3OL6A

Poliovirus polymerase elongation complex
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymerase
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
total genus 140
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3ol6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ol6A02
4K50A 4RNFA 4DL4A 1RT3A 3H59A 4YR3A 4I7FA 4GC6A 1REVB 4H54A 1JLCA 3DOKA 1FK9B 4LSNB 4EYHB 4I2PA 1S1WA 1S0OA 3RBEA 5J2PA 4IR1A 3QO9B 1JKHB 3I5AA 1ZTTA 1VRTA 1TQLA 1S97A 3MEGA 1RTJA 5J2NA 2AX1A 4ICLA 5K14A 4QWDA 1S0NA 1RA6A 1SUQB 3MFIA 3DM2A 1N48A 4TY8B 2FJVA 4NLVA 2HNDB 4I2QB 3I5BA 3H5UA 3V6HA 3LP0B 2ILYA 5KFTA 5L9XA 3LP1B 3PR4A 3GIJA 2UVUA 3KK3A 1WNEA 4EO8A 1TV6A 4IH7A 3HHKA 3KLEB 5KFRA 4TQSA 1ZTWA 3Q8PB 5KFAA 3LANA 3NKYA 3KLFA 4DL5A 3DI6A 4DL2A 3FRZA 4RW6B 1JLQB 5CYMB 1HYSA 3KK2A 4NLQA 2ASDA 1T05B 1BQMA 4PWDB 2RDJA 3NAIA 3IS9A 2AX0A 3KHGA 4QWCA 1S9EA 5KT4A 4G1QA 3RB3A 3LALA 3C6UB 4K4VA 2ILZA 4J9QA 1T3NA 2W9CB 4YP3A 2WCXA 4KAIA 2OPQB 3MECB 3N6NA 4IOBA 3QLHB 3BSNA 4F4YA 4FBTA 3CO9A 1LW2A 5F8HA 1DLOB 1HNIA 4R5PB 5J2MA 2B6AA 3DRRB 4RW4B 3V81B 5KT2A 3PW5A 1S9FA 3NBPB 1N6QB 3DOLA 3MEEB 4ECYA 1HQEB 4K4YA 3MEDB 5F9NA 5HROB 2IAJB 4IQXA 1K1QA 4Y2CA 3MR3A 1BQNB 3IGVA 2E9ZA 1RT6A 2GIRA 3E51A 4KHMA 2IM0A 3OHAA 2R8KA 1I6JA 4Q0BA 2D3UA 4KO0B 1JX4A 4IFVA 3QZ7A 5KFXA 4ZPBA 3OL9A 1JLGA 2BANA 4RW8B 1S1XB 1S1TA 4ZVFA 5C24B 4H4MB 4IH5A 4O3NA 3SFUA 2R2UA 3KNAA 2W9BA 4IG0B 2OPSA 4QPXA 2YKMB 3BSAA 3IRXA 4KKOB 1LWEB 3DRPA 5C42B 5F8GA 3KLGB 1JLBB 2ZKUA 3RB4A 2FJWA 3PJWA 2HNYB 1QE1A 4WFXA 5KG4A 4F4ZA 2IMWP 3VQSA 3G6XA 3I0RB 4IFYB 1C0UA 1LWCB 5KG3A 1HNVB 3DLEA 2IBKA 4ECWA 2BE2A 1IKYB 3T5KA 1MMLA 3FQKA 4RNHA 3LP2B 3D28A 4O3QA 2YNHB 5JXSA 4WXWA 5KFGA 2W7PA 1C1CA 4IG3B 5C5JA 4ED2A 1JLEB 4KFBA 3CJ0A 3BQ1A 3DYAA 2WONA 1S1VA 3FFIA 3DRSB 3UQSA 3PJXA 2I1RA 2XI2A 4LQ3A 1IKVA 1IM4A 4TLRA 1SH3A 4IR9A 4NCGB 3M9OB 5HLFA 4WZMA 4NLOA 1C0TA 1SV5B 5EWFA 4EYIB 1T03B 3BR9A 2YNIA 1R0AB 2XGQA 1JLAB 2ZE2A 4TN2A 3EPIA 1TVRA 4ED1A 4K4SA 1S6PA 3FSIA 1RT5B 4QWBA 2IM2A 2XCPA 4MK9A 2VG5A 3G6YA 3PVXA 5I42A 1K1SA 1D1UA 3KJVA 4Y34A 3V4IB 1REVA 4KV8B 1KLMA 3KOAA 4O4RA 5F8IA 3UR0A 4MFBB 5KG2A 3H4BA 4F4XA 4ED3A 2FVRA 1JKHA 4KE5A 3RAQA 5J2QA 4OL8A 3T1AA 1RTHA 2WK4A 1RT2A 4TY9A 3T5HA 2CJQA 2VG6A 5HP1A 4ECUA 5FDLA 1SUQA 1W25A 3GIMA 3LAMA 3JYTB 4NLDA 4TY8A 4QW9A 1TKTA 1IKWB 2HNDA 2QV6A 4IDKA 5KFJA 5C25B 3HVAA 3KHRA 5DG7A 3IG1A 1S9GA 1J5OA 5F9LA 3KLEA 4O3OA 1VRUA 2ATLA 3CWJA 2OPRB 5L1IA 2DPIA 1TL3B 2C2DA 2YNFA 2BQRA 4WZQA 2FLLA 2J6UA 4FBUA 2FVCA 3QGHA 4EBEA 3CJ4A 4HYKA 1UWBA 3QGIA 5KT7A 1NNDA 4IRCA 4PUOA 3KLVA 2FLPA 4ID5A 2EC0A 2D41A 3TQ1A 1QUVA 2VA2A 5DLGA 2RF2B 1YVFA 4NRTA 2B5JB 5KFOA 4RNMA 2R8JA 5F8JA 4ED7A 3QLHA 4GC7A 3EZUA 1S1UB 3HVTA 3M8PB 3M8QB 4EBDA 4YR0A 4RU9A 3FDSA 3ITHB 4XPEA 1S6QB 1RT7B 5J2MB 4NLPA 1TKXB 1TKZB 4H4OB 3NBPA 1N6QA 1EP4A 4DG1B 1JLFA 1HQEA 3DLGB 3GYNA 1IKXB 3D5MA 4Q45A 4QWEA 3ISND 1QAJA 1BQNA 3KHLA 2I5JA 2FLNA 1HQUB 4NLXA 3H5XA 4KO0A 2IA6A 1FKPB 3T5LA 1QAIA 2D7SA 2YNGA 4RW9A 4MK7A 3FQLA 4ZPDA 5I3UA 3QZ8A 1S10A 4H4MA 2HAIA 4ED0A 1S49A 3KLIA 3CDUA 4IG0A 4ZVGA 2J6SA 2YKMA 2GIQA 4J9NA 1LWEA 2R2SA 1RTDB 5KFLA 2HNYA 4ECXA 3RAXA 1GX6A 1TP7A 3IGNA 3QIPA 3KLHB 4NLTA 4WYWA 3M9NB 4M94A 1RT4B 1HNVA 1T94A 3H98A 4RUCA 4F50A 2C2RA 2ZD1A 2J6TA 1ZETA 1EETB 2IC3B 1HPZB 4O4GB 3LP2A 3MR5A 1FKOA 1RT3B 3E01B 4EBCA 1JLCB 3DOKB 4ZHRA 2C22A 4I2PB 1S1WB 1JXLA 2AGOA 4K4UA 5KFKA 5JUMA 1VRTB 1LW0A 4KHRA 3I5CA 1RT1B 5KFCA 4DL6A 1RTIA 3H2LA 1RTJB 3MEGB 5KFMA 5L1JA 2BR0A 2XI3A 4ZVHA 2WRMA 4O3SA 1HMVB 2UVRA 3DM2B 4NCGA 4DEZA 1SH0A 3CJ3A 2FVSA 1SV5A 5KFYA 5DGAA 2UVVA 1R0AA 3DDKA 1U09A 1TL1A 1JLAA 3C6TA 5DGBA 5KFNA 2O5DA 3KK3B 2DPJA 1C1BA 1RT5A 2D3ZA 1TV6B 4TYAA 4ZVEA 5KFDA 4ZP8A 2V4RA 3LAKA 4LSLB 3PW0A 1DTQA 1JIHA 3V4IA 4URSA 3CDWA 3KLFB 4TYBA 3TAMB 2E9RX 3N6MA 3DI6B 4IRDA 2XCAA 1HYSB 3KK2B 2R8GA 4NLWA 1BQMB 3DLKA 4MFBA 4O44A 5EWGA 3BSCA 2VG7A 3CDEA 4WYLA 4ZP7A 4G1QB 4K4TA 3BGRA 4ED8A 3CVKA 1DTTA 5L1LA 4K4ZA 4JV1A 3JYTA 5DQGA 1N5YB 2OPPA 1LW2B 4YQWA 3KMQA 3Q8QB 2B6AB 3CIZA 5KFPA 3NGDA 1LWFA 2V9WA 4IRKA 2HNZA 5F8MA 3DOLB 2WTFA 2FJXA 3PW2A 4ECTA 2YKNA 5DQHA 4R8UA 3KK1A 4X2BA 2BQUA 5KT5A 1RT6B 3NL0A 3RBDA 5KG5A 4LSNA 5DQIA 1FK9A 4Q0BB 4RZRA 2BRLA 1NHUA 3QO9A 3I0SB 1JLGB 2BANB 2UUWA 1S1TB 4ECZA 4MIAA 2V0NA 2WB4A 1C2PA 2OPSB 3Q8SB 3IRXB 3H40A 2JEJA 4MKBA 1RT7A 1D0EA 4JV2A 3PW7A 4I2QA 1TKZA 4NZ0A 1QE1B 3LP0A 3LP1A 3DLGA 2W8KA 1C0UB 3OSPA 3GILA 3KMSA 3OL7A 2BE2B 4O3RA 4M95A 3M9MB 4O4GA 3V6KA 3G86A 3BQ0A 5KG6A 3SFGA 1C1CB 3PZPA 4RW6A 1JLQA 5CYMA 5CYQB 5KFUA 4URGA 1T05A 1GX5A 1XR7A 4O3PA 4XPCA 3MR6A 4PWDA 3G6VA 3DYAB 2WONB 3RB0A 4PQUB 1S1VB 3FFIB 3V6DB 3C6UA 2V4QA 5F8LA 2W9CA 3V6JA 2OPQA 3MECA 3BREA 2W7OA 5HLFB 1C0TB 2ASLA 2AWZA 4ZPAA 5DG8A 5HBMB 1DLOA 4U7CA 4R5PA 3H4DA 4J9OA 2FVQA 3DMJB 4ZP6A 2ZE2B 3DRRA 4RW4A 2HWHA 4WE1B 3KLHA 3V81A 3RB6A 1RT4A 1N4LA 2HMIB 1S6PB 3QYYA 3CJ2A 4MH8A 3MEEA 2RKIB 3ICLA 4XO0A 2VG5B 2XC9A 5D3GB 3OLBA 3MEDA 5I42B 3OL6A 3IN5A 3TVKA 3GV8B 2IAJA 3KJVB 5L1KA 5HROA 3E01A 