3OL6A

Poliovirus polymerase elongation complex
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
461
structure length
461
Chain Sequence
b'GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymerase
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
total genus 140
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3ol6A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ol6A02
2R8HA 4HKQA 3JYTB 2W7OA 2ZD1A 3T5LA 2EC0A 3NMAA 5L9XA 1S97A 4K4TA 3C6UA 4KV8B 5KFQA 1S1UA 3KNAA 3LP1B 2BE2B 2R2UA 2R2RA 4ED6A 4M94A 5KFVA 2CJQA 4NLYA 4NLQA 2V4QA 3CVKA 4KFBA 1ZTWA 4QWDA 4ZPDA 4PUOB 3Q8PB 2FJXA 1DTTA 3G6VA 4RNFA 2HAIA 1TKTB 1SH2A 1BQNB 4TY8A 1FKOB 4O44A 4RZRA 4ED8A 2BR0A 3DI6B 2IJNA 1JLGB 1S0MA 1IKWA 1HNVA 3HKWA 4DG1B 5J2QB 3PW2A 5KFBA 4PQUB 1S1TB 3G6XA 3QO9B 3KK3A 2HNYB 1QE1B 3CJ2A 3H40A 3DMJA 4GC7A 3MR6A 4ECQA 5HROA 3RBEA 4KB7A 2IAJB 2HWIA 4KKOB 4RNOA 2AX1A 2YNGB 3KHRA 2OH2A 5HP1A 4IDKA 2JEIA 3MR2A 3BREA 1RT1B 1N5YA 4F4ZA 2V0NA 4JUZA 3CJ4A 5J1EB 3IS9B 3QGHA 2JEJA 3IRXA 3DRSA 3OHAA 2WCXA 2OPRA 4O3RA 2BQ3A 3HVTA 4ECZA 5KG3A 3CIZA 3V81B 2ASDA 1HQUB 4NLRA 5I42B 1TKZA 4R8UB 1SUQB 2VG7B 3V4IB 1K1SA 2I5JA 3PW7A 1REVB 4Y34A 3UQSA 5C42B 2XGQA 2AU0A 4B3OB 4XO0A 3GIMA 4OL8A 3DLGB 3KLIB 3DLKA 4KSEB 3QLHB 1S1XA 1OS5A 2YNHA 4J9OA 4RW4A 4URSA 1JLEB 1VRUA 1N6QB 2YKNA 3BQ1A 4F50A 3T1AA 3BGRA 4IG0A 2ATLA 2ZD1B 3CWJA 3SFGA 3C6UB 1RTJB 5C24A 1S1UB 5KFCA 3RAQA 5KFWA 2AX0A 5DQHA 3FFIA 2AWZA 4LSNB 4KFBB 5CYMB 1CSJA 2D3UA 1DTTB 5HLFA 4MIBA 5KFJA 2GC8A 3LP2A 4MKAA 4TY8B 4O44B 5K14A 3E01A 2E9RX 2RDIA 3LP0A 1IKWB 5KT5A 4DL5A 4QW9A 2VG5B 3KK3B 1S1WA 2DPIA 4NLVA 5HROB 2C2RA 4KE5A 3DMJB 2R8GA 2RDJA 2BQUA 2IM3A 1FK9A 3I5AA 5D3GA 3M8QA 5L1IA 3MFHA 4U6PA 3BR9A 3KLEA 3IGVA 5HP1B 4IDKB 2UVWA 3OLBA 2XWYA 4Q8FA 5F8GA 3RAXA 4DL4A 1RYSA 4LSLA 2QV6A 3I0RA 3ISND 1TV6A 3IRXB 2JC1A 3DRSB 2OPRB 4ZPAA 3CJ5A 3HVWA 3M9OB 5F9NA 4EO6A 3HVTB 4RNNA 4IFYA 2BRKA 1TKZB 5CYQB 1LWCA 4R5PA 2I5JB 2J6TA 3ICLA 3OL8A 3FSIA 5DLGA 2AGOA 1HYSA 3DLKB 3MEEA 3H98A 3DRRA 5KFPA 4QWEA 4IRCA 1S1XB 4NZ0A 2XCPA 2YNHB 4O3PA 4RW4B 4NRTA 4I2PA 2DPJA 2YKNB 3V6JA 4J9PA 2AQ4A 3NAHA 3BGRB 4IG0B 4DL2A 4YR2A 4TYAA 4J9MA 2IM2A 3MR5A 2UUTA 5C24B 1JLBA 2UVUA 4Y2CA 3D28A 3CDUA 3T5KA 3H4DA 5DLFA 3IG1A 4PWDA 2HNZA 4ED0A 5HLFB 2YNIA 4TQRA 2F8EX 5KFEA 3LP2B 1EP4A 4IH5A 2B5JA 4MIAA 5K14B 3E01B 1RAJA 4NLTA 4ZHRA 2W8LA 1EETA 4O4GA 4U7CA 1N56A 5KFRA 3LP0B 4K4XA 4H4OB 1JX4A 3OSNA 3DDKA 3V6HA 1S1WB 4RNMA 1S0OA 1RYRA 3OL7A 3Q8SB 2E9ZA 3UR0A 1FK9B 2XC9A 2W9CA 3RB4A 5KFUA 3CO9A 3UDLA 1RT4A 3NBPA 5D3GB 2C2DA 3M8QB 2WK4A 1JLCA 1IKVA 4MK9A 3KK1A 2E9TA 3KLEB 3LALA 3TAMA 5KT2A 5KFAA 3RBDA 4JV2A 4NLWA 5J2MA 3LAKA 2B6AA 4J9SA 2FVSA 1S4FA 1T94A 2HNDA 3PW5A 2D7SA 1W25A 4ZVEA 2FLNA 3I0RB 5C25A 3GV5B 1S9EA 1TV6B 4O3OA 2C2EA 4M95A 3PW4A 4IOBA 1N48A 1MU2A 3H59A 3C6TA 3DLEA 4IFYB 4F4XA 1HMVA 5KG0A 2HWHA 5EDWA 4QWCA 2R8IA 3QGGA 2D3ZA 2RF2B 1LWCB 4R5PB 1S10A 3TQ1A 3KMSA 5KG6A 2YNFA 3V6DA 4QWAA 3NGDA 3KOAA 5KFOA 1J5OB 1SV5B 5KFIA 3MEGA 4KHMA 4ECTA 3PHEA 2JC0A 3MEEB 3KK2A 1HYSB 3TVKA 4MK7A 2ILYA 3DRRB 3V6KA 1T05A 4H4MA 5KG1A 3NAIA 1RT7A 4I2PB 3PR4A 1KLMA 3MR3A 2W8KA 4ECUA 4RW6B 3OL6A 1IKYA 1HPZA 2WOMA 1UWBB 3BSOA 1JLBB 1D1UA 4JV1A 4ECRA 1XR7A 1JLFA 3I0SA 1HNIA 5DQGA 1C1BA 4RW9A 4PWDB 2HNZB 5DGAA 3FQLA 2YNIB 1EP4B 2B5JB 2JEFA 2WONA 3M9NB 3OHBA 1VRTA 3RB3A 1EETB 4O4GB 4EEYA 4TLRA 3PZPA 5F8JA 3N6MA 3N6LA 2XGPA 1LWFA 4IKAA 2WTFA 4XPEA 1RTIA 2W9CB 2BQRA 2XCAA 1RTDA 2BANA 1RT4B 3NBPB 4ID5A 4MKBA 4IRDA 3QYYA 1JLCB 1IKVB 3PJXA 3KHHA 3KK1B 3JSMA 3TAMB 1R0AA 5J2MB 4G1QA 2B6AB 3I5BA 3G6YA 2HNDB 3EZUA 5DGBA 2FVQA 3GYNA 4EYHB 5C25B 2ASJA 2IM1A 3GIKA 4K4UA 2QE5A 5KG7A 2W9AA 1HNVB 1IM4A 5KG4A 4H54A 3BQ0A 4Q0BA 1MU2B 1WNEA 3C6TB 1C0TA 3DLEB 4IH6A 1TL1A 1HMVB 4ZMMA 2RKIA 5KFMA 3GV8B 1LW0A 1RTHA 1MMLA 5KFHA 3KLFA 5KFNA 4KBIA 2YNFB 1NHUA 5C5JA 5J2PA 1U09A 1FKPA 3MEGB 3GV7B 1N5YB 4NLSA 1JLAA 3KK2B 2BRLA 1S0NA 2FLLA 4J9QA 1T05B 4DL7A 5KT4A 4H4MB 5KFXA 5KFLA 1RT7B 4TY9A 5EWGA 4WYWA 1KLMB 5KT3A 3CJ0A 2IMWP 4QW8A 1IKYB 1HPZB 3HVAA 3Q8RB 1BQMA 3NL0A 4KV8A 5EUHA 1JLFB 3I0SB 1HNIB 3LP1A 1TP7A 2HMIA 1C1BB 4RW9B 5DG8A 4ZP9A 1C1CA 2IC3A 3H5YA 3PR5B 4ZP6A 4K4YA 1JKHA 3RB0A 4NCGA 4PUOA 2WONB 1VRTB 1TKXA 1K1QA 2YKMA 1BQNA 4K4WA 1VRUB 4NLDA 3H4BA 3RB6A 1S49A 5DQIA 2R8KA 4IR1A 5EWEA 1LWFB 2OPSA 4RUAA 4K50A 1RTIB 1S1TA 2ASLA 4WYLA 3KMQA 1RTDB 4ID5B 4ED7A 2VG6A 1QUVA 3FFIB 5JUMA 1QAIA 4FBUA 3E51A 4RUCA 2IJFA 4I7FA 3JSMB 1T03A 1R0AB 2FJVA 4G1QB 3NKYA 4GC6A 4Q45A 1S9FA 4IRKA 1RT6A 4ZP7A 4FS1A 1ZETA 3N6NA 2R2TA 3QIPA 4Q0BB 3IS9A 3PW0A 1C0TB 1TL1B 1SH0A 3PJWA 4O3SA 1LW0B 1RTHB 5T14A 3KLGA 4NLGA 5DG9A 3KLFB 3GQCA 3T5JA 5I42A 3H2LA 4YR3A 4DL3A 2I1RA 1LW2A 4QWBA 5J2PB 2IM0A 1FKPB 1S9GA 2OPPA 2AGQA 3H5UA 1JLAB 3PVXA 4G3IA 1C0UA 4ZPBA 1S48A 4DL6A 4X2BA 4LSLB 4WXOA 1S6PA 1KHVA 4TN2A 4O4RA 3DOKA 3HHKA 4KHRA 1RA7A 3FQKA 3H5SA 3MECA 1IKXA 4O3NA 5KFGA 2W7PA 3CJ3A 1BQMB 4Q8EA 4K4SA 1RTJA 3KLHA 3CDWA 4J9LA 5F8HA 3MF5A 3KJVA 4JV0A 4ICLA 4ECSA 2HMIB 4MFBA 4YP3A 2IC3B 1C1CB 