3OL7A

Poliovirus polymerase elongation complex with ctp
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
461
structure length
461
Chain Sequence
b'GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymerase
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
total genus 143
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3ol7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ol7A02
2B5JB 4KKOB 4ECXA 2VG5B 5KFUA 3DOLB 2AGPA 1T3NA 1QE1B 3KLGB 2JLEA 1LW2B 1RT7A 4H54A 4IDKA 3QLHA 4KBIA 4QWBA 5KG6A 5HLFA 1ZTTA 1S6QB 3IRXB 2OPSA 4J9KA 1RTHB 3KK3B 3IS9A 5C24B 4WFZA 2W9CB 5F8IA 4J9SA 4TY9A 1S49A 2YKMA 4KO0A 4DG1B 2ILZA 3M9NB 1HYSB 2CKWA 2BRLA 1RYSA 4PUOB 4PQUA 4RNOA 1T03A 2BQ3A 3T5HA 5JXSA 4DL3A 1HQEB 3JYTA 4ZPAA 1Z4UA 1VRTB 3QO9B 2F8EX 2QV6A 2BANA 3DM2A 2OPPA 3ICLA 2IC3B 5C5JA 3EPGA 2R2SA 2FVRA 3BGRB 5D3GB 5KT2A 2RKIA 4RW4B 4IRKA 1TL3B 3CJ5A 4RUCA 2IJNA 2BE2B 5J2NA 1C1CB 1RAJA 3SFUA 1S9GA 5EWGA 3DYAB 1IKVB 1JKHA 1RA6A 3JSMA 4IFYB 3CDWA 3Q8RB 4ID5A 1FKOB 4EBDA 1TL1A 3VQSA 3RB4A 3MECA 1GX6A 4U6PA 3M9MB 3H40A 2B5JA 1XR6A 3UPFA 5HROA 4KKOA 4RW6B 2VG5A 1TV6B 3DOLA 3SI8A 1S10A 3GIMA 1QE1A 3KLGA 1LW2A 2VA3A 4MKBA 4MK8A 1HNIB 1D1UA 2IMWP 1LWCB 1S6QA 3IRXA 3MEGB 1RTHA 3KK3A 1MMLA 5C24A 4WXWA 2W9CA 2IM2A 1QAIA 5KG4A 4DG1A 1LWEB 5EWFA 1HYSA 5I42B 1C1BA 4PUOA 4QW9A 1S1XB 2HAIA 4ZVEA 3G6XA 4G3IA 1HMVA 1VRTA 2D3ZA 3HVAA 1RT4B 3DDKA 1SH0A 2IC3A 1IKWB 3BGRA 4YR3A 1LW0B 4TQSA 3RBDA 5D3GA 4RW4A 4M94A 1TL3A 3FQKA 2XGPA 5DGAA 3ISNC 2VG7B 2BE2A 1S4FA 3H98A 4KB7A 3PR5B 1C1CA 3DYAA 3N6MA 4JV0A 1IKVA 2FJXA 4Q8FA 3KMSA 5I3UB 1S97A 4XO0A 3CJ4A 2V4RA 1FKOA 2C2RA 3KOAA 4RU9A 4QWCA 1OS5A 4ECQA 5KG2A 4RW6A 3MFIA 2I5JB 4MFBB 3MR3A 4YR0A 2R8KA 2XWYA 1HNIA 1JLGB 3CDUA 3KNAA 1LWCA 4KHRA 4ZP7A 5F8JA 3MR5A 3IGVA 3LP1B 3TAMB 2FJWA 3QZ7A 3QGIA 1CSJA 2OPQB 1LWEA 4ECSA 5I42A 1FK9B 2BQUA 1DTTA 2HMIB 5DQIA 2HWHA 4IOBA 1RT4A 3PZPA 2FLPA 1IKWA 1C0UB 1LWFB 1LW0A 4MIBA 5KFZA 3MEEB 4F4WA 4TYBA 1RDRA 4MIAA 4NLYA 4WYLA 4QPXA 5KT7A 5KT3A 1RTDB 1N4LA 2FVPA 3C6UB 3KMQA 4WYWA 2R8GA 4NLWA 5I3UA 4RW9B 3FDSA 4KHMA 3OLBA 5KFTA 2UVUA 3E51A 4NLOA 3LP2B 2WONB 5FDLB 1JLFB 2OPRA 3V4IB 4IR1A 2I5JA 4MFBA 4IRDA 4MK7A 3PW4A 2IM3A 1JLCB 2WB4A 4KAIA 4J9RA 1YVFA 1JLGA 3DI6B 3BSCA 4O3NA 2IJFA 1DTQB 3BQ0A 1S1VB 2XC9A 4TN2A 3TAMA 3LP1A 2W7OA 4FS1A 2UUWA 3HKWA 3BQ1A 2OPQA 2ALZA 1S9EB 3CJ0A 1FK9A 4QWDA 3QGHA 2HMIA 4MK9A 3E01A 2AWZA 4NLQA 1DLOB 5HBMB 4FS2A 3BSOA 4I2PA 1S1UB 4URGA 4YQWA 4HYKA 1C0UA 1LWFA 1RTIB 1RTJA 3MEEA 3ITHB 5CYQB 3DLGB 1MU2A 1RTDA 3QZ8A 3GIIA 2HNDB 3CVKA 4IH7A 4RW7B 5L1JA 4F4YA 4ECWA 3C6UA 2GIRA 4X2BA 4RNNA 3HVTB 4IH5A 3GILA 4LSLB 4EBEA 4Q45A 4RW9A 5F9NA 2AQ4A 2WHOA 4RW8B 1K1SA 5F9LA 5DQHA 2ASLA 3PHEA 2IBKA 4Y2CA 4J9MA 2W8KA 3LP2A 2R8HA 2WONA 5DG9A 5FDLA 3GQCA 3OL9A 1JLFA 4I7FA 5KFAA 3V4IA 5KFIA 3RB0A 3PJXA 2UVVA 4WZQA 4ZP8A 1JLCA 3DRRA 2DPJA 3GIKA 3PW2A 3DI6A 1RT3B 4O4GB 4R8UB 3G6VA 2D41A 4ED3A 4WFYA 1DTQA 3V6DB 3V6JA 3G86A 5J2QB 4JV2A 3T19A 4IFVB 1JX4A 4H4MA 3KK2A 4LQ9A 1S9EA 3NBPB 3MEDA 4R5PB 3H2LA 3KHRA 4NLGA 3BREA 3PR4A 1T05B 2AGOA 5KFNA 1DLOA 5HBMA 2FJVA 2VA2A 1JLAA 1S1UA 4LSNB 4NLSA 4WFXA 1RT2B 3QYYA 3MFHA 1RTIA 5CYQA 5KFDA 3I0RB 3ITHA 4IG0B 3DLGA 4XPCA 3RAXA 2HNDA 4RW7A 4ED1A 4OL8A 4URQU 3LALA 4NLDA 4NLXA 3H5YA 3HVTA 3N6NA 1HPZB 4LSLA 3DLEB 3BQ2A 5L1LA 3T5KA 2EC0A 4RW8A 4NLUA 4ZP9A 2FVSA 3MR6A 5KFMA 3M8QB 3ISND 3MF5A 3KK1B 5T14A 1HQUB 3NAHA 5F8MA 2YNIB 1JXLA 2V9WA 5J2MB 1HQEA 5DG7A 4ECZA 4MKAA 3LAMA 1JIHA 3QO9A 3Q8QB 4O4GA 1RT1B 1RT3A 5KFHA 3KLHB 2E9TA 3V6DA 1N6QB 5KT4A 1FKPB 1JLQB 5J2QA 5KFCA 4MH8A 3OL7A 3H4BA 4IFVA 3TQ1A 4WXOA 2YKNB 1BQMB 3NBPA 5DG8A 4R5PA 3OL8A 4K4XA 4ZPDA 4ZMMA 1JLEB 5KFFA 1T05A 4G1QB 3GYNA 4IFYA 3RB6A 1TKXB 4LSNA 5L1KA 1U09A 1RT2A 2JC0A 2RDIA 5KFWA 3D5MA 3I0RA 4IG0A 3KJVB 2WOMB 3CIZA 5KG0A 1R0AB 1TV6A 3H4DA 3OSNA 1JLBB 3RB3A 1RA7A 1HPZA 3MEGA 3DLEA 1C0TB 2WRMA 3NAIA 4J9PA 1TKZB 3PW5A 5KG3A 5F8GA 2B6AB 3BR9A 5F8LA 1N48A 4QWEA 3M8QA 2W9BB 4EO8A 3KK1A 4WE1B 1S48A 5DLGA 1S1XA 5J2MA 4K4ZA 4NRUA 1KHWA 1RT1A 4IKAA 3CJ3A 3DOKB 1EETB 4NRTA 1NHUA 1N6QA 5KFYA 4U7CA 1FKPA 1JLQA 2YNGB 4RNHA 2OH2A 3PW0A 3RBEA 2VG7A 4ZVGA 2YKNA 1BQMA 4ECUA 5DQGA 5C25B 2R2RA 4NLPA 3DMJB 3UDLA 4HKQA 1JLEA 5KFLA 3DRSB 4G1QA 2RDJA 2XCPA 1HARA 1EP4B 2IA6A 2ATLA 3LP0B 1TKXA 3V6HA 4RZRA 4O3RA 4Y2AA 5KFKA 5KFOA 3UQSA 3KJVA 3MTKA 3NKYA 2WOMA 1J5OB 3TVKA 4J9QA 1R0AA 4ZVFA 2UVRA 4O4RA 3PVXA 1JLBA 3FFIB 3M9OB 4J9OA 4JV1A 1C0TA 1TKZA 2C22A 2B6AA 2O5DA 4TXSA 2AU0A 4K4SA 4ICLB 2WTFA 2W9BA 2ASDA 3QLHB 4WE1A 4B3OB 3KHGA 3FQLA 1IKXB 2HNZB 4ZHRB 4ED6A 1K1QA 1EETA 4J9NA 4PQUB 1NHVA 2YNGA 4ECTA 4ZVHA 3JYTB 4O3OA 2HNYB 5KFVA 5DGBA 5C25A 3DM2B 1C2PA 3DMJA 5CYMB 2ILYA 3CWJA 3DRSA 1KLMB 1UWBB 1EP4A 1RT6B 2RKIB 3CDEA 3LP0A 3BSNA 2XCAA 3GV5B 3KHHA 1W25A 5L1IA 4F50A 4DL7A 3KLFB 4ECRA 1N5YB 4ECVA 5EDWA 4ED8A 3I0SB 3NGDA 5KFBA 3M8PB 2WK4A 5KFQA 2DPIA 4PWDB 5KFJA 3V81B 2J6TA 3IG1B 2FVCA 3T1AA 4RNMA 3GIJA 1SUQB 3FFIA 3SFGA 4Y34A 2GIQA 5HROB 4YMEA 1S1VA 4GC6A 2R2TA 4I2QB 4KE5A 2IM1A 4ICLA 