3OL7A

Poliovirus polymerase elongation complex with ctp
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
molecule keywords Polymerase
total genus 143
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3ol7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ol7A02
4ZPAA 2V4RA 3KK2A 1DLOA 1S1UB 3I0RA 2ILYA 4ZHRA 4R5PB 3C6UA 2RDJA 3IGNA 2FVSA 2R8IA 1S9GA 2BANA 5EWEA 1JLCB 4LSNB 4KB7A 1TL1A 1RT3B 3BQ0A 2VG5B 1S1WB 1MMLA 3LAKA 1SV5A 5JXSA 1S6PA 2YNIB 2W9CA 5L9XA 3RAQA 5EUHA 1TKXB 4FBTA 1RDRA 4DL4A 4EEYA 1FK9A 3T5LA 4MKAA 3MECB 5KFTA 1RT4A 3RAXA 3UR0A 2V0NA 5KFRA 2HNZA 2ZKUA 3OHBA 3KK1B 3GIMA 3KHLA 4IRDA 4ZPCA 5KFKA 1D1UA 1LWCA 5KFGA 1RT5B 2XWYA 2YNFB 4H4MA 4MK7A 4IFVA 1KHVA 1IKYA 3UQSA 1JLQB 5KG5A 3QO9A 4ZP9A 2XI3A 3KLEB 3KLFB 3MTKA 3HHKA 4DL6A 1C1BB 3V6DA 1IKWB 1TKXA 1IKXA 1DTQA 4KO0A 1C0UA 3BSNA 4ECQA 5KT7A 3V6JA 1VRTB 1RT7A 3OL9A 3H4DA 2C2DA 3UPFA 4MIBA 5DG7A 3N6LA 1HYSB 3E01A 3T1AA 3RB0A 1RA6A 4Q45A 3V4IA 2WONB 5EWFA 4K4UA 3MEGB 3CIZA 3BSOA 3BQ2A 5HROA 2FJVA 3OL6A 1REVB 1HARA 3DM2A 5KFAA 2DPIA 2IM1A 3OL7A 1EP4B 4QPXA 4JV0A 4O4GB 5KFLA 3KLFA 3M9NB 3IG1B 2W8KA 1R0AA 4F4ZA 2FLNA 3DLGB 1IKWA 4IFYA 2J6TA 2YKNA 5CYMA 2B43A 5KG4A 4JUZA 3MF5A 3M8PB 1RTDA 3DOKB 3JYTB 3KHHA 4EYIB 4EBDA 3D28A 1QE1A 4X2BA 2YNGA 2HWHA 4ZVHA 2VG7B 3QIPA 5K14A 5KFFA 5J2NA 3MEEA 3PZPA 3PW4A 2FVRA 2GIQA 3FFIA 4K4TA 3CJ2A 2R2RA 4GC6A 2D3ZA 2E9ZA 1IKVA 4IQXA 1GX5A 2VG6A 5EWGA 4PWDA 5KFPA 4Q43A 4WFXA 2RDIA 5DGAA 4YP3A 4MK8A 3RBDA 1NHVA 4ZMMA 3MEDA 5I42B 4WZQA 3DRRA 3HVWA 1S1TA 4ZVGA 2ILZA 2C2EA 1J5OA 2XI2A 5CYMB 1JX4A 3V81B 1RT6A 4EBEA 2IJFA 1S97A 3BSCA 5FDLA 2HMIA 5C42A 2W7OA 1RT2B 4DG1B 3G6XA 4JV2A 5J2NB 2XCAA 3ITHA 3KLVA 3NBPB 3DOLB 3DRPB 3CDUA 2W9BA 3RB6A 4RW4B 3IGVA 1HQUA 1W25A 3FQLA 3HVAA 4ZP6A 1S9GB 2BANB 5J2MB 1EETA 1ZTTA 4ECYA 4J9SA 1RT3A 4QWBA 4ZVFA 1CSJA 3NMAA 1TKZB 3CDEA 4EBCA 4ICLA 4NCGA 2BRKA 3KLHA 3EPGA 4ECWA 3DRRB 1HMVA 1ZETA 4ED7A 4EO8A 4ZHRB 2RKIA 3LP0B 3DMJA 2JEJA 4PQUA 1T94A 2BE2A 4H4OA 4ED6A 4PUOA 3GILA 1QAJA 4RW8A 2OPRA 1BQMB 2GC8A 1LWCB 2YKMA 1YVFA 5KFDA 3H2LA 3H5YA 4RU9A 2ZE2A 3LP1A 2RF2B 4IH7A 3KLEA 5I3UB 2ASJA 3DYAA 4KFBB 5KFUA 4ECUA 2W9AA 3V6DB 2YNHA 3IS9A 1NHUA 3M8QA 3QLHB 1N6QB 3PHEA 3T5HA 3KLIB 1C2PA 1I6JA 4MK9A 2WRMA 5C25B 1JLGB 4QWCA 4NZ0A 1C1CB 1S1UA 2JC0A 3I0SB 4IOBA 4LSLB 4RW6B 3IN5A 3RB4A 1D0EA 3SFGA 4IKAA 5KFCA 2ASLA 2UVVA 1N48A 2FJWA 4KSEB 4WFYA 4ED0A 2OPSB 2YKMB 2WOMB 3CVKA 1IKXB 4KO0B 4ZP7A 1TQLA 4K4XA 3BREA 5T14A 1EP4A 2O5DA 1R0AB 3QZ7A 3DLEA 1XR7A 1UWBA 1KHWA 3DLKB 5J1EA 2OPQA 4J9LA 5DLGA 3QLHA 2YKNB 4YMEA 2IAJA 1HNIA 4IG0A 4ID5B 2WONA 3GIJA 4Q8FA 4NLQA 4KV8A 4Y34A 4WE1A 4J9MA 3KK1A 4MKBA 1LWEA 2IM3A 1K1QA 4XO0A 2VG6B 3Q8PB 4G3IA 3DLGA 5KFEA 2AGPA 3FQKA 4RW9B 5KT6A 2ATLA 2UUWA 1C0TA 2C28A 1S1XB 1S1VA 4B3OB 2YNIA 4J9QA 3GIIA 3KLGA 3KNAA 5F8NA 2BQ3A 3LALA 1JKHA 4G1QA 2UVUA 4NLOA 1RT7B 3QGGA 2WHOA 1HNIB 3ISND 4IG0B 3NL0A 4KKOB 1S6QB 4FS2A 2C22A 3V6KA 1RT2A 1LWFA 4LSNA 4F50A 4XPEA 3DRPA 2OPPB 1TVRB 1VRUB 2XGQA 1T03B 1RTHB 4RNNA 2XGPA 4QW9A 4J9PA 2WCXA 3BSAA 3MEDB 4FBUA 4URSA 1HQEB 4IFVB 4MH8A 4RUCA 3KHGA 4GC7A 5HP1A 3SI8A 1S10A 1C0TB 4R0EA 3GV8B 5J2QA 4I2QA 4KHRA 5DG8A 2V9WA 3KLGB 4NLRA 3DRSA 3M9OB 5KFYA 3NBPA 2DPJA 4DL7A 3DOKA 3FRZA 2UVRA 2UVWA 3G86A 1RTIA 3FSIA 2IC3B 2RKIB 1TV6B 2HNDB 1QE1B 3LP0A 4MFBA 2IA6A 4H4OB 5F8MA 5C24A 3KK2B 3QZ8A 2UUTA 3VQSA 4IG3B 1WNEA 3BJYA 4K4SA 4ZPDA 4NLGA 2WK4A 4NLUA 1TKZA 3PJWA 3GIKA 3DI6B 2BR0A 3CJ3A 4ICLB 1S9EA 1JLEB 4Q0BA 2I5JA 3TAMB 2AX1A 3OL8A 2W8LA 1HNVB 4RW7B 3IG1A 4HYKA 5KFBA 4TN2A 1SH0A 1FKPA 1TL3B 2ZD1B 4TYAA 4RNHA 1FK9B 3HVTB 3NGDA 5KG6A 2JEGA 5C42B 5J2PB 5DGBA 4Y2AA 3MR6A 3JYTA 3MEGA 5KFHA 5CYQA 5KG0A 4QWDA 5KFNA 4KHMA 1N5YA 2QE5A 5HBMA 1BQNB 3Q8SB 3H5SA 1S0OA 4LQ9A 1RA7A 3KK3A 2FVQA 4R5PA 2RF2A 2YNFA 2EC0A 4H4MB 3DI6A 4DEZA 3GQCA 4TY8B 4ECTA 1IKYB 4ED2A 5D3GA 2YNHB 4LQ3A 4TXSA 3NKYA 4ECZA 4Q8EA 2E9RX 1S49A 3KOAA 4TY9A 1XR5A 4IR1A 1RT4B 3DLKA 1C0UB 1RTJA 1FKPB 4DL5A 3NAHA 3LP2A 2VA2A 4R8UB 4O3PA 3KJVB 1MU2A 1RT6B 2R2SA 1IKVB 5KFQA 4WYLA 4K4WA 4WE1B 2AGOA 1BQNA 2R8HA 1TL1B 2HNZB 4O44B 2ASDA 3KK3B 4QWEA 3JSMB 4O3OA 3C6TA 3BGRA 3KMQA 1RT5A 5J1EB 1LW2B 3QIDA 5KG2A 2BQRA 1N56A 3MR3A 4M95A 1JLBA 2BQUA 4FS1A 3HKWA 2B5JB 4Q44A 3TQ1A 5F8HA 4WZMA 4J9RA 4G1QB 5KFIA 1DTQB 4ECXA 4K50A 1DTTB 3IRXA 4RW4A 4WXWA 4WXOA 3PW5A 3GV5B 1T3NA 3ICLA 5L1LA 4NLPA 1C1CA 2BE2B 4ZVEA 4TYBA 1JLAA 5K14B 3DM2B 5JUMA 2XC9A 3OSPA 2CKWA 2E9TA 4RNFA 4RNOA 4WFZA 1JLQA 1S4FA 3CDWA 4TQSA 2R2UA 4NLTA 4O3RA 4B3OA 3T5KA 1JLCA 1TKTA 2HAIA 3BGRB 3H98A 2V4QA 1T05A 4PQUB 3T5JA 3QGHA 4EYHB 3SFUA 1JKHB 1JLBB 1UWBB 4MIAA 5KFSA 1RAJA 2B5JA 1S1TB 4NLXA 1RYRA 1QAIA 3N6MA 4OL8A 5KT3A 1DLOB 3I0RB 4K4ZA 3E01B 4I7FA 3IRXB 4QW8A 4ED1A 4KV8B 1RTIB 3M8PA 1RTHA 4DG1A 1NNDA 5F8IA 5KT5A 3ITHB 4IH6A 4KAIA 1JLFA 5L1KA 1S1WA 3H5UA 2VA3A 1S0MA 1HQUB 3H59A 2W7PA 1S48A 5HLFB 1IM4A 1HPZA 5J2QB 2R8KA 5I42A 3LAMA 1TKTB 3KHRA 4F4XA 1S9EB 4ECRA 3PJXA 4HKQA 3QO9B 3MFHA 4NLVA 3G6VA 4YR0A 4U6PA 3KLIA 3PR4A 5KFOA 5C24B 