3OL7A

Poliovirus polymerase elongation complex with ctp
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polymerase
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase/rna
total genus 143
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3ol7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ol7A02
2R8JA 2RDJA 4ZP6A 3PVXA 1T94A 3RB3A 3RBEA 3FFIB 4NLQA 1RT3B 3GV8B 4X2BA 3KLHB 3Q8RB 2ILYA 2VG6B 4KKOB 3KLGA 1T3NA 2R8HA 5HLFA 1HNIB 3DLKB 1HNVA 4NRUA 1Z4UA 4MIAA 2ASDA 4LQ3A 3JYTB 1S1XB 2RDIA 3CO9A 4GC7A 3IS9B 3I0SA 4XPEA 1IKYA 2DPJA 3LALA 3GIMA 3FRZA 4RNNA 2WHOA 4F4XA 1JX4A 1JLCA 3OL8A 3H5UA 5KG7A 3T5LA 4IR9A 4ZP8A 1HARA 3LANA 4ECUA 4IFVA 3PJWA 3QGGA 4J9PA 1LW2A 3M9OB 2CJQA 2WB4A 2BQ3A 2AX1A 3QIDA 4F4YA 1N4LA 4WZQA 1JIHA 5KFXA 5KFFA 4Q8FA 2HNDA 3PZPA 3DYAA 5EUHA 3GV7B 4KFBA 3KLGB 2HWIA 5HLFB 2UVRA 3UQSA 4ECZA 3HVTA 4YP3A 2ZKUA 4NLGA 1RAJA 1S1UA 2J6TA 3T19A 3I0SB 2B43A 4Q45A 2RKIA 5EDWA 4K4ZA 3I5BA 5KFQA 2W9BA 1IKYB 3CWJA 4IOBA 1S6PA 3DDKA 1DLOA 4RW4A 1RA7A 4ED3A 4I7FA 2HMIA 5DQHA 2OPRA 1JLCB 4WFYA 2ALZA 4NLVA 1BQNA 1CSJA 4H4OA 2AQ4A 2ZD1A 5CYQB 4IFVB 3PR4A 5KFAA 1RT4A 4G1QA 4WE1A 1LW2B 4Q0BA 1IKVA 4IQXA 4LSNA 1C1BA 4IFYA 5DQGA 4DG1A 1S9EA 2FVQA 1XR6A 2V4QA 3MR5A 2BE2A 1RT2A 5KFJA 3OSNA 3KHRA 1TQLA 1S1TA 2HNDB 4Y34A 1DTTA 5KG2A 3DYAB 2XI2A 4KFBB 3RB4A 1TKZB 3RAQA 2ATLA 3DRSA 3CJ4A 4TY9A 4DL6A 1ZETA 3FQLA 4RW8A 4K4TA 2JC1A 3UPFA 4O3PA 4EBCA 3HVTB 5DG9A 1MMLA 4FS1A 3H40A 1S1UB 2B5JA 1JLGA 2OPQA 4ICLA 3KLEA 3M8PA 2RKIB 4DL4A 4TY8A 2W9BB 1S6QA 2UVVA 3FSIA 1S6PB 3DMJA 4QWDA 1R0AA 4XPCA 1DLOB 4RW4B 2R2SA 4DL3A 2FVCA 4ID5A 4I7FB 5KFDA 2HMIB 2OPRB 3RAXA 1BQNB 3IG1A 1RTIA 2IM2A 3QYYA 4H4OB 2ZD1B 5KFSA 4ZHRA 4F4ZA 4K4WA 1RT4B 3LP2A 4G1QB 4WE1B 4Q0BB 2E9RX 2V4RA 1IKVB 5L1KA 3C6TA 5C5JA 4LSNB 1HYSA 1C1BB 4IFYB 5KFEA 3Q8QB 2IM1A 1K1SA 4DG1B 1S9EB 3T5KA 1S10A 1SH2A 2BE2B 1RT2B 1RT3A 1S1TB 5KFWA 4RNMA 1DTTB 3SFUA 1RYRA 1KHWA 2IBKA 5KFCA 4NLOA 3V6DA 3DRSB 3OL9A 5F8JA 1S1WA 4RW8B 1KLMA 5F8NA 4ECTA 4KBIA 3CVKA 1XR7A 1RT1A 2W9AA 3UR0A 2B5JB 1JLGB 5DGAA 2OPQB 2D3ZA 4ICLB 3KLEB 3M9MB 4F50A 3M8PB 1BQMA 4TY8B 1S6QB 4NZ0A 5JUMA 4NRTA 4JV2A 2D7SA 3DMJB 3C6UA 3BREA 3NAIA 1R0AB 1JLBA 4R0EA 1RTHB 1JLQA 4ID5B 4ZMMA 4G3IA 3KK3A 3MR3A 1S1VA 4HYKA 4DL7A 2YNIA 4ZHRB 3IG1B 1RTIB 3BQ2A 1N56A 2IA6A 4FBUA 2JEIA 5KFTA 4NLUA 3BJYA 4J9QA 2FJXA 1T03A 3LP2B 1LWFA 3C6TB 2GC8A 4O44A 1TKXA 4RW6A 2ASLA 2WRMA 1HYSB 1C2PA 3N6LA 3KOAA 5L1LA 5J2MA 1TL3A 3H2LA 3G86A 1N5YA 2IMWP 1OS5A 4NLYA 3BSCA 3HVAA 5EWEA 5HROA 3MR2A 3V6DB 2W8LA 4JUZA 4EO6A 2CKWA 2R8KA 3LAMA 1S1WB 3CDWA 4MKAA 1KLMB 1RT1B 2WONA 1VRTA 4NLPA 5KFPA 2WTFA 4URGA 2HNYA 4NLTA 1BQMB 3TAMA 4QWCA 1RTDA 4LSLA 4K4VA 4JV1A 1KHVA 3C6UB 3LP1A 1QUVA 2XC9A 1JLBB 5JXSA 3NKYA 1JLQB 2GIRA 3CIZA 5KFHA 3KK3B 1S1VB 1ZTTA 4K4UA 1HPZA 2YNIB 3V6HA 3V4IA 2C28A 1RDRA 5F8LA 2OPSA 3DOKA 3KLFA 1XR5A 1JLFA 3OL6A 2AX0A 5CYQA 1T03B 2R8GA 5HP1B 3NBPA 1LWFB 4LQ9A 3QGHA 3DOLA 1QAJA 2HWHA 4O3RA 4ZPBA 1HQUA 1FK9A 4O44B 1TKXB 1RT5A 1S4FA 3D28A 4IH7A 4RW6B 3V6KA 2V9WA 5J2MB 1TL3B 3H4DA 2FVPA 2OH2A 5KT2A 1N5YB 2FVSA 2JEGA 5HROB 3I0RA 1TVRA 2WCXA 3GILA 4WYWA 1NHUA 3ICLA 1TKZA 4XO0A 4KHRA 3G6YA 5C25A 3PR5B 3EPIA 3CJ5A 2I5JA 2WONB 1VRTB 3QGIA 1IKXA 3BSNA 1TV6A 1MU2A 5KG4A 5EWFA 4J9MA 4Y2AA 2HNYB 1RTDB 3TAMB 3KNAA 5KFRA 3E01A 4LSLB 4MIBA 4IRKA 4PWDA 1S97A 3GIJA 5KG0A 3LP1B 4ECVA 3MEDA 3M8QA 5T14A 4RNHA 4ZVHA 4JV0A 3H4BA 4GC6A 4ECRA 3V4IB 1WNEA 1HPZB 4RW7A 4OL8A 1RTJA 3G6XA 4ECWA 2FVRA 4MFBA 2OPSB 3DOKB 3KLFB 1JLFB 1SH0A 5HP1A 1JKHA 3NBPB 3SFGA 4ED0A 5DQIA 2IAJA 4K50A 3DOLB 3KLIA 3ISND 4J9NA 1HQUB 4F4WA 1FK9B 3IGVA 4H4MA 1RT5B 5DG8A 4PQUA 4TLRA 3GIKA 4TYBA 4TQRA 