5KG1A 5HP1B 4ZPBA 3MR2A 4O3QA 3Q8PB 3BJYA 4F4ZA 4B3OA 5KFPA 4EBCA 3I5BA 1D0EA 1IKXA 2HNZA 5K14B 4ZHRA 1S6PB 2FLLA 2B43A 3D28A 3KLVA 3EPIA 1S0NA 1NNDA 3CJ2A 4EO6A 4IQXA 4K50A 2FLNA 4ZP6A 1C1BB 4K4YA 2ZD1B 2V4QA 2JEJA 3DRPB 4DL4A 2JEIA 1TKTB 5L9XA 1HMVB 2HNYA 4F4XA 2R8JA 1IKYB 4NLVA 2I1RA 5CYMA 4KFBB 5DLFA 1ZETA 3RAQA 2E9ZA 1KLMA 1UWBA 4GC7A 1RT6A 2AX1A 4IH6A 4ED0A 3KLFA 2D7SA 5EUHA 4O3PA 5EWEA 1N5YA 4RNFA 5KT5A 2XI3A 3I0SA 4K4WA 3FSIA 3M8PA 4PWDA 4RUAA 1SV5B 3V81A 3IG1A 3QIDA 3QIPB 5KFRA 4NLTA 1XR7A 3NMAA 1SUQA 4Q0BB 4R8UA 3OSPA 4EEYA 4O3SA 3UR0A 4K4TA 2BRKA 2BR0A 3V6KA 4NCGA 2VG6B 2ZE2B 4I2QA 2J6UA 3GV8B 5HP1A 2C28A 4Q43A 4KSEB 3BSAA 5J2PB 4YR2A 4ECYA 2IAJB 1KHVA 2XI2A 4XPEA 3KLIB 4TLRA 3GV7B 1S9FA 1RT5B 5K14A 1ZTWA 3FRZA 4H4OB 1S0MA 1S6PA 2ZKUA 1QAJA 5C42B 1GX5A 2ZD1A 5F8HA 4TY8B 3I5CA 1DTTB 2GC8A 3DRPA 4URSA 4TQRA 4IG3B 3OHAA 3DLKB 3KLEB 1VRUB 1TKTA 3G6YA 3PW7A 4K4VA 4O44B 3NL0A 5J1EB 2UVWA 1IKYA 4FBUA 4KFBA 4DL5A 4JUZA 2IM0A 3EZUA 3I5AA 4DL6A 1S1TB 2BQRA 3LANA 3QGGA 3IN5A 5KFSA 1HQUA 2YNHB 2AGQA 2YNIA 4KV8B 4DEZA 1SV5A 4ED2A 3H59A 3QIPA 1RYRA 5KG5A 2ASJA 3OLAA 5F8NA 5KT6A 4Q0BA 3KLHA 4EYIB 4Q44A 2JC1A 1QUVA 2OPRB 2R8IA 2VG6A 2ZE2A 4ED7A 4J9LA 2RF2B 4QW8A 5KFGA 2C2EA 1SH3A 2D3UA 5J2PA 2UUTA 5JUMA 2IAJA 4FBTA 1BQNB 3KLIA 1RT5A 1SH2A 3LAKA 4H4OA 4NYZA 1HNVB 2WCXA 2YNFB 2W7PA 3T5LA 1REVB 1TVRB 5C42A 3OL6A 4TY8A 3PJWA 2JEGA 1S1WB 4IG3A 3KLEA 3DLKA 1VRUA 4ZPCA 3C6TB 4O44A 5J1EA 4I2PB 1S0OA 2J6SA 3E01B 3OHBA 4NCGB 1RTJB 1I6JA 1N56A 1TP7A 1S1TA 1MU2B 4WZMA 4Q8EA 1RT7B 5HLFB 3HVWA 4IDKB 1WNEA 2YNHA 2FVQA 2QE5A 3N6LA 4KV8A 4DL2A 2OPSB 4Y3CA 4EYHB 3HHKA 2AX0A 3IS9B 5KFXA 3KHLA 1XR5A 1IM4A 2CJQA 3DOKA 4NZ0A 2YKMB 4KO0B 4IRCA 2HWIA 1T94A 4I7FB 1T03B 4K4UA 4M95A 2RF2A 3DRRB 2C2DA 2BANB 3H5SA 2OPPB 1BQNA 4NLRA 1HNVA 2YNFA 3Q8SB 1REVA 3T5JA 3CO9A 4QWAA 1TVRA 4H4MB 3KK2B 5J2NB 2JEFA 2XGQA 1S9GB 3H5UA 3MEDB 4TYAA 4IR9A 1JKHB 1J5OA 1S1WA 3H5XA 2W8LA 4LQ3A 4YP3A 3JSMB 2R2UA 5KFEA 3C6TA 5KG7A 1TQLA 1JLAB 4ID5B 2V0NA 2W9AA 1TL1B 3IGNA 4R0EA 3MECB 2E9RX
chains in the Genus database with same CATH superfamily
4KKOB 2HYIB 2OHDA 1V3SA 1QE1B 2ABYA 5HLFA 3P5BP 2Z56B 3IWXA 3KG1A 4ZLPA 2ZITA 4RNOA 5HMZA 4DSJA 4DFMA 1LEOA 2BANA 3DM2A 2OPPA 2LLZA 4RUCA 1DBDA 4P74A 2JSXA 3JSMA 3VAGA 3MECA 1N34J 3R5DA 3UPFA 3LUYA 4YS2A 1HNIB 3PXGa 2J9EA 1HNWJ 3IRXA 1DFDA 1AB8A 5B0CA 3RAMA 4CLYA 2MMYA 2GQQA 1NK0A 3QQCD 2CNNB 3K5OA 2C3PA 5DGAA 4F04B 3PIPQ 1YX2A 4KB7A 3MMBB 2LECA 3GJQB 5B0GA 1AT1B 2UXBJ 4QQBA 2XWYA 4LF5J 2FTRA 5K8NA 2W25A 3W2VA 2GS8A 3I87A 4QOTA 1CPZA 4TYBA 3OTEA 3BKTA 3C6UB 1RXOB 2ERRA 3E51A 3UCZP 4MFBA 3RJMB 1M5SA 2WVCA 3PW4A 2X1BA 4J9RA 3L95X 3TNVA 4QR1A 2HMIA 2XSJA 1DLOB 5HI7A 3H90A 4YQWA 2VKZG 5CYQB 4DLEA 2HNDB 4IH7A 3RRHA 3NEKA 1KDNA 2W01A 4HHJA 1IVZA 3LP2A 2DHSA 1F6TA 2LQ5A 3GIRA 4G6VB 3CD7A 4JYAJ 2L48A 3QWPA 3P45B 4MKYA 3N6NA 3H7HB 4BHQA 3HLUA 4OI3A 1SJ4P 2AW0A 3L09A 2V9WA 3RW6A 1Z2ZA 4CT8A 1UCNA 1QLNA 4ER8A 5KFFA 4LSNA 2JC0A 3OSNA 1PO6A 1RA7A 2OO4A 3TZXA 2B6AB 5HMXA 1N48A 4L73A 3HDSA 3M8WA 3IAS9 1SJQA 3MD1A 1RLDA 3UD4P 2KDOA 4IQMA 2CZ9A 3A8IA 2HFVA 2VG7A 1HD0A 3RBEA 4FYWB 2BKPA 1RCXB 4G1QA 1HW8A 3QRPA 2Z2MA 4PKDB 2ZWOA 1N8RT 1WC0A 2G0CA 1UVJA 2MLYA 2FC9A 2QLBB 5GAGU 3FQLA 3J7ZT 1RJJA 3J7YI 2E7VA 4KC5A 1RWWB 4EMDA 2AMCB 1KLMB 3LP0A 4NWBA 3AOBA 4WP8A 2DY9A 2DIUA 3V81B 3CEDA 4A46A 4O3QA 2YBVA 4IO1A 4PAAA 3G8QA 2IVYA 3CXCR 3EPIA 2HIYA 1HMVB 4ZIVA 4KFBB 2BA9A 4DSIA 4Q5VA 1IM6A 5KT5A 2Z0GA 1W2BR 5LOQA 1RGVA 1XR7A 4Q0BB 1ITPA 3UR0A 4F2SA 2XM3A 2CRLA 2DGVA 2V4JA 3GV7B 2OI2A 3O8WA 1NO8A 4DV7J 4MJKA 1VHFA 1KD1T 4CLPA 5LT5A 4C11A 4HH0A 3SXLA 5KG5A 4Q44A 2YX1A 4C3KA 2OIHA 3B4MA 4DV0F 5CZVA 1K0TA 3GZ7A 3M8YA 1KFSA 3FSYA 1MROA 4A8FA 3D6HB 4DFKA 5A0YA 1VRQC 4Q8EA 1UW4A 2HVHA 3B8HA 3NNCA 4PG6A 1KTVA 1WF1A 2MLZA 2N7CA 2C2DA 2KFYA 2QL7B 3I4PA 2FY8A 1HLWA 5GVQA 2DHHA 2CQDA 3JTNA 3NGSA 3GB0A 1YWXA 1RAIB 3HM9A 1SKUB 3LGHA 5F0UA 3DOLB 3GSIA 3RR8A 3KLGB 2YH1A 5KG6A 2J7UA 5I3QA 1HNZF 3LF0A 1T0TV 1S49A 5E3QA 4PUOB 5JXSA 3QO9B 2F8EX 3VCDA 4ES1A 4IRKA 4F36A 1RABB 2BE2B 3CCES 3C2PA 5F0WA 2HGLA 1VQ8S 1IR0A 3VAJA 2VA3A 2EWHA 2XS7A 2QYCA 4QW9A 3UN5A 1A6LA 4YR3A 5D3GA 1VQPS 4RW4A 1IBMJ 1WD6A 5B0AA 2V4RA 3NCQA 2EKNA 3KOAA 1OS5A 1IR2A 2MQ8A 3CDUA 3FEXB 1VIOA 3MXHP 2EI5A 1TZ0A 1RT4A 2HQFA 3P4UB 3MUMP 3CCZA 4OHZA 5LJ3Y 2R8GA 4KHMA 1P6TA 2HFZA 1XMBA 2JZ5A 3C15A 3CCRS 1JLCB 2WB4A 4ELUA 1UVIA 1WKKA 1FVSA 4FS1A 1S9EB 1HHQA 3PRVA 3IBCB 2KHCA 1HR0F 1C0UA 2XS5A 2EFGA 2V8HA 3NOGA 3ELHA 3T6BA 4ECWA 2P8IA 3J81U 4C8KA 1WDTA 4AL7A 2F3JA 3NWGA 1F1BB 3CNQP 1P27B 3RB0A 4DFPA 2GVZA 3DRRA 5JJBA 5J2QB 2NLWA 1T9UA 1GFWB 1HNXF 4AL5A 2F40A 3MEDA 1HL6A 3QPIA 1X4FA 5HBMA 2UXCJ 1S1UA 4WFXA 2R7SA 3RAXA 2DGWA 4GO5X 2CPJA 4NLDA 3HVTA 3P8BB 3T5KA 1BXNA 4ZVRB 3NAHA 1FJCA 1SXLA 3ILJA 2H48B 2A6OA 4GKJF 1RT1B 3CD0A 1W2IA 5KT4A 4MH8A 4IFVA 3NBPA 4GO7X 3LQVA 2RDIA 4R25A 4DCPB 4K2XA 2B9YA 5LM7E 4RPFA 5CCLA 2B4PA 1HPZA 3SCJE 3BR8A 3X3UA 4OLPA 5C2GA 4K5RA 4JI1J 2AT1B 1U25A 4ZKAA 3IR7B 3HJVA 4USVA 4U7CA 3OT9A 