2AQ4A 3BR9A 2JEFA 3EPIA 3HVTA 3MEEB 2R2TA 5KT2A 3EZUA 5F9NA 4U7CA 5KG7A 4NLSA 5J2PA 3PVXA 1LW0B 1JLEA 2OPRB 2I1RA 2WB4A 1JLFB 4XPCA 4Q0BB 1T03A 5DQHA 4J9NA 5L1IA 1SUQB 4O3QA 1S6PB 3CWJA 4NLDA 1REVA 1Z4UA 2W9CB 3RBEA 5D3GB 3KMSA 1RT1B 1J5OB 4EO6A 1VRTA 4O4GA 1ZTWA 2IM2A 2HNYA 3QGIA 2FLPA 3DRSB 1HYSA 2F8EX 4NCGB 5CYQB 3PW7A 4I2PA 1BQMA 2FVPA 4KE5A 3DOLA 2W9BB 2HNDA 2R8JA 4ECSA 3PW0A 3DMJB 1S9FA 2YNGB 4NLYA 5C5JA 4M94A 3FFIB 2IJNA 4DL3A 4RW8B 3CJ5A 4ED3A 1TVRA 1VRUA 3JSMA 1C1BA 1LW2A 1HQEA 4URGA 1JIHA 3LP2B 4Y3CA 1SV5B 3OLAA 3GYNA 3CJ0A 4I2QB 3ISNC 4LSLA 4RW6A 3IS9B 5KFWA 1KLMB 1N6QA 4ID5A 3C6UB 4O3SA 2OPPA 5KT4A 1SH3A 1N5YB 1OS5A 3MECA 2OPSA 4PWDB 1TP7A 4Y2CA 3LANA 1JLAB 3Q8RB 1JLGA 3RB3A 5EDWA 5DQGA 3H40A 5KFZA 2D41A 2B6AB 4TY8A 2ZE2B 2FVCA 3CJ4A 3LP1B 3CO9A 5F9LA 4J9OA 3H4BA 2AGQA 1K1SA 4IFYB 4IR9A 3H5XA 4NRTA 5KFVA 2AU0A 1HNVA 4O4RA 3UDLA 5C25A 2OPQB 4NYZA 5DQIA 5KFJA 3PR5B 1KLMA 1TL3A 2VG7A 2ZD1A 4ED8A 3MR2A 4NLWA 3OLBA 3BQ1A 1LWFB 4DL2A 5J2MA 3MR5A 5F8LA 2FLLA 5KFMA 2J6SA 3FDSA 5HBMB 4IH5A 2IMWP 3V4IB 1S1XA 1LWEB 1FKOB 2B6AA 3GV7B 5HROB 1RYSA 4RW7A 4IDKB 2IM0A 1HMVB 4ECVA 4IRCA 2JC1A 3OHAA 4ZP8A 3QYYA 4I7FB 2IAJB 4F4YA 3V81A 5FDLB 2HMIB 3M8QB 2C2RA 2J6UA 4QWAA 4JV1A 4F4WA 4K4VA 5HLFA 1TV6A 4MFBB 3V6HA 3NAIA 1MU2B 4IRKA 3I5AA 4KKOA 1LW0A 2AX0A 4RZRA 4IG3A 1QUVA 5KFXA 4H54A 4RUAA 2IBKA 4K4YA 4RW9A 5I3UA 4O44A 1FKOA 2WTFA 1S1VB 3OSNA 2WOMA 1N4LA 4IDKA 1S0NA 3G6YA 2I5JB 3TAMA 1RTJB 3M9MB 5HP1B 5L1JA 1RTDB 2AWZA 4R8UA 3KJVA 1U09A 3D5MA 4YR3A 2HNYB 1SH2A 1S6QA 3I5BA 3I0SA 3MFIA 2QV6A 5KG1A 2BRLA 3QIPB 2ALZA 4J9KA 4PUOB 4RNMA 4TLRA 5F8JA 3TVKA 2IC3A 1SUQA 4NRUA 4WYWA 4ZPBA 3C6TB 2R8GA 3I5CA 5DLFA 2VG5A 1HPZB 3PW2A 2OH2A 2JEIA 1RT1A 2JLEA 3E51A 3DLEB 4O3NA 5KG3A 1T05B 2D3UA 2GIRA 3DYAB 4KFBA 1EETB 1XR6A 2HWIA 1GX6A 5DG9A 3DDKA 4I2PB 3Q8QB 3N6NA 5F8GA 4TQRA 2XCPA 4YQWA 4URQU 1DTTA 4YR2A 1JXLA 3T19A 3KLHB 2FJXA 4KBIA 2CJQA 2D7SA
chains in the Genus database with same CATH superfamily
3FUYA 4CWBA 2V4RA 2VODA 2E29A 1VR6A 2GHVC 4GKJF 1KS2A 2DK2A 4JI2J 2W7AA 3C6UA 1QAYA 4LBIA 2OSRA 3M2VB 3IA0A 3H20A 2VQFF 1BGXT 4ZLJA 4DFPA 1S1WB 1MMLA 2V4JA 2VUGA 4DR2F 1IBLJ 3FBFA 4OJ3A 4G6VB 1S6PA 1VDHA 4H4KA 4Y2KA 1Y10A 1MMDA 3TUIC 4ED4A 1V6HA 1TKXB 5HAOA 4DV7F 2V1TA 2RQMA 1EIYB 1RU1A 4MKAA 2QLJB 5A6WA 2KM8B 1HWLA 1LK7A 2BJ3A 1RT4A 2DGXA 2V0NA 4BC9A 2MSTA 2HNZA 4CO2A 4UUWA 3OHBA 4LFAF 2L9WA 4DU8A 2B56A 3A8IA 2KJVA 5IQ6A 4PG7A 3ZZRA 1RAHB 3AX5A 2XWYA 3ISZA 4IFVA 2AZ3A 2XYGB 3UQSA 1X60A 3BS9A 5DO2A 4F0KA 3QO9A 4ZP9A 2BKNA 3J81j 1EB0A 1ZS6A 1FTCA 2CPYA 1FRJA 3MM9B 1IKWB 1FF2A 3G8QA 2MY8A 1FRLA 4IQMA 1FFGB 3BPSP 4KO0A 3UN3A 4DWIA 4WP9A 5GADU 2ZBRA 1P6TA 1ZA1B 2FGCA 2K7KA 3OUYA 2ZH1A 1CJKA 1RT7A 2R42A 1VBYA 5IXUA 1TELA 5HN0A 5DG7A 3N6LA 2RSQA 3C15B 3I31A 1YJRA 2N3LA 2JEFA 5AXMA 2XSFA 1R8CA 2DHAA 2HK3A 2QL5B 4KYZA 2HQCA 4OZ5A 2ERRA 2WONB 4AFFA 1IBKJ 2WAQD 3MHYA 3BSOA 4Q7AA 3OL6A 4DCJB 2ZH3A 3PKYA 3ZC4A 2HQ3A 3DM2A 2DR5A 2YWEA 3ZZZA 3OFHA 2RQKA 1TAUA 4JV0A 3KLFA 2CJYB 3OPKA 3MCOA 3A8EA 3VGUA 1JJCB 2DR6A 3GB0A 3OFEA 3SYZA 3CCLS 3P5BP 3MF5A 4C8KA 1PJ5A 1SBRA 2HGMA 4P7TA 1F9FA 5T7LB 3UCGA 5KFFA 2M0GB 1FCAA 1RP5A 2IRYA 3HZEA 2GIQA 1OMSA 4K5RA 3CJ2A 4WTOB 3AOBA 5HO4A 1HBNA 2E9ZA 1NDKA 1WTFA 2A0FB 2VPYB 3A13A 3MWBA 3W62A 4EK2A 1GX5A 5GAHU 3RBXA 4PWDA 1FRIA 1FRKA 1OWXA 1CBKA 1M1HA 1R0BG 1NXIA 2OUGA 2RJZA 3MMBB 4ZMMA 2Y8WA 2CNNB 3MEDA 3C46A 3W3SA 4MKVA 2FZGB 4ZVGA 1U8WA 1JK9B 2XSJB 2YWHA 2RAQA 1YG0A 5FDLA 1ZYQA 1BC6A 3GWCA 1E6YB 1XNQJ 5J2NB 1MN9A 3NBPB 3BKFA 4NWBA 2D74B 3L09A 1KP6A 2MLZA 5T41A 3RB6A 3IGVA 1W25A 2C2MB 2WBRA 3FQLA 3HSGA 3FEZA 5H9EJ 1KNZA 4OYMA 2UU9J 2XTDA 5J2MB 1JXVA 4DF4A 5A6PA 2OMOA 4ECYA 1ZTTA 1F2GA 1HWUA 3PYFA 4QWBA 5IT4A 1VQMS 1RKIA 2XY7A 1TKZB 3TARA 4EBCA 2A10A 4OQJA 4ECWA 2KVQE 1YDLA 4OZ0A 3A12A 2PI4A 4DV5F 2KRBA 4C8YA 1IN0A 2G0IA 1IJFB 1NEEA 5D0HA 4ZHRB 4DUZF 3OFGA 2QYGA 2MHEA 1TUVA 2GS8A 4ED6A 3VR1A 3O2IA 4RW8A 4LUBA 1BQMB 1XEZA 3NCRA 2MQQA 3BB5A 2KB2A 1M90T 1CQNA 5L38A 1LWCB 4YOEA 3UNYA 2Z2MA 4RWXA 4NZ7A 2GMLA 1J2VA 2X1BA 1HNZJ 4A48A 1Q95G 2XBPA 2YTCA 3R8YA 3LP1A 3KUGA 2RF2B 2MQNA 4IH7A 2FDNA 3BO2A 5KFUA 2HFZA 1D9FA 4A8SA 2OKQA 1N88A 2LEAA 2PA8D 3BPDA 1TK0A 3CNQP 5ETOA 2AEMA 3PHEA 4ES3A 2M7SA 3HT0A 2KT5A 5GADI 1G1XA 3G8TA 1GXUA 4LF5J 2GO8A 1TR0A 4NZ0A 2CXEA 4IOBA 4X4TA 3K2YA 4OLPA 3SFGA 4OI6A 2ASLA 1PC4A 1PG5B 1N48A 2FJWA 3BH7B 2VDHA 2AP6A 2ZHAA 4C2MA 2G2ZA 4OLOA 4UUXA 3AQOA 4U67Q 4DJBA 3TW0A 4FS2A 4DR6F 4DXLA 1X5OA 5B7WA 1IKXB 3S8SA 1FT8A 4ZP7A 4CT9A 4K4XA 1IR2A 3O3LA 3HO1A 3QAUA 3TX0A 1EP4A 1Y5NB 3QZ7A 1XR7A 1KHWA 1X4GA 3M6WA 2H9ZA 4X64F 5DLGA 5L9NA 2MHNA 4DPOA 5AXLA 1B3TA 5EGYA 4YMEA 2IJRA 1KQKA 3THPA 1HNWJ 1HNIA 4CQ1A 5L8RC 5AE1A 4DFKA 2WONA 4V1Ak 3GIJA 8RUCA 4M5IA 5BR8F 2HEKA 1ZM4A 5LM7E 4B02A 2M70A 4C9DA 3M1VA 4M5JA 1B4SA 1LWEA 4K5SA 1YIJS 1TFYA 1Q78A 3GONA 4DCPB 5HATA 5AXNA 4RW9B 1L3KA 1E6VB 2G0CA 4KGZB 3UD3P 2GGPA 2ATLA 1WELA 4WFNQ 1S1XB 2F40A 4J90A 2E1MC 4OX9F 3AD7C 4DR7F 2D3OR 2AIRB 3OR2A 3QT5A 5E5NA 