2V4RA 3FRZA 1JKHB 1JLQA 4LSNA 5JXSA 1I6JA 5CYMA 2IBKA 4NCGB 3GIIA 2J6SA 4IG3A 4KO0A 1TKXB 3M8PA 2YKMB 2VA2A 3DRPA 4RNHA 2OPSB 2WRMA 3DM2A 2C22A 2FJWA 4I2QA 2VG5A 3MEDA 4LQ3A 4IFVA 1HARA 3BSAA 3KHGA 3KHLA 2VG6B 3IGNA 1TL3A 1LWEA 4I7FB 3EPGA 1T03B 4MK8A 3IG1B 2FVRA 1S1VA 1TVRA 3CDEA 1D0EA 3BSNA 1RT6B 4WFYA 5FDLA 4ZHRB 1RT5A 2XI2A 4ED1A 3QZ7A 1QAJA 3QIPB 1RT2A 2OPQA 4TXSA 3BJYA 2ZE2A 1T3NA 2R8JA 1JXLA 5KFSA 3KLVA 2UUWA 1S6QA 4ZP8A 3T5HA 4IR9A 3KLGB 4ZVFA 2W9BA 3ISNC 5CYQA 5KFTA 2FVPA 3H5XA 1LW2B 5KFFA 3GILA 4YR0A 4J9NA 4URQU 1HQEA 1S9GB 2OPPB 2JLEA 4NLXA 4K4VA 5HBMA 5KT6A 3IN5A 2FLPA 5KG5A 3DYAA 1C0UB 3SFUA 3ITHA 5J2NA 4EBDA 3SI8A 3MFIA 4R0EA 1S6PB 3M9MB 3BQ2A 1S9EB 1N4LA 2AGPA 3DOKB 2UVRA 4WE1A 3OSPA 1KHWA 3MECB 5F8IA 5I3UA 1IKXB 2J6UA 4RW8A 4WZMA 2B43A 3KLHB 1C2PA 4NYZA 3KJVB 4ICLB 3V6DB 1DLOA 2O5DA 4MFBB 4ZVGA 4RW7A 4IQXA 1JLQB 2JEGA 4IG3B 4KO0B 4NLUA 4DEZA 5L1KA 4ECXA 1DTQA 3M8PB 4TYBA 1RT3A 3DRPB 4IH7A 3DOLA 3EPIA 4Y2AA 3DM2B 5KG2A 2XI3A 4H4OA 2WOMB 1TQLA 2FVCA 3D5MA 4I2QB 3JYTA 2ILZA 2WB4A 3MEDB 4IFVB 3Q8QB 2GIQA 3QGIA 4HYKA 1TL3B 1LWEB 2BE2A 4Q44A 5KFDA 4YQWA 4ZPCA 1S1VB 1TVRB 5KT7A 3LANA 4URGA 2UVVA 3I5CA 2ALZA 5FDLB 4EYIB 1RT5B 4MH8A 5DG7A 3OLAA 1NNDA 1TKTA 4WXWA 1RT2B 1FKOA 2OPQB 4KAIA 3DI6A 1SH3A 2ZE2B 4LQ9A 1NHVA 5KFKA 1JLGA 5L1JA 5J2QA 2VA3A 3QIDA 1JIHA 4DG1A 4FBTA 1S6QB 4PQUA 3QO9A 3VQSA 4WFZA 2W9BB 2HNYA 1QE1A 5L1LA 2BANB 3QZ8A 5F8MA 2RF2A 2IA6A 3OL9A 2IAJA 2D41A 1HQEB 4KKOA 5HBMB 5EWFA 1GX6A 4RU9A 2YNGA 4NLOA 3DYAB 3ITHB 1J5OA 1SV5A 5J2NB 5F9LA 4EBEA 3G86A 4NLPA 1RT1A 4XPCA 4ECWA 5F8LA 5KFZA 4FS2A 4O3QA 5KFYA 5J1EA 1GX5A 5F8NA 4WE1B 4NRUA 3UPFA 4J9KA 2ZKUA 5I3UB 4YMEA 4ED2A 1ZTTA 2RKIB 3GIJA 4WZQA 4RW8B 1XR6A 3LAMA 3V81A 4RW6A 2CKWA 1HQUA 4TQSA 4R8UA 1UWBA 1SUQA 1YVFA 2VG7A 1RA6A 3T19A 4F4WA 4F4YA 3V4IA 1DLOB 3MTKA 2GIRA 4ED3A 4K4ZA 4WFXA 1REVA 4RW7B 2WHOA 5C42A 4ECVA 2C28A 4B3OA 3FDSA 3DLGA 4QPXA 3BSCA 1RDRA 3KLIA 1Z4UA 2R2SA 4EO8A 4EBCA 1DTQB 2V9WA 3QLHA 1RT3B 3DOLB 1JLEA 4ZVHA 1XR5A 4Y3CA 4Q43A 4ECYA 1N6QA 4J9RA
chains in the Genus database with same CATH superfamily
4DR2F 2P6TA 1K8AT 1NK8A 1SKSA 4ED6A 1PC5A 1CJVA 3TQEA 4JOUA 4OLPA 1IKWA 1HI0P 2WVEA 4KB7A 2U1AA 2AX1A 4LFAJ 3VVUA 2B0GA 3IBCB 4ATNA 4YHHF 1RCOB 2WCXA 3C14A 4ECZA 2ASDA 2EFPA 1HQUB 3K2YA 1EHWA 3MM7B 5FIIA 1ZA2B 3QLHB 5J1NA 4UF4A 2QFJA 2CADA 3T1AA 3GFXA 2VICA 3J7ZT 4P10A 3NNHA 4LT6A 2Z57B 2D3UA 2VQFJ 5DM7Q 3VZIA 5B0BA 2G2ZA 2Z2YB 3HHLA 1NDPA 1GTHA 3Q8YA 5KAKA 1YJWS 1UEKA 2XLKA 2QC3A 1TV6A 1ZAWA 1D9AA 3HVTB 4WIQA 2YKQA 3ICLA 1C4AA 4FYWB 1FRMA 3H98A 3POTB 3A4TA 3RGIA 2OFGX 1S57A 3F41A 4IG0B 5IXUA 4TYAA 2QO3A 3TZWA 3T5KA 5DLFA 2XBPA 1KBRA 2M4MA 4HT5A 1VQ8S 3MD1A 4ZIVA 2B5JA 4U67Q 4I67A 2VQEF 2GX8A 3V6HA 3MI7X 1KVKA 1U4BA 3N79A 3NBPA 5D3GB 3KLEB 1IQTA 5H1SV 2CQ0A 2FVSA 3NNAA 1S4FA 1HHTP 2JFDA 5LMNJ 2FZCB 3DHXA 2GGPA 4NEZA 1IJEB 3IWXA 3MEGA 3NGSA 3EGNA 1YX2A 3H7HB 2LU2A 2NQPA 5H9EJ 2MZSA 3W64A 2XLIA 1RK8A 3KDNA 5AJ3F 3DCAA 1D1UA 2Y1JA 4DQPA 5DGAA 3FQLA 3L7UA 4QR0A 2EW9A 1MMNA 3M9NB 1PG5B 4USTA 4PG5A 3B6BA 2G1HA 2YPYA 2MHEA 1H3DA 4OHVA 2FHJA 2A18A 3QYYA 3VAFA 3T1HF 2RIJA 2FYXA 4EYHB 4H54A 1RTHA 1RAEB 4HDHA 5A0YB 1SQFA 1RWUA 1I1GA 2A6OA 4FF2A 3KK2B 4TU9A 2BRLA 5KT4A 4OHWA 1FRHA 5KFLA 2AYEA 3C66A 3JTNA 1NK9A 3GU0A 4QW8A 4PKDB 4LF6J 2CYYA 3UNGC 2HGNA 3RB0A 3IR6B 5ETRA 2B8PA 1Y11A 3KKFA 1Y5LB 5ETQA 4FF3A 2MKSA 3CW2C 4LFCF 4G1QB 3W9IA 1Q5YA 2CG8A 3Q22A 4O3SA 2MQQA 3N28A 2VFUA 4LR9A 4N8OA 2GA7A 3LH2S 1C0UA 3AXMA 1VQ6S 1OY9A 4O4RA 5KFGA 7FD1A 1BQMB 1HBUB 3G8QA 3KJVA 2K8GA 3HULA 5CYMA 3HD2A 5CD4H 1OPZA 1SIWB 3AD8C 2HWTA 2CPYA 2PEHA 7FDRA 4IFVA 1HARA 1H2VZ 9RUBA 1TL3A 1UP1A 4F67A 3ZTRA 4C0OC 2HFNA 2D3OR 4F25A 1G2EA 4A8KA 1AT1B 2QLFB 3AY0A 5KFTA 4OI4A 4WCEQ 3ONQA 4X65F 3T1YF 3W60A 1SCJB 2RJZA 4TU7A 4WZMA 5GAEI 2C3MA 2DY9A 2NUUG 4TYBA 2DNHA 1DURA 2ILZA 4M5KA 5LXYA 2AHOB 2M8DB 2BX6A 1WHWA 2MKYA 4Y2IA 5KFKA 3O6QA 3VCDA 1Y4ZB 4DDFA 4WFZA 2DGOA 4LREA 3G8TA 2D41A 4LFAF 3VF0B 4X4QA 4CLPA 4RKUC 2V69A 5J1EA 2HBZB 1EZZB 3JSRA 4L73A 3J7AN 4RW6A 1UA0A 3V4IA 3PM9A 2GO9A 4B02A 2DH7A 3BSCA 2R2SA 4EO8A 2N7CA 4R25A 1FNXH 1DZ5A 2R8HA 3AX5A 3D0HE 3P45B 1U1OA 3NMAA 2AEMA 3HHEA 1RWKB 1RKIA 4QWDA 2VQFF 4OJGA 1Q16B 1TFWA 4O44A 4ED8A 5M2PA 1KQSR 1AZSB 3IAS9 2QJ3A 1NB2A 3CJ2A 1FRKA 3MR6A 2UXBJ 4LBPA 1U8SA 1S99A 4PCQA 5DO2A 1V5VA 2J8AA 3DLJA 3OUYB 3PNIA 4DSJA 2LQ5A 3I55S 2PA3A 3TAQA 1TK8A 2MJNA 4KYZA 4Y00A 4AUKA 1HWLA 5B0CA 1S5ZA 2YKNA 1GEHA 1PGZA 2IRUA 3O3LA 5HLFA 4TY8B 1FJ7A 2XHWA 2J7KA 4EMDA 2NYIA 1VISA 3DDIA 3I5AA 3FEYB 5CHCB 4Q8FA 3RAXA 2B9EA 3CD7A 3M6WA 1T8EA 2VBYA 2XB2D 1TKZB 1LWCA 3B8HA 2XMJA 4AE5A 3IR7B 4IRCA 4C11A 3MAQA 2ZM6F 1K0VA 2XYGB 3EWGA 3Q8VA 4DR3J 4DR1F 2QRRA 2W8LA 3CO9A 3UDLA 4OX9F 3DGPA 5KT2A 1K44A 5ADZA 3HJFA 2FGOA 4PABA 3W9JA 3GV5B 3ZZRA 2HLUA 4QWCA 1H38A 1JK9B 2E44A 3OFEA 3KMSA 3Q86A 3KXDA 4DR7F 2JC0A 4ZS6A 1T05A 3MURP 1NSQA 1SBRA 4FDFA 5HJYA 4EWTA 1JLBB 2ZBIA 4K7QA 2J0QD 2BJ1A 1BWEA 1SQEA 2L48A 1Q82T 3KDOA 2WTFA 3RAMA 3D67A 2ZKTA 1EKRA 1RTDA 4CLZA 3R2CJ 