2YKNA 1F5BA 4NLPA 3DMJB 2IA6A 3RG6A 4AT1B 5KFOA 3KJVA 2NSBA 3PYDA 8ATCB 1Q5YA 4TXSA 1X9MA 3PDNA 3IMQJ 3MUTP 1TL4A 1FJEB 2ZEJA 2DCUB 3PYGA 1RBLA 5E3RA 5H9EK 4DU7A 3C8YA 1YBAA 3UD5A 3CO0P 4FXWA 2FZGB 1C4CA 4Y34A 1S1VA 2KZMA 3MR2A 1JNZB 3G96A 1C1BB 1PJ7A 1QUPA 2DEIA 5L9XA 3MM9B 3D4JA 2JOQA 2MPUA 2E9ZA 2JJ4D 1S76D 1IQZA 4DV6F 4UQGA 3V6KA 4KY3A 4DJBA 2ZBQA 4YR2A 1FRLA 3KWMA 2OUGA 2KKHA 4A8SA 4K5SA 2KXNB 4CI0B 3OHAA 1C4AA 2DRDA 4BS2A 4RWWA 3IN5A 1J2VA 4N7TA 2BW7A 2LU1A 4J9LA 1FEHA 1SH3A 3GJTB 4L74A 4RUBA 2XMWA 3T5LA 3R5BA 1TVRB 2AP6A 3UWTA 3IWLA 2DR7A 1S1TA 2KH9A 3FK4A 4FZVA 2M5YA 1SVDA 2YKMB 1KKHA 4I7FB 2R7OA 2R7QA 4LF4J 1QSLA 5J2NB 1TAUA 5D77A 3VWSA 3MAHA 1SJ1A 3V5RA 4B9MA 2V0NA 2NYIA 2Z2YB 3GU0A 1LXJA 4LSZB 2B5JB 4PG5A 1AUSL 4KHPF 4PXEA 4H54A 1WHWA 1R89A 2VJUA 2EFOA 2IIHA 1EZZB 3AX2A 5B0BA 2FVRA 3KG4A 1LOUA 1IBCB 4QU6A 4G1IA 2KB2A 4NI2A 4NXMF 1RA6A 1VJWA 4IFYB 1Q5VA 1TL1A 3RB4A 2M0GB 1E6YB 1CJKB 1FO1A 4MK8A 1RTHA 1NPPA 3DLBA 1HYSA 5CD4H 2MQQA 4G3IA 2KO1A 2GAHC 3VQTA 1FESA 1URRA 2LFVA 1FRKA 1A9NB 5HJXA 5H9EJ 2X3DA 3CMQA 4XO0A 4N41A 2A3JA 3MR7A 5KG2A 3KUHA 2K2PA 5T41A 4YHHF 1UJ5A 2AF6A 5F8JA 3MMAA 2RVJA 1Q79A 8AT1B 1CSJA 3VHQA 1RHUB 3BGOP 5ETSA 1ZA2B 5ETLA 2ZH3A 3QFHA 1OPIA 1RQ0A 3OLBA 2HHPA 4JI8F 4PCQA 5A8WB 2RQMA 2XC9A 2EKYA 4P7VA 1RZMA 3DLHA 1AW0A 1VCTA 2Q1LA 5D4PA 2F1FA 4NCAA 1RTJA 1YIJS 2WAQD 2XY7A 2GIRA 1X4AA 1K1SA 1SC6A 1V5VA 1V3RA 3D1HA 1FEEA 3G86A 2YVSA 5D4LA 2IHR1 4FF3A 4PXBA 1WI8A 3A8KA 5F41A 1RT2B 5KFDA 4OL8A 3NGKA 3OUYB 2ZZTA 2KM8B 4HI1A 1FXRA 2V67A 2OTLS 1WG1A 3LAMA 3A8JA 2CQBA 3M8ZA 2XYGB 3LWLA 4CO1A 2DNRA 3H4BA 1X0PA 1BQMB 1VR6A 3VTIA 1RHQB 1NLKL 4HHHA 2J9DE 2L9DA 2R7WA 5LMNJ 2VASA 2HEKA 3P96A 4DQPA 3J81Y 1HBNB 3K7RA 2VBWA 2MZQA 2IA0A 4N8OA 4OHXA 2OSQA 1U1NA 3DC2A 5GAGI 2HHUA 2BABA 3EVOA 3GCXP 2ATLA 3R5GA 2UUCJ 1F2HA 4ZVQB 5GAEU 1EQMA 2NREA 1FE4A 3ZTPA 2BW2A 1BHNA 3L9ZA 4K4SA 4LFCF 2V5HG 4RJVA 4TLQA 3DHXA 2R9LA 1T9TA 3TAPA 5C25A 3FEZA 4LFBF 5KOXA 5EDWA 1WSVA 5KFQA 4J9UE 1JK9B 2MJNA 2DH7A 4GC6A 3GP9A 3MPYA 3HHLA 2H1YA 3CJ2A 5ETTA 4ZP6A 1H2VZ 4HVZA 2ZZNA 2KU7A 3A3PB 2XY5A 1IR1A 1O0PA 4LBIA 3Q23A 2B9EA 3TA2A 3BBCA 5E41A 4Y2KA 2BR0A 1TUGB 2GQCA 2GJFA 3OFHA 1FNXH 2NZCA 2K8GA 3TYTA 1VRUB 3ZO7A 3NL0A 4N56A 2Y1JA 4NL5A 2ZVIA 4FNIA 2DXFA 2GW8A 3W3SA 1HWJA 1SV5A 4UOFA 1E6VB 1VC5A 2V9KA 2ASJA 6AT1B 4DU8A 5KT6A 1G4CA 3D0GE 3ILOA 2L08A 4M5MA 5E3PA 2G13A 1CJTB 5JUMA 5K8MA 3CC2S 1N54B 1XK8A 4CTAA 4HR2A 4WZMA 3B6BA 5HLFB 2HHXA 2QE5A 3Q22A 4YEAA 2AKWB 2H3EB 4M5LA 1L3TA 4K4UA 2NCKL 2E5LF 4LF8F 3CJKA 2BANB 2CUYA 2OPPB 4NLRA 2WB1D 2GHWA 3Q8SB 2KJVA 1PG5B 1U02A 4ZLLA 1VBZA 4U96A 3JSMB 3A8EA 3C6TA 3MECB 2JVOA 3R1LA 2MQMA 3QLHA 1ZTTA 3IRXB 2RB7A 3F0NA 2HZVA 2BJEA 4DL3A 1HQEB 1Z4UA 1AROP 2KYZA 1P9QC 1UVLA 3W5YA 4A8XA 4YOEA 2CADA 1U8SA 1X5PA 2VG5A 3MURP 3SI8A 2ZBCA 1D1UA 2V63A 4FF1A 1MMLA 5C24A 4E98A 3W2VB 3AD9C 2VJVA 1TR0A 2DNQA 2D3ZA 2EBGA 4LFCJ 3WC0A 3ZZUA 2NS1B 5GMEA 1I94F 4Q8FA 4GKKF 3A4TA 1EAYC 4MFBB 2CIMA 5DZ6A 2Y1IA 4W90B 2UU9F 1U2RA 2JNJA 2H51B 3LW5C 4JI0J 4DSFA 2BQUA 1DTTA 2HMIB 4B3SF 2HWHA 3AXKA 5KT7A 1F2GA 4CIOA 2FVPA 2V1TA 4IYQA 3GR1A 3EDRB 3LP2B 1D8ZA 2B9WA 2QG9B 2R7TA 1YKWA 3SCLE 3CCMS 3N79A 2ALZA 1DQAA 4A8WA 4DV2F 5L9NA 2XLKA 2NQPA 2MKYA 4WWSA 3NG8A 4EFAC 3GSDA 2XZDB 2LMIA 3BPSP 2YKOA 4UF4A 3QZ8A 3GIIA 4LBPA 5D0RA 4X2BA 4DL0C 2EBEA 3IM9A 5FDLA 1WC6A 3PJXA 5IOLA 2XNRA 3PW2A 3PX0A 1DURA 4R8UB 1U4BA 2I38A 2A0FB 4LSNB 1GQEA 3QYYA 2YWEA 4MMOA 3PG9A 3HSZA 4OQJA 3MOZA 4I6WA 1Y3JA 5DG7A 1VQMS 1JIHA 1DQ8A 2A2DA 3OL7A 4R5PA 4USJC 2H4WB 3H8YA 4G1QB 4FKYA 1ZM3A 3D5MA 1U1PA 2YQ1A 3JSYA 2KG1A 3C16A 1S1XA 3WIVA 2C3YA 4TNOA 3CJ3A 4YDXA 1NHUA 1JLQA 2OH2A 4KR0B 1R8PA 4CO3A 1HBOA 4ZK7M 1HARA 3IBWA 5A8KA 3LP0B 2R4FA 3TJ9A 2GAGC 5KFKA 3VVTA 1U1QA 3J80U 2DNPA 1JLBA 1M1HA 4JV1A 1SPBP 4OZLA 3PEHA 2MSTA 2DEJA 2QL5B 3PV8A 5GAHI 1Q82T 1EETA 3PKYA 4PQUB 3W9JA 1NK7A 5B7WA 3JYTB 1HHSA 2CQPA 2J6TA 3PRDA 3KXDA 4DSEA 2PA3A 2W2MP 1VFJA 2GIQA 5HROB 3QSIA 2VBXA 4KGZB 2V4JB 1D0EA 2HNZA 2GVDA 3K8WA 3RU0A 4L3KA 4LIWA 1IWAA 4NMXA 3W61A 4PYAA 4OX9F 4C11B 5KFRA 1JQGA 5CAAA 4DZDA 4JI3F 5IV3A 3O2IA 3WIUA 1MROB 4DI6A 2DXEA 2AJQA 2G1DA 1PILA 3M2RA 3EZUA 3VGUA 4M5GA 2QTWA 4WBFA 5A0YB 2BQRA 1Y0HA 4LF9J 1U1KA 4RWXA 1G3OA 2UXDF 2A1BA 4EYIB 4ZPWR 1CQNA 1QUVA 2ZE2A 5EHHA 3IR6B 1ZPVA 2H5EA 1JJHA 3EX7B 3W64A 3HSDA 4TY8A 1NXIA 1ZH5A 5L46A 4IG3A 1OO0B 5CZXA 4DPOA 1FNOA 3TVYA 2FVQA 1NKEA 2W2PP 1NJIT 3HK2A 1UWAA 2YWHA 4H4MB 3H5UA 4TYAA 2RILA 3FUYA 5KFUA 3THPA 3BEGB 4KJIA 4GVBA 1U8WA 3I6PA 2M8HA 4FN5A 3AWRA 3G8TA 4PG8A 2CKWA 3HI9A 2QV6A 2R2SA 5D3GB 4RW4B 3ENQA 1GAOA 2KVIA 4P73A 2Z2ZA 1JXEA 4G65A 3H2VE 1WEXA 2CQHA 2YX7A 2HRYA 4U67Q 3THVA 3F44A 1UETA 3D67A 4ANEA 3ZC4A 3NGUA 4UUWA 2W24A 3GONA 4UOGA 1RT4B 1SH0A 1QY7A 1BMQB 2DKOB 3M30A 2QMUB 2BDPA 1XN9A 1OMSA 3QFWA 2H5JB 3KNGA 3C15B 1TAQA 2OEMA 1LV5A 1KEKA 2KZZA 3TX8A 1DRZA 4I6AA 4OV1A 1HKAA 1C0UB 1LW0A 5KT3A 1VMBA 3F73A 4PXCA 3VGSA 3TVZA 3DLJA 1U6FA 3T41A 2UVUA 2ZJPQ 4DUYF 1RWUA 2GVZB 2I5JA 1GXTA 5CXTA 2CAJA 3TX0A 1UA0A 