2HAIA 3H5YA 2O5DA 5J1EA 2I1RA 3G6VA 3T5JA 5KFYA 4RW9A 4WYLA 4ED8A 3I0RB 1TVRB 3DRPA 3V81A 2YNFA 2IM3A 5C25B 2QV6A 3E51A 3MEEA 2I5JB 2R2UA 4TXSA 1IKXB 1S9GA 1TV6B 1MU2B 3DM2A 4NLXA 1ZTWA 2UVUA 3BQ1A 3IRXA 5HBMA 3E01B 2OPPA 4ECXA 3KJVA 2FJVA 4ECQA 4PWDB 2IJFA 4ZPCA 1I6JA 3GV5B 1FKPA 2C22A 3MEDB 3M8QB 3KHGA 1U09A 2D41A 4J9OA 1RTHA 2BRKA 1NNDA 4RW7B 3CDEA 1HQEA 4ED6A 1SUQA 1RTJB 3MF5A 4MFBB 3LP0B 1C0UA 3I5CA 3M9NB 1TL1A 2AGPA 1JKHB 4R5PA 2IAJB 3MEGA 3KLIB 2IM0A 4I2QA 4O4GA 5CYMA 4DL2A 2FLNA 4PUOB 4H4MB 4PQUB 5KG1A 4IKAA 1S0MA 1SH3A 3PHEA 1D1UA 4O3NA 5J1EB 4IG3A 1C1CA 3QIPA 4RW9B 4ED1A 5J2QA 3DRPB 4RZRA 3V81B 2YNFB 2RF2A 1QAIA 4EEYA 2BQUA 3VQSA 4ZVGA 3KK1A 3MEEB 4YR3A 1S9GB 3DM2B 4QPXA 1QE1A 2VG7A 4I2PA 4Q43A 4K4XA 3Q8PB 3IRXB 3MFHA 5HBMB 1RT7A 2IC3A 2OPPB 4RNFA 3KJVB 5DG7A 1FKPB 3OHAA 4WZMA 5L1IA 2XGPA 1JXLA 1RT6A 2D3UA 4DEZA 1HQEB 3KMSA 1SUQB 5F9NA 3NGDA 4QW9A 5KG6A 2WOMA 4ZP9A 1C0UB 3DLEA 1TL1B 3IGNA 3EZUA 4QWBA 5KT7A 5DGBA 4URSA 2XI3A 4RNOA 2IJNA 3NL0A 1S49A 2XWYA 3MEGB 4O4GB 4WFXA 4I2QB 5CYMB 5K14A 4R5PB 3DRRA 3FQKA 5KFKA 5KT4A 4URQU 2J6UA 4ED7A 5KFIA 4MK9A 1JLEA 3QZ8A 4YQWA 2HNZA 4IG3B 3PJXA 1GX5A 2C2EA 2AWZA 1C1CB 3QIPB 3TVKA 5J2QB 2BR0A 4FBTA 5F8GA 2FLLA 2RF2B 1HMVA 1TKTA 1N48A 4Y3CA 3KK1B 3BR9A 4ECSA 3D5MA 1QE1B 2VG7B 4I2PB 2VG5A 4MK7A 1JLAA 1RT7B 2IC3B 2V0NA 1IKWA 5DLGA 3RB0A 4B3OA 3SI8A 3BSAA 1VRUA 4RUAA 4KHMA 5FDLA 3HKWA 1UWBA 2FLPA 1RT6B 5F8IA 1DTQA 3KK2A 1LW0A 2C2DA 3KLVA 2AGQA 1W25A 5J2PA 4J9KA 2E9TA 2WOMB 2BANA 3DLEB 3CDUA 5KFNA 2YKNA 3ISNC 4H54A 5K14B 4DL5A 4M94A 4IRDA 3DRRB 3Q8SB 2EC0A 3H5SA 2W9CA 4IG0A 2ILZA 4ZVFA 3GQCA 3I5AA 1JLEB 4QW8A 3NAHA 2HNZB 4IR1A 5F8HA 3CJ2A 1HMVB 1TKTB 2F8EX 4QWAA 3LAKA 2R2TA 4KE5A 4U6PA 3FDSA 4EBEA 2QE5A 3T1AA 2VA3A 1S48A 4EO8A 2YNHA 4YR2A 4R8UA 5J2NA 5KFLA 2VG5B 5KG5A 4WXWA 1JLAB 5KT5A 3ITHA 4J9SA 1IKWB 5EWGA 4B3OB 3NMAA 1VRUB 4U7CA 2BQRA 4EYHB 1IM4A 1NHVA 3BGRA 5FDLB 5KFOA 4NLSA 4NLWA 1UWBB 3JSMA 4WXOA 1D0EA 1DTQB 3KK2B 1LW0B 3H98A 5J2PB 2YNGA 5DLFA 2BANB 3PW5A 2DPIA 4Q8EA 3LP0A 4KO0A 4FS2A 2YKNB 4EYIB 4K4SA 4YR0A 2ZE2A 1LWEA 3QO9A 1C0TA 5KFMA 3N6NA 2W9CB 4IG0B 4ECYA 2ASJA 1HNVB 4RUCA 2WK4A 3RBDA 4KB7A 2C2RA 3OSPA 3HVWA 2JEJA 3MR6A 2GIQA 5KT6A 5I42A 4IH6A 5J2NB 2YNHB 4HKQA 4R8UB 4IRCA 4TYAA 5D3GA 2VA2A 2UVWA 5L1JA 1SV5A 5C42A 3ITHB 3PW7A 2B6AA 3H59A 3BGRB 3MTKA 2W8KA 1TP7A 4O3SA 2R8IA 2XGQA 4O3OA 4ED2A 2XCAA 3JSMB 2AU0A 4TQSA 5KT3A 1REVA 3PW4A 2XCPA 2YNGB 5KFGA 3N6MA 1FKOA 3PW2A 4KO0B 4ZPDA 2ZE2B 1LWEB 3QLHA 5C24A 3QO9B 5F9LA 1C0TB 2FJWA 4ZVEA 1T05A 3OLBA 4O3QA 1LWCA 4PUOA 3DLGA 1EETA 4ZPAA 2R2RA 4NLRA 3GIIA 1N6QA 3UDLA 3DI6A 3V6JA 5KG3A 4EBDA 5KFBA 3KHLA 3MFIA 5I42B 2AGOA 1S0OA 4KV8A 3OHBA 3CJ0A 1J5OA 1EP4A 5D3GB 1SV5B 1S9FA 5C42B 4NCGA 4Q44A 3OL7A 2B6AB 5I3UA 2YKMA 3T5HA 4IDKA 3KHHA 3HHKA 4O4RA 4KAIA 1S0NA 3BQ0A 3MECA 3GYNA 2UUTA 3PW0A 1REVB 3IN5A 4IH5A 1FKOB 3FFIA 3KLHA 5C24B 3QLHB 5KFZA 4YMEA 2VG6A 4KKOA 3RB6A 4M95A 1T05B 4J9LA 1HNIA 1LWCB 3DLKA 4NLDA 3BSOA 1RA6A 1EETB 3DLGB 3JYTA 4MK8A 2JLEA 1S1XA 1N6QB 2UUWA 3DI6B 3H5XA 3IS9A 1YVFA 4MKBA 3TQ1A 4QWEA 2E9ZA 5F8MA 3OLAA 3EPGA 5KFUA 5L9XA 2W7PA 1RYSA 2J6SA 4KV8B 2JEFA 5KFVA 2BRLA 1J5OB 1EP4B 3KMQA 4Y2CA 4NCGB 4RU9A 4K4YA 4MH8A 4NYZA 4J9RA 2W7OA 4ZP7A 4KSEB 2YKMB 5I3UB 4IDKB 4WFZA 1K1QA 3QZ7A 3MECB 2JC0A 3CJ3A 1GX6A 4TN2A
chains in the Genus database with same CATH superfamily