3R7BB 2HGLA 3QGGA 1RTZA 2I38A 2V2QA 3MM5B 2C22A 3C15A 1GXLA 1LWFA 2CWXA 1M5SA 2VV5A 3LWMA 4FN5A 2K1RB 2QRRA 3FSXA 4I64A 1SJ3P 4MKYA 4NCBA 2OPPB 1CLFA 1TVRB 2HS4A 2XGQA 2HHTA 5CHCB 2F5GA 4JI2F 3HK2A 2MJUA 2MQ8A 1BD6A 1HQEB 4URSA 4RUCA 1NK7A 4FBUA 3NNAA 4GC7A 4Q2LA 2HFSA 3SI8A 2YBVA 2VJVA 2HZVA 2HPUA 1S10A 4DQPA 1FWKA 2FUG9 2D9PA 2HBRB 5DG8A 3OTOJ 2DHHA 3KLGB 3FCVA 4NLRA 3DRSA 3TANA 2RU3A 4USKA 3AWRA 1FHTA 2DPJA 3NGRA 3FRZA 2RDDA 2UVRA 3SV4A 3FSIA 1U02A 1TV6B 2WVFA 4MFBA 2DR9A 2RRBA 3W60A 4H4OB 2EK1A 2YVSA 3QZ8A 1FEEA 3VZIA 1KN6A 1YK9A 2LXIA 5G4DA 2W24A 2R4FA 1NKCA 3PX0A 2WK4A 1TKZA 1Y5IB 4X4PA 1VQ7S 2ROGA 4ICLB 1S9EA 1JLEB 3OTOF 4QJVA 3CJRA 4EZ9A 4LBHA 1VLYA 2AX1A 4TU7A 1Q8KA 3PJ9A 3PRBA 3FCWA 1HNVB 5B0DA 1EZZB 1CEZA 5GAEI 1OY6A 2XTEA 1SPBP 2HRUA 5KFBA 1U1NA 1SH0A 4WK1A 1TL3B 4OJHA 2DR8A 3FMWA 3SCKE 3PIPQ 1D8YA 5J2PB 2FQQB 1O51A 3CD6S 4USWA 5KFHA 1F5CA 5CYQA 3TVZA 2B8QA 2QE5A 1BQNB 1N33J 4DX5A 1S0OA 2OIHA 1ITPA 1JMTA 4DQQA 2HFVA 2L48A 4ECTA 2RF2A 2YNFA 3L9ZA 4H4MB 2NUUG 1IKYB 1VC6A 2R7XA 2I8EA 4TXSA 1FFSB 2R7OA 2R7VA 2O01C 5JVHQ 5HJXA 2RUGA 2Q1LA 3F56A 3QRQA 1RTJA 4OX7A 1WDTA 3LP2A 2VA2A 4DS4A 4R8UB 4O3PA 1ZAVA 4HTIA 4FF2A 3GYGA 4Y28C 1NSAA 1AZSB 4ID8A 3ZNUA 4AT1B 1S4EA 1ZM2A 3BGOP 4WE1B 1VQLS 4AQYF 2YY3A 3V5RA 1P8GA 1TL1B 2HNZB 3MM8B 3NOCA 3LWLA 3OR1A 3KK3B 4QWEA 3J81U 2KN4A 2ZBQA 3MMBA 3C6TA 2V68A 1M5VC 2MZJA 3R6GB 4V19X 2F4VF 5K9FA 5EX0A 2HGNA 3FJ2A 4FS1A 3BO3A 4J37A 1ROFA 2F8HA 2H5IB 2MY7A 3O44A 4PG4A 2KM8C 5GMEA 1U1MA 4WZMA 4LFBF 1E6YA 2HIQA 3W8PA 5DDOC 5GVQA 4JI7F 1DTQB 2DTJA 3D54A 4XK8C 4ECXA 2J6UA 2YXLA 1GNKA 1RK8A 2GIFA 1PKUA 4FVCA 3ICLA 3OUYB 5L46A 3DHWC 5L1LA 3PW5A 2F4VJ 4LF5F 1NSKL 2FY8A 4C6AA 4G1IA 1T11A 4RNFA 3LF0A 4RNOA 4WFZA 1JLQA 1X5PA 3CDWA 4IOCQ 4ELVA 4NXMF 2F4FA 3I4PA 1KQGB 4B3OA 2VH7A 3H98A 1TKTA 3BGRB 2JRSA 4A8WA 2N7YA 2V4QA 1XMQJ 2DNNA 1RWKB 1XTZA 3QGHA 4PPDA 4JP8A 4EYHB 4USJC 2CQ4A 3DCAA 1UWBB 2DGUA 3OT9A 4DV2F 1VIOA 1RYRA 1WJ9A 1S1TB 4NLXA 2W4DA 4FKXA 3N6MA 4UW2A 1WORA 4K4ZA 2CVEA 1L3TA 1UW4A 3IRXB 3HDSA 4QU6A 3NS5A 1F9EB 1NNDA 4DG1A 5KT5A 5A8RA 1WDDA 2E5HA 3AX2A 2K3KA 3DGVA 3MTJA 1JLFA 1K44A 4ZOSA 5D78A 3UD4P 1HNXJ 5HLFB 1IM4A 1PYSB 1XMBA 1YJUA 5J2QB 3D9BA 2HVZA 2C3OA 3LAMA 3JTNA 4B9NA 1HBOB 2GVZA 2VASA 1W2IA 3E8OA 2K7JA 1V3SA 4U7UD 1FDBA 4N7TA 2PMZD 4V19J 4FXWA 1BHNA 3R5JB 4X4SA 5I4MA 4LF7J 1NUEA 3CC4S 2NR0A 4F26A 2LLZA 3HVTA 5BYSA 2W25A 3EZUA 5F9NA 3BH6B 4FPIA 3CCUS 1KONA 1LW0B 3D0HE 3W9JA 2K1RA 1FX4A 2JZ5A 1DQ8A 2QG9B 2I1RA 1FVQA 1T03A 1A6LA 4J9NA 2XZ2A 2J9DA 4LF2A 3NWRA 4DR4J 2E66A 5K8OA 2IPOB 1EQMA 4NLDA 2GQQA 2J9CA 3MM7A 3Q8VA 4LRDA 3KMSA 3OD2A 2CPJA 4NPOA 4FDFA 4A8QA 1N36F 3AFGA 4EO6A 4O4GA 3PCOB 2IYIA 1UMJA 4QIEA 4ZJQA 2J0XA 3JSYA 3KYLA 3TAPA 3BBBA 5E0OA 1HYSA 1SKUB 2E5IA 2U1AA 4I2PA 2QFIA 5CYQB 4KR0B 4C8NA 4DV6J 1M5PC 1NM2A 4KE5A 1NHKL 4OYBA 3DOLA 3HSJA 4ZJOA 4C4WA 1X9WA 4DV7J 3P5TL 2DXFA 2ZC4A 1URRA 2KT3A 1S9FA 2PA3A 4B17A 1Y00A 2NZCA 5C5JA 4I6YA 1CULB 2JVOA 1YJ9S 1R8PA 2UXBF 2WZ1A 3N28A 2XY5A 1RHRB 3QT8A 1EJ7L 1VRUA 1K73T 2ZEJA 4U8YA 2RB7A 3OV7A 4M5KA 3N0VA 1QM9A 2WSFC 1FDAA 2P6SA 3A3OB 4JI4J 1HQEA 2X1FA 4AL7A 1UEUA 3LP2B 1FA0A 2VC1A 1FWLA 4ZLPA 1HD0A 1N32F 1FJEB 1S79A 2C3PA 3IS9B 2CG8A 1KLMB 5DJBA 2GA7A 4ID5A 4OI3A 2UUAF 5SZTA 4C8ZA 5KT4A 3D1QA 1QTMA 4Z2XA 3LANA 1JLAB 5DQGA 2M9KA 4AQYJ 2DGTA 2GJFA 1MROA 2O67A 7AT1B 2MKCA 2FVCA 2ZE2B 3CJ4A 5L39A 3Q8YA 3H4BA 2AGQA 3IM8A 3NRBA 4IFYB 4CLZA 2RNEA 1HNWF 4CTAA 4Y2IA 1CJVB 2AU0A 1WEXA 1HNVA 2V2KA 3E3XA 4O4RA 2L9DA 3L7PA 3BYRA 4C0HA 3D6TB 4CO4A 4F67A 1H2VZ 5DQIA 2ZD1A 2VG7A 3C16B 1YLXA 3Q83A 5IQQA 2MYFA 5JMNA 3MR2A 4O0NA 2XQCA 1DJ0A 3RZAA 4DL2A 4QCLA 2HBZB 3RUBL 3MR5A 2Y3YA 2XZTB 3FDSA 5HBMB 2IMWP 1FEHA 1LWEB 4OYAA 1N33F 2B6AA 3PYEA 1RYSA 1HW8A 3B54A 4DV4J 2I6WA 4DSKA 2BEFA 2QSWA 4IRCA 3OHAA 2UXBJ 2IAJB 3CCJS 2LA6A 5D4NA 1FERA 2YX1A 3HM9A 3H25A 1RHJB 4F4YA 2W2OP 1U1PA 1R3NA 4JI3F 3M8QB 2GVDB 3BM7A 4F4WA 1HL6A 3M32B 2UZAA 4F3QA 5HLFA 2CNOB 5D6GA 2W1BA 5E33A 4RZRA 1NJWA 1QUVA 2XNRA 1Q0NA 4UOHA 2GVZB 2HZAA 4QBUA 4JI1J 3O8WA 1IQZA 1FKOA 5ETTA 1S1VB 3OSNA 1KC8T 2WOMA 1N4LA 1S0NA 2CQIA 2I5JB 3OTEA 4UQGA 2V8DA 3W66A 4HHJA 3MMCA 5L1JA 1RTDB 1PIEA 4R8UA 1QY7A 4Q2MA 2H4YB 4DZ6A 4YR3A 2LMIA 3DGPB 2AHOB 3I5BA 3MFIA 5KOWA 1DARA 2DO4A 3M6UA 5CD4A 1PYOB 4O3SA 2PN6A 3SCJE 2AW0A 1RACB 4HDHA 4PG6A 3LPYA 4TLRA 4DN0A 3DLBA 4WYWA 2Z8QA 2PI5A 1FKAF 3VGVA 2VG5A 5DLFA 3TO8A 1NBEB 2JLEA 3E51A 1RHKB 4NE9C 3NY0A 5ETMA 3CIMA 2A3JA 2FD2A 4DDFA 4JYAF 1XNQF 4KFBA 2VPZB 2V9WA 1GX6A 1VJWA 3DDKA 2UV8A 3KJQB 4I2PB 5DG9A 4X4RA 2ZJPQ 3WC0A 4RUHA 4YQWA 3OVSA 4DUZJ 4F25A 1DTTA 2EBEA 4FYXB 2YH0A 4A8XA 2OO4A 2C3MA 5EWEA 2GMHA 1NB2A 1T9TA 1G4CA 2EI5A 4ZPAA 2MZSA 4KBIA 3HP6A 2HHHF 4NI2B 4EMDA 3KTQA 5D4PA 1S1UB 4ZPTR 3AA9A 4UOGA 4ZHRA 4OMFG 4R5PB 3AX3A 1QAXA 1HW9A 4FNIA 1WC6A 4C0BA 5LT5A 5IZHA 1M0SA 1PC5A 2E1PA 1JXEA 1UAWA 2HQDA 2ZKTA 1JLCB 3NGKA 3B82A 4LSNB 5A0YB 1GFWB 1R8BA 4DQSA 1NZAA 1RT3B 1XIQA 4DCOB 1N52B 1GMWA 1PJ7A 2W9CA 4FNHA 1SQGA 4F4AA 3X3UA 2BKPA 