3OL6A

Poliovirus polymerase elongation complex
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
molecule keywords Polymerase
total genus 140
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3ol6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ol6A02
3CDUA 4J9PA 1TL3B 1OS5A 3DDKA 5F8HA 5KT5A 3KLFA 4DL7A 4PUOA 2QE5A 4QWDA 1EETB 3T1AA 4NRUA 4QPXA 1S1WB 2HNDB 4ZP8A 2BR0A 5J2MA 2WB4A 3I0RB 2RF2A 2HWIA 3KLHA 1NHVA 1S1VB 5C42A 3T5LA 1RA6A 2GIRA 3QZ7A 1GX5A 4O4GA 1S6PB 5J2QA 3OSNA 4TQRA 3UR0A 3FSIA 5J2PA 2OPPB 1D0EA 4Q0BA 2YKNB 1BQMA 4RW6A 1R0AB 3DLGB 5DLGA 2HMIA 4KB7A 5J2QB 1VRTB 4EEYA 1T03B 2OH2A 1RT4B 1S6PA 5KT4A 2E9RX 2R2RA 3I5CA 3DMJB 2VG5A 4EYHB 3HVAA 3RB0A 1RAJA 5KFHA 3G86A 2FJVA 4ZP9A 3LANA 1HQUB 5KFEA 4B3OA 1RT7B 3Q8RB 3MFIA 1C1CA 5J2MB 5KFQA 4EBCA 2HNDA 2IM0A 4Q45A 1T05A 3KK2A 2VA3A 4ID5A 2UVVA 3H5XA 3H5YA 3HVTB 4DL4A 1JLQB 4LQ3A 3MFHA 2C22A 1IKVB 3BQ0A 4XO0A 1S1TA 3Q8PB 1SUQB 4NLYA 4X2BA 3CVKA 5KFCA 4NRTA 2BQUA 4YR3A 3HHKA 4TXSA 1JX4A 1UWBB 3KLVA 1HMVB 3I0SA 5I3UB 1RTDA 4PQUA 4KHMA 1TVRA 2R2UA 3N6LA 3FDSA 2IM2A 1UWBA 2V0NA 4DG1A 1S1XA 2XGPA 1VRUA 2BE2A 3GV5B 4Y2AA 3MECA 4IRCA 1C0TB 3BGRB 2D41A 1HYSB 4ZHRA 3ICLA 3KK1A 5KFOA 1CSJA 1T94A 5K14A 4MIBA 4RW8A 4R8UB 1N48A 4DL6A 2V4QA 4EO6A 2R8JA 3IGVA 5KFKA 1LW0A 4KO0B 4ICLB 4R5PB 5KG7A 1RT3A 2W9BA 2AGQA 1GX6A 2RKIB 4YMEA 3H4BA 2IJFA 2WONA 3DLKB 4IFVB 3MEGB 4LSLA 4GC7A 4ED6A 2ZKUA 2W7PA 1RT2A 3QLHB 5JUMA 3PJXA 2ALZA 4ECSA 1RT3B 4NLQA 2IAJA 3V6KA 2ASLA 1N5YB 5KT6A 3KHHA 1DLOB 3IS9B 1JLBB 3C6TA 3QIPB 2YKMB 2VG5B 1RTIB 4IQXA 2JLEA 4KV8B 4QWEA 2J6UA 3N6NA 4R8UA 2OPRA 3M8PA 3BQ2A 2HNYA 5KFIA 4ZHRB 5KFWA 3JYTB 2BANB 3KOAA 3BGRA 2ILYA 4ZP7A 4DL2A 3IRXA 4PWDA 2VG7B 1JLEB 1RTJB 4RW9B 5KFBA 4ECZA 2JEIA 5EWEA 5KG4A 3FQKA 1LWCB 3H2LA 1RT5A 5F8JA 5KG6A 1N6QB 2FLPA 3PZPA 5L1LA 3RAQA 5DQIA 1LWFA 2AWZA 3UQSA 2UVWA 2XI2A 5FDLA 1TKZA 3NGDA 5EUHA 1HNIB 4ED3A 3OSPA 2B6AA 4O3QA 1J5OB 1JLCB 2WCXA 4FS2A 3DM2B 3GIMA 4K4ZA 4J9SA 5DG9A 2AGPA 4H4OA 2FVPA 5HP1B 4ID5B 3MR5A 5JXSA 3PW0A 1FKPB 4O3RA 4XPCA 3FRZA 4JV0A 4WZMA 1C2PA 2W9AA 3KMQA 1RT7A 1S9EA 2BQ3A 1RT5B 4NLUA 4FS1A 3QGHA 4MFBB 3KK3A 3DRPA 1HNVA 1S6QA 2WOMB 3OLAA 3DLEA 4QWAA 3N6MA 3MF5A 3DLGA 4IOBA 4RUCA 5D3GB 1N56A 2JC0A 2BANA 3NL0A 2HNYB 2GIQA 3M8PB 5J2NB 4EYIB 2WOMA 3PJWA 4WXOA 1S9FA 3VQSA 1FK9B 5KG3A 3KK3B 4NLDA 4TYBA 3BQ1A 1S1VA 1JLBA 4Y34A 1TQLA 4ZPBA 1DLOA 3BR9A 2HNZA 3QGIA 1FKOB 3TVKA 5KT2A 4RUAA 4IH6A 1N5YA 1RTDB 1S9EB 2GC8A 4QW8A 4U6PA 5KFTA 5KFSA 2FVSA 4K4UA 4IG3A 3GQCA 3OL6A 4H4MA 1MU2B 3CDWA 3KNAA 3DLKA 2C28A 1S0NA 2V9WA 4R5PA 3ISNC 4ICLA 4KSEB 2W9BB 1LW0B 1TKTB 5EWFA 5CYQB 2WTFA 4MKAA 3SI8A 3PVXA 3RB6A 1JLCA 2W8KA 3GV7B 1KHVA 1HNIA 1Z4UA 2CKWA 4NCGA 5KT7A 5DQHA 3KK1B 3KHRA 4J9RA 1DTTB 3MEEB 4EBDA 1LWFB 4O3OA 5KFZA 4F4ZA 5KFGA 4ECRA 2YNFB 1JLGA 4QWCA 1JLAB 1N6QA 1S9GB 2YNGA 4K4YA 4IDKA 2YNHA 1IKXA 2HWHA 3CJ3A 1TVRB 4I2PA 1C0UA 4KE5A 3EPIA 4PQUB 1S1UA 4O3PA 1YVFA 1EP4A 1S49A 2R8GA 1JLGB 4Q43A 1RTJA 4J9OA 2VG7A 3OHBA 2UVRA 2J6SA 1SUQA 3DYAB 3MEDB 1S1TB 1DTQB 1JLFA 5L9XA 5KFNA 2OPRB 3C6UA 4NLXA 1TKXB 3LAKA 5KG1A 3V6JA 4NLSA 4LSNB 2CJQA 4NLGA 1RT6A 4LQ9A 3H5UA 3H98A 4IG0A 5KFJA 3PR4A 3EPGA 3HVTA 1RT1B 2OPQB 3M9MB 4F4WA 4J9QA 3DRRB 4MK7A 4KHRA 1W25A 4TY8B 1KLMA 1RT2B 3MTKA 3QLHA 2XGQA 4ED0A 2AU0A 4IG3B 2AX1A 3MEGA 1C1CB 4TY8A 5KG0A 2RKIA 4RNNA 4Q8EA 2OPQA 2W7OA 1QE1A 1HQUA 2R8IA 2ZE2A 1RT6B 4IG0B 3KJVA 5HLFA 2C2EA 1FK9A 3E01A 3LALA 4DEZA 1TP7A 3E51A 4YQWA 2HMIB 4O3SA 3V81A 3DYAA 3DOLB 4DL5A 2FJWA 1RTHA 2OPPA 1XR5A 3MECB 2XCAA 5L1JA 1JXLA 5D3GA 4RZRA 1XR6A 3HVWA 4DG1B 2D7SA 3CIZA 3DOKB 5CYMA 1IM4A 3DRPB 5F9LA 2XI3A 4I2PB 5KFRA 2YNHB 3V6DB 4HKQA 3I0SB 4IDKB 3NAHA 5DLFA 5C25B 3I0RA 4RNMA 5I3UA 1JLAA 5KFPA 3M9OB 3CJ2A 4J9LA 1IKWB 1DTTA 2ZD1A 4NLOA 4IR1A 3PR5B 5I42A 1IKVA 3NKYA 4ZVEA 2I1RA 4RW7A 4O4RA 4ECYA 2YNIB 4IKAA 1LWEB 2UVUA 1MU2A 2ZD1B 4J9MA 1T05B 3D28A 3I5AA 3IG1B 5F8IA 2XCPA 4JV2A 2I5JA 1ZTTA 5C25A 4NLVA 1JIHA 1TV6B 4IH5A 3TQ1A 3FQLA 1SH3A 3QGGA 4MK8A 3RB3A 5HBMA 1RT4A 4URSA 5F8MA 3RB4A 4Q8FA 3UPFA 4URQU 3DOLA 2FVRA 4KBIA 3JYTA 3CDEA 4O4GB 2VA2A 2IC3A 4DL3A 1RTIA 4MFBA 5HLFB 4ZPDA 1HPZA 4I2QA 1XR7A 3T5KA 2ZE2B 3LP0B 4ZVFA 3JSMA 1QE1B 4KAIA 5L1IA 1C1BB 4KKOA 4MKBA 4ED8A 3PW7A 4MK9A 1SV5B 3ISND 4O44B 4TYAA 1KLMB 4IFVA 3M9NB 1REVB 2D3UA 1RT1A 1TL3A 3RAXA 3LP2B 3CWJA 3M8QB 4RW7B 2IJNA 2OPSB 4O3NA 3G6YA 2ASDA 3OL9A 4TQSA 1SH0A 1J5OA 2WK4A 1NNDA 1TKXA 3DI6A 4RW8B 5C24B 5I42B 4ZP6A 4WYLA 4WFXA 1DTQA 1JLFB 3MEDA 4IFYA 1TKZB 5F9NA 2IBKA 2FVQA 2E9TA 1C0TA 4I7FA 3I5BA 1BQNB 1IKWA 4EO8A 2RDIA 4NLPA 2AQ4A 1JKHA 1N4LA 4QW9A 1LWCA 4WE1A 3MR2A 1S1UB 3OL8A 3PHEA 3SFGA 3CO9A 4YP3A 3G6VA 1RYRA 4WFZA 2VG6B 3DOKA 5CYMB 5KG5A 4WFYA 3GYNA 4IRKA 3BSOA 3TAMB 3IRXB 3IN5A 4I7FB 5DG8A 2W9CA 3FFIB 4K4WA 1K1SA 4F50A 4J9NA 4K4VA 5F8NA 3DI6B 3NMAA 3E01B 1ZETA 3ITHA 1HQEA 2OPSA 4WYWA 3NBPB 3OLBA 1TKTA 1S48A 3GILA 4ECTA 1QAJA 1SV5A 4O44A 4H4MB 1D1UA 2ILZA 4ED1A 2R2TA 1ZTWA 4K50A 2F8EX 1S10A 1RA7A 3QZ8A 3DRRA 1QUVA 1C1BA 4KKOB 