3BS9A 2FIUA 2VHGA 3KHHA 2AJ0A 5G0RA 3EZUA 2C2OB 5KG7A 4BBYA 1TL7B 1WNEA 3DLEB 2LXIA 5J1PA 2KB2A 3P8BB 4P72A 3H25A 4NLSA 1JLAA 1HBMB 1U2CA 3C16B 2QEXS 3CJ0A 2U2FA 1VIOA 2LXFA 3Q8RB 2JL9A 2HVZA 1JKHA 3R5JB 5I3QA 4CYUB 4B9NA 1K1QA 4PXBA 5DQIA 3TAPA 4ID5B 4QYRA 1JXVA 3L09A 2FJVA 1NDKA 2ZH2A 1KFSA 1W2IA 3CDAA 2E7WA 3KLGA 1OIAA 2HG4A 3MHYA 2DISA 3MCNA 3D4JA 2IFXA 1IM6A 1F5BA 1OWXA 1KP6A 4M1KA 4KGZB 4B3SF 1XMQJ 4NCGB 2UXCJ 4IG3A 1SJFA 2PFDA 4HI1A 1FDBA 4E8UA 3CJKA 1HNWF 3O44A 1G6BA 8RUCA 2FVRA 3GJSB 3BSNA 4ED1A 4LBIA 3RJMB 2OPQA 4LF5F 4TXSA 1VYAA 2V8DA 1A9NB 4RBVA 1IWAA 5LJ3Y 4AL5A 2UUBJ 1XK8A 2IJRA 4PR6A 4EBDA 5A8WB 5LL6d 1WKJA 4WE1A 3KLHB 2Z2LA 1UJ5A 3BBBA 1VC5A 3VGSA 3W2WA 3UDEA 3DRPB 2NZCA 4IH7A 1WG5A 1NH8A 3D5MA 2WB4A 1ZH5A 2PA8D 3UN2A 5KT7A 1MN9A 4EYIB 2OEMA 5L9NA 2XY7A 1KONA 5A8RA 3QJLA 1FTCA 2F4VJ 1UZHA 4DQSA 5BR8F 2BANB 2IA6A 2W4DA 3OR1B 5F9LA 2JVRA 3Q83A 4J9KA 2J7UA 1IXKA 1ZTTA 1AROP 4F4WA 2VG7A 4X4OA 3GPAA 4ZITA 4X62J 4ED3A 3N5FA 4DCJB 3M8YA 4QPXA 1RTZA 2MEWA 1PC4A 1OYEA 2ZD1A 2N4DA 1S97A 5M2RA 4DFKA 2QMWA 5KFQA 4HL9A 1WG4A 3CVKA 2OP5A 5CABA 3RR7A 2V68A 2HW3A 2RS8A 2FGCA 3RBEA 3DMJA 2UXDJ 5D0EA 2ZZTA 1KTVA 2GW8A 4RJVA 2XTDA 3QRQA 3OBIA 5DDRC 3HZGA 4F3MA 4FXWA 1N5VA 2UUCF 3CD5A 2HHUA 1K1SA 3GSDA 4OQJA 4F3QA 5IT9U 3WDOA 2WBRA 2XY6A 5HK4A 4F50A 4USUA 4C3MA 2V1SA 5C24A 4M5NA 4HLBA 2R3VA 4FF4A 5KFJA 3C19A 1VHIA 1RISA 2RDIA 4F4AA 1T0TV 3NG8A 3DGVA 1MW7A 3J81j 4JI6J 4EU0A 5ETSA 3I0RA 1N5SA 4AXIA 1GK8A 5I4MA 2MZRA 2YKPA 1VQ7S 1HYSA 2YWGA 1DQ9A 4X66J 3OJSA 3KJQB 1UMJA 4FNHA 4PWWA 3LP2B 4GKKJ 5K14B 1RAJA 1EETA 2DYAA 1H98A 3GJTB 3SSRA 3Q8UA 2O66A 2C2DA 2V8VA 2WK4A 3KK1A 3SEOA 2KYZA 4AXJA 3IBWA 2E1RA 3UI3A 4F4XA 4KR0B 2MQMA 1CLFA 5KFOA 4DU7A 3TVKA 5A6WA 1FVQA 2BKPA 1OSCA 2OKQA 2V34A 2MZ1A 3DNCA 2M8HA 1JLFA 1HNIA 1RB0A 5C2GA 3LF0A 2YNIB 2RRNA 2WONA 5LJ5Y 4IKAA 1U2RA 3CCJS 3OTBA 4F0MA 2RQCA 2QL7B 3TAMB 3DLHA 2DHGA 3A8JA 2FVQA 5C25B 3AT1B 1VLOA 3C6TB 4ZMMA 1FNOA 1ICEB 1VC6A 3TR5A 4PG7A 1FKPA 2DNYA 1O8BA 1FXRA 4AD6A 2GO8A 2K3IA 1SC6A 1WOOA 2UV8A 1TR0A 2UU9J 3W5XA 3TUZC 2D1CA 3FK4A 1YSJA 4RUBA 2UXCF 4K5SA 1HW9A 2BA9A 1U6FA 2VPXB 5DDPC 4I1TA 4F02A 4I6WA 2NXJA 1AFJA 2EPIA 3EUNA 4QBUA 3KWMA 4WYLA 4A8MP 2VG6A 2QYCA 4DR4J 3W8PA 3OFHA 2YH0A 4Q45A 1GMWD 5LSOA 2QLBB 3ET6B 3W5YA 1CJTA 4L6V3 1ZM3A 3H2LA 5CH7B 3FJ2A 5E33A 2AV5A 2HBYB 1RA7A 3FQKA 3JSYA 2K1RA 5C7PA 1Q86T 2H54B 4K4SA 4MFBA 2IC3B 3S7RA 4HH1A 2WVCA 3OXLA 4RL1A 3KTQA 4LQ3A 3KHGA 3F56A 1RU1A 3G96A 2V1TA 1RT2A 4LRBA 3CCQS 3EVMA 5HQ8A 3M6XA 4CLWA 4IR9A 2HKEA 2FVPA 5E3AA 1K47A 5J2NA 2VONA 3M2RB 1N4LA 2DTJA 3MECB 4OZ0A 3EDQB 2VPWB 3KG0A 4RW7A 3NWRA 3VAGA 4IQXA 2JEGA 4KO0B 3CJRA 4NZ6A 4OZ3A 2OTLS 2M2BA 3HHLD 3MEDB 2FJBB 2BE2A 3FBCA 4F36A 1HWIA 1TVRB 3SQGA 2XO6A 1NMEB 2VA3A 1JIHA 4HI2A 3DHWC 2UXDF 4A8OA 2Y1IA 1CPZA 4JI4J 3M8ZA 1HQEB 2XY5A 1J5OA 1RWWB 2DIUA 2JNJA 2D9OA 4RUHA 4ZLLA 4RW8B 1YVFA 1N54B 1VOMA 5CCMA 2RT3A 2CPZA 2AKWB 5F3ZA 4TNOA 2E29A 2EFGA 4LF7F 3T5LA 4K4TA 1S1UA 3KNAA 2J5AA 1XEZA 2BR0A 1X7VA 3BDEA 3DI6B 2UP1A 3AB2B 4JV5J 4LF2A 1DJ0A 4ECQA 1X5SA 1OY6A 2OO4A 4KKOB 1U1KA 1NDCA 3KHRA 3ILLA 2OH2A 2EC2A 2XMTA 4JUZA 2BOAA 3P5BP 1RU2A 2BYCA 3UN3A 2I5JA 1REVB 4Y34A 3CCMS 2ZZNA 4PYDA 4Z7CA 1UFLA 2FHJD 2DK2A 4KGMA 5CYMB 1P8GA 4MIBA 1FRXA 4K2JA 1F9HA 3SCIE 5KT5A 4QCLA 5AXNA 1FJCA 2VJUA 4ED5A 4Y28C 3MFHA 3OLBA 3DRSB 4ZJQA 1K73T 1UZDA 2LMIA 2HHWA 1UPMB 2ZEJA 4RW4B 1U8WA 5D8HB 4WKRA 4CI0B 5GAHI 4DFMA 2ZVSA 4QYZK 2XEXA 5LOQA 2DXEA 1U2FA 4XTTA 3FMWA 1P6TA 3WQPA 3BGOP 1N56A 4HH0A 4YDDB 4X4TA 2R7VA 2RRBA 1RT4A 2H5EA 1MSWD 4MKVA 4IOAQ 1FESA 3AJ2A 1BHNA 4O3OA 2C2EA 1AYEA 5GMDA 1RGVA 3BN4A 1FKAF 2E1CA 3HDSA 1JJCB 2VFTA 3DRRB 4P2XA 4KGVB 1UPPA 4RW6B 4WU3A 1AUSL 2GJ2A 2B9XA 2UU9F 1KEKA 2H48B 3BKFA 4O4GB 1WOPA 2FZGB 2BM0A 2XGPA 4A8XA 1WKKA 2NLWA 4YDXA 2XTEA 2BJEA 1IKVB 3JSMA 2BMBA 2ZBCA 4J90A 2KXNB 2ABYA 4CZCA 4FXDA 4K0KF 4CLTA 1N34F 2VBZA 1WORA 1RI7A 3ZC4A 1RT7B 2EFQA 4GO5X 1KLMB 4IYQA 4DV5J 2BEFA 4DFJA 2W2QP 3NL0A 4FYXB 4JI7J 3LP1A 1N36F 3QAUA 2HHHF 3NLCA 3CCUS 1KRPA 1O5JA 1U0HB 4U96A 4A47A 5FJ4A 4LJMA 1YZ7A 3PIPQ 4G1IA 5IT4A 2ASLA 2JJ4D 1X0FA 2PO4A 4ED7A 4RUCA 2OTJS 3N6NA 2HSEB 4N41A 3MM9B 3D7SB 4X64J 3MM6A 2AJ2A 3W3SA 1HR0F 4DL3A 4ZJLA 2F1FA 3G9CA 4ZPBA 4M5JA 5HQLA 1S6PA 3I87A 1ROFA 2AYGA 2KM8B 3CMES 4CM0A 2HHXA 1F5AA 3MAHA 3MF5A 2V6AA 3TO8A 5HL7Q 2KG1A 2BKNA 2VKZG 2R7SA 2VA2A 2AZ1A 1R8PA 2W25A 2RH3A 4I7FB 4K8RA 3DXBA 1FWLA 5ETLA 1RT5A 4UOHA 3BJYA 3J7A1 1X0PA 4ZP8A 4N77A 5AE3A 1FHTA 4GVLA 2HLTA 3I96A 3LGNA 2JEIA 4C8LA 3SI8A 3CPWR 3MWBA 5E2QA 3DOKB 4B9TA 2DGTA 4YY3J 2K7JA 1VLYA 1R8CA 1C2PA 4DR5F 4OHZA 2MZJA 3CCVS 1X4HA 3ULHA 1JLQB 4LMZA 3R5AA 2YTCA 2WW4A 3RRHA 3W8GA 1TAUA 4CO3A 5AXLA 5HO4A 2ALZA 1JLGA 4PQUA 4CTAB 2DNOA 5F8MA 3OL9A 4PYAA 3ITHB 3SXLA 4ANDA 1GX5A 5JJBA 3UNYA 3ENAA 3JTOA 3NY0A 1IBMF 4F4YA 4UUXA 3TVYA 5C42A 3FDSA 2HS0A 1WC0A 1DTQB 4JI0F 3P3DA 1JLEA 1I51B 1FRLA 2BACA 2BVZA 5K8NA 1YIJS 4J9RA 3VGVA 2M3DA 1EARA 3R3TA 4M94A 4ZPDA 1DTTA 3QT5A 1SH2A 1QSYA 3ZZTA 4QIGA 4DG1B 3M2UB 4OYOA 