1HWJA 1RB0A 1TFWA 1HA1A 2CQ3A 2KHCA 3D4JA 4DL4A 1FK9A 2R7TA 5A76A 3T5LA 3UW1A 9RUBA 1SVDA 1NLKL 3RAXA 3PHTA 2ZKUA 5KFRA 2QA4G 3ZTSA 2DR7A 1Q5YA 2XS2A 4OZLA 5KFKA 3R1LA 3ZTQA 1LWCA 1RT5B 1U0HA 3L7OA 1P9QC 1OYDA 4UQTA 3H8YA 2J7WA 4CLSA 1UJ5A 2IRUA 2XMJA 3GCWP 4A47A 2YH1A 2J0SD 3CCSS 1FJGF 1K0VA 3MTKA 4DL6A 1C1BB 3PRVA 3O6QA 4BCAA 5C2GA 1Z2ZA 4FP9A 1TKXA 1IKXA 3DLHA 2KI2A 1C0UA 1CC7A 2J9DE 3BSNA 2LDYA 2M52A 2W01A 3L7UA 3I6PA 4LBPA 5KT7A 4ECQA 3V6JA 5FIIA 3OL9A 4CDIA 1F3FA 2RRNA 3AAWB 2KVIA 3EZOA 3MDFA 3H4DA 1YBUA 4OI2A 1HYSB 5HMXA 3E01A 3T1AA 3PX4A 4C7QA 2KL8A 1SB6A 2LQBA 3RB0A 3A8KA 4BHQA 1JQGA 3VV2B 5LMUF 4TU8A 4RBTA 4ANDA 1RWOB 2M3DA 2DNRA 3CIZA 1R27B 4ITSA 3BQ2A 3VTIA 5HROA 3S6EA 1J5EJ 2FJVA 3NS6A 4ZVSB 5KFAA 3ETMA 5DDQC 2DPIA 5KFLA 4QPXA 2F9DA 4O4GB 3TZXA 4N5SA 1HIYA 4O0IA 4MT1A 1UEVA 3US5A 3G71S 2FLNA 3DLGB 3CCVS 4OHWA 5A8KB 3ZFVA 1VHFA 2HQGA 1T9WA 2YKNA 1N5QA 2C2ZB 1KWMA 2FHJA 4IFYA 5CYMA 2UUBF 5KG4A 3MPVA 3M8PB 2H3EB 2CDQA 3OW2R 4I56A 3HD1A 4EYIB 2VJUA 2DRDA 4ELUA 2HWHA 2NYHA 2VG7B 1YZ6A 3OFFA 4ZVHA 5K14A 5LJ3Y 1NK8A 2FVRA 4PWUA 4GC6A 2QMWA 2D3ZA 1AROP 1IKVA 1RBAA 2G1DA 1WF2A 2KG0A 4IQXA 1QDUB 2VG6A 2VKRA 1WKKA 4E8UA 5AJ3J 4WFXA 5FLXY 4DQRA 1XMOF 1X4CA 2M8DB 1S77D 5G0RA 2JLFA 3BGFA 4LFAJ 3B4MA 2K2PA 4MK8A 1T9UA 1G3OA 3FZ2A 4FYWB 5KTQA 2HVEA 3HVWA 4NMLA 1DAXA 2E7WA 3ZTRA 1J5OA 3K57A 4ZIVA 2Q79A 2AYGA 4LFCJ 2HMIA 4ZLLA 2BKOA 1B0TA 3MI7X 4C3MA 3KLVA 3R5DA 3DRPB 3CDUA 1HQUA 4WTYA 4C97A 2VPXB 5IV4A 4A8KA 5FJ4A 2IFXA 2B4PA 1S9GB 3OQ2A 1EETA 2Q43A 1NU4A 1CJTA 1WI8A 1X8DA 1D09B 3BN4A 3AHPA 3NMAA 4QIWD 2PDAA 2JDJA 4USHA 1NK0A 5LMNF 2E7XA 4ICLA 2FIUA 2RIJA 3KLHA 3VAIA 3GSDA 3EPGA 3DRRB 2QL7B 1HMVA 4GMKA 4CT8A 1JJ2R 5C2CA 3P8BB 1P1TA 2O1PA 3HJFA 2MZTA 3LP0B 3DMJA 1SIZA 4P74A 4H4OA 5BXIA 1VYAA 2V69A 4USIA 4H4KC 4PUOA 3WC2A 3CT9A 3B6BA 4L3KA 2OPRA 3GJTB 3AT1B 2ACYA 2GC8A 2J7KA 2LXUA 3B8HA 3ETOA 3FBCA 3SCIE 4OX9J 1RWMB 1VK8A 1XBWA 1EX8A 5ETPA 1V5IB 2YKMA 4PG8A 5HL7Q 5IT9U 2XMWA 4X65J 3CCRS 2J0WA 2PT0A 3EJMA 2EC2A 5I3UB 1LOUA 4KFBB 3UN5A 3EZ5A 4ECUA 2W9AA 2V8PA 3V6DB 4N8OA 2JSXA 1YI2S 4Y6IA 3VGTA 1NHUA 1S12A 3M8QA 3QLHB 2CQ0A 2CQBA 2VHGA 2KFNA 2DHGA 3ENWA 4HT7A 2DGQA 2NSBA 3CCMS 3QFHA 2CG4A 3I9V9 4UTGA 2B9YA 2JFDA 2MGZA 1JLGB 2PO4A 5K8MA 1C1CB 1YGYA 2JC0A 1B0PA 4OHZA 1D0EA 2EFGA 1SCJB 4X64J 5DS7A 2Q3PA 4KSEB 2ADCA 4LF6F 1FNXH 1ZH5A 3HHEA 2BE9B 4ZVRB 1I94J 3CVKA 1EKRA 4DR7J 1H73A 2F3JA 2ROEA 3BREA 4DZDA 2YX7A 3WIVA 4X65F 2O5DA 2M88A 2RUSA 1VC0A 1Q1KA 2UXDJ 5D4LA 2FB0A 2BYCA 4AUKA 4IG0A 1NK5A 5ITHA 3FVYA 1ZOTA 4NLQA 5HQ8A 4YB6A 3VF0B 2DNQA 4A8OA 3HX9A 1KFSA 1DHMA 1F3VA 3POTA 4NYOA 1U25A 3G87A 2IM3A 3HKZD 2RS8A 1K1QA 2J7UA 1HBMA 4PPZA 4XO0A 2DY9A 5IV3A 1OJ4A 3DLGA 3FBBA 5KFEA 2BQRA 4ANEA 3FQKA 1A7GE 3ZTOA 4DX6A 1RGVA 5FD1A 1C0TA 4J91A 3AJDA 4B3OB 3ZZPA 2YNIA 4FXVA 4Y00A 2IVFB 4J9QA 2LU2A 1K9MT 5MAOA 3AD9C 3GSIA 1RWPB 1CJKB 1RT7B 2CIMA 2F1FA 2FPHX 2WHOA 4J9VA 4DR3J 1S6QB 4I1TA 4AXIA 3J80U 1UL3A 2LU1A 2MKKA 4LSNA 2KXFA 4UOFA 4ZA1A 1FO1A 3D3BJ 3W5XA 2KRRA 2Y8YA 1VRUB 2IVMA 3R7NB 4WBFA 4WCEQ 1RTHB 2NXEA 4PAAA 3UNGC 2MQPA 4QW9A 5D77A 2CUYA 2HQFA 2WCXA 1UVJA 2CAJA 1UUJA 1R6YA 1SXLA 1VFJA 2AMCB 4CH1A 1U2RA 1I51B 3KHGA 2ZH8A 3UCZP 2DNHA 1NK9A 2GGPB 3TR5A 4R0EA 3GV8B 5J2QA 3RW7A 4AL6A 4RX6A 1X4BA 3BGUA 2EFPA 2Z0GA 3J7AN 2DXEA 3D6HB 2K8GA 4MYTA 2MLYA 5KFYA 3M9OB 3M2UB 3NLCA 5HI7A 4LF8F 2UVWA 1SJ1A 2FJDB 1Y5LB 2IC3B 2RKIB 5IS2A 3KK2B 1YX2A 4WKYA 4MIWA 2B4UA 1WNEA 4IG3B 3BJYA 3R6LB 3G9CA 1LKZA 2YQ3A 3CMES 2JL9A 3QNWB 3GFZA 4LT6A 1AXQA 1T9XA 3K8WA 3K7RA 3PFOA 3HULA 4B9SA 1FJ7A 3KKFA 5I3PA 2IMOA 2YPZA 3TAMB 3EGNA 3HT3A 3OL8A 4DFMA 1FRHA 1M5KC 2H5JB 1N0VC 2DNYA 2GFFA 2QEXS 3IP0A 3PY8A 4CNZA 3SZ2A 2XM3A 2ZD1B 3C16A 3KXDA 4N47A 4F0MA 2R7RA 1NKBA 2DXDA 4K59A 2DB1A 1UVKA 5DGBA 4QWDA 1RJJA 3DDIA 5KG0A 2YQ1A 4FKYA 4P7VA 5HBMA 3ZZTA 2PMWA 4JI6F 4DR5J 3H5SA 1SKWA 2CPHA 2EXUA 3M6VA 3PX6A 3EYZA 2OELA 3DI6A 2ZOFA 4TY8B 4ED2A 4ZVOB 5D3GA 4FYYB 2DRAA 2HBYB 4QU7A 4LQ3A 5DZ6A 2KDOA 1ZBTA 3NOGA 5CH7B 1LEOA 2I9SA 1X5SA 3IWNC 1TTHB 1H0HB 2AD9A 3DLKA 1SJRA 5ETKA 1FKPB 1CJUB 2YKQA 2QTWA 4DL5A 4P52A 2XO7A 3KJVB 2VFUA 4DSJA 2R2SA 3I55S 4F8RA 4RBVA 1JWWA 1IKVB 2V9KA 1L5UA 1UTAA 5KFQA 4WYLA 1Y9OA 2HFOA 3M2VA 4X66J 1QSLA 2I2YA 3T9NA 3SSQA 4ZCIA 2KZMA 1MMNA 4KQZA 2QA2A 1NPPA 4O3OA 3U1LA 1RT5A 1RAAB 1V3RA 1LW2B 2Q6CA 2XWXA 2JHEA 3K5OA 4OFZA 2PGCA 1WC0A 3EWGA 1JLBA 4KH1B 1GMVA 1Q53A 2V67A 2B5JB 1YSJA 4IO1A 3RRHA 1WHWA 5F8HA 4B3RF 2AF6A 4G1QB 3VQTA 5IWAF 2EFQA 4K50A 1NH8A 2XEXA 3D68A 4WXOA 1S0VA 3GV5B 4NLPA 1LNQA 1C1CA 1WWHA 4QPTA 4TYBA 1JLAA 1FNOA 3DU6A 2E9TA 5M2UA 4TQSA 4DUTA 3W65A 4NLTA 3EVMA 2NXJA 3OR1B 5IM0A 2GCFA 3T5KA 5H9FK 2QMUB 2LQ9A 3T5JA 4LIWA 1N34J 3SFUA 4XDCA 1JKHB 1H7WA 3P96A 1WG4A 3CSKA 4MIAA 2RILA 5KFSA 2ZM6J 3ADAC 1RAJA 4GO5X 2G9OA 4RO0A 2DNOA 2KYZA 3TZZA 5DZ7A 5KT3A 3I0RB 1W26A 2K06A 2Y1JA 3EXCX 1HR0F 1ZZNA 1RTIB 2VOPA 3M8PA 1RTHA 1S99A 3GG0A 5F8IA 2NXUA 1S72S 1NJYA 1R43A 2RS2A 3BBCA 1YZ7A 2XMVA 1RWWB 1F0XA 2VA3A 3GFYA 1S48A 1RKJA 2XLKA 