4TN2A 4NLTA 1FKOA 4ZVHA 2HNZB 4EBEA 4KO0A 2O5DA 3Q8SB 5DQGA 4RNHA 2FLNA 3NBPA 1HPZB 4I2QB 4LSNA 4RW4A 2FLLA 5F8GA 3DMJA 3KLIA 5T14A 2IC3B 5EWGA 3MR6A 1T03A 2IM3A 4WXWA 2WRMA 3V4IA 2W9CB 3T5JA 2BRLA 3BSNA 4YR2A 4G1QB 1EP4B 5HBMB 2E9ZA 2B5JA 4MH8A 2W8LA 4WE1B 1HMVA 2DPJA 3KLEA 3CJ5A 2I5JB 1U09A 3IG1A 1TL1B 1RYSA 4KFBA 1SH2A 4IFYB 3T5HA 4IRDA 4FBUA 5HP1A 3LP1A 4H4OB 2FJXA 5C24A 3KLFB 3PW4A 4JUZA 5CYQA 1K1QA 2IMWP 3LP2A 1JLQA 4XPEA 4G3IA 4TLRA 3LP1B 4TY9A 1REVA 5F8LA 2XWYA 5KFDA 5FDLB 5KFVA 2JEGA 3T19A 5KFUA 3GIKA 1NHUA 3GIIA 4ECVA 1IKYA 4Y2CA 3DRSB 4OL8A 3KLEB 5J1EA 3LP0A 2B5JB 5L1KA 3H40A 4NLWA 3H4DA 5KFYA 3QIDA 1VRTA 1R0AA 1RTHB 2FVCA 2YKNA 3V4IB 1S97A 2R8KA 3OL7A 1KHWA 3KMSA 1HARA 3DLEB 4J9KA 2C2RA 4RNOA 1HNVB 1S6QB 3NAIA 5HROA 3IGNA 2JEJA 5C42B 1TV6A 3IS9A 3G6XA 3KLHB 4F4YA 2R2SA 4ECQA 2IAJB 3DRSA 3Q8QB 5KT3A 5C5JA 4ECUA 2WHOA 5KFLA 3D5MA 1EETA 1FKPA 2WONB 4LSLB 3GIJA 1LWEA 1S4FA 2AGOA 1T3NA 4PUOB 3H59A 4ECWA 2R8HA 4YR0A 3DM2A 4ZPAA 4ED7A 2B6AB 3C6UB 4ZVGA 5DGBA 2QV6A 4ECXA 2BRKA 2HAIA 4RNFA 2V4RA 2BQRA 3FFIA 1HYSA 4KFBB 4U7CA 1TL1A 2IM1A 4K4TA 4Q44A 1S0MA 2UUTA 2AX0A 2XC9A 3BSAA 4F4XA 5DGAA 2JC1A 4M95A 3KHLA 3RBEA 2VG6A 4NZ0A 2RDJA 2ASJA 3V6DA 1I6JA 1JKHB 4G1QA 2YNFA 1JLEA 4RW9A 4K4SA 4PWDB 3MEEA 3BREA 3V81B 3LAMA 2EC0A 3HKWA 4KV8A 3KLIB 2YKMA 4NLRA 4RW4B 4HYKA 3KJVB 3QO9A 3C6TB 3M8QA 3QIPA 2B43A 1LW2B 3KLGA 3GV8B 3BJYA 2IA6A 3QYYA 5KG2A 4GC6A 3KK2B 2ATLA 3UDLA 4MIAA 5KFXA 4H54A 4IH7A 2UUWA 3OHAA 4B3OB 1MMLA 3CJ4A 3MR3A 3JSMB 3CJ0A 1LW2A 3QO9B 3KLGB 1HQEB 5KFMA 3ITHB 5HROB 3KHGA 1RDRA 1S0OA 4R0EA 3PW5A 5J2NA 4M94A 5K14B 5KFAA 4RU9A 5KFFA 1BQMB 4RW6B 5EDWA 4ED2A 5J2PB 4Q0BB 4WZQA 3V6HA 3EZUA 1VRUB 2BE2B 3TAMA 2DPIA 3SFUA 4K4XA 1S1XB 1C0UB 4QWBA 4Y3CA 1IKXB 3BSCA 4FBTA 1S9GA 2YNGB 2RF2B 5J1EB 3PW2A 4NYZA 5DG7A 2C2DA 1IKYB 4ZPCA 4ZMMA 1BQNA 1WNEA 1S1WA 3H5SA 3RBDA 4IR9A 4NCGB 4URGA 2YNIA 4JV1A 2J6TA 2JEFA 2D3ZA 1QAIA
chains in the Genus database with same CATH superfamily
4OYBA 1TK5A 5KT5A 2LDIA 3DDKA 4A4JA 4ANCA 2F5GA 2Y8WA 1HW9A 1X60A 2D74B 2Y3YA 3AXKA 4OJ1A 4ZDNA 3T1AA 1RCOB 2CPZA 4QPXA 2ZKTA 3N5FA 3T1HJ 4F25A 1T9XA 1M1GA 1S5ZA 2JVRA 5J2MA 2HYIB 1WKLA 1RTZA 4F67A 2DXFA 3K5PA 1VQ5S 4YN3B 3KLHA 1UVNA 1KNZA 1NHVA 1Q7LB 2CFXA 3RAMA 5C42A 1HWJA 1JJCB 4CLZA 4ZN3A 2XHCA 5IM0B 2X1AA 1N5QA 4O4GA 1ZA2B 4L73A 5AE2A 4KR0B 3TUPA 4LFBJ 3MMAB 3UR0A 2EFGA 5J2PA 2YKNB 4RW6A 3UFCX 4USJC 2CQHA 3L7UA 2GQ2A 2VFSA 4HH0A 4DPXA 4KB7A 4PABA 3W1YC 4EEYA 1S72S 2JWNA 1SQFA 4DV7J 1T03B 2E9RX 2NXNA 3Q86A 1Q81T 3HO1A 5ETVA 1F6TA 3OUYA 1M5SA 7AT1B 2VBXA 3TJ8A 3K89A 1RAJA 4EYHB 1MNEA 4QIFA 3TZWA 4IO9Q 4ZP9A 4NXNJ 3JQKA 1X4GA 1WOPA 5KFEA 1N36F 2VZ9A 2UXDF 2AJ4A 3Q8RB 4CM2A 2ZNYA 3PNIA 1GXUA 2HNDA 3HJVA 5HQLA 1MMDA 2HAFA 2F65A 2QN6B 4ED5A 3F0NA 2Y8YA 3Q83A 2MZQA 1JLQB 3C14B 4N76A 2WBRA 1QD1A 3NGSA 5DDQC 1ICEB 4XO0A 1ZH5A 2IRYA 3UE2A 4X2BA 3PTWA 5FJ4A 1I1GA 1KQKA 4XIUA 2Y0SD 3ZXWA 2BQUA 3HHKA 4U8VA 1UWBB 3MAQA 3I0SA 4PWWA 5JVHQ 4PQUA 3P96A 1O0PA 2YH0A 2LMIA 2R42A 2ZBPA 2OMLA 1CG2A 1X5TA 4CH0S 3R1LA 1NEEA 1UWBA 4BBYA 2GMHA 4DG1A 5IC4B 2XGPA 2VKRA 4DMZA 5C2CA 4U67Q 3ZTQA 3DLLQ 3BDEA 3MECA 2W2OP 1VCTA 1C0TB 1EX8A 1H73A 3BGRB 5ETTA 2G13A 4LF8F 3ICLA 1CBKA 1TU0B 3HHLD 5C2GA 1NPPA 1ROFA 1T94A 5K14A 4R8UB 5AXNA 1N48A 2PI5A 3BV8A 2QYGA 4DL6A 3AB4B 4EO6A 2R8JA 1DY3A 4NMLA 4KO0B 2MKYA 4LR9A 2GMLA 2AGQA 2UXCJ 3J7Z5 2PO4A 4W4MA 2RKIB 5HSPA 3H4BA 3LA0A 3O2IA 3DLKB 1YJWS 4ED6A 2W25A 3TZXA 3CXCR 2ZKUA 3MTJA 4CLYA 4RBVA 2AYGA 2KG0A 4EZ9A 3BO3A 2ALZA 2I6WA 1RT3B 4WP3A 2B9YA 3VAIA 3QAEA 4ZLNA 3V6KA 3L7OA 2ASLA 2DHHA 5IXUA 1N5YB 3SSSA 3UO0A 1NHKL 3BN7A 4C7QA 3QRRA 1RTIB 4KV8B 3N6NA 1XNQJ 3M8PA 2XNQA 3BQ2A 3HM9A 3L95X 5KFIA 2H3EB 2FDNA 5E2QA 3KOAA 3Q23A 2D9PA 1IBMJ 4QCLA 2FUG9 3ZZ0A 3MUTP 4DF4A 2VG7B 1FTCA 1JLEB 3DU5A 4OZ2A 2RH3A 1B7YB 2YKAA 1RABB 4MTPA 2XB2D 5E0OA 1NB7A 4JI5J 1QSYA 1PO6A 4USHA 1N6QB 1HD0A 3NWGA 2F4VJ 2OKQA 2VBYA 3HKZD 5K20B 4ILMA 3QATA 2V8DA 1LWFA 5E33A 4DN9A 2XI2A 3MPYA 5FDLA 4UTGA 5E5NA 3GQCA 4UQGA 2VFTA 2UUBJ 1RSCA 4WFNQ 2MQPA 1RISA 1CC7A 1NPKA 3EWGA 3GJQB 3OTOF 1NO8A 3BGOP 3DM2B 4DR5J 2OUGA 4NXNF 2M5YA 1RWNB 3KG4A 2LQBA 2RDDA 3R5BA 4ID5B 4BDPA 4ZKAA 2J0SD 3D0GE 4O3RA 4GRSA 5F3ZA 5J1PA 3RGIA 2V4JA 4PZVA 3THVA 3IWNC 3FRZA 2HBRB 4FPIA 3KMQA 3KNGA 2YWEA 2Z2ZA 2VONA 4HL9A 2BJ1A 2ZH7A 2V5HG 2LEPA 4FS1A 1OY9A 4DN0A 4MFBB 3KK3A 4GC7A 4QU7A 4XK8C 2VDHA 3D1OA 2DKOB 1EJ7L 4X4PA 4G65A 1SJFA 4DR7F 2DXDA 2FZKB 2JC0A 1PCAA 2CQ2A 4NMXA 4OI4A 4P7VA 4K2JA 1CJUA 2P2CB 3I4HX 2J0XA 4DJBA 1FWPA 4L74A 4YY3J 1FNMA 1NJIT 4EYIB 3PJWA 4WXOA 3MZIA 5BYSA 3ET6A 1FK9B 1S9FA 1QSSA 1TFYA 1ZM4A 4OQJA 3BQ1A 2DR5A 3QGIA 1HLWA 3PYFA 4ZPBA 3D4JA 3GFHA 4D3HA 4DSEA 4B3MJ 3GMGA 4DR6F 1R8BA 2GMJA 1UFWA 2GHVC 1S9EB 1WTBA 2C3UA 4QW8A 4HHHA 4U6PA 3BKUA 4GKJF 4OHWA 3CW2C 3CDWA 1T11A 1NZ8A 1TMMA 1TAQA 2M7SA 3MEKA 1G4CA 2H5IB 2RUSA 4USIA 2C28A 2JVOA 2W9BB 3ISNC 4HT7A 4ICLA 4NXMF 1GNKA 5EWFA 3RB6A 3DOMA 3G87A 1H3DA 4ETZA 1EKRA 1JLCA 5A8RB 2CIMA 5C7PA 4Y2MA 1KQSR 4CO3A 2CQ3A 