4GC7A 3PHTA 2BKOA 1Y5NB 4DS4A 1HI8A 1N5YA 3L95X 4DPWA 1X8DA 4OZ1A 1RHRB 1H72C 2R7TA 2G13A 1E6YA 3UDVA 3T3FA 4IO1A 3KLIB 4KSEB 2KDOA 4PAAA 4J9OA 1IBLJ 3I9V9 2YXLA 3D9BA 1FFWB 6FD1A 4C2MA 1VQLS 1CSJA 5U47A 3R7SB 3EVOA 4QW9A 1E6VA 5D4PA 2ZOFA 3IXQA 2BJ3A 2OSRA 3FZBA 2XWYA 1A6LA 3SCKE 2CDQA 3UVJA 1LWXA 1R6VA 2FHKA 4P71A 2EBEA 3IM9A 2Y9HA 1L3TA 1BE4A 3C15B 1WF1A 2XHCA 2R7QA 1SL1A 2OEJA 4J9MA 2UVUA 4Y2CA 4DUTA 1NAQA 3IG1A 3W2WB 1EP4A 4CP5A 5A2QY 3OSNA 4RNMA 5SUHA 1VQ4S 3SZ2A 2CQPA 3LALA 2PT0A 1LOUA 1V3RA 2HHQA 3TQ1A 5JMNA 1HBNB 3ZTOA 2DEJA 3ILIA 3MPUB 4PRFA 4MAKA 4TU8A 4DLEA 1X5PA 2MQPA 3GB0A 2MPUA 4JV1A 4CT8A 2DHAA 3RB3A 2DR6A 3W1YC 3I82A 5K8PA 4WF9Q 2BQRA 2BXJA 1JLCB 2JHEA 3PV8A 3CCTA 3K7RA 4RU2A 2FJEB 4H4KA 4KIAA 4U8YA 1IM4A 3ZTSA 1SL0A 4WP9A 2AEJA 2CVEA 1LW0A 3RRKA 1AXQA 3VAKA 1ITPA 1U09A 1FX4A 1VJWA 3HJVA 5KT3A 2IMWP 1YJTA 3ZZZA 2EFVA 1W7WA 4XDCA 1IKYB 3QFWA 1NSKL 4AYBD 3M1VB 4PUOA 1VRTB 1TKXA 1BQNA 1FVSA 2CQGA 2R8KA 5EWEA 1YZ6A 2CZVC 1RTIB 1HWJA 3TZZA 3R1LA 3GG0A 2YVSA 3UD4P 1D3WA 3KJNB 1LQ9A 2VIHA 5T14A 4NLGA 2DR9A 1XMBA 2XO7A 5I42A 1WHYA 3HXMA 4K2XA 3UWTA 2GCFA 3VTIA 1FI4A 1OSDA 5C2CA 1R27B 4ICLA 1YJVA 3DFEA 5JXSA 2V4JB 4ZVUB 3HT0A 2YKMB 2NR0A 3CC7S 1RWOB 4FYVB 4RX6A 3BH6B 5D4NA 4LF1A 2OJ3A 1HNZJ 1F2GA 2ATCB 3M4XA 2J7WA 2HIYA 1ZM2A 1N52B 4FYYB 4DMZA 2KKHA 2N3OA 3DN9A 1JXLA 3GLJA 1ZYQA 4G65A 1P9YA 2I9SA 2MB0B 2YQ0A 5CA5A 5KT6A 4JI3J 1V3SA 1G1XA 4EZ9A 4USHA 4WP8A 1D9FA 5I3UA 1FJEB 4ZKAA 4P7VA 1XNQJ 4QIWD 3JAMY 4NYOA 1VQYA 5L1KA 2G0CA 5K8OA 2YQ1A 2XYPB 4PXCA 5KG2A 3H8YA 1H7XA 4I2QB 3JYTA 4DZ6A 4HYKA 2GIQA 2DGXA 3U1MA 3D3CJ 3I56S 3GZ7A 2MYFA 1RZMA 3QIDA 3QO9A 2C1EB 4IUFA 1UKUA 4ENOA 4EBEA 1RT1A 2C2ZB 5THWA 4DPOA 3SSQA 1UVMA 1WHVA 1XR6A 1OQ3A 4R8UA 1UWBA 1RA6A 2B9WA 4NMXA 2FHOB 2L3MA 1VMBA 4UZCA 3IAM9 2C28A 3DLGA 2V9WA 2LVWA 5IQQA 1IBLF 4JYAF 2QSFA 4OHYA 4CO5A 4MTPA 3BF4A 2R7RA 3TJ8A 3D66A 4HKQA 1X9WA 2YKOA 4LBHA 2R2RA 2OHDA 1ZAVA 4KY3A 4ZK7M 2FJXA 2HAIA 3PXGa 1V9OA 2PDAA 3H40A 5HROA 4WBFA 3MOJB 4UTGA 2X1AA 4V1Ak 1Q0NA 2CNNB 2CZ4A 1CULB 2OI2A 2NXEA 2ROPA 5KG3A 1PO6A 4UUWA 2FC9A 3FC9A 2DKOB 2PI5A 1SXLA 1S1XA 4URSA 2XS5A 1N6QB 5IV4A 3C6UB 1EQ0A 4K5RA 2CPXA 2CVIA 4DV1J 2W01A 2GFFA 3E01A 1OYDA 4DLGA 2JWNA 3KK3B 2C2RA 4ZOSA 2YX1A 2RDJA 4DUYF 1X4EA 2CJXB 1X31C 4DPUA 2PN6A 5HP1B 3HLUA 4MJKA 1NZ8A 4F0HA 5CAAA 2BJDA 4D3HA 3GR0A 2F4FA 4B3MF 2W2MP 2MDAA 3Q89A 4WFBQ 2N7YA 1NDLA 3WC2A 3DLKB 2YNHB 2M88A 3MMCA 2DPJA 2RB7A 3BGRB 4M5IA 3ZFVA 2IM2A 4ZPVR 3CJ8A 5IT0A 2LFVA 4IH5A 1B7FA 1KWMA 1UWAA 1FDNA 2HRYA 3GONA 3M8RA 2KL8A 1FK9B 1GFWB 3RB4A 3ZZPA 3MPDA 1YHQS 5J2MA 2JZ5A 2DBBA 2D7SA 1W25A 4M95A 1MU2A 5A8KB 1HMVA 2R8IA 1QM9A 1SVDA 2B3TB 2EG1A 1J5OB 4YOEA 3V5RA 4MK7A 3HP6A 2HS3A 3V6KA 2PEBA 5KG1A 3NAIA 3FEZA 2W8KA 4OJHA 1UCNA 1FEEA 4CWBA 2N4CA 3TEGA 2WVDA 5ETVA 4EEYA 1CVJA 2MLXA 3SIPB 1M0SA 2Z2MA 3CCZA 2B6AB 4HACA 4OI6A 3K5PA 4GC6A 4LF8F 5EHHA 1TL5A 1O51A 3GV8B 3OVSA 4YUDA 3OR2B 1DFDA 4UT4A 2DO0A 1FFGB 4DSLA 3ZO7A 5F0UA 4JI1J 4BC7A 1M5HA 4TY9A 4LIWA 2G0JA 3J81U 4OX6A 3LA0A 5K20B 4RW9B 4ZP9A 4ELVA 3ZXWA 3HT3A 4K4WA 2R7WA 1HD1A 5IWAJ 1LWFB 1NK6A 2XZDB 3FKBA 1W26A 1FX2A 4CRJA 1HNZF 4ZP7A 1RKJA 4Q0BB 1C0TB 1TL1B 4NX9A 5B09A 4JI3F 4DL6A 1WC1A 4O3NA 2QMXA 2RHSB 4DQRA 4XAKA 3QWUA 2GHWA 1XNQF 3A1YG 4YP3A 3AJ1A 1C1CB 4JI5F 3JQJA 3CDBA 1HWUA 1XWLA 5H9FK 3BSAA 2QLWA 1T03B 1KNZA 1S1VA 3CDEA 5GADI 1D0EA 2XI2A 3HM9A 2ZE2A 3MCMA 2CXEA 2BZ2A 3P5TL 1XMOJ 5HBMA 2OPPB 3IN5A 4C8YA 1NKEA 4KHPJ 2L9NA 3BQ2A 2V8HA 4UY85 5F8IA 4DR2J 1DLOA 3LPYA 1YGYA 3RRGA 3TYTA 5MAOA 1DARA 3O8WA 1RT3A 1S0VA 2CJYB 4ELUA 4DV7F 3GSIA 4Q44A 5KFDA 3KNGA 3J7YU 3GIRA 4L74A 4YHHJ 2E5LF 2DGSA 1NNDA 1TKTA 4WXWA 3CTRA 4V19J 3HSGA 4LFBJ 1VQSA 1GXTA 4FKYA 1J27A 1UW9A 1M5VC 4DPXA 1KQFB 2M9KA 2XZ2A 5ETNA 3FMBA 4NRUA 4BWJA 3V2UC 1M90T 5DZ6A 4WZQA 1PJ6A 1NSAA 2V2QA 1JNRB 3AH6A 2J9DA 4CLYA 1BUXA 3C46A 2OD6A 4Y3CA 4OX8A 3CJQA 2CPFA 3NXZA 3LP1B 3DU6A 3WIVA 2V4QA 2Z2ZA 2ZC3A 1WEZA 2IPOB 4RZRA 4OYBA 2IJNA 3UCGA 1Y0HA 5D15A 4OJ1A 2RHQB 4OI3A 3BREA 5JVGQ 2XSJA 1TK5A 2JEJA 3CJTA 2LYVA 3U02A 2W4PA 4ZPTR 5IV3A 4RBUA 1VC0A 3UD3P 3UQSA 4HT7A 4Q2LA 1MMDA 4MIWA 1VRUA 2PIIA 3BQ1A 1FXDA 2VQEJ 4ZCLA 2IYGA 3SFGA 2KXFA 3MCSA 2K06A 4B3TJ 4X4SA 1X4CA 4MKAA 3LP0A 4WTOB 3LTOA 4CM2A 2Q66A 1CQMA 2E7VA 2BQUA 2NPFA 3UCUP 2J8SA 5BXIA 4IDKB 2DGQA 3PX0A 4FYDA 3THTA 5HATA 3IRXB 2JC1A 5B08A 5E3RA 2E5JA 1L3UA 5AJ3J 5DLGA 1R8AA 2L41A 2X7IA 3ENVA 1FF2A 1RHJB 3ENWA 2XS7A 2R7OA 1RAIB 4DF4A 3I4HX 2A2CA 2HNZA 4NXNF 8AT1B 4U7CA 3BO3A 2CPHA 3CGIA 1HBOA 1JX4A 1S1WB 5CCLA 2W9CA 4WWSA 5LT5A 2AYBA 1RBOB 4JV2A 4C3KA 4J9SA 1TTHB 1FERA 3W63A 5E5NA 4IFYB 4R5PB 2CWKA 3NGDA 2A3JA 3MEEB 5EX3A 4ZVRB 3TX0A 4IOCQ 4Y0FA 5KTQA 1IWGA 1RBLA 1HPZA 1NLKL 4F2SA 5DQGA 1P9QC 4PWDB 4GVBA 2ZHOA 4EK2A 2HQFA 2JEFA 2AJQA 3PZPA 1VQNS 3SSSA 2BABA 4HHHA 1RACB 1R0AA 4JI2F 1NKCA 2MKIA 2E66A 3GIKA 3NCRA 4IH6A 2QA4S 3AD7C 1PBUA 2CIMA 3BN7A 2IVYA 2YNFB 1MWZA 2MQLA 1N5YB 1S0NA 2BE7D 4J9QA 3LOUA 4H4MB 3PYGA 5JVHQ 4L75A 4HTIA 3HVAA 3RBZA 2BOPA 3I0SB 4USMA 1CS4A 4ZP6A 