3OL6A

Poliovirus polymerase elongation complex
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymerase
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
total genus 140
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3ol6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ol6A02
2OPQB 1JLAA 4H4OA 1Z4UA 3FQKA 2FVPA 1S1VB 2FVSA 1JLCA 1KHWA 3H5XA 5HROB 1J5OA 3UR0A 3D28A 2FVCA 3IGVA 1SH2A 4NLXA 4KKOB 2YNGB 3BGRB 2R2UA 4ECSA 5KFQA 3T5HA 3V81B 2BQUA 4U7CA 4ECVA 4NLTA 4ID5A 5DQIA 3BQ0A 5KFYA 4IR1A 1SH3A 1SUQA 3DYAA 2AGQA 1RYRA 2J6TA 3QLHB 1LW2B 4K4WA 3M8PB 3QYYA 4KHMA 2IJNA 5KT2A 4IKAA 3E51A 2V4RA 4QWBA 1XR6A 3ISNC 3DLKA 2RF2B 1FK9A 4ZVHA 2D7SA 1VRTA 1RTJB 3PW5A 5F8JA 2V4QA 2ILYA 3DMJB 4IFVA 1C0UA 2J6SA 2QV6A 3DRSB 1TV6A 3DRRA 3T5LA 5KG1A 1S0MA 4ZP6A 3QGGA 5J2PA 5KT7A 2C28A 2FLNA 4O44B 4K50A 4Y2CA 4ED0A 2I5JA 4WYWA 2AQ4A 2B5JA 4NLYA 2ZD1A 1JLFB 2YKNA 3H59A 3IS9B 2IC3B 2WHOA 3DLEB 5C42B 1FKPA 3QO9A 4R8UA 4ED3A 4K4YA 4IG0B 3I0SB 5F8LA 1JLBA 2UVWA 4MFBB 2BQRA 1TVRB 1K1SA 1JLGA 1JKHA 1R0AA 2IMWP 1S1UB 2XI2A 1HQUB 1T03B 5J2NA 4MK9A 5I3UA 1DTQA 1S1WA 2GIQA 3I5AA 4YR2A 1N4LA 2BE2A 3KJVB 2J6UA 3OL8A 1IM4A 2AGPA 1TKXB 4ED2A 1QE1A 3SI8A 3GV5B 2VG6B 4DL5A 2UVVA 4KE5A 4F4XA 2IAJB 1KLMA 1S6QA 3G86A 4IH6A 3HKWA 4NLRA 1C1BA 2OPSA 2O5DA 1RA6A 2UVRA 2AX0A 4Q8EA 3GIKA 2I1RA 3OHBA 3KK2A 4QWAA 3PZPA 1HMVB 4FBUA 2FJWA 5KG4A 3PR5B 4H4MA 2R2SA 1S0NA 5DLFA 4PUOA 4IFYA 2OH2A 1JXLA 4LSLB 2W9AA 3RAQA 3M9MB 2YNHA 2FVRA 4GC6A 4I2QA 2IM0A 3T5JA 5KFHA 2ASLA 4ZVGA 1LWFA 3CJ0A 3KLHB 3GQCA 1BQMB 4NRUA 5KFGA 2BR0A 3MF5A 2UUWA 4G1QB 4NCGB 3KLFB 4ECWA 1RTDA 3OHAA 3DM2A 4RW8A 5J2QB 3LAMA 3C6UA 5KFJA 3NKYA 4YMEA 3T19A 3CVKA 4B3OB 2WOMA 3KLIA 2XCAA 3UQSA 4G3IA 2OPPA 3QIDA 3DOLA 5D3GA 2AX1A 1RT2A 4O3OA 4EBEA 3T1AA 3IG1A 1EP4B 3PVXA 1HARA 1I6JA 4RW7A 3BSCA 5KFAA 2HMIA 4ICLB 4ZVEA 5KFDA 1MU2B 3LP0B 3M8QB 2HNZA 2HNYB 5KG7A 4EEYA 1C1CB 4KB7A 5CYMA 1TQLA 4ZPDA 3UDLA 2W9CA 1RT3B 5J2MB 2IA6A 4ZP8A 4K4TA 4Q0BA 1HPZB 4ZPCA 3FFIB 4TYAA 5KG2A 4NLUA 4IRDA 1LWCB 2B6AB 4PQUA 3PHEA 1HNIA 3JSMA 2AWZA 4I7FB 3NL0A 1TL1A 1S9EA 2BANA 3MEGB 5KT6A 5HBMA 1HYSA 1T05A 3CWJA 2W8LA 4PWDA 4WXWA 2AGOA 4ZPAA 1TKTB 1IKYB 1C2PA 4RUCA 5EWEA 2OPQA 4RNMA 3D5MA 2HWIA 1BQNA 2HNDB 5HROA 5KG6A 5KFTA 2YKMA 4EYHB 2ASDA 2JC1A 3DI6B 4KKOA 2YNGA 3BGRA 5J1EB 3V81A 1N6QB 3BQ1A 4MKAA 4J9SA 3CJ2A 3LP1B 3G6XA 1LW2A 3HVWA 3M8PA 4RW9B 2ILZA 1GX5A 4K4XA 3Q8SB 4MKBA 2W9BB 5DGAA 4KV8A 3EPIA 3V6DB 2EC0A 4WE1B 5L9XA 4ECXA 2RF2A 3DLGA 2UUTA 1RTJA 3G6YA 1FKOA 3DMJA 5C25B 4ECZA 1S1XA 5F8NA 3DRSA 4K4ZA 4GC7A 2ATLA 2BQ3A 4OL8A 3PW0A 1W25A 4NLSA 5L1IA 3LAKA 4O44A 5KFNA 1JLEB 1S6PB 2XGQA 3LP2B 4LQ3A 2YNFA 5HLFB 5DG9A 4RZRA 4TQRA 2XCPA 1JLFA 4ZVFA 5JXSA 3IS9A 1C0TA 2IC3A 3DLEA 2CKWA 3V6HA 5I42B 4IG0A 3I0SA 2FLLA 4XPEA 5L1LA 5DLGA 4MFBA 4F50A 1TVRA 5F8GA 4IOBA 2E9TA 1S1UA 1JIHA 1HQUA 5F8MA 2ALZA 5KFMA 2W7OA 1QAJA 2WK4A 3RBEA 5CYQA 2R8IA 2ASJA 3HVAA 3I5BA 3KJVA 3E01B 2VG5A 1TKXA 3MECB 4IH7A 2VG6A 3N6MA 4NLWA 3OLBA 4ZP7A 4F4YA 3C6TB 2IAJA 1LWEB 4IDKB 3H40A 2HWHA 3PR4A 3I0RB 4RW6B 1JLQB 5HP1B 5T14A 1DLOB 3JYTB 4URQU 4DL6A 4EO8A 5KFUA 1J5OB 1RTHA 4KSEB 4J9RA 4IQXA 3H5YA 1IKWA 4WFZA 2XWYA 2RDJA 4F4WA 1ZTWA 2C2DA 5DGBA 3KOAA 1N56A 4TY8B 4EBCA 1BQMA 5EWFA 4G1QA 4NLPA 4R5PB 4NCGA 4QPXA 2YNIB 3TVKA 3KLFA 3MEDB 3KK3B 3M9NB 5KT5A 4U6PA 1OS5A 4ED8A 4MH8A 5KG5A 1VRTB 3ITHB 4B3OA 4NYZA 3DDKA 2D3ZA 4IFVB 1S10A 5F9LA 4O3RA 1IKVA 1TV6B 2WONA 3DRRB 3HVTB 3PW7A 4O3SA 3IN5A 3Q8PB 1IKXB 1LW0A 5DQHA 1T3NA 3QGHA 3OSPA 1EP4A 2OPRA 4J9LA 4NRTA 5DG7A 4ICLA 1FKPB 4DL3A 4Y3CA 1MU2A 2D3UA 5FDLB 5K14A 3BREA 3CDUA 3LP0A 3M8QA 3TAMB 2XC9A 4NZ0A 3GV7B 2HNYA 2JEJA 1C1CA 3QIPA 5EWGA 3NGDA 2F8EX 1RT3A 4YQWA 3GIIA 5J2MA 2ZE2B 4J9KA 1HPZA 1REVB 5DQGA 2R8HA 1DTQB 3CJ5A 3NAHA 2BE2B 1LWCA 3FRZA 3V6JA 2V0NA 5KFSA 3KHLA 1EETB 4DL2A 1SV5B 4RU9A 2RKIA 1KHVA 2R2RA 4ECUA 3RBDA 4DL4A 4EYIB 4ZHRA 3IRXB 3BSNA 1HQEB 1IKYA 1TKTA 1RT5A 4Q45A 3FQLA 2HNDA 3OLAA 1UWBB 1TKZB 2BRKA 1RT6B 1RT7B 3DRPB 5C5JA 3DI6A 1N6QA 4O3PA 5J1EA 3KHHA 2FJVA 2FVQA 1S48A 4HKQA 3RAXA 3FSIA 1TL3A 4JV1A 4ED1A 5L1KA 4F4ZA 1QAIA 3N6NA 4WZQA 4RW4A 3BR9A 3CO9A 4JV0A 3PJXA 5JUMA 3KLEB 3Q8RB 2W9BA 4J9OA 3V6DA 1RTDB 4IRKA 4I2PB 4WE1A 4IR9A 2JEIA 1S1VA 4NLVA 1S0OA 5C25A 1RA7A 1N5YB 2IM1A 3KLIB 2R8GA 5KFLA 3SFUA 1NHVA 3CJ3A 1DTTB 4RUAA 4ED6A 3MEEB 3DOLB 4QW9A 3PW4A 3DOKB 5C24B 3ICLA 2C2EA 4O4RA 4IRCA 3KNAA 1JLEA 1S6PA 1RT2B 3GYNA 3QLHA 1RTIB 2FLPA 4RNOA 3VQSA 3NBPB 4TQSA 2FJXA 3KHGA 4MIBA 3H98A 4LSNB 3KLGB 5I42A 1XR5A 2JLEA 3H4DA 1U09A 2VG7B 5F8IA 4YP3A 5CYMB 1JX4A 4EO6A 3V4IB 4TYBA 3QZ8A 1CSJA 1RT1B 4M94A 2V9WA 4FBTA 1S9GB 3MR5A 3E01A 4HYKA 4YR3A 3QGIA 3PJWA 3C6TA 3Q8QB 1LWEA 4IDKA 4TN2A 5C42A 5HBMB 4M95A 1HYSB 4ECQA 4X2BA 3BSAA 2WTFA 1RT4B 5KT3A 3I0RA 1VRUB 1JLQA 3LANA 4IG3B 4RW6A 4J9QA 3OL7A 2QE5A 3V6KA 3OSNA 4MK7A 1DLOA 4DL7A 3JYTA 3SFGA 4DG1B 4KFBB 1BQNB 1T03A 4KO0B 1YVFA 3MFHA 4Q43A 1WNEA 2YKMB 2JEFA 4Y2AA 4O4GB 3KK1B 3PW2A 4ECTA 4ECYA 4O3QA 1HNVB 1S1TB 4TY8A 4K4VA 2UVUA 4H54A 