2O67A 3SQGB 5K8NA 4ZLLA 5DQHA 5KT7A 1SCJB 4U7UD 2F1FA 4WU2A 1YZ6A 4I64A 5KFZA 4F4ZA 4K5RA 5KFGA 3MUMP 3OW2R 3EGWB 3QMQA 2MSSA 2YNGA 4HHUA 5KOXA 1H2UX 4DV2J 2YNHA 1IKXA 1AZSA 4K8RA 4CYUA 2YWGA 4LF4J 4LR7A 4P74A 3EPIA 1M1HA 2QLXA 1R27B 1YVFA 4JI1J 1G2EA 1EP4A 1JLGB 4Q43A 1RTJA 4J9OA 3BB5A 3OHBA 2JLFA 3TANA 3MGJA 2J6SA 2E44A 3IMQJ 1SUQA 2V67A 2HHUA 3Q0AA 4DX6A 1S1TB 1RHQB 4ZVPB 3OXFA 5KFNA 2OPRB 1I3OB 5KG1A 3I32A 2B4OA 3V6JA 4K59A 4F8RA 3MM9B 1CJKA 2AJ2A 2GIFA 4V19J 1FXLA 3QNWB 4LQ9A 3PR4A 4JI5F 2NSBA 1RT1B 2OPQB 1GH8A 3ZO7A 3DRRB 4TY8B 3AJ1A 4PPDA 3P5TL 1RT2B 3MTKA 3D1QA 3QLHA 2F9DA 1IWGA 4GO5X 4M5DA 4F0HA 5MLCV 1DQ8A 2XGQA 1UCNA 3MEGA 3QJPA 1SJ4P 3H20A 3RG6A 4HEA9 2R8IA 5D0EA 3R3TA 2C2EA 4WF9Q 1MN9A 3LALA 1BE4A 1B4SA 4FZVA 4O3SA 4DR1F 3DYAA 2H54B 2HQCA 4CTAA 5DDPC 4DL5A 1JXLA 1YBAA 4X64J 1XR6A 4OYZA 4C9DA 3QBCA 3TP2A 5CYMA 4CLSA 1UW9A 4I2PB 5KFRA 1EZZB 1X4FA 5IOLA 5I3UA 1RTDB 4B9LA 3I0RA 1JLAA 5KFPA 3M9OB 4ED0A 2WVDA 3BGFA 3AA9A 3P4UB 5B0CA 2OGUA 2VUGA 5HANA 3VAFA 2SXLA 3ENQA 1Y11A 3K2YA 2MZTA 4JI6J 5A0YA 2BBEA 3W2WB 1U24A 3M32B 4IR1A 3K0JA 1VIXA 4K7QA 3PR5B 5A8KB 4P2XA 3S1TA 5CCLA 5CAAA 3RR7A 4FF4A 3D6FB 3OPKA 2I1RA 5ETQA 4RW7A 4PYAA 3W64A 3NNAA 2HHTA 2LFVA 1TTHB 4LSZB 5BYQA 3K57A 5L9NA 3CO0P 2JHEA 4LVNP 4L3NA 2UVUA 1VQMS 1W26A 2F40A 2DEJA 4RO0A 4NWBA 3D28A 2A2DA 1LV5A 2EBEA 2X51A 3IG1B 5F8IA 3MPUB 1ZTTA 1NDLA 5H9EJ 2EW9A 2RQKA 4IH5A 3Q2TC 1NK5A 3TUIC 1WEYA 1WI8A 2MQMA 4X66J 4JI3J 2UXBJ 2CQDA 1RUSA 2XHWA 3IP0A 1ITPA 3BH6B 4YDXA 1Y0HA 3W66A 3MUVP 4KIAA 2P8IA 2QTWA 3UNYA 1Q53A 3DOLA 3D68A 1HI8A 3CIMA 3M2RB 3IR7B 3TUZC 4WK3A 2QZ8A 2O1PA 4HTIA 4QIVA 2V1TA 3W2VB 5HVGA 4PR6A 1L3VA 1M5KC 1WUUA 3MMBB 5B0BA 1HI1A 1Y3KA 3L3CA 5DZ6A 2MZ1A 4USWA 1F5AA 4OJ3A 4ED8A 1YX2A 3PW7A 3CB4A 4OYMA 4NYOA 2VOPA 2E5LF 4X84A 1KLMB 3M9NB 1QVFR 3JSRA 2BJDA 5K9FA 3Q2SC 1G1XA 1ZM2A 4LF9J 3LP2B 2IJRA 4N5SA 4RW7B 3DDNA 4XTTA 2KXNB 2ASDA 3ILJA 2WK4A 1NNDA 1HBNA 2DIVA 3GWCA 3IAM9 3O6QA 3SDEA 5C24B 2VHGA 4WFXA 2XMKA 1JLFB 3CD5A 3CMQA 3C16A 3OXLA 4OX7A 2VICA 3SYZA 1UFLA 3ZZPA 3K58A 5HL7Q 1BQNB 2E5IA 2Q6BA 4OI0A 2DRAA 4IUFA 4JV5J 1JKHA 1N4LA 2YBVA 1XTZA 4QW9A 3SCLE 2KM8C 3MM8A 3G6VA 3SFGA 2CJBA 2QL9B 2VG6B 1LOUA 5CYMB 3P5BP 1H7XA 5GMKa 4LBIA 4J9UE 3JSYA 4Q2MA 5G0RB 2HURA 5IC6B 2MGZA 2W9CA 3PRBA 4I67A 1UPMB 4K4WA 2CQIA 2HK3A 1D8ZA 3HZEA 2UUAJ 4C8OA 1WOOA 4DPTA 3RBXA 4CLPA 5F8NA 3DI6B 4DV1F 4X65J 5B09A 3CCLS 3ENVA 2F3JA 1KVKA 2OPSA 4WYWA 1TKTA 1NU4A 2OO4A 2DNGA 4M1KA 1BWEA 2H1YA 4QR2A 4EU0A 2C42A 2VQFF 1NXIA 4DLGA 1SV5A 3IXQA 4KGXB 1XJWB 4ECTA 4ED1A 1D1UA 1BMQB 4K50A 1JXEA 1APSA 1S10A 3QZ8A 3DRRA 1QUVA 4DPUA 1C1BA 3MMJA 4KKOB 1FKOA 2CVEA 3BPDA 3NOGA 3CJSA 3Q8VA 1ZM3A 3W9HA 5LOQA 3NBPA 4CNYA 2V2QA 3DN9A 1VQLS 4FF2A 2BW2A 2KB2A 4Q2LA 5EWGA 4LT6A 4WTOB 1NRKA 1PBAA 5JVGQ 3RW6A 1YG0A 4WXWA 1TR0A 4ZPTR 3T5JA 2BRLA 3VGTA 1CJTB 2GNKA 4OHZA 1FD8A 4PG6A 2HQGA 3A3PB 3UVJB 5H1SV 3MURP 1EP4B 4LF7F 1YJRA 2ZBCA 4CZCA 2MZRA 2L41A 1WF0A 4MH8A 2UXBF 4UQTA 4OI1A 3KLEA 2I5JB 1ZS6A 2J9EA 3BR8A 3O44A 1NSQA 3BYPA 1RYSA 3RBZA 3K59A 1WSRA 2PMWA 2LVWA 4L72B 4ZCLA 4CLUA 1U48A 4JI2F 4IRDA 3LP1A 3FBBA 2FJXA 3LW5C 2CDRB 2J0QD 1FWKA 4HACB 2DT9A 4XPEA 1U6BA 5D77A 1UVKA 4TY9A 1REVA 2XWYA 3HZGA 5KFDA 2QEXS 2BKNA 2KKHA 2V8VA 5KFVA 2AYEA 3KDNA 1H98A 5KFUA 2JEGA 3OVBA 4YEAA 1NHUA 4ECVA 2E1RA 4Y2CA 1RLDA 2KFYA 1QTMA 3LP0A 1F2GA 1I51B 2GJIA 2RS8A 2XMJA 2B5JB 2QRRA 2LQJA 5L39A 1WC4A 3GP9A 1YK9A 1U2RA 2M52A 3PM9A 4DOZA 3BDPA 2XG8A 3BKFA 1VRTA 4QYRA 4AL6A 3MXHP 2I0XA 2MZSA 1KTVA 4B3RF 1A9NB 1RTHB 2FVCA 3V4IB 1S97A 3OL7A 4DFMA 4DPYA 1KHWA 3EM1A 1N5VA 3CD0A 5IQQA 1OYDA 3AY0A 3ENWA 3IGNA 4QQBA 5HROA 2OIHA 3UD3P 3CGIA 4WBFA 1TV6A 5MAOA 4DR5F 4ECQA 5SUHA 4BWJA 3Q8QB 1DHMA 3QWPA 2PE8A 4A8XA 2RRAA 3C2PA 4LRDA 2A3JA 3UW1A 4PQAA 3O8WA 2R7RA 1TL7A 1Y7PA 1EETA 3CDBA 2MQLA 2WONB 3QQCD 1DARA 1LWEA 1QJHA 1RHRB 1VDHA 2O3DA 3A12A 3SIPB 3R5AA 1SKUB 5A2QY 1RAEB 4TU9A 1PKUA 4N7TA 3DM2A 4NZ7A 1U02A 2HQIA 4ED7A 2G2ZA 3I9ZA 3EDRB 3TR5A 2MKJA 3BGLA 2BDPA 1L3KA 2ZBRA 5LMUF 2QA4S 2BRKA 2ZNZA 2IVFB 2XLJA 2V2ZA 1RK8A 3FFIA 3NLCA 4A48A 1I5OB 2V4RA 3G82A 3CF5Q 1N34J 4MT1A 2CQBA 1F5CA 2RD5C 3GJSB 4N8OA 5E3PA 5DGAA 4M95A 3W62A 2LDYA 3RBEA 4FF1A 2ASJA 3V6DA 3OT9A 4BC7A 1PYOB 2H4YB 1AYEA 3CTRA 1ZPVA 5ETMA 1RHMB 2YNFA 4N47A 1JLEA 1NSKL 4K4SA 1K47A 1NM2A 2LXUA 3VZIA 1WJ9A 4F4XA 3THTA 1CVJA 3V81B 4EFAC 1T7PA 1J2VA 2ZITA 4LF7J 1VHIA 2AF6A 3M8YA 2ZBQA 3AQOA 3HKWA 3KLIB 4KV8A 4P73A 3ZNUA 3KJVB 2K2PA 2OEKA 3ILIA 2RVJA 5D4LA 1FI4A 2QSFA 3VWSA 5KG2A 1FRJA 4ZA1A 4HT5A 1BUXA 2PDAA 4Q7AA 3UDLA 4AQYF 4X62F 4C98A 2ZH3A 1YZ7A 5A2QU 3OHAA 3HXMA 5CYJA 4B3OB 3MR3A 3HF5A 1ZM9A 2JSXA 1U2CA 2PEHA 2OAUA 2J8SA 3BF4A 3ETOA 3Q22A 4LFCJ 4MKYA 1HYSA 1IBCB 4CP5A 5K14B 4RU9A 5J2NA 5IWAJ 2H5EA 1L5UA 2B9EA 3T1HF 1JJ4A 2DCLA 1BQMB 2FIUA 2HVEA 1Q1KA 1XMOF 2XLKA 2RNEA 4DV5J 4Q0BB 4KGZB 2DPIA 1TAUA 4Y2IA 2RQMA 2I38A 2RIJA 1WHVA 4PG7A 2XMAA 1C0UB 4QWBA 3KYLA 1DRZA 2BE7D 4OI6A 3B8HA 4NCBA 3AD9C 3P49B 2RF2B 1YKWA 3M2UB 3QPIA 1IKYB 2AEJA 2C2KB 