4K4YA 4ZIWA 3DOMB 3QAEA 3PDNA 2QG9B 2OPSA 2OEKA 5LSLA 1H6KX 3W2VB 4CO1A 3T1YJ 1Z2LA 2R2TA 1MROA 2OSQA 3KJFB 3PJWA 3GQCA 1EB0A 1SC1B 1LW2A 2GAGC 1NXIA 2R7XA 3R1HA 4OZ5A 1RTJA 2HMIB 1X9SA 2DNLA 1NSPA 1DRZA 2PSZA 2HBQB 1JJHA 3DDNA 3IG1B 1VS3A 2O1PA 3MEKA 2ERRA 3AJDA 3MD3A 3M2VA 1QAJA 1Q8LA 3QIPB 3MXHP 2R8JA 2GS8A 1PAUB 1IN0A 4ZVFA 4LFBF 5CYQA 4KTQA 3O2IA 1UEUA 1S9GB 2HBRB 4J9VA 1YRXA 2PD1A 2R42A 3OSPA 1IKXB 5IFMA 1YI2S 3BGLA 2DNKA 1TMMA 1OJ4A 3CE8A 4TLQA 3ILJA 4DEZA 3CD6S 1NO8A 4P2FA 3UFCX 5FD1A 2AZ3A 1WC6A 3W61A 4GRSA 3H90A 1LWEB 1GTEA 3R7BB 2H5JB 2KZZA 3QZ8A 2CQ3A 3NCPA 2Q43A 3BPDA 1GX6A 4J5OA 3R7NB 5KFZA 1KC8T 4I4BA 1PIEA 4TQSA 1HQUA 2EBGA 2CAJA 2WHOA 3T6JA 1X4FA 1K9MT 1N33J 3QLHA 2Y8YA 2W2PP 2LEAA 1QD1A 3HHNB 2FLOA 3QT6A 2Y1LB 4B3TF 4PUOB 4USKA 2VL1A 1BQNB 3W66A 4UZBA 3PW2A 1QE1B 2IAJB 4RNOA 4YB5A 2YNGB 4OYWA 3GCXP 4F4ZA 3HVTA 2ZM6J 1YITS 5I42B 4EI2A 1SUQB 1X9MA 2M70A 4B3OB 4DR1J 2MLZA 3TA0A 3POTA 2MQ8A 3JTPA 4IG0A 2HHPA 2V67A 1JJ4A 4E98A 5DQHA 1JMTA 2F63A 3FFIA 1P27B 3G82B 4KFBB 4OX9J 1QSLA 4ZVTB 1ACMB 4ZLJA 1ZA1B 3MMBB 1FD8A 3BEGB 3D0GE 1U1RA 5D3GA 5L1IA 3ETOA 3KLEA 4DR7J 1P1LA 2HK3A 5F8GA 4PPZA 5LXRA 3TNVA 5GAGI 3UE2A 1B70B 3J80Y 1S12A 4AQYJ 4O23A 2L9WA 2MGZB 4YB7A 3B78A 2ZH8A 2GJFA 3P96A 1PKUA 1EKSA 1WD6A 3EGWB 1U1PA 1UJ4A 3DDKA 1CJKB 4G6VB 1ZPVA 3M8QB 3X1LB 3N01A 4HTJA 4RR5A 2KG0A 1N48A 2BV3A 1Q7YT 1KDNA 5A0YA 2WVBA 3TJAA 4KHMA 4RBTA 3KK2A 4I2PB 2DGVA 4DBQA 2W2OP 1VK8A 5RUBA 1N0VC 2QT7A 2M5YA 2IVMA 1UWBB 3BSOA 2CQ1A 2Y0SD 5H9EK 4PQAA 1EIYB 3D3BJ 1RWVB 1VHFA 3NS6A 1I5OB 2ZFHA 4G1QA 3RU0A 5B7WA 3ZZOA 2HNDB 5DGBA 2X1BA 2QE5A 3TW0A 5LM7E 2H3EB 1RP5A 1WDTA 3VR1A 4D3GA 5KFHA 5FLXY 1NHUA 3MM5A 4B3SJ 2KRBA 3DC2A 1X4BA 5DRKA 2ACYA 1YJRA 4AFFA 3T6BA 1WHXA 1BQMA 1HNWJ 1HBUA 4OYIA 2LA6A 2OMLA 3LGHA 3VAJA 2EWHA 3A8EA 1NKBA 4LF5J 1FRJA 1EQMA 4QIVA 5JUMA 3AOCA 1UVIA 4DR6F 2DHSA 1SKUB 1VQ5S 3MUVP 4DQQA 1WSVA 2I1RA 4QWBA 2CJKA 4WXOA 2YBVA 2KFZA 2YX7A 3TUIC 4LF9J 4KHRA 1MN7A 3R8YA 1NEEA 2ZH6A 4ALZA 2XQCA 1JNZB 2AF6A 1UUJA 1XIQA 5D0HA 1ZBTA 2IBOA 5E3QA 2WW8A 2F9JA 4PWUA 2VD3A 1VGYA 3HSZA 5BR8J 3TX8A 5IM0B 4WFYA 4QJVA 4UOGA 1XJWB 2YKAA 2B4UA 5KFSA 2IY5B 2UUWA 1XNRJ 2HS4A 3PJ9A 2JX2A 4XK8C 4YR0A 4URQU 2JLEA 4K4VA 2FLPA 4OFZA 1SQGA 3TANA 1UVKA 2ZITA 3F73A 1LEOA 5B0FA 2VODA 1N33F 4ITSA 1U26A 3HX9A 3EGZA 4U8VA 3MAAA 4NZ7A 3GG1A 5HANA 2MZQA 1H74A 3MM8B 5FDLB 3HSJA 2EK1A 1AUDA 4B9SA 2FJAB 1AZSA 1UW4A 2W9BB 2UUCJ 4M5DA 4C6AA 1S6UA 3CULA 3DYAB 3OV7A 1SV5A 4NLPA 2QA1A 4ECWA 5KFYA 2BM1A 2BDPA 1VFJA 2CUYA 1L3KA 1QAXA 3GIJA 3S1TA 3OUYA 2YX4A 2NSCA 2QYGA 3LO3A 4WKYA 4DV4F 1NPPA 1U24A 4FZVA 3DOLB 4OZNA 4O0IA 2E5HA 2YQ3A 3PX4A 3G6VA 4RNFA 1VK3A 4TY8A 3UDCA 2NXCA 4ZCMA 1SC4B 5L46A 2ZNYA 1VQOS 1IUJA 3OHAA 4EZ6A 4C8NA 4NCBA 3PEHA 3V81B 4L3KA 4CT9A 1GH8A 1TKZA 2CG4A 2HZVA 2DH8A 2DNPA 4AQYF 3SMZA 3SCJE 4F4KA 4KRWA 2ASYA 1F0XA 5D0RA 4DX6A 4F0KA 1VDHA 3S01A 1B4SA 2IHR1 4KH0B 2E5GA 3ZZ0A 2VFSA 2OPRB 2QX0A 2GVZB 4YN3B 1URRA 1TELA 2NSBA 1KLNA 2VFRA 2J76E 3FSIA 4A48A 2CQ4A 1H7WA 4NZ0A 3F44A 4Y65A 3CF5Q 2MY8A 2GJIA 1JLBA 3FVYA 4DV2J 4NWBA 1F9FA 2XNQA 2P9CA 3N4WA 2HFOA 4OYZA 1IBKF 4M5LA 2CQHA 3AXKA 2RE1A 1B0VA 1X5OA 4NI2A 1TZ0A 3CJSA 1S9EA 3PW4A 4IOBA 1TL7A 3H59A 3DLEA 3FBBA 5KG0A 1RAAB 1S7HA 1T9TA 1SJ3P 3K17A 3PFEA 1RLDA 3C16A 1HBMA 3ILOA 4YS2A 1H2TZ 2VBWA 4F04B 2CPDA 4MYTA 3GR1A 4IO9Q 3OL6A 4USVA 4NPOA 4CYUA 3GJRB 2HIQA 1WEYA 4ID5A 4MKBA 4IRDA 1SKRA 3QGPA 2ZDOA 5LMUF 2DB1A 3GYNA 3CNQP 3FRYA 5KFMA 3AFGA 2PI4A 1BLUA 2DIVA 4NA1A 4LF9F 5CZXA 3PRDA 1C1BB 4JI8F 4NCGA 2KRRA 2D69A 1VRUB 4HDGA 1J5EJ 3KMQA 1O0PA 1QAIA 3BKTA 1N32F 3FUYA 4Z37A 3KUGA 3CCLS 3IS9A 1SC3B 4BS2A 3EE3A 1XNRF 4DUZF 3KLFB 2HPUA 4YR3A 5AT1B 2YH1A 5J2PB 2CRLA 3LW5C 4G3IA 5A8WA 4TN2A 1UFKA 3Q23A 2ZH7A 3SDEB 5IZHA 2W7PA 3QJJA 2AJFE 3AODA 3KLHA 1F3VA 3CDWA 4J9LA 2FTRA 4OI1A 3K0JA 2ZJQQ 1OM2A 3FGVA 3DRPA 3CT9A 4OZJA 3UD5A 1VQ9S 2FJWA 3AB4B 5D78A 2JDJA 2JH3A 3I31A 4PXEA 2LKZA 1RT6B 2JFKA 4S0MA 3ZNJ1 1U48A 1UVJA 3KLVA 2QFIA 2IDLA 3C3LA 2F40A 2KM8C 3ISNC 3K59A 4J9NA 2KYXA 5GMEA 2ROGA 2LLZA 3QSIA 1NK5A 4LF7J 2ZUAA 3DRXA 4MYUA 2DR7A 1BGXT 4LVOP 5CD4A 3M8PB 3S8SA 5B0EA 3EPIA 3DM2B 4ES2A 3G87A 2Z58B 3WIUA 3LWLA 4LRDA 3HK2A 1D8YA 1IJFB 1S6QB 3W65A 3VQSA 2XMAA 3AQOA 1UFWA 3HF5A 2KT2A 3ZZUA 5EWFA 1FO1A 2XMUA 4OI2A 4FS2A 3A13A 1I3OB 4ED2A 1IR2A 3PO4A 1QY7A 3M30A 5D4LA 5IC6B 5A6PA 3K8WA 3MMAB 2B4PA 4C8MA 1NJXA 3K5LA 1XR5A 2FZKB 3NOCA 3OVBA 1T11A 4YEAA 1FKOB 2EKNA 2VKRA 5J2QB 3HKWA 4CQ1A 1HNXF 3IR5B 2HNYB 4PG8A 4CLFA 2HWIA 5GAEU 3MR2A 1YJUA 2ZJPQ 3DLLQ 2KVQE 2FHMA 3BDPA 1I94F 4M5GA 3J7Z5 1FJGF 4X4VA 1Z2ZA 3PO5A 2AU0A 1M1HA 4QR1A 2DJWA 2GHPA 1OS5A 4X4NA 1VBYA 1BY9A 3CWJA 1RTJB 2VPYB 4DV2F 1CJVB 2P8IA 3LP2A 3OTDA 5K14A 2E9RX 1IKWB 1MLAA 2DPIA 1H2UX 2YWHA 3M6UA 4NE9C 4B3RF 3BR9A 4KGXB 2KI2A 3C14B 1HWKA 1T9UA 1WELA 3FEXB 5CYQB 3PYEA 4P52A 1WI6A 4F2RA 4OYXA 3L3CA 2AGOA 4O3PA 2HQ3A 3OFGA 4NRTA 4YR2A 2LQ9A 3CC4S 3GMGA 3D28A 2DHXA 2YNIA 5HI7A 5D77A 5KFEA 3N5BA 4O0NA 9ATCB 5HMYA 4W4MA 4K0KJ 4FXVA 2ZBQA 3HHLB 4DSEA 