1HPZA 1HBMB 2IHR1 3KUEA 1CQMA 4I4BA 2HRYA 1YTYA 5I42A 1DY3A 2VPWB 2A6MA 1TKTB 3KHRA 1DQAA 1WC1A 3GTYX 3D1HA 2U2FA 2XNQA 4CYUB 3Q24A 1XQIA 3J81Y 2ZZTA 2MEWA 3G6VA 2BOPA 4LFCF 3VAMA 3MZIA 4U6PA 1ZA2B 3PEHA 1CG2A 5LMNJ 4C3LA 2HSEB 2ROPA 2W4CA 3MCNA 1GAOA 4QR0A 3MUVP 3QT6A 3R5GA 2R2TA 3MEEB 1WTBA 3ZNJ1 2CJAA 4U7CA 2MKSA 1ELOA 2ZNYA 3TUZC 4ENOA 2E5LF 2XMKA 4CZCA 1JLFB 2QLFB 2GW8A 4XPCA 2HHVA 1UA1A 1OQ3A 3V2UC 1IWGA 5DDRC 1OIAA 3A8JA 1SUQB 4W98A 3GMGA 4DUYJ 4Y65A 3SV3A 2LECA 2B0GA 1H6KX 1U2CA 1UA0A 1MLAA 3KJNB 4CLUA 2Z2LA 1BXNA 1GH8A 2BJEA 3ENVA 1ZTWA 3ZZYA 3W8GA 4F3MA 3IXQA 2IM2A 2HNYA 3MMJA 2V1SA 3DRSB 2HLTA 3PW7A 1HHQA 3NWGA 2ZVSA 1MG7A 5ETLA 2N7CA 2C3UA 1NPRA 1OPZA 2W9BB 2MB0B 2R8JA 1EARA 5AJ3F 3DLLQ 4DX8H 3EE3A 5CZXA 3MPYA 3QJJA 2YNGB 4NLYA 1UZHA 2NPFA 1L3VA 1F1BB 5I3QA 2OFHX 4M5MA 4DL3A 2ZUAA 4RW8B 4LF1A 5LMUJ 3ENAA 2HS3A 1H2UX 4K8RA 5KAKA 1B7YB 3JTPA 2NYIA 1U2FA 5ADZA 1SV5B 2VQEJ 1XMQF 4L76A 2FHKA 3VAGA 1XERA 1WI6A 4HI1A 4YFUA 1HNXF 4RW6A 4P10A 5KFWA 2IDEA 3T3FA 1Q8IA 2BJ9A 2CQ1A 3C6UB 3IFEA 2OPPA 2O66A 2Y1RI 1SH3A 3L95X 4XDDA 1OSDA 1VQKS 1J5EF 4EZ6A 2L41A 2OPSA 2BW7A 2EFVA 3PXGa 4Y2CA 4F04B 2ATCB 3HCXA 3VALA 4NASA 3RB3A 1JLGA 4PG5A 5G0RB 1TZ0A 1WOSA 4AYBD 3CC2S 1WF1A 1AT1B 4M63A 4WIQA 2KH9A 1SL2A 3LP1B 4KHPJ 2KT2A 2UP1A 1URNA 1D9AA 1K1SA 2AJ1A 4LVNP 3H5XA 1LFPA 3DU5A 2AYEA 4YN3B 3DFEA 2YKOA 2N82B 1CS4B 3C14B 3MD1A 3UDLA 2KZZA 5C25A 2EEYA 4NEYA 4P2MA 4X4QA 4CM2A 3PR5B 1HWKA 4FYVB 4MMOA 3CXCR 4ED8A 1KSPA 1UEKA 3M30B 4P2FA 4CO0A 1LWFB 4KHPF 5GMDA 3FNNA 1H74A 2IBOA 2BJ7A 5F8LA 2J6SA 3G6ES 3MGJA 1G7CB 4DPUA 3LPEA 4GVBB 8ATCB 3FZBA 3V4IB 4G65A 4U7UK 1RHQB 4B3SF 2BBEA 2JX2A 3X1LB 2NS1B 5HROB 1Q82T 4OJGA 3HMJG 3MURP 4IDKB 4DLEA 1HMVB 3PACA 4NOHA 4TKTA 2HHHJ 2JC1A 2VF3A 1XN9A 3W2VA 1IVZA 5RUBA 4OYZA 1X4FA 3NCQA 1Q81T 4GKKF 3CUNA 3CJ8A 2A2CA 1U1RA 4JV1A 1X9MA 4NX9A 1VQNS 5HVHA 4DLGA 1MU2B 3V6HA 5BYQA 3DRXA 1PILA 2AX0A 3QWPA 2IRXA 3SEOA 2RU9A 2DO0A 5BYRA 3T41A 2CZVC 2QA4S 2VL1A 4ZCKA 1S57A 4RW9A 5E7OB 4CYUA 3D2WA 5I3UA 4FXDA 1R6VA 1U0SA 2OMLA 1DURA 1TL7B 2CQHA 2DITA 3SQOP 5B0CA 3EMTA 1VJQA 2XHCA 1X5TA 4DMZA 4FPRA 1RTJB 5GAHI 4X4OA 2LXFA 2VKZG 5CZVA 3NG8A 3KJVA 4ILRA 3D5MA 1NDLA 1IUJA 3UDVA 3DC2A 3I82A 2OP5A 2J76E 2KFYA 5H1SV 3CPWR 2HHQA 4TLQA 5GAEU 4DSEA 1YHQS 2IC3A 1SUQA 2EW9A 3C6TB 5A2QY 2R8GA 1YJTA 1RUSA 4OX6A 1HBUB 1WHYA 4DR1J 1KVKA 1NRKA 2VONA 2AT1B 2DISA 4O3NA 4PEOA 8AT1B 2CJBA 1BE4A 4KRWA 5IM0B 1EETB 1XJWB 3EX7B 2C42A 2XCPA 1PGZA 3N6NA 5F8GA 1XWLA 3R97A 4IO9Q 3R1HA 3VAFA 1JXLA 1O0PA 2H54B 2EFNA 2ZH6A 2Z2ZA 3KLHB 1Y3JA 4J9PA 2D7SA 4DV4F 4IRDA 4DX7A 3I0RA 3AXKA 4K2XA 2ILYA 3MD3A 2RDJA 6FDRA 3BKUA 3IGNA 2GAGC 4PABA 2R8IA 1S9GA 1WC4A 3W63A 2DH9A 3MAAB 4BC7A 4KB7A 1TL1A 3MM8A 2VG5B 3BR8A 1PCAA 3C8YA 1LFWA 2FJAB 3HLUA 3LAKA 1SV5A 4DSLA 1HLWA 1FESA 2YNIB 1RQ0A 3EUNA 3M8YA 1UETA 1RISA 2ASYA 4DV0J 1UVNA 2AJ2A 2WW4A 1N54B 4CRJA 5CCLA 4Y0FA 1XC9A 4FBTA 1RDRA 1U7LA 4XTTA 2JOQA 4ZVTB 1QLNA 1KQFB 3LH2S 1AFIA 2BUNA 1DQ9A 3M6XA 4KGMA 5KFTA 3HJVA 3UR0A 2CJ9A 2BVZA 1NSQA 3JAMU 3KK1B 1TK8A 3OTBA 4ZPCA 1BUXA 2GJIA 4LF4F 5CAAA 1D1UA 2G0JA 3UCUP 5KFGA 4MK7A 2YNFB 4H4MA 5IOLA 1KHVA 2G2OA 3RBZA 1YJWS 1IKYA 4A8MP 1LV5A 5KG5A 2CPFA 2BX6A 1MNEA 4OHXA 2XI3A 3F44A 3VCDA 2UUAJ 1YBTA 3HHKA 1VIXA 2B4OA 2ZITA 4RUBA 1TMMA 2RMLA 1RWNB 1KTVA 2YWWA 3V6DA 3CD0A 4ZVUB 4WP8A 4K7QA 1VISA 1BQXA 4WU2A 4B3RJ 4K0KJ 1MW7A 3VVUA 3H0PA 4BS2A 3GFHA 1VRTB 1UWAA 5T7LA 3UDCA 1WACA 5K5MA 1U45A 2V8HA 4JI4F 3UPFA 4MIBA 2ACMA 2PEBA 5THWA 2G1HA 1X4AA 3TUJC 3NNCA 3V4IA 1K0TA 3PRDA 1D9DA 1T7PA 5EWFA 2GQCA 1ZPWX 4Q5VA 5CABA 2Y9HA 2H65B 2RQCA 2W2NP 2YKPA 1HARA 2B7CB 1N5TA 4CM0A 6AT1B 5B0EA 1EP4B 3CCTA 4ZCMA 3M9NB 3HVRA 2DKOB 3T1YF 3IG1B 2W8KA 4F4ZA 1EHWA 3GPAA 1IKWA 1RBOB 2HKEA 1X4EA 3H90A 1IR1A 4MTPA 2ABYA 2J6TA 1OY8A 2N3OA 2ZJQQ 4WFBQ 1H98A 2A1BA 2LQ5A 3DOKB 3C3LA 1Y4ZB 2W2QP 2W2MP 4WPAA 1KTQA 3D28A 2KYXA 3MCSA 4CP5A 2DJWA 1QE1A 4X2BA 4XAKA 1SC1B 3QIPA 4P71A 4R0JA 3PW4A 4OZ3A 4ILMA 3EGWB 4K4TA 2XO6A 2Z30B 2COLA 1VBXA 3BGLA 2CFXA 5EWGA 2XS7A 1NJIT 3QWUA 4YB7A 5A8RB 5KFPA 3CGIA 2RDIA 4Q43A 1RLCL 3M8RA 4YP3A 5CD4H 5HK4A 3MAQA 3RBDA 4EBDA 3B78A 3NXZA 1QJHA 2BZ2A 2QN6B 3WDOA 3UE2A 4CH0S 1VC5A 1CJUA 1S1TA 1RWUA 2ILZA 3CB4A 3CJTA 1GXTA 2XI2A 5CYMB 1RT6A 2EG2A 1N36J 4EBEA 2IJFA 1S97A 3TZYA 1NB7A 4USMA 1LK5A 4P75A 2W7OA 1U1LA 3HHNB 1BWEA 1Q5VA 3DXSX 3KUHA 3GJSB 4HI2A 4DG1B 4DFJA 2XCAA 4JV2A 3ITHA 1G6BA 3DOLB 1WKJA 2E1RA 4QYRA 4RW4B 1MWQA 3WX8A 3M8SA 4CLFA 3PKMA 2JWNA 4ZP6A 3RAMA 2BANB 3HSZA 4L3NA 2VIHA 3OXFA 4ZVFA 2C2NA 4N56A 2OEJA 4DN9A 2XS5A 1VGYA 3QBCA 4NCGA 5D4OA 4AD6A 1WOOA 3TYTA 4DV2J 3S7RA 4YY3F 1Z1ZA 3M2UA 2UU9F 1U6ZA 3NP5A 5JVGQ 1GT8A 3W2VB 1U1KA 3ZZ0A 2XYPB 4MAKA 2JEJA 4B9UA 1HI8A 2QT7A 3MM6A 2CADA 2CVIA 5BJRA 3GILA 3A1YG 1QAJA 3LGMA 5E41A 5HMZA 3DXBA 4ERDA 4ZKAA 2VC0A 2CWKA 2JNJA 2CA9A 2DHXA 3JB9k 3K59A 4KTQA 5KFDA 1ZPVA 3NGTA 1CULA 2GQ2A 3H2LA 3H5YA 5DETA 4RU9A 2HLUA 1YRTA 2ASJA 4ZDNA 1JB0C 3KLEA 5DM6Q 3AH6A 1B0VA 2FC9A 1Q4RA 1TMJA 3CDAA 3G8SA 1J27A 