4ZPCA 1P6TA 5LJ5Y 4F04B 3NS7B 1FDAA 3H5SA 4IR9A 4PG8A 4A8YA 4NCGB 4URGA 1H2VZ 4JV1A 2J6TA 2HHHJ 2D3ZA 5DRKA 4UUXA 5IT0A 2BABA 3C14A 3POTB 3CDUA 3E3XA 2YXLA 3EDQB 1TL3B 4ES3A 4NI2B 3KLFA 1NCLA 4UT4A 2QE5A 4QWDA 3MAHA 3OFFA 1EETB 4NL5A 3C15A 4NRUA 4CLTA 2E66A 2HNDB 4ZP8A 2XSJA 4HDGA 5CZXA 2BR0A 1FRXA 5DDOC 1PYTA 2C2MB 2RF2A 3M2UA 2ZHAA 2FY1A 1HBOB 2FZCB 4PYDA 3HX9A 4X4VA 2QA2A 3OUYB 3QZ7A 1KSPA 5I3QA 1GX5A 2WSCC 2YPYA 2KJVA 4TQRA 1RCXB 4OZNA 3PKYA 4A8KA 5AXMA 1YJ9S 1NK4A 1BQMA 2LA4A 2F8HA 4LIWA 3ZC4A 3DLGB 2MB0B 2HMIA 1VRTB 4LR8A 2OH2A 1RT4B 3R2DJ 2R2RA 3SSRA 3I5CA 3J7YU 2GGPA 2DNKA 1BWVA 2JH3A 3DMJB 4M5MA 1UFKA 1QUPA 3RW7A 1GAOA 2E1AA 2IYGA 2GQCA 2Z2LA 3G86A 2I2YA 3HFKA 2B7BB 4B3OA 4M5IA 1RT7B 2ZH8A 4WKRA 5J2MB 5KFQA 2FGCA 4QU6A 4J91A 4Q45A 2IM0A 1BHNA 1OM2A 2HWTA 2DITA 1ZAVA 2KVIA 2BV3A 1N33J 2B3TB 5CD4A 1NH8A 2BMBA 1JWWA 2APOA 2DGTA 4F2RA 1SB6A 3I4PA 2AU0A 1VC6A 2AEMA 3DCAA 3R5DA 3QFWA 3MFHA 2C22A 1IKVB 1LNQA 3BQ0A 4A8WA 4K0KF 4FXVA 2CNKB 3HHEA 3G8TA 3FMWA 2P6SA 4JI8F 3WIUA 3F73A 2EI5A 1HNZF 3LUYA 3CVKA 3GYGA 2IVYA 4DV0J 1F3FA 4DUZJ 4TXSA 3D3BJ 1MROA 3ETMA 1G6BA 4KHMA 2YKOA 3HHLC 1FE0A 1XIQA 2V0NA 3H42A 1S1XA 3DGPA 3HDSA 2BE2A 2PD1A 1CJTA 3G82B 2M9KA 4DFPA 1U1RA 4IRCA 2UV8A 1HYSB 3FCHA 2HHSA 4ZHRA 2RSQA 3KK1A 2DRBA 2G1HA 2BJEA 3GIRA 2HW3A 3AX2A 1CSJA 1RB0A 3CCWA 4MIBA 5RUBA 3RRHA 3T6BA 1TK8A 1T0TV 2JJ4D 4R5PB 1OPIA 3MCMA 5KG7A 2HIQA 1GX6A 1HL6A 2Q1LA 4K5SA 4IFVB 2WONA 4YMEA 3G8SA 2YQ3A 2BX6A 2KXHA 3TEGA 4CH1A 3MHYA 4W98A 4CWBA 5JUMA 6FDRA 4PG5A 1HBUA 4ECSA 4A47A 4QOTA 5ETLA 3C6TA 1YWXA 1F5BA 1Q79A 2LYVA 1YRXA 2VG5B 1D3WA 4J9VA 3EGNA 3KG1A 4GMKA 3AAWB 3ONQA 1ELOA 4XAKA 3ZZUA 3FEYB 3W60A 3VALA 2KVQE 4L75A 4ALZA 4OLOA 4C97A 2XYGB 1VYAA 3A3NB 3MCOA 2ILYA 2AEFA 2BJ9A 1U1PA 1MN7A 5G0RA 1QAXA 3ZTPA 4AL5A 4PWDA 1BQXA 1P8GA 5IT9Y 5KFBA 4ECZA 5T7LA 3OTCA 1FX2A 5IFMA 2BZ2A 4NPOA 1KBRA 2N3OA 4Y0FA 2U2FA 3TOQA 2Y1LB 1UVMA 2W2MP 4L76A 3H2LA 4KT0C 5F8JA 3DRXA 3PZPA 2CJAA 2G2YA 4BCAA 2VQFJ 5L1LA 2B4PA 1YLXA 1FXDA 2CPHA 2AWZA 1V5IB 2J9DA 2M4MA 2VKZG 4CLKA 5EN1A 3G8QA 1S0VA 4LRCA 3DGVA 3GTYX 3TJAA 1XN9A 3K7RA 1WHYA 1S76D 2XMTA 4CO1A 1HNIB 4ED3A 3NNCA 5H9FK 4G1IA 3OSPA 2YTCA 2NREA 2KJWA 2QMWA 2RRBA 1Q8LA 3O1LA 4PEOA 1HA1A 2DH7A 1FESA 1YJTA 1WD6A 2HGLA 4Y28C 3PW0A 2D3O1 2N4CA 1HKAA 1JQGA 3P45B 1RKIA 1IQTA 2R7SA 1B70B 5F41A 1UJ5A 5CABA 1RT5B 2NCKL 4NLUA 1CC8A 1FDBA 3DRPA 1H72C 1S6QA 1SIWB 3I82A 4FYWB 1VJWA 3GCWP 3VAKA 3N6MA 4A8OA 3QT8A 3MF5A 3KXDA 2PT0A 2FQQB 2AYBA 1X9MA 2BANA 3NL0A 3D7SB 2HNYB 2PSZA 2R4FA 1TKDA 1NK0A 4CLWA 3KG0A 2FHKA 4DV4F 4ZCMA 4DR4J 3B54A 2KRBA 1LEOA 4DV2F 1F9FA 3AOBA 5KG3A 3VQSA 4LF4F 3R5CA 1S1VA 1JLBA 1VRQC 1DLOA 3M8WA 4RUAA 2MKSA 2ZH9A 1FKOB 1WC6A 4IH6A 3EJMA 2GC8A 1IBKJ 3ZZRA 1U6FA 4DCOB 1KOHA 3BN4A 2AGOA 4IG3A 2FVSA 3VAMA 2HQFA 3EZ5A 3KNAA 3S7RA 1L3UA 4KSEB 3OBIA 4ZVTB 4B17A 1LW0B 1TKTB 2WSFC 1X4DA 1FFWB 4ZPVR 2MLZA 2M88A 1RHKB 2NXEA 3LH2S 1KHVA 1HNIA 4UOGA 2CKWA 4J9RA 3W2WA 5BXIA 3CNQP 2IPOB 2ZJPQ 2LU1A 2GQQA 5SZTA 3G96A 4Z37A 1RAGB 2DEIA 1VOMA 2HQ3A 3N9UC 1FRIA 2J7KA 1HIYA 1JLAB 2CPXA 5IT9U 3G2XA 3QRPA 4ZK7M 4I2PA 3K5OA 1TVRB 4KE5A 4C3MA 2Y0BB 3LO3A 4O3PA 5HJYA 4QR0A 1XNQF 2R8GA 4A8FA 2X1FA 3L9ZA 2AYMA 4WIQA 3G6ES 4DFKA 4OYOA 2UVRA 3GG1A 3HFZB 2G4BA 3DYAB 4GVLA 1Y5LB 2BKPA 1JLFA 2AMCB 5IQ6A 4X64F 1TUGB 3SDEB 4FNHA 4QIWD 2ZH1A 1Z2ZA 3TRGA 4OX8A 3H5UA 2LECA 3SXLA 1SBRA 2LQ5A 3VCDA 1JJHA 3HVTA 1EHWA 2H9ZA 4J9QA 2JL9A 4MK7A 4N77A 4DQSA 1KLMA 3NG8A 1ULRA 1R8PA 1SKWA 1GXLA 4LF6J 4IG3B 3HK2A 4USKA 1DURA 1BLUA 1C1CB 3A8KA 3OFGA 4TY8A 5LL6d 5KG0A 4DHVA 4Q8EA 1M5PC 2OPQA 3TJ9A 1HQUA 3GB0A 3DHXA 3JTNA 1O51A 3MMBA 2WBMA 2IBOA 3I96A 4TNOA 3UD5A 3UN2A 2ZVSA 2VQEF 2NUHA 2ZOMA 4DEZA 4F4AA 3HHNB 5KAKA 3DOLB 2OPPA 1XR5A 5EGYA 3OQ2A 2DR6A 2XCAA 1AUDA 2FY8A 2FJEB 1S6UA 4CLLA 4RZRA 2XTDA 3DGPB 1SC3B 5ETSA 3T9NA 4DI6A 5AJ3F 3CC2S 3TARA 3DRPB 5F9LA 1AZSB 2B51A 2BJ7A 2YNHB 4IQMA 4EI2A 5B0AA 4JI3F 3NAHA 2AW0A 5HMYA 3WC2A 2QLFB 1MROB 2LLZA 3R7SB 4F2SA 3IBCB 1R3NA 2POKA 5F3TA 4X62J 2KI2A 2XBPA 4KJIA 4RL1A 5I42A 2RAQA 2HS4A 4P2FA 1IKVA 2CPJA 2QGFB 1TMJA 4FYYB 4ZVEA 1PG5B 2HHXA 3SEOA 1CJVA 3I55S 4O4RA 1UKUA 3J7AN 3LOUA 2K7KA 4OX6A 1IBKF 1IR1A 3Q24A 5D4PA 3PO5A 4GKJJ 3TVYA 3MD1A 2XCPA 1FE4A 1UEKA 3IRWP 1VQPS 4OYWA 2AJQA 2GVDB 1U1LA 4YDDB 1VK8A 3TQ1A 3FQLA 1SH3A 3QGGA 5D78A 1X31C 3QRQA 5IS2A 1FWLA 4GKKF 5HBMA 1RT4A 4URSA 3RB4A 2FVRA 5M2PA 2V69A 3AFGA 2FYXA 2A18A 1HFEL 2KHCA 1R0BG 2VFUA 4ZVUB 2IC3A 1RAFB 3GSDA 4MFBA 5DM6Q 1HBOA 4M5HA 4I2QA 1XR7A 3BBFA 1RAHB 3H90A 3N5BA 4LRBA 3D6MB 4ZVFA 3TZZA 3JSMA 5L1IA 4ER8A 2PN6A 2Z8QA 4LRAA 3HI9A 2QC3A 4MKBA 5HQMA 1VQNS 2DGUA 1FD2A 4O44B 4USUA 1Q8BA 2MJNA 4IFVA 4K2XA 1RT1A 3A8JA 4NCAA 1TL3A 3OXGA 4X4OA 2C2NA 3M8QB 4O3NA 3POTA 3DNCA 4A8SA 2OHDA 1VIOA 1HBMA 1SH0A 4EGLA 4TQSA 3D2WA 4WYLA 1NPRA 4Y00A 3J7ZT 2J8AA 1X5OA 2Q3PA 1SJRA 3I5BA 1IKWA 3MPDA 1NKCA 4EO8A 2ZC4A 1CQNA 3PIOQ 2VIHA 1H38A 3R7BB 2NQPA 3QT6A 1VQOS 3BYRA 4WE1A 3OL8A 4YP3A 4CYUB 3BH7B 3OTBA 1U8SA 3DOKA 3DLJA 2GV1A 3FK4A 3AB2B 