4JB8B 1N34J 2XMMA 1QDUB 2FUG9 3AA9A 1V3ZA 3TAMA 1RWNB 5K5MA 5C25A 4Y2MA 1TV6B 3DKDA 3PW7A 3C6TA 4BC9A 3HSDA 2HWHA 4QR2A 4QWAA 1N36J 2HYIB 2XLJA 4DX7A 2HHHJ 4ER8A 1SJ1A 4DF8A 4Y2KA 3VQTA 4ES1A 2QLXA 2WOMA 1XBWA 1XTZA 2LQ8A 4DU8A 4EUVA 2B5JB 2MKCA 1J5EF 3NGTA 5GMKa 3NBPB 1HR0J 3OTEA 4C7QA 1S4EA 1LK5A 2MKHA 1F60B 3R2DJ 2XWXA 1S59A 3ET6A 3B54A 2OFHX 3FCWA 2RQKA 4KBIA 2GGPB 2OAUA 3MEGB 3GV7B 2ADCA 1N5QA 4Z7YA 1U1LA 2VF3A 3BGFA 1QLNA 1GXLA 1VBZA 4KV8A 3P4UB 3U1LA 1Q53A 2UUAF 2MJUA 2IC3A 2VBXA 3CMQA 1TKDA 4IR1A 3RUBL 3NP5A 4K50A 1S1TA 3FFIB 2ZH5A 4CIOA 3GTYX 2K7KA 2IIHA 1B0PA 2PMZD 4HHUA 1Q78A 2RDDA 2DNQA 3I4PA 1KVIA 1RTHB 2O3DA 4DR5J 5B0DA 1S48A 3CCES 3M2RA 3W5ZA 4ILLA 2BBEA 3MECA 3CJ3A 2WB1D 2ZC4A 4OHXA 4LSNA 3GIIA 4KO0A 2WBMA 3TWZA 4FN5A 4F7VA 2F5GA 3MEDA 2GQ2A 3IGNA 1TVRA 1R0BG 3QZ7A 5GVQA 4BHQA 5DETA 3MPWA 2NREA 4CH1A 4WK3A 2DRBA 5T7LA 1VBKA 3H5XA 1IBMJ 1HQEA 2IVFB 1C0UB 3EMTA 4JI0J 3IFEA 3RG6A 3H42A 2DY1A 2B8QA 4RW8A 2B43A 2NYHA 3KJVB 2W4CA 3Q0AA 1KOHA 2HGMA 2DD8S 4M5HA 1FE4A 4IFVB 3Q8QB 1TL3B 2WAQD 1YJNS 4L76A 3DI6A 1SH3A 2ZOMA 3K89A 3GYXB 1D9DA 4CLKA 4ZLPA 4CH0S 4KKOA 1AA1B 4DV0F 1KR4A 3BYPA 3R5CA 2RD5C 2PMWA 1R8HA 2V50A 5F8NA 2OELA 4YMEA 3LAMA 1S72S 2VDIA 3EYZA 3FBFA 3MM5B 4N56A 2AT1B 4OLOA 1REVA 2QSWA 3PRBA 2Q6CA 1WSRA 4J9UE 3MTJA 3GYGA 5L9XA 4A8QA 2HURA 2HRTA 1PSDA 1WI8A 2C2MB 4Q5VA 2HHSA 1HNVA 3D1QA 3K8VA 1M5OC 1LV5A 1KTQA 1WOSA 2NCKL 3SV3A 1R43A 5J1EB 3DRSA 3V4IB 1CEZA 4CNYA 1PJ7A 2XGQA 4LF4F 2V2VA 5KOWA 1RAOA 2F8MA 5E41A 2FY1A 4RW4A 2LCWA 1ZZFA 1MWYA 4WPAA 2F9DA 1RJJA 1SJ4P 4O44B 5IT9Y 1D09B 1URNA 1FCAA 4M63A 4PEOA 5HSPA 2OMOA 5DDQC 3HFKA 4ZCIA 4LSLA 4ZPAA 1Y9OA 2VC0A 3AA8A 3OL8A 2HZCA 3DRRA 2C3UA 2YKNB 3R27A 2AQ4A 2FQQB 4EFAC 2UUTA 2FC8A 2GIFA 3BR8A 5HLFB 1X60A 4O4GA 2JVOA 1F1BB 3MAAB 2E9ZA 4DSFA 1IKVA 5KFAA 2W2NP 3LAKA 1T94A 2KFNA 3IWNC 5DM6Q 4M5DB 1B7YB 1LWCB 3I32A 4NASA 1JXEA 1SV5B 3PHEA 4CO0A 3FSXA 2EK6A 4C11B 1RT7A 4OIXA 1VQMS 1KLMA 1CBKA 3IM8A 2OLWA 4ILMA 4ES3A 5F0WA 1U0HA 3VHQA 2HQGA 1B64A 1Q4RA 1Q8IA 2MMYA 1QTNB 1O6XA 6AT1B 3PJXA 3QWPA 3DGPB 4QIFA 3QMQA 4DPYA 3WX4A 2HVIA 1B99A 1ELOA 1QVGR 2IM1A 4GKJJ 3MM9A 2VH7A 2DR8A 2CPJA 4A8FA 4OI0A 1RHKB 2FY8A 2DNMA 2RKIA 4C0HA 1V6HA 3P49B 1T05B 4DL7A 1U1MA 4WYWA 5LMNF 2G9OA 3VAMA 3BZQA 1M5KC 2KXHA 2HRUA 4Q2MA 5E3CA 2DITA 3T9NA 3H4BA 3A12A 3ELHA 3IBFB 1RTDB 2CQCA 4I7FA 1U02A 4ZPWR 1EAYC 2Z8QA 5G0RB 4IRKA 3ADAC 2R7UA 3PW0A 2FPHX 3NS5A 2VASA 3VZHA 3K58A 2AGQA 1JLAB 3IRWP 5CYJA 1B0TA 4X2BA 1PYOB 1KHVA 2BW7A 3DOKA 2ZJRQ 2O01C 3TZYA 4C8ZA 1BQXA 3CCWA 4AL6A 1F9EB 3PY8A 2MSTA 2V4RA 1JKHB 1JLQA 1I6JA 1NZAA 4I64A 2HGLA 1NUEA 1X5TA 2RUGA 4LF6F 3DLBA 1UVLA 4N76A 2AMCB 3D0IE 2DR5A 3DXSX 3TOQA 2Y8WA 2VJVA 4CTAA 3KLGB 2J9EA 1NJYA 3L7PA 5KFFA 4NI2B 4USJC 2VB6A 3ITHA 3KUHA 3V4MA 4BCAA 1AFIA 4R0EA 2DT9A 4ED4A 1G7CB 1S9EB 2LA4A 4JYAJ 5G4DA 5ETTA 5ETMA 5T41A 3WC0A 4ZVGA 2DH9A 2JRSA 3EDRB 4IG3B 1DTQA 1HL6A 1ULRA 3CJKB 2AP6A 2J0SD 2XI3A 2I0XA 4ZDNA 3I9ZA 3A3PB 1Q79A 1WACA 4HHJA 3LANA 3OT9A 3OLAA 1RUSA 4QIEA 4ZN1A 2OPQB 4KAIA 1YRTA 3Q24A 5L1JA 4DG1A 3M2UA 4RU9A 3T9ZA 3EZ5A 5M2UA 2IDEA 3G86A 1YJ7A 4A8YA 5F8LA 4O3QA 3CD0A 4WE1B 2ZKUA 5DS7A 1YRUA 3MTKA 1NU4A 4A4JA 3KLIA 4ILRA 2RNEA 2MZTA 4DUYJ 2CJQA 5B0GA 4LVNP 2JLFA 3H2UB 3L7OA 3WHIA 1U1NA 5A8RB 2EEYA 2D9PA 1R31A 5KFBA 3TEHB 1LXNA 4B3MJ 1M5SA 4N5SA 2Q1LA 3LGMA 4W90B 4WK1A 3IS9B 2ZUGA 3EXCX 3CO0P 3CIZA 1HHQA 3KG4A 4NLRA 2CQ2A 2VG7B 3EM1A 3C15A 4OL8A 2KU7A 2QA2A 2ZD1B 4XDDA 3A8KA 3RAQA 5BYQA 4DCOB 2ZNZA 2RILA 4P73A 1WC4A 1NM2A 2DNGA 3U27A 2LEPA 2GZOA 3DMJB 2R8GA 2GNKA 1YBAA 3R6LB 1NK0A 1BXNA 3HO1A 4DL4A 4C48A 1F3FA 4EO6A 4LIRA 2F3JA 2UXBF 2F65A 1M1GA 2UV8G 3QJPA 1HBNA 2J6TA 2YPZA 3TVZA 3RW6A 4QWEA 5MLCV 1TAQA 3MR5A 5C24B 1QTMA 1UEVA 3GFHA 3OFFA 4LF8J 2KJWA 1S0OA 3OL7A 2KO1A 4NMLA 2B9YA 1JLCA 4B9VA 2N3LA 4NXMJ 3BH7B 4GKJF 3I0RB 4J7CA 3BB5A 1FXLA 3EGVA 3QGGA 1NRKA 1WJ9A 1U45A 3GWCA 1HYSB 2A1BA 2XTCA 2P2CB 3NRBA 3VWSA 1IKYA 3M30B 5CZVA 2V2ZA 3BGUA 2RQ4A 1PBAA 3M1VA 3OHBA 1VRTA 1EETB 3NMRA 4DPTA 4XPEA 3HVRA 1VIXA 3AWRA 1RTIA 1RHUB 3ZZYA 4DR3F 3TA1A 3D6FB 5L8RC 3KK1B 3E3XA 3L4BC 1PJ5A 3C2PA 2W9AA 1U49A 3OQ2A 1Y7PA 1MMLA 5GAHU 3CC2S 2AW0A 3IA0A 2RU9A 4YB6A 4JI5J 1R0CB 1WF2A 2F7VA 4M5MA 4DOZA 4P75A 1JLFB 1HNIB 3D68A 4U7UK 3H5YA 4N7TA 2WONB 2V4JA 2V8PA 2YKMA 3RB6A 1F6TA 2VOPA 2V5HG 4RUAA 1F2HA 2ZBRA 4TKTA 3BO4A 4G1PA 3NKYA 2C42A 1S9FA 4OYPA 1ZETA 3K5MA 1L3SA 3QQCD 3BV8A 1SH0A 3NOGA 1KVJA 2UZAA 1FKPB 1FEHA 3H5UA 1WC3A 5HMXA 2BJ9A 2KJVA 2V8GA 1PYTA 4DV7J 4Q8EA 2A2DA 1R89A 2APOA 3NCQA 4JP8A 3MMJA 2E5LJ 8ATCB 3LQVA 4RNHA 4I56A 3AOAA 2WRMA 3CCSS 3I6PA 4I2QA 2VG5A 2VG6B 1HQ2A 4E2FB 3EPGA 4L3NA 2WSCC 5B0AA 4ZVQB 3NGKA 1HKAA 1T3NA 1ZS6A 3AAWB 1CJTB 2C3PA 1QVFR 5KG5A 3SFUA 1MWQA 1U47A 1T9WA 4DZDA 1A7GE 1KN6A 1PAEX 2K1RB 2QLJB 1GQEA 4PG6A 1NCLA 2O5DA 4MFBB 1SPBP 4PPDA 2WOMB 5BJRA 1XMQF 4I6YA 4YQWA 5DG7A 1RT2B 2VC1A 2Z4PA 4DHVA 2VDHA 1OO0B 2RF2A 5J2NB 3R9LA 4OJ3A 3CCRS 1CULA 2O67A 1SB6A 2CQBA 3BO2A 2UUBF 1Y5IB 2HFSA 2NXNA 4RW7B 3NEKA 4P2SA 1Z4UA 5CQGA 