3N6LA 4WXOA 4XO0A 4J9NA 4R5PA 3KK3A 2YNIA 5KFWA 5KFEA 4QWCA 3MEDA 3RB3A 4KV8B 4NLOA 1NNDA 4JUZA 1TP7A 1JLAB 3DLGB 3ITHA 4H4OB 3KHRA 2B43A 1JLCB 1FKOB 1HMVA 1S1XB 2AU0A 1T94A 4KBIA 1D0EA 3GIJA 3HVTA 5KFOA 4XPCA 4K4SA 2JC0A 3OL6A 4LSLA 1IKXA 4URGA 2W7PA 4PWDB 4ID5B 4IH5A 2IJFA 3QZ7A 3RB6A 1SUQB 3DYAB 4KHRA 2YNFB 3KLHA 1C0TB 4Q8FA 4WFYA 5J2QA 5FDLA 5KFKA 3TAMA 2W8KA 3DLKB 3HHKA 1FK9B 4LQ9A 5DG8A 2XGPA 5HP1A 4WYLA 1C0UB 4NLDA 5KFIA 3ISND 4ZP9A 1MMLA 2ZE2A 4TXSA 4URSA 5J2PB 2CJQA 1REVA 3H4BA 2JEGA 5CYQB 5KFCA 2I5JB 4TY9A 3RB0A 2D41A 5F8HA 2B5JB 2HAIA 1RDRA 3NAIA 2VG5B 1EETA 2ZD1B 3MFIA 3GILA 1SV5A 2VA3A 2YKNB 4R0EA 5KFRA 3QO9B 4R8UB 2IM3A 1QUVA 3H5SA 3IRXA 2BRLA 4K4UA 1HQEA 1JLBB 4KAIA 5F9NA 5KFBA 1SH0A 5KFXA 1JLGB 1JKHB 1R0AB 3RB4A 1UWBA 5J2NB 1TKZA 2E9ZA 5I3UB 3DRPA 1RT7A 1RT6A 3FFIA 1RTHB 3CJ4A 1S1WB 3GV8B 3CIZA 1ZTTA 1IKWB 2B6AA 3UPFA 4I7FA 1QE1B 1D1UA 1K1QA 3MEGA 4RNFA 4DEZA 5EUHA 1KLMB 1S6QB 3CDEA 3BQ2A 5KFPA 2R2TA 3KLEA 3BSOA 3CDWA 3EPGA 2C2RA 2IBKA 1GX6A 1C1BB 2OPSB 4I2PA 5KG0A 4RNHA 3M9OB 4ED7A 2R8KA 1N5YA 4J9PA 3KK2B 4NLQA 4O3NA 1DTTA 2DPIA 5KFZA 1IKVB 2GC8A 3MEEA 4H4MB 4PUOB 2WONB 2ZKUA 3DOKA 4IFYB 5C24A 1LW0B 2YNHB 3LP1A 2XI3A 4I2QB 1RTIA 4RW9A 1N48A 3KMQA 3T5KA 1LWFB 2OPRB 3NBPA 3MR6A 1S9FA 1XR7A 2WB4A 3H2LA 2RDIA 4LSNA 3KLGA 2WRMA 3DM2B 4RW8B 2WCXA 5KG3A 1RAJA 3C6UB 5K14B 4RNNA 4MK8A 2VG7A 2WOMB 5KT4A 3QIPB 3MR2A 3G6VA 2OPPB 4FS1A 3V4IA 2E9RX 3H5UA 1RYSA 5D3GB 3I5CA 4ECRA 1RT1A 2R8JA 1S9GA 3LP2A 1S4FA 5HLFA 3IG1B 4QWDA 3KLVA 4RW7B 4WFXA 3BJYA 2RKIB 4MIAA 4TLRA 2HMIB 3KMSA 4JV2A 3LALA 3MTKA 4ZHRB 1RT4A 4ZPBA 3OL9A 1VRUA 2HNZB 4IG3A 4FS2A 3TQ1A 4WZMA 1RT5B 2C22A 5KFVA 3FDSA 3EZUA 4ZMMA 2W9CB 4DG1A 4KFBA 4QW8A 3MR3A 4KO0A 4J9MA 2DPJA 3NMAA 2GIRA 3IGNA 4Q0BB 4O4GA 3KK1A 5EDWA 5L1JA 2VA2A 1NHUA 4PQUB 3MECA 1HNIB 3JSMB 1ZETA 1HNVA 1S1TA 1TL1B 4QWEA 1S97A 1S9EB 1TL3B 2BANB 2IM2A 1T05B 4EBDA 4RW4B 5KFFA 4Y34A 3GIMA 4NLGA 1S49A 4Q44A 4YR0A
chains in the Genus database with same CATH superfamily
1WTBA 3MDFA 4I6AA 3IGVA 2R2UA 4NLXA 3T5HA 1HWUA 2F5GA 1SC1B 4DR4F 1FK9A 3MUMP 2V9KA 3JAMU 3ZXWA 3PYDA 3AODA 3CC4S 5C2CA 5SUHA 1UVKA 3HT0A 4QIWD 3D9BA 4ETZA 1VBYA 4DS5A 2XI2A 4DL5A 4NCAA 1NK6A 2B9XA 3PKMA 4ELUA 2V34A 1OYEA 1JK9B 4IFYA 1VS3A 1VQKS 3RU0A 3CCLS 2OMLA 3U1LA 2DNRA 5HVHA 3G8SA 4ECWA 1HLWA 5L8RC 2KG1A 1RWVB 4B08A 4RWWA 1KTVA 3T1AA 1GFWB 2MQQA 3GU0A 2VFVA 2VUGA 2YVSA 4WFBQ 2QYCA 4DZ6A 3EUNA 4KJIA 5E3PA 1W26A 2J0XA 3OJUA 2QT7A 4NLUA 1GK8A 1RWKB 1TL1A 1MMNA 1HYSA 3K17A 2HHWA 5HJYA 3ZNUA 2HVHA 1URRA 4GKKF 5EWEA 1U26A 2HNDB 2FDNA 3NOCA 1OYDA 3HVWA 3Q8SB 4ZN1A 2E1AA 2PGCA 3DLGA 4ER8A 2BE9B 3W2WA 4ECZA 4YB5A 5AXMA 2VJVA 4HHHA 5F8NA 4RL1A 4O44A 2O01C 2YNFA 4RPFA 2WVDA 5A6PA 3BO2A 3J81j 5I3QA 1CULA 4YDXA 1VHIA 3M1VB 3H40A 3O1LA 4LUBA 4FZVA 3AQPA 2DCUB 1S76D 2E7VA 2H5EA 1IKWA 2CADA 1B70B 3KUGA 3TRGA 1OS5A 1OO0B 1S10A 4U95A 4M5IA 5H9EK 1UJ4A 4EK2A 4J9LA 5DG7A 3RBZA 2VKZG 3BREA 3DN9A 3PCOB 1Y11A 3NGDA 2HHQA 1E6VA 4PCQA 2LA6A 5DQGA 4H4KA 4DL2A 3U1MA 1IUJA 1NKCA 1IKYA 4LFAF 3L3CA 2ZH4A 3W64A 1TKZB 1Y5LB 4J7CA 4A8OA 4B9VA 4F4ZA 4JV0A 1S0OA 4K8RA 3GSDA 5C24B 5AE1A 3VQSA 5I42A 2ZFHA 2KZMA 2FHJA 2G2YA 4DV0F 1VQNS 1NSAA 1CSJA 1R8AA 5I3PA 4C2MA 4FBTA 2MZRA 1UL3A 4U8YA 3QBCA 3QGIA 2BYCA 3C6TA 2VC1A 2H51B 2WTFA 1VRUB 4W98A 5HQLA 1WG4A 1OMSA 1T03A 3PG9A 4Q43A 3T9ZA 1RWXB 1U6BA 5FJ4A 3OTOF 3TZZA 3RR8A 3EYZA 3Q24A 1EJ7L 2J7WA 1XQIA 4KGKA 1HWIA 4MMOA 3GIJA 3OL6A 2E29A 1Q82T 1QUPA 1ZPWX 4U67Q 4WFYA 1C0UB 3GLJA 5KFIA 3ISND 1XNRF 2W4CA 2JEGA 4ZIWA 3GILA 5ETRA 1UW4A 3W2VA 4A8YA 1QUVA 1X4EA 2BRLA 2HQFA 2MLXA 2R9LA 3CJ4A 2EVZA 4PKDB 3T1YJ 4C8KA 4NMXA 4Y2MA 4PYAA 3VAKA 3BGFA 5KFPA 1R7IA 3AFGA 2H5IB 1FNXH 2MGZA 1XR7A 3TVZA 4LSNA 5K14B 2HWTA 1KSPA 2DR5A 2WOMB 2F4VF 1K0TA 3MCSA 2OPPB 4N41A 4X4NA 3A8JA 1K9MT 4ZOSA 1U1NA 2ADCA 2QC3A 3UN2A 3P5BP 3FDSA 4B3RF 3TAPA 1KFSA 2VA2A 3NCRA 2WVBA 3R8YA 1HNIB 1ELOA 4HEA9 5G0RB 3CCVS 2G2OA 1DBDA 1S49A 5IXUA 2YNGB 5HSPA 3R5BA 1LW2B 4KHMA 5JVGQ 3KUHA 4OZNA 3ISNC 2RF2B 1HBMB 1FWKA 5ETNA 5F8JA 2RQKA 4ZP6A 3QGGA 5KT7A 2FLNA 4U96A 3R5DA 3GG0A 4JI5J 4R8UA 2Q6CA 3MPWA 5F8LA 2A6OA 2DIUA 2MTLA 5ETOA 3OVBA 3IAM9 2P8IA 5J2NA 1P6TA 2QLBB 1S1WA 2GIQA 1KQSR 3D4JA 3C66A 2YKQA 1X0FA 2MZJA 2RVJA 1SXLA 3G4SS 3R5AA 3VTIA 2K3KA 4I2QA 2Z56B 1WOOA 3TOQA 3NKYA 2XMMA 2AX1A 4U7UK 3OD2A 4DFPA 1N33F 2UU9J 4RW7A 3RW7A 3BDPA 4ZLLA 5KG7A 3OR2A 4PXEA 4Q0BA 3HP6A 4Z37A 3UO0A 4DV1J 2Z58B 1S72S 5MLCV 2AGOA 2MLZA 2KDOA 5K8PA 3A3OB 3RBXA 2YY3A 2RUSA 1RP5A 1FF2A 2ASDA 4DV6J 1X9SA 4LVNP 4J9SA 5D15A 4DSIA 4HR2A 3V6DB 4QYZK 4ZA1A 2VICA 3NNHA 2J9CA 2DGOA 2RH3A 2EFNA 2DH7A 3CGIA 1DFDA 1Q95G 4IOBA 2A10A 2JVRA 5A8RA 3MM9A 4ZP7A 1RWPB 2IAJA 4OYZA 4OIXA 1SQFA 3HSZA 1WWHA 4K5SA 1N54B 5KFUA 1FVSA 2Y0SD 2YPZA 4KSEB 1YG0A 4OYAA 3JSRA 3Q83A 1JJCB 2CZVC 2VODA 4U6PA 3BS9A 4I1TA 3CO0P 4NA3A 3M2VA 4IYQA 5FDLB 1UFWA 3ZC4A 1WELA 2GFFA 3WDOA 3TJAA 4YN3B 3HK2A 3OVSA 3CJ5A 4FXVA 3V6JA 4X65F 3RBDA 2MKSA 4EYIB 5GMKa 2XTDA 1RT5A 1N5SA 1V9OA 2BRKA 5IC6B 3U02A 