3R27A 3TYTA 2OFHX 1RKJA 3BSOA 4IRKA 2BVZA 4I7FB 5DG8A 2NSCA 2OELA 1O6XA 4F50A 2NR0A 4K4VA 2DB1A 3AA8A 1K44A 4DR3J 5I4MA 3DKDA 3NMAA 3CPWR 2A1BA 3F56A 3AQPA 1GQEA 1YJUA 3QT5A 5H9FJ 2FB0A 5K8MA 2KT3A 3GILA 3ZNJ1 1UEUA 2WSEC 4FXDA 3HHLB 2R2TA 3SV4A 3JQMA 2JNJA 2VPXB 3KJFB 3AHPA 4OYXA 4V19X 1WHWA 3K8VA 4NLTA 2DGOA 2FHJD 3N79A 4KO0A 1OSDA 5KTQA 1SPBP 4H4KC 1HPZB 4WP9A 2M8HA 1NB2A 3LWMA 2GGPB 2BXJA 2GW8A 3DMJA 3KLIA 2XY6A 1Y00A 3M8SA 1FERA 5E7OB 1RU2A 5A6WA 3HLUA 4MKVA 1DBDA 3BSNA 1PJ5A 3F44A 2KZZA 1Q5YA 2B4UA 4WE1B 4KPYA 1IQZA 1KEKA 3EVOA 3JTOA 2ZJRQ 1FRKA 2R7WA 3C15B 3UI3A 2NLWA 2KT2A 4YB6A 1GT8A 2VU5A 3C8YA 3KLFB 1DJ0A 4JI0F 2P9EA 2C2OB 2VJVA 4NYPA 4ZLJA 3U7JA 3LTOA 5CYQA 1PGZA 2IMWP 4C8KA 1IUJA 1JLQA 3B78A 1EQ0A 1Q5VA 2CPFA 4G3IA 2J7UA 1JMTA 3IAS9 1SL2A 4X4NA 1RBOB 2HBYB 3AT1B 1WEZA 5FDLB 1VQSA 4MYTA 2E5LJ 5DZ7A 2ZHBA 3GIIA 2W4PA 1IKYA 3E2EA 2QSWA 3EZOA 3FSXA 3GU0A 3NEKA 2CPEA 1PC5A 2V8PA 2ADBA 4B9VA 2N7CA 2XTEA 1OIAA 2EWHA 3B4MA 1OWXA 3DDIA 1SC1B 3KUGA 5B08A 3H40A 2D1CA 4NLWA 2KTQA 3U02A 1T95A 2AKWB 2XO7A 2R8KA 2YKNA 2RB7A 1A7GE 2CPDA 2QO3A 3LGHA 1TUWA 3MMAA 4MYUA 3CCMS 4P2MA 1R8HA 1HNXJ 3DLEB 3IC1A 3HULA 3JTPA 4O23A 5HJXA 2MKKA 1HNVB 4OHYA 2W2QP 4DUYJ 3HP6A 2JEJA 1B0TA 4M63A 4ID8A 5C42B 4ZCKA 3KLHB 3S01A 1RGVA 1VMBA 3SCKE 4ED4A 2R2SA 2XZ2A 1OQ3A 2GVDA 2C3YA 3TUJC 5KT3A 1FJCA 5C5JA 3WQPA 4ECUA 4DQQA 3R97A 4MIWA 5KFLA 4JI4J 3M8ZA 1U8WA 3D5MA 3PCOB 1FKPA 3NNHA 2QT7A 1ZAWA 1IJFB 2P9GA 4DR3F 3PYGA 1YJ7A 4F7VA 2R8HA 1EAYC 4YR0A 1CJVB 8RUCA 4ZPAA 2HS3A 1AA1B 2CQCA 2B6AB 3Q8YA 4NA1A 3C6UB 4OJGA 2QV6A 4DR7J 1QY7A 2HAIA 3BZQA 4FKXA 2CWXA 3ZFVA 2BEFA 2CQ0A 1SJ3P 2YVSA 2IDEA 3VTIA 2UUTA 3D3CJ 1RWXB 3D6HB 3HSZA 3PG9A 4JOUA 4E98A 2VBZA 2EKNA 2XC9A 1GMWD 1NMEB 3N4WA 2RDJA 1V3RA 2HHVA 4CO4A 1RJJA 4HR2A 4LUBA 1KFDA 1Q7YT 1D9DA 2LP4A 1WWHA 3PX6A 4RBUA 4CCHA 2AV5A 1KVJA 2PFFB 3MCNA 1YQHA 2Y1RI 4FVCA 3WZ0A 3MEEA 2LXFA 4LBPA 1YRUA 2N3LA 3VZHA 1QAYA 2EC0A 3CJKA 4DS4A 3TVZA 3UD4P 5EX0A 1U1KA 1M1KT 4IOAQ 9RUBA 2W4DA 4EK2A 2AJFE 2YKQA 1FT8A 3M8QA 3W65A 1LW2B 1N8RT 1D9FA 2AD9A 1HHTP 2DNPA 4UW2A 3WBZA 9ATCB 1ZPWX 3SQOP 1N88A 1TL7B 1R89A 2DRDA 2HHPA 3MCSA 4MIAA 2QMUB 1RBAA 4H54A 3NCPA 4I6AA 4IH7A 2UUWA 4LFBF 2BOPA 3JSMB 2VPWB 3M05A 3QO9B 2H4WB 3KLGB 3KHGA 5KFMA 5HROB 4HI2A 2OTLS 3PW5A 3MAAA 2RRNA 4QIGA 2L3MA 4JP8A 5KFAA 2KHDA 3W8PA 5ADZA 1RAOA 4RW6B 5KFFA 1SC6A 5J2PB 2EKYA 3HFVA 1EB0A 2P6TA 3FZBA 3EZUA 1VRUB 4FXWA 1TFWA 3IO1A 1PJ7A 2Q43A 1WC3A 1K9MT 2DR8A 3TA2A 5ETOA 4Y3CA 5M2RA 4ERDA 3T41A 5DG7A 5K8PA 1YGYA 3FBFA 2V2VA 1PILA 1BQNA 2LXIA 1RWWB 3HT0A 1M5OC 5EX3A 3VV2B 2HVHA 2O66A 1V6HA 1TELA 4YY3F 2NZ4A 3K5NA 4O0NA 5HO4A 4ENOA 3ZZYA 1OSCA 2P5VA 3M8RA 4I0WA 5K5MA 3W5YA 4J9PA 4DR2F 1YI2S 2KFNA 5F8HA 2RT3A 3JXOA 1N36J 5CZVA 1WKJA 4PUOA 4ILRA 4KY3A 2RHQB 2GJ2A 1S1WB 2DH8A 1OMSA 2VOOA 1RADB 4OLPA 4PXEA 2XNRA 3P3DA 5ETKA 2HWIA 1E6YB 1S1VB 1WKKA 3JSBA 4ZVSB 2DY9A 3K5LA 2OI2A 2YX7A 1RA6A 3KWMA 3T5LA 4F4KA 1K8AT 1N32F 1G7CB 1R6VA 3UVJA 3G71S 4HLBA 5L38A 3M4XA 5J2QA 1BD6A 4ATNA 4F36A 4ZLPA 3FSIA 2OPPB 1DAXA 2OSRA 4W90B 3UCZP 3PKMA 1R0AB 2ADCA 4PXDA 3VGSA 4DV3J 2I8EA 1XBWA 1S6PA 2KO1A 3J81j 5IV3A 1ZZFA 3HVAA 3LPYA 2OSQA 3MD3A 2FJVA 3TX8A 2YWHA 3LANA 2ZWPA 1HQUB 3NMRA 3AD7C 2EK1A 3FC9A 4QR1A 1C1CA 2XZDB 1U7LA 1UEVA 3FEXB 4PAAA 4U7UK 1SXLA 4ZN1A 3NOCA 3EMTA 3KK2A 4KH0B 1NJXA 2VA3A 2IFXA 2UVVA 1UZDA 2BUNA 1Y5IB 3HVTB 1WF1A 3FBCA 2CWKA 4LQ3A 4C0HA 1A0OB 3HPOA 1OYEA 2R7QA 4X66F 2BACA 4M5GA 2GVZB 2HSEB 4QYZK 5A8KA 3UDCA 5CXTA 4GKKJ 2MLXA 1A6LA 2NXUA 4M5NA 5E3QA 3Q8PB 2R7XA 5ETNA 2D3OR 1HWLA 1HNWJ 2QX0A 2FLOA 4NA3A 4L3KA 2AJ0A 1U47A 3OFEA 2CQGA 3LPEA 3W7BA 2VPYB 2RJZA 5I3UB 1RTDA 2LCWA 1R7IA 3B4DA 2GS8A 1TVRA 4CT8A 1N54B 2M3DA 3FDSA 4NEYA 3VR1A 1Q86T 1FJ7A 3EUNA 3GPAA 2M0GB 1D8YA 4Y2AA 2WAQD 2D41A 2DNLA 1SL1A 1MG7A 1BXNA 1Y4ZB 4OJHA 1RHUB 5KFOA 4OI3A 1HBNB 2HHWA 4AD6A 2CPYA 2YWKA 4WWSA 2GVZA 2MJUA 4JYAF 1FDNA 2ERRA 4ZS6A 5B0FA 2QG9B 5KFKA 1LW0A 1ZA1B 4CO0A 4LF5F 1LK7A 4LFAF 1GTHA 1QTNB 1R6YA 1WG4A 2R9LA 1XMQF 2IJFA 1SJ1A 4CRJA 1U49A 3MEGB 2FGOA 1D09B 7FDRA 4M5LA 5GAHU 1WTFA 3VAJA 4MJKA 3DHWC 3PXGa 2W7PA 1RT2A 3QLHB 4NE9C 2KM8B 3FKBA 3RZAA 1N34F 1FJEB 1FKAF 2BYCA 2OP5A 2XYPB 1FTRA 1GMUA 5BR8J 5GAGI 1MSWD 3KHHA 1DLOB 2CQPA 1JLBB 3QIPB 2VPZB 4X4UA 1CJKB 2YKMB 2FHJA 3EVWA 2F8MA 2JLEA 2UV8G 3W2VA 4QWEA 3ELHA 2ZH2A 2ZJQQ 2OPRA 4B3TF 2HNYA 3M2RA 4ZHRB 2XS5A 1X7VA 2BANB 1S79A 1V9OA 1CQMA 4DL2A 2UUAF 3ILOA 2ZEJA 1RTJB 4RW9B 3D67A 2XS2A 1YITS 5EWEA 1FRMA 3W63A 3PO4A 2KFZA 1RWVB 2D9OA 3FQKA 1LWCB 1RT5A 1KRPA 5CH7B 5CA5A 2YH1A 3K17A 3RAQA 1X4HA 3DLHA 3UQSA 1BGXT 4RLEA 2I9SA 1TKZA 1T9VA 5HQ8A 3NGDA 1YHQS 1AFIA 1GXTA 1KFSA 4O3QA 2UU9J 1JLCB 3NS6A 4FS2A 3CULA 1D0EA 2AT1B 2E7XA 1B3TA 2XZTB 5DG9A 4IYQA 3MR5A 5HP1B 4BS2A 1RWKB 4XDCA 4USVA 2VASA 4HI1A 4ZIVA 3FCVA 1C2PA 2W9AA 2BQ3A 1RT7A 1S9EA 2IY5B 2W4CA 4OZJA 2KRRA 3HCXA 2N4DA 5JMNA 2CADA 4XDDA 1GTEA 2A6OA 1RU1A 2W7AA 2HVIA 5LXRA 5B0EA 1P1LA 2WVCA 3ULHA 4QWAA 1Q0NA 2MHEA 1CJUB 2PEBA 3DLGA 2XWXA 4EZ6A 1NLKL 