3MR7A 4X4UA 5IOLA 2DNZA 3MGJA 4CNZA 1N6QA 3C6UA 4KV8B 2V9KA 1APSA 2BE2B 1VRQC 4NLQA 1ZTWA 1Q81T 3SQGB 4H4KC 1YWXA 1IR1A 1WKLA 3JSBA 4QQBA 4FKXA 1S0MA 1S1TB 3KK3A 2LEBA 3JQKA 3G8SA 5HQMA 1C4CA 1TUVA 3JS9A 5HP1A 1G4CA 1S76D 2F4VF 4O3RA 2MKKA 1Z1ZA 2YWKA 3D6HB 4UQGA 3PFOA 1XQIA 2RAQA 4XO0A 3GIMA 3AD9C 1FA0A 3QT8A 3DLKA 2H65B 4NXNJ 2YNHA 4DCPB 2J0XA 3BGRA 1X4GA 1S1UB 5BYRA 5KFCA 4X62F 4OV6A 5HMZA 2RVJA 3UR3C 4LSNB 2DNNA 4DSKA 1CJUA 2XMVA 2M7SA 5HMWA 4I0WA 4KE5A 1FK9A 4DV6J 2FJDB 4ID8A 1H73A 1QJHA 4NXMF 1RAGB 3Q2TC 2QV6A 4C8OA 3D1OA 5T7LB 3FZ2A 2HQIA 5F9NA 5A8KA 1KD1T 3OW2R 4F3OA 2I5JB 2CPIA 1Q95G 1EJ7L 3PYDA 1TK0A 3PX6A 4QYZJ 3U1NA 1RAFB 4RPFA 1IR0A 2XCPA 4F8RA 5A2QU 2CJAA 1ZPWX 2MSSA 1YBUA 1T95A 2HHTA 4J9PA 2NS1B 3NAHA 3WX8A 4FP9A 1XC9A 5HN0A 3EICA 1XN9A 2RRAA 4JI2J 2XM3A 4TQRA 4JBCA 2E1MC 3AX3A 4DN0A 3Q8SB 3DU5A 1GAOA 2XC9A 3KUEA 3K5OA 2B6AA 1XERA 3PW5A 2FLNA 4BWMA 2DCUB 3QT7A 4C97A 2D3ZA 3VALA 3OR2A 4JI6F 3KOAA 4DJBA 2POKA 4QPTA 5DZ7A 2R9LA 3GJQB 3NWGA 1DAXA 1UJ6A 3NNCA 4RW9A 4A46A 4ETXA 4ANEA 5IQ6A 5F8JA 4W98A 3N6LA 4X66F 1LWFA 4A8SA 3FSYA 1RT4B 2XMKA 1UETA 4MMOA 4GKKF 2X1FA 1YLXA 1HLWA 2RMLA 4OV1A 4Q0BA 1HNVB 1C0TA 1TL1A 2EXUA 4ELTA 3M8WA 1R8BA 1Y00A 3CIMA 4GMKA 5KFXA 5HJXA 4X84A 4C0BA 2ZBPA 1AB8A 4C4WA 2ZH9A 1C1CA 4ETZA 3M6VA 5DDOC 2HFVA 3OTOJ 2G2OA 4DS5A 2DRAA 1QUVA 2NZ4A 2IJFA 1T03A 3JSMB 3PKYA 2AJ1A 4FS1A 5ETOA 3QRPA 1ZM9A 1HHSA 3OVAA 2H5IB 4RLEA 3T5JA 1HA1A 3JQMA 3US5A 2OPPA 3PVXA 2GQQA 4LSLB 1L5UA 4C9DA 3HHKA 3H5SA 3WZ0A 3HHDA 3JB9k 3PKMA 3F0NA 4NCAA 5KOXA 2J6SA 1T9VA 1UTAA 3VV2B 1YTYA 5SZTA 3HD1A 1QSSA 1HI1A 2GMJA 3TJ9A 1Q7LB 2RQMA 2Q79A 2HVHA 2ZHBA 1HW8A 3MM6B 3T5HA 4OMFG 3JAMU 1NJIT 4DR4F 2HQCA 3GILA 2ZVIA 4WU2A 2LQJA 3MFIA 1S6PB 2Z56B 2AGPA 2DRDA 5D0GA 5ITHA 4NYZA 1N88A 4NLUA 3D6TB 2LP4A 4KQZA 4H4OA 5A76A 4UY8T 3IC1A 4P6QA 3R6GB 1PYSB 4URGA 3EZOA 2UVVA 1OY8A 1RT5B 1F5CA 2AJ4A 1ZM4A 2L9DA 3R5BA 2YWWA 1GMUA 1NK7A 2FDNA 4NLOA 3CMAS 4QOTA 1YK9A 3O5TB 3D54A 4U9RA 2WZ1A 3UPFA 2HZAA 2HHVA 2RKIB 4USIA 3TRGA 2ZH4A 1N5TA 3T19A 5K9FA 4K4ZA 2W7AA 3A3OB 5HVHA 4EBCA 2KHCA 2G2YA 1R3NA 4PG4A 4CLUA 3OPKA 2ALYB 3M32A 2VFVA 3UCZP 3A8IA 5KFVA 2X51A 3U7JA 2P5VA 2QZ8A 3BPSP 4DN9A 2GMLA 3Q2SC 1JLGB 4PQUB 3G6XA 4DV6F 3VGUA 4IDKA 4FF1A 3IRXA 1CG2A 1TFYA 3IP0A 2MQNA 4JI4F 3G4SS 4LRAA 1VQPS 2M0GB 5C42B 2NUHA 1JB0C 1JLEB 3A3NB 2AWZA 1S79A 4ZCKA 3W9HA 1DTTB 4Z2XA 4FPRA 3B4MA 3L9ZA 1S1WA 4Y6IA 3TUJC 1HD0A 3B4DA 4TVAB 1RYSA 1IBCB 3ISND 4JV5F 3HVWA 1RBAA 4RNNA 4IFYA 1E6YB 1A0OB 1X4AA 2JOQA 4R5PA 1PILA 1RWMB 1FNMA 2GVDA 3MEEA 5KFPA 2DHHA 1N0UA 3RYLA 3V6JA 3GFYA 2YY3A 1TMJA 1NB7A 2E5IA 4C3LA 4PWDA 4ED0A 4DSIA 1T3OA 4ZHRA 3IMQJ 5AE2A 7AT1B 3S6EA 3QNWB 1E6VB 5KFUA 2DEIA 2E9TA 2I38A 4NLWA 2B4OA 2HFUA 3UVJB 2GQCA 3M05A 3ZNUA 3TUPA 5KG6A 2YNFA 3V6DA 4ECTA 2PE8A 4YFUA 3PYFA 3HPOA 1EX8A 1G3OA 4H4MA 3PR4A 3CXCR 3T41A 1QUPA 3QSYB 1DBDA 4ECRA 3QATA 2ZZMA 3I0SA 2MTLA 3H2VE 3DOMA 1EP4B 1LNQA 4OX7A 4DR6J 4TLRA 2IYIA 1BMQB 3THVA 3OTOF 2XCAA 4KH1B 3W2VA 3PCOB 4HEA9 2F8HA 3I5BA 1KQKA 3G6YA 5L38A 1U6ZA 4X4PA 1CC8A 1DQ8A 3FCHA 2HK2A 4LSZB 5C5JA 3M7VA 1REGX 5AXMA 3KG1A 2BW2A 3R5GA 1KS2A 2PC6A 2VPZB 3JXOA 3UO0A 3PRVA 2DCLA 2Q6BA 1KFDA 2HMIA 1YG0A 3N9UC 2G0IA 1UA1A 1SKWA 3VGTA 3G6ES 3ZTQA 4C98A 2XS2A 1LXJA 4LR7A 5ETKA 5L39A 1P1TA 3J81Y 4R0JA 2Y3YA 1WTBA 1YQHA 3MPYA 3HCXA 3QIPA 5EN1A 1RABB 3ETMA 4L72B 1LW0B 4FNIA 3J7YI 1S9GA 3B82A 3PACA 2CNKB 3TP2A 3ENQA 3MM7A 2VU5A 3OD2A 2KFYA 1IKXA 2BE9B 4I68A 1KKHA 2J9DE 2FD2A 3GFZA 5F8HA 2AD9A 1TKXB 2CJ9A 3QFHA 4DV5F 1SIZA 1FE0A 5E0OA 2ZWOA 4JI7F 4AT1B 3LWMA 1CQNA 3OXGA 1LWEA 2CJBA 4MKYA 1L3VA 4RWWA 1U0SA 4DXLA 2YWFA 2H4YB 4UOCA 2SXLA 4N8NA 2DXFA 1NBEB 4DI6A 4NLXA 2DGWA 2HFZA 1LKZA 4U7UD 4LUBA 3M9MB 2RUSA 4DV4J 3VAHA 4X64F 2KT5A 2QIFA 2ZOGA 4ICLB 1RE1B 4B17A 1RXOB 1B3TA 1RWPB 1SL2A 5HVFA 1VJQA 3NS7B 3PTWA 4ECXA 1CC7A 4ZJOA 4Y2AA 1OQ6A 2FVCA 1SJRA 3QGIA 3BBFA 2NXUA 1UAWA 3K5NA 4LQ9A 1NHVA 4FBTA 3EJMA 1QE1A 2JSXA 2E7XA 2QN6B 2IAJA 1FWPA 1V5IB 2YNGA 4KC5A 3GCWP 2CQIA 2J0WA 1WG1A 5I3UB 4KJIA 1SI9A 3UW1A 5DJBA 1SUQA 5EX0A 4M8LA 2GIRA 4WFXA 4ECVA 4ZVSB 4B3OA 1GNKA 1N8RT 2B7BB 5GADU 2X3GA 4ZVHA 5AE1A 2Z0GA 4YY3F 3JYTB 2W7OA 2YWEA 2EC0A 2Q3PA 1JQGA 2C2NA 2R2UA 3G82A 4KFBA 3OJUA 4DX5A 3HFZB 2E1AA 3R5DA 3CEDA 3MMBA 3QO9B 3MZIA 2MQOA 1RT1B 2V0NA 3CJ4A 1S6OA 2X3DA 5HAOA 4CO4A 1KQGB 1FFSB 3G2XA 2IA0A 4V19X 1IQZA 1ZOTA 3EX7B 4R8UB 2VUGA 2LQBA 2KH9A 3DLGB 5K8MA 1K0TA 3TARA 1IBKJ 2MGZA 2ATLA 1RWXB 5KFWA 2V94A 2AX0A 2W24A 3QPIA 5BYSA 2A0FB 1LFWA 1WEXA 3NGUA 3HKZD 3SCLE 2QMUB 3EVWA 2VG5B 1M5PC 4NLVA 5HROB 2IM3A 1CJKA 1IVZA 1S7IA 3M8QA 2QGFB 3RZAA 2GAHC 3HI9A 4U6PA 1JJ2R 3IGVA 5ETPA 2UVWA 4X4RA 2JLGA 2L08A 1T9YA 1NK4A 1OPIA 4CO2A 2EFNA 2WSEC 3M9OB 2HVEA 2BRKA 1NJWA 2KN4A 2HQDA 2HAFA 2KZMA 3IWLA 2EVZA 1H0HB 4RWXA 1S1XB 2G1DA 2QL5B 1FD2A 4I2PA 3K57A 4DL2A 2MHNA 2XULA 3H4DA 2XTJP 2VZ9A 2EI5A 1TU0B 5LMUJ 3E01B 4NLTA 4K4XA 4F26A 4J37A 1NPKA 1T02A 3OTCA 3MOZA 1BWVA 1GMVA 2P9EA 3OXFA 4MK9A 3RBDA 3HFVA 2C3YA 2HNDA 3BBCA 4ZA1A 5EDWA 2RF2B 5KFIA 