1OPZA 2Z2LA 1VIOA 1VQOS 2AW0A 2R8HA 4NA2A 1N36F 4NRUA 1O8BA 4A4JA 1FX2A 2X7IA 1UVIA 4X4OA 3GIMA 3EE3A 3LANA 2B51A 1NRKA 2ZUAA 3HI9A 4B3RF 3QIDA 5M2RA 2CJKA 4PG7A 1FXRA 2U1AA 4ZCLA 3HJFA 2IPOB 3QSIA 5HLFB 4K4ZA 1IKYB 3DDKA 2LFVA 3R6LB 1CC8A 5DO2A 1UW9A 2J7KA 2X3GA 2ZBPA 5KFJA 5KG2A 1NJZA 1T9UA 1LOUA 2HGLA 4F25A 4K4TA 4FXWA 3UPFA 3N0VA 3Q0AA 3L9ZA 2R2SA 2OPRB 1V3ZA 1RTIA 3W5ZA 4G1QB 2GIFA 1SIZA 4DG1B 1RT2B 4RNMA 2NXJA 1CJKB 2HZAA 3C6UA 4C3MA 5ETLA 3I96A 2MKIA 5KFTA 1IR2A 3CCTA 3W9JA 4O44A 1M5PC 2V2KA 3VAJA 2DR8A 3CDWA 4PAAA 1JNZB 4P7TA 2ZH1A 3FEZA 3GZ7A 3KK3B 2YNIB 1UEUA 3FBCA 1SKSA 3QFWA 2AX0A 1OO0B 3HHLB 1LWFB 1TKXB 3D28A 3UCGA 4LRDA 4LR8A 1RKJA 5C25A 2VONA 1RWOB 2DR9A 5ETTA 3E01A 2B0GA 1FD8A 4I6WA 1NM2A 1VI7A 4GRSA 3J81Y 3D9BA 4CLKA 5DG8A 4DU8A 2W2NP 4C3KA 3G6VA 2BJ3A 2XMVA 3QT5A 2B9WA 3D6FB 2FJBB 1KP6A 3W60A 4DPOA 4ECXA 2C22A 3KHGA 4LUBA 4JI7F 2F9JA 2ZH3A 2RHQB 4ILRA 4RZRA 3JQKA 4YN3B 2NR0A 1F9FA 4X65F 2P6SA 2OTLS 3NCRA 3FBFA 1O51A 2GV1A 1U02A 3OVSA 3IFEA 3EZUA 3HVRA 4J7CA 4W4MA 1HBMA 3NY0A 1NZAA 3QJJA 3NCQA 1GX5A 1PYSB 3QT7A 1HMVA 4XIUA 3VAGA 2AMCB 4ECSA 1AT1B 3SI8A 3EGVA 1VRUA 1UPMB 1RBLA 1FJEB 2E9TA 3DLEB 1IQZA 1N5TA 4WK1A 3JXOA 5AJ3F 1Q1KA 1JJ4A 2J9CA 2VA3A 1OWXA 2EEYA 5B0FA 1J5EF 5IQ6A 4LVNP 2QA4S 2ZH4A 4JI4F 5KOXA 4EYHB 1NPRA 1FO1A 1I5OB 5LMNJ 3JSMA 4ZVUB 2DPIA 1QSSA 3BV8A 6AT1B 1RK8A 3MM5A 2E5IA 4EWTA 2R7TA 4A8XA 3SV3A 2GIQA 2HIQA 4ID8A 5I42A 3HFZB 2OD4A 4TYAA 5FJ4A 5D3GA 2XZWA 1H74A 4PWWA 1U1NA 2AKWB 1VDHA 4I6YA 2Y0BB 4XAKA 4YDXA 4ZVEA 2X51A 2V68A 3PX0A 4L3NA 3UDLA 1PAEX 4ZVRB 3V6JA 3I82A 4K2XA 3NEKA 1RU2A 4DUZJ 3CT9A 3UVJB 1PKUA 4ELTA 3ET6A 2EI5A 4OI4A 2JLEA 2H3EB 5DDRC 2CPFA 4DV4F 3CCJS 3IA0A 1HBOB 1YJUA 3PY8A 5KFVA 4L6V3 1YZ7A 2IHR1 2W7OA 5I3UB 2W2QP 4XK8C 4R25A 4C11B 4USTA 4WP3A 4ZP6A 3SQGB 2CPXA 2ILYA 3KLGA 2MGZB 1VHIA 3X3UA 2DR7A 3JYTB 3K59A 2W25A 3I0SA 3EXCX 4OZJA 3KG4A 2QN6B 1VBKA 2G4BA 1U1QA 4ZP8A 1YJVA 3CJKA 3WC2A 2NQPA 4AT1B 1JIHA 5CD4A 5KFFA 1M5SA 3W65A 3EUNA 1NKEA 3AJ1A 1K0VA 2UVRA 5IM0B 3OTCA 3DFEA 1DLOA 3N79A 2COLA 3UFCX 1BQNA 1Q53A 3KYLA 1IKVA 3PRVA 4ETXA 1HNZJ 4QIVA 5D4OA 5AXMA 1S1TA 4ZLJA 4LFBJ 3BKFA 3FQLA 5DS7A 1VIXA 4LJMA 4HI2A 2QYCA 1VQYA 5GMEA 4WU3A 5KFDA 3NLCA 2C3UA 3R3TA 1TUVA 1R6YA 2RMLA 3BYRA 5GAGU 3TI0A 1HYSA 4QPTA 3T5KA 2B9YA 3GFYA 1NSKL 5KFCA 5L38A 2W9AA 2OPQB 3OR2B 4DZDA 3M8PB 4I64A 5A2QY 6FDRA 1Q8IA 2ZDPA 4ID5B 4R0EA 1CULA 1Y0HA 4L74A 3BKTA 2V6AA 2XMMA 4DL0C 3F56A 1RWVB 2KT3A 3G8SA 3FJ2A 3A8IA 1N5YA 2IMWP 5LJ3Y 1HNWJ 2U2FA 1KFDA 1UEKA 5H9FK 3TAMA 3MAAB 1S4EA 4ZVQB 1S1VB 2BUNA 1VBXA 1HPZA 2C28A 4DOZA 3N28A 2R8GA 1X4HA 2VH7A 4PXDA 1N8RT 1QAJA 2CZVC 1S5ZA 5AE3A 4WFBQ 3ZZPA 3AA8A 2F8MA 1J2VA 4L76A 3MDFA 4J9MA 2WW8A 4E2FB 5ETQA 1S97A 2R7QA 3CD7A 2CFXA 2MY7A 4OZ0A 2BMBA 4P72A 4JV1A 3DOLB 3IWNC 4PUOA 4F4WA 4L72B 1FK9B 1ULRA 3GIKA 3T5JA 4DSIA 4WYLA 3IM9A 3V81A 2AD9A 2VOPA 4OZ3A 2R2UA 1RHJB 3D0GE 3R5GA 3ZZTA 4JI0J 3FCVA 3ILLA 3VVUA 5JVGQ 1FHTA 3OT9A 2ASYA 3HSDA 4C8YA 4GKJJ 1W2BR 2OAUA 2IM0A 2R7XA 4ES2A 5J1EB 3SSQA 1LV5A 4OZ5A 4QIWD 2PC6A 4X4TA 3HLUA 4AQYJ 4YY3F 4PWUA 2OIHA 4LRFA 3B8HA 2FLPA 1CC7A 4HDGA 1SC6A 5CYMB 2K06A 4PG5A 4LIWA 5D0GA 5J2QB 1RAAB 2ACMA 1AZSA 5ADZA 3FGVA 3H42A 4P10A 4RUAA 2J7UA 1RT6B 4FYVB 3KLVA 4CLLA 2AT1B 5KFNA 3R8YA 4M94A 4B3TF 3Q8SB 2EC0A 1OPIA 2GA7A 4ZVFA 1RHUB 1DARA 2OGUA 2WZ1A 1GXTA 2R7WA 2HK2A 2XS5A 2R2TA 4FYXB 3ZXWA 2ZHBA 4R8UA 4X4QA 3ITHA 3I87A 1WF1A 2AZ1A 1UWBB 4BS2A 4EZ6A 1Q0NA 2GGPB 1VRQC 3DHXA 2RSQA 5DM7Q 2QSWA 2GAGC 4F3OA 4EK2A 3SCLE 3L3CA 1F1BB 3BBFA 3NGUA 1LFWA 4PG4A 4A48A 3H0PA 4X4PA 5T7LB 4DCJB 5HVHA 2W8KA 4O3SA 2ZOFA 3R7NB 2EWHA 1TKDA 4FDFA 1UPPA 4ZPDA 4CH7A 1NZ8A 2PMHA 2VDIA 3OFFA 1WSVA 2J76E 2KXFA 1VQSA 2YQ3A 3RW6A 2ADCA 2YKPA 2GVZA 2KB2A 5LMNF 2KTQA 1S7HA 2OEKA 4M5NA 5C24B 2NZCA 2VUGA 3D1QA 2CRLA 3DLKA 2ZH9A 4CYUB 3DLGB 3EM1A 1NKBA 1N6QB 3N5FA 2V69A 3OBIA 4WP9A 2EFPA 4NYZA 5ETVA 2YKMB 2XNQA 2VB6A 3QQCD 3D68A 4RPFA 4DLEA 5LSRA 2VBXA 4V19X 3GR0A 1Q5VA 