2WOMB 4ZPCA 4Q8EA 4Y3CA 1KLMB 2ASJA 2IJFA 4WXOA 1S48A 5EDWA 2R2TA 4ZP9A 3SI8A 5J2QB 1RT1A 1RTHB 1RT2B 4ECQA 2VG6B 2C28A 5HP1B 1XR6A 1S1XA 4RW8A 5FDLB 3MF5A 1HMVA 2JLEA 5C24A 4B3OB 4RW7B 3GV5B 1TKTB 4IDKB 4KB7A 2XGPA 4J9MA 4KKOA 5KG1A 4EEYA 3BQ2A 5C42A 1MU2B 1JLBA 3IG1B 1S9GB 3KLGA 1J5OB 3GIKA 4NLUA 4J9KA 2JEFA 3I0RA 4IFYA 1VRUB 1LWCA 3JSMB 4F4WA 4LSLA 2B43A 4QW8A 5J1EB 2VA3A 2CKWA 1IKYA 2YNFB 3TAMA 3GIIA 5EWEA 1CSJA 5KFEA 2YNHA 4MIBA 4YR2A 4RUAA 4I7FB 2HWIA 4IG3A 5KFSA 2BQ3A 1JLEA 1S4FA 1UWBB 4FS2A 4PUOB 2JC1A 5J2PB 4ID5B 4RNNA 3EPGA 4DL7A 1RA7A 3DRSA 5J2NB 4Q8FA 5KFIA 3MTKA 4J9SA 3GV7B 4ICLB 3HVTB 5K14B 5KFFA 4DL3A 1N5YA 3PW4A 4ZMMA 3OLAA 3PHEA 1T03A 3BSOA 4MKAA 5KG7A 1EP4B 1JLFB 5EUHA 3N6LA 3MFHA 2AU0A 4FS1A 4Q44A 4NLRA 1KHWA 4QWAA 2UVWA 4KSEB 3T5JA 3NAHA 2I5JB 3BJYA 2F8EX 4KV8A 5KFVA 3CJ5A 4EO6A 2W8LA 2R8IA 2JEIA 4NLYA 3ISNC 3T19A 3IS9B 3I0SA 2YNGB 4RW9B 1S9EB 2XWYA 5I3UB 2AGQA 3GQCA 5DG9A 4ED6A 5DLFA 3KLIB 1NHVA 2JC0A 3UDLA 4J9LA 3MR2A 3NMAA 4K4WA 1KHVA 1IKWA 2IM1A 4U6PA 5C25A 1HNIB 3QIPB 1RYSA 1RDRA 1SH2A 4ECRA 2AQ4A 4URQU 1RAJA 5KFZA 3H5SA 2ZD1B 2FVPA 2OPRA 4NLSA 2JEGA 1TL3A 1FKOB 4ECVA 3QIDA 4MK8A 5CYQA 4YMEA 4ZHRB 1OS5A 2WHOA 4PQUA 2IM3A 2R2RA 2W9AA 1LW0B 4TQRA 3KHHA 3V6DA 4IFVB 4Y2AA 1RTIB 5KFWA 1S0MA 3Q8RB 2RF2A 2B5JA 4Q43A 2RDIA 2AGPA 1S1UA 3M8PA 2BRKA 3M8QA 2W9BB 3ITHA 4LQ9A 5HBMA 1S6QA 4WFYA 2GC8A 3DMJA 2E9TA 3C6TB 1TL1B 3DRPB 4WE1A 5KFQA 1TKXA 5KFBA 5KT3A 4H4OA 5T14A 4J9PA 2HMIA 1C1BB 5KG0A 4NRUA 2RKIA 4DG1A 2UUTA 3PR5B 1Z4UA 1IKXA 5D3GA 4TXSA 3DLEB 3QGGA 1DTQB 4IH6A 4JUZA 3OHBA 2WOMA 4K4XA 1XR5A 3DLKB 2QE5A 4O44B 5KFHA 2ALZA 1HQUA 2IJNA 2VG7B 1N56A 1FKPA 3BGRB 4KFBB 3OSNA 3OL8A 4RNOA 5KT6A 1DTTB 2OH2A 1RYRA 1HARA 4R0EA 5F8NA 4NYZA 4KBIA 4B3OA 4HKQA 2C2EA 4RW7A 4ECSA 2OPPB 1IKVB 1RTDA 1MU2A 2YNIB 4JV0A 3H5YA 1LWFB 2HNZB 1TVRB 3JSMA 2YKNB 4G3IA 4R8UB 3KK1B 4WFZA 3UPFA 4J9RA 3HKWA 3HVWA 5J1EA 2R8HA 1EETA 4IKAA 2IC3A 4NLGA 1HPZA
chains in the Genus database with same CATH superfamily
1IWGA 4LSNB 1FK9B 2VHGA 2LYVA 3K57A 1JKHB 4F0MA 3MM8B 4A8OA 3PYEA 1YJVA 4A8SA 1HI1A 3A12A 3GIJA 2DCUB 4N76A 2QL9B 2RS8A 2ZNYA 1WNEA 1S5ZA 4I67A 1FNMA 2LQBA 2KB2A 2DRDA 1HBMA 1WC0A 3IBFB 5KTQA 1IWAA 2IAJB 2HHVA 2AJ0A 1Q82T 3HX9A 5KFXA 3VAHA 2GAGC 4NPOA 4H4MB 2XO7A 4ELVA 1UEKA 2IMWP 1OYEA 4WFXA 4LF8J 2LQJA 1PAEX 4ED5A 4WXWA 5IQ6A 3NOCA 1VIOA 2WONA 1CVJA 3THPA 2HQFA 3F41A 3M9OB 4YEAA 3JB9k 4K4SA 2MSSA 1S72S 4Y2IA 4MK9A 5I42A 3IMQJ 2KHDA 2XS2A 5DO2A 1JKHA 4CLFA 3MM8A 2DITA 3NS7B 4X4UA 1SQEA 4DSKA 5M2PA 1VRUA 3PM9A 1NDKA 4EBEA 3HSJA 1NNDA 1S59A 3TQ1A 4RUHA 1XJWB 2R8JA 4GC7A 1G4CA 4EBDA 2B8QA 3HP6A 4ZITA 4H4OB 1YJUA 3HHEA 1F9HA 2HAFA 1I94F 1FKPB 2YNGA 2J0QD 4WU2A 1LXJA 4LFBJ 4H4MA 2HAIA 5H1SV 2R2SA 1NO8A 2O1PA 3W9JA 4WYWA 2CPIA 4F50A 2DXDA 1APSA 4Z7CA 3R9LA 1HPZB 1HWJA 2LFVA 4A8FA 2GW8A 3EVMA 1U8WA 5HANA 2EPIA 2F40A 5E5NA 5KFYA 3KK3B 3B78A 4U9RA 4ZN3A 3CTRA 4J5OA 4J9VA 4I6WA 2XCAA 1B0VA 4BHQA 3IBWA 1SJ3P 2RMLA 1DTTA 4K4ZA 1D09B 3CCUS 4PG8A 4DR4F 1MROB 2K1RB 4BCAA 2UV8G 2YKOA 3UCGA 1CJUA 2HQGA 1RWVB 2GHPA 2CPDA 4IQMA 2GQCA 2XMWA 2HKEA 4F25A 3RZAA 1N5TA 3JQKA 3SCLE 3Q23A 3GONA 2Y0SD 5AT1B 5CYQB 3DYAB 4PCQA 4C4WA 1W2BR 5F8LA 2GIFA 3NGUA 1RACB 4B9VA 3GZ7A 4RW4A 3DXSX 3O5TB 4LF6J 2HMIB 2LDYA 5BJRA 3HHNB 3LGMA 2MEWA 5L1KA 3ILIA 4DR7F 5LJ3Y 2P5VA 3W64A 4ZP9A 5EDWA 2C28A 5HP1B 1ROFA 1XR6A 2HHSA 3GV5B 1Q5VA 2CQGA 5E3RA 1K0TA 1UETA 1S9GB 3R7SB 1J5OB 3KG0A 3UVJB 1V5VA 3DC2A 2HYIB 2ADCA 1W26A 3AX2A 3ZZOA 3S01A 1T9WA 3C3LA 1JLFB 2ZBPA 4TU8A 4Q44A 1BC6A 2KH9A 4DR2F 4EO6A 1NJWA 5IM0B 2PA8D 4M5DB 4HEA9 1KD1T 2FZGB 4YDDB 4ECRA 4OJ1A 2HHTA 4UZBA 5KFZA 3H5SA 4DSFA 2FZCB 3SBMA 1TL3A 4MK8A 5CYQA 4WJBA 2KG0A 4KR0B 1XMBA 3E8OA 4LFCF 3BN4A 5J2MA 1FDAA 3FEYB 3AXMA 5T14A 2HMIA 4NRUA 1X31C 2RHQB 5AXLA 3WZ0A 3DLEB 1ULRA 4UOFA 1HD1A 4C8ZA 1N56A 3HFVA 2ZOMA 4KFBB 4ZVOB 1RWPB 1LFWA 1SIWB 4NL5A 1SKRA 4WFZA 3HVWA 1EKSA 4DL4A 5GADU 1D8YA 4DV3J 4F02A 3QO9B 4OYOA 3FEXB 2ACYA 5B0BA 1N48A 2HNDB 4CZCA 1FJ7A 1B64A 1FDNA 4V19J 4M5DA 3PKYA 1T3NA 2ILZA 2W9CB 3C46A 4RBUA 2LXIA 1RWNB 4QYZJ 3NBPB 5AXMA 4ECYA 1WKLA 4PR6A 2PC6A 3CC2S 2DNLA 2HGLA 2BX6A 2PEBA 2IM0A 3W61A 2BV3A 3K5LA 4Q0BA 4ZPBA 3BF4A 2UXDF 5K8PA 2ZKUA 2BABA 2HIQA 3X1LB 3DLEA 4UT4A 2VPZB 2BE2A 1MWZA 4CH1A 2GNKA 2ZC4A 4KFBA 1HKAA 1TUWA 4OJHA 3ZTSA 2RUSA 4BS2A 4TLRA 4Y28C 2WVEA 2HQCA 2R7QA 3O2IA 1S6PA 3ZO7A 4C0BA 4CQ1A 1Z1ZA 3Q8UA 1ZAWA 1RT2A 3T5HA 3C14B 5FDLA 2DJWA 2HNDA 3W1YC 4O3OA 1F5AA 2ATLA 2V4JB 4UOGA 3GR1A 2NSCA 4IOCQ 2BDPA 4W90B 4WZQA 2C2ZB 1ZOTA 4FKYA 1QUVA 4X84A 1WUUA 3HVTA 1Q8BA 4YR0A 3ITHB 1RT7B 4LBPA 1SKSA 3NBPA 1RAGB 2F63A 2FHKA 4RJVA 4ED4A 3TAQA 2HLTA 3GFZA 2Q79A 3PY8A 3KLIA 3RAMA 1UVNA 1T11A 1TP7A 4D3HA 5A6PA 3CCZA 1RT4B 1YLXA 3E01B 1WEYA 3RRKA 4DXLA 2V1TA 2RU9A 3DU5A 2V8GA 3ZZYA 2DVIA 1SH0A 2H4YB 1KOHA 3CCWA 4RO0A 4DDFA 4A8XA 3PW0A 3KLFB 4OX9J 4O44A 2VL1A 4C8NA 5L1LA 1RADB 2MXYA 2OPPA 2B6AB 1F5CA 2CPEA 3M2RA 3ENAA 4GKJF 2V4JA 3RBDA 2EK1A 1ZYQA 3POTB 3CJ8A 1T8EA 1R8HA 4DFPA 3SV3A 