1N6QA 1TL3A 1GQEA 5L1KA 4F2RA 5CD4A 1QY7A 2UV8G 2RDDA 4KGXB 2IM1A 4RUAA 2E7XA 2JX2A 3DOKB 2EWHA 3LWLA 4F36A 3NBPB 3SSRA 1HWKA 4DQQA 4DSLA 3H98A 2ZOFA 1N52B 1YKWA 2NXJA 3TW0A 5HQMA 2HKEA 2MJNA 3E01A 3TJ8A 2OELA 5C42A 1DRZA 1LFWA 4X2BA 4EBCA 4CZCA 1JLQA 3DU6A 3SQOP 2MPUA 4HVZA 3BB5A 3P5TL 2P5VA 2MKHA 4XDDA 4WXOA 3U7JA 1YJNS 4KV8B 4C3MA 4KTQA 1V5VA 3M30B 1S57A 3J81Y 4C0BA 2O67A 5IV3A 1CLFA 1UCNA 3PNIA 2KXHA 2VQFF 1HR0J 2R3VA 4KGVB 4J9VA 1YK9A 2OIHA 1VK3A 2VA3A 2YKNB 2DHGA 1HQEA 4KAIA 1YX2A 4PXDA 3I96A 1J5EF 1P27B 1U1QA 4U9RA 2V69A 3FFIA 4ZLPA 2NXNA 3ZZ0A 3J81U 4CO4A 4F0MA 4B9UA 2CQ1A 4PWWA 3OFHA 4DDFA 3M2RB 5GAHI 2AZ1A 1DTTA 2WONB 1N5QA 2Q6BA 2C2OB 3DXSX 2XZDB 3B4DA 2CWKA 1RTIA 4RW9A 2G0JA 3EMTA 3I87A 4ANDA 3G6VA 1D9AA 3DLBA 1S6UA 4OHXA 1LEOA 4P10A 3LP2A 2LQ8A 4MIAA 1SVDA 4A48A 3TQ1A 3ULHA 1QSSA 1CS4A 2OEKA 5EDWA 1Q7LB 1T9YA 2EFOA 2BANB 2Z4PA 3CCES 1NDLA 4F25A 2CJXB 2ZVIA 4LVOP 5E5NA 1Z4UA 4DX7A 5JVHQ 3D28A 3BO4A 2V9WA 2GGPB 3AAWB 1YHQS 3P49B 1HQ2A 3DLKA 1ZAXA 2K7KA 3DRSB 4YUDA 4QYRA 4OYWA 3O3LA 1RAGB 2A2DA 1S77D 2B5JA 1TAQA 2Z0GA 2W4DA 3IS9B 2IC3B 2M88A 3ZZPA 1SJQA 2Z2MA 1DTQA 2V2ZA 2SXLA 2CPXA 1S6QA 2C42A 3GIKA 2MMYA 2DNNA 2DGXA 4LF8J 2FJWA 5KG4A 4USMA 4H4MA 3ETMA 4L6V3 2BJEA 2N7CA 1K44A 2F8HA 4K2JA 3DDIA 2KVQE 4BLGA 1PAEX 5KFJA 1L3UA 1S6OA 2MLYA 5L46A 3MM6A 2C3MA 2X1GA 1RT2A 2HHSA 5M2RA 4WU2A 4AT1B 3LP0B 4USHA 1U4BA 3DOMA 2WAQD 5CYMA 1WI6A 2BBEA 1YDLA 5B0BA 1HBOB 5KG2A 2RB7A 4X4VA 2FJAB 4DX5A 1T05A 1S79A 3B4MA 1SCJB 2MQMA 3ETOA 4HL9A 5E7OB 1RHMB 3LP1B 1AXQA 2KH9A 1B0PA 4F3OA 1YRTA 2XY7A 5AXKA 1UFKA 3G6YA 1UVLA 4CIOA 2I38A 5K8NA 4B3MJ 4FDFA 4L76A 2HLTA 3CT9A 1M5OC 2XSJB 1MNEA 4YHHF 3I4PA 4I56A 2QTWA 3Q2TC 3TWZA 3LF0A 3HVAA 3N0VA 1QM9A 3MM5A 2RRAA 2QLWA 2CPHA 4DL6A 1J5OB 3H2VE 2DNMA 3G82A 3MGJA 2PMHA 4V19X 1X4CA 5A2QY 4G1QA 4LF5J 2OSQA 1FFGB 5KG5A 4IFVB 1TV6B 3RUBL 1M5SA 1WJ9A 4DQSA 3CE8A 3VZHA 2ZWOA 3GWCA 4WFAQ 1MU2A 5B7WA 2C2ZB 2NR0A 1OSCA 1SIZA 1HPZA 2C3UA 2AF6A 4B3TJ 4A8QA 3J80Y 3VGSA 1TKTA 3CF5Q 3M6WA 3NGUA 5A2QU 4Q2MA 4NXMJ 3PTWA 1R89A 4O3PA 2VZ9A 3HFVA 1FWLA 3KLEB 4EFAC 4IR9A 1U8SA 3US5A 2HZAA 4JV5J 3BEGB 4NOHA 3D0HE 3GYNA 4C97A 2CYYA 3QPIA 2R7QA 5K8OA 4QR0A 4MIBA 1OSDA 3KLGB 1Q78A 5ETLA 4OHVA 2UUBJ 2D9OA 3TQEA 4F2SA 4M95A 3BSAA 1U2RA 5GAHU 4J9QA 1DLOA 3I31A 4FF2A 3C14A 3KK1B 4J91A 1U1RA 1HNVB 1Q0NA 4TY8A 3SMZA 2UVUA 5CQGA 4DR4J 4DR7F 1ZZNA 1FEHA 1XNQF 4JUZA 1TP7A 2RRNA 3TYTA 1D0EA 1U1KA 3EDRB 2XTEA 4OZ1A 3MAAA 2YWWA 2V6AA 4W90B 2CJKA 3MPUB 4OX8A 1DHMA 7FD1A 3EVWA 2VONA 1RAAB 4DF4A 4AL7A 1YBAA 1VRQC 2DXFA 3RB4A 3MPDA 4C8YA 4FF3A 2HHVA 4YEAA 3GP9A 1YTYA 2D9PA 2PN6A 3M9OB 2ROGA 4J9PA 4C8ZA 3D6TB 2XI3A 1TMJA 3ENWA 2WRMA 1NBEB 1Y4ZB 3QIPB 1FI4A 2EG2A 3I5CA 2MHEA 1RT1A 2CVIA 1GEHA 2RKIB 3HDSA 2V4JA 1UPMB 2ZJQQ 3MMAB 4GKKJ 2UV8A 4ZMMA 4QW8A 2EFVA 1OIAA 3VAGA 2H9ZA 4I0WA 4M5KA 2UUAF 9RUBA 2PFDA 3Q89A 3GIMA 4YR0A 4H4OA 2FVPA 1ZM2A 4M5JA 3V81B 2ZZNA 4NLTA 4F4KA 5C2GA 1HNXJ 5EX0A 3K58A 4K0KJ 3X3UA 4ANCA 2CQ0A 2EK6A 5KG1A 2MKCA 4GVBB 3W9JA 5CHCB 2DY9A 2UVWA 4X4TA 1IR1A 3FCVA 1JKHA 3M8WA 1R0AA 3IP0A 1DJ0A 1NK0A 2NXEA 5D4OA 1QE1A 2ZNYA 4QU7A 4RBTA 1GMWA 1N32F 4A8WA 2ZH5A 4LMZA 1U02A 2JLGA 3PZPA 2JSXA 4PUOA 4K2XA 1UVNA 4LSLB 4C0OC 1OQ3A 3GSIA 3KLHB 3DM2A 3T19A 3R5GA 2A18A 2BJ1A 1R43A 5IM0A 1F1BB 4ZVEA 4A8FA 2HNZA 1RCOB 1NJWA 1RT3B 1NK9A 2XG8A 2YQ1A 1NDCA 1ICEB 4A46A 2R7XA 2R7OA 4PG5A 3ZO7A 3E8OA 3SCLE 1JB0C 3D5MA 1FX2A 5GVQA 1ZAVA 3FNNA 5GAEI 1LV5A 2A3JA 2IA0A 3BR8A 4K59A 4NPOA 4CTAA 3MURP 3BPDA 1RTJA 4UZCA 3DMJA 4DV0J 1JLEB 1UTAA 5HLFB 5IV4A 1JLFA 1NB7A 1X60A 2B4OA 4DPYA 2E9TA 4RX6A 2XQCA 2W7OA 3RBEA 3OFEA 2CG8A 2NCKL 5CYQA 4ZLJA 2ASJA 2HVZA 4PZVA 1N5TA 1UA1A 2CQBA 4F4YA 1BMQB 1WF2A 4IO9Q 4OV1A 3NY0A 2DNYA 3OUYA 3H5YA 2XWYA 4USTA 3THTA 2ADBA 2VHGA 3MEDB 5KT5A 1VRTB 4DUYF 1Q53A 4N56A 5HN0A 3DGPA 2XS2A 5BR8F 2ROPA 1WORA 2VFRA 1ITPA 4I69A 1HI8A 1NCLA 5J2MA 1CJVA 3HHDA 2IRYA 3QRPA 1LK5A 2KXNB 2RS2A 1F5AA 2DNHA 3N01A 3OR1B 3OLAA 1SBRA 2WSFC 3CMQA 1RT6B 4JI3F 4LR8A 2Z2YB 1NSPA 2CNKB 2X3GA 1C4AA 2JEIA 1Q8KA 5E33A 2JDJA 3HHNB 2G9OA 3JS9A 3KHGA 1F60B 3MXHP 3H4DA 1D8YA 2HFNA 2V5HG 5D0GA 2E7WA 4C8MA 2EKNA 5RUBA 1NH8A 4IDKA 3A8KA 4BWMA 1Q4RA 3V6KA 5IQQA 1X4DA 1NU4A 1EAYC 1X5OA 1R6YA 4ECYA 2FUG9 1PYSB 2VPXB 2J9DA 3FSXA 3GFZA 2MZTA 5CA5A 2VBWA 2VQEF 3HVTA 1HW8A 1J27A 1IKXA 1F3FA 3DYAB 1ZYQA 4LQ9A 2N4CA 1XWLA 4CO3A 1KN6A 2RSQA 4QOTA 3ILLA 2A2CA 5IWAF 1B0TA 4UQGA 2CJ9A 5M2UA 2MQPA 2FGCA 3FBBA 1RKIA 2R4FA 5I3UB 1RT7A 1JJHA 3CIZA 1ZTTA 4B9TA 1XN9A 2M3DA 3CDWA 5A0YA 2IBKA 1GX6A 3CSKA 1YRXA 2VPYB 2FLOA 2WBRA 1IM6A 2MY8A 3TO8A 3NWGA 1FJGJ 4MK8A 1IWAA 3PRVA 1T7PA 1S5ZA 2FZGB 4QR2A 3OTCA 1XBWA 4FS2A 2UXCF 4X4QA 2DRAA 1U47A 4J9MA 4OYXA 3KFWX 2L41A 4PQUB 4MAKA 1Q16B 3BYPA 1PILA 2QEXS 2IM2A 4EBDA 4RW4B 3LA0A 4Y34A 3UD5A 4PXCA 3FQKA 5DO2A 1JLCA 4I4BA 1EKRA 4DHVA 5AE2A 4FF1A 2G4BA 5E2QA 4F7VA 1XR6A 1XC9A 2LYVA 1CEZA 1JQGA 1EQ0A 1YJ7A 5LL6d 4WYWA 2O3DA 1PJ5A 3H59A 2MSTA 1FKPA 3M2UB 1JLBA 4MFBB 2Q1LA 1TVRB 1K1SA 1JLGA 2XHWA 2IMWP 4CO5A 