1UAWA 2E29A 2OPQA 4WF9Q 4B3RF 4CO0A 4MK9A 5DM6Q 2HHSA 1UA1A 5HBMB 3KFWX 1S1UB 1X5OA 1ZAWA 3MEEA 3BDEA 4RNNA 3HVTB 1HQ2A 2VDIA 3NS6A 3OL9A 3C14A 1PCAA 2VD3A 2HZCA 2XYHB 5IT0A 4WFYA 3RUBL 3CUNA 3GCWP 4IFVB 3NBPB 5IV4A 5A76A 1OWXA 1NDCA 2HG4A 4X62F 3LALA 1SL2A 1HPZB 4RW8A 3OFGA 2V2QA 5KFMA 1H6KX 1HQUB 4B3TF 3CCQS 1NSAA 4C8NA 1SQGA 2GX8A 2YKNB 1OY9A 2O67A 2ZM6F 2N4DA 2OKQA 3KJVB 2HPUA 4DR4J 1J27A 2HVIA 3W7BA 2L41A 2WRMA 2Z2LA 5IZHA 3ZZTA 4LFAF 5F8LA 3M8QA 2FQQB 2F9DA 4R0JA 1GXLA 4IKAA 4DV1F 1N6QA 2VBYA 4HTJA 4ZLJA 2ZHBA 5DQGA 1A0OB 4YB7A 3ZXWA 4NA3A 1OSCA 2QT7A 2VPZB 3MTKA 1MMDA 1J5OB 4M5KA 4OJ1A 1T9YA 2ALYB 2XTEA 1RCOB 3TA0A 4JI7F 4LREA 4NMLA 4DPYA 1U26A 5GADI 2DR9A 4YY3J 2UUAJ 2OJ3A 1FRJA 2LDIA 4ECRA 2E5JA 5KFJA 3ZZOA 2C42A 5AXKA 4I69A 3BPDA 2WW4A 3M6XA 4LF7F 2DGSA 3W8GA 3D28A 3QBCA 1NZ8A 2ZZMA 4K4YA 2HHWA 1NBEB 2JRSA 1QJHA 2HNYA 4HH1A 2VODA 1GMUA 7FD1A 1KR4A 2QA4G 2D7SA 4X64F 3N5BA 1FD2A 4AFFA 3LPEA 2VC1A 4CO4A 1MG7A 2J6UA 3GV8B 4ECYA 2UVRA 1KHVA 2LXIA 3TARA 5K14A 1S6PA 3MAAA 4OYZA 1RHKB 1S1TB 4P2XA 3OR2B 4XK8C 3QIPA 1ROFA 4FYXB 5F8NA 2IVMA 2Y0BB 3AA8A 3HKZD 3GYGA 3QRRA 2XMKA 1GMWD 3QSYB 2IAJA 2PEBA 3RR7A 4U8YA 2LA6A 2MKKA 2CQ0A 4U8VA 3SMZA 2JEGA 3DLKA 3CCWA 5HSPA 2VFVA 1X0FA 3KHLA 1XR5A 2J7WA 2EVZA 2Q6CA 2JHEA 4ZS6A 4C8ZA 2CXEA 2AD9A 5D0EA 2VICA 2DRBA 3LGNA 2HLUA 4NI2B 1TL1B 1XEZA 2LA4A 1HI0P 2DR8A 2RJZA 1RT7A 3UDEA 1QAYA 5ADZA 1RTHB 3M32A 3JQMA 1HYSB 2MZRA 4LF6F 3A13A 2D9PA 1VLYA 2LEPA 4DV1J 1JNRB 5ETVA 3Q8RB 1Y4ZB 4EBDA 2GJ2A 1YJUA 2PGCA 2CFXA 1TV6B 2W9CA 3QWUA 1T11A 2LXFA 2DITA 3BGRA 1IKVA 1Q81T 2CQ4A 2HVZA 4OX7A 4GRSA 2CZ4A 2AJ1A 4HACA 3UVJA 3W5ZA 1IKWA 4MIBA 1YQHA 3WZ0A 2BUNA 3W9IA 4DCOB 2APOA 4WYWA 4N77A 4DX8H 2N7YA 4NEZA 4IR1A 4MK7A 2CPXA 1BY9A 4NYOA 2VH7A 4TN2A 1BUXA 2UUWA 2FJAB 4X66F 4CNZA 3ZTQA 2QSFA 2J9CA 4RU2A 1Q1KA 4DV5F 3HPOA 1Q53A 3GILA 5C7PA 4EUVA 4DR3F 3AXMA 1XIQA 2R8HA 2VFSA 4YB6A 5MAOA 3VVUA 4X65F 1F60B 3V6JA 3T19A 1UFLA 1RISA 2DNKA 2BYCA 1TK8A 1FJGF 3UNYA 3K58A 1WI6A 4LR8A 3AQPA 5L1LA 2FZCB 2ADCA 1XMOF 1VDHA 1NK9A 2JDJA 2DNZA 2HBYB 2XO7A 1IBKF 1VQLS 3R6GB 4BDPA 2DO4A 4AD6A 3TUZC 5IWAJ 3M2UA 2H65B 3MEGA 4DPXA 3NAIA 3MM8A 3PTWA 1KWMA 4DR5F 3L4BC 2W2OP 1EHWA 4OYXA 4RLEA 1NDKA 4FPRA 2MKJA 3HFKA 5C25B 2WVDA 4JI6F 1XMQJ 3D1QA 2UUBF 2X1FA 1TKXA 4Y2AA 2VBZA 2KI2A 3UQSA 2HFOA 4ZVFA 2FUG9 4O4RA 2MZTA 2F8MA 2WTFA 4M5IA 3HHLB 1MLAA 3OQ2A 2PFDA 1TMJA 3UN2A 3AJDA 2YNGA 2U1AA 1CS4A 3R6LB 1M90T 4KGXB 1P1TA 1BWEA 3RRGA 4H4KC 3Q89A 2IPOB 1FDNA 1BE4A 4CLLA 4J5OA 1TL7A 1YJRA 3A12A 4M8LA 2VPXB 3V4MA 2Z30B 2WVFA 4J90A 4A47A 2K7KA 3NNAA 1U7LA 3E3XA 5HJYA 1GXUA 4OI1A 1VLOA 2HLTA 4DDFA 4PEOA 6FD1A 4E0DA 1U1LA 3DOMA 1D3WA 4I67A 3WBZA 2Q43A 4DZ6A 3JS9A 4NLVA 5B0FA 1UWBA 2AX1A 2CQIA 4C6AA 2HS4A 4RNFA 3I0SA 1APSA 1H2UX 1SV5B 3G4SS 1LQ9A 1ZOTA 3Q8YA 3OSPA 4LR7A 5A6PA 5HP1A 2C28A 4OHYA 3I82A 1FTRA 1K44A 3FRZA 3W62A 1X4CA 1GX5A 5F8HA 3TEHB 4OZ0A 2F65A 3A1YG 4O23A 2XMVA 2X3GA 2RS8A 4CTAB 1B0TA 1SIZA 5LL6d 4ILMA 3ZNUA 1RHJB 2AIRB 4DR3J 5KFGA 3CJKB 4AUKA 2RU9A 2WVBA 4YB5A 2CJAA 3PJWA 3ZZPA 4DR1J 1RWVB 3C6TB 4DS4A 2HQCA 1RK8A 1DAXA 4NZ6A 5L38A 2HBRB 4C0BA 4NZ0A 5DZ7A 1XMOJ 3HMJG 2QA2A 5IS2A 2KYXA 3KK2B 1WELA 3A3OB 2BBEA 4X4OA 2RAQA 1N0UA 2W8LA 2R2UA 1R0CB 1TQLA 1JLAB 3TO8A 2DT9A 2V1SA 3G87A 2HGNA 3KDOA 5AT1B 2VG5B 3O1LA 3FMWA 4FP9A 4LRDA 4K0KJ 5HN0A 5C24B 2VQEF 3MPVA 5DDQC 2ACYA 5KT2A 2RKIA 4P10A 4CM2A 1R8HA 3KJFB 2ZUAA 1J5EF 5D78A 3BO3A 2UUBJ 3GIMA 3S1TA 4MKBA 1PSDA 1S6QA 1LFPA 3DGVA 4Q7AA 3OTDA 3CD5A 2QLJB 3IM8A 2P2CB 2CPHA 2OEKA 3FQKA 1T95A 4DUZF 2FJXA 2P9CA 5F3ZA 2C3MA 3MR3A 3HZGA 3L7OA 2PMHA 1WG5A 3KNAA 3K0JA 4P2MA 3D2WA 3M2VA 4B3MF 5FLXY 3PZPA 4KH1B 3RW7A 1FRIA 2XO6A 1N33J 4OYIA 1PYOB 4OIXA 5FDLB 3LTOA 2OPRA 2BJ8A 1Y10A 3GG0A 2IMOA 3PFEA 3RYLA 2FJDB 5IFMA 2CQ2A 2ADBA 1R31A 2HVEA 3BKUA 4LJMA 3R7SB 3HT3A 2M52A 1RBAA 1HHTP 3BSOA 2CQ1A 3QT6A 3D54A 5L1JA 1N52B 1W26A 2ZHAA 2WHOA 2JL9A 3TRGA 5DG9A 1JJ4A 1JLFA 3AJ2A 2VONA 2DCLA 4WZQA 2FB0A 1M5OC 3FNNA 3DU6A 3G82B 4R5PB 4EGLA 2W4DA 3TEGA 1QVGR 2R7UA 5KFNA 4NLSA 4MYUA 3NP5A 4LVNP 4OFZA 2L9WA 3H5YA 4DPWA 3C16B 1OQ3A 1UPPA 2FVSA 3MR6A 4Z2XA 4K8RA 4W92B 2GO8A 3VV2B 5F8MA 5F3TA 3TZZA 1B4SA 2K3KA 4O4GA 1RT3A 3KLHB 1TUVA 1F3FA 4OYOA 2OTJS 1JLQB 1H3DA 1FRXA 3LA0A 4NPOA 1HBOB 1R43A 4I56A 1O5JA 5A8KB 5AJ3F 2G4BA 5KG0A 2Q79A 5AXMA 4CRJA 3SV3A 1JLBB 4J9PA 5F8GA 3AB4B 3KK1A 3VGTA 1YI2S 5J1PA 3DOKB 1EETB 1FKPA 4LRBA 1AXQA 4DR2F 3DXBA 4RL1A 3T1HF 1U0SA 3EGWB 3NKYA 4J9QA 1FERA 1HIYA 2ZH2A 3BO2A 4JV5J 2HNZB 2GVDB 4M5NA 1WHYA 4ZVHA 1RBOB 2LEBA 4N76A 1C2PA 3CWJA 2MGZA 3OR1B 3CDEA 1FHTA 3K59A 1N5TA 1ZAXA 2BKNA 3T1AA 1FDBA 1Q8LA 4HEA9 1RKJA 3N01A 3MPDA 2R2TA 4KE5A 1N88A 4F4ZA 3CGIA 3BJYA 3K8VA 1RWNB 3GLJA 3KLVA 1XNQF 1NNDA 4WTYA 1WEZA 2H4YB 3M2RB 2XMUA 4DV3J 1N5YA 4O3PA 4DX5A 2XI3A 3BYRA 3FJ2A 4OI6A 5CYJA 2BX6A 3QIDA 5EX0A 4NLTA 4UY85 1SUQA 5IC6B 1NKCA 2B8QA 2D9OA 1RP5A 2ZE2B 3BSAA 2M88A 4JI4F 5IT9Y 1YJVA 5LMUF 4TY8B 3TOQA 2C2KB 4IG3B 3HXMA 3VAKA 1T9WA 3OTOJ 4J9VA 1CJVA 2IM0A 2PIIA 2WBRA 4DL6A 1T9XA 