4G1PA 2MKYA 3SBMA 1N6QB 3DHXA 4E2FB 3PV8A 3T5HA 1T0TV 5E3CA 1HWIA 3KLIB 1C2PA 3G96A 2DGOA 2NXCA 4MK9A 4QR1A 3IN5A 3I0SB 1S1UA 2QO3A 4RW6B 2BJ1A 3RB4A 4NXMJ 3RU0A 4IKAA 3SSSA 5KFCA 2VD3A 4GO7X 2MXYA 4A8YA 2XULA 4WFYA 1ACMB 1Y7PA 2OPSB 2QMXA 2WOMB 5E3RA 1DFDA 2CPZA 2DIUA 4NA2A 4CH7A 1TQLA 5U47A 2V8VA 2MSSA 3SDEA 1RWVB 4J9LA 2ZBIA 4K0KF 2OPQA 3QLHA 4LR9A 2IAJA 3Q0AA 1VBZA 2J0QD 4NXNJ 2XMAA 2PSZA 4ID5B 2AKWB 4Q8FA 3FK4A 4KV8A 5LXYA 2GVDA 4WE1A 4J9MA 2P5VA 4FF4A 2H4WB 3BDEA 4LIRA 4B3TJ 1NMEB 4HACB 3Q23A 3WHIA 4DV5J 3UN2A 4LF4J 1H2TZ 3MPUB 3D1OA 1GEHA 4OHVA 2D9OA 2XLIA 5DDPC 3I4HX 2MKIA 2C28A 1S1VA 2RT3A 4J7CA 1X0PA 2R9LA 3KLGA 4DR2J 3KNAA 4D3GA 4ZLNA 2AEFA 2B4VA 2BQ3A 1JKHA 1IBLF 2UVUA 2VOOA 3LUYA 4NLOA 2GZOA 2QA1A 1HNIB 4P9SA 3NL0A 5ETRA 2M2BA 3NS7B 4EFAC 2MZRA 3WIUA 2ZH9A 4DPWA 4C8MA 1RT2A 1YRXA 2XTJP 2ADBA 3M2RA 2IBKA 4GRSA 3IMQJ 1FDDA 4F50A 2HVDA 3KG0A 2X7IA 4WJBA 1NAQA 2FTRA 4PCQA 4L73A 2CRLA 4M5DB 3BSAA 5SUHA 4ZCLA 2OTLS 1V5VA 1A0OB 1IM6A 2GV1A 2C3YA 1U24A 4RLEA 1C0TB 4CO1A 4C3KA 4F2RA 3UO0A 3U02A 4CIOA 1VLOA 2ZNZA 3QATA 2J8SA 3QFWA 4RR5A 5LL6d 1TAQA 3DOKA 4I67A 4CCHA 4D3HA 1RTIA 2C2OB 2OHDA 3BKTA 3M32A 4DS5A 1I3OB 2IA6A 4OJ1A 2V5HG 3IWXA 2V63A 5F8MA 5F3ZA 3TI0A 1WSVA 3J7Z5 2UUTA 3VQSA 2LQJA 3MEKA 3LGHA 3TEGA 2BACA 4P2SA 1R7IA 3QGPA 4NLGA 3PJWA 2BR0A 3GIKA 3CJ3A 1ZM3A 2BV3A 4C11B 1VQ5S 4U9RA 1VS3A 4UT4A 2BM1A 1FRXA 1H72C 1UFWA 2I5JA 2NSCA 3A4TA 5J1NA 3WBZA 4ETXA 1TL4A 1SKRA 1F5AA 1KR4A 2BOAA 2W8LA 3HF5A 2HW3A 2FJBB 1L3UA 3IG1A 3GR0A 3DRYA 4TN2A 3MM6B 4TYAA 3CULA 4RNHA 2JEGA 3HVTB 3Q2SC 5KG6A 5K8PA 2YX4A 3SXLA 2VFVA 2IY5B 1IWAA 4Z7CA 1U48A 3JYTA 1N5YA 1X4HA 2KJWA 1W2BR 1NKEA 5KFNA 2G13A 3N5FA 3Q8SB 1IQTA 2BM0A 2ZWPA 2VFRA 4LQ9A 4RWWA 1YJNS 3TNVA 2KFZA 1RADB 3HHLA 3J80Y 4R5PA 2GJ2A 4WIIA 1BMQB 3NEKA 2PIIA 4DEZA 1VRQC 3OJSA 2YNHB 1D8ZA 1RI7A 1SC3B 3N79A 2HRTA 1KD1T 1X31C 3NKYA 2ZFHA 4ECZA 2E9RX 1S49A 4I69A 5C7PA 2PEHA 3JSRA 4Q8EA 1XR5A 1IBMJ 4IR1A 2CQDA 3MM9A 3R5BA 1RT4B 3BEGB 3ENQA 4P2XA 1C0UB 1I1GA 4NA3A 4UZBA 1AW0A 1UJ6A 4W92B 1MU2A 1P9YA 1RT6B 2F63A 4M5GA 3ILOA 3GP9A 2A6OA 2CPIA 3BBFA 4K4WA 2VBWA 4LRBA 1TUGB 4HH0A 4DR3F 2AGOA 1BQNA 3D66A 3FBEA 2R8HA 4F3OA 3H2UB 2RH3A 4O44B 5HVFA 2QL9B 2CPXA 2A18A 2BMBA 2WVEA 2B9EA 3KMQA 1N0UA 1F2HA 1Y3KA 2XHWA 3QIDA 3BGRA 3CE8A 1YRUA 4USVA 5KG2A 1N56A 2HYIB 1VQOS 3JSBA 3BF4A 1XNRJ 1RSCA 1RBLA 1RZMA 2OSQA 3L3CA 3UI3A 2Z57B 2IA0A 3DKDA 4WP3A 5LSRA 4Q44A 3G4SS 4HDGA 2FC8A 3A3NB 4TVAB 3TEHB 1JNRB 2DGWA 2IVYA 5KFIA 3K0JA 2EKYA 3HFVA 2SXLA 3IRXA 4ALZA 1T3NA 3I96A 2E44A 1WD6A 3IO1A 5LXRA 3OBIA 4ZVEA 2HG4A 5K14B 3OSPA 1YBAA 2Z58B 2CDRB 3D6MB 3MAHA 2CKWA 3HSDA 5JUMA 1M5HA 1FJGJ 1S4FA 2R2UA 4O3RA 2BE7D 1DRZA 4PZVA 2QJ3A 1T05A 4PQUB 4PYAA 1NJXA 5ETNA 2DEJA 2X3DA 3SDEB 4X4NA 3ILLA 1JLBB 3H2VE 1FTRA 3QPIA 3C66A 2MTLA 3UDEA 2EPIA 3CJSA 3QAEA 1DLOB 3ULHA 3IM9A 2PD1A 3D0GE 3M30A 4L75A 2HAFA 2HQIA 2D68A 5LOQA 3MPWA 4IH6A 2YWGA 4KAIA 4TU9A 1IBCB 4ES2A 1QTNB 5L1KA 3H59A 4A8FA 4FVMA 1X0FA 1R0CB 2LFVA 2R8KA 4JBCA 1ICEB 2B9WA 1GTEA 2YPYA 5IT0A 2EBGA 1S9EB 3D3CJ 4CLYA 3QO9B 3EGVA 3N5BA 3SIPB 3VWSA 2KXNB 2WB1D 4PWWA 1S7HA 4YR0A 4CLWA 2R7UA 1ZM9A 3KLIA 3PR4A 4OX8A 4J9UE 4OYPA 3HZGA 1O5JA 3SCLE 3CW2C 4EGLA 2AQ4A 3CCWA 2VBYA 3LA0A 2WSEC 4LR7A 4DUYF 4KT0C 4MJKA 2GHPA 5IC4B 5KT2A 2POKA 3PVXA 5J2PA 4F4KA 3CJQA 3TJAA 4BLGA 4JYAJ 1MWZA 2VBXA 2DH8A 4Q0BB 2OPRB 1R89A 1KOOA 1M1GA 1FJCA 5DQHA 1U1QA 2WW8A 1JJHA 3IR7B 1RLDA 4LRAA 4R25A 5L1IA 2Z56B 3I87A 4O3QA 3PO5A 2HHXA 1S6PB 3CWJA 3RBEA 1REVA 1Z4UA 2AEJA 3CEDA 4GKJJ 2AJQA 2GNKA 3W9IA 5K20B 2NCKL 4OZ1A 1RT1B 1SC4B 1SJQA 2AV5A 1J5OB 1VRTA 2WVCA 1OO0B 1WG1A 2F8EX 1K8AT 2FVPA 4B9VA 2Y1IA 1VOMA 3P6YC 2MZ1A 3RW6A 3EGZA 3DMJB 3ZO7A 2LQ8A 1XK8A 1FD8A 3LGNA 4ES1A 3FFIB 3NGSA 4ED3A 2MLXA 2UXDF 1ZAXA 3O5TB 3NNHA 3CJKB 3JSMA 5E3QA 1Y0HA 1Y11A 3AOAA 3OXLA 1MN7A 4CLKA 3SSRA 4URGA 4ZN3A 4Y3CA 1T9VA 4N8NA 4JOUA 4EWTA 4UY85 2WVDA 3DN9A 1KFDA 2DCLA 5B0AA 3GYNA 4NCAA 4NEZA 3FKBA 1VQPS 2XTCA 2WBMA 4LSLA 1S6OA 4KPCA 1QSYA 2DBBA 2XSJA 3M2RB 4X62J 1N6QA 3JTOA 3EVWA 3R5AA 4Y2MA 1N5YB 1V3ZA 5HMWA 4QYZK 2R2RA 1YITS 1Q86T 1N5VA 3FC9A 1SKSA 3MAAA 1FE0A 1UFKA 1UVLA 2HHUA 4JV5J 1SQFA 1PBAA 1RAOA 1TU0B 3CO0P 2RD5C 2HHWA 3UR3C 4TY8A 1QVGR 3H7HB 2CZ4A 2H5EA 1FNMA 2OLWA 5F9LA 5FLXU 4J9OA 4PXEA 2Z4PA 2MMYA 1WHVA 1U47A 1U8SA 1FDNA 2HHSA 5KFVA 4ANCA 1IBMF 3OR2B 3N01A 2RRAA 3Q2TC 1O6XA 3M1VB 3DNCA 3FMBA 3M8ZA 4QYZJ 4IOAQ 4LMZA 1KLMA 1YWXA 1KKHA 2RQ4A 1S5ZA 2V94A 4NLWA 3ILIA 1KDNA 2HFNA 3IAM9 3MMAB 3OLBA 4PXCA 2DNGA 1U0HB 2FZCB 3DOMA 3IWLA 3PDNA 2OAUA 4X66F 2FLLA 1C4CA 1QD1A 1S1XA 1SC6A 5E2QA 2E1CA 1NSPA 4HHUA 2CJXB 1P1LA 2H48B 4E98A 5M2RA 3PYGA 3K17A 1WKLA 2O3DA 4GVLA 2IM0A 4RL1A 3LTOA 3MUTP 3F73A 5GMKa 5CQGA 5D8HB 4ZP8A 3QYYA 4I7FB 3RG6A 2AJ4A 2RHQB 2V6AA 1HHSA 3MUMP 4CTAB 3V81A 3EM1A 5LSLA 5FDLB 4QWAA 4K4VA 1VMBA 2CJKA 1TV6A 4MFBB 3TAQA 3TA0A 4IRKA 2JVRA 3LQVA 1F60B 3JQJA 4DR5F 1REGX 1B64A 5DM7Q 4IG3A 3IAS9 3O1LA 2MPUA 4RUAA 2P9GA 4DPXA 4K4YA 2B9XA 3MCMA 2MJNA 4O44A 1KBRA 2ZH7A 2E1AA 