE 4M1KA 2N4CA 4NLUA 3PCOB 2G13A 1Y7PA 4LR9A 4P2SA 5E2QA 3V4MA 2IAJA 2LXUA 4KKOA 4RX6A 3BQ2A 5E3AA 4B9SA 2BX6A 3ZZOA 2ZC3A 4QIFA 4OX9J 3GFXA 3KK3B 4O3PA 4ZJLA 4MYTA 1CJUA 3IRXA 4BCAA 1NRKA 4ZMMA 4NYOA 1K0VA 3D6MB 3CCRS 1YZ6A 3AX5A 1FERA 2CPJA 1K1SA 3EZOA 1T05A 2NPIA 1YGYA 2XMAA 4O4GB 1B0TA 2DH8A 2HMIA 3BSOA 4LRCA 4YHHF 1XNRF 2HWTA 5HBMA 5M2PA 3QJJA 1Y9OA 1G7CB 4RR5A 5HO4A 3SCIE 1FKAF 3ETOA 2CDRB 4M5DA 1VC0A 1VQ9S 3QATA 1K44A 3UR3C 2FLNA 3VGTA 3V81A 4ZJOA 4UZBA 2BACA 2WCXA 3PKMA 1U24A 2OI2A 2BYCA 1LWCA 3CCWA 4FKYA 4WF9Q 4GVBA 3PHTA 4K4UA 1YHQS 2DGTA 4CLYA 2HVEA 2QMUB 1P6TA 2DVIA 4EK2A 4G3IA 1RXOB 2ZH7A 1PAEX 1N0UA 1ZTWA 4Q43A 1F2GA 1M5VC 1RB0A 2UV8A 2OFGX 3HSZA 1KSPA 2CQ4A 1RAFB 1NK4A 1UJ6A 1KQSR 2VG6A 2DB1A 2DCLA 2IYIA 1NK5A 1UVNA 3M8ZA 3T1HF 1JQGA 5DQGA 3OXLA 2CADA 2IM1A 2GJFA 5A0YA 3W62A 5DGBA 4LFCF 2KT2A 5H9EJ 3N28A 2RF2B 4M5MA 3EXYA 3NLCA 2H65B 4EI2A 2E1RA 3PZPA 2BA9A 3F56A 3N5BA 3Q8SB 1FNMA 2YH1A 2HHPA 3EPGA 3M30A 1HWLA 1HWIA 2EFOA 4OI1A 1TL3B 2YQ1A 3D6FB 1OY6A 1IQZA 2BKOA 3ENQA 1SH2A 1LQ9A 1VRQC 3EVOA 4LBHA 5ETVA 3F44A 4DOZA 4JI7F 4LF5J 3LP2A 2QL5B 3R7SB 3J7YI 4IFYA 2FIUA 1TTHB 5J2PA 4DV1F 2KFZA 1HYSA 3H8YA 4WIIA 2C28A 2CG8A 5HMXA 3HJFA 4DSJA 1REGX 2E9ZA 3R5AA 3UQSA 1HHQA 3OVBA 1XR7A 1SV5B 5C24B 1XIQA 1C1CA 4FDFA 4G1PA 2BVZA 3CB4A 1QUVA 3OR1B 4RBUA 1R8CA 5IQ6A 1QVGR 3WZ0A 1F5BA 1VCTA 3PO4A 4NXMJ 5CYJA 2XYHB 3MMCB 3NS7B 3UVJB 3C14A 2CJYB 3L9ZA 4QIGA 3C6UB 3UN5A 2AJQA 2VC1A 4JUZA 2KM8C 3EGVA 3X3UA 2PI5A 5I3UA 4I7FB 2BJEA 1TELA 2VFTA 4ZHRB 1SB6A 5K9FA 2H5JB 2BQUA 3R7NB 1F5AA 1O8BA 2MY7A 2RKIA 1YJRA 2L9DA 1SJ3P 1S72S 4CLLA 2HHWA 1RT5B 3R7BB 1YDLA 