3MMCA 5THWA 5KFSA 4C2MA 3MPUB 3JTOA 3M6VA 3L7UA 5B0EA 3GMGA 1NSPA 2GJIA 4USHA 5G0RA 2V2VA 2ZJRQ 2RRBA 2HFUA 4H4OA 2FHJA 3NWRA 2CNLB 2CG8A 4I2PB 3OHBA 4PQAA 1EQ0A 2MYFA 4P2SA 2VKRA 2NPFA 1N0VC 3BM7A 1REVA 3CO9A 1V3ZA 1QSSA 1XNRF 2CWXA 3K5NA 4M5JA 2MZJA 3QNWB 2K06A 1TKDA 2FPHX 3DHWC 2OMOA 1DY3A 1TUWA 3M30B 3CE8A 5BR8F 2YY3A 1S72S 1Q16B 1NMEB 3NGRA 3CDWA 4ID5A 5HVGA 1HBMA 3ENAA 4DV4F 4UOHA 4AE5A 1VQ4S 1NPKA 2Y9HA 4DG1A 5EWFA 4ED4A 2YPYA 1HMVA 1LW0B 3NNHA 2XGPA 1XC9A 4RKUC 1H38A 3PCOB 2NYHA 2BJ1A 3CIMA 1S97A 2V8PA 1FKOA 2QRRA 4ITSA 4ZVSB 4RW6A 2I5JB 4JB8B 1FF2A 3I56S 1SJFA 3R27A 2KM8C 2KT2A 1QM9A 4I4BA 1VS3A 1FXDA 3QGIA 2OPQB 3CT9A 2RNEA 3SCIE 5G4DA 3MEEB 1S5ZA 2KTQA 1X4BA 1XNQJ 3LPYA 5KFTA 2KXFA 2Q6BA 4NLOA 3C14B 4YFUA 1U1MA 4O3NA 4C0HA 2RRAA 2FJEB 2EXUA 4NLQA 4Y2IA 1LWFA 1NPRA 1VC6A 1GNKA 2Y8WA 4EBEA 2CYYA 4RW8B 1IQTA 2OD6A 2XHWA 3RBZA 1S77D 2XTJP 5IM0A 4ED3A 1DTQA 1NAQA 2ZHOA 1WHVA 3CF5Q 3UCUP 2VC0A 2RUSA 1KQGB 3FGVA 3D68A 3NMRA 1G1XA 3SZ2A 3DLGA 4X4QA 4AYBD 1RAEB 3A3NB 2DNHA 1VQKS 1NK6A 3M8QB 4Y2MA 2IRXA 3HP6A 2YNIB 2VB6A 3QO9A 3VAIA 2YWKA 2CJBA 3VZHA 1N6QB 2EG1A 3PX6A 1JWWA 1RUSA 4WP3A 3TP2A 4ZMMA 2AJ4A 2J5AA 2FC8A 1KSPA 3HO1A 1H72C 3KUEA 2GIFA 1VQ7S 4ZDNA 3BR9A 4QPTA 4QWEA 4PG7A 2DHAA 1R0BG 1HWLA 1KHWA 3SV4A 5ETKA 1X4HA 3MM7A 1JB0C 2VOOA 4UOCA 2VFTA 4ZVGA 4QIWD 4C48A 2I2YA 4ZCIA 4ED5A 2XEXA 5HANA 1F9EB 3PVXA 1HWUA 1UEUA 2ZDOA 2W9BA 1EB0A 4WE1A 4WFBQ 3CTRA 4C8MA 2EFNA 5KAKA 1MMNA 3FBCA 2DNLA 4K7QA 2HNYB 4KGMA 4C3LA 2LXUA 3BSNA 1R3NA 4ECVA 2WK4A 2BV3A 3B82A 4UUXA 3UE2A 1NJYA 3WX4A 1EKSA 5K14B 1S6PB 3D6MB 4RBVA 3MAAB 4LRCA 2I8EA 2FZKB 3BZQA 4QIFA 3KLFA 5EUHA 3SQOP 4B17A 1UVKA 3QIPB 1YRTA 3DCAA 4O3SA 3VAHA 1WTFA 4I2QA 4OZ3A 1U47A 2AYEA 2IAJB 2ZKUA 2KFNA 1SBRA 4NZ7A 3DLKB 4YDDB 1Q8IA 2OSRA 4Z7YA 2CNOB 1IXKA 3I5AA 1WORA 4UZCA 2HSEB 3OLAA 2DR6A 2FLOA 3T6JA 2JC1A 4XDDA 4CYUA 1WWHA 4ED7A 4I6YA 2D3UA 3ET6A 2YQ3A 4NYZA 2L3MA 2RQ4A 4F8RA 4DR6F 4P75A 5IXUA 1I6JA 2BJ9A 2I9SA 3SEOA 1X4EA 1RT7B 2YXLA 1BD6A 1Y5IB 2YNHA 4EZ6A 3NS7B 4OMFG 3M32B 3FBBA 3IC1A 2FJBB 4DN9A 3EZOA 4QCLA 1BQNA 3N5FA 3AD7C 4CWBA 3PNIA 2XGQA 5A2QU 4ZITA 1N36F 1AUDA 3J7YU 4QWBA 4M63A 1R8AA 2W9CB 2ZWPA 4KGKA 7FDRA 4KO0A 1B7FA 4AQYF 1K0VA 3O5TB 4OHVA 3BGRB 3IFEA 1UTAA 1I1GA 3GR0A 1RAJA 1SKWA 2HHTA 4ELTA 4ZN1A 1IKVB 4FYDA 3P3DA 4DV0J 3EWGA 3M8RA 4C98A 1S10A 2V50A 2AYBA 2RH3A 2QN6B 2JX2A 2IM2A 4HACB 4ANDA 3AB2B 1QAIA 3UVJB 1C1BA 3PKMA 1F3VA 1V6HA 3DDKA 1IKWB 1TL3A 3PM9A 3H98A 3PR5B 2V69A 1FCAA 4DUTA 4HHUA 5HL7Q 4OYMA 3QAUA 1ZA1B 2CQCA 1UEKA 4P2FA 2GFFA 2R8KA 3NXZA 4J7CA 1PIEA 2H9ZA 3OJUA 2FJWA 3OTBA 4W98A 1YDLA 2OEJA 1QD1A 1HNZJ 4U95A 1RAAB 1N4LA 2BMBA 3KMQA 2LDYA 4UTGA 2ZH9A 4NCBA 1WOSA 2OD4A 3AT1B 4G1PA 4P71A 1X5TA 1YVFA 2BEFA 1V9OA 5C2CA 1IBLF 1FK9A 1P1LA 4OHWA 2CPZA 3I9ZA 2VDHA 2MQNA 2WONA 4XTTA 4I7FA 5KFAA 3PJ9A 2ZC3A 3D0HE 1I5OB 3UNGC 3H2LA 3KHRA 3G71S 4EI2A 4KIAA 2BJDA 2JLGA 1RTIA 1NSQA 4RW7A 3M2UB 2HHHF 2R7VA 1PAEX 1YBTA 3MM8B 2ZH5A 1T8EA 1UKUA 4CO2A 1VC0A 4ZPTR 4ECZA 1TFYA 1FFWB 4MAKA 4Y6IA 1RKIA 4WXOA 7AT1B 5DG8A 2XMMA 3CSKA 1G6BA 4IFYA 1TKXB 5K9FA 3CIZA 3SSRA 1RADB 4LVOP 5KG3A 1RAHB 4TKTA 4DQQA 2XNQA 1HR0J 2I6WA 3QRQA 2P6TA 2YNGB 1CS4B 4YUDA 1UFWA 1S59A 2R2RA 2DNNA 3BB5A 1JLEA 1ZM2A 4DPUA 1TL7B 4RZRA 4AXIA 3CCLS 1R6YA 2ZH7A 1HNXJ 1TKZA 2H54B 2CVIA 2AU0A 3M05A 5AXNA 5D8HB 3KHGA 5MLCV 1F9HA 5AE2A 2HHVA 3PX4A 1NH8A 4ED6A 3DOMB 5A8RA 1X9SA 4ECTA 1CULA 3QMQA 3OBIA 3KUGA 5E3AA 1UWBB 1EP4A 4DL7A 4GKJJ 3I0SB 5SZTA 3POTA 3IRWP 1K47A 2CJYB 2R3VA 3FFIA 4TU8A 1OY8A 5HP1B 1YZ7A 1U6ZA 1WSRA 2FHMA 3KKFA 1ZAVA 4ZHRA 4KPYA 2B43A 2FY1A 2KFZA 4K50A 2NXJA 2V4QA 2UP1A 4DL4A 2ZDPA 4PPDA 2BE7D 3MCNA 5CYMA 2Y1LB 4IH6A 3OVAA 2CPYA 2MB0B 4NE9C 3R2CJ 1V5IB 4C97A 1M5VC 3OFEA 4OX8A 2KRRA 3EGZA 1EARA 1VQ9S 2DYAA 1MW7A 4TQRA 2DNOA 2F8HA 4X4TA 2MQOA 3D6FB 1IKYA 2UVWA 4XDCA 3AX3A 3QGGA 2QSWA 3W63A 2AGQA 4A8MP 1YJ9S 2K3IA 3H59A 4A8YA 1D9DA 3U1MA 1TU0B 1RWXB 2E1AA 3EGNA 1N34F 2HHQA 4HT7A 1HNWF 1QSYA 2W4CA 3M1VA 4HDGA 5E2QA 4O44A 4MKVA 1D8YA 1N56A 4ZN3A 1MU2B 2G2ZA 2M9KA 3B4DA 4C4WA 2YKAA 3T9ZA 5A6WA 4DL2A 3LOUA 5I3PA 4OZ5A 2AX0A 2ZJQQ 5KFXA 4OYPA 4M95A 1FJ7A 4KPCA 2UXBF 3DNCA 3DLLQ 5FJ4A 4DV6J 4LF5F 2HZAA 1S1WA 1H73A 1FRMA 2W9AA 3IGNA 2NR0A 4NCGA 3CC4S 1OYDA 3NS5A 1TTHB 1T3NA 2IJRA 1S6QB 4J9KA 1I51B 4WFZA 5F8IA 2ILZA 1RYSA 3WC2A 4AL6A 3P49B 3GE9A 1S9GA 2ZH4A 3MM5A 4ZJOA 5BJRA 2X1GA 1F9FA 4ZA1A 2B0GA 4DFJA 3AA9A 1KLNA 1DHMA 3R5JB 1GH8A 2A10A 3M2VB 3VAFA 3HVAA 2IC3A 3W8PA 5D6GA 1S6OA 5DDRC 4JV0A 2DHXA 4FDFA 2C2RA 2PD1A 1KQKA 4BC9A 5K20B 2MKIA 4USIA 1LWCA 3GYXB 2CZVC 2HQGA 5K5MA 2V94A 3QZ7A 1Q0NA 1Y3KA 1LWEA 2Z58B 3K57A 3Q83A 5DQIA 4KHPJ 3ENVA 1X4DA 4PABA 1RTZA 1U1OA 1M5PC 2YWWA 3FDSA 2CDRB 1JLFB 4X4UA 2GGPA 1VJQA 1SB6A 4JI5F 4QJVA 4NXMJ 3DFEA 4USMA 1JXVA 4DX6A 3MTJA 1RTDA 1VIXA 5CQGA 4IH5A 4V1Ak 4GMKA 3UDVA 3JSBA 1XBWA 4JBCA 3GQCA 2CNKB 3EICA 4O4GB 1RT3B 2Q66A 3HSGA 3M6UA 1JJ2R 3W9HA 2ZH6A 4WKRA 2GHPA 3EMTA 3BREA 2EPIA 4YHHJ 3MFHA 3ITHA 3RGIA 4URQU 1LWXA 3MPWA 2D74B 4ZP9A 4NYPA 2SXLA 