3AH6A 2CQ2A 4B3RJ 4MAKA 1RT7A 2UUAJ 2DHAA 2DNHA 1QAXA 3NP5A 2DR9A 3IAS9 2VJVA 1Q8LA 2JLGA 3LQVA 3MR6A 3RGIA 2CPYA 2FVQA 3E2EA 1O51A 4F2SA 1RT4A 4PPZA 2DNMA 3EZ5A 1SJRA 3E01A 4RBVA 4GO7X 4G1PA 1TK8A 3DOMA 2ZJRQ 1FE4A 3V5RA 1Q4RA 4DSEA 2FYXA 4J9KA 1Y3KA 3JSMB 3M7VA 2BW2A 5I3QA 1CSJA 3AD8C 2POKA 3QPIA 2CVEA 4EI2A 2DNPA 4CLWA 2F9JA 2MKKA 1RAFB 1MMDA 2VQFJ 4DL3A 2VQEJ 3PHEA 2CQDA 3HLUA 4F0KA 2CJBA 3AB4B 1UZDA 4V1Ak 5EUHA 5A8RB 2AU0A 2G0JA 1PSDA 1UA1A 4WP9A 1DAXA 3BJYA 3ISNC 3I96A 2M52A 4I64A 1VQKS 4C11B 3MR2A 1SKWA 3Q2SC 1RDRA 1TU0B 3AD7C 2PMWA 4LRAA 2PE8A 1J5EF 4OI6A 3R5AA 4M5GA 4OZ2A 4ETXA 2ZHAA 1PBAA 4DG1A 3IWNC 1DTQB 1NJXA 2HVZA 2IJNA 3CCES 2J0SD 1R8AA 3W2VB 4KBIA 4NYZA 3NWGA 3QQCD 1VBYA 4FYVB 1RWMB 2RU3A 1B7FA 4WU3A 5KAKA 3SCKE 3JSMA 4JI5F 1DRZA 2IC3A 4XDDA 2V2KA 5HMYA 4H54A 1JLCA 2F9DA 1VRTA 3BN7A 3MEGA 1ZAVA 4HACB 3AQPA 3DM2A 1JNZB 2HZCA 4DUZJ 4X4RA 3LP0B 5A8RA 4EO8A 1YRUA 4DL2A 4RW6B 2ASDA 2ZHBA 2R7SA 4YP3A 4KAIA 5D4LA 2OPQB 2JL9A 1FTCA 2FZKB 3PX4A 3HCXA 1PC5A 4USMA 4JI0J 3CB4A 3UD3P 1YZ7A 3MEEB 1U2RA 1A7GE 3BYPA 3MPYA 1BQNB 1RT6A 2BXJA 1JX4A 4XDCA 2QL5B 4DS4A 2FUG9 2GGPB 3CCRS 3RB4A 1JLBB 5B0GA 3KDNA 4JB8B 1YJ7A 2UXBF 5JXSA 1TL7B 3L7OA 2DO0A 1T0TV 4CLZA 2G4BA 1UW4A 3CJRA 5AE3A 3OUYA 3H25A 2I1RA 1IM4A 1SH3A 3UW1A 2EW9A 4U7UK 4W98A 1YX2A 2XMAA 4R25A 4DN9A 1RT5B 1OMSA 3BBFA 3T9ZA 2LXFA 4KE5A 3KG4A 3CIMA 4QYRA 2EK6A 4ER8A 2X1FA 2ERRA 2J8AA 3UN5A 4L76A 2DPIA 1IJEB 3ZTOA 2C3MA 1XMQF 3ONQA 3HFKA 4UOHA 2V8HA 4YB7A 4B9NA 4DR1F 3DDIA 2CQHA 1RBOB 1BQNA 4L75A 1KKHA 3VAIA 5DJBA 1HQUB 4JI1J 5G0RB 3DLJA 2YWFA 2N4CA 1VC5A 4LSZB 2HQDA 4X62F 1QVFR 2C2RA 4NWBA 1HIYA 3MR5A 1FKOA 1RT3B 4EBCA 1UEUA 3MUMP 3NNCA 4OI1A 1EHWA 5DGAA 2K2PA 2DPJA 3MMBB 2OFHX 1RT5A 5DS7A 2ZH6A 4URSA 1WORA 2XMMA 2B56A 1GMUA 4DS5A 3U1MA 2RRBA 1AT1B 1DHMA 3W3SA 4RX6A 4FNHA 2AEMA 1R8CA 3NGDA 2Q6CA 2KXNB 4LRBA 4X2BA 5GAGU 3HKZD 2VJUA 2BANB 3M8ZA 1BXNA 1WOOA 4JV2A 3AA8A 4ANDA 1FRJA 2Z2YB 5B0FA 1IBKJ 5ADZA 1PILA 3C16A 1K0VA 5EHHA 2YQ3A 3RB0A 3FFIB 1UVLA 2ALYB 2WB1D 1DY3A 2I6WA 2VFVA 2W4CA 2N3LA 4J7CA 4JI3J 4ENOA 2QMWA 2C3OA 1KVKA 3TVKA 3KJVB 3NEKA 3D6FB 1W7WA 3L09A 4DPUA 4CM2A 3P96A 3UN2A 2UUBF 3CO0P 3R7BB 2KRRA 1N54B 1MU2B 3FMBA 3GIKA 4LF9J 2V8DA 1LWCA 2VA3A 4EZ6A 3CGIA 2WVFA 3PX6A 3K5NA 2VFRA 5B0EA 4OX8A 3RJMB 1EP4B 1DARA 1NKCA 1VC0A 2I0XA 3ZTPA 2NZ4A 4NLYA 3RW7A 1S9EB 2QIFA 4NXNJ 4ED6A 2FY8A 2Y9HA 3R8YA 4USKA 3WDOA 3RU0A 4TVAB 1OS5A 4F4AA 2R2RA 4DR5F 3IRWP 1NPRA 2MJUA 4Q43A 2Q6BA 1Q8KA 5FLXY 4WIIA 4AQYF 2BRKA 3W5YA 3HI9A 1D3WA 4ZLJA 2UUTA 2EFOA 1GFWB 2G9OA 4QR2A 2BKPA 4Q7AA 1N32F 3FZ2A 1WELA 4DU8A 1MU2A 1YGYA 1AZSB 2RQCA 1FFGB 4ZCLA 1RJJA 2AZ3A 2YKNB 4G1IA 1FRHA 3HKWA 5LMNF 2AW0A 4GC6A 1X4HA 4QIFA 3X3UA 2OO4A 1YHQS 1RA6A 3PRBA 2O3DA 2CFXA 2COLA 4OZ0A 1T05B 1HNZF 2AX0A 1S9EA 3LALA 2W24A 2DNNA 2AMCB 2CJKA 2KN4A 4M5KA 3ZTRA 3TP2A 4OJGA 5HROB 1IBMF 3OR1B 3OHAA 4AT1B 3N5BA 1RCXB 2IMOA 3T1YJ 2YPYA 3QNWB 3MAQA 1N5VA 3VF0B 5EX0A 1XNRF 3BSAA 4KKOB 2C42A 3MUVP 4ZVTB 1RCOB 3DGPA 3T5KA 2JX2A 1G2EA 4IG3B 1JLEB 1FRMA 1F3VA 3WIVA 2CNLB 4DQIA 4OYWA 1AROP 4X64J 3IR5B 2XYGB 2ZOFA 2VG5A 2VDHA 1F1BB 5D6GA 3RAQA 1RTHA 3M1VB 1B99A 4ZKAA 4ECUA 2XTDA 2OEKA 1W25A 3GIMA 1EJ7L 3I4PA 5KFJA 5C25B 2MJNA 3HVAA 4LF1A 2DY9A 4NMXA 4CTAA 5E3PA 1X60A 3TO8A 4UUWA 2L9WA 3HULA 3BDPA 1EAYC 3KLVA 1TKDA 1T7PA 1TMMA 2UXCF 2CG8A 1TKXB 3F44A 1RLDA 3D5MA 5IQQA 4RU2A 1D9AA 2IHR1 4LVOP 3HHDA 3W8PA 4OHXA 5I3UA 3QZ8A 2GIQA 3EX7B 1JXEA 1GX6A 3QIPA 4P2FA 4RUCA 1T9UA 3K0JA 3DOKB 2V94A 4IO1A 4YOEA 5I3PA 2A3JA 3HF5A 1S0MA 3TUJC 1M1KT 2FB0A 2J7WA 5KFNA 2ZM6J 5B7WA 2CZ4A 4LUBA 2HVIA 2BJDA 4NLWA 1BQMB 2RS2A 5A8KB 4OLOA 4HI2A 5BR8J 2BE7D 3PIPQ 2LECA 3PW2A 1TTHB 4OZ5A 1JJHA 3CCLS 2OHDA 1N0VC 4X4QA 3N28A 3C66A 1JLGB 3IAM9 3A1YG 2JJ4D 3GB0A 1RK8A 3DGVA 4ZIVA 1D0EA 3K59A 3J81j 1HD0A 3J7YI 3MMAB 4CO0A 2C3UA 2CPHA 4OHYA 3IFEA 1WTBA 3WX8A 3PIOQ 3D2WA 5U47A 2GMJA 4PQUB 1YK9A 4KGZB 3CD7A 2KHCA 4CCHA 2A1BA 3TZYA 4OZNA 1H98A 3DMJB 5GAGI 3D0IE 3CJ2A 3ICLA 1YITS 3ZZUA 5JJBA 1S4EA 5CA5A 4WXOA 2VDIA 3GJTB 4RBTA 1GMVA 2W1BA 4RW8A 2YWWA 1BE4A 2JFDA 4I6AA 4DI6A 4J9MA 4EEYA 3D3CJ 3KLGA 3MMCA 3D6MB 2IVFB 3I0RA 3Q8VA 3GPAA 2GO8A 2N7YA 3NGTA 2D74B 2YNHA 2BQ3A 3AJ1A 2HWIA 2ZVIA 1SQFA 3GCWP 4CNYA 5I4MA 3MM7B 4J9SA 4ZMMA 2KT3A 4CT9A 4PG7A 2OEMA 2MLZA 5CAAA 4DJBA 1E6VA 5KFVA 2GQ2A 3CJSA 5F3ZA 2VC1A 2OD4A 3JAMY 1IKWA 1YBUA 3MMAA 1NH7A 2ZD1B 2OPRA 5D78A 2GVDB 1U1LA 4ZVPB 1SIZA 4PQUA 4TQRA 4LF7F 1GEHA 8ATCB 4U8VA 1ELOA 4P75A 3M8PA 2GC8A 4WFYA 3DMJA 1GTEA 3DRPB 1KVJA 5KG0A 2LVWA 3D3BJ 5KFHA 4DMZA 2C2EA 1U25A 4F3OA 3O1LA 1KS2A 5D4NA 2CQCA 2R4FA 3MMJA 3PW5A 4IKAA 4O4GA 4K50A 4WP8A 2QMXA 2W2QP 2CQPA 2NREA 2Y1JA 2CJ9A 1FX4A 3MM7A 3G96A 4ELTA 1RHRB 4FF2A 4DR4J 3CUNA 3LP1B 4MKVA 2CQ3A 1R8PA 3KLEB 1TUGB 4TQSA 1WI8A 3F73A 3LANA 2ZH5A 3GR0A 1M1GA 5LMUJ 2QJ3A 4J9QA 3BR8A 1X0PA 4IOBA 4DPOA 5E3CA 1VS3A 4R5PB 3DRRB 4JI8J 3MEDB 1HNWF 2GVDA 2XY5A 3AD9C 4NYOA 2CQIA 1UUJA 2WVCA 1DQ9A 1RWUA 3ZZ0A 4MYUA 4AL7A 3KNAA 4QPXA 2F4FA 3DRPA 1G6BA 2PO4A 4F0HA 