1YITS 1FE0A 2OJ3A 1UCNA 2IRXA 3LF0A 7AT1B 3OL8A 2B7BB 1KONA 4MIWA 1M0SA 3ETOA 4OYIA 4DUZF 3PJWA 4C48A 3D54A 1F3VA 4USMA 3IXQA 4DU7A 3VAFA 1FNXH 3U1NA 2ZDOA 1Q86T 4Q45A 4IOBA 2AJ0A 2QEXS 1F60B 4IFVB 2EC2A 4WE1A 2XZTB 3MPYA 2FHOB 3R1LA 3K5PA 2FVQA 2BE2A 2C3MA 4NCAA 2K2PA 1DTTA 2QA4G 3J80Y 3CJ4A 3TUIC 1YTYA 2V94A 1YRUA 3TNVA 1S6PB 2QMXA 4RW4B 5GAGI 2F9DA 3C66A 3TVYA 2IM2A 3UDEA 3A8JA 5B0EA 3Q2SC 1AFIA 3PO4A 2KT5A 1C1BB 2XZDB 3Q8QB 1RT3A 3V2UC 2UXDJ 2FJAB 4NLOA 2DNZA 4RW8B 5C2GA 2M9KA 3UR0A 1JLGB 5D0EA 1R8BA 1S6QB 3UD4P 1R0AB 4MTPA 1JLBA 3BQ2A 3M2RB 2E7XA 3C15B 2Z2YB 1XMOJ 1HNZF 1KR4A 2WRMA 1C2PA 3RU0A 2XQCA 4OI3A 3CTRA 5EWEA 5HROA 2DY1A 1F6TA 5K9FA 3BGLA 2MZQA 1T9YA 4NA1A 1MROB 2HNYA 3W3SA 3QATA 4CNYA 2DIVA 4ZPTR 3QT6A 1QUVA 3DDIA 3GTYX 3ZTOA 2QO3A 2YVSA 5F8LA 5LT5A 1V3RA 1XMQJ 2FPHX 2DGUA 4JI5F 2KKHA 1HQUA 2NUHA 4CM0A 2OH2A 1KDNA 2HHTA 2HK3A 2WONB 3BSNA 2I0XA 2HRUA 4DR4J 2BE9B 4KH1B 3CULA 2KYXA 3KLFB 4W90B 1HQ2A 2IAJA 4QQBA 5E2QA 1RT5B 1IBKJ 2OKQA 1M1GA 2WVCA 4OHXA 1HNWF 4RW9A 2HVDA 4IOAQ 2M7SA 4DPYA 1VQ7S 1MU2B 3OD2A 4OHVA 1WC6A 2ZKTA 2GAHC 2NXUA 3MEDB 3D6HB 4RW7B 3I9V9 3TA2A 4Y0FA 4I2QA 2JZ5A 2MZTA 1RZMA 4O3NA 2FJDB 4OMFG 1HBUA 3QIPA 3S6EA 4S0MA 1REGX 3IWLA 3THVA 1QTMA 3MEEB 2KL8A 2VG7A 3GYGA 4I2PA 2KRBA 3HX9A 4X4UA 3G6ES 3JQJA 1GT8A 1O0PA 1KEKA 1HQEB 1NBEB 5KG6A 3FNNA 3IGNA 4QWBA 3AY0A 4NZ6A 1CS4A 1FJ7A 3TVKA 4NA3A 2BR0A 1H7XA 4MK7A 1Q95G 5DLGA 4B3OA 3M05A 2VC1A 4HHJA 3DNCA 3RTVA 2DCUB 4GKJF 1TTHB 5HQLA 2CJXB 1JLEB 1WKKA 4IR1A 4DI6A 2Q79A 1U0SA 2QC3A 3TA1A 2QTWA 3QRQA 5DZ7A 1VQKS 4KE5A 3JSYA 1X4AA 5HK4A 4UOFA 4WP8A 4JYAJ 5JVHQ 4OX7A 5J2PB 1KS2A 4EYIB 4TNOA 2FDNA 1VQ6S 2ZM6J 2JEJA 3HK2A 1KN6A 1U1MA 3HP6A 3FKBA 3US5A 2H4WB 3IRWP 3PG9A 5IT9U 2V50A 1FKOA 4F2RA 4B08A 3Q83A 4CO4A 4KTQA 4IYQA 3T5HA 4KAIA 1Y4ZB 2B9XA 5IWAF 1V3SA 1CVJA 2NYHA 3D3BJ 1T05B 3CB4A 3BSOA 1RA6A 4ZDNA 2KT2A 3PNIA 3TQ1A 4MJKA 2E9ZA 4IQMA 4JBCA 3UN3A 4A46A 1EZZB 4K4YA 3THPA 1VC6A 2JC0A 3MAQA 2BZ2A 2CPYA 4HL9A 1CPZA 2VG6B 4P74A 1T3NA 4M8LA 5L39A 2P6TA 1EX8A 1RSCA 4UZCA 2ASDA 3I55S 2RDIA 3CO9A 3EMTA 1W7WA 3IR6B 3SYZA 3BF4A 1LWXA 3L09A 2BE7D 2ZVIA 3D6MB 4F4YA 1W2IA 3GV7B 1BXNA 4KFBA 3LGNA 3CCWA 2ZKUA 3KUGA 3T19A 3EVOA 1HWKA 2VFVA 3MM8A 2XM3A 2MZRA 1JLCB 2ZD1A 1HI1A 1X4FA 2V4QA 1KVIA 2W7AA 1FXLA 1RWMB 4X4RA 5D0RA 4TY9A 2B5JA 4MAKA 4OV1A 4GKKJ 1FRKA 4UZBA 4XPCA 2HMIB 3QYYA 3NGSA 1RT4B 2CQDA 1ZAWA 2E9RX 4IFYB 1S9EB 1PILA 4ZN3A 3K0JA 3ZZYA 3SFUA 1S1WA 3CVKA 3JSBA 5J1PA 1AB8A 2AHOB 3KKFA 2HURA 3GFZA 2EG1A 2XO7A 5CABA 2IA6A 4K8RA 3KFWX 1LQ9A 3CDAA 1BQXA 2BM1A 2RRBA 3OW2R 1OS5A 3V6DB 2HBZB 2LEBA 2NXCA 2KXNB 3OXGA 3PEJA 4LSLA 2QSFA 4DV0J 3LP1A 4F4KA 5KFHA 1C4AA 2APOA 1S72S 3NBPA 2HHQA 1N5VA 3PTWA 2KJVA 3SDEA 3BBCA 2XMWA 2WSCC 1ZAVA 3GILA 3ICLA 2CVIA 2RIJA 4FF2A 4U7UD 3QGPA 1T95A 1XNQJ 4PWDA 3GWCA 2BXJA 4ZVHA 1R8PA 4JV0A 3V4IB 1HWJA 2FVRA 1JLFB 2EFNA 1X9MA 1T9XA 4Z2XA 2I1RA 1OJ4A 2EW9A 4ED8A 3IAM9 2IM3A 2Y1IA 1H98A 1K73T 3ENWA 4OYMA 1FDBA 3CDEA 1SUQA 4B9NA 1XMQF 1N0VC 3MEGA 4O4GA 4P52A 2CADA 2PMZD 3TZXA 2R42A 4LBPA 3DRPB 2YNFB 3TP2A 4A8KA 1H73A 1AFJA 2WBMA 5A0YB 3VVTA 3MFHA 1NK9A 1FKPB 4O0IA 3PDNA 3JQMA 3KUEA 4QW9A 1P6TA 3J7ZT 3W66A 3CPWR 1R31A 2VU5A 1IBKF 1FWLA 4RL1A 3V5RA 4X64F 5ETSA 1EAYC 3RZAA 4ZIWA 1MMDA 3BSAA 2XMAA 5AE2A 2R9LA 2LEPA 4IOCQ 4H54A 4V19J 1P1LA 4Z7CA 1NAQA 1VQLS 5B0BA 2QLJB 2KVIA 3HHEA 3J7AN 2F8EX 2N3OA 2QE5A 2QLBB 1Y00A 1XBWA 1JLAB 3VCDA 2J8SA 3NMAA 2HZVA 2ZVSA 3CCQS 2K3KA 1LW0B 3MUMP 4HVZA 2L08A 2JHEA 5LMUJ 5DRKA 2ZE2A 1LWEA 1S7IA 2W9CB 3TX0A 3LGMA 2C2RA 4CRJA 4F2SA 4MMOA 1OM2A 2VA2A 3HD1A 2DYAA 3PW7A 5G0RB 4J37A 1REVA 4G65A 5B08A 4KO0B 4CTAA 1YQHA 4KJIA 2PN6A 1LWCA 1MWZA 