3T1YF 1SJQA 1S12A 4DV0F 1DQ9A 2GIQA 2QJ3A 4KRWA 3MAAB 3FNNA 3UWTA 3KK3B 3MMCA 3CCZA 4TYBA 3BR9A 4A8MP 4Y34A 1TQLA 1JNZB 5KT2A 1VC5A 2HNZA 3WHIA 3JB9k 1NSPA 2HG4A 1X4AA 2L08A 3KJNB 4DV6J 4K4UA 3GCXP 2V4JB 2Y1JA 2MQ8A 2VB6A 1MU2B 1YDLA 4C8NA 1S0NA 3H25A 3A4TA 3ZTOA 1L3TA 3NY0A 4R5PA 2GAHC 5EHHA 2BOAA 3BO2A 3SI8A 4B9UA 3MM9A 1N33F 1RACB 3GV7B 3KHRA 2OEJA 1WELA 4NCGA 1VBZA 3KK1B 3M2VB 3IM8A 4LF5J 1VC0A 1DTTB 3MEEB 1FNXH 4LF6F 1LWFB 4O3OA 1QDUB 2YWWA 1H6KX 1VJQA 3PIPQ 4DFJA 1JLGA 3W5ZA 1N6QA 1NKBA 4B9SA 4K4YA 2DXEA 4W92B 2HWHA 1CS4A 1UW4A 2JDJA 1C0UA 2Z57B 5LSLA 5ETRA 3W8GA 3PY8A 1S49A 3PACA 1B64A 3JAMU 3OV7A 1URRA 2VG7A 3A8EA 2Y1IA 2C3MA 2XTCA 3GONA 2DY1A 4ZPWR 3DU6A 1UWAA 4CT9A 1SC4B 2K3KA 5L9XA 3SQGA 2Z0GA 3PEJA 1P1TA 4NEZA 4P10A 2YQ0A 4NLXA 2RILA 3C6UA 4B02A 3SV3A 3QT7A 4NLSA 4LSNB 4NLGA 1S6OA 1RT6A 3NGRA 1FVSA 3H98A 3I87A 5KFJA 4I4BA 4NASA 2W2PP 4DSKA 4F4WA 2X7IA 1NK8A 1HW8A 1Q4RA 2DIUA 2Q6CA 1W25A 4KHRA 2YX4A 5LMUJ 4DCJB 2YY3A 1DFDA 2LU2A 3PRDA 4KGKA 2AX1A 2G0CA 3R9LA 2V8GA 2L9DA 4RNNA 2LEBA 2RKIA 3PEHA 4OV6A 4RKUC 2HGNA 2ZVIA 2W7OA 1XNRF 4QJVA 2M2BA 5D0HA 1AUSL 4IG0B 3KJVA 5HLFA 3LQVA 2MZJA 1FK9A 2XSFA 2C2ZB 3E01A 1UETA 4LIRA 2QLBB 2EFNA 5THWA 1FF2A 3UDEA 2KXFA 3VAHA 1TP7A 1JX4A 2JZ5A 2HMIB 2EK6A 3PRVA 3V81A 5H9EK 4R25A 5LXYA 1TK0A 2H51B 3MECB 4LF8J 2JRSA 3HHDA 3N0VA 2QYCA 1KD1T 2P9CA 4DG1B 2D7SA 3GJTB 3CIZA 3MPWA 1IM4A 1KONA 3OTDA 2YKPA 4KH1B 1U1QA 2D68A 2C3OA 3VHQA 2F63A 3V6DB 3I0SB 4I6WA 4IDKB 5DLFA 5C25B 1UVIA 4DSJA 3CJ2A 2EBGA 1WC0A 3QAUA 3THPA 2ZD1A 5FLXU 4NLOA 3GG0A 4YB7A 3CDAA 3BO4A 2V94A 4NI2A 2VJUA 3NKYA 4ES2A 4UZCA 2MY7A 2XMWA 1HHSA 2D69A 1UPPA 1OO0B 3GR0A 1LK5A 1LWEB 2MXYA 1W7WA 1N52B 1F9EB 1TL5A 2ALYB 3E8OA 4DR1J 2CYYA 5AXLA 4A46A 3HSJA 5CQGA 1NBEB 1Q95G 3I5AA 3RJMB 4CI0B 4ZJQA 4QPTA 4DL0C 3FEZA 4E2FB 1MW7A 4JV2A 3K5MA 2DNYA 3MM6B 2NPFA 4NLVA 6FD1A 2UUCF 1TV6B 5DDRC 4X4SA 3QSIA 4MK8A 4WFBQ 3RB3A 1X8DA 1S4EA 2E5JA 5F8MA 2ZC3A 3HD2A 3EICA 3RU0A 3UPFA 2KT5A 2V68A 4KBIA 3CDEA 4JV5F 1XMBA 2CAJA 4WKYA 4O4GB 1H0HB 4O0IA 4DL3A 4YHHF 1RTIA 2GHPA 1HPZA 5FIIA 5HI7A 2ZE2B 3AOCA 3LP0B 4WTYA 4DR2J 1QE1B 1ZBTA 1M0SA 4KAIA 3WIVA 3JAMY 1HD1A 4JYAJ 4WJBA 2MY8A 3HHLA 4MK9A 4TYAA 2V1SA 2K1RA 4KGVB 5E3AA 3LWLA 2HFSA 1REVB 2HQDA 4G1PA 1U1MA 1K0VA 1XK8A 2PI4A 1UMJA 4B08A 4FYXB 4X65F 2RS2A 1VQ4S 2AZ3A 2N82B 3OL9A 1J5OA 1IWAA 4CNZA 1TKXA 2AJ1A 3U1MA 2WVBA 1HR0J 1DQAA 2EPIA 2UXCF 2QLJB 1WORA 1DTQA 3WX4A 1AXQA 3MEDA 5F9NA 2IBKA 1OQ6A 2Y9HA 2E9TA 1C0TA 4I7FA 3HMJG 1OPZA 2FPHX 4F3QA 4EUVA 2VD3A 3VF0B 4TVAB 2ZUGA 2ZBIA 3TO8A 2XLIA 1S1UB 3U1LA 3AH6A 3CO9A 4LFCF 1KTQA 1O5JA 5E3CA 5KG5A 4B3MF 3GYNA 2QFIA 3TAQA 2GCFA 4HDHA 4CM0A 1WF2A 3IRXB 1LXJA 3NGKA 1VR6A 1HQ2A 4Y6IA 4EWTA 3FFIB 2XTJP 3AX5A 1K1SA 2QIFA 4J9NA 2XY7A 2B8QA 3VAGA 3MWBA 5AJ3J 4LF9F 3E01B 1HBMB 1UUJA 1ZETA 1DZ5A 1V3SA 1HQEA 3DLBA 3NBPB 3W9IA 2JFKA 4OZ1A 2DGSA 1UA0A 2FZGB 1ZYQA 2F4VF 4PWUA 3L7PA 4FKYA 4EBCA 3CC4S 1QAJA 4DQIA 4O44A 1T9YA 3NGTA 4H4MB 2ILZA 2X1BA 4FYVB 4BC9A 5D4OA 5T41A 2PA3A 5BYRA 1ZTWA 1VS3A 2HVDA 3AD8C 3CJTA 4TN2A 4DUZF 4ZVRB 3Q8SB 3I6PA 2FLNA 4TKTA 4RNHA 1KLNA 3W61A 4I2QB 5GMDA 4LSNA 4RW4A 2FLLA 4PRFA 2F4FA 2MHNA 4AL7A 4C4WA 1N5TA 1UL3A 2IC3B 3NRBA 5T14A 3MR6A 1GMVA 1N0UA 2DK2A 4LVOP 1FDDA 1T03A 2O01C 1UVLA 2AHOB 3PFEA 2BKOA 4DF8A 2VL1A 2WRMA 4U96A 3J81Y 2MGZB 2W9CB 3V4IA 2FC8A 4P52A 3VGUA 4X4TA 4YR2A 4G1QB 5HBMB 3IBFB 5DETA 2UUCJ 2E9ZA 2B5JA 4FP9A 2ROGA 1HMVA 5J1NA 3CJ5A 5D0GA 1WEXA 4I6YA 2JFDA 1YBTA 2VBWA 2JOQA 1TL1B 4RUBA 4WU3A 6AT1B 1IBLF 4KFBA 3J7A1 3VVTA 4RR5A 4OYAA 2C1EB 3C16B 4OZ0A 3T5HA 1HNXF 2E1CA 1WG5A 4H4OB 2DO0A 1R31A 5C24A 1U4BA 1M90T 3ZZOA 1CEZA 2EG2A 2W01A 4JUZA 1YJNS 1SVDA 1R8CA 3LP2A 3NXZA 5A8WB 5GVQA 2ROPA 3LP1B 4TLRA 3EXYA 2XY5A 2EFQA 4KHPF 3Q8UA 4DZ6A 4ANDA 4F0KA 3RRKA 5IZHA 1MWYA 1X4CA 3PDNA 3M1VB 4J7CA 1R0CB 3T19A 1Y5NB 3MM7B 1NUEA 3IFEA 3IM9A 1H74A 4B3SF 1WSVA 2CUYA 4C3LA 3KLEB 1WC5A 4ZIWA 3MMCB 2CVIA 3T6JA 4K0KJ 4I68A 2Q79A 4ANEA 2DGXA 1I94F 1FXRA 1IJEB 2CQ1A 1AW0A 2Z4PA 4KPCA 4MAKA 2W24A 1HWUA 3V4MA 3CEDA 4OHXA 3W3SA 3KMSA 4J9KA 3B6BA 3J80Y 4QIEA 3OJSA 3NAIA 5ETPA 3EE3A 5HMXA 2DNZA 3IS9A 5GAEI 3G6XA 2IAJB 2CNLB 3B82A 2XMVA 3DRSA 3TAPA 2R3VA 4C11B 5K8OA 3EX7B 4ZJLA 3D0HE 4LSLB 5AE3A 3GIJA 1S4FA 1T3NA 3DFEA 3RB0A 2L9NA 2XS7A 4CO5A 4ECWA 3PJ9A 2DGWA 3UR3C 3QSYB 4ZVGA 5DGBA 1YSJA 3M32A 3CCVS 3TA1A 1PIEA 4ECXA 4HHJA 3U27A 2BQRA 1EIYB 4NZ6A 1XERA 4B9MA 4B3RJ 2HFVA 2QL7B 1NK9A 2CZ9A 3K8WA 3FGVA 4OX9F 1SKRA 3BSAA 2DYAA 2DNNA 2JC1A 2K3IA 3UN3A 4UOHA 2IIHA 2VG6A 4NZ0A 3KHLA 2KDOA 3MM8B 5BJRA 4DSIA 1GK8A 2HRUA 2UXDJ 1JKHB 2IVMA 4S0MA 2V8HA 4RW9A 3AWRA 3OR1A 3R7NB 2HLUA 8AT1B 3J81U 4CTAB 1AT1B 3BREA 4DU8A 1IBMF 4QYZJ 3CD6S 2MTLA 2E5HA 2ABYA 3VQTA 4ES1A 2DO4A 5HK4A 2CJ9A 2ZZNA 2XM3A 2HZAA 2RU9A 2YKMA 4NLRA 2M70A 1NDKA 4HYKA 3QIPA 3NCQA 4U95A 2IA6A 1M5VC 1RWMB 1KKHA 2RMLA 2ROEA 3QYYA 1J5EJ 2MKCA 2ATLA 5GAGU 1MLAA 3C19A 4OIXA 2UZAA 2ZWOA 2H48B 5GAHI 3W9JA 2FJBB 2KYZA 4PKDB 3ITHB 1S0OA 4DU7A 4R0EA 2GFFA 4M94A 2RHSB 2KU7A 