1HQUB 5LSLA 4DLEA 2CQGA 2LA4A 5GAEU 3KJVB 2FPHX 3OL8A 1TKXB 1KLMA 3CCUS 1KQFB 1C1BA 3MPYA 4RJVA 3KK2A 3C2PA 4QWAA 1HBUB 5DJBA 1WOPA 3M9MB 3QGPA 3I82A 1VIOA 3MF5A 1U2CA 4NCGB 5IZHA 4RW8A 2D3O1 2BKPA 2YXLA 3QIDA 3DOLA 4Y2KA 3OFFA 4EBEA 4X65J 3PYEA 4USWA 4F3MA 1KD1T 2LXIA 1VQ4S 2HRYA 2CDQA 1T9VA 5CABA 3V4MA 4HDHA 2F3JA 1I94F 5HMXA 5LT5A 1CJTB 4WXWA 2YQ3A 3PFEA 2LMIA 2LXFA 1BQNA 3LO3A 2YKMA 3DI6B 2HYIB 4OV6A 1D9FA 4ES2A 2HURA 3UI3A 2LU1A 3PHTA 4DV3F 1S7HA 2EC0A 4C48A 4DPXA 4CLUA 2CQCA 2BJ7A 4PXBA 2XMKA 4AE5A 2OLWA 2W2QP 3TX0A 2CQ3A 4A47A 1M5VC 1FFWB 2VB6A 4XPEA 5DLGA 3KWMA 2HQGA 3W60A 2XMWA 2KRBA 3GTYX 5HP1B 2EI5A 3F0NA 4URQU 4NXNF 1VJWA 4F4WA 3G2XA 1NJYA 2LU2A 3KOAA 2DNZA 4FVCA 3TVKA 2YNIB 2CPZA 4LBHA 3KLFA 4F4AA 1Q86T 2RQCA 3OW2R 4RR5A 2H5JB 1IKVA 2MB0B 1LW0A 4C11B 3LUYA 2ZBRA 2BJ8A 3TUZC 1RXOB 3CDUA 4B9SA 2DH9A 1J5EJ 1OY9A 4YQWA 4C3LA 1MN9A 3NAHA 1H2UX 5KFSA 3S6EA 1NB2A 1I5OB 2ROEA 3IRXB 2R42A 4A4JA 1W2IA 1J2VA 2E1MC 4CLPA 4Y28C 5CD4H 3BR9A 2N3LA 3PKYA 3WQPA 4DQRA 3AH6A 3PW4A 1WC1A 2ZUAA 3M32A 1VIXA 2P9CA 2F8MA 1G7CB 4BC9A 4O0NA 4FYYB 3HHLC 4CRJA 3T41A 1TL4A 4Y00A 1KVKA 5FIIA 1YJTA 4KO0B 3DU5A 2CJYB 1OY8A 3W9IA 2VBYA 2GHWA 3Q8UA 2HQIA 3KK3A 3GB0A 3TA2A 1BWEA 2DBBA 2Y0BB 4A8MP 2DHXA 3AX2A 4IH5A 1T95A 4Q8FA 1R8CA 3THPA 4EGLA 3LH2S 4DR2F 5KFKA 3TAMA 1FK9B 4OYPA 4I6YA 1REVA 1T8EA 1M1HA 5L38A 4OMFG 3AXMA 3ZTRA 3DRYA 2VJUA 1TL5A 1FRXA 2RJZA 3RRHA 1V3RA 4D3HA 3T1YF 3H25A 3O5TB 3IR5B 1FRKA 4DXLA 5CH7B 1FDNA 2BW7A 2R2TA 2QLXA 2C2RA 2DYAA 1X4AA 1KNZA 2R8KA 1HI0P 2CPJA 4IFYB 1RHUB 3PEHA 2QA4S 1E6YB 1RU2A 2VFSA 3OXFA 5T7LA 3BBBA 1NLKL 1FO1A 3D7SB 1TK8A 4TLRA 1AYEA 2R7VA 1EX8A 4IG3A 5LMNJ 2HGLA 4C7QA 5ETSA 5F3TA 3R1HA 1TL1B 3M1VA 1WHWA 3TA1A 5AXLA 4Q44A 3F41A 1JLAA 2FVSA 1TZ0A 1VDHA 3C15A 4PWDA 3BQ0A 2J6TA 1WHYA 3C46A 2IJNA 4QQBA 3AD9C 3NNAA 3PW5A 1Y7PA 4YHHJ 2ILYA 2J6SA 1JNRB 2JJ4D 2H4WB 4O44B 1X31C 2KL8A 2I5JA 1DQAA 3C19A 3FSYA 5ETKA 2NZ4A 1Y9OA 4JI5F 1FDDA 4C8NA 4U8VA 3CUNA 2XBPA 1D09B 2OO4A 3BGUA 4DV7F 4Z7CA 3D54A 4LBIA 4AUKA 5LXRA 4IH6A 2DITA 1PBUA 1IBMJ 4IOAQ 1JXLA 4DFMA 3NS7B 3W5XA 4CLSA 1I51B 2GIFA 3C6UA 2HRUA 3CD7A 3HULA 1UFLA 3A4TA 1OWXA 3OPKA 1U1MA 1A9NB 1I6JA 2UU9F 1RWUA 5D0EA 4CLWA 3HM9A 1CBKA 2DGTA 1E6VB 4RO0A 4X4PA 4ZP8A 4TYAA 4WCEQ 4UQTA 3PHEA 2AWZA 3NL0A 1S9EA 1APSA 4WFNQ 3OTDA 3GCWP 3MCMA 1IKYB 5A8WA 5LXYA 1LXJA 2Q66A 2GJFA 3SSSA 2RD5C 5L9XA 4FYVB 3GJTB 1QTMA 4R25A 1W25A 1HA1A 2COLA 4JI7J 2X3DA 5I42B 2P9EA 1NZ8A 3QATA 5F8GA 1KQKA 3I9V9 1T9WA 3BN4A 2NZCA 2ZBPA 2GAHC 3C6TB 3AX3A 4DX6A 2B3TB 1NM2A 3T1HF 2OP5A 4ZVSB 1SKWA 2KKHA 2JZ5A 4PG6A 2DR9A 3IBFB 4PPDA 4ZJLA 1BQMA 4LF2A 2Y1LB 2DCLA 3EGNA 3AJDA 2F4FA 4DL3A 5K14A 2XYGB 5DM7Q 2XC9A 2HNYA 1C1CA 3NXZA 1EB0A 2N7YA 3IFEA 1O6XA 2NQPA 1UZDA 1LXNA 2FB0A 3TVYA 1V3SA 1PBAA 3AWRA 4R0JA 2JWNA 3FQLA 2BVZA 2V2QA 2QMUB 3WBZA 3LTOA 1M5PC 4EWTA 1WC0A 1U24A 4HTJA 3D66A 1RTDB 1S59A 1KOHA 3MOJB 3JTPA 1AT1B 2LQ5A 5HVFA 3M6UA 2MGZB 4RNOA 2ZBQA 4LSNB 4DV5F 1U48A 4K5RA 3R27A 3KNGA 3P4UB 4TYBA 1RISA 3QZ8A 4M94A 2UUAJ 1NDPA 3NP5A 5J1NA 1LWEA 2IFXA 5LMUJ 4KHPJ 4DOZA 3MFHA 4OYOA 4Z7YA 3CJKA 1PYOB 3UD4P 4J9NA 4ZVRB 3C16A 1ZA1B 2FHJD 4NLOA 3QAEA 4HLBA 1S1XB 4LT6A 2AYBA 3OJSA 4AXIA 4OYBA 1C0TB 1GXLA 1UUJA 1HR0F 4LFBJ 1QSLA 3NEKA 5F8HA 3R7BB 1EETA 2BABA 2J0SD 4R8UB 2KM8B 3IMQJ 4MKVA 4ED4A 1ZPVA 4BWJA 2VDIA 4FYDA 5J2NB 3W62A 1S1WB 2ERRA 2NLWA 3W8PA 2MZSA 4H4KC 5EX3A 1WKLA 2KVIA 3ENAA 1NK8A 3HX9A 2XMTA 1N5YA 4I67A 4E8UA 3H90A 2K3IA 4I2QB 3KMQA 1S9FA 4LFCJ 2VPWB 2U2FA 2MYFA 3K5MA 3H5UA 5E3CA 3M8SA 1MROA 4RW7B 3A8IA 4ZHRB 4RBVA 3MR7A 4NEYA 3CC7S 3OR2B 2CWXA 1VMBA 4Q0BB 1RHRB 5MAOA 3KUEA 2AKWB 3B6BA 3MMBA 2HRTA 4OZ2A 4TU8A 3FKBA 1FJ7A 3H5XA 1YZ6A 3QQCD 3MUTP 4F67A 2D7SA 2LKZA 3NGKA 2MKYA 2AYEA 2ZHOA 1SJRA 2CZ9A 4CWBA 4DR6J 5AJ3J 1U25A 4AL6A 2PD1A 2QIFA 1K73T 2ZH3A 1FDAA 3I5AA 4OHYA 1DQ9A 5A8RB 3MM9B 3IR6B 4F4XA 2IAJB 1AZSA 4CQ1A 2OPSA 1GXTA 4YY3J 4DUYJ 4FPIA 5DLFA 3QJPA 3KYLA 3FRYA 1KEKA 2YNHA 2FVRA 1I3OB 1RCXB 2W2NP 3CJ0A 2AT1B 3M6VA 1NPKA 1VQ5S 2B9EA 1JXVA 3UDEA 4ALZA 1REGX 5KFDA 3GYXB 4ZKAA 1QTNB 2J5AA 2J76E 3NG8A 3SCIE 4JI3J 2XMAA 3MMCA 4KGMA 1L3SA 1W7WA 2OPQA 3BKTA 4KKOA 1N6QB 1KC8T 3SCKE 4KV8A 1UJ5A 3M30A 4W4MA 5DDOC 4NLSA 1YBUA 5E0OA 2XCPA 3LW5C 1DAXA 2NSCA 5E3QA 1S12A 4DZDA 2R8IA 3I5BA 4USUA 3E01B 3MECB 4IH7A 1KRPA 2D68A 5DDQC 2YQ0A 3R7SB 1EIYB 2HVIA 3ADAC 2N3OA 1JLQB 3DFEA 1X4BA 4QPTA 3MAQA 2KM8C 3G8QA 4ATNA 2KRRA 2V1SA 2YH0A 2MKJA 4QPXA 3K2YA 4LF5F 5HMWA 4CCHA 2GCFA 3IWNC 2XZWA 3AOCA 2WONA 3DRRB 4NZ7A 5DQHA 4PRFA 3L4BC 2J7UA 3K8WA 4YOEA 2YWGA 9ATCB 3EXYA 4LIWA 4J9KA 3VZIA 4AQYJ 1F5CA 1R0BG 4ZCIA 4B3TF 3KHLA 4DS4A 2XNQA 1Q1KA 1KBRA 4WJBA 4X64J 2HIQA 1HQEB 1QSYA 2ZZMA 2KJWA 4NXMF 2APOA 1VR6A 4X84A 5JUMA 4HH0A 2XMUA 4OZ0A 1RZMA 2HS0A 3QJJA 2AJ2A 1DTTB 3ICLA 4JV5F 1A6LA 1RTIB 2YX7A 2EBGA 2WB1D 3TARA 4Z2XA 5HMZA 5F8IA 3UWTA 3RGIA 2Z2ZA 2QZ8A 4M5DA 2RS8A 3OSNA 1CS4B 2JEFA 3FBFA 4P72A 3M05A 3UCUP 2BA9A 5KFWA 4LRCA 5KFEA 1YJ9S 3KHRA 2FHKA 2DK2A 1FKOB 1EHWA 5L39A 4LJMA 2IJFA 3D6HB 