3KLFB 4CCHA 2E1CA 3JS9A 3C6TA 3M2RA 1WWHA 2LA6A 3CCTA 3V5RA 3R97A 2QLFB 3RG6A 2KHCA 4S0MA 2JC1A 9ATCB 4B3RJ 2NUHA 3QO9B 3RAQA 3MPVA 2KJWA 2OMOA 2CRLA 1YIJS 2AEJA 3CJ5A 1N52B 3DRSB 3KK1B 1MU2B 3FBCA 2PDAA 1KEKA 3BGFA 5CD4H 2VA3A 3QRQA 2MZJA 1CVJA 1B7FA 5HP1A 2CVEA 3EMTA 2C3OA 3ULHA 2ZVSA 3HFKA 5GAEI 5KFKA 4KAIA 2AYEA 3F73A 2PA3A 3BDEA 2B9YA 3GP9A 4M63A 1UETA 5C24A 4LSLA 1JB0C 1Q5YA 3QPIA 2DNLA 4MK8A 1F1BB 2WVDA 2YTCA 1XR5A 1H0HB 4DUYJ 3CWJA 1HPZB 2K7JA 5K8NA 3SQOP 2ZJRQ 3VF0B 3GCXP 1X9WA 3X1LB 3LTOA 5D3GA 3OBIA 4KE5A 4K7QA 4F0HA 3I56S 4WIQA 2JVRA 3RAXA 5BYQA 5DDOC 1NK9A 4N8NA 3IC1A 2XY6A 2R8KA 1TL1A 2HS3A 2J0XA 4I56A 1AUDA 3TEHB 3I96A 4ZOSA 2C2MB 4ZVSB 3JQKA 2OD6A 2FLPA 3HX9A 2Y9HA 3N5FA 2BDPA 2OAUA 1SI9A 1RKIA 3MWBA 1IBMJ 1X4EA 4V19X 2B9WA 4IG0A 2ZH6A 1VISA 5AE1A 2BBEA 2OPSB 2HVHA 2UUWA 2WHOA 4LR8A 5ETLA 2ZEJA 5A8RB 3GE9A 3N9UC 4QJVA 2IBKA 4BBYA 2Q79A 3DLGA 2LQ8A 3BO4A 1D09B 2FHKA 2FJEB 3P3DA 1HD1A 3HVAA 3W2WA 3RW6A 1GX5A 3W2VA 2QLXA 5HMWA 3I55S 4CH1A 3TANA 2UUCF 2MHNA 4KTQA 1HNZF 1TV6A 4CO4A 2DR7A 3TZZA 1N34F 3RBEA 1IR0A 5F9NA 3CUNA 2IC3A 1LWCB 2DH7A 2JX2A 5DRKA 3RB4A 1J5EJ 2HNZA 3I0RB 2LQJA 3BREA 3LPEA 2C2NA 2FUG9 3T1YF 1IWGA 4KV8B 3QFWA 4M5DB 4QU7A 4ZJQA 1FXLA 1T9XA 2KHDA 4B9UA 3ZZZA 1QTMA 3OJUA 1NKBA 5A2QY 1O6XA 1UEKA 4ZLJA 2J0SD 4N41A 2YKQA 3M7VA 3A3OB 1JJHA 1RWNB 3CDEA 2CQCA 5T7LB 3U1NA 2OP5A 1UWBB 1JLBB 3HKWA 2OPQA 4ZCIA 3K0JA 2GV1A 5IT9U 1CULA 1FX4A 3MPYA 3R2CJ 3T5HA 3SI8A 4WYWA 2FB0A 3TQEA 3DGPA 4JI5J 4F67A 1OO0B 2GAGC 2J76E 2XI3A 1Y5LB 4UOHA 4L3NA 4RUCA 2HURA 2CFXA 5KFYA 3NCPA 1RT1A 2EFVA 2XO6A 1TKXA 2KZMA 1M0SA 2RRAA 2C3UA 3B8HA 1RWKB 