3OHBA 5C42B 4NCGA 1BHNA 4NI2B 1KFSA 2D9OA 3RBXA 4PYAA 3CCES 1HNIA 2L3MA 5IZHA 3T1YF 2ZM6F 1EETB 4QWEA 3R5CA 2WVEA 2MLXA 2Z57B 3EPGA 5IT0A 2FLOA 3OPKA 2LA6A 1U0HA 5B7WA 3RB3A 1RT3B 3Q8RB 2LP4A 4DQIA 1S1XB 3DGPA 1BWEA 1U48A 5LXRA 4RNNA 1UJ4A 5KG7A 2LKZA 2V1SA 1WUUA 3MM9B 4N76A 2M88A 4N41A 1XNRJ 4USWA 3EDQB 2F4VF 2ERRA 3DLHA 2V63A 2G2YA 3VAMA 1X31C 3A12A 5CYJA 4C8LA 3I5BA 3ILJA 2HBQB 2YKOA 1D8ZA 1CSJA 3NCPA 3M32B 3MD1A 3PR4A 1M5HA 2WB1D 2CPJA 3MMBB 4QYZK 3IC1A 4LSNA 1VJWA 2ZEJA 2ATLA 3DRSA 1KBRA 4O3PA 2ZJPQ 4FS1A 2KI2A 3KLEA 1KVKA 3CGIA 3PCOB 3G2XA 2V2QA 1LXNA 3SSSA 2YX4A 4LF5J 1R43A 1S10A 1Q79A 1F2HA 4N56A 1WEYA 5H9FJ 5D8HB 3MPUB 1KHWA 2RILA 3QJPA 3WQPA 1RT1A 4DQRA 4HLBA 2GW8A 4NZ0A 5LM7E 2GHVC 3DMJB 4PABA 2CNOB 3EDRB 5HANA 1AW0A 2E44A 2DGTA 1X7VA 3LP2B 2WVFA 1O6XA 4DV7J 2PA8D 1I51B 3N6LA 2ZHOA 2DGOA 3HVAA 4BHQA 4EZ9A 3BEGB 2R8KA 4N8NA 3MM6B 1IQTA 2WTFA 2PGCA 1KOHA 2PFFB 1MSWD 2YQ1A 3MHYA 4QR0A 3AWRA 2R3VA 1SQFA 1YI2S 2OPSA 1Y9OA 3QGHA 1NK0A 1YIJS 2FGOA 2PDAA 4UQTA 2CWKA 4DSEA 1A6LA 2E5HA 1TKZA 3K2YA 3PR5B 4DWIA 3R7BB 5KG4A 1RTDB 2ZJQQ 5KG0A 1PBAA 3M8QA 1S76D 2DGXA 3G6XA 3LO3A 3IGVA 4TLRA 2HAIA 2HHUA 1UEVA 5KFYA 3I0RB 5A8RB 2UUCJ 4TXSA 1Y3KA 3L95X 1ZTWA 3BQ1A 3IRXA 5BYQA 4DV0F 2B8QA 1LNQA 1OY6A 1X4GA 2XY5A 3TR5A 4P7VA 4TU9A 2CQ2A 1N0UA 3S8SA 3POTA 3G82A 4C8MA 3KK1A 1XNQF 2P2CB 4CP5A 3I32A 3KG1A 2A18A 1KQFB 3R5DA 4C8ZA 2ZWOA 3NGDA 2WOMA 3FSIA 2XLKA 5KAKA 4I67A 3R5JB 2B7CB 5CD4H 1H2VZ 4LRCA 1YJWS 1ZM2A 5DZ6A 5CCLA 3IR5B 2AGQA 2XYHB 2YKNA 3H5SA 3FBBA 2QA2A 4RBUA 3MOJB 2HFSA 3DLBA 4WIQA 4QWAA 5HMZA 3T1AA 4CCHA 4DFKA 1QUPA 3AX5A 5KT5A 4YB5A 4U7CA 4PXCA 2HFOA 1V5VA 2ZNZA 2E29A 3PJ9A 2Q43A 2ZNYA 3N6NA 3UNGC 4DF4A 2N4CA 3OSPA 4B3SJ 2NXNA 2M3DA 1M5KC 3OVBA 1N54B 3I4PA 1RAEB 5ETPA 1U1OA 4XDCA 5KT6A 2YNHB 5SZTA 2HHHJ 4M5DA 3CUNA 2XULA 2UXBJ 3HHLD 1FI4A 3M1VA 2AU0A 2HGMA 4FF3A 5KFGA 3N6MA 3PW2A 2B9EA 1C0TB 5M2UA 3H20A 4DR3J 4M5IA 3S01A 3D0HE 2R2RA 4GVBB 4DQSA 5KFBA 3O3LA 1EP4A 4NXMJ 2CVEA 1R8CA 3E8OA 2RD5C 1U26A 4F36A 4IDKA 1D9DA 5LL6d 2E5LF 5LMUF 3KJFB 2Z0GA 1H38A 5LSLA 4CLUA 2XHWA 4AYBD 5L9XA 3IBCB 3BO4A 1YJ7A 1Z2ZA 3D1OA 3CMES 4RU9A 3HF5A 2KYZA 3JTOA 1K44A 1GX6A 3VV2B 4JI3F 2NUUG 4USHA 2RDJA 3AOBA 4NLQA 4C0HA 4B9SA 3BDPA 1ZPWX 2BJ8A 4M5GA 4TU7A 5HLFA 2MEWA 4C0OC 4OJHA 4N7TA 4Y2MA 5IQQA 1IKYA 1YBTA 2PMWA 3MZIA 4OJ3A 1KOOA 2GVDB 2DNHA 2E7VA 1UKUA 2J0XA 2M8DB 2DRDA 2HWIA 3HFVA 4NLGA 4OV6A 4LRBA 1X4EA 2HVIA 2OPRA 4WFYA 1PGZA 4G1QA 1LW2B 5CAAA 1UP1A 4DG1A 1NXIA 3MR5A 1RT2A 3KHRA 2HNDB 1CJKA 1WI6A 2VODA 3NWGA 2DNRA 1FFSB 3KXDA 4DJBA 2MQMA 4DR5J 4RBVA 4H4OB 3MURP 2JNJA 4F4ZA 3M6XA 4KH0B 3OFHA 1A7GE 4RR5A 3M2VB 3JB9k 4J9UE 4WBFA 4U9RA 2Q6BA 5DGAA 4ICLB 1RAGB 2B4OA 2VPYB 2CPIA 4TY8B 3SEOA 3ZZOA 5JUMA 3KK3A 4HYKA 2YNIA 3IP0A 4DSFA 1CEZA 2CAJA 4RUHA 2HBYB 3HHLA 1LWFA 4AFFA 1S6OA 1TKXA 4RBTA 3WBZA 3OVAA 3UCUP 3KOAA 2AYBA 3RJMB 3ZTRA 1KNZA 3UNYA 3CD5A 2HQCA 3PYGA 2ADBA 2IIHA 4UOGA 1KHVA 3J81U 4ES3A 1CBKA 2FZGB 1RDRA 5I4MA 2DJWA 3CD0A 3W8GA 3D0IE 5K20B 3H4DA 1BY9A 2FVSA 3N5BA 2N82B 3G6YA 4C8OA 3QGIA 3ILOA 2I6WA 4IRKA 4OYOA 1FE4A 1WG4A 1ZM4A 3DOKB 4Y6IA 1VFJA 2CIMA 2ZBCA 4U7UK 2Z2MA 2HS0A 1TVRB 1HNXJ 1TZ0A 3OTDA 2KG0A 2RAQA 3A4TA 2CXEA 2EBGA 1U09A 2POKA 1X5SA 1HWLA 4Y65A 5RUBA 3M9NB 3QWUA 2EFQA 1NB2A 3SCJE 2YKQA 1H3DA 4UOCA 4IKAA 4RLEA 1L3SA 2CZ9A 2DT9A 1R3NA 3W2VB 1RP5A 4EI2A 5F0UA 4DDFA 4LF9F 1JXLA 1YLXA 3DLEA 4URSA 3NL0A 3FQKA 2V34A 3QZ8A 4YQWA 3PKYA 2NLWA 4FBTA 3QFHA 2FLLA 2UUCF 2XLJA 3BR9A 3AAWB 1RLDA 2P9EA 4LF7J 2HFNA 4FKYA 4W98A 1FTCA 4DR6J 4YFUA 1KQSR 4KYZA 1SJFA 3AOAA 2ILZA 5F8HA 1U2FA 3N01A 3CEDA 1DBDA 1IBMJ 5EWGA 5IOLA 1IBLF 2VHGA 3K5MA 4CLPA 4WF9Q 3CCVS 