2CNOB 2PMHA 2L48A 2HLTA 1RWPB 4ED2A 2PIIA 4G6VB 4LREA 4DUTA 5CD4H 2A0FB 4WZQA 2RU3A 3CCES 3MI7X 3V6HA 4WP8A 3TAMA 2HZVA 3SFUA 4K4XA 5DJBA 3ZZTA 3CMES 2DCUB 2A10A 4PXBA 2DHXA 4P6QA 1KQGB 1IKXB 3LGMA 5U47A 1WHXA 1T3OA 4FBTA 2YNGB 5J1EB 2H5JB 4ZMMA 1RLCL 4P7TA 1Q82T 2EFOA 1WNEA 3CT9A 3RBDA 2DJWA 4J5OA 4P72A 2DGVA 3UCGA 2E5GA 1T9WA 4EMDA 5CCMA 1B0PA 3EVMA 4X4QA 2DR9A 2ZUAA 3V2UC 2FJAB 2JEFA 3R6LB 4ELTA 1XNRJ 1P9QC 3DOMB 4DCPB 4Q0BA 3PX0A 1CPZA 2J76E 1OS5A 3R6GB 4HTJA 4DL7A 5DO2A 2BM1A 2X1GA 3EGZA 2GZOA 3LGNA 5A0YB 1FJGF 1UZHA 5D4NA 2PMZD 4X4RA 3O3LA 2KH9A 1XMOJ 3G9CA 3VVUA 2OEMA 4C11A 2MPUA 2NYIA 2PA8D 4HH1A 2WB4A 1LXNA 3I0RB 3IA0A 1RWOB 2RQCA 3CMAS 4OYIA 4AUKA 4FF3A 2GIRA 2ATCB 2C3PA 2IA0A 3DXSX 1S6PB 3ZTRA 3CCSS 2HEKA 4UZBA 1JJ2R 1UA1A 2CNNB 2WVFA 2HK2A 2DD8S 1VBKA 3A1YG 5D0RA 3OSNA 2M8DB 1RBLA 2IMOA 2WZ1A 3TQEA 4YB1P 1E6VA 5DLGA 4OX9J 5J2QB 2CJXB 1IR2A 3FZ2A 5LJ3Y 1B7FA 5KT4A 1ZAXA 3NWRA 4DWIA 3NCRA 1J5EF 4JI0J 1FX4A 3QJLA 2VG5A 3BBCA 2UP1A 5KFHA 2BA9A 2G2OA 3HSDA 2K06A 4JI1F 1WDTA 1HBUB 3FMBA 3MFIA 1XC9A 3TI0A 2CXEA 3IR6B 3TZYA 1T05A 4M5DB 1U1NA 2CRLA 5CHCB 4ID5A 2J9CA 3UCUP 1NJZA 1CLFA 3H5XA 3H5YA 4R0JA 4DL4A 4BWMA 2X3DA 1SI9A 1UTAA 2NS1B 2WVEA 1X5PA 1S1TA 1WG1A 1SUQB 4NLYA 2J5AA 2U1AA 1NAQA 1YTYA 3BGUA 4KYZA 5DS7A 4NRTA 4FN5A 5KFCA 1ACMB 4C48A 4YR3A 3PYEA 1XQIA 1JNRB 2YWFA 5BR8F 3KLVA 1HMVB 2B0GA 2COLA 2HS0A 2NPIA 1U0HB 2Z56B 4YHHJ 2R2UA 3N6LA 5AT1B 2IM2A 5IT4A 1FCAA 1T9UA 1RAAB 1W2IA 4C8ZA 1VRUA 3Q89A 3GV5B 4DLEA 3GLJA 4H4KA 2IRXA 2E7VA 4KGMA 5HATA 2HIYA 4CQ1A 1VLOA 4NA2A 1VQ8S 4RW8A 2DVIA 5JJBA 3D9BA 1KP6A 2V4QA 1FRHA 2HFOA 2FD2A 2OD6A 2W2NP 1FA0A 3IGVA 1HWKA 3M7VA 1FEEA 1N0VC 3FJ2A 4ICLB 2CZ4A 1RT3A 2HBZB 2NUUG 2MKHA 3A3OB 4C0BA 2W9BA 4DSLA 4LBHA 4LSLA 7FD1A 4GVBA 3CCJS 4OZ5A 2CG4A 1GMWA 1X5SA 3PJXA 1GFWB 2MQQA 2GHWA 3G4SS 1QLNA 4NLQA 2IAJA 1RQ0A 3IWLA 4RBTA 1B99A 5KT6A 1H2TZ 3IS9B 3PV8A 1SQEA 2UU9F 3GFYA 3N28A 4ZVOB 1CULB 4ETXA 4IQXA 4UY85 2GAGC 2Z2MA 2J6UA 2V6AA 4R8UA 3OR2A 2KG1A 3IR5B 1VHFA 5KFWA 3JYTB 3PYDA 3U1NA 3BGRA 3H7HB 4ZP7A 3MDFA 3IRXA 2MLYA 4OHVA 2HZCA 5HVFA 2JEIA 2BE9B 2F7VA 2ZDOA 4P71A 4UOFA 2XMMA 1Q8KA 3AJ2A 3AOAA 5KG4A 4AYBD 2YPZA 1VBXA 3EGVA 3CJ8A 2ASYA 4KQZA 1T9TA 3TNVA 1N32J 5D8HB 3RR8A 5KG6A 3TEHB 3FCWA 2FLPA 5I3PA 3OVAA 4FPRA 5LSRA 2EFVA 5DQIA 1WOSA 4C8MA 2F9JA 2XSJB 3CCQS 2UVWA 2H65B 3ILLA 3T1YJ 3WX8A 3AXMA 5M2UA 1JK9B 2GA7A 5EUHA 2FHMA 3GSIA 1NKEA 2B6AA 1J5OB 1ZZNA 1C4AA 1YJVA 2WCXA 5L46A 4F0MA 1Q8IA 3KDOA 5AE1A 3F41A 3S6EA 3GIMA 4K4ZA 3KFWX 5LSOA 4J9SA 2AGPA 4H4OA 2FVPA 4YOEA 1WACA 5JXSA 4LRFA 1FKPB 5GADI 3CJQA 4DV6F 4OYPA 4XPCA 4JV0A 4WZMA 2ZH6A 8ATCB 2ZH4A 1S99A 4RU2A 2L9WA 3O5TB 5LM7E 3T3FA 4C6AA 1NZAA 2HHQA 3QGHA 1HNVA 2WOMB 2Z30B 1WC1A 3OLAA 3FSYA 3N01A 1KDNA 2HGMA 3DLEA 5IV4A 5KOWA 2XMUA 1QSLA 4IOBA 4RUCA 5D3GB 1N56A 1IBLJ 1KN6A 4DDFA 2UUBF 2PC6A 4ZVQB 3M8PB 5J2NB 2WOMA 2R7TA 4V1Ak 2FHOB 2QL5B 2HHHF 3OTOJ 4NLDA 3PX4A 3KJQB 2BW7A 3QGPA 3OVSA 3BKTA 3MR7A 3I31A 3TVKA 1N5YA 2RQ4A 1Z2LA 1VLYA 1J27A 4P9SA 4E8UA 3OD2A 2XZWA 4LJMA 5KFTA 1NSAA 3BBBA 4P75A 3OL6A 4H4MA 5KFSA 4DBQA 4QBUA 3M6WA 2YX1A 3CE8A 3DLKA 3T9ZA 3US5A 4ZCIA 2BJ3A 2MYFA 2KN4A 2V9WA 2Q66A 4M5KA 4WIIA 2E29A 5CYQB 2WTFA 4MKAA 1FHTA 2BJ8A 5HAOA 1TL4A 1U6ZA 3PVXA 2W8KA 1BY9A 2JLGA 4UF4A 4ZOSA 1IR0A 2ZM6J 2LEAA 1Z4UA 3BS9A 3H2VE 2VH7A 5FD1A 2XEXA 2YQ1A 2DNQA 2X3GA 2E7WA 4CH7A 3D66A 4EBDA 4ECRA 1F2HA 2EC2A 2EG1A 1FVQA 2YNFB 3GE9A 3GJRB 1F60B 4F3MA 4QWCA 1S9GB 4IDKA 5L8RC 2DHSA 4DUYF 1REGX 3CJ3A 3V5RA 1FFSB 1AB8A 1S1UA 4OMFG 4PQUB 4PXCA 2MMYA 4UUWA 2WW8A 2MQNA 4YB5A 2LKZA 1MWQA 1D9AA 1GEHA 1PAUB 2V2KA 2VFVA 1FEHA 4PCQA 4BLGA 4IO1A 4DV5F 3MEDB 4C0OC 1DTQB 2R7VA 3J80U 1B0VA 4KC5A 3TX0A 3JQJA 5LMNF 3OR2B 2DHAA 1TKXB 3LAKA 2CG8A 4N8NA 5E41A 1P27B 1CULA 2CJQA 3DXBA 5D6GA 4IG0A 3CD7A 3SSQA 3EPGA 3M9MB 2J9DE 2MDAA 3NS5A 1X0PA 2K8GA 3OFHA 3RTVA 2K1RB 1Q16B 2AIRB 4Q5VA 2B9XA 1HNZJ 4JI8J 1S77D 5F0WA 1HNWF 4GVBB 2IRUA 4DSFA 1QE1A 2DR7A 1SL0A 2HFZA 2ZE2A 2MKIA 1RAIB 1RT6B 1VI7A 1AROP 2DHGA 1IN0A 1YBUA 2G0JA 2XYHB 2ZOFA 3DC2A 4AE5A 3QWUA 3D1HA 2IYIA 3E51A 4YQWA 1C4CA 2VC1A 1JB0C 1W2BR 3NP5A 2FJWA 1RTHA 4ITSA 4NOHA 5L1JA 2LQ8A 5D3GA 4KTQA 3HVWA 3IBWA 3I56S 4RWWA 4C2MA 1KOOA 3DOKB 3HVRA 4DV1J 1LWXA 3D0IE 2XULA 3C66A 2XI3A 3H8YA 4TLQA 5IM0A 4DX5A 1VQKS 1EARA 4LFAJ 1LKZA 3MM6A 2MEWA 1S57A 3ZTSA 3GYXB 4UOCA 4RNMA 2CJKA 2ACMA 5HMWA 1IKWB 4J9LA 1RP5A 5ITHA 1DTTA 3EXCX 1VGYA 3M2VA 2A2CA 3ZZZA 3M6VA 1R8AA 2B9WA 3P6YC 4PG4A 4MMOA 4DV7F 1ZOTA 4I69A 5AXKA 3X3UA 4HACA 1RHJB 4B3TJ 3J7YI 2RUGA 2AZ1A 2YNIB 5GMEA 4ECYA 4IKAA 1MU2A 5GAEU 4C8YA 2ZD1B 2ZH5A 2NXCA 4J9MA 1T05B 2J7WA 2CA9A 4JI4F 4Y65A 1KC8T 3GFZA 3KKFA 2I5JA 3MM5B 4AXJA 5C25A 2PGCA 2EXUA 3DRYA 1JIHA 4QZVB 2OLWA 1UJ4A 2KL8A 4M8LA 3TWZA 4FVMA 3FRYA 3VGVA 3HT3A 4JI7J 4RJVA 1U1OA 2GJFA 1YIJS 2DTJA 1YRTA 2ZM6F 1VBYA 3PHTA 3R5JB 1WI6A 2G0IA 2J0WA 4Q8FA 2OFGX 4URQU 1O8BA 3JYTA 2EVZA 4FNIA 2VA2A 2B56A 2DBBA 3I9V9 5HLFB 4ZPDA 1XWLA 3T5KA 1SKSA 2GX8A 4TU8A 2B8PA 4OV1A 1IXKA 2HRTA 1C1BB 