2MEWA 3DLKB 2CQ4A 1EKSA 2R7RA 2YWHA 5KFCA 1WC6A 2D41A 2B5JB 2ZH7A 1H98A 5KFRA 4ZS6A 5B09A 3AD7C 2IY5B 2QLJB 4LF6F 1RTHB 3GV8B 1RAHB 1NPPA 2ACYA 3AB4B 2HFUA 5D4LA 4DEZA 1S6QB 3ZFVA 4M5LA 2GO8A 1PKUA 2CNLB 4M5GA 4CO0A 1RADB 2XS7A 4H4MB 2HPUA 3LP1A 2Q43A 3IXQA 3H2LA 1K47A 3W66A 4DI6A 2DR7A 1AW0A 2VBXA 4ECRA 3MM6B 4ZCLA 3ET6B 1I94J 2VKRA 3FCHA 3B82A 3DOMB 2C22A 2FY1A 2DPJA 2AEMA 5L1JA 1U1OA 2K2PA 1NHUA 4PYDA 5BYQA 3PYFA 1LQ9A 1T05B 4DV3J 1MMDA 1NPRA 2HHTA 1S1VB 1J5OA 1VC6A 2DPIA 2BQUA 3L7PA 3QLHB 1HNXF 4IQMA 4IKAA 5U47A 4K0KF 1KQGB 3I4HX 8RUCA 2VFTA 4CI0B 2AD9A 1SPBP 4IFVA 1N0UA 1TV6A 4S0MA 4DV2J 3NLCA 4K50A 2VIHA 3K7RA 3W8GA 2WHOA 1Y10A 3QO9A 3Q23A 1O0PA 4K4YA 2RU3A 2BQRA 7AT1B 1D9DA 2QLFB 4NXNJ 4MK9A 2DNOA 3KG4A 2EXUA 4YR2A 2FYXA 3ENVA 3MM5B 4J9UE 2UVVA 3G86A 4NLRA 2H1YA 3VF0B 4QBUA 3PM9A 4Q8EA 2I1RA 1RLDA 2VD3A 3ISZA 3G82B 3MCNA 4G1QB 3CVKA 3CTRA 2HQ3A 5D3GA 2C2MB 4WTYA 3PVXA 3BSCA 2QMWA 1MU2B 4NASA 5IT9Y 1F2GA 1HPZB 1YJRA 2B6AB 4DR5J 3LGMA 4C0HA 2ZH8A 1TKTB 1RK8A 1ZH5A 4RWXA 2HWIA 1JWWA 2XO7A 2E5JA 2AEFA 5BYSA 4MKAA 4GRSA 3MHYA 3VV2B 3EPIA 3PX6A 3EZ5A 2BM0A 4GC7A 2RHQB 2BKOA 3I55S 5L1IA 4LF4F 2QMXA 3WC2A 1HW9A 3HO1A 2PI4A 5IT9U 4RZRA 5DS7A 5HANA 1HD0A 2D1CA 2OI2A 2IHR1 3CPWR 3WIUA 1SJ4P 3QT8A 4MYUA 3GE9A 1VC5A 2VG6A 3OLBA 1BQXA 1DLOB 4EO8A 3C14B 4IQXA 1BWVA 4TY8B 4BC7A 5EWFA 4GVLA 5K9FA 4DR2J 2M7SA 4O3RA 3GIRA 2ZJPQ 2J0QD 2DY1A 3IN5A 1T3NA 3FUYA 3MAAB 3MM8A 2M52A 4ICLA 3M8QA 1UWAA 4NI2A 3QIPA 1U2FA 4EZ9A 1Y5IB 3ILOA 1LWCA 4L75A 2RKIA 3AT1B 2I2YA 3A12A 1M5KC 4JV1A 4CLZA 1NO8A 4KH1B 3PV8A 4J90A 4WE1A 1R8PA 3H7HB 2R8GA 1F3VA 2W1BA 2B7CB 2IJRA 4N76A 2M0GB 1R3NA 2L08A 3KG0A 1QLNA 1NJZA 4USIA 2AW0A 1ZZFA 4JOUA 1UVJA 2JLEA 2F9JA 1CPZA 2GJIA 3HKZD 2W2OP 1RT1B 2GS8A 1VLYA 3IA0A 1SL0A 1IBLJ 1SC6A 2V4JB 5HBMB 4XTTA 3KJQB 3LANA 2KZZA 3W61A 1OPZA 1ZAWA 2V8PA 2IDLA 2VDHA 3HFKA 2DD8S 3R2DJ 4DFKA 1NKEA 4R5PA 4WP9A 3D3BJ 3SBMA 4H4OB 1YIJS 1SC3B 1MWQA 4KBIA 4QIFA 2GHVC 2DNPA 1VQ6S 1HHSA 3AOBA 4LSLA 4ZN3A 4KHRA 1B64A 3KLHA 1ULRA 1KP6A 2GMLA 3D0GE 1RI7A 3VHQA 1MMLA 3L7UA 4URSA 1D8ZA 3MFIA 4DV7J 2MSSA 4X66F 1LKZA 4K4UA 2LEPA 1WD6A 3OXGA 1JKHB 1R0AB 3M4XA 2GQ2A 2BMBA 3DRPA 2VL1A 3SQGA 1QE1B 1D1UA 3NNCA 3CDEA 1KS2A 3TUPA 4I2PA 1U49A 5GMEA 3N5BA 4Y2IA 3G6ES 2QA4G 4O3NA 4PUOB 2OPRB 3W65A 3DM2B 2OTJS 3AA9A 1FJGF 8ATCB 2VG7A 5JJBA 5KT4A 1WDDA 1U7LA 2E44A 5J1PA 2OSRA 1TTHB 4FKYA 2KHCA 3IBWA 3K5OA 1S9GA 5IM0B 5HLFA 3BBFA 3BJYA 3K59A 1RT4A 2HNZB 3K5PA 4OI2A 3UNYA 3EZUA 2B4PA 3D1OA 2FIUA 2OEJA 3QT7A 2M5YA 3AXKA 2RUGA 1WEZA 1GNKA 4QWEA 1NK5A 1Z1ZA 2FZKB 4F02A 2DO0A 2JRSA 4DCJB 1U1LA 1VOMA 2M4MA 3NCPA 1BUXA 1LNQA 4ECVA 4ID5A 1WEYA 1SUQA 5KT2A 2F9DA 1VRTA 1RTJB 3DMJB 1CVJA 1G2EA 2LFVA 1S0VA 1U8WA 4Y2CA 2E1RA 4M8LA 1SKUB 1VFJA 4X4RA 1HNWJ 1JLFB 3T1HJ 2HBYB 2ZZTA 2JOQA 1WF0A 1Q5VA 3LWMA 2BEFA 2DB1A 1WEXA 1YJUA 1ZM9A 4OJHA 4DSFA 1RA6A 2AX0A 5EN1A 3ZTOA 4OX9J 2DNGA 3D6FB 3OUYB 2J8SA 4Y6IA 1F9FA 3D2WA 4GC6A 1LWFA 3T6JA 5KFGA 3MAHA 2FC9A 1PSDA 2UUCJ 2WZ1A 4X62F 3DGPB 1GMWD 3NWRA 5KFAA 2N82B 2FJDB 2HMIA 2B8PA 4HT5A 3UD3P 4KB7A 5J2MB 2F1FA 1T3OA 4DSKA 2PEBA 4IRDA 3MI7X 1Y0HA 4I7FB 3J7YI 3R2CJ 1WG1A 3CWJA 1XJWB 4E98A 5KG6A 1YI2S 1YSJA 1YGYA 1T9UA 2CIMA 2VOPA 3FEYB 3ENQA 4K4XA 4DV5J 2BUNA 4C98A 4J5OA 4K4ZA 2KJVA 3EGVA 3GJRB 3FEZA 1PIEA 4ZVFA 2W24A 2HG4A 4ZVPB 5IFMA 4LF9J 1M0SA 3FEXB 3UDCA 4PABA 2J9EA 4IDKB 1WSRA 1NRKA 4B9LA 5T14A 1B3TA 3D3CJ 1SJFA 4XIUA 2C2DA 5JMNA 4OX7A 4QIEA 2VBZA 2W2PP 2D3ZA 3HVTB 3U27A 4QCLA 2E66A 1IKXB 1F0XA 4MJKA 2DGUA 1UEVA 2D3UA 3GV7B 4NZ0A 2QL5B 2GQQA 3GIIA 4JI8F 3CDBA 1JMTA 2V0NA 3QSIA 2KG0A 1KHVA 2R2RA 4DL4A 4L72B 1MG7A 4CT9A 1GMVA 1RT7B 2CVEA 4KIAA 4RW4A 2XZ2A 2W9BA 5A0YB 4WWSA 3FMWA 5C25A 1RA7A 2PMZD 5B0GA 1A0OB 1N36F 1VQ7S 1IBCB 4TQSA 3BKFA 1QD1A 4Q7AA 3HHLA 2CPIA 5D4NA 4ZDNA 2XSFA 1WUUA 3SDEA 2AHOB 3FC9A 1X5SA 2GQCA 2W01A 3BM7A 1FXLA 5ETVA 4Y2AA 4EU0A 2EBEA 2LECA 4P7TA 1HWJA 4XO0A 4UZBA 1N34J 2DISA 4OHWA 3JB9k 2QN6B 1NNDA 2E5LF 3ITHA 1JLCB 2BXJA 3CD6S 2HIYA 3MUVP 4DJBA 3CIMA 3WX4A 1V5IB 2QGFB 1NK4A 4DL0C 2CQ2A 2W8KA 4ZPTR 4ZP9A 1RB0A 3RB0A 3R97A 2DJWA 2VG5B 3KJFB 3PYGA 1H7WA 1BC6A 1KVIA 4JI6F 1XEZA 1JLBB 2RU9A 5KFBA 3BN7A 1JLGB 1UWBA 5ETMA 5H9FJ 1WC4A 1KLMB 1CJTA 1RWWB 1C1BB 3VVUA 2MKKA 2MY7A 3KK2B 1FX4A 3E3XA 2WSEC 5B0EA 4GO5X 1GT8A 2WB4A 3CJRA 4CP5A 1IR0A 4RW8B 4BBYA 5KG3A 1TKDA 1D3WA 3JQMA 2BDPA 1RHJB 1VQ9S 2XO6A 4G6VB 1HNZJ 2G0IA 5L9NA 1VQLS 3MTKA 3OL9A 5LMNF 4DG1A 1U6ZA 2DIVA 3NMAA 3PIPQ 4O4GA 2XS5A 4P73A 4I64A 4UTGA 2NXUA 3Q8VA 2C3YA 5HP1A 4JI1J 1UETA 4U7UD 2FVCA 2EFQA 3GCXP 1TK0A 2V63A 2V4QA 2E1PA 2P2CB 1UAWA 1S0MA 5J2PA 2C28A 4ED0A 3J7YU 4C11A 2ZD1A 3D1HA 3KG1A 4ITSA 1N88A 4WKYA 2YBVA 1HBNA 2HGNA 2Q79A 1FTRA 2KT2A 2AEJA 5D77A 3RRGA 1IBMF 1X8DA 3AA8A 4FBUA 1S0NA 2DNKA 2OH2A 5KFHA 4WU3A 4ILLA 1RUSA 3KLFB 3OHAA 5J2QB 2B51A 2OAUA 1AUSL 2ZBIA 3V5RA 1YRUA 1RWNB 1RTZA 2ASYA 2ALYB 2LXUA 4C9DA 4M5NA 1TUWA 1OY6A 2GW8A 2LCWA 1P1LA 2CNOB 1QAXA 2GVZA 1LWXA 2U1AA 3NOGA 4HHJA 4UF4A 3MEGB 2OTLS 2G0CA 3JAMY 7FDRA 3A13A 