3TRGA 2DGQA 5K8NA 2V8DA 2F1FA 2LMIA 5J2NB 4WWSA 3DU5A 3L4BC 4WKYA 5GAEU 2MB0B 3UVJA 2GX8A 4OQJA 3L7OA 5LSOA 3LQVA 1HBOA 1FEEA 4OFZA 1HI8A 4Z37A 4AUKA 5I3UA 4L75A 4DN0A 4JI1J 1AROP 4C11A 3MMCB 3PW0A 3M6UA 5HVFA 5E7OB 8AT1B 3SQGA 2AJ4A 2DB1A 2C3PA 2MGZA 1Q8BA 4WCEQ 1TK0A 2RDDA 3JYTA 1YVFA 3OTOF 3E3XA 3RRHA 3OLAA 2HHHF 2QJ3A 2QZ8A 1JK9B 3CXCR 2GHPA 2ZBRA 4DV3F 2HHVA 2J0WA 2MQNA 3SIPB 3RBEA 2M70A 1DHMA 3GV8B 3NNHA 2BJ1A 4CO3A 1RAFB 3TEHB 4KKOB 1EARA 5IM0A 3W61A 3AD8C 4K0KJ 1KRPA 1R0BG 2BKOA 5HN0A 1YGYA 2G9OA 1FTRA 2O01C 1R27B 2DVIA 2OHDA 2VPXB 2V5HG 5EUHA 2DHHA 4YHHJ 1NLKL 2H54B 2P9GA 2EPIA 2L9DA 3UN2A 4CLYA 3C46A 3WC0A 3CWJA 3GG0A 3M6WA 5DQHA 2B8PA 4HEA9 1GMVA 1TKZB 4M5LA 2MLYA 3G4SS 4OX8A 1RB0A 4ZCMA 2OPQA 5E3AA 1MW7A 3OR2A 3M8PA 1FX4A 4DL4A 2LQBA 1X0FA 1JB0C 4ID5A 2QLWA 1MN7A 2GJIA 3A1YG 4PEOA 4DQPA 2LVWA 2UU9F 5JMNA 2DCLA 2DD8S 3VAIA 2XBPA 3ZTPA 1VC5A 1A9NB 5MLCV 3GFXA 4ECTA 4KBIA 2O67A 1UFLA 2P8IA 4CWBA 1QJHA 4NRTA 2JSXA 3MAAA 1ZM3A 1NK4A 4Q2LA 1S1VA 5A8KB 3B6BA 2CYYA 4WPAA 2FJXA 2IYIA 2IDEA 5IC4B 2L41A 2D3OR 1ACMB 3TA0A 4EO6A 1KLMB 4Y2IA 3JTNA 4DV2J 4YB1P 4NLPA 5KFPA 1NUEA 5FLXY 2CQ3A 5C2CA 1YJRA 4DR5F 2XC9A 1M1HA 2BM0A 3OFEA 1ZTTA 2WBRA 1NDLA 3W9HA 2MZ1A 1OSCA 3RYLA 4LQ9A 3DOLA 4JI8J 4ZPBA 1FK9A 2QYGA 1WEZA 3MTJA 1S4FA 1T02A 4I6AA 3B54A 4P2MA 4WYWA 2WVBA 1RWWB 3CJ5A 3FRYA 1RADB 2MLZA 3V4MA 4NXNJ 3A3PB 4ZCKA 1HHTP 3A3NB 2DNKA 1WNEA 2Z30B 2M5YA 1SH0A 1ITPA 4LFCJ 3QNWB 2RS8A 3DXBA 5J1EA 2X1GA 4LFAF 1M5VC 5ETOA 4A8QA 1FVSA 3FEXB 2WVDA 1TELA 1KC8T 1IKXB 4ATNA 2HRTA 1RI7A 2O1PA 1IWAA 4ECQA 3PXGa 2IJFA 1N52B 3GV5B 5FIIA 4J9OA 2BRKA 1NNDA 2LXUA 4OX9J 1WHYA 2XO6A 5CYMA 4H4KC 2V8VA 1Y7PA 1R6VA 1V6HA 5J2QA 3IWXA 2Y0SD 5A8WB 1YHQS 4JOUA 5AXKA 3MM7B 3GJSB 1GK8A 4BWMA 5HBMB 1IM6A 4RNFA 2UP1A 2FYXA 4AL5A 1QSLA 4WZMA 4B17A 4GO5X 1RT6A 4FF1A 4RNOA 5KT7A 2W4DA 2OEJA 3P6YC 2QMUB 4IG3B 2X1FA 2XSJB 3CCLS 4UT4A 2CJYB 1N88A 3NG8A 4TLQA 4W92B 4KHMA 1R8HA 1UWBA 2GGPA 2RS2A 1W25A 4CLTA 5K14B 4DL5A 1SJ4P 3HSZA 3FEYB 2Q66A 1DQAA 2QT7A 5T7LA 5FDLB 2G0IA 2HQ3A 2PIIA 1MG7A 2BANB 3AFGA 2A10A 1EJ7L 1WTBA 4C8KA 4JI6J 4DMZA 4DFMA 3HVWA 3BGUA 4LF4J 3K57A 1HBNB 4QOTA 4WFNQ 2R4FA 4ZLLA 4DFJA 2ACYA 5GAEI 4DSJA 4LF7F 1CJTB 1VOMA 4DR6F 4TQSA 2N7CA 2BJ7A 2EK1A 5C24A 5AT1B 2FJWA 2JOQA 4CYUA 3DLGA 3R2CJ 3MUTP 1N6QA 3AB4B 2KXHA 2E66A 5L8RC 2Q6CA 3BN7A 3RUBL 1DY3A 2I2YA 4A8YA 1YJNS 2MQPA 2YKMA 2EBEA 3TANA 4KPCA 4Y28C 4P2FA 3RB6A 4WK3A 3GU0A 2G0JA 1UA1A 2LDIA 3IO1A 2FHKA 4FZVA 4DPTA 3DC2A 1K1QA 1BGXT 1RE1B 2VOOA 3THTA 1U1PA 3CJ8A 3CC4S 3O8WA 4LQ3A 2BV3A 1PG5B 1TAUA 2JLFA 4IFVA 2ALYB 4JI1F 2Q1LA 3MMAB 4WZQA 2PSZA 3NGTA 3K17A 1N32F 3TYTA 2UUBF 2IBOA 3Q24A 2BW7A 1U25A 1S6PA 2WAQD 4RW4A 4AXJA 2ALZA 2G2ZA 1SI9A 3KDNA 5HMYA 3QMQA 2ZUGA 1C1BA 1XJWB 4Y34A 3DYAB 5H9EK 4RW8A 1TK5A 5HO4A 1JLGA 4ILMA 1S6QA 1R0AA 2QLFB 1WDTA 2K1RB 4WTOB 2IY5B 2D1CA 1CJUB 1HR0J 3BPDA 3M2RA 3C15A 2V4RA 1BLUA 5F3ZA 3GYXB 1FD2A 2VFUA 4LF8F 5A6WA 2RRNA 1MROA 2HBRB 1HI0P 1S59A 2D7SA 4C3LA 4ZKAA 4DL7A 3MR3A 4ZHRB 2IVFB 1E6YB 2CNLB 4OYAA 4A8MP 2E5JA 3M4XA 1FJGJ 1AA1B 1NCLA 2DNYA 3IAS9 4CQ1A 2WONA 4QWCA 3ELHA 2GIRA 1JLQB 1H72C 3EVMA 3KLFA 2YWEA 1RT5A 4IH7A 4ZVOB 3GIRA 3TEGA 3S1TA 1TL3B 1QAXA 3NWRA 3ZZZA 1VCTA 4OYBA 4KHRA 2VASA 3AX2A 1U1KA 3NXZA 1PSDA 1MU2A 3HZEA 4PKDB 4LF2A 4IUFA 3MEDA 4DF8A 4RNHA 4OL8A 4RW7A 2ABYA 3BYPA 2ZOGA 1TUWA 4J91A 3I9ZA 3NP5A 4FPRA 2NCKL 4DV2F 3E51A 3MEEA 3NNCA 2VBZA 4J9VA 2HPUA 3DOMB 1RABB 1RTHA 1HQEA 3AOCA 1R89A 4NEZA 5B0DA 4JI8F 5CH7B 3KLIB 1X5TA 1FA0A 3GFHA 1HA1A 1Y3JA 3VQSA 4ZVGA 1TL7B 2MKKA 1C4CA 4NXNF 5DDPC 4QPXA 4DS5A 5DG7A 1MNEA 1K8AT 1QTNB 1C0UB 3BJYA 2EG2A 4LFCF 2HVEA 2FIUA 4MK9A 1JLEA 5E3PA 