4LIRA 1N88A 4ECWA 2XZTB 1MMLA 3LP2B 1PJ7A 5KFGA 5DZ7A 3ILLA 3BQ1A 2CXEA 4EUVA 2GVZA 4HDGA 2KM8C 3TYTA 1KP6A 4JI4F 3ELHA 2QO3A 2ZE2A 4ED1A 1MW7A 4QWBA 2XCPA 3UCUP 3R3TA 5CH7B 1FERA 1FXRA 2CJQA 2VG6A 2Y1LB 1IM6A 1M5PC 4OYAA 5F0WA 1Y4ZB 3HHLC 3TJ9A 3D7SB 3KLEA 4CLTA 4ES1A 3T6JA 4DR2J 2ZH9A 1SC1B 2DGUA 3PCOB 4ES3A 2K3IA 2FLPA 2VH7A 1WHWA 3CD5A 1P6TA 2VIHA 5HN0A 4RWXA 2KU7A 2HURA 3NMRA 1GH8A 3AOAA 1QAJA 2ZDPA 3SIPB 4RUBA 5AJ3J 1VDHA 2HEKA 4NLXA 2R9LA 1WC1A 3CNQP 2JVOA 4LFCJ 4QU7A 1EARA 2VD3A 1RSCA 4D3GA 2J6SA 4NI2B 4ECXA 1S79A 1T94A 1ZETA 3LP2A 4B9TA 3PYDA 2C22A 2KT5A 5HMWA 4KHRA 3QRQA 2XI3A 1NKEA 4ZOSA 2UP1A 2A2CA 5B0DA 4XTTA 2D3ZA 4TYAA 1Q5YA 3DI6B 1S57A 3LGNA 1UVJA 1FEHA 3BGRA 2GJFA 1FO1A 1PC4A 3M2UB 4HHJA 4YQWA 4OJ3A 2W4DA 5KFPA 3AA9A 3E3XA 3LPYA 4I4BA 3UI3A 4DF8A 2MSTA 2L3MA 2FQQB 5KG5A 1VQ7S 2XY7A 1FKAF 5D0RA 5L38A 4EZ9A 2GJIA 1U0HB 4M8LA 2PN6A 4ZJOA 4FYYB 3GILA 1CJTB 1DQ8A 2CQ4A 3SFGA 4LF5F 3O44A 3NCPA 5CYMA 3BGLA 3G6VA 3P6YC 4NOHA 2UXDJ 2BJ7A 4QBUA 2KT2A 3D0GE 1NK9A 2CADA 3OR2A 3QYYA 2RKIB 3EGWB 3W62A 1NSPA 1QSSA 2WOMB 4ZPCA 1RHUB 3PYGA 2I2YA 1WF1A 4YFUA 2HG4A 1MWQA 4IFYA 5EX3A 2HHWA 2IYIA 5EWEA 1LOUA 4B3TF 3EXCX 4DV5F 2KM8B 4AL5A 2EXUA 1R3NA 3GV7B 1WJ9A 4GVBB 1FJCA 3TAPA 1T3OA 5KG7A 4UQTA 1FWKA 4NA1A 1CEZA 3DXBA 4DFJA 3T5JA 1Q79A 2VBYA 2A2DA 4KV8A 3Q86A 2W8LA 3R5JB 3O8WA 2ZNZA 1UVMA 5A76A 2HWTA 3Q8YA 1N0UA 3CCMS 3HHLB 3I31A 2ZUAA 1RYSA 5HQMA 4U67Q 1CJTA 2FVPA 4Y2KA 3VTIA 3QIDA 2APOA 2WHOA 1UW9A 1M5HA 1RTIB 3M05A 2RDIA 4GVLA 2DBBA 2NLWA 3M8QA 3LW5C 1TL1B 2MHEA 3CPWR 2RKIA 1VQMS 3FUYA 4CP5A 4HH1A 2WOMA 2CDRB 4ZVUB 2ZVSA 2VG7B 1HQ2A 1T95A 3W65A 3FSXA 3OL8A 1R89A 5KT6A 3K7RA 4I69A 1IKVB 1DQAA 2LMIA 4FYXB 5HQLA 4B3MF 3JXOA 2KKHA 1FRLA 2E5GA 5A8WA 3QJLA 1TVRB 2CNKB 4RNFA 4JYAJ 1REVB 3P8BB 2NUUG 1X9WA 4I2PA 1IVZA 4ILRA 2OLWA 2J5AA 1YJNS 1HBOB 1KRPA 1XBWA 4F67A 2HPUA 3FBBA 4O23A 4OI2A 3G9CA 1ZTWA 3Q8PB 1KTQA 4UUXA 1HYSA 2VBZA 2E5LF 3C6UB 1XWLA 1CJKA 4DUYF 3HJVA 4DX8H 3HHLA 2J9CA 1LW2A 5F8HA 3GCXP 2PEHA 4EU0A 1NK0A 3D67A 2GA7A 3MR3A 4KHMA 2JRSA 2JOQA 1H7XA 2NUHA 1I6JA 2F4VF 4X4TA 3K5OA 1KTVA 5C24B 3SFUA 2BJ8A 4EGLA 1OO0B 3C15B 1QE1A 3D28A 4CLKA 1RKIA 2OSQA 2J0XA 3KUEA 3DRSB 3WC0A 3CJKB 1IKVA 3U1LA 1K47A 2M8HA 1SJFA 3UNGC 3EPIA 1TVRA 4E98A 2OUGA 2IM2A 2LDIA 3BPSP 1REVA 2B8PA 1KLMA 4O4RA 2W2MP 1BHNA 4PG6A 1R6VA 2B7BB 3VV2B 3S1TA 5J2QA 3T1AA 1RI7A 4WK3A 2MHNA 3PKMA 2QV6A 2FIUA 3B4MA 4DSJA 5F9LA 3K58A 2W01A 1PYOB 2HFNA 1JNRB 1RAIB 2J76E 3HK2A 1UWBA 5KT7A 4C8LA 2LEPA 5DLGA 2MGZB 2DGSA 1FCAA 4PEOA 1I3OB 3ISND 2AIRB 1AUDA 2CQBA 2D7SA 3OTEA 4RW9A 5AE1A 2GV1A 2QA1A 4OX6A 3WQPA 5IV4A 2XM3A 3JTPA 4NMLA 4NLTA 4DV2J 2B4OA 3SCJE 3OVAA 2BZ2A 1X9MA 3M30B 3H2LA 1R31A 2DNOA 5DDPC 1TFWA 1KFDA 1SL0A 3D6TB 5H9EK 4OYZA 4JI5J 2K7KA 2V4RA 2W7AA 5F3TA 1EX8A 2RRNA 1MLAA 2ZBRA 1N36F 1ZM4A 2ATCB 2UZAA 3MAHA 4WCEQ 2ZH7A 4KIAA 5BYRA 4EK2A 3SSQA 4JOUA 4H4KA 4RZRA 3I0SB 4LRDA 2MGZA 2OMLA 3G8TA 3IRXB 2QN6B 2RUGA 1V5IB 3S7RA 2EEYA 5GAEU 1SQGA 1M5OC 1OWXA 4ZLPA 1C0UB 2YWEA 1N33F 1X5TA 3OBIA 2V5HG 1BWEA 4F36A 1YDLA 1R7IA 1N5SA 1S1VB 3NGKA 4DSLA 2EBGA 4RPFA 3T6BA 3QT8A 4ELUA 1OPZA 4KTQA 4WE1B 3RB6A 2V68A 4IRKA 4PXBA 2ZOGA 3TA2A 4X65F 3PHTA 3HSDA 1T9YA 3OTCA 3OTOF 5FD1A 6FDRA 3GFHA 3W5ZA 1S48A 2VPYB 2DH8A 3GJSB 4C8YA 4KB7A 2XGPA 1NK4A 5C42A 1NMEB 3MOJB 1H2UX 5J1EB 2YNFB 3G82B 2HK3A 4DL7A 2AJ4A 5J2NB 2MDAA 3PW4A 3W8GA 4JV5F 3A8JA 5L39A 4MKAA 2QC3A 4N47A 3OV7A 2GMHA 4QWAA 4KSEB 3QJPA 4M5MA 2L9NA 3I0SA 2AEFA 4X4OA 2IVMA 2VKRA 4DR1J 4DLEA 3SQOP 1KHVA 1Q1KA 2DKOB 5A0YA 5CD4A 3AXKA 2XYPB 2D9PA 3HFZB 1VK8A 1QLNA 2DGWA 4IFVB 4OQJA 2RF2A 2L08A 5KOXA 2AGPA 4LF2A 2E9TA 4WE1A 2LA6A 4ZA1A 2V2VA 2QE5A 2HHXA 1AW0A 4IYQA 1YJWS 1S77D 2HHUA 2NS1B 2OI2A 2XTJP 2NR0A 5J1EA 4ANEA 3G82A 2JFKA 3GFYA 1FWPA 4L3KA 1IR1A 1S1WA 1TMJA 1RBLA 4WFAQ 5J2NA 3W63A 1B4SA 5A2QU 2AKWB 4FF4A 4IH7A 4DPWA 1R0BG 3A8EA 1HBNB 3GP9A 4DL5A 2BJ3A 2WBRA 3RB3A 1F9FA 3G6ES 3H2UB 4R0JA 3V81B 5KT2A 3DOLA 1HQEB 1NM2A 5F9NA 3NGSA 1NKBA 2FPHX 2MLXA 3TRGA 3EGZA 3I6PA 3JTNA 2Q43A 2EG2A 4IFVA 3TEGA 4ERDA 1XERA 2XMUA 2V1SA 4PXDA 1GT8A 1VC6A 5F8GA 1UCNA 5KG4A 2IBKA 1IKYB 1LK5A 2Y8YA 5IS2A 1HW8A 4USUA 2HFZA 2UUBJ 1S7HA 3O3LA 4GO5X 1RKJA 4LFBF 1AA1B 4NLOA 1T03B 1Q0NA 2FC8A 2ZKTA 2U1AA 3FSIA 3RTVA 2JSXA 3MWBA 2FVRA 2WK4A 1M1HA 4KHPJ 1HI8A 3DHWC 2HHHJ 4OI4A 4JI6J 3LPEA 5DG7A 3IG1A 2C2KB 4DBQA 3TWZA 5IT9U 2ZH1A 3OXFA 3ISZA 1U1PA 4ZVRB 2FVCA 3J81U 4PUOA 2EC0A 3GTYX 5EGYA 1U1KA 2B5JB 4U95A 1S1UB 1HBUB 3HM9A 4XIUA 3J7Z5 4M5NA 2W4PA 1HQEA 4Q45A 4QWEA 3QT7A 1F2HA 1XEZA 3ADAC 2CRLA 4ZPDA 4AQYJ 4L74A 1WG4A 1VQNS 4CLPA 2XHCA 3D0HE 5KFLA 1E6YB 2AYMA 4QIGA 3KLHB 2H5IB 4K5SA 2F8HA 2XLKA 1FT8A 3IR7B 4ZPVR 5L1JA 5KFMA 2BW7A 3DDKA 1X4GA 3DCAA 3D9BA 4LF6F 2QA4G 4CWBA 1IJFB 3TUPA 4M5JA 4ZP7A 3S8SA 2YH0A 2VPXB 2LEBA 3Q8QB 2EWHA 4U7UD 2BQUA 2PMZD 5ETTA 5DQIA 2MKJA 1NHUA 3VR1A 4TU7A 2WSCC 3C2PA 4USVA 4DCJB 1Q53A 1TL5A 2WB4A 3H40A 2KVQE 4I2QA 3PO4A 3G86A 5IZHA 4URGA 4KPYA 2WONB 2DR5A 3RR7A 3M32A 1XNRJ 3EXYA 3I56S 3MECA 1BD6A 