4B3SF 3GFYA 3BGRA 4NZ6A 3CJ2A 2Y8YA 1HL6A 4DPWA 4NWBA 3J80U 5HO4A 1RBOB 2DR8A 4RBUA 3PW0A 3MTJA 4F3QA 1WTFA 2XGQA 1F9HA 2GVDA 3M32B 4OHZA 2PDAA 4JI7F 4IG0A 3GJSB 5L1LA 5IT0A 2HEKA 1S1UA 4ELVA 5KFMA 2LP4A 3MM7A 1FVQA 4HH1A 4DCOB 3TZXA 1TAUA 2ZVSA 1RSCA 5BYRA 1TU0B 3CJTA 4WKRA 4JI2F 3N9UC 3KK3B 1GAOA 4QZVB 4B3OA 2B8QA 4EZ6A 4DU8A 4DBQA 5F9LA 5IS2A 3Q8PB 1EP4A 2B9WA 1VI7A 4Y3CA 3TAMB 1E6YA 5CZVA 4KT0C 2JEJA 4LF6J 1CQNA 1ZOTA 1REVB 2BE2B 1SJ3P 4HDGA 3VAMA 2OFGX 3BSNA 3NS6A 3TZWA 2EC2A 3UFCX 3H20A 5J1EA 1O5JA 1R0CB 4N8OA 4CLYA 3MOZA 4TLQA 2DT9A 4ZVTB 1QAIA 3PJXA 4IRKA 1R31A 2ZITA 2IVYA 2M70A 3EWGA 1MWYA 3KNAA 5K20B 4DMZA 4DQPA 4JYAF 2RE1A 4DUZF 5IT4A 1XR5A 1FCAA 2V1TA 2LEAA 2L9NA 4YP3A 5T7LB 2YKAA 1VQ8S 3HHEA 3J7Z5 2ZH2A 2ZJRQ 3MPVA 2E1CA 2FZCB 1B0VA 4TN2A 4HHUA 5D0HA 2W4PA 4IG3B 5LMUF 4KHPF 3JYTA 2XLIA 3WZ0A 1B7YB 1WC5A 3SIPB 3N6LA 1H2TZ 3MEKA 4QWCA 2OD6A 3PXGa 3WHIA 5LJ5Y 1JLAB 5LJ3Y 3C15B 2V2KA 2PIIA 4FXWA 4K4SA 2JC0A 2ZOMA 4EUVA 3HJVA 4PWDB 4OZLA 4PAAA 4P2SA 4USJC 1H72C 3HI9A 2XGPA 2DNQA 4LFBF 3VGVA 2ZE2A 4TXSA 2YPYA 2BM1A 2DRDA 2I5JB 4B17A 1RDRA 3R6GB 1T0TV 1SV5A 2QSWA 3L9ZA 1CJUA 3VALA 2QSFA 4B9NA 4CYUA 4RNFA 2OGUA 5EUHA 4DU7A 1C4CA 1G3OA 2CPDA 1RAEB 3VVTA 4AXJA 4DR3F 5E3AA 4JI4J 5KFZA 3MEEA 1UVMA 4DR1F 2AJ4A 5HVGA 4PQAA 2BJ9A 5B0FA 4LFCF 3EVOA 2DXEA 3C6UB 2HHHJ 3MR2A 1VYAA 1RYSA 2R8JA 2QL7B 2LQJA 1PC4A 3RZAA 3T9NA 4LIRA 4LRAA 5ETPA 3VAHA 3B54A 2HHPA 3POTA 1UMJA 4KFBA 3FCWA 3A8EA 2CXEA 5AXNA 1TUGB 1YLXA 3HF5A 5ETTA 4Q2LA 1S9EB 1N8RT 4M63A 2XLKA 2HHXA 5A8WB 1X4GA 1WDTA 1YJVA 4LF4J 1IJFB 3UR3C 1UZHA 4K4WA 2LQ9A 3KDNA 3E51A 1IXKA 4PG7A 2PC6A 3DXBA 4GO7X 4HI1A 4LREA 4OJ1A 2QV6A 4N7TA 4OI6A 4DV4J 4NLYA 4DR6F 2HBZB 5AJ3F 2HVEA 4ED3A 1SL1A 3Q0AA 3CCJS 1YBTA 3SV4A 2PI5A 3HLUA 3WIVA 2B9YA 3SI8A 1HWLA 2K8GA 2IYGA 2Z2LA 2DNLA 3DRXA 2NUUG 4YY3F 3ZTQA 1Q8BA 4P2MA 2W9AA 5B0DA 3EE3A 3VCDA 1RU1A 2UVRA 2BR0A 1BQMB 1G4CA 1LFPA 2KFZA 1RTDA 2W2MP 2FY8A 2AZ3A 4G3IA 3QT6A 3OBIA 1Y00A 4F26A 5D78A 4CO1A 2CPFA 2KTQA 3DNCA 3M6XA 3JTNA 2I6WA 2HNYB 3IM8A 1C1CB 2XB2D 3H42A 4FN5A 2YX4A 3JSMA 1Q81T 2CAJA 5KT6A 2QA2A 3DDNA 3MZIA 5HROA 3F44A 2EK1A 2GNKA 3KXDA 3M8PA 5THWA 1JXEA 5AE3A 5DGAA 2NPIA 3NCQA 1LOUA 3BV8A 3N28A 1S1XA 2ATLA 2GMHA 2W25A 4OFZA 3C8YA 8AT1B 1C0TA 3DLEA 2CKWA 3G71S 2B0GA 3I0SA 2NSBA 1VQMS 3BZQA 6AT1B 2YWFA 2BKNA 2MQNA 2Y3YA 3BYRA 3N6MA 4M5MA 1LWEB 4CLLA 3IR7B 1SQEA 4P74A 3VGTA 1FJCA 1BLUA 3HMJG 2OJ3A 3QWUA 2RDJA 1IVZA 4RUHA 3CJKB 4PPZA 5GADI 4NLPA 3C16B 4ZPWR 5H9EJ 4ED8A 3JXOA 1QAYA 1FNOA 1H73A 5HAOA 2G1DA 2CPYA 3QGHA 3UN3A 2XLJA 4X66J 1X7VA 4P6QA 3G96A 2ZM6J 2ZH1A 2PT0A 4AQYF 4UUWA 1EETB 5H1SV 5AT1B 4ZHRA 4X64F 1PC5A 1RAIB 5HMYA 3KHHA 1S48A 3GZ7A 2KO1A 4ED1A 3A3NB 3LGHA 4WZQA 4LF1A 3Q8RB 5KOXA 3QFHA 1N5YB 3KLIB 2CQPA 5KFLA 2H48B 1FXRA 4LR9A 2OD4A 1S6PA 3JQKA 1FRJA 1UEKA 3N5FA 3H0PA 4O23A 1KTQA 2K1RA 3SCJE 3MR5A 2RQ4A 3SSQA 1MROB 3CCMS 2HS3A 3Q22A 1K8AT 2QJ3A 3I0RA 4RW6A 2QL9B 3OL7A 2QE5A 2IYIA 1CC8A 1AB8A 2ZBCA 1WNEA 1CJKA 1P1TA 2XULA 3TA0A 5CAAA 4O3QA 1U45A 3K0JA 4ERDA 2IRXA 3MMBB 4Y0FA 4WK1A 4PWUA 3CXCR 1IBKF 2RT3A 5M2PA 1T94A 5KFOA 2IVMA 2PO4A 2MZ1A 2HGMA 3D67A 2PEHA 4RLEA 4OQJA 2AP6A 3JSBA 4LSZB 2P6TA 3IWXA 4NX9A 3DC2A 4DCPB 1UKUA 1ZM4A 3RAMA 2B4UA 3KDOA 1EZZB 4NMLA 1X9WA 1AFIA 4RUBA 3UPFA 5HL7Q 2RHSB 3PDNA 4WP3A 5A8KA 1AZSB 2OPSB 1UEUA 3R5CA 3UCZP 4X62J 2HFOA 2NPFA 2ZKUA 2YNHB 1N48A 3UVJA 2PA3A 2GJ2A 3V4IA 1UPPA 2YX1A 2CA9A 2BZ2A 4DWIA 2RMLA 2V94A 2JVOA 4JV2A 4ZPBA 4ID8A 3W1YC 2OFHX 3T6BA 4YB1P 3IO1A 4C6AA 3MR3A 4C3KA 3QFWA 2KYXA 4ZK7M 1WACA 3MECA 4A8SA 1S1TA 3MMCB 1S97A 2M8HA 1FJEB 3CD0A 3MCOA 2OPQB 1XMOF 2F63A 1FRLA 1U0HA 1KHWA 4RU2A 2J9DE 2HLUA 2EEYA 4KKOB 4UOHA 4IR1A 1GXUA 1V3ZA 2AGQA 2XM3A 4ZVHA 1X4HA 3DRRA 1TL7A 3HJFA 4DV2F 5IQ6A 3QRRA 4HACA 4NCBA 4KRWA 2G1HA 3I6PA 2DTJA 4NA2A 2VF3A 1FERA 1IM4A 4KE5A 1S4EA 2VU5A 1HMVB 3PR5B 3HFZB 1Q5YA 3RAQA 3R3TA 4ZVGA 4OJGA 2XTJP 1URNA 2XCAA 1I1GA 2V67A 3OXLA 3TANA 4JI8J 3IG1A 2FD2A 4CLTA 4DF8A 1QVFR 3J7A1 2MJUA 2W9CA 3M8YA 1VCTA 2IA6A 2MQLA 3O2IA 5GADU 4DR5F 4L3NA 3RR7A 2QFIA 4WP8A 2RAQA 1N36J 2AYMA 4QYZJ 1GX5A 2IDEA 4MKBA 3EICA 2NYHA 3H8YA 1FKOA 4CDIA 2K7JA 2FLLA 1DY3A 4LF7F 4OZJA 1QAJA 5KOWA 4M5DB 4N47A 2H4YB 1GTHA 1NZAA 2E5LJ 4ILMA 2L9DA 4B9MA 1MLAA 1RTHA 1L3TA 4OI3A 3W5YA 1N56A 4P9SA 1L5UA 2X1FA 3M9NB 2QO3A 1NH7A 2DH8A 1NKBA 2FHMA 1FD8A 3RG6A 3FBCA 1TELA 3OSPA 3HCXA 4JI6J 1VHFA 1PG5B 2BJDA 4V19J 2M9KA 3Q2SC 3ET6A 3PFOA 3DHWC 2UXBF 2H65B 4Q45A 2W7AA 2HNDA 2BE7D 4WK3A 6FD1A 5DRKA 2I8EA 3TZYA 2FC8A 1S1VA 2XEXA 1VC0A 1JJ4A 2X7IA 4LBPA 3QLHA 2FLPA 3R9LA 1TR0A 5LSRA 3QNWB 3PACA 1IBLF 1HYSB 3AD8C 3G87A 3C3LA 4IO1A 2H54B 3RRKA 3LQVA 4PEOA 4K4VA 1P9QC 3PJ9A 4ZITA 3VAFA 3RB3A 3DLGB 2JHEA 3W2WB 2B43A 2CJBA 2LLZA 1AA1B 3EGWB 2OHDA 1BHNA 4IUFA 3RB6A 2LQBA 2YNFB 2HK3A 1VQOS 1JJ2R 3LPEA 4JI0J 3LPYA 2FJEB 5DG8A 4FVMA 2IRUA 1CULB 4C8LA 1R8BA 1G6BA 4TY9A 1PO6A 4JBCA 2QA1A 1FA0A 3QO9B 4ZVQB 4UW2A 1F9EB 2XWXA 4OI0A 1TKZA 5BJRA 1N5VA 1VISA 1IKWB 2B6AA 4CLFA 1K1QA 1BY9A 5CXTA 3BQ2A 