4UY8T 2BKPA 5K8MA 1IBCB 2KFYA 5ETKA 1RKIA 3K8WA 3OXFA 1O5JA 3E2EA 2CQIA 2MXYA 3LH2S 2C2DA 5J2PA 4J9KA 4OX9F 1H7WA 2W4CA 3DRRB 1Y10A 3GQCA 4QW8A 3LPEA 4U95A 3ENVA 4L73A 2VQEJ 4LR9A 3CJ2A 4DV5J 3OJUA 1YSJA 3ZC4A 2LQ9A 4J9SA 1IKWB 2JH3A 3WX8A 2QL7B 3OUYB 1MMNA 1VK3A 4U67Q 1IWGA 5HJYA 2BOAA 5DJBA 4HHUA 1HD0A 4JV5J 3VR1A 3MR6A 2HFVA 4OHYA 3Q89A 5THWA 3FZBA 2MQOA 3HM9A 3CD6S 2YY3A 3R7SB 1YBAA 3C19A 4WFAQ 3SZ2A 3HSGA 4ZS6A 3GSDA 3L7PA 2PEBA 4P6QA 1HLWA 2QLXA 4NE9C 1T05A 4ETZA 1A0OB 1ZM9A 2RB7A 2J9DA 3CJ0A 3FK4A 3TVZA 3HHKA 1WTFA 2NXEA 4HACB 3QRRA 2H51B 2AJ2A 2VG6A 4M95A 3PX6A 1UZHA 3TOQA 3BPSP 2YWHA 4LF4F 4USKA 1SXLA 2HLTA 4KR0B 4KV8B 1SBRA 1J5OB 2CJBA 1XC9A 5CCMA 4FVCA 4DV6J 1NH7A 4N47A 2YWGA 4DR7J 3AJ2A 1M1KT 4DUTA 5HMWA 1NPPA 4RO0A 3P8BB 1JX4A 4BLGA 1JLCA 1HARA 3QGGA 3M9OB 3EZOA 1X9WA 1WG5A 2LCWA 4LBHA 2D9PA 3F41A 7FDRA 2P5VA 2RQKA 5LJ5Y 1UZDA 2V9KA 1B3TA 2J6TA 2BABA 3M8SA 5KFQA 4TKTA 3AODA 2J9EA 2HMIA 1FFWB 3MCMA 4NLVA 2B4UA 3FCWA 2AQ4A 1H6KX 4CLSA 1RT4A 1KTQA 2XB2D 2W2MP 2GJFA 4IFYA 4P9SA 1S9EA 1XR6A 3CO0P 1BD6A 1S57A 3F0NA 1MN9A 1LFPA 4DL6A 5DG9A 1S1UB 3VGVA 3GG1A 4OHZA 1SJ3P 4LRAA 1UTAA 4KY3A 2HS3A 2FY8A 4KIAA 4ZOSA 5KFSA 2OSQA 2UXCJ 3BR8A 2QX0A 5KFWA 3V6DA 5LOQA 5F8JA 2KHCA 1HKAA 2FY1A 5MAOA 2LU1A 2VQFJ 2BVZA 1FXDA 4JV2A 3BB5A 2P9CA 3IG1B 2DGWA 1T7PA 4OYZA 3C6TB 4OLPA 2W2OP 4NLYA 4JUZA 1L5UA 1RCOB 5CHCB 3FZ2A 4NLTA 3TARA 4ZPVR 3C2PA 4OZNA 3UI3A 4GO7X 3V6HA 3V4IA 4KGZB 1JLFA 2BEFA 4RW6B 3CJTA 5E3CA 1VBZA 4AE5A 3T9ZA 4KGVB 3A3OB 1AUDA 2MKJA 3K5LA 1UVMA 3OTEA 2LQ8A 2LA4A 4MIBA 4DPUA 2CNNB 1RISA 4CI0B 2RQMA 4G1IA 1I94J 4AD6A 3DRPA 2YNFA 2MTLA 4MKVA 2DRBA 2A6OA 5CQGA 2I5JB 1X4BA 5A0YA 1TV6B 4MT1A 2EKNA 2CZ4A 3L7UA 1RBAA 4HHHA 1FKPA 2D41A 4ZK7M 1G2EA 3D4JA 2KU7A 4MFBB 2EFVA 2O66A 5G4DA 4C6AA 2LXIA 5DM6Q 4QBUA 3D2WA 3AXKA 1BUXA 5FD1A 4ZJOA 1YJTA 2GQQA 4DX5A 1EKRA 2OPPB 4I1TA 2F3JA 4UW2A 4DEZA 2QL9B 1TL1B 1AUSL 1YK9A 4J5OA 5GAHU 2MHNA 4C8NA 4NYOA 4MKYA 4FYWB 2CQBA 1QE1B 1JLAA 2RNEA 1VISA 3HHDA 1RXOB 1LW0A 3CDUA 2HEKA 3NNAA 1RHQB 2W9CA 1B4SA 3NAHA 3X1LB 3U27A 3J7A1 1YDLA 1TKTB 1CLFA 4RKUC 1S48A 4EO8A 4OI0A 1OYEA 5F0WA 2DEIA 2VPZB 2HHPA 2KZMA 4OLOA 5G0RA 1IM4A 4NLWA 1JNRB 1DTQB 4DLGA 4KO0A 2ZH5A 3GONA 5KFMA 2WW4A 2JX2A 2VICA 1NDCA 2A6MA 2YPYA 5ETMA 5HATA 1RHKB 2XY7A 3R9LA 3QWPA 5C42A 4NI2A 3BGRB 2QFJA 4QR1A 2XGQA 1E6VB 4K2JA 2YNGB 8ATCB 3CCMS 1WSRA 3QO9B 5F9LA 2WSEC 2VQEF 1EETA 4ZPAA 4YB7A 2HQDA 2Y9HA 2KFZA 3KHLA 1QY7A 3CMAS 2MKSA 6FD1A 4KQZA 2FGCA 2BX6A 3O6QA 2MQLA 3GYNA 3ZTQA 3IN5A 8RUCA 4P73A 1NEEA 4JV5F 4OJ1A 3T3FA 2E1MC 4PR6A 1S1XA 3DI6B 1H2UX 5KFUA 4M63A 4X66J 4Y2CA 3MM9A 4OI1A 3MPWA 1U6FA 4MYTA 5K8PA 4LFBF 2DH8A 3KLHB 2J9DE 4F4AA 1HNVA 4ILLA 3IS9B 1RAHB 1EQMA 2LDYA 3M32A 4NWBA 3MMBA 4ZJLA 5KFXA 2GMJA 3QSYB 1UFKA 2OTJS 2YH1A 1RLCL 2YPZA 1IUJA 3UDVA 2AJ1A 2XLIA 4L3KA 3SV4A 1DQ8A 3MI7X 1UFWA 4DS4A 4PZVA 1NDKA 1W26A 5BYRA 1SC1B 1SKWA 1WHXA 2IMOA 2V8GA 4EU0A 1H2TZ 2W9BB 3DMJA 1CJVB 4I7FB 5HJXA 1QVGR 1GH8A 3LP2A 4Q0BB 5L1KA 4OHWA 5KFEA 3D7SB 1DJ0A 4CLWA 3AB2B 2C2KB 3BKUA 1XR7A 3MM6A 2Y8WA 2D3ZA 4I69A 5BXIA 1RTHB 2CQHA 2CPDA 4FBUA 2G0CA 3QPIA 2VFRA 3OTBA 2ASLA 1T9VA 4QIGA 1TK8A 3BSCA 3FVYA 4URGA 3PYFA 1BQMB 1RTDA 3W63A 2VV5A 4JI0F 4I68A 2YWWA 4CH0S 1IN0A 1FNOA 3CJQA 1JJCB 2NPIA 1DFDA 2UXCF 2V9WA 3R2DJ 2G1DA 1UJ5A 3IBFB 5J2MB 2OSRA 2JEGA 2ZZMA 2HHWA 3I0RA 5A8RA 3B82A 4XO0A 2ROPA 4AQYF 2VQFF 4F0MA 1XEZA 1GXLA 1XIQA 3C16B 1YWXA 1TFWA 3P4UB 5BJRA 2WSFC 3H8YA 2DTJA 2UV8A 1K47A 3CCUS 4OZLA 3VTIA 1WC0A 4A8FA 1VHFA 2F65A 1ZZFA 3TUZC 3M2UB 1TAQA 2W1BA 1HIYA 2W24A 1I6JA 3AX3A 1SKRA 3UO0A 2PFDA 1RTJB 2GQ2A 2AGPA 1JKHB 2HIYA 1QD1A 3MCSA 5KG1A 2DO4A 2XMJA 4PQUB 3PHEA 