1FEEA 2ASLA 1FJGF 1CJVA 4U7CA 2VFUA 3KLHA 2HWHA 2R7VA 5I42B 2ZDOA 2V8PA 4MTPA 1RXOB 3ET6A 2L48A 5GAEI 4F4KA 1S1XA 2IRUA 1OYDA 3L7PA 2YXLA 1WEXA 3FCVA 2GAHC 2N7CA 1A6LA 1HLWA 1CBKA 1VRUB 2B43A 2DTJA 1VBXA 4I7FB 3FVYA 3RG6A 1ZBTA 1NZAA 4B9LA 1QSLA 3QAUA 1W2IA 3T41A 3LF0A 3HMJG 2HBQB 4F2RA 2UVWA 2DISA 3KNGA 5ETNA 2YNGB 4ZK7M 2XSJB 3NGRA 4DV3F 2HS4A 4PYDA 1K73T 4JI7F 1SH2A 2YWHA 3G8SA 2ZH4A 3HD2A 4C8KA 2CPFA 3MD3A 2Z4PA 3B54A 1FJEB 2BYCA 2PA3A 7FDRA 3ENWA 4A48A 2E7WA 3QWUA 1DTTB 4DQPA 5D8HB 4ECSA 2HBZB 1RISA 2ZZMA 3Q24A 1NDCA 4G3IA 1EETA 1U1NA 1CJUB 4I7FA 1QD1A 4KQZA 4TY8B 4NLVA 2QFJA 2M7SA 5IOLA 1U47A 1T9TA 2QSWA 2M8DB 2RQ4A 3G87A 1C4CA 4UOCA 1B70B 2AJ1A 2XSJA 4DL0C 1F9EB 3N6NA 2IPOB 5D15A 2P9EA 5LSOA 3KJQB 4RW4B 3SCIE 1FI4A 2I9SA 3R6LB 1JWWA 2R8KA 4J91A 2MQNA 1FDBA 3OL9A 3M6WA 1S1TA 4ZVFA 3GIRA 1RWWB 2KFNA 4LRFA 1U0SA 5KG3A 2W7PA 4C3LA 2H9ZA 3G71S 2IVYA 5C5JA 4QIVA 3MM6B 3CJ0A 2MKIA 2HLUA 2YWGA 1S76D 3UQSA 2RQKA 4N5SA 5HLFA 1C0TA 2D3OR 1K44A 2I8EA 4KGVB 3UCZP 4AL6A 4NCBA 2E44A 1PG5B 4W92B 4ED3A 2PFDA 2SXLA 1I5OB 2CPXA 2MY7A 2EKYA 4TY8A 1TKTA 4IDKA 1B3TA 1R27B 2DO4A 2CA9A 3GYGA 4FF1A 5HJXA 1TL3B 2H65B 3VVTA 4LMZA 4ZJLA 2UU9F 3NCQA 4PPDA 3L3CA 2D41A 4OX9F 3UDVA 5ITHA 4XPEA 5J2MB 4QIEA 4NLPA 1TKZB 3AODA 2BM0A 4ZDNA 3VGSA 4WK1A 2FLNA 3MCNA 5H9FJ 3KYLA 4LF7J 3DRXA 1HWLA 3MPWA 3FQLA 3N79A 3CSKA 4DX5A 5HI7A 1WACA 4B3RF 2QLBB 4S0MA 3QSYB 2AYBA 4NASA 2MQPA 1X4FA 1LKZA 2P8IA 4K59A 3DLBA 4ZHRA 3MM6A 1TAUA 1JXLA 4C2MA 1LW0A 3U1NA 1CC7A 3TNVA 2DHHA 2Z2MA 3VAGA 3C6TA 5DGBA 1UPPA 4ZVEA 4DZ6A 2VOOA 3EM1A 3LAKA 4P73A 2MKCA 4K7QA 3DFEA 5EWGA 3VWSA 1ZS6A 3BSCA 2DK2A 5AE2A 2XZDB 5IWAJ 3LA0A 2E29A 5DQHA 4R8UA 3KK1A 4QJVA 5C2CA 3UWTA 2Y8WA 1UFWA 2Z30B 4Q0BB 2KXHA 4ECZA 4M5LA 2OELA 2JEJA 1EB0A 4MKBA 2OFGX 1PBUA 3PW7A 2VQFF 3UE2A 1TKZA 3U02A 2VQEF 1HNWJ 4Q2LA 3KMSA 2BE2B 1BUXA 1RAHB 2XMKA 3PZPA 4FXVA 2FHOB 1GMWA 3W2WA 1UVIA 2YBVA 3OJSA 2V6AA 3R27A 9RUBA 3G4SS 1DLOA 3L4BC 4B02A 3M8YA 1FWLA 1S6PB 4XO0A 1XTZA 2QX0A 4EWTA 4LRCA 4Y3CA 3EE3A 3WBZA 3NCRA 4CYUA 1RT2B 1UPMB 4OZLA 5FDLB 5L9NA 3NY0A 2R7XA 1KQKA 1HHTP 2MYFA 2OTJS 1N34F 2PFFB 1ACMB 3MOZA 4CO2A 3OFFA 2EKNA 1S4FA 2FY1A 1RA7A 2HZAA 3HVTB 5KFFA 5AXNA 3VCDA 4FDFA 3HT3A 4KGKA 1HR0F 2HQ3A 1U8SA 2F8EX 3CJ5A 2JEIA 4HI1A 3GG1A 1OY8A 3HHLD 4OV1A 3KLIB 1L3KA 2G13A 4NEYA 4OHWA 1VI7A 1WDTA 1U2FA 4KT0C 4LVNP 3M4XA 2F1FA 2P9GA 1FVQA 2MQQA 5DETA 5KFBA 4UY8T 1IKXA 4JI0F 3NS6A 3SDEB 4O44B 3OSNA 2RT3A 1RYRA 5F8NA 1H73A 1KFSA 1T02A 2OPPB 4CO1A 4FVMA 1RTDA 1NAQA 3M2RB 2K06A 4WF9Q 3UPFA 4X66J 1J2VA 3KUHA 2ACMA 4USTA 5HAOA 5K8OA 3I5AA 1ZTTA 1UKUA 1TQLA 1S97A 4RLEA 4EMDA 1SUQB 5L8RC 3VGTA 1WF2A 3C19A 3VHQA 2KFYA 1FESA 5KFRA 3A3PB 3MM9B 2HRYA 3HZEA 2KO1A 4F26A 3KK2A 3NWRA 2RDJA 3KHGA 5KT4A 4G1QA 2MZRA 2YTCA 4FBTA 3PEHA 1UJ6A 4CRJA 2JHEA 4LF5J 4BLGA 4DV0F 1UJ5A 4L73A 3DOMB 3ZXWA 1KSPA 2MQMA 2OPSA 4ZVQB 3SV4A 3PJWA 2ZHOA 3N4WA 3SDEA 1GK8A 3FQKA 1C1CA 4OMFG 3H42A 4QPTA 4BWJA 1D8ZA 1P1LA 1SV5B 3BR9A 5E7OB 3FEZA 3MZIA 2G1HA 2XB2D 3PVXA 1SCJB 2DIVA 3D4JA 3IWXA 1WSVA 3VALA 4AXIA 2CPZA 4TY9A 1HHSA 1Y9OA 1SUQA 3LAMA 3FBEA 2C2NA 3P49B 2MZQA 3CWJA 3MM9A 3J7AN 5CD4H 2FLOA 3S6EA 1YVFA 3PFOA 4KGMA 5JVHQ 1VRQC 4RWWA 4DG1B 4UZCA 2I5JA 4PZVA 3EVWA 2E66A 4XAKA 4ZVGA 2YPZA 2BA9A 5ETPA 3PACA 2ZZTA 2IC3B 3B4DA 3GSIA 1SJ1A 4OI0A 3I55S 1IBKF 1JLCB 5HATA 3QAEA 4GKKJ 2YX7A 2KI2A 4DL6A 1VRTB 5KFCA 3MEGB 4B3MJ 4KH0B 3DM2B 4DEZA 2IRYA 2NXUA 4ZCKA 1SV5A 1VYAA 2KG1A 3CXCR 4JI3F 3GMGA 4EFAC 3RBXA 4F7VA 2MZ1A 1CLFA 2RHSB 4ED8A 2M5YA 1KDNA 4JV1A 4YS2A 1EKRA 1RGVA 4NA3A 3SQGA 4DLGA 1WI6A 5BYSA 2HNZA 4PABA 4ECTA 3UR3C 2CZVC 2KZMA 4LF9F 1RT6B 3SXLA 2MKHA 4PWWA 1VISA 2MMYA 2JNJA 1QJHA 2WBMA 4MT1A 2GJ2A 4DV7J 3BQ0A 1JLQA 2DHSA 4CO3A 4PWDA 3OUYB 1AFJA 4NXNF 2XMTA 1Z2LA 2EFVA 2M0GB 1KBRA 1QM9A 4DQQA 2JH3A 2ASJA 2PIIA 3D1QA 3THVA 1VQ6S 4ECQA 1MWYA 3TJ8A 4ILLA 4OYPA 2E5IA 4L3NA 1VCTA 4QW8A 2R3VA 2J9DA 2Y1RI 3OD2A 2NPIA 2XMJA 4F3MA 4QYZK 4KH1B 1HWKA 5A2QY 3EJMA 3OLAA 3DKDA 1LXNA 4YHHF 5GADI 2E1MC 2XS5A 4A8WA 5D0HA 1KHWA 1XN9A 2ROPA 2HW3A 2OJ3A 4DR6F 2R8IA 4I68A 3FMWA 3HSGA 1HNIB 4AFFA 1T9XA 1RAJA 1PJ5A 3TW0A 1KQSR 3K8VA 1FKOB 4YMEA 2J9EA 1X5SA 2DNRA 1S6UA 1YRXA 4LQ9A 1S6QA 4B08A 4J9PA 4P71A 1ZH5A 1Z4UA 4TXSA 2HRTA 2NXJA 4K4XA 1B0TA 4W4MA 1XR5A 5CCLA 1KEKA 2Q3PA 5CYJA 5C2GA 3LWMA 2XLIA 3I32A 2C1EB 3M8SA 1XK8A 2LQ9A 2QYCA 1MG7A 2YKAA 5ETQA 4P6QA 2RJZA 2Y0BB 4B9SA 4IR1A 3R1LA 1RTJA 1EIYB 4E0DA 4QWDA 3SSSA 3I5BA 5IT9Y 2R7TA 2YH1A 3OT9A 4X64F 1TV6A 3AJ2A 3R5BA 5KFAA 3C16B 2KYXA 2KFZA 1AFIA 2B4PA 2CNNB 3NAIA 1U1MA 1QTNB 1VQPS 3BSNA 1HNIA 3Q89A 3NOGA 2HHQA 2E9ZA 3E51A 3CULA 3VAKA 4ANCA 2RNEA 2DCLA 5CQGA 4IH5A 1RAEB 4IG0B 2YX1A 1NJZA 1RLCL 2IDLA 2VOPA 2HNYB 1LWCB 5IT4A 2VODA 1GNKA 3R7NB 4MKYA 2LU1A 2C2MB 3FSYA 3DN9A 2Z0GA 1OQ3A 2VICA 1PCAA 2XI2A 1X8DA 4WIQA 3N0VA 3A13A 4TN2A 2RE1A 5M2RA 4A8MP 3GSDA 1XMOF 4CNZA 2RDDA 3PXGa 3EZOA 1OIAA 4JI2F 5DRKA 4DV1F 2H51B 2E5JA 1V3SA 2G2YA 3MDFA 2QZ8A 3CMQA 2GX8A 3NLCA 1Y5LB 4I6YA 3JQMA 2FLLA 4FBUA 2Y3YA 3DRYA 