1KVJA 1B99A 3GR1A 2DEIA 2HVDA 4DPTA 1WKJA 3ZZOA 5C24A 2OMOA 2WVFA 3NS5A 3HSGA 2RDIA 3TJ9A 4GKJJ 5GAGI 2GO9A 3OQ2A 3RTVA 2YH1A 3OFGA 5D3GB 4D3GA 1NSKL 1S4FA 1ZS6A 1CQMA 3EGZA 4PG4A 1VRUA 2UXDF 2V68A 4B3SJ 3QSYB 4PG8A 4A8KA 1YITS 1RWOB 4TKTA 2R7TA 3UCGA 1SH2A 4ECSA 2ABYA 5KFYA 4WTOB 3FK4A 2WVCA 5I4MA 1SC4B 4W92B 4LRFA 3UE2A 1WF1A 2JFDA 1C0UA 1U6FA 4X4UA 3T5LA 3IRWP 2AQ4A 3X1LB 1HNWF 3PEJA 4DUTA 2HZCA 3S1TA 1T03B 1SB6A 3P96A 4RKUC 3IM9A 2J6UA 4JI2J 2VG6B 1Y3JA 5B08A 2M8DB 1IJEB 4ES3A 4OX9F 2GV1A 2ZC4A 2BOAA 2VOOA 3CULA 2IM0A 3QT5A 2UUWA 2LEBA 1VBKA 2NUHA 2UUCF 2WOMA 4TVAB 1FE0A 5DZ7A 2CQDA 2OPPA 2KI2A 2O1PA 3ELHA 5KAKA 3MM8B 4OZ3A 4ICLB 3W2VB 3M8QB 4NI2B 2XZTB 1RKJA 1TQLA 4ZPDA 5D6GA 3M8ZA 1LWCB 1KFDA 1HNIA 1RACB 1LK7A 1M5HA 5HBMA 2W8LA 5G0RA 3CDAA 2AJ1A 4G65A 4FKXA 1C2PA 2DHAA 2RRBA 5KFTA 3UW1A 2YNGA 1FDBA 2HK2A 4ANEA 4JYAJ 4DFJA 3E2EA 1LW2A 4DUZJ 2ILZA 3ZZUA 1IN0A 4WE1B 2RF2A 1HBMA 3VQTA 3LAKA 2Z30B 1DURA 3QRQA 2QRRA 4L74A 2KT5A 3LOUA 1NUEA 1YJWS 3WX8A 4WF9Q 2ZH9A 2XY5A 4N8NA 5HJXA 2QFJA 4LF9F 1VK8A 5F8MA 4WPAA 2ALZA 2WK4A 5HI7A 1QDUB 4G1PA 2HW3A 2KXFA 3J7ZT 3S01A 2E5GA 2YWEA 3GYGA 1Q8LA 3R6LB 1GMUA 4UY85 4J9RA 3UN5A 5ITHA 4R5PB 1A7GE 3CB4A 3HVRA 2CNNB 1VBZA 2OPRA 3JQJA 4NRTA 4CH7A 2KN4A 3A3PB 3TEHB 1OQ6A 4M5HA 3PRBA 3OT9A 5EWGA 1QJHA 3ILJA 5E41A 1T9XA 3BGOP 2CZ4A 1XERA 1FTCA 4ECUA 1EQMA 1JNZB 2HBRB 2ZNZA 4LFAJ 2HAFA 4DR3J 3DRPB 3SQGB 5C5JA 4DR1J 3RAXA 1KWMA 1O8BA 3P8BB 3V6DA 1Q79A 4I2PB 2J0WA 2HBQB 4QW9A 4AYBD 2VPZB 4DPUA 2GMJA 5G4DA 2G2ZA 3IAS9 2XNRA 2VG7B 3SEOA 3SYZA 2BACA 4ZVUB 4BS2A 4DSJA 1S9GB 4I6WA 4HYKA 1RT4B 3W3SA 4E2FB 3GMGA 4MK7A 2X1BA 3OTOJ 4ECTA 1WHXA 2POKA 4YS2A 4H54A 2D74B 5GAGU 1N34F 3W5ZA 4O0IA 2R7UA 4WBFA 4ID5B 3CJ8A 1SUQB 2MXYA 4QU6A 2OEMA 4XK8C 3ILIA 5FDLA 4BCAA 3NMRA 4FNHA 1XNRJ 4C8OA 2FJBB 1HI1A 1RGVA 4DN9A 2HAIA 3VWSA 1HFEL 2GX8A 3AQOA 5F9NA 3TUIC 4YB7A 3W9HA 4AFFA 2E5IA 4DPOA 4KC5A 4I7FA 5LSOA 4KPYA 3EPGA 4G1IA 4OYMA 4ED7A 2GC8A 3OVAA 3DOKA 4NYPA 5CCLA 3M2VB 1RWMB 1LWFB 3NBPA 3EM1A 2I9SA 1TK5A 3M8RA 2KU7A 1VQYA 2F4VJ 1KDNA 4EI2A 1HNZF 6FDRA 1O51A 2OKQA 4FYWB 3MWBA 2HMIB 3KMSA 2DR6A 2Q3PA 3FZ2A 3B78A 1RT5B 4ZCMA 3K8VA 2CFXA 2X1AA 2Y8WA 4B3RJ 4FYXB 5F0UA 1TL3B 2ZHBA 1NHKL 2J8AA 4C4WA 2XYHB 4NLGA 1FEEA 4JI1F 3NGRA 1QVGR 4AL5A 5DQIA 1RYRA 4MT1A 1BXNA 5LM7E 2MZQA 3PIOQ 2HQDA 4KYZA 1BD6A 2DO4A 1UVIA 2HSEB 2YKNA 5C42B 1G1XA 1UP1A 3OV7A 3EZOA 2A1BA 1YQHA 3GV5B 3CCZA 3L7OA 4A8XA 4MYTA 3HKWA 1DARA 3HZEA 3TEGA 2O5DA 3M2RA 3I9ZA 3HPOA 1XMQF 2NREA 2B7BB 3AOAA 2MQOA 2GZOA 3GQCA 1VQSA 2CG4A 4YMEA 2JFKA 3CNQP 3UQSA 3HSDA 4UOGA 2LDYA 1N33J 1IQZA 3OTEA 4L73A 3PO5A 4DQIA 1H38A 2VFUA 2ZDPA 3I32A 1KLNA 5A6WA 3FFIB 4ZVOB 4CT8A 1K0VA 2BANA 5FD1A 4RUCA 3ONQA 1R8HA 2GGPA 1UA0A 2C2KB 3QAUA 4RW9B 3ZTSA 5A76A 2W9BB 4ECXA 2UUTA 2DGQA 5C25B 1DZ5A 1FXDA 3AHPA 3DRSA 1PJ7A 4OL8A 5F0WA 2AMCB 3SV3A 1Y5NB 4LQ3A 2RILA 3LP2B 4F0HA 1L3KA 3IS9A 2IC3A 2B56A 1L3VA 1Q8IA 1SKSA 3HHLB 3BDEA 2VG5A 3SDEB 2XMVA 1ACMB 1NMEB 1IBKJ 2DVIA 4ZCKA 3T3FA 4QIGA 2V8GA 3NRBA 4MH8A 3TX8A 3ITHB 5HQ8A 1HD1A 3PW7A 1F5BA 4FXDA 1HHQA 5ETQA 3RW6A 1PAUB 5DDPC 3DCAA 4P75A 3LP0A 2CPEA 3J7AN 4QIVA 1HBOA 1DTQB 2DGWA 4TU9A 1GTEA 3FRZA 1S99A 1CG2A 2C3OA 3NGSA 4CM0A 1UWBB 4BDPA 3TAQA 1ZM3A 3KTQA 1WI8A 1NJXA 1ROFA 4NLVA 3AY0A 1OM2A 3CJ3A 3Q8YA 3VAJA 4ED6A 3F73A 2F7VA 4ZJOA 2ZKTA 3K5NA 3G9CA 4ENOA 1RT2B 3CEDA 1FWPA 2XSJA 4TU7A 3JTOA 2RIJA 1U09A 5CYMB 5D0RA 4CH0S 2YTCA 4YB6A 1VJQA 4YR3A 1H3DA 3FJ2A 2F65A 2JNJA 1FRMA 5KT3A 1FRIA 1XMOJ 4DG1B 4P2FA 2L48A 3DKDA 4O4GB 2D3OR 1RE1B 4MTPA 1DQ8A 4P7VA 3FGVA 4ZJQA 5F3ZA 2LVWA 2AYGA 3HHLD 2MKIA 4M1KA 2DGVA 1R27B 1HKAA 3AJ2A 3GG1A 4KGZB 1V6HA 2W7PA 4URGA 4FPRA 3FVYA 2L9WA 3DLJA 5J2QA 2VQFJ 2HHUA 4FF4A 2AJFE 4AD6A 4DSEA 2G13A 4ES1A 4NLDA 1YWXA 4PR6A 3IC1A 5J2PB 3H4BA 4TNOA 1FRHA 4UOFA 3CC2S 2ATCB 2ZD1B 1NEEA 1PYTA 2GAGC 3GFHA 4R0EA 5GMDA 1SH0A 2EG1A 3O8WA 1BE4A 1HBNB 3EX7B 1NXIA 4LRBA 2E9ZA 5T41A 3MEGA 3KLEA 3SZ2A 4RNHA 4NLQA 4UT4A 3W7BA 4JI4F 3ZZTA 3BKUA 1HHTP 1P8GA 2IPOB 3CMAS 4MIWA 1AROP 3CCSS 3KLGA 4GMKA 3U1NA 2EW9A 2WCXA 2K06A 4CLKA 2HHHF 4FS1A 1VQPS 3KLVA 4WFXA 3D68A 3LALA 4YDDB 4NA1A 5D4PA 3BF4A 1X9MA 3RJMB 2Z8QA 2GVZB 2O66A 2PMWA 3KK1A 4ZLNA 3HD1A 3LGNA 1HNVA 4P71A 1KR4A 1H74A 2FHOB 2ZWPA 5IOLA 3JSYA 3BGRB 5KFQA 4U7CA 4L3KA 4OLOA 3ZZYA 2VH7A 5E3RA 2V4RA 2MQ8A 3GJQB 1RJJA 3GONA 2I0XA 4LF7J 2BW2A 4OI1A 4LRDA 4DX8H 1IWGA 4DV4F 3FMBA 3PRDA 4F0KA 2GVDB 3CCWA 2QG9B 3HSJA 4IG0B 4JP8A 2YKPA 2KT3A 3RYLA 3PY8A 3EVMA 1OJ4A 1S1UB 3BH7B 3P45B 3HT3A 2BE2A 4KPCA 3MM7B 3NGTA 1OPIA 3R5JB 3W63A 1TMMA 2ZHAA 3MD1A 3GPAA 2DRBA 4HT7A 1RBLA 1H0HB 3OHBA 5DDRC 2Y1JA 4V1Ak 2ASLA 4NRUA 1SI9A 1WSVA 4P52A 4CNYA 1AFJA 4E0DA 2YWKA 4QR1A 4B3OB 1S7IA 4ILRA 2EFGA 1EP4B 1HARA 1SKRA 5CCMA 1H7XA 2UXBJ 3MMAA 3HZGA 2ZC3A 1FD2A 1NAQA 2UP1A 1XTZA 4ZPCA 1NDKA 3MMJA 5LOQA 4ZPAA 4KR0B 4RNMA 2GHPA 1H6KX 4EMDA 2CRLA 4EYHB 1U0SA 2JC1A 3V81A 1RHQB 5J1EB 4ED5A 3G6XA 2GA7A 3EJMA 1RBAA 1SJ1A 2H3EB 1IQTA 4GVBA 5F41A 4CH1A 3BPSP 2FTRA 1X0PA 1HIYA 5JXSA 3V6HA 