1XWLA 3KK1B 3J7AN 1HQEA 3BBFA 1N5VA 3H0PA 1FKPB 5KFCA 1IWGA 2FDNA 4JI8J 1BWVA 1HA1A 5E33A 3Q8VA 3JAMU 2JVRA 1U09A 3O3LA 3I0RA 2RRNA 3VR1A 1P9YA 4B9TA 4DF4A 3DDIA 1B0VA 2VL1A 4RNHA 2ZBIA 1NK4A 3TR5A 2P9GA 3QJJA 2MGZB 2RDJA 3HVRA 1PC5A 2NUHA 1R0AA 4DV7F 3R2DJ 4JP8A 2MZSA 1C0TA 1AYEA 2DO0A 3MM6A 1SC1B 1B70B 4FPIA 4OZNA 3TWZA 1NHVA 3TJAA 4F26A 4O3OA 3KJQB 1EX8A 4U7UD 3DM2B 5FD1A 2U2FA 3DRSA 2E1RA 1TK0A 1HBUA 1H7WA 2WBMA 1N5YB 4LR9A 4WFAQ 3Q24A 2M7SA 1NDPA 1SUQB 2F4VF 1WTBA 2DIVA 2KT3A 3OJSA 2K7JA 3C19A 1S0NA 2LP4A 3KDNA 1K9MT 3D1OA 1NB7A 2DXDA 4OJHA 2RSQA 1CJVB 3EVMA 4N8NA 1RAGB 3MMCB 4F2RA 3ADAC 3TZYA 4R8UA 4DPTA 3P6YC 3ZNJ1 1H74A 1H0HB 2ZNYA 2B8PA 5G0RB 1YRXA 3CMAS 4TLRA 4H4OB 1R8CA 5HO4A 2DNYA 5I4MA 4JI5J 2GMJA 1S12A 4URSA 2MEWA 3LH2S 3PFOA 3PW7A 2VFUA 1KTQA 2HFNA 5DETA 4OZJA 1U2FA 3Q2TC 1ZM4A 1UP1A 4ED2A 4LFBJ 2R8IA 2C2EA 2DGOA 1FD8A 1REVB 5C42A 1U48A 1B0PA 2RU3A 3GJSB 3KLEA 2XSJB 1YJNS 4ZCMA 2QA1A 2AJFE 4V19X 3MAQA 3N6LA 4KV8A 5IQ6A 4Y3CA 4KH0B 1IBMF 2GA7A 4DCJB 1R8BA 3CJRA 3FZ2A 1FFGB 3DRXA 3PYEA 4MYTA 4CO5A 3QATA 3D0IE 4M5DA 3EXYA 1WJ9A 4BC7A 2YNFA 1WC5A 2YWFA 2GNKA 3H5XA 5KFEA 4ID5B 1CJUA 2RHQB 1HBMB 4R0EA 3E01A 3HHNB 2JLEA 3IO1A 2VIHA 3WQPA 2D3OR 2OPSA 4DG1B 4B9SA 4PQUA 2BRLA 2B7CB 1T03A 2BQ3A 2E1CA 4BLGA 3JYTA 3U1LA 3CW2C 1YJWS 1AZSA 2IYGA 2X51A 2MKSA 5KOWA 1FKOB 3L3CA 5HROA 3M9MB 3H40A 4RW6B 1HI8A 1FDAA 2LQBA 4ZPVR 2WZ1A 4K59A 4P9SA 2HQDA 1AFIA 2WSEC 4XAKA 2A18A 1T02A 2VG7B 1S4FA 2MY7A 4U9RA 1KVJA 1QAXA 2E5LJ 4LF8J 1VQSA 2Q3PA 3X1LB 4ZJLA 2UXCF 4KHRA 5DJBA 3KYLA 4RR5A 1X60A 2F4VJ 5I42A 2J8AA 2XMJA 1NK5A 1YJ7A 2CDQA 4F4KA 1LWFB 4USKA 1RWPB 1FA0A 2O3DA 2QYGA 1PBAA 4RX6A 3MOJB 1QTNB 2IM3A 2HVDA 3S6EA 5IM0B 1HD1A 1RWMB 4P72A 1DTQB 3K5PA 4L6V3 1Z2LA 3LP1A 2W7OA 4CNYA 4QWDA 4OYBA 4FS2A 4JI1F 2HWTA 3BH6B 3CB4A 1L3KA 3DLGB 4PR6A 3E2EA 3U27A 2KG0A 2AQ4A 1YG0A 3PHEA 2IBKA 4ZP8A 2G2YA 3EGVA 4ES2A 3K2YA 3EUNA 1YHQS 1SL0A 1I94J 3MDFA 4GKKJ 5EN1A 3HHLC 2E5GA 4H4MA 4LRAA 3PR4A 2J0XA 1CBKA 3KTQA 2G2OA 4ILRA 1SJ3P 2UU9J 3K17A 1VQOS 1L3SA 2LVWA 5LSOA 4OYWA 3BDPA 4B3SJ 2B4UA 4LT6A 1OIAA 2PA8D 5KFHA 4C9DA 2E9TA 5EGYA 3MM7B 2YKQA 1K8AT 1SKRA 3BBBA 4C8OA 1D9FA 1AA1B 2KT5A 9RUBA 1CC7A 3IA0A 4TU7A 3D7SB 4DV2J 2DR5A 3R3TA 3PW5A 4NXNF 3Q2SC 1B7YB 2W9BB 4WE1B 2QIFA 2MQLA 5KFYA 1HWIA 2V34A 3UDLA 3V6HA 1WDDA 4TVAB 2J76E 3TVKA 4F0KA 3UW1A 1VI7A 2P5VA 3DGPA 2OP5A 2COLA 2IFXA 3Q86A 5DGBA 3JAMY 2ILYA 2X7IA 3GWCA 2RT3A 4QR0A 3KLFB 3HHLD 4BCAA 2PC6A 2DPIA 1A7GE 5E5NA 4I2QB 2IM1A 1ZS6A 2XQCA 2FLLA 1B64A 2BVZA 4NEYA 4IQXA 4ZOSA 3GG1A 1RE1B 2HBZB 2JEIA 3OXFA 1ZETA 2AEJA 1SIWB 5ETMA 1BLUA 4LF4F 4K4WA 3FSIA 3M8PA 3J7Z5 5E7OB 2IBOA 3EZ5A 1NB2A 4CYUB 2JFKA 1SL1A 1UVMA 3ET6B 4XPEA 2CQ3A 4WIIA 4Y0FA 1ZTWA 2V6AA 2UV8A 2N4CA 2D69A 2XWXA 3B54A 2PO4A 2RHSB 1HQUA 2YNHB 3NCRA 1NJXA 4FYYB 4CLKA 2VUGA 2R7RA 2Y1RI 1BQNB 3KLIA 1ZBTA 3DKDA 4IO9Q 1Y5LB 1ACMB 4HL9A 3I9V9 2OMLA 1KQFB 3I55S 1REGX 1OYEA 1PYSB 1PJ5A 1S0OA 1SC4B 4M1KA 3HHKA 2NXUA 3NRBA 2HKEA 4IRCA 5J1NA 4KO0B 2GCFA 3DRRB 3HZEA 4OX9J 3H5SA 2B9XA 3KJNB 1BGXT 1HNVA 1TELA 3T5JA 3HSJA 1SQEA 2JEFA 3VF0B 3MEDB 1IJFB 3HX9A 1J5OA 2XZTB 5GAHU 4JI3J 5LXRA 2IDEA 1SC3B 4KBIA 3IS9A 3BN4A 4NOHA 3M9NB 4NXNJ 4WP9A 4ENOA 4F4AA 4ETZA 2G0JA 3EPGA 3W66A 1TL3B 3CJ5A 4DHVA 1H2TZ 2UXDJ 3AH6A 3BGUA 1JKHA 1KBRA 3NOCA 3ILIA 5H1SV 3OVSA 5DS7A 2J0WA 2W7AA 2V2ZA 4L75A 3KK3A 4A8OA 3EM1A 5KG4A 4EZ9A 1MWZA 1GMVA 1X7VA 3S7RA 4UW2A 3SDEA 1X4GA 1TFWA 3RBDA 3BN7A 3HT0A 3ISNC 1OQ6A 1MSWD 3N6MA 2MHEA 1X31C 1U6BA 3MFIA 4FF2A 1VYAA 1O51A 2VHGA 3MR5A 1FK9B 2MHNA 2F5GA 5GAEI 5B08A 4CM0A 4IOAQ 2V8GA 1DQ9A 2FLPA 1LK5A 5ETPA 4J37A 4I64A 2BXJA 5D4OA 5T7LA 2MSSA 3OR2A 1RLCL 3W2WA 3K89A 2WONB 3Q0AA 2AYMA 2N3LA 1OPZA 4KAIA 3BSCA 5LMNF 1TL5A 2IJFA 1RACB 3BF4A 1VK8A 2QFJA 1S1VB 3MWBA 4ZCKA 3TAMA 3HKWA 3QGHA 2VU5A 2AWZA 1CEZA 3QJPA 2ZH1A 1WG4A 1RTIB 3CVKA 4RW7B 2MLXA 2PI5A 4RW9A 2HBQB 3F56A 4J9MA 1ZYQA 5KFIA 1G2EA 2DPJA 3WDOA 2UUCF 2AYGA 3VGVA 3CJQA 3D3BJ 4F3OA 4E8UA 3T3FA 2XLIA 4M5HA 2FJVA 1KOHA 2Z4PA 1CQMA 4HLBA 4ED1A 4NLXA 4LSLA 8RUCA 2E66A 1VGYA 3JB9k 2K1RA 3ISND 3J80Y 2CVEA 1VHIA 3U7JA 4ATNA 2GZOA 4CCHA 4LBHA 2RIJA 4ZIWA 4DUYJ 1JLEB 1T05A 4ELVA 1O8BA 5L1KA 3DXSX 5KFWA 4IG0A 2R7XA 1TV6A 3OV7A 3EYZA 3RB3A 3ZTRA 3DLEA 4B3RJ 1TKZB 2M3DA 1UPMB 3QGPA 4FVMA 4KYZA 5A8RB 1CULB 4I68A 1EP4B 4EK2A 3D9BA 3POTB 2B56A 3FFIB 4J9OA 4B9VA 3PYFA 3UFCX 2VQFF 2ASDA 4P6QA 4ZHRB 1P8GA 4X62J 4PZVA 4X84A 4KGVB 4RBUA 3IBFB 4B9UA 2AEFA 4USTA 2PFFB 5CYMB 3UO0A 4B3TJ 3BGLA 2MKHA 1L3VA 4OV6A 4OI4A 5HAOA 4WPAA 1EKRA 2ZM6J 4C3MA 4B3OA 1I3OB 3QJLA 3DN9A 3G2XA 4EO6A 2X1AA 4LFAJ 1T9VA 1T7PA 3IWNC 1IKYB 3R9LA 5DLFA 2EW9A 5ITHA 2WVEA 5KTQA 4CLZA 5EWEA 1PC4A 3S01A 4X4VA 3IG1A 3M8SA 3EJMA 3CDAA 3H25A 2EK1A 4EEYA 3HHDA 4KSEB 1UVNA 3MMAB 1CLFA 2AZ3A 2DH8A 1VQNS 5HK4A 3AFGA 2ZD1A 3I5CA 3DRPA 3M1VB 1TKTA 4O44B 4JUZA 3OPKA 5E0OA 4JI7J 4CH7A 4C7QA 3R5CA 1B99A 3C46A 2LKZA 4PPZA 1LKZA 1RT5A 2WCXA 2Z8QA 2G1HA 1S1WB 5DO2A 5J1EA 2DGXA 2PMWA 4LF7J 2WSCC 4NCGB 1RTJB 5H9FK 3HVWA 2ROGA 1RB0A 6FDRA 