1YJ9S 3ICLA 1HNIB 1V5VA 2DY1A 5G4DA 2ZBRA 3I31A 2MXYA 1D8YA 4G65A 2VUGA 3FEYB 1RAIB 4LBIA 3C46A 1W2BR 4ELTA 2M70A 2QN6B 3HVRA 1KN6A 3H0PA 4C3KA 5GMEA 2VKZG 4DR6F 2EVZA 3ITHA 1FX2A 2W25A 3BBFA 3C8YA 2ZDPA 3DYAA 2N3OA 1IJEB 4QIVA 4O3SA 7FDRA 3KLGA 2ZH4A 2CPZA 3CC2S 3FCHA 4B3RF 1RT6A 4JI4J 5KG1A 2AF6A 2GIFA 4DV2F 3RYLA 4ECTA 1WOOA 3A8EA 1JLEA 2VQFJ 4XTTA 3ZZRA 2FJVA 2DNNA 3I32A 1EQ0A 2AKWB 1Y4ZB 2ADBA 2HFVA 4X84A 1W25A 3CXCR 1U2CA 2VONA 1TUGB 3M1VB 2I1RA 2QYCA 3AJ1A 3KWMA 2Q1LA 3P8BB 1RT7B 4F26A 2VBYA 1KS2A 3C2PA 1VQNS 4DDFA 2M5YA 2MKKA 5LMNF 1S1VB 1GXUA 1VJWA 4ZS6A 1KDNA 4OI0A 3GYXB 2WB1D 2YXLA 3LP2B 1GFWB 1EIYB 5CXTA 2PT0A 3GONA 2IVFB 1CJUB 1UFKA 3IRXB 3KNGA 3NEKA 4NXMF 4FF1A 2RSQA 3MM6B 2E5LJ 3BH7B 1RAGB 1ZETA 1HQUA 1H74A 1RACB 4DR3F 3PEJA 2WOMA 1BQXA 3Q8VA 3TZYA 3DCAA 2IMOA 4TLQA 2I2YA 2ZZMA 2BANB 3FCVA 5K14B 1TK0A 2HIQA 4I0WA 5IC4B 1TKZA 1PCAA 1TL7A 3B54A 1R0AA 1RBOB 2XMTA 3TRGA 1U1OA 3OJSA 3P5TL 4UOCA 4M94A 2CQIA 2DHHA 4DQQA 5DLGA 2VODA 2C3YA 4Q45A 2QEXS 5K14A 2XLJA 4DL2A 1RBLA 5B0GA 3M8PB 1G1XA 1S6QA 4NYZA 4FNIA 1VR6A 4LF7F 1VQOS 4NLQA 1SUQA 5AT1B 2XY7A 4MFBA 1CSJA 3BEGB 4LF1A 4Y2AA 1R0BG 2BRKA 2QMWA 4USWA 4F3OA 1QD1A 2OIHA 4TU7A 4RW9A 1TL1B 1DTTA 3HVWA 3JSRA 4L6V3 4OYBA 5DGAA 3BN4A 1WKJA 1HNWJ 2M3DA 3IG1B 3QRRA 4ED4A 2XMMA 1SC4B 1U2FA 2AJ1A 2YVSA 3JQMA 4RJVA 5ETQA 4ZN1A 3GSIA 4NZ0A 1AZSA 4K0KJ
chains in the Genus database with same CATH topology