3AOCA 3CJ4A 4IRCA 4ID5A 2A6OA 4NA2A 2AT1B 3NXZA 2CJXB 3MHYA 5FIIA 5BR8F 4CO5A 3KHLA 1JK9B 1OJ4A 3R97A 2BVZA 4K2XA 2C3PA 5LL6d 4NYPA 4MIWA 2L41A 5DDQC 4IG0A 4X4PA 3BGFA 1VIXA 1RHJB 3W5XA 3TZXA 2XMVA 2HNYA 3IGNA 2DH9A 1CQMA 2J6TA 1YSJA 3TANA 3A4TA 1JJ4A 2AF6A 4K4UA 1SXLA 2V69A 2LXUA 1LEOA 3N9UC 3CJ3A 1FE0A 2R7UA 1KLNA 5FLXU 3T1HF 3WX4A 3QGPA 1C1BA 2BJEA 1S99A 3TZZA 1JIHA 3FKBA 1WOPA 4TYBA 3DLKA 1AXQA 3RRGA 2ZWPA 1QY7A 3GG0A 3CIZA 1P27B 4USJC 1LWFA 5F8MA 1QUPA 2YVSA 1TK5A 3UDEA 1AB8A 4LSNA 1FK9A 3ZZZA 3HVRA 4FYDA 4LFAJ 2Q66A 2OIHA 4P52A 2E1RA 1DFDA 2R7RA 2DGVA 3HXMA 1C2PA 1PIEA 1GXLA 2W8KA 3EWGA 2B4UA 1SBRA 3DGPB 3V6KA 1DJ0A 1TFYA 1RABB 3V6DB 4ZS6A 3TUZC 4P7TA 2AWZA 3R5GA 2IYGA 2UUCJ 4FP9A 1U2CA 2XC9A 1CQNA 3ZZRA 2VG5B 3IN5A 2IAJA 4QZVB 2N3OA 1LV5A 1I1GA 1RTHB 1D9DA 5HVHA 1CC8A 2JLEA 2HVHA 4RW7B 1NB2A 3UD4P 5KG1A 2ABYA 4ID8A 4CTAB 2IY5B 5HL7Q 1YRTA 2VU5A 1FHTA 5ETLA 1B7YB 2WW4A 4LR9A 5J2PB 4WP3A 2RSQA 1U1QA 2DEJA 1Y5NB 1G1XA 4ICLB 4PWUA 2EFQA 4USHA 3W9HA 1KQFB 4ZN1A 4WTOB 3JSYA 2LQ5A 5HJYA 5I3UB 2AGQA 4QR1A 3UDLA 2PT0A 3QIPB 1URRA 2D3O1 5E0OA 2BJ9A 4B3SF 4ECVA 4YUDA 3OPKA 1KNZA 4Q5VA 3KHHA 3V6DA 4HT5A 2DGXA 3GLJA 5LMUF 1WG1A 1Q86T 1FD2A 4E2FB 4H4OA 3OXLA 1EQMA 5JMNA 4JUZA 3I9ZA 4OZ1A 4JI8F 3M6XA 1FKPA 4ZPTR 4I1TA 4R0EA 3LO3A 4RW7A 2X51A 3K2YA 3NNHA 2YNIB 5D0EA 5HVGA 1NK7A 2IFXA 2HIYA 2BJ1A 2DH7A 4J9RA 2R8HA 1HPZA 2XBPA 4YR3A 3CT9A 5J2PA 4Y0FA 2XLJA 3UN3A 4ICLA 2J8SA 3K5PA 1D9FA 2V63A 3H5UA 1GAOA 3D68A 3CCJS 3KK3A 3HHKA 3BKUA 4DR3J 4QWCA 2RD5C 2QLWA 1IBCB 1WDDA 2WCXA 2G0IA 2M2BA 4F4YA 4N8NA 1MROA 2K1RA 4FPRA 3R6GB 2RILA 4Y2CA 2W25A 2DYAA 2FJDB 4Y65A 3LTOA 9ATCB 1Y11A 1Q95G 4RW8B 4C9DA 3OFHA 1FJGJ 1WC3A 4A47A 4DCOB 3KLGB 3MMCB 1NLKL 3I0RB 1FFSB 3BEGB 4O3QA 2YNHB 3U7JA 3CDAA 1RHKB 5AJ3F 3DYAA 2D69A 1X4EA 2OAUA 2HQIA 2NQPA 5EWFA 4OI3A 1H7WA 2YNIA 2V34A 3FGVA 5B0AA 3FC9A 1D1UA 5GVQA 1FXLA 1E6VB 3IM8A 3UR0A 1XC9A 2AJ2A 3JS9A 5HMXA 4G6VB 5HP1A 1FDDA 2B4VA 1IKWB 4FPIA 1CULB 1S9GA 2V50A 4QR0A 1J5OA 1RUSA 2IDEA 3BBBA 2OPRB 1H6KX 3BBCA 3UVJA 3AT1B 1X4BA 2A10A 2HSEB 2HFOA 4C48A 1S6OA 2VA2A 4NZ6A 3AOBA 3EDRB 4NRTA 4ED7A 1L3TA 3M8PB 5CZXA 2K3KA 4JI7J 3PNIA 1JLFA 3DLGB 1U1OA 3CEDA 1GMWD 2CQ0A 2IA6A 2HRUA 4K8RA 5IM0A 3G8QA 1U6BA 1S49A 5T41A 4J9NA 1YTYA 3JAMU 3N5FA 2KJVA 2FC9A 1LWXA 4O4GB 4J90A 1FRXA 1YWXA 3MD1A 1RT1B 1TELA 2FVSA 1TAQA 3W7BA 1DURA 5HQ8A 2O5DA 4X4VA 2ZBQA 1WSRA 2ZZNA 3CDWA 2R8GA 2CAJA 3BH6B 4K4TA 1KQGB 5DQGA 2AYGA 1CULA 2ROGA 4DN0A 3MCMA 4ZCIA 5KT5A 2HFSA 1I94J 2AJFE 4DX6A 2H5JB 1VOMA 3NL0A 1BQXA 3JQJA 3QO9A 2DGTA 1O6XA 1Q8IA 2XNQA 3MXHP 4OYXA 4X4SA 5EN1A 3DLGA 3OL7A 2DGQA 2CPJA 1GX5A 1MMNA 3SEOA 4XPCA 1IR2A 2P6TA 2W9CA 4OYMA 2GVZB 3UD5A 3BREA 2W7OA 3H4DA 4B9UA 4J9OA 3PRVA 1KWMA 4ZP6A 2ZE2B 4MH8A 5FJ4A 4CH7A 1RT1A 2QMUB 2VG6B 2A6MA 2ZBCA 3UDCA 3P5BP 1UJ4A 3GIIA 4MIBA 3KUGA 1RU1A 4M63A 2M70A 1NJYA 4BWMA 2WVBA 5ETVA 2WSEC 6FD1A 4Z7YA 1NCLA 2UU9J 3NAHA 4DF4A 1HFEL 3IS9B 4JYAF 1LQ9A 3C14A 1NHVA 2JC0A 1NPKA 3V2UC 3NMAA 2B9YA 3JSRA 4F04B 4F3QA 5B09A 4AUKA 2H48B 4DR7J 2GS8A 2DB1A 2W9AA 3ZNJ1 2Q1LA 4LF4F 4P7VA 2QTWA 3ITHA 5KT3A 2FHMA 3T9NA 3M8WA 2DRBA 2MY8A 4WPAA 3BGRB 1TZ0A 1KONA 4CIOA 3L7UA 2OH2A 5LXYA 2B9EA 2F65A 1G7CB 2ZJQQ 3R5CA 4CLSA 3N01A 3OQ2A 1Y0HA 3TEHB 4WKRA 4C3MA 3GYXB 1FFWB 3H59A 4EYHB 4Z2XA 2PI5A 1VMBA 4YN3B 2AX1A 4A8QA 1RQ0A 3PEJA 4QQBA 5J1NA 1RHQB 4WTYA 5SZTA 3SYZA 2ILYA 2OKQA 2UVUA 2ROEA 1X4DA 3ETMA 1VQ8S 3EYZA 1REGX 3TOQA 3NKYA 3KLFA 2EVZA 1NK6A 5CYMB 2FTRA 2ZJPQ 3IS9A 1RWOB 3TARA 3K89A 3QLHB 1OY6A 5IV3A 2B6AA 1S9FA 3OR2B 2HHPA 4MMOA 2XZWA 4IQXA 1K1QA 3IGVA 3P5TL 4DV6F 3POTA 1HW9A 2FJEB 2YKMB 1IQTA 3O6QA 4IFYB 1HNVB 2YY3A 3W66A 4OX7A 3AHPA 4ED2A 3M6VA 2E1PA 4FNIA 3FK4A 4WZMA 1N34J 1A0OB 3HD1A 4HVZA 3G6YA 3M2VB 1K1SA 4CDIA 4DV2F 3QRRA 4HTJA 4KV8B 4F4XA 1SPBP 1A9NB 4ZJQA 2ASYA 4OL8A 3KXDA 3GWCA 3P45B 3PFEA 2FD2A 3QBCA 1HR0J 1Q7YT 3KHRA 2VBWA 4TLQA 5LJ5Y 2BACA 4FN5A 2J6UA 3NS5A 3QGHA 1SL2A 2VPWB 1RTZA 3HO1A 2VASA 5SUHA 4WFNQ 3ILOA 5KFOA 3IXQA 3QLHA 4M5IA 1M5KC 3M8QB 3FDSA 2WVDA 5HVFA 2V8VA 3VAMA 4YB5A 3EGNA 3VAJA 1F2GA 1WG5A 2AHOB 3H5XA 1OSCA 1NB7A 3HZGA 4C11A 2YKMA 4FYWB 3QT5A 2DEIA 1U45A 2ZEJA 5A8WB 5D4PA 4M94A 1HNVA 4N7TA 4ATNA 3HSZA 4YDXA 3NG8A 4I2PB 1YBTA 2CDQA 4WBFA 4H4KC 3WHIA 2UVRA 2IBOA 1PGZA 4FXDA 2UVVA 3H0PA 1SC4B 4ZP8A 3M2VA 2PMHA 1DTQA 1BY9A 4DHVA 4YY3F 2BM1A 1U49A 1HYSB 5LSRA 2QFIA 2XEXA 3TA1A 1ZZNA 1CJKB 5GMDA 3W2VA 1N5YB 1B0PA 4LR8A 1LW2B 3KDOA 3KWMA 2A18A 3CCVS 3THTA 4WWSA 2FJXA 1BWVA 3KKFA 3J80U 2XY6A 2UUWA 2CNOB 2OP5A 5J1PA 2B3TB 3TX8A 2K8GA 4HACA 2XULA 1JQGA 1QE1B 3LP0A 4PG5A 4DCPB 1Q81T 4DV0J 1UWAA 4YB6A 5E3AA 2JVRA 3T3FA 4RW6A 4DQSA 2ZH3A 2JZ5A 4KRWA 1ZM9A 3V6JA 3IO1A 2ZH8A 2OPQA 1RP5A 3DHXA 4DFMA 1XNQF 3IR6B 5HBMB 2H3EB 2DHXA 3MEEA 2H1YA 4K0KF 1IXKA 1NDPA 3MM5B 1KLMB 4CLUA 2R2TA 5J2QB 1RWKB 4KJIA 3IP0A 2O67A 4L6V3 1R8BA 3MPDA 4IOAQ 1SC6A 2GGPA 4GKJJ 3BQ2A 2AEJA 1JLBA 4NE9C 1VGYA 4NEZA 2O01C 1WD6A 2CKWA 3MAAB 1Y00A 1TL7A 1UWBB 4QU6A 2PDAA 1FTRA 1X9SA 5KFIA 2R42A 1N5YA 1HNXF 