4KKOA 2B7CB 1K0TA 1VK3A 1S7IA 4UY8T 3SMZA 2HFUA 4BHQA 4OZLA 3M30B 3TA0A 1SV5B 3ISND 4ZITA 3GR1A 2ZZMA 4AFFA 2OD4A 2D3UA 2IHR1 1HHQA 3RAXA 4JB8B 1RI7A 1PC4A 3CWJA 3G6YA 2IJNA 2OPSB 4Z7YA 5E3RA 1KR4A 3AX3A 1U0SA 3DI6A 2FC9A 4RW8B 2R7OA 2HPUA 5I42B 2DISA 2B4VA 4ZP6A 1NDCA 3HSGA 2EEYA 4ZJOA 4IFYA 1NDPA 1TKZB 1Y10A 4WPAA 4DX7A 1KS2A 1IM6A 2DNMA 2QA4G 2FVQA 1V5VA 1LFWA 4DQRA 3CC7S 1PJ6A 2DGQA 1NK6A 2RDIA 4NLPA 4DV4J 2AQ4A 3CCTA 1LWCA 1RYRA 3MR2A 1UAWA 3H0PA 3PHEA 4B9NA 1CS4B 1SIZA 4F02A 4WFZA 1U0HA 4WFYA 1F0XA 1SQGA 4RWXA 3TAMB 3H2UB 4DPOA 5IWAF 2XO6A 1T8EA 5HN0A 3IN5A 4YS2A 1T02A 5B7WA 1N5SA 1URNA 2HFNA 5B0GA 2CPIA 2CZVC 4CLFA 4OZ3A 2XQCA 1H7WA 1VFJA 4YUDA 3ITHA 1UVJA 1X9WA 2OMOA 3R1HA 3OLBA 2E1MC 1X4BA 3RUBL 1S48A 1IVZA 2QMXA 3RRGA 1OJ4A 3SCIE 1KVIA 4I56A 2Z2YB 4B9TA 2F8EX 3C46A 1RA7A 2KYXA 3AJDA 4ZVHA 2V9KA 4EBEA 3HD1A 2HNZB 5A76A 2O5DA 2DNOA 2WW4A 5DQGA 5HVHA 4Y2KA 3S8SA 5F8GA 4ILLA 2K7JA 3UDVA 4KHPJ 2IM3A 1G3OA 1E6VB 3L09A 2CJYB 1NK7A 3C3LA 1R43A 3SBMA 1NJWA 2VFRA 3OTEA 1TUVA 5G4DA 1EQMA 2OJ3A 4ELVA 3LF0A 3CCRS 4FYDA 1UJ6A 5D15A 2VV5A 4AXIA 4WCEQ 4JI7F 4CIOA 2W8LA 1MMNA 2QFJA 2DPJA 3JS9A 1U09A 2HVZA 3GFXA 1XMQJ 3IG1A 3WDOA 3X1LB 2PFDA 1SH2A 4IFYB 3UN5A 2V34A 4USMA 5HP1A 4NX9A 4FBUA 2G9OA 4DR4F 1P9YA 1EKSA 2E1PA 5HMZA 3R2CJ 2VF3A 3PW4A 2VQEJ 4A8QA 3AODA 4C3KA 1FFGB 2ZFHA 1K1QA 5GADU 1BC6A 2V50A 4DQPA 1PAEX 2ZHOA 3NGUA 3R5GA 4DR6J 4RPFA 2VDIA 5F8LA 4HKQA 4OI2A 1Y3JA 2AP6A 3L4BC 3RYLA 3OJUA 3BPSP 2DH9A 4P2SA 4DPWA 4YFUA 3GIKA 1F1BB 1X4EA 3DRSB 3MPVA 4OL8A 2Z58B 3A13A 5J1EA 4NXMJ 3ADAC 5LT5A 1FNOA 4N41A 5L1KA 3A8IA 3WC0A 3H4DA 1X0FA 1RZMA 4J37A 5KFYA 3QIDA 2G1DA 1U26A 3ISZA 2HKEA 4DXLA 3M6XA 1R0AA 3QJJA 2WB1D 5FLXY 4JI2J 2DNHA 1HARA 3MOJB 2CQ4A 2C2RA 1HI0P 4RNOA 1S6QB 3FUYA 4LF1A 3FVYA 2LA6A 4IOCQ 4CDIA 2DNRA 4DS5A 4F4YA 1OY6A 1Q78A 3MM5A 2GO8A 3M1VA 2CDQA 1NH7A 1S7HA 2WHOA 4M5JA 3W5XA 1VQ6S 2IDLA 2R7UA 1FO1A 3R8YA 3TW0A 4PUOB 2W1BA 1RXOB 3HJFA 3H59A 2BM0A 3BM7A 3KUHA 4LF2A 1RWUA 5DM7Q 2QLWA 1HWIA 1LFPA 2N7YA 4RX6A 1OY8A 1RE1B 1K73T 4Z2XA 1NJYA 2EFPA 4DX8H 3P8BB 4RNFA 3CJRA 4DV3F 4KFBB 3ENAA 4U7CA 1PBUA 4DZDA 1TL1A 2IM1A 4K4TA 1QM9A 3OR1B 4Q44A 3PFOA 2AX0A 5A6PA 4FDFA 1FRLA 1S0MA 1L3SA 4F26A 4J90A 1KQFB 2NYHA 1V3ZA 2ZDPA 3IWXA 1I6JA 4G1QA 5T7LB 2FJDB 3KTQA 4PWDB 2VODA 1QVGR 4JBCA 1X9SA 1Z1ZA 2LQ9A 3LAMA 3GZ7A 2JX2A 1MWZA 3QFHA 5A8RA 2ACYA 3SZ2A 4RW4B 1U45A 3CSKA 3QO9A 3C6TB 4WFAQ 3KLGA 2B43A 1JXVA 3D54A 1U2FA 4USTA 1U25A 3GV8B 3BJYA 4PPZA 1HR0F 4U9RA 4GO7X 4L6V3 5B0DA 4GC6A 3KK2B 2FTRA 1VQ9S 3MOZA 3M30A 5KFXA 4F3OA 4JI6F 1AFJA 1VQ7S 1MMLA 2KZMA 3CJ4A 1KWMA 3FBEA 3EYZA 1XEZA 3CJ0A 1LW2A 2A6MA 2V63A 4RUHA 4ELUA 4HVZA 1F9HA 1HQEB 2HRYA 3ET6B 1RDRA 4E0DA 1WDDA 4C8LA 1VISA 2OTJS 3D6TB 3CJKB 2GO9A 3UNGC 1PYSB 2NZCA 2MQOA 1LQ9A 2MSTA 4TU7A 3CCUS 1M5HA 5EDWA 1FJGJ 1PSDA 4B3SJ 2BE2B 3KUEA 4D3GA 5LMNJ 1F3VA 1S1XB 2ZZTA 4N56A 4LMZA 1Y9OA 3BSCA 4CO2A 1E6YA 4U8YA 1S9GA 1VQYA 3PW2A 4NYZA 2C2DA 2QA1A 2HBQB 3CUNA 3SCJE 2ZOGA 3MM7A 1I94J 4Z7CA 2VC0A 4AQYJ 1S1WA 3BEGB 4OFZA 1UP1A 4AT1B 2YNIA 1S59A 4I1TA 3M6UA 2RE1A 2NXJA 1TZ0A 4WK1A 5A8WA 1QAIA 5F0UA
chains in the Genus database with same CATH topology
1TK5A 5KT5A 2LDIA 3DDKA 4A4JA 1HW9A 2D74B 4ZDNA 2MB0B 4OJ1A 3T1AA 2CPZA 4QPXA 2ZKTA 3N5FA 4F25A 2JVRA 5J2MA 4F67A 3K5PA 1VQ5S 3KLHA 1KNZA 1NHVA 1Q7LB 2CFXA 3RAMA 5C42A 1HWJA 5IM0B 2X1AA 4DFPA 1QVGR 1N5QA 4O4GA 5AE2A 4KR0B 3MMAB 3UR0A 2EFGA 5J2PA 2YKNB 4RW6A 3UFCX 4USJC 2CQHA 1YTYA 2GQ2A 2VFSA 4HH0A 4KB7A 1U6BA 4EEYA 1S72S 2JWNA 1T03B 3HO1A 1Q81T 2E9RX 3OUYA 1M5SA 2VBXA 4EYHB 1RAJA 1MNEA 4QIFA 4IO9Q 4ZP9A 5KFEA 1X4GA 1N36F 2UXDF 2VZ9A 2AJ4A 3Q8RB 2ZNYA 3PNIA 1GXUA 2HNDA 1MMDA 4ED5A 2MZQA 1JLQB 4N76A 2WBRA 5DDQC 4XO0A 1ZH5A 2IRYA 3UE2A 4X2BA 5FJ4A 1I1GA 1KQKA 4XIUA 2Y0SD 2BQUA 3HHKA 1UWBB 3MAQA 3I0SA 5JVHQ 4PQUA 3P96A 1O0PA 2YH0A 2LMIA 2OMLA 1CG2A 1X5TA 4CH0S 3R1LA 1NEEA 1UWBA 4BBYA 2GMHA 4DG1A 2XGPA 2VKRA 4DMZA 4U67Q 3DLLQ 3BDEA 3MECA 1C0TB 3BGRB 2G13A 4LF8F 3ICLA 3HHLD 2PI5A 1ROFA 1T94A 5K14A 4R8UB 5AXNA 1N48A 2NZ4A 4DL6A 3AB4B 4EO6A 2R8JA 4NMLA 4KO0B 2GMLA 2AGQA 3J7Z5 2PO4A 2RKIB 3H4BA 1YJWS 3O2IA 3DLKB 4ED6A 2W25A 3CXCR 2ZKUA 3MTJA 4RBVA 2AYGA 2KG0A 4EZ9A 3BO3A 2ALZA 1RT3B 3VAIA 2B9YA 3V6KA 3QAEA 2ASLA 1N5YB 3L7OA 5IXUA 3SSSA 3BN7A 4C7QA 1RTIB 4KV8B 3N6NA 3M8PA 2XNQA 3BQ2A 3HM9A 3L95X 5KFIA 2FDNA 5E2QA 3KOAA 3Q23A 2D9PA 4QCLA 2FUG9 3ZZ0A 3MUTP 4DF4A 2VG7B 1FTCA 1JLEB 3DU5A 2RH3A 2YKAA 4MTPA 2XB2D 5E0OA 1NB7A 1QSYA 1PO6A 4USHA 1N6QB 1HD0A 3NWGA 2OKQA 2VBYA 3HKZD 4ILMA 2V8DA 1LWFA 5E33A 4DN9A 2XI2A 3MPYA 5FDLA 5E5NA 4UQGA 2VFTA 4WFNQ 2MQPA 1RISA 1CC7A 3OTOF 1NO8A 3DM2B 4NXNF 2M5YA 3KG4A 2LQBA 3R5BA 4ID5B 4BDPA 4ZKAA 2J0SD 3D0GE 4O3RA 5F3ZA 5J1PA 3IWNC 2V4JA 3THVA 3FRZA 3KMQA 3KNGA 2YWEA 2VONA 4HL9A 2ZH7A 2V5HG 2LEPA 4FS1A 4DN0A 4MFBB 3KK3A 4QU7A 4XK8C 3D1OA 4X4PA 1SJFA 4DR7F 2JC0A 4OI4A 2CQ2A 4P7VA 3I4HX 4DJBA 2J0XA 1FNMA 1NJIT 4EYIB 3PJWA 4WXOA 3MZIA 5BYSA 1S9FA 1FK9B 1QSSA 1TFYA 1ZM4A 4OQJA 3BQ1A 2DR5A 3QGIA 4ZPBA 3GFHA