1M5KC 1NM2A 1Q7YT 4X64J 1PBUA 1OSDA 1DARA 2E5HA 3SIPB 1QDUB 1S9GB 3LWMA 3MM5B 2ZH8A 4YP3A 4JI0F 5HQMA 4JV2A 3FKBA 2E1MC 2AGPA 3R7NB 2QLXA 5GADU 3N4WA 1ZPWX 4Y28C 4TY9A 4DBQA 2J9DA 2QMWA 3P5TL 2QX0A 5D0HA 2FD2A 2IC3B 3SBMA 2IJNA 5EWGA 2IVFB 1YTYA 1Q4RA 2HS3A 4PWUA 1NK8A 4DLGA 3VQSA 4OZ2A 1UJ4A 1LW2A 1LWCB 2XHCA 3LGMA 2IRYA 2UZAA 1LWEB 4QYZK 1Z1ZA 1VRTA 2VQFJ 3CCVS 1NDLA 1FTCA 4M94A 1OM2A 2NPIA 4ERDA 1C1CA 3DYAA 4RU9A 1U2CA 2HRTA 1XJWB 2GGPB 4WU3A 3TJ8A 4TU9A 4X4PA 3CCTA 1S4EA 3FCVA 4IOBA 2GO9A 1KQSR 1YLXA 3V2UC 4NLYA 1RTDB 5RUBA 5I3UA 4DF8A 3L7PA 1RWKB 3ONQA 4LF6J 4LF1A 2ROEA 2C2OB 4A48A 2MY8A 1JLGA 5HMWA 2CG4A 4AXJA 4ZLNA 4HDHA 1YGYA 2DNGA 3ITHB 2ZVSA 3QT7A 3DDNA 5BYSA 4B9NA 4O0NA 5F9LA 2V8DA 1GT8A 2YH0A 3SSSA 4QIEA 3V4IA 3EE3A 3AX5A 3GIKA 3DI6A 1RU1A 5LSRA 4I1TA 5CD4A 3KK2A 4F02A 4NA2A 1JLAA 5ETOA 3BGFA 3I0RB 1RAOA 3IR5B 3SQGA 5H9FJ 2M2BA 1WKJA 1JXLA 4MKAA 3Q8QB 3JSRA 3V6DA 4CQ1A 2ROPA 4P52A 3IXQA 3OL8A 1NH7A 1KVIA 4N5SA 3SCKE 3UI3A 4RUHA 1R0AB 1KOOA 4P7TA 2HAFA 1C0TB 4X66J 1U45A 3D66A 1WF2A 3MM6B 5GMKa 5J2MA 4DV5J 1YZ6A 3PW0A 4PYDA 4WK3A 3DRSB 3J7A1 2A2CA 4O3RA 1HBUB 2KJWA 4X65J 3E8OA 2WOMA 2BM1A 1YBUA 5DDPC 1FJGJ 2GV1A 4DXLA 4E2FB 3QLHB 4UY8T 3QT8A 4QYZJ 4LF9F 5ETQA 3H2UB 3R97A 2RS2A 2DTJA 1JJCB 2JH3A 5L1IA 3GV5B 1W25A 1FNMA 2O01C 5DDOC 1U0HA 4ED8A 4RNMA 1KP6A 1FVQA 1U24A 1SKSA 1IBKJ 3SFGA 3D3CJ 4ICLA 3NGTA 3ZFVA 2ASYA 1FFSB 5KFPA 3I5BA 2GMLA 1IKXA 1IN0A 1X5SA 2FLNA 3HULA 4WK1A 2PT0A 3OD2A 2JEJA 2GHVC 3ENWA 1X8DA 1NSKL 4JOUA 1VBKA 2IYIA 3RAQA 4DR5J 2XY6A 4GC7A 1RT6A 4ED0A 4KTQA 4PWDA 3RBXA 4RUAA 3AJ1A 3GTYX 2KHDA 5EX3A 3MCSA 2BRKA 4JI6J 3OVBA 1NCLA 3G82A 1NUEA 1S9FA 5D0GA 5C42B 4Z7CA 1DTTB 2GC8A 3KLEB 1M1KT 2CJKA 5BYRA 3K5LA 1JMTA 1YRUA 4CH0S 5B0DA 5JVHQ 1LK7A 3CC7S 2KL8A 4KV8B 2W2QP 3KLHA 1KVKA 2YTCA 2VG6A 3CULA 5J2PA 4M5DB 3JQKA 2W4PA 5HVHA 3LAKA 2YNFB 2W7PA 3NY0A 2OGUA 3OL6A 3PHTA 4J91A 2MJUA 3RTVA 2RMLA 1CJUB 1ZM9A 1GMWA 1Y9OA 3E01B 3FBEA 2A6MA 1U49A 1FWPA 2IY5B 1WNEA 1UZHA 2OPSB 2B4OA 4LRFA 2V2KA 4BBYA 1U1RA 2HS0A 3DOKA 1DZ5A 2WSFC 1T94A 4WKYA 1RHRB 1T03B 2RF2A 2VFRA 4WTOB 4PWWA 3WHIA 3M7VA 1WC4A 1AZSB 4IR9A 4PRFA 4LQ3A 3QT5A 2DGTA 3CCUS 5HATA 4IDKA 2AJ0A 1XTZA 2AJ2A 3T5HA 4ZPAA 3ICLA 5CHCB 3PY8A 3OR1A 2WW8A 3HFVA 5M2PA 1R6VA 3J81j 1OJ4A 2DGUA 3SFUA 1NKBA 2J8SA 3HCXA 4JI2F 1GX6A 4X4NA 4B02A 1XR6A 4KKOA 1QE1A 3N9UC 1M0SA 3B78A 4WXWA 1Q95G 5I42B 4WU2A 1S1XB 5CCMA 4ZVEA 4HTIA 2ZC4A 2DRAA 2ZUGA 3KMSA 1RSCA 3CJ4A 3JQJA 4NX9A 1MWYA 4Q2LA 4ECQA 3ISZA 1HNIA 4ZP7A 3R1HA 3IGVA 1LFWA 3LP1B 1KFDA 2EEYA 2XMTA 2PI4A 4CLTA 3S8SA 4NA1A 2QZ8A 4F4WA 1RDRA 4MIAA 4QPXA 1GTHA 2LEAA 2VQEJ 3MMBA 5SUHA 3KG0A 4X4SA 2LU2A 1WEYA 1R7IA 3F41A 4USUA 1RHMB 4DR4F 1FX4A 1J5EJ 3BQ1A 3CJ0A 3IP0A 1WF0A 3ZZYA 2VV5A 4I2PA 1YITS 4URGA 2HIQA 3AY0A 3TQEA 5LXYA 4F4YA 3C6UA 1H7XA 3TAQA 2HW3A 5F9NA 3HHEA 1VOMA 3TI0A 1EIYB 5IQQA 3VZIA 2RD5C 1UZDA 2D41A 4DUZJ 4ZCLA 4PXDA 1JX4A 3AHPA 5BYQA 1ICEB 1SQFA 2F63A 1DLOA 1RU2A 3ZZ0A 2DVIA 3FMBA 1PKUA 5CYQA 4XPCA 2HNDA 4A8KA 3PO4A 1LXNA 4DQRA 1FX2A 4F25A 2EC0A 2VZ9A 1K73T 2FYXA 4C8YA 4B3MJ 3I96A 5LJ5Y 3MF5A 4YY3F 1NZAA 2UUAF 5ETNA 2QFIA 2KVQE 2BJ3A 3FZBA 3N0VA 3ZZZA 1YJTA 1TMMA 1YSJA 2EFPA 3PO5A 2XZ2A 2YQ0A 2G0IA 3DGPB 2D68A 5DLGA 4K2JA 2GMHA 1D9AA 3TZWA 2AV5A 3QAEA 2G9OA 4Z37A 4YN3B 1Q86T 4HKQA 5KFLA 1BC6A 1NEEA 2XCPA 5BXIA 2KN4A 2QEXS 2HRUA 1YK9A 5DRKA 5B09A 2ZKTA 3M9OB 1D09B 1FWKA 2C22A 2B6AA 3AODA 2VPWB 4UQTA 4GVBB 4JI2J 3CPWR 2RE1A 1FXLA 3R5AA 4DSLA 4F3QA 3KHHA 1PYTA 3M8PB 3BO4A 1URNA 2FVCA 2NXCA 3G9CA 5KG1A 2HURA 4OI2A 3Q8PB 5AJ3J 4CZCA 1WOPA 3BS9A 1Y00A 4F4XA 4DS5A 2BZ2A 1KLMA 2AHOB 3JXOA 3V81A 4FF4A 4DR2J 2XULA 3AQOA 3T1HJ 5U47A 2XI2A 3KLIB 1XERA 2NUUG 1S0MA 2EFQA 4L3NA 1QAJA 2J7KA 3TW0A 4W4MA 3NCPA 4B08A 4L76A 5L39A 4K4VA 2NXNA 3AOCA 4KFBA 4DL5A 4NASA 2RQCA 4BWMA 4V19J 2RQKA 3LANA 4C8LA 2H5IB 4CT9A 1QVFR 2YNIA 4Q0BA 1VQ6S 3FEYB 4OJGA 4QW8A 3MCMA 2ZBRA 2UUTA 1UFKA 3H42A 1HNVB 1UW9A 1LNQA 1S57A 2C2MB 3SSQA 3HD1A 1WOOA 2VOPA 1WUUA 3TANA 2ZBPA 4EYHB 3IS9B 2HWIA 1F5AA 2M8DB 1ZZNA 1MN7A 2RDDA 3T1YF 2VPYB 4H4KA 3FSXA 2J0SD 2DD8S 2PEHA 1JKHB 1Y11A 5KG7A 2DNMA 4JI4J 4HI2A 1CG2A 1NU4A 5LMUJ 2Z57B 3KK3B 3I32A 1ULRA 4BWJA 3SDEB 1FWLA 5C5JA 3MI7X 2FGOA 5M2RA 3RZAA 3LO3A 3BYPA 1F0XA 1GK8A 2V68A 4CLSA 4U6PA 2Y8YA 5IT4A 3DOLA 3KLGA 4B9LA 2ACMA 2O66A 2IMWP 4ZVPB 3MD3A 3UR3C 2HGMA 1MN9A 2QL9B 4PUOA 2PE8A 2XTDA 1FDDA 3W5XA 2HAIA 3G6XA 3TUPA 4DMZA 4FYVB 2BE2A 2W1BA 3UCGA 4WIQA 5T7LB 1M5HA 2DISA 4Q2MA 3W2WB 2AZ1A 4QWCA 2CPDA 1IJEB 2V8VA 3TAMB 4D3GA 1VISA 2ZOFA 1XNRJ 3ETMA 2B7BB 4QR2A 1ZZFA 4QIVA 3HFZB 4GVLA 2L9NA 2LQJA 1RI7A 2I0XA 4RW9B 2P9EA 3MHYA 1WC1A 5DM7Q 2Y3YA 2CA9A 1WKLA 1UJ6A 2AEMA 5BR8J 2E44A 2DJWA 2F7VA 3BQ0A 2OLWA 2BACA 5IWAF 4ANCA 4DV4J 2NXEA 2QO3A 1PAUB 2HQ3A 1NJWA 4LSLB 4WCEQ 2J0QD 2CJ9A 4Y2CA 2HFSA 1T3OA 2K1RB 2W8KA 1XMQF 4ZJQA 3AOAA 1JLCA 1N5QA 4RO0A 5FLXU 2N3OA 2XSFA 3PEJA 4LQ9A 1S9EA 4LMZA 4WJBA 4NLGA 1T05B 2B51A 2VA2A 2N82B 2LQ9A 9ATCB 2BKOA 4IG0B 3U1NA 1KS2A 5AE1A 3TA1A 3DLEB 5HQ8A 2OELA 4DOZA 1F5CA 1KC8T 