2WTFA 2UXCF 3RR8A 4U8VA 5AE2A 4B3MF 3M4XA 3G6YA 3TA2A 1Z2LA 4TNOA 2PC6A 3MOZA 2JH3A 2LA4A 3AD8C 4DR1F 1U09A 3GCXP 4ED0A 1SH2A 1S6QA 4P73A 2CNLB 3I0SA 2QV6A 3JQMA 1RWXB 5KG1A 2ALZA 4J9KA 5DRKA 1JNZB 1TUWA 4RNMA 1U1OA 4B9LA 3BN7A 1UPPA 4JI8J 3TVKA 1YKWA 4NRUA 1FI4A 2OI2A 4DR4F 3F41A 3I5CA 2OH2A 3PW2A 1HPZB 2DH7A 2JEIA 1RT1A 2JFKA 3J7ZT 1ULRA 5ETQA 4IYQA 5KG3A 1UFLA 3FSYA 3OVAA 2K3IA 3DYAB 1T05B 3CD7A 5EX3A 4PQUA 1XR6A 2HWIA 4OYOA 2L3MA 2ZH4A 1FRMA 2UUCF 3K89A 4YY3J 3QRPA 3AY0A 1B70B 2FJXA 2CJQA 3FGVA 3PNIA 2E5GA 3HFZB 3TP2A 3KK2A 2LP4A 4HACA 1DLOA 3T9ZA 4DL0C 2HHPA 2AYMA 3P3DA 3MM5A 4C0OC 2UUBJ 2QLXA 2FVSA 3R2DJ 2BANA 2DNZA 2GHWA 2JLGA 1H7XA 2BXJA 4BWMA 1CJTB 1IR0A 3BQ0A 3E2EA 3TUPA 3U1NA 5JXSA 4N76A 2DVIA 3RAQA 5L9XA 4JI5F 2CZ9A 4CLPA 4DBQA 5EUHA 2MQOA 2E7VA 4JI7J 1UP1A 5LJ5Y 2VFTA 4EEYA 4N77A 1T3OA 9ATCB 3MECB 4ZS6A 1HFEL 4M8LA 2B51A 1U49A 4ZIWA 1K47A 2ZOGA 5HQMA 3GIMA 1GK8A 3Q89A 3KHLA 3GYXB 3MOJB 3J7A1 1NK6A 2Y0BB 5B0FA 3AB4B 2GMJA 1M5OC 1JLQB 1V9OA 4JI0J 1CC8A 1XNRF 1C4AA 2IDLA 4HTJA 3RGIA 3KLFB 3KLEB 5A2QU 2QIFA 1DTQA 2VDIA 3W2WA 4LFBJ 3W61A 4WKRA 2OEKA 3W1YC 2P9CA 5D0EA 4DV3F 2C2DA 1I94F 4YDXA 4QZVB 3CCQS 4P72A 2R7WA 1HI1A 1RA6A 4RJVA 4Q45A 1JJ4A 4LF6J 2F65A 1EQ0A 4K4UA 1NCLA 3MEGB 3VAKA 2CQ2A 2R7QA 1QSSA 1REVB 3AA8A 2XYHB 1IJEB 4KGKA 4QR2A 2IM1A 1F6TA 3OL7A 2VQEF 4DHVA 2MZQA 1HBOA 2IIHA 1SL1A 4DOZA 2OFGX 3FEYB 1UKUA 2BABA 3LOUA 3J7YI 2AYBA 2B43A 3QJLA 1VK3A 2AZ1A 1SIWB 4JUZA 3TVYA 1RTDA 1FXDA 3JYTB 3KHHA 2XY6A 4HL9A 1SL0A 1HI0P 4KC5A 3VHQA 2YNGA 4DV0F 1RAFB 5J2NA 3PZPA 5CXTA 3MEEA 1UZDA 3AJ2A 3FFIA 3FRYA 4JB8B 1SI9A 4OI4A 3DOMB 4PXDA 4QQBA 1VBKA 3TZWA 4LF7F 2D69A 3K58A 1B7FA 1P27B 3RRKA 4HVZA 5DGAA 2OTJS 2YWFA 4ZVPB 3C19A 1NDCA 4QOTA 1NHVA 2FYXA 4M5DA 5I42B 4FF3A 2EFOA 4WZQA 2HZCA 3DRRA 2C2EA 1RAEB 1JX4A 3TX8A 3BDPA 2ZZMA 2BW2A 1DBDA 2LEPA 2ZJRQ 3V81B 5E3AA 4HH1A 5A8WA 3BSCA 1S76D 5C42A 1RT2B 5KFMA 1A9NB 2E5LJ 3PEJA 3G6XA 4E0DA 3RJMB 1QVFR 1WC5A 4HT5A 2W9BA 3UFCX 1L3SA 4WWSA 5HMYA 3HVAA 6FD1A 1UW9A 4LF9J 2DRBA 4AXJA 2NUHA 3AOCA 1VI7A 4YB5A 2LCWA 4ATNA 2PMHA 4J9SA 1RT3A 2HWTA 4ZPWR 1CSJA 1FXLA 5HJYA 4JI1F 1S7IA 1F9HA 2F7VA 3CDEA 3IC1A 1NJZA 2CQGA 1Q16B 2BRKA 5ETVA 4AE5A 2EG1A 2MDAA 2XZWA 3R5CA 3T1HF 2DGSA 3ZXWA 2P6TA 1ZETA 4U96A 5D0RA 5K8NA 1OYEA 2BJDA 4UF4A 3D0IE 4EO8A 2RKIA 4EU0A 4ED7A 3T1YJ 1T94A 2BE2A 1SJFA 2A2DA 1YQHA 2L9NA 3KDNA 4JI3J 3GE9A 2MKHA 1KOHA 1WEYA 3KWMA 3PFEA 4UOCA 4X4VA 2FHOB 3K5PA 4DV1F 2C1EB 5AE3A 2ZBPA 1VQ4S 1YVFA 3NCPA 4UZCA 5D0GA 3HHDA 5M2PA 2ZM6F 4F02A 2JJ4D 2KHDA 5D15A 1NO8A 2GX8A 1RHUB 3D67A 2ZE2A 4QIVA 3B4DA 5H9FJ 2ZZNA 1RABB 3DYAA 2OEMA 2YNHA 3IS9A 4KH0B 2EKNA 2ZDOA 3MXHP 4B3TF 1VQYA 1FXRA 2V34A 4WK3A 4GKKJ 4HEA9 3PTWA 4BWJA 2AJ0A 1CJVA 2H1YA 1WEZA 1WHXA 3KJFB 1EAYC 1Q7YT 1I6JA 1RE1B 5HANA 5C25B 1BWVA 2WRMA 4FZVA 4QWCA 3GU0A 4OHYA 4LSLB 5EHHA 1U6FA 1PAUB 4L72B 2UVVA 1R8AA 2NLWA 3GLJA 3TJ9A 4DV3J 2VU5A 4QIGA 4I0WA 4X62F 2YKMB 3CD5A 4FYDA 2DCUB 4HLBA 4I68A 4KO0B 4CI0B 5T14A 5JJBA 2FHMA 3Q86A 4YHHF 3PYDA 1R0AB 5CA5A 4NZ6A 3DLEA 1UWBA 2LVWA 1O8BA 3DLKB 5J1EA 4DV1J 1WF0A 4ZK7M 3ET6A 2EVZA 2YKNB 3HI9A 3K5NA 2QGFB 3VZHA 1VQ9S 4DU7A 3M05A 3OTDA 4Y34A 1CS4A 3P4UB 4LR8A 4OZNA 3KK1A 3HHLC 4MKBA 4ILLA 1N32J 1YJ7A 1HBUA 1LWXA 3R7SB 1OQ6A 5J1EB 1MROB 3MPDA 2NREA 2GO9A 2LKZA 1D3WA 2DNMA 2VG6B 3Q8PB 4G3IA 5MLCV 2CQPA 2AGPA 4WU3A 2ZH5A 1AFJA 3SQGA 2OJ3A 4RBUA 3U7JA 5KT6A 3F0NA 2UUWA 2FGOA 4XIUA 3RTVA 1T8EA 2J9EA 3KDOA 1PJ6A 4ZJLA 3GIIA 1PBUA 3C14A 3AXMA 3W2WB 5F8NA 3I9ZA 1FFWB 3EICA 3IR5B 3LALA 4G1QA 4DPTA 3JAMY 5B0BA 3ISND 4HR2A 4IG0B 3U27A 4KKOB 3DGPA 5F41A 1KLNA 4YS2A 3V6KA 2D3O1 4DI6A 4DV6F 3UWTA 4F7VA 4U95A 4XPEA 4PYDA 1OY9A 3DRPA 3JS9A 4RKUC 1T03B 2Q66A 2I0XA 4PQAA 4B08A 1B99A 3TQEA 4RNNA 2XGPA 4DSFA 1TKDA 3IBFB 3MEDB 4A46A 2UUCJ 4IFVB 1S59A 3R27A 4MH8A 4L74A 3W7BA 5HP1A 1GMWD 5IC6B 4ZN1A 1UCNA 4DPYA 4RPFA 4EI2A 4I2QA 4KHRA 4I6WA 2GAHC 3IRWP 2KKHA 3P49B 1LXJA 3NBPA 4DL7A 5ETSA 1KVIA 2UV8G 3G86A 1RAIB 1AYEA 3LP0A 2HNDB 1QE1B 4JI8F 5C24A 1W7WA 2B3TB 4NI2A 3TWZA 2CPDA 2DGVA 4ZPVR 3H42A 4K4SA 3M7VA 2FY1A 3W9HA 3FCHA 4ZPDA 2ZDPA 4NXNF 5H9EK 4NLUA 5F0UA 2ZH2A 1CVJA 3DI6B 4IUFA 5IFMA 4Q0BA 2QZ8A 3T6JA 1BY9A 3AB2B 7FDRA 2HS0A 1DZ5A 2X3GA 3KNGA 1WG5A 3UVJA 3WX4A 3MMCB 3Q22A 3HD2A 4RW7B 3GJRB 3GG1A 4LRCA 2N4CA 3KG1A 2Y0SD 4HYKA 3LO3A 2APOA 1FKPA 3IBCB 4WFAQ 3NGDA 5KOXA 3T1HJ 1FK9B 5EN1A 2CPEA 1OSCA 3CMAS 2P8IA 2ZBCA 4ETZA 5C42B 1WUUA 2V2ZA 3SMZA 2QFJA 4ER8A 4X84A 5HSPA 4Y2AA 2XMUA 4YDDB 3MEGA 4NL5A 5HVGA 3MR6A 4CLLA 4B3SJ 4KHMA 4PR6A 1FX2A 1RA7A 5E3PA 2CYYA 3V4MA 3KK3A 7FD1A 3DDNA 3VAHA 2FVQA 2EC0A 4C98A 4Z37A 3GQCA 4C8OA 2RHSB 2PFFB 1LXNA 2OGUA 4OI1A 2FZKB 1SJ4P 4YEAA 4B3MJ 3MR7A 3KOAA 4TY9A 4JI0F 3ZTPA 1HR0J 4O23A 2Y1LB 3PO4A 2N4DA 2MQLA 3K5MA 3G82A 2J5AA 2F9JA 4M5LA 1TK5A 3NAHA 1FD2A 4YHHJ 3HXMA 5B09A 1T95A 4FF1A 1OM2A 1UVIA 2HBQB 3DLJA 3TJ8A 2XB2D 3U1MA 1TL5A 1SQEA 5F0WA 3HHLB 5B0GA 1VHIA 4OYIA 4ZVQB 2ASDA 3CJKA 3JSMB 1HQ2A 4CO3A 4LREA 2M4MA 1Q79A 2ZOMA 1AB8A 4NYPA 1X4DA 2IYGA 