3Q0AA 3M8RA 3RR8A 2LCWA 2E5HA 3MFHA 3N6LA 4OZ3A 1VR6A 3A8IA 2MQLA 3J7YU 2DNYA 4OV6A 1F6TA 4RW9B 4K4WA 4CM0A 4AD6A 4LIWA 4OYIA 4PXCA 4CLLA 1WHXA 2QEXS 5HBMA 4ZIWA 3PR5B 4OHZA 1U24A 1P8GA 3OHBA 3MM5A 1S12A 4FKXA 2ALZA 1HQUA 2VV5A 5G0RA 2LP4A 1WEZA 4NLGA 2KTQA 1UFKA 2OTLS 3MAAA 1RT3A 3Q2TC 2HS3A 1S0OA 4DPXA 2HFVA 4CT8A 3MCSA 4DV4F 4IO9Q 2OGUA 2KL8A 2G2OA 3K8WA 1Z2ZA 3DLHA 3MMBA 1J5EJ 2DY1A 1K9MT 2LKZA 1RB0A 1ZM3A 4LJMA 2YQ1A 3UFCX 4C0OC 1IBLF 4OHVA 1FF2A 1EZZB 3ENQA 3QJJA 3BPDA 2K7JA 3AAWB 4KHPF 1NJIT 5E3QA 2HHHF 4JI6F 4K4YA 3HT0A 1J27A 3PYFA 2GIRA 4KO0B 3GE9A 3J7A1 2BANA 2BKOA 1UFLA 2R2UA 4C6AA 5C42B 2FJWA 3VQSA 4Z37A 2A0FB 4USWA 1DZ5A 3BDEA 5E33A 1VQ4S 3P4UB 2H4WB 3OTDA 3FFIA 1V3ZA 3BGOP 5CHCB 2V2QA 4IR9A 2IA0A 4NCGB 2EBEA 1U26A 3KJVA 3V4IB 4U96A 3H4BA 1YG0A 5ETRA 2L9DA 4YHHJ 2LEAA 3FCWA 4P2SA 4NXMF 5A0YB 2QLXA 1WC5A 2C2DA 4DR6J 1VHIA 5MAOA 1EQ0A 4P10A 1WF0A 5LSLA 1OY9A 2CJAA 4HYKA 3QGIA 4DPYA 2RF2B 2G1DA 5K8NA 1NK8A 2FJAB 1IR0A 1EP4A 1OSDA 1IQZA 2UXBJ 1AUSL 2VBXA 2J7KA 1OM2A 4KO0A 1N8RT 3OFGA 2VZ9A 2AD9A 1NBEB 2VONA 3M9NB 1UA0A 4Y00A 4A46A 4KC5A 3AY0A 4RL1A 4C8MA 2PSZA 1S1WB 1NH8A 8RUCA 5JUMA 4NCGA 2NZCA 4X4NA 2FHJA 4UF4A 2VFTA 4LSLB 3HPOA 3V4IA 1OPIA 3N6MA 4IRDA 3RRHA 4DUTA 1XMQJ 1WKKA 3QT6A 1AZSA 4FZVA 3DOLB 2NSBA 2YKNA 3B6BA 4OYBA 2G0CA 3AX3A 5RUBA 4X62J 3Q8SB 5CXTA 3EVOA 4BBYA 1Y5IB 3OSPA 4N56A 2JLFA 2ZFHA 1I51B 1VFJA 2PGCA 5KFUA 1RE1B 1T05A 1R0CB 2V4QA 3K17A 4P2XA 4A8KA 3A3OB 4ZPAA 5ETMA 2XS7A 5D3GB 4LF8F 5HROA 3OR1A 3KJNB 5HO4A 4Q2MA 3KTQA 4JBCA 1H74A 3CCQS 2XWXA 1RWXB 4KKOA 1L3VA 1R43A 3IG1B 1WC4A 1XMOJ 4LSLA 4C3KA 5KFEA 2MLYA 4RUAA 4IG3A 4JI2J 1JLEA 4PUOB 2JC1A 1NZ8A 4DV1J 4RNNA 3EPGA 1QAYA 3TA0A 3D6HB 2VC0A 4OLPA 4ZPWR 1NPPA 4ILMA 1SJQA 1FD8A 1H2TZ 4NLRA 3VZIA 1M0SA 2YX4A 1VBZA 4HH0A 2VFSA 3PDNA 3T19A 5E2QA 1BLUA 2N4DA 2XWYA 1ICEB 3M1VA 3GQCA 4DFKA 1JXVA 2QL7B 3RW6A 2VB6A 5C25A 1UL3A 7AT1B 1RZMA 2J0WA 4A4JA 3FZBA 2IM3A 5ETKA 3Q8RB 2F8MA 1JB0C 3A3NB 2W9BB 4ZVSB 1TKXA 4O0IA 5D3GA 2WSFC 3QGGA 3QSIA 4DSIA 3IBCB 4ITSA 1HARA 5DM7Q 3T1HJ 3MPUB 2CWXA 3CCSS 2F5GA 1UP1A 3MURP 3DOKA 1SL1A 4DWIA 3RBEA 2Y1IA 5D4OA 3R5DA 1SKUB 3DDNA 4I56A 2R7WA 4PRFA 1S0NA 2ZUGA 3MFIA 4I2QB 2NCKL 4QOTA 5KFTA 3V6HA 3PR4A 1ZPWX 2Z57B 1HL6A 1Q16B 4DR5J 1R6YA 4NLQA 5D0GA 1BQMA 5A8KA 3CD6S 4DZDA 3M32B 1RBAA 3VQTA 3MECB 4DOZA 1F5BA 1X4AA 3CO9A 2MQOA 1CJVB 1GTHA 3BO4A 1QTMA 3ZZTA 3H8YA 3CC7S 2CQ1A 3P3DA 1MNEA 4TNOA 1N32J 3ET6B 2D3UA 3QZ7A 1YJTA 2ZBIA 1JLGA 2DNZA 1S1XB 4K2JA 1K8AT 2W9BA 1YBAA 2GFFA 1LWEB 4I0WA 2OSRA 2VKZG 5LMNJ 4ZCMA 1X0FA 4FXWA 1UTAA 3KG1A 1VK3A 4LR7A 4AE5A 2KJWA 1ZM2A 1VQOS 3NNAA 5ETSA 2P9CA 1DBDA 3RYLA 1Y10A 5KOWA 5M2UA 1RHMB 1VQSA 3UNYA 1VQ9S 5LT5A 1VQLS 3H7HB 1HNZJ 3TVYA 3WIUA 3CMES 3ILJA 1QVGR 2GMLA 4LREA 4BC9A 1U1RA 5CABA 1V6HA 1WC6A 1IBMJ 2JDJA 3OVSA 3BGUA 1OQ6A 3IC1A 3QFWA 2MPUA 2N82B 3PO5A 5F8JA 1XIQA 3TX0A 3EZUA 4RU9A 5IWAF 1U02A 2PD1A 4B3SJ 3AB2B 2CYYA 5K8MA 1NDLA 1QAIA 1PAUB 1F3FA 4J37A 3CDUA 5THWA 3JSBA 1LWEA 2EG1A 3RAXA 1VJQA 2WW8A 1XQIA 2ZD1A 1EETB 1H3DA 2LLZA 3I5CA 2KXFA 1S0VA 3CC4S 3EGVA 2D1CA 2P2CB 2MKSA 3CF5Q 1FRIA 3TAMB 4OIXA 2UV8A 2B7CB 3CDEA 4NCAA 1TL4A 2UXCJ 1H38A 2LU2A 4PYAA 4AXJA 2BUNA 2B9XA 1SI9A 2ZH2A 3QWPA 5LOQA 2OEJA 3GU0A 1ZPVA 1S1TB 1UAWA 3LP1A 2CZ9A 4P74A 3I4HX 6AT1B 3RBZA 1C4AA 1GXUA 4KYZA 5HLFB 1C0TB 2ZC3A 3FBFA 4OZJA 4R5PA 3DRRA 2XQCA 2CWKA 2Z58B 3OLBA 3MEDA 3OL6A 2FJBB 3I82A 3U27A 2HVDA 2AZ1A 4ZLNA 3SI8A 1CPZA 4G65A 1SJ4P 3MF5A 4B3OB 3PJ9A 2DT9A 1O0PA 1TKTB 4IDKB 1FVSA 4DPTA 2JEFA 4YB1P 8AT1B 1TK0A 3TAMA 1U7LA 1P1TA 2ZITA 3QFHA 5KFSA 4TU9A 2QGFB 4C8OA 1HHQA 1VQYA 1RAOA 5D77A 4C0HA 2CJYB 2CVIA 2XTCA 2DRAA 1WWHA 4FS1A 2CIMA 4HL9A 5H9EJ 4X66F 1V9OA 2RAQA 4F8RA 1M5VC 2BKNA 2AP6A 5DG9A 1X7VA 1ZA2B 1H0HB 2DIUA 2XSFA 4HHHA 2DR6A 5GAHU 4OFZA 1RU2A 2HFUA 5LM7E 5F0UA 3LWLA 4ZHRB 4CLYA 1LW0B 3ETOA 4AYBD 3MEKA 2EFNA 2KDOA 4MYTA 3C6TB 5KFQA 3D1HA 2HBRB 4IH6A 2DR8A 2XG8A 2HS0A 1NHKL 3OVBA 2RH3A 3R2DJ 3MR7A 2YWKA 4DX7A 4RNOA 1PO6A 4HKQA 4B3OA 2OMOA 3L9ZA 3LGHA 4NI2A 1YKWA 5BXIA 3AWRA 4RKUC 4R8UB 3KK1B 2KRBA 2MB0B 1U6FA 2B0GA 4JP8A 3LUYA 2KVIA 1TR0A 3I9V9 2OD6A 3VZHA 2FJVA 1O5JA 2M4MA 1FXDA 2MZSA 1Q78A 3VGUA 3DI6A 1X5OA 4PAAA 3W2WB 3H20A 5C7PA 4WKYA 3PV8A 3M2UA 2Z2LA 1DLOB 3CMAS 2BBEA 2HVEA 2UUAF 3OXGA 1GXTA 1IN0A 5MLCV 1Y7PA 1KOOA 4C97A 3H90A 4CYUB 2XTEA 1N5QA 1H2VZ 1JJ2R 4HTIA 1P9YA 4FF3A 2E1AA 4LT6A 1LFPA 2PI4A 2GHVC 1U0HA 5BYQA 3PX0A 1ZZFA 1VBKA 7FD1A 4RNHA 3QATA 4L72B 4E8UA 3ZTQA 3PJXA 2F3JA 4LQ3A 2M3DA 2MZTA 4EYIB 1R0AB 2XGQA 3AQOA 1JLAB 2B9WA 3CCTA 5HMZA 3GFXA 5DM6Q 2M9KA 4M5HA 3KOAA 1X4CA 2RIJA 3ZFVA 4GKKF 3AFGA 3B8HA 1SC3B 1M5SA 2QRRA 3JYTB 1YZ6A 4NLDA 4QW9A 3MUTP 2X1BA 3J80Y 5L1IA 4GMKA 2NYIA 2LA4A 2BQRA 1CG2A 1VHFA 5T7LB 2QSFA 4RNMA 4GVBA 4KY3A 1L5UA 4CH0S 5AXKA 3GYNA 1IKXB 3EICA 1LNQA 3BH7B 4DQRA 3T5LA 4LF4J 1S10A 4ED0A 2XHWA 4JI4J 1RTDB 3TJAA 3US5A 4A8YA 4PKDB 1YQHA 4DV7F 1MN9A 5K20B 2AGOA 4PQAA 1RTIA 2BR0A 2J7UA 1WKJA 4O0NA 2F7VA 1HMVB 4KGXB 3FNNA 1R0AA 3VAFA 3BYRA 1TL1A 1JLAA 