2BE9B 1MNEA 3MEKA 4OX6A 4C0OC 5J2QA 4DSKA 4K4XA 4ZPDA 2E7XA 2JFDA 3W1YC 3GYNA 3RB6A 4DQSA 3T1YJ 3H4DA 1UEVA 2E1PA 1DJ0A 3EDQB 1Q8BA 4EO8A 3N28A 1S7HA 1S48A 1S79A 2KRBA 4K4ZA 1AFJA 1RT1A 2EC2A 5JVGQ 5HMYA 4NRTA 4ZVTB 3PRBA 1Q7LB 2E5IA 4F67A 2E7WA 2QJ3A 5L8RC 1PGZA 2LYVA 2YKPA 3CD6S 2PN6A 2FIUA 2IRUA 3HF5A 3THTA 4MT1A 5FIIA 2CPFA 2O5DA 5D15A 3GFYA 3GJRB 4B3OB 1SI9A 2VF3A 2R42A 2FGCA 2EFVA 2DH9A 2FHOB 3DMJA 3D6TB 2RUGA 3ZTOA 2C3UA 1Q78A 2LCWA 3O6QA 3NGDA 5KFBA 2P6SA 3IG1B 3GIJA 4FXDA 3DRYA 4DR1F 2B4VA 3U02A 2D1CA 2ZD1B 1GEHA 3DRPB 1Y5NB 1TKTB 2R8JA 2DB1A 1N32F 2FHKA 2I1RA 1HW9A 4ES3A 2F9JA 4OYAA 4D3HA 1SJRA 2ZOMA 3T9NA 1SCJB 4CDIA 4FNHA 4K4TA 4OJ3A 2QC3A 1M1GA 1VBXA 1S99A 1RT5B 1UUJA 5K8PA 4ZVUB 4K0KF 3AD8C 3G6YA 2F4FA 2C2NA 2MDAA 3MM9A 5J1EB 3ZZRA 4HT5A 1L3UA 4ZVOB 2EK6A 2HQIA 1KRPA 2Y0SD 5K8OA 2FHJD 3EXCX 4ID8A 2PMZD 5LSLA 3FCHA 4EWTA 1W7WA 4L72B 2XS2A 5IC4B 2D3O1 1SH2A 2DBBA 1RAFB 3VAMA 4Y00A 3UD3P 4ZPCA 4ILLA 1H98A 4A4JA 5M2UA 3FVYA 2J6SA 1UL3A 3FCWA 1KN6A 3MUVP 4F0MA 3C3LA 2MZ1A 5IT9U 4Y65A 1QTMA 5E3CA 1B3TA 2JWNA 2LQ8A 1TVRA 4F0HA 1FE0A 2B3TB 3PACA 1VK3A 1WHXA 5HVFA 4ECXA 2PDAA 1LW2B 1BQXA 3Q8UA 5CH7B 3BKFA 4KQZA 4J9SA 3W60A 2YKMA 1Q8KA 1UMJA 2QLFB 1N33F 1VBYA 1R27B 5AE3A 1VRTB 2NSCA 5CABA 3BV8A 4PG4A 5J2NA 1C1CB 3DYAB 3BH7B 1TK5A 4KT0C 4DR7F 2B5JA 2JLFA 2ZFHA 1HFEL 3MEGB 5GMDA 4DR6J 3CCJS 2QMXA 3MGJA 4YB1P 2KXHA 3MCOA 4TQSA 4S0MA 3G6ES 2C1EB 1OY6A 1Y7PA 5I3UB 2BOAA 3I4HX 1E6YA 4CLWA 2XB2D 3HD2A 4YR0A 1CJKA 1KONA 1JLGB 2ZNZA 3ZTSA 3R8YA 1N36J 4ECSA 4USWA 3FRYA 5KFZA 4WYLA 2OFGX 4NLWA 4DN0A 1WACA 3VALA 4F3MA 4AQYJ 1N32J 3V4IB 4RBTA 4IRDA 1XQIA 3DI6B 3CJ8A 4XIUA 4IUFA 2O1PA 4U7UK 1S7IA 3FBFA 2QGFB 2IDLA 4HYKA 4KRWA 2UV8G 1MU2A 1IUJA 3SQGB 4Q45A 1ELOA 3M4XA 5DQHA 2ASLA 5AXLA 2QLWA 2UVVA 2BJ7A 5A8WA 1WC3A 3G6VA 3V6DB 1NHKL 3H20A 4QZVB 2AGOA 4LUBA 3O44A 4QIGA 4JV5F 2OFHX 3OXLA 3BQ2A 2QA4S 4NLUA 3OTCA 5T14A 5J2MB 3CMES 1KNZA 3TUJC 5CA5A 2DGQA 2ZOGA 4WFNQ 3OW2R 3TQ1A 4EU0A 2CPEA 2XMAA 2HK2A 1L5UA 3GFXA 4CH1A 3CJTA 1RT2A 4CLUA 2WOMB 1IBLJ 3OUYA 2XBPA 2EG2A 4LF2A 4DX7A 4CP5A 4DV3F 4NRUA 3GFZA 2OAUA 3DU5A 1S0VA 1BQMA 2M70A 4ECUA 2CJXB 4FKXA 2PSZA 4UZBA 1U0HB 1O6XA 1HBNA 2XLJA 1FI4A 3NLCA 1RWOB 3PIOQ 3K5MA 2XG8A 4UT4A 4ICLB 3OTOF 3FC9A 4DR7J 3G8SA 4A8QA 1IKXB 3MZIA 3W65A 1HI1A 1K1QA 2HHHJ 4J9NA 2YPZA 5KFVA 1FKAF 2GQ2A 2XCAA 2RKIB 1RT6B 4F50A 2W2NP 4QU7A 5HQLA 4PWDB 2CWKA 1CVJA 3JTPA 4YMEA 4I0WA 4OZ1A 2MXYA 4QYRA 5ETRA 4ZPBA 4EBCA 3GPAA 2DY1A 2M4MA 3C66A 4OI0A 2C2ZB 2XYPB 2MQPA 3WX8A 1VQ5S 4MTPA 2POKA 4CLFA 1X9WA 4FVCA 5JMNA 3CDBA 4O0IA 3NMAA 3SYZA 2NZ4A 3EVWA 2YWGA 3ILLA 3OFFA 2VG6B 4IOCQ 3TUIC 4Q43A 5J2PB 1GTEA 1NRKA 2XTCA 2MTLA 2ATCB 3CCSS 2CPIA 2DK2A 1NJZA 2YX4A 4FBUA 4OLOA 4FXVA 3HJFA 5A2QY 1FT8A 2C3OA 3MMJA 4ALZA 4DEZA 3I31A 1RYRA 1MWQA 4LIRA 3CJSA 2XZWA 3AAWB 2OPRB 1S6UA 4JYAF 1CC8A 4DWIA 2RF2B 3US5A 4FBTA 4QBUA 4F7VA 5D4NA 3ETOA 2BOPA 4X4RA 4ETXA 3RRKA 1VRUA 3UN3A 4DQIA 1TP7A 3R7BB 3UDCA 1HWKA 3OXGA 1EJ7L 4N47A 4IDKB 1PJ6A 3ULHA 2BM0A 1E6VA 3IAM9 3M6WA 2CQGA 1IM4A 1FRHA 2CJQA 1N5SA 2MKCA 2DHGA 1CJTA 3GFHA 1VQYA 4QWAA 1G7CB 4MIWA 2HK3A 2E9RX
chains in the Genus database with same CATH topology
4KKOB 2HYIB 2E1MC 5KFUA 1V3SA 2AGPA 3THPA 1QE1B 2QLXA 2ABYA 4QWBA 5HLFA 3BEGB 4KJIA 4M63A 3I6PA 5GADU 2M8HA 1R8AA 4FN5A 3N4WA 2W9CB 1ZPWX 4KGKA 7FDRA 3IWXA 4Y28C 4TY9A 4DBQA 3KG1A 4KO0A 4ZLPA 2J9DA 4PG8A 3G8TA 1B7FA 2CKWA 2ZITA 4RNOA 5HMZA 3HI9A 4DSJA 4DFMA 2QMWA 3P5TL 4AQYF 2QV6A 1K0VA 2BANA 3DM2A 2OPPA 2R2SA 2FD2A 2IC3B 3O5TB 4OHVA 2LLZA 3BGRB 3IFEA 5D3GB 4RW4B 3ENQA 4RUCA 2IJNA 1DBDA 1GAOA 1I1GA 3GR0A 1RAJA 2KVIA 1SKWA 4ELTA 5EWGA 2IVFB 1YTYA 2HHTA 2JSXA 1IKVB 1Q4RA 1JXEA 4FYDA 2HS3A 3JSMA 3P3DA 4PWUA 3H2VE 1WEXA 2CQHA 1NK8A 4DLGA 3VAGA 3VQSA 3M8RA 3MECA 3R5DA 1UJ4A 3UPFA 2YX7A 3LUYA 4C98A 2HRYA 1S10A 1LW2A 2AYBA 1HNIB 3PXGa 2J9EA 4U67Q 1LWCB 2RH3A 3IRXA 2JX2A 3F44A 3THVA 1DFDA 1UETA 5B0CA 3RAMA 2IM2A 3LGMA 3AB2B 1QAIA 2IRYA 2UZAA 1LWEB 2MMYA 1C1BA 1Z1ZA 2GQQA 3ZC4A 3PKMA 4UUWA 2W24A 1NK0A 1V6HA 1VRTA 3CCVS 1RT4B 3DDKA 1SH0A 1QY7A 1FTCA 1IKWB 3K5OA 4M94A 1TL3A 2C3PA 5DGAA 3PM9A 3PIPQ 3H98A 2NPIA 3M30A 1C1CA 4KB7A 3PR5B 1XN9A 2BDPA 3MMBB 4ERDA 3DYAA 1FCAA 5HL7Q 3QAUA 2LECA 5B0GA 4RU9A 2CQCA 3KNGA 4QQBA 1TAQA 2GGPB 4WU3A 2GFFA 2R8KA 4TU9A 2XWYA 4X4PA 2FTRA 3CCTA 2H9ZA 1LV5A 1KEKA 3OJUA 2FJWA 2KZZA 3OTBA 5K8NA 3TX8A 1DRZA 2W25A 4I6AA 3W2VA 3I87A 4OV1A 4QOTA 1CPZA 4IOBA 2GO9A 1KQSR 1C0UB 1LW0A 4TYBA 3V2UC 4NLYA 3OTEA 5KT3A 1VMBA 3F73A 1RTDB 1N4LA 4PXCA 3C6UB 3KMQA 5I3UA 3TVZA 2LDYA 3DLJA 1U6FA 3L7PA 2ZH9A 4DF8A 2ERRA 2ZJPQ 3E51A 2UVUA 4NCBA 3ONQA 4DUYF 1RWUA 3UCZP 2I5JA 2OD4A 2ROEA 4G1PA 4MFBA 4A48A 1M5SA 3PW4A 1X5TA 1GXTA 2MY8A 5CXTA 2X1BA 1YVFA 1JLGA 4J9RA 1V9OA 5HMWA 1UA0A 1IBLF 1UAWA 2E29A 3L95X 3TNVA 2OPQA 4WF9Q 4QR1A 1FK9A 2CG4A 4AXJA 1P1LA 4B3RF 4CO0A 2HMIA 4MK9A 5DM6Q 2XSJA 2HHSA 1UA1A 4HDHA 1DLOB 3KFWX 5HI7A 5HBMB 4OHWA 1S1UB 4YQWA 1YGYA 1X5OA 2DNGA 2VKZG 1ZAWA 3MEEA 3ITHB 5CYQB 4DLEA 2ZVSA 2HNDB 3DDNA 4IH7A 3BDEA