2XMTA 1Q8BA 2EWHA 2Q6BA 3MR3A 4M5HA 4OZJA 3UD5A 2BQUA 3W5ZA 4M95A 1CPZA 2OD4A 2ALYB 2VZ9A 1YJVA 4MYUA 3HKWA 3TA1A 3GR1A 3VGSA 1UPMB 1Q7LB 3TQ1A 4UY8T 4PRFA 4JV5F 1WSRA 1R31A 3GJQB 4J9RA 3CMQA 1DTTB 4USTA 4RW4A 4WXWA 1APSA 1R8HA 3TRGA 1X7VA 2BE2B 2Z2YB 2MQMA 3DM2B 2XC9A 2H51B 3A3PB 3SQGB 1KRPA 5J1PA 2YKAA 4RU2A 2VB6A 1F5BA 2HFUA 3I32A 4NA1A 1JLCA 2HAIA 5A0YA 4BBYA 3RR7A 1KEKA 3ZZUA 2LDIA 3N4WA 2QSFA 4YUDA 1G2EA 3BV8A 3CTRA 2B5JA 4J5OA 4CNYA 2QX0A 1QAIA 4ED5A 3QT7A 4LVOP 4OL8A 3M8WA 2M8HA 3E01B 2ZWOA 4I7FA 5HQLA 3MMAA 3L4BC 4QW8A 2BJ8A 4ED1A 4KV8B 2DNPA 1KVJA 3TOQA 2CQCA 3ITHB 2BDPA 1S1WA 2V4JB 3H5UA 3PIOQ 1HQUB 2W7PA 1HKAA 2VQFJ 1S0MA 4ELTA 3I56S 3OVBA 1GMUA 2BA9A 3KFWX 4CLTA 1IXKA 4JI6J 4F4XA 1RAGB 3P45B 5AT1B 2ZC3A 4ECRA 3PJXA 4HKQA 4I6AA 2WVBA 3G2XA 4C48A 4OI0A 1ZAWA 3IR6B 2MKJA 1NPKA 4NLVA 3MFHA 4A4JA 4KIAA 1HNZF 2XMMA 3OXGA 2C2KB 5KFOA 5C24B 3Q8UA 3ZZOA 3BR9A 1T02A 3ET6B 4K2JA 5GAGI 2ZUGA 3CDBA 2X1AA 3EPIA 2ZVIA 3AJ1A 1PO6A 4Z7YA 1AUDA 5CYJA 4NLSA 5KG7A 1GTHA 2CNKB 1T9YA 2KXHA 4LF9F 3CC7S 1JLEA 3VAJA 2WB4A 3HFKA 4DF8A 4W4MA 3KG4A 2RE1A 2NZ4A 2B8PA 3D6FB 3GIRA 1FWPA 1TL7A 2HIYA 1UVMA 2KO1A 2W9CB 4AL5A 3THVA 3QSIA 3K8VA 3WQPA 5D3GB 1KQSR 1FVSA 3RRGA 4BDPA 4M1KA 3J7YU 4W90B 2X1GA 5AXKA 3AODA 4S0MA 1XMOJ 3GFXA 3R2CJ 3QGIA 1M1KT 2F8MA 2V2VA 5A8KA 2DYAA 2FLPA 3FEXB 4NCGB 2OD6A 4KGXB 1LQ9A 1BQMA 3QQCD 4KY3A 1PSDA 4NMXA 1N34F 5LSOA 3BO4A 1AUSL 2HNDA 5BR8J 2QLBB 1N8RT 4ECSA 4OV6A 3PW0A 1NDPA 1H38A 3PM9A 4M94A 3PG9A 2XZDB 2IJNA 1H3DA 3CJ5A 1NK4A 1TVRA 2V50A 4OYXA 4C11A 1C1BA 2HURA 2LYVA 3AQPA 5IWAJ 1LW2A 3D7SB 1JIHA 2YWKA 4OIXA 4CO5A 4LF8J 2PFDA 3OLAA 2L08A 2MGZB 2VBZA 1AZSA 4F36A 3CJ0A 4I2QB 4YB1P 3ISNC 2XLJA 2V8GA 1VQ6S 2R7SA 2DT9A 1U26A 3OJUA 2M5YA 2RVJA 1ZZFA 1WOPA 3JQKA 1VQ8S 2UXCJ 4KPYA 1OS5A 3MECA 3VVTA 4PWDB 3QRRA 1TP7A 2AJFE 1RXOB 2P9EA 3EVOA 2FHJD 2E5JA 5EDWA 3OTCA 4GVBA 3Q8RB 1RHMB 1WC3A 2QLWA 2NXNA 2DHSA 5KFZA 3H40A 2D41A 2B6AB 2YQ0A 2EK6A 5B08A 4DR6J 3CO9A 4IR9A 2DY1A 4NRTA 1EKSA 1HHTP 2PE8A 4KJIA 1Q8LA 4EUVA 1X9SA 5KFJA 2OPQB 4NYZA 4JI5J 2LEBA 1TL3A 2XG8A 2NQPA 4DQIA 4F2SA 3BQ1A 4LSZB 5J2MA 3HHLD 1PAEX 1RU2A 1E6VA 1MWYA 2P2CB 2VFSA 2WSCC 4IH5A 4KGVB 4P6QA 3CCES 2DNKA 2G2YA 2NPIA 3ELHA 1U4BA 4N41A 1FKOB 3EXYA 3UVJB 3GV7B 3QJPA 2D1CA 3S01A 4RW7A 3HPOA 2HVIA 2HVHA 3C2PA 4ECVA 1I5OB 1VQSA 3QMQA 4OV1A 3QSYB 3S1TA 2B7BB 2QYCA 2DEIA 4PXBA 3RYLA 2KG1A 1AA1B 3CCZA 2HMIB 4F0HA 2C2RA 2R3VA 2J8AA 3BZQA 4HHHA 3T6BA 2DNLA 3IBWA 5GAGU 3N9UC 3NAIA 3K5LA 3I5AA 1RCOB 4KKOA 1LW0A 1FE4A 4QIFA 5KFXA 4H54A 4X4UA 1OPIA 4OYWA 3WZ0A 1S6UA 2G4BA 1HBNB 2KU7A 2W2PP 3ILJA 3CF5Q 1R0AA 3NMRA 2ZHBA 4IDKA 3G82B 2KTQA 4L6V3 4C8LA 3TAMA 5IT9Y 1QUPA 3R9LA 3ONQA 3M9MB 1U6BA 4LRFA 5HP1B 4ZITA 3EDRB 2AWZA 3GZ7A 4PKDB 3W64A 1N5SA 2DD8S 1PYTA 2HNYB 1UJ4A 1VCTA 3W5YA 2BRLA 3QIPB 4PUOB 2VICA 3JXOA 3R3TA 4USUA 5A8WB 4OZ2A 5F8JA 1GQEA 2FJEB 3NGUA 1NH7A 1RCXB 4LJMA 4B9TA 2QC3A 4ZPBA 5CCMA 4B9MA 4DSIA 4WF9Q 3MM7B 3POTB 2DIVA 3EDQB 4M5NA 2ZHOA 2FLOA 3LW5C 3DLEB 5F3TA 3BYPA 2D3UA 2GIRA 2HK2A 1HD1A 3Q8QB 1MSWD 1NZ8A 2X51A 4TQRA 4URQU 2W4PA 4YR2A 1IBKF 3THTA 1BLUA 3T19A
chains in the Genus database with same CATH topology
2VODA 2V4RA 2E29A 2GHVC 4GKJF 1KS2A 2DK2A 2W7AA 3C6UA 1QAYA 2OSRA 3M2VB 3IA0A 3H20A 2VQFF 1BGXT 4DFPA 1S1WB 1MMLA 2V4JA 2VUGA 4DR2F 4OJ3A 4G6VB 1S6PA 4H4KA 4Y2KA 3TUIC 1MMDA 1V6HA 1TKXB 2RQMA 4MKAA 5A6WA 2KM8B 1HWLA 1LK7A 2DGXA 1RT4A 4BC9A 2V0NA 3OHBA 2MSTA 2HNZA 4CO2A 4UUWA 4LFAF 4DR7F 2L9WA 2B56A 2KJVA 5IQ6A 4PG7A 3ZZRA 2XWYA 3ISZA 4IFVA 3UQSA 5DO2A 3BS9A 3QO9A 4ZP9A 1FTCA 2CPYA 1FRJA 3MM9B 1IKWB 1FF2A 3G8QA 2MY8A 1FRLA 4IQMA 4DWIA 4KO0A 5GADU 1P6TA 2FGCA 2K7KA 3OUYA 2ZH1A 1RT7A 1VBYA 5IXUA 5HN0A 5DG7A 3N6LA 2RSQA 3I31A 1YJRA 2N3LA 5AXMA 2XSFA 1R8CA 2DHAA 2ERRA 4OZ5A 2WONB 4AFFA 2WAQD 3MHYA 3BSOA 4Q7AA 3OL6A 2ZH3A 3PKYA 3ZC4A 2HQ3A 3DM2A 2DR5A 2YWEA 3ZZZA 3OFHA 2RQKA 1TAUA 4JV0A 3KLFA 3OPKA 3A8EA 3GB0A 3OFEA 3SYZA 3CCLS 3MF5A 1SBRA 2HGMA 4P7TA 1F9FA 5T7LB 3UCGA 5KFFA 2M0GB 1FCAA 1RP5A 2IRYA 3HZEA 2GIQA 4K5RA 5HO4A 3CJ2A 4DV7F 2R2RA 1HBNA 2E9ZA 1WTFA 2VPYB 3MWBA 1GX5A 5GAHU 4PWDA 1FRIA 1FRKA 1OWXA 2RJZA 3MMBB 4ZMMA 3MEDA 3C46A 3W3SA 4ZVGA 1JK9B 2XSJB 2YWHA 1YG0A 5FDLA 1ZYQA 1BC6A 3GWCA 1E6YB 5J2NB 5T41A 3NBPB 4NWBA 2D74B 3L09A 3RB6A 3IGVA 1W25A 2WBRA 3FQLA 5H9EJ 3FEZA 1KNZA 2XTDA 5J2MB 4DF4A 5A6PA 2OMOA 4ECYA 1ZTTA 1F2GA 1HWUA 4QWBA 5IT4A 1VQMS 1RKIA 2XY7A 1TKZB 4EBCA 2A10A 4OQJA 4ECWA 4OZ0A 2PI4A 4C8YA 4DV5F 2KRBA 1IN0A 4DUZF 1IJFB 1NEEA 4ZHRB 3OFGA 2MHEA 1TUVA 4ED6A 3VR1A 3O2IA 4RW8A 4LUBA 1BQMB 1XEZA 3NCRA 2MQQA 3BB5A 2KB2A 1M90T 1CQNA 5L38A 1LWCB 4YOEA 2Z2MA 4RWXA 4NZ7A 2GMLA 1J2VA 2X1BA 4A48A 2XBPA 2YTCA 3LP1A 4IH7A 2RF2B 2MQNA 3BO2A 2FDNA 5KFUA 2HFZA 4A8SA 2OKQA 1N88A 2LEAA 2PA8D 1TK0A 3PHEA 4ES3A 2M7SA 2KT5A 5GADI 1G1XA 3G8TA 1GXUA 1TR0A 4NZ0A 2GO8A 4IOBA 4X4TA 3K2YA 4OLPA 3SFGA 4OI6A 2ASLA 1PC4A 1N48A 2FJWA 2ZHAA 2AP6A 4C2MA 4OLOA 4UUXA 3AQOA 4U67Q 4DJBA 3TW0A 4DR6F 5B7WA 1X5OA 1IKXB 3S8SA 1FT8A 4ZP7A 4CT9A 4K4XA