3EXCX 1F2HA 2PFFB 1JIHA 2AIRB 4DLGA 1Q7YT 3D1QA 3DLHA 3QMQA 1UJ6A 3JYTB 3TR5A 2BJ3A 2R7WA 4OYIA 1ZTWA 3TP2A 3TNVA 2E5HA 3O44A 1ZA2B 4CNZA 2XYPB 2KB2A 4ECQA 3ZNJ1 2X51A 5K8MA 3DDKA 4O3SA 2KYZA 4HTIA 4QJVA 2KFNA 2MHNA 4NL5A 4KY3A 2F8EX 1RT3A 4OX6A 2ZE2B 3AX5A 2ZM6F 2R8HA 1NSQA 1SV5B 1WKKA 2IMOA 3P6YC 2LDIA 2ZEJA 2DXDA 1CJUB 5FLXY 2NYIA 1XIQA 2FVQA 2FJVA 4DV1F 4CYUB 1VBXA 2Y1IA 3BGLA 3N6NA 2HS4A 3CO9A 3D0IE 3UDVA 1X4FA 1MWZA 2BX6A 2L3MA 4F04B 3SFUA 3MEEB 2C2EA 4DV6F 4O4RA 4IRCA 1JLEA 4Q5VA 3A1YG 3O6QA 1VGYA 4XDCA 2FJXA 3P3DA 3CD5A 1CC7A 2UXDJ 5HATA 1T9TA 1JX4A 4EO6A 1RABB 3QWPA 1WC3A 5B0AA 3CJSA 5FLXU 3ZZRA 3B8HA 3PJWA 3Q8QB 4JB8B 4KQZA 1KKHA 1PCAA 2V8VA 2NS1B 3POTB 5DZ6A 4DL7A 4KFBB 4P2XA 3TUJC 3PW2A 3VGUA 3MD3A 4DR7J 3MEDA 1XNQJ 2M2BA 4ZIVA 4CTAB 3L09A 3ZZZA 4XPCA 4B02A 3QZ7A 3TI0A 2JLFA 3ZTPA 2EKYA 3CMES 4WYLA 1M1KT 3H2UB 2CJQA 3PX0A 5CYQB 4I68A 2NXCA 3H5SA 2KFYA 1R6VA 5KFXA 2CJAA 1EARA 2HZVA 3OR1A 1RT6A 4F8RA 3K5LA 2WSCC 2WW8A 5IC4B 3VR1A 4XAKA 5H9FK 2CQIA 2Y9HA 1TFYA 3MR6A 3IWLA 3EDQB 3HD2A 4N5SA 1RAJA 4RNNA 4OI4A 2DHSA 2E9RX 2XY6A 1CJVB 1SL2A 2IVFB 3SXLA 3CJQA 2QX0A 2JH3A 5B0CA 1BGXT 3S7RA 3IGNA 1XMBA 3JSMB 3N79A 5C7PA 4USKA 3CCQS 2HFSA 4X4SA 3THVA 1TFWA 5HROB 3UR0A 2ZOGA 1N0VC 4IOCQ 1SH3A 3DYAA 3M8PB 3QYYA 4WIIA 4QWBA 3CCRS 2DGSA 2DEJA 1M90T 4CO2A 2PA8D 5D8HB 3L95X 1X5TA 4FNIA 1IR2A 2D69A 2B4VA 3DLEB 3I0SB 1XK8A 1NK7A 2WBMA 5I3UA 1N4LA 3Q86A 2HQCA 2AGPA 1T02A 4ED2A 1VLOA 2RQMA 1ZBTA 4NYOA 3BBCA 4ZPVR 1U1PA 1N32J 3DLLQ 1FESA 3S8SA 5K5MA 2EPIA 4WIQA 2VC0A 2R2SA 2BV3A 1X5PA 2F40A 3I56S 3T5JA 1B7FA 1PJ6A 4K7QA 3DHXA 3LAMA 4UY8T 3KLIA 3CW2C 2XMJA 2A6MA 2C2NA 4O3OA 1F6TA 1RLCL 4LR7A 1WOSA 1RAFB 2IIHA 4USVA 2YKOA 4EEYA 2DKOB 5HK4A 3UDLA 2WW4A 4UOCA 3R7NB 2EFPA 4K4TA 2HFZA 2ZDOA 4PQUA 3M7VA 2Z57B 1NJIT 3GFXA 2WVEA 3F56A 3FZBA 1T11A 2N4DA 3CCTA 1AUDA 1WG5A 1FFSB 1UW9A 3BQ1A 2PE8A 1SIWB 2BOPA 1FNMA 4KH0B 3WC0A 2BQ3A 5KFNA 1S6PB 2AV5A 1SQGA 5DG9A 4TQRA 1Y3KA 3KKFA 1M1GA 3KJNB 4J37A 4OZ5A 2OUGA 3M2UA 1KONA 1MW7A 4MFBA 4F50A 1TVRA 2XHCA 5ADZA 1HQUA 2K1RB 3KJVA 2A0FB 1TKXA 3BH6B 4NLWA 3UNGC 1Z2LA 2HWHA 3PR4A 3I0RB 4RW6B 2VV5A 1CJKB 1HBUA 4WFZA 4N77A 2FGOA 5DGBA 2IBOA 1RHKB 2J7KA 4NCGA 5EHHA 4NYZA 4UUXA 3OTBA 4LF8F 2HFVA 3IBCB 2CUYA 1MN7A 5BR8J 1FKPB 2Y1RI 3N4WA 2FQQB 2ZH6A 2RNEA 3AB2B 2XTCA 2ZUGA 3VAIA 4RU9A 1H2VZ 2KHDA 1FHTA 1KOOA 3DI6A 2V2VA 4HKQA 3FSIA 4CM2A 1MSWD 3GR0A 5A8KB 4J9OA 2UZAA 1NHVA 3DOLB 5EGYA 3PX4A 2P9GA 3AJ1A 5CYJA 3UVJB 2V50A 1RQ0A 1RAOA 3K57A 4BHQA 4Y65A 4DN0A 5CZXA 3V4IB 5DM6Q 4B3MF 2DHHA 1FKAF 2CQHA 2AJ0A 1WHVA 1FT8A 1FE4A 4FP9A 3SFGA 2R7SA 1BQNB 1YVFA 1TUVA 2YKMB 2C1EB 2V8DA 1S1TB 2YNIA 4ELTA 1U0HB 4OJ3A 1PGZA 1HMVA 2VQEJ 2AU0A 5SZTA 5BXIA 2C3PA 2CDRB 3DGVA 4JI0F 3HHKA 2JL9A 3V2UC 1W2BR 1TL7B 3PO4A 1P9YA 5DETA 2AJQA 4HACB 3NAIA 1YZ7A 2QYGA 3BO3A 5IWAJ 2IM3A 3IRXA 1XMQJ 2P6SA 3D6MB 1GH8A 2PSZA 3BSOA 4ETXA 5KG0A 3G8TA 2MDAA 2ACMA 1IKVB 4NE9C 1LW0B 3T5KA 4GKJF 1Z2ZA 3HXMA 3QJLA 4X4OA 5KTQA 4YFUA 3IG1B 4OLPA 4QWDA 3FBEA 2UXCJ 4WZMA 5KFVA 2W9CB 2VASA 4KO0A 2UUBF 2GIRA 1ZETA 3K89A 3R1LA 1B4SA 4NEZA 5KFFA 4MKYA 2V8HA 4HI2A
chains in the Genus database with same CATH topology
1YITS 3FQKA 5DO2A 1U1LA 1WTBA 1JLCA 1VOMA 3MDFA 4TKTA 4I4BA 2R7TA 2M4MA 3UCGA 3NCPA 4I6AA 3IGVA 1SH2A 4NLXA 2R2UA 3T5HA 4ECSA 4OI0A 2ABYA 4DHVA 1HWUA 4ECVA 4ID5A 1WEYA 5KFYA 1SUQA 5AE2A 5KT2A 5I4MA 4DR4F 2F9DA 4FF1A 2G4BA 5E2QA 1XR6A 4W92B 1FK9A 1VRTA 1RTJB 3UE2A 3MUMP 1WF1A 2V9KA 1XC9A 3DMJB 1CVJA 2JFDA 1C0UA 1U6FA 2LYVA 1G2EA 4X4UA 1CEZA 3T5LA 3IRWP 5LL6d 1S0VA 2E1RA 4Y2CA 4M8LA 3CC4S 4WYWA 1VFJA 2AQ4A 4X4RA 3X1LB 5SUHA 1HNWF 2O3DA 1JLFB 3H59A 3PEJA 2MSTA 1FKPA 2HZCA 1UVKA 3M2UB 1JLBA 4MFBB 4QIWD 2Q1LA 3S1TA 2JOQA 1TVRB 4ETZA 1K1SA 1VBYA 1JLGA 1WF0A 2XHWA 4DS5A 2IMWP 2XI2A 3LWMA 4CO5A 1HQUB 5LSLA 4DLEA 1T03B 2CQGA 2DB1A 1SB6A 2LA4A 3P96A 4RKUC 5GAEU 3KJVB 2FPHX 2J6UA 3OL8A 1TKXB 1WEXA 2VG6B 1YJUA 4DL5A 1KLMA 3CCUS 1Y3JA 1KQFB 1ZM9A 4NCAA 5B08A 2B9XA 1NK6A 1C1BA 4OJHA 4DSFA 1RA6A 2M8DB 1IJEB 3PKMA 4ELUA 2AX0A 3MPYA 5EN1A 3KK2A 3C2PA 4QWAA 4ES3A 4OX9F 2DNGA 3OUYB 1JK9B 2GV1A 4IFYA 1VS3A 1HBUB 5DJBA 1VQKS 2ZC4A 3RU0A 4Y6IA 1F9FA 3M9MB 3QGPA 3D2WA 3CCLS 2VOOA 4GC6A 3CULA 2IM0A 2OMLA 3I82A 1LWFA 1VIOA 3T6JA 3U1LA 5KFGA 2DNRA 3MAHA 3MF5A 2UUWA 3G8SA 4NCGB 5IZHA 4ECWA 2FC9A 2LEBA 4RW8A 5L8RC 2NUHA 1PSDA 2KG1A 2UUCF 2WOMA 4B08A 1FE0A 4X62F 2CQDA 2OPPA 3QIDA 2KI2A 2O1PA 3DOLA 4RWWA 4Y2KA 3OFFA 1KTVA 4EBEA 3T1AA 5KAKA 2MQQA 3MM8B 2VFVA 5KFAA 2N82B 2FJDB 2HMIA 4ICLB 4F3MA 1KD1T 3W2VB 2LXIA 2VUGA 2HRYA 4HT5A 1VQ4S 2YVSA 3M8QB 2CDQA 4WFBQ 1RKJA 2QYCA 3EUNA 3UD3P 4KB7A 1TQLA 4KJIA 4ZPDA 5D6GA 5E3PA 5J2MB 2J0XA 2F1FA 3OJUA 1T3OA 2QT7A 4NLUA 4DSKA 3V4MA 4IRDA 1LWCB 3MI7X 1KFDA 1Y0HA 4HDHA 1HNIA 4I7FB 2F3JA 1I94F 1TL1A 5HMXA 1MMNA 1LK7A 1M5HA 5HBMA 3J7YI 1HYSA 5LT5A 1WG1A 3CWJA 5G0RA 2W8LA 4WXWA 2HHWA 2YQ3A 3CDAA 2AJ1A 3PFEA 2HVHA 1URRA 2LMIA 4E98A 1C2PA 2DHAA 2RRBA 4GKKF 5EWEA 2LXFA 1U26A 1BQNA 2HNDB 5KG6A 3LO3A 5KFTA 1YSJA 2YKMA 3UW1A