1OQ6A 3R3TA 5HMYA 2FD2A 2VOPA 4Y34A 1U7LA 1VK8A 2FHJA 2XSFA 4EGLA 1VC5A 2O01C 3LW5C 1S97A 2MPUA 3RB3A 1L5UA 1LWEA 3MM8A 2B4VA 2J0WA 3D54A 2IAJB 4NX9A 4C3LA 4AE5A 4R5PB 4DR2F 1RAJA 1N5QA 4IH6A 3L7PA 3T9NA 3G6VA 1QAYA 4DLGA 2P5VA 5DQHA 3DRRB 2IRXA 3MOZA 1BQMB 1TKTB 1T95A 5DDPC 2HWHA 3QYYA 2ZKTA 4DWIA 3EGWB 2QSWA 1RKJA 4KGMA 4RW7B 2CQ2A 5I4MA 1UMJA 3UPFA 3PRDA 4OJ1A 2D1CA 1S48A 5JUMA 1XNQF 1VHFA 2HGNA 4O44A 3CCLS 4NCAA 4KBIA 3QMQA 1N4LA 1NJZA 2ZD1B 1SL2A 1P8GA 4HTIA 4IH7A 2LA4A 3LPYA 2A2DA 2UVWA 2HVZA 1JLFB 3H40A 2BM1A 1H3DA 3ZZUA 1DTTB 3H25A 4FBUA 5F9LA 4YDXA 2YH0A 2BE2A 2ZJPQ 1Q8IA 2FC9A 1N56A 2R2RA 5KFEA 1WHXA 4B02A 5D3GB 3S8SA 4TU9A 1U45A 4NLRA 1ZM2A 5L1KA 4WE1B 4DL6A 2FHMA 1RTHB 3BM7A 3V6DA 1U1RA 3JTPA 4HI1A 5T14A 4W90B 4I2PB 4K5RA 4PPDA 5I42A 4NPOA 2D9OA 3OXGA 2FJDB 4DR4F 1HQEA 2GMJA 1N6QB 2LDYA 1HQEB 2FY1A 5F3TA 1S10A 3TAPA 3JTOA 1C0UB 5KT4A 4RW8A 1T3OA 3RRGA 4OZLA 5HROB 2E29A 3MGJA 5AE2A 5MAOA 2R2UA 2RS2A 3CDAA 3CTRA 4RUAA 1TV6B 2M9KA 2VPYB 3PV8A 3K8WA 5GADI 1C0TA 4DUZF 1FHTA 1JLFA 2MB0B 4DQSA 4NYPA 1IKXB 2HG4A 4RU2A 1XN9A 3O5TB 3JYTB 2QA4G 1K8AT 3V6JA 2D68A 1NJXA 4X4NA 4KIAA 1S1VA 1SIZA 1SJRA 1I1GA 2GGPB 2B4PA 3OTOF 1RWUA 2VASA 2F3JA 2ZH8A 2LMIA 4Y00A 4F02A 3NGKA 3RU0A 4NXNF 4IRKA 4DL7A 2FGOA 2OJ3A 1JIHA 2QMXA 4HT5A 2LU1A 3LALA 1BQMA 1F60B 4F4KA 4V19J 1ROFA 2DISA 3W3SA 5FD1A 3ZZTA 5IZHA 4A8FA 4NMLA 4EUVA 4MKYA 1KVIA 4QZVB 1E6YB 2N7CA 2R7TA 4QWEA 2Q66A 4EO8A 3O3LA 3DN9A 2XC9A 2KDOA 1BQNA 5J1NA 2NPFA 2IA0A 3RB6A 4PWUA 1HNVB 4Q2MA 4ECQA 2R7SA 5ADZA 5J2MA 4NLXA 1DQAA 3PW5A 3M8SA 5CYQA 1TQLA 4K4SA 3Q8RB 3IA0A 4RLEA 2CQBA 3DU5A 2IYGA 1OPIA 4HLBA 3M6VA 1U1PA 3O8WA 1QE1A 2B56A 4PG5A 4Z37A 5DDRC 3JTNA 4RNMA 5JVGQ 1FO1A 5HLFB 2P9EA 3DLLQ 2ZUGA 2JFDA 2B5JB 1P1LA 4JV2A 1KR4A 2B4OA 3HF5A 4YP3A 3O2IA 4X66F 4QU6A 4H4OB 3DDNA 3E2EA 5MLCV 5J1EA 1VC6A