2CA9A 2HVDA 4JI8J 2ILYA 2A6MA 2PGCA 3PEJA 3MMCB 4Q7AA 1FDAA 1XR7A 3HHLC 4E0DA 4YB1P 2ADBA 1AW0A 1N32J 3KYLA 1R6YA 4FPIA 3WBZA 3GP9A 3N6MA 4OZ2A 1HIYA 3ISZA 4DUZJ 5D6GA 2A10A 2QA4G 1FWKA 3W62A 1RADB 5J2MB 2ASJA 2C3OA 4K4UA 3BQ0A 1MU2B 1HMVB 2ACMA 5KFNA 2MY7A 2FLLA 3VVTA 2D74B 2W1BA 4WTYA 4KT0C 1RQ0A 4KGKA 5EWGA 3TA2A 5EUHA 1TP7A 5DG8A 2DO4A 1RSCA 4LRFA 2QTWA 2B4VA 4NLDA 1S49A 4WFAQ 3SBMA 4FVCA 4FBUA 4I6AA 1QAYA 2DVIA 5IM0A 4BDPA 3LUYA 4HACB 1CJUB 1KSPA 4B08A 2IM0A 2ZH3A 4MT1A 1TL4A 2B56A 2CFXA 2IMOA 1ZAXA 2DGUA 1YBTA 3BYRA 1WUUA 1RCXB 4ECSA 4NL5A 2BUNA 2V63A 3FRZA 2LDIA 2IBKA 5H9FJ 1R7IA 2XYHB 3EXYA 3H20A 1NJZA 2OD4A 2HEKA 4UOFA 3G71S 3MM8A 5FDLA 3VAIA 4P9SA 2OGUA 2ZDPA 2W9BA 3X3UA 4J91A 2CQDA 2IRXA 2OIHA 3DYAA 4RO0A 2ZH1A 2J6UA 1WDDA 3IO1A 2QL9B 2G4BA 5IC4B 4OZLA 3FBEA 4DV3J 2KTQA 3RBXA 1YJ9S 2CNOB 3BKUA 3DOLA 4DFPA 1HNXJ 2XG8A 4ZVOB 2H51B 4ZPCA 1S1VB 4DX8H 4P74A 3I5CA 5LSRA 3MUTP 3TI0A 2X1GA 1WWHA 4UQTA 3FNNA 2ZE2B 4WFNQ 1I94J 1ZZNA 2B7CB 1FJGJ 1Q8BA 5HBMB 2DNRA 1MG7A 4XPCA 1BD6A 2GMHA 4CLSA 5CXTA 3V81A 2CKWA 1YDLA 1W2BR 1DLOB 4CCHA 2EG2A 1VBXA 1RDRA 4NEYA 1LK7A 3HMJG 4CLLA 1RT3B 1Q8KA 1DHMA 4Q43A 4ECYA 2B51A 3MUMP 5I3PA 3THPA 2ZHAA 2D68A 3C8YA 1VCTA 3RTVA 4B3RJ 4NLYA 2H1YA 3Q8PB 1TKTB 6FDRA 3UN5A 3AOBA 2IRYA 3PIOQ 4UW2A 1U7LA 2RS2A 3D6MB 1U6BA 2I2YA 4KPCA 1PCAA 4WJBA 3AX2A 3QGHA 2OPRA 4ZN3A 2BQ3A 4OYMA 2EKYA 2GVZA 1HFEL 2RU3A 2CDRB 2N82B 2KT3A 1WC5A 1S77D 4QU7A 4DQIA 2I8EA 3MPVA 1NHKL 2LDYA 2GC8A 3D2WA 3AQPA 1Y3KA 4WIIA 3SYZA 4DL5A 1VQKS 1M1KT 4PZVA 1RHQB 2K2PA 3J80U 3RW7A 2H9ZA 2E1PA 2MXYA 4LR8A 2XSJB 2V2KA 3CJ5A 4B9LA 3FCVA 2I6WA 4QZVB 1NPRA 1FTRA 2AEFA 2MLYA 3SQOP 4ZLNA 3CDUA 2CNLB 2COLA 2LXUA 3O1LA 2F8EX 4MIAA 5E7OB 5KFRA 3LP0B 3H0PA 4H4OB 1VR6A 2GV1A 3MCOA 1RYRA 3UR0A 3AHPA 4DV1F 1DY3A 1WF0A 4ZVEA 1RLCL 2LECA 3CB4A 4DWIA 2Z30B 4PXDA 2CZ9A 1S10A 1U25A 3ZTPA 2UUAJ 2DXDA 2K3KA 2VV5A 5D4OA 1BC6A 1UVNA 3MR3A 4ECUA 1Y3JA 1C1BA 2CWXA 5AXKA 2HNZB 2FB0A 2BJ7A 4ZVPB 5F3TA 1Y10A 2LU1A 2VOOA 1HBOB 2XZWA 2J9CA 4NOHA 4P2MA 5FLXU 3M32B 2W9CB 2BANA 5GAGU 3OR1A 4B9UA 4EGLA 3KFWX 5EGYA 3SV4A 5KG4A 2P9GA 3DRYA 4OYAA 3KLFA 4NA3A 5J2PA 1T9XA 3RR8A 4ANCA 3TZXA 2WSFC 1TUGB 3SDEA 3NGRA 1GXUA 1HPZB 2PFFB 3W7BA 5HVGA 3D1HA 3PR5B 1KOOA 5IS2A 4GVBB 1U1QA 4B9MA 2D3O1 1TUWA 3CSKA 1Q5VA 3E51A 4LRCA 1R0AB 1RT6A 4N47A 3T1HJ 4K59A 4CH7A 2RSQA 3M8SA 4NYPA 4W92B 2C2KB 5DG9A 1MNEA 2XZTB 1RHMB 3P6YC 3CUNA 3QBCA 4HR2A 4AL7A 2OUGA 4C8KA 2AYMA 1Q1KA 1RAHB 3BM7A 4JV0A 4DV3F 1CS4B 3MDFA 2GVDB 1J2VA 4JI1F 3LPEA 1D8ZA 2ZWPA 1LFPA 3M8PA 4DL0C 4KPYA 2OPSB 3DM2A 2PMHA 2C22A 3KHLA 3PG9A 3N0VA 4MK8A 4LFCJ 3R97A 4DV0J 4ZHRB 1FT8A 1MROB 5IWAF 1S6QA 4WP3A 4IQMA 2P6SA 1LW2B 2WVFA 1UL3A 5E3PA 4A8WA 2UVRA 1KHWA 2XSFA 4HVZA 2Y0BB 3HZEA 4XIUA 3V6DB 3E2EA 2R4FA 2NPIA 4GO7X 2MKJA 1YKWA 3E8OA 2CPEA 2Y1RI 3MMAA 4ERDA 2EFOA 4I69A 1OMSA 4QU6A 2AIRB 1FRIA 1TQLA 1T7PA 2M52A 3M2VB 4MH8A 1NH7A 2BJ8A 4U95A 2H4WB 1FKOA 5J2QA 4USWA 1SJQA 4P7TA 5L1LA 1DQAA 2GHVC 2HNYA 2ROEA 2KHDA 1JWWA 2XMWA 4FVMA 2KVIA 4X65J 4LF4J 2XNRA 1VI7A 1GMWA 1FDDA 4CDIA 3GE9A 1X4DA 1XMOF 1GT8A 4KHPF 1WTFA 4BLGA 4NA2A 5F41A 3QRRA
chains in the Genus database with same CATH topology
4DR2F 2M3DA 2P6TA 3C6UA 2E5HA 4KV8B 2V9KA 1APSA 1K8AT 1NK8A 2BE2B 3R3TA 2YQ3A 1SKSA 4M94A 4ED6A 1PC5A 4NLQA 3PX4A 1ZTWA 4ZPDA 1DTTA 3G6VA 4RNFA 1Q81T 3SQGB 4H4KC 1VK3A 1SH2A 1YWXA 4TY8A 3UDCA 3JSBA 1QSYA 4JOUA 3ZZTA 4QQBA 4OLPA 1S0MA 1IKWA 4QIGA 4DG1B 1S1TB 1HI0P 3KK3A 3M2UB 4GC7A 4ZCMA 2LEBA 1Y5NB 4KB7A 3G8SA 1C4CA 2U1AA 1TUVA 2AX1A 4DS4A 2B0GA 1HI8A 5HP1A 4ATNA 4YHHF 1N5YA 3L95X 2ZNYA 1VQOS 1S76D 1IUJA 1X8DA 2F4VF 4OZ1A 3OHAA 4O3RA 2WCXA 4EZ6A 4C8NA 2MKKA 1Z1ZA 4NCBA 2YWKA 3PEHA 4ECZA 2R7TA 2G13A 3V81B 1E6YA 2EFPA 1HQUB 4CT9A 2ASDA 1TKZA 2CG4A 1GH8A 3K2YA 4UQGA 3T3FA 2DH8A 4IO1A 2DNPA 3PFOA 4XO0A 3GIMA 4AQYF 3SMZA 1FA0A 3KLIB 3DLKA 2KDOA 3MM7B 4KSEB 5FIIA 3QLHB 5J1NA 3SCJE 2YNHA 4J9OA 4F4KA 2QFJA 3I9V9 2J0XA 4KRWA 3T1AA 3BGRA 1X4GA 6FD1A 3GFXA 1S1UB 5BYRA 5KFCA 2ASYA 4X62F 3J7ZT 4C2MA 5HMZA 1VQLS 2RVJA 3NNHA 3UR3C 1F0XA 4LSNB 4LT6A 2DNNA 4DSKA 1CSJA 2D3UA 5U47A 5DM7Q 3S01A 3VZIA 5B0BA 2IHR1 2XMVA 2M7SA 4QW9A 5HMWA 4I0WA 4KE5A 1E6VA 2E5GA 1FK9A 3HHLA 5D4PA 2ZOFA 1GTHA 2FJDB 3IXQA 4ID8A 2OSRA 3FZBA 3ZZ0A 1QJHA 2XWYA 4NXMF 1A6LA 3SCKE 5KAKA 3Q2TC 2CDQA 1YJWS 2VFSA 2QV6A 2FHKA 4C8OA 2XLKA 1TV6A 1ZAWA 3D1OA 2OPRB 5T7LB 2EBEA 3FZ2A 2HQIA 5F9NA 1D9AA 3HVTB 5A8KA 1KD1T 3OW2R 1L3TA 4F3OA 2I5JB 2YKQA 2CPIA 1URRA 2NSBA 1KLNA 2VFRA 1WF1A 2J76E 3ICLA 1C4AA 3FSIA 1FRMA 2CQ4A 4A48A 3PX6A 1TK0A 4QYZJ 3U1NA 2R7QA 3H98A 1H7WA 1IR0A 2XCPA 4NZ0A 1SL1A 4F8RA 3POTB 3F44A 4Y65A 2CJAA 3CF5Q 1ZPWX 2MSSA 2MY8A 2OFGX 1T95A 2HHTA 3F41A 4J9PA 2NS1B 3NAHA 2GJIA 4IG0B 5IXUA 4TYAA 4J9MA 2QO3A 2UVUA 1JLBA 4FP9A 1XC9A 3FVYA 4Y2CA 5HN0A 4NWBA 1XN9A 3T5KA 1F9FA 1NAQA 5DLFA 2XBPA 2M4MA 3IG1A 4HT5A 2RRAA 3W2WB 2XNQA 2P9CA 4TQRA 3N4WA 2HFOA 1VQ8S 1EP4A 3MD1A 2B5JA 4JBCA 2E1MC 4U67Q 1IBKF 4I67A 5A2QY 2GX8A 2VQEF 3OSNA 3V6HA 3MI7X 4RNMA 5SUHA 4DN0A 3Q8SB 1VQ4S </