5KFDA 2IIHA 1URNA 3KK2B 2E7VA 2VG7A 1TUVA 4G1QB 3DU6A 2NYHA 1YJRA 2DNGA 2HK2A 3JYTA 3CE8A 1FX2A 3KMQA 1NSKL 1FNXH 4HR2A 1JMTA 3OW2R 3KFWX 2XZ2A 4DUZF 2V9WA 2WTFA 2D68A 2DD8S 4Y2MA 1VJWA 3TI0A 4BC7A 5T7LA 4IUFA 2BRLA 3ENVA 4MIAA 2DR7A 2V0NA 2OPSB 1NUEA 1HBOA 3TZWA 5CCMA 2VUGA 4P9SA 5F41A 5KG6A 4DV6J 1U4BA 1C1CB 1PKUA 2BOAA 4O3PA 3WC2A 2DGOA 3C6UA 3K5MA 1QSYA 5DG8A 5LXRA 4U8YA 2NPFA 4Y6IA 2IJFA 2FDNA 2V67A 3NRBA 4WFBQ 3HJFA 1HMVA 5C24A 3CDBA 3IM9A 1U48A 1BMQB 3C15A 4NLUA 2GHWA 4F4WA 1X5PA 4B9MA 4NX9A 3Q22A 3M6UA 2W2PP 3DRSA 4Q8FA 2JWNA 5K14B 3CJKA 1T9VA 3Q83A 3BSOA 2D9OA 2GCFA 4NZ7A 3FCHA 3EUNA 2I5JB 1L3SA 2CUYA 4HHUA 2GZOA 5K5MA 3EMTA 5DLFA 3LH2S 2QYGA 5CZVA 2AYEA 4M1KA 4U6PA 2IM1A 3BO2A 2AQ4A 2ZWOA 4URQU 3MTJA 1AYEA 1FNOA 4NLSA 3C8YA 4PXEA 4JI1F 4Y2AA 5KFWA 3MI7X 2RB7A 4QIWD 2QG9B 3FRYA 5E41A 1MN7A 1PYTA 3TVZA 4PG4A 1WOSA 2YKPA 4B3TJ 3MCOA 4HT7A 3A8KA 2X1AA 1Q7LB 1M90T 4DV5J 3EDQB 3IA0A 5GAHI 4J9UE 4LBHA 3SQGB 2Z2ZA 4JV0A 2HNZB 1IUJA 2IJRA 3J7ZT 4YY3J 3TUIC 1KC8T 1YIJS 2DXEA 5IC6B 2FGOA 3M30A 3CJTA 3F0NA 5DDOC 4N8OA 5K14A 4RR5A 5GMKa 2WZ1A 1LK7A 2NXCA 5L9XA 3BV8A 1MSWD 5H9FK 1NSAA 3MPVA 1UMJA 3FRZA 1SB6A 1JLQB 4ES2A 4PWDB 2V2ZA 4K4VA 1NXIA 2QLJB 1L3UA 5DZ6A 2O66A 1N6QB 1UEVA 3OFEA 3H2VE 2NXNA 2EFPA 1CS4B 2RQMA 1XNQJ 2HGMA 1KN6A 4O3NA 2C2OB 3IRXA 1U6ZA 2QA2A 4F4ZA 4K0KJ 3G6XA 1C0UA 3TR5A 3BKTA 2DNQA 3SSRA 2MKYA 3BB5A 4QCLA 1NRKA 3L95X 2BEFA 3IWLA 4C98A 1S1VA 5GMEA 2J9DE 3ZZPA 2U2FA 1WHYA 5A6WA 2FHJD 5JVGQ 4V19X 2I38A 4Y34A 5IC4B 2E5LJ 1P9QC 2QA4S 5F8IA 4DUYJ 4MFBB 5KG2A 3GJRB 2X7IA 2X1GA 5IXUA 1HNXJ 2IRXA 5B0CA 4UY85 2W2NP 1F60B 2RRAA 2AV5A 4BDPA 3CW2C 1JJCB 4K5RA 1H72C 4P2MA 3I87A 3R1HA 2YNFA 2F4VJ 1UZHA 1WHVA 1PYSB 3SZ2A 3PTWA 4ALZA 1S6QB 1FA0A 3OJUA 2Z8QA 1N6QA 2YKQA 2HGNA 2DHGA 1ITPA 3CJQA 2GO9A 4MK7A 3DNCA 1CS4A 4LFAF 1N52B 4ZLLA 2BE9B 3SMZA 2YQ0A 1O8BA 2B51A 5HK4A 4CI0B 3H98A 2WAQD 4ETZA 3B82A 1QDUB 2E1CA 2G2ZA 2XNRA 3RUBL 3MGJA 2DNKA 5KFKA 4LBIA 3VVUA 4DU7A 1VLYA 1RTJB 1HWIA 2V9KA 4ZVHA 2WRMA 4O3SA 2XYHB 2NXEA 1F0XA 3D1OA 1U09A 2P6SA 2MQ8A 4FVCA 1WTFA 3CD0A 1TV6B 2UUCF 2VF3A 3QRPA 1V3RA 3F56A 2E9RX 1SVDA 4UTGA 4MFBA 4WYLA 5G4DA 5K9FA 1BGXT 1VQ5S 3CVKA 1UVKA 1KVIA 4DV4J 3JTOA 2QLFB 4CO4A 4UW2A 5IFMA 2EC2A 2DXFA 5ETOA 1IBLJ 2C3YA 2AJQA 3D66A 3V4MA 3PG9A 3BZQA 1KR4A 3GJQB 4B17A 4NZ0A 1G3OA 2EI5A 4GRSA 3BO3A 4O3RA 4M95A 3M9MB 1HBNA 3BM7A 1VLOA 1YI2S 1XR7A 2QT7A 3BKFA 3T1YF 2KZZA 2R7OA 3V81A 1N4LA 1NEEA 2ADBA 5L46A 3KJFB 3GV8B 2LQ8A 4Q8EA 1N36J 5B08A 2BMBA 4TKTA 1GQEA 1HA1A 3FJ2A 3G2XA 3HDSA 3UO0A 3ZNUA 4N41A 3BS9A 1FRKA 1IKYA 2HZVA 3J81Y 1S7IA 4MJKA 4YR2A 3VGVA 4FS2A 4ID5B 2FGCA 3W9IA 3D54A 1HWUA 4XK8C 2HBYB 3MTKA 3W60A 2H54B 3R2CJ 1N33J 1T03A 4NXMJ 4HDHA 2W2OP 1NSQA 3AJDA 3OTBA 4HLBA 2Z56B 2X3DA 2BOPA 4J9LA 3TQEA 1RAAB 5DDRC 1PJ6A 4P72A 4X65J 1HBMB 3OTOJ 1YJ9S 2JEGA 2MZJA 1NK5A 4USIA 2CG4A 4DR3F 5IT0A 2B5JA 2MTLA 2M88A 2GQQA 1S1UA 3ZC4A 3ULHA 1HBUA 2X3GA 1NU4A 1C1BB 1ZA1B 2H5EA 2RVJA 2E7XA 3FBCA 2KYZA 1HI0P 3QMQA 2XO6A 3DLKB 3DLLQ 3PRDA 4N77A 4UQGA 4JV5J 5HSPA 3LOUA 4C7QA 1E6YA 3H5YA 1LWFB 1Y3JA 1ZAXA 3AX5A 2EFGA 4KPCA 2ZM6F
chains in the Genus database with same CATH topology
4K50A 2QMXA 1RT3A 3Q2TC 2CQPA 1J2VA 2HS3A 4LSNB 1FK9B 1S0OA 2LYVA 2Y1JA 2NREA 3K57A 2CJ9A 1JKHB 5K8OA 3I5AA 1ZTTA 1UKUA 1TQLA 3MM8B 3MM7A 4A8OA 3G96A 1S97A 4RLEA 1YJVA 4CT8A 4A8SA 1SUQB 3MCSA 5L8RC 4DV4F 4IO9Q 1WF2A 1HI1A 2KFYA 4ELTA 4FF2A 3K8WA 3CUNA 1FESA 3LP1B 3GIJA 2DCUB 2CQ3A 4N76A 1Z2ZA 2RS8A 2ZNYA 1WNEA 3MMBA 1R8PA 3DLHA 4I67A 3KLEB 5KFRA 4TQSA 1WI8A 3F73A 3MM9B 1FNMA 2HRYA 3HZEA 1K9MT 3LANA 2ZH5A 2KO1A 2LKZA 1ZM3A 4F26A 4LJMA 3KK2A 3UFCX 4C0OC 2RDJA 4OHVA 1FF2A 3GR0A 3KHGA 1IBLF 5KT4A 4G1QA 2MZRA 4J9QA 3BR8A 2LQBA 3ENQA 1X0PA 4IOBA 3QJJA 4DPOA 2YTCA 4FBTA 5E3CA 1VS3A 2K7JA 4R5PB 3AAWB 3PEHA 1UJ6A 3DRRB 4KHPF 2KB2A 1HBMA 5KTQA 1NJIT 5E3QA 2HHHF 4JI6F 2JHEA 4K4YA 3MEDB 1HNWF 2IAJB 2XY5A 4DV0F 1UJ5A 2HHVA 4NYOA 2AJ0A 2GIRA 2CQIA 1UUJA 1Q82T 3HX9A 4KO0B 5KFXA 3VAHA 3GE9A 3J7A1 1DQ9A 1RWUA 3ZZ0A 2BANA 4MYUA 1UFLA 4AL7A 4NPOA 4H4MB 2XO7A 1KSPA 2R2UA 4ELVA 2MQMA 3KNAA 2OPSA 4QPXA 3DRPA 3SV4A 1G6BA 5C42B 2PO4A 2FJWA 3PJWA 2IMWP 4WFXA 3VQSA 4LIRA 2ZHOA 4Z37A 1N88A 3K58A 4ECWA 3N4WA 1DZ5A 3BDEA 3SDEA 5E33A 2LQJA 1MMLA 3FQKA 3LP2B 4ED5A 4WXWA 5IQ6A 5KFGA 1C1CA 1VQ4S 3OTDA 1VIOA 3BQ1A 4OMFG 2WONA 4EUVA 3FFIA 1V3ZA 1CVJA 3THPA 4QPTA 5CHCB 4BWJA 1D8ZA 3F41A 4IR9A 2IA0A 4HDGA 1P1LA 4NCGB 2KM8C 3M9OB 1SV5B 3TYTA 3BR9A 4YEAA 3FEZA 5E7OB 4JI4F 3MZIA 2QO3A 2ZE2A 4ED1A 3JB9k 4K4SA 1MW7A 2MSSA 1S72S 4QWBA 4Y2IA 2XCPA 4MK9A 2XB2D 3UCUP 3R3TA 3PVXA 5I42A 2EBEA 1U26A 3KJVA 3V4IB 5CH7B 1FERA 2KHDA 2XS2A 1FXRA 2DIVA 3H4BA 5DO2A 3IWXA 1JKHA 3VALA 3MM8A 2CPZA 4AXIA 4TY9A 1YG0A 2CJQA 2VG6A 2DITA 1HHSA 1Y9OA 2L9DA 1SUQA 3LAMA 1M5PC 4X4UA 1SQEA 5F0WA 1Y4ZB 2LEAA 3HHLC 3P49B 4DSKA 5M2PA 4P2SA 4NXMF 5A0YB 3KLEA 2MZQA 1VRUA 2QLXA 4ES1A 3CWJA 3MM9A 3T6JA 2C2DA 3PM9A 5MAOA 2ZH9A 1WF0A 5LSLA 5CD4H 2CJAA 4EBEA 4HYKA 2DGUA 3QGIA 1NNDA 2K3IA 4ES3A 2FLPA