4O0NA 4X4VA 2VBWA 1WEXA 2JLGA 5HI7A 1FCAA 1FF2A 2PA3A 3CCSS 4K4XA 1R7IA 3MAHA 3KJVB 5BYSA 3BDEA 5GAHI 2XGPA 2D3UA 4DBQA 1HHQA 3W62A 1NO8A 1WOOA 2E1RA 2FD2A 2MQQA 2JL9A 2D74B 3H2UB 4Q7AA 4EGLA 1I94F 4URQU 1WOPA 3KNGA 2ZBIA 3WDOA 3MWBA 1XK8A 5EHHA 1C1CB 1TMMA 2RF2B 2H4YB 1N48A 3T6BA 1RUSA 1FRMA 4N5SA 2E7WA 1JXEA 3LWMA 2C2OB 2V0NA 3BH7B 1TL4A 4DSLA 3M8WA 2PT0A 3M30B 3RG6A 2HVZA 1DQ9A 3ISNC 4DCPB 4E0DA 4NYPA 2IVMA 2HNZB 4LIRA 2YNHA 5EN1A 3RRGA 1HWUA 4WXWA 4YY3J 2OELA 2HAFA 2GFFA 2OD6A 2PI5A 3ZTSA 2PI4A 1C0TA 4IG0B 3TJAA 1RHRB 2J0QD 3RBDA 4GVBA 1QDUB 2MZSA 5HSPA 3MPDA 2V1TA 1NH8A 2DIUA 4ZPWR 4B3TJ 2JWNA 1NK8A 2XHCA 2AYGA 5KG3A 3AH6A 4U96A 1JQGA 2M0GB 4PXEA 2FQQB 1S0NA 1G7CB 4IH5A 3QLHB 2ZZTA 4YMEA 4X84A 3EXYA 4WTYA 2UUWA 1KD1T 3FC9A 2JEFA 2FC9A 1OMSA 1PJ7A 1WWHA 3G9CA 3Q2TC 4ENOA 2GVDA 4QCLA 1UMJA 1IXKA 1UVJA 1T0TV 2I38A 4X62J 1XN9A 3DLLQ 3DN9A 3LA0A 2DPJA 3FRZA 2UUAJ 2OMOA 2IRUA 3T5LA 2XY6A 4ZLPA 4J9PA 1LW2A 1N5SA 2CQ0A 2AX1A 1GMWD 2LECA 5H9EJ 4ANEA 2UXDF 2C3YA 2HNDA 4Y2KA 3HSJA 1X8DA 4D3HA 2B43A 3B4MA 4X66F 1RA7A 5C7PA 4H4OA 1T3OA 2SXLA 1CG2A 1XMOF 3M2VA 1SL1A 4C97A 1HFEL 5EGYA 2RJZA 3GR1A 1F5AA 3HVTB 3CC2S 4ICLA 1IR0A 2RKIB 4TY8A 3LUYA 2K8GA 2UVVA 3R5BA 1F5CA 4FP9A 2VJUA 3RAXA 1VS3A 2K3IA 4K4WA 2B56A 2V4JB 2F4FA 4ZVPB 5C5JA 1X4CA 2ZZNA 1GAOA 3I4HX 5ETRA 3OL9A 2MKYA 2JVOA 3J7YU 3OXLA 5GMDA 3J7Z5 4F50A 4DR4F 3T41A 2Y1LB 4G3IA 4ZMMA 2XTEA 1OQ3A 2AYMA 2F40A 2GC8A 4DHVA 4OYXA 1FRHA 4DCOB 1P8GA 2HFZA 3GJQB 5IXUA 4FKXA 4MKAA 2DO0A 1NJWA 2E1CA 3QAUA 2BKNA 1S0VA 5SUHA 3JSRA 3DOKA 1XR5A 3OL6A 1T03B 3PRBA 1GXUA 2JJ4D 4PCQA 1TVRA 1NHUA 2JVRA 2GO8A 3J81j 4BCAA 1VRTB 2MMYA 3UD5A 1X60A 3OJSA 2CDQA 3DKDA 4ECWA 4M5JA 2YX7A 1DURA 4ED0A 3C8YA 4TYBA 4CO0A 3KG0A 2BOPA 3U1MA 5D4PA 4OI2A 1NU4A 3W2VA 4FYYB 1GNKA 4K5RA 3Q8VA 1OYDA 1D3WA 3PEHA 1Q7LB 4F3MA 1RAIB 1N34J 4WU2A 1JJHA 1KVJA 3DRYA 1U1RA 1GMWA 4H4MB 3P49B 3AQOA 4JI5J 2A0FB 1RAOA 4ELVA 2DGSA 4DSKA 4EEYA 1S9GB 3DM2B 4U8YA 7FD1A 2D69A 4A47A 4JYAF 1U8SA 4PPZA 5L1IA 3ZZ0A 3ETMA 5DGBA 1F5BA 4R5PB 5KFKA 2J6UA 1WELA 5F41A 1B99A 1X9SA 1GFWB 4CDIA 1RT7B 2IC3B 2Y8YA 4OIXA 4B9TA 4MYUA 3HKWA 1GEHA 2AJQA 5F8IA 3CE8A 2ZC3A 4Q2MA 3P5BP 4NCBA 2CQ1A 2ROEA 2VFSA 5A6PA 3M8YA 5E5NA 1NHKL 1P9YA 3NGRA 4YR2A 5J2NA 1QLNA 1NPKA 2MYFA 2VG5B 5KG5A 4NLSA 1RBOB 2GJ2A 3KK2B 1LXJA 4P2XA 1QM9A 3WIVA 2E5GA 4YR0A 3JTPA 3UE2A 1RWXB 4ECYA 2ASJA 2IYGA 1HNVB 3W7BA 2OMLA 3ILIA 3W2WB 1NK5A 2KDOA 2DNGA 2ATCB 3ADAC 3HCXA 3H59A 3OR1B 2XYGB 5KT3A 3MMCA 3VAKA 4KGKA 1FDAA 2HHXA 1D8YA 5B0GA 2KO1A 2AGOA 2CPZA 4CO2A 1L3UA 3MEKA 1SV5B 2B6AB 4KGMA 1RWUA 4OX6A 1MWYA 4KKOA 4NLDA 4UQGA 1SQEA 1Q8LA 1WDDA 4RU2A 4DZ6A 1RU1A 3Q8YA 3HMJG 2XS7A 3RBZA 3I56S 4ZP7A 3MECB 1VJQA 3W64A 1X0PA 3EICA 3C14B 3FFIB 2ZJRQ 4LBIA 3AJDA 1U47A 4GKKF 1WKLA 4DUYJ 2XG8A 4KGXB 5IFMA 3H5UA 2HS4A 3PYDA 3K7RA 3QBCA 4LMZA 4ECUA 4QU6A 4KHPJ 2BQ3A 2E1AA 3UR3C 4PQAA 3O1LA 5IWAJ 3IBWA 2AYEA 4ED3A 1WHWA 2DH7A 1SPBP 3W8PA 2Z56B 5KFAA 4IQXA 5EX3A 4AL7A 5DQGA 2KG1A 1FRXA 2XI2A 1Y5NB 1ZETA 4X62F 1RWKB 1MMLA 3JAMU 3EGNA 2UUAF 1VK8A 1OSDA 3C3LA 4F3QA 4E8UA 5A8KA 3VALA 4F04B 1JWWA 2YX1A 2VD3A 1NDPA 1G3OA 3J7YI 4NL5A 5FLXU 2KZZA 2IBKA 1KLMA 1TU0B 4ANDA 2VF3A 3QJLA 3QRPA 3TZZA 2HW3A 2UV8G 5BR8J 4DX7A 1RTIB 1B64A 2ZOMA 1SB6A 3BZQA 4NLUA 3F44A 2FHMA 4CH1A 1PC5A 3HZGA 4TVAB 4UF4A 3U7JA 2H1YA 1Z1ZA 1WC3A 3LAMA 1ZAXA 2VJVA 1V5IB 5HMXA 3BGFA 2YXLA 3C6UB 5GADU 2DHXA 1VMBA 2CQ4A 2HWHA 4O44B 4CNZA 1VC0A 2C42A 1X5PA 2FJEB 1IKXA 4UOHA 5E3QA 2ROGA 3VGTA 3GIJA 5CZVA 3H4BA 4ECRA 5CA5A 3SFGA 4TQRA 2O5DA 3H5YA 1FNMA 1F3FA 2FZCB 5A8WA 5C25B 2QV6A 3MM7A 4NLXA 5HBMA 3E01B 1VQ9S 2FJVA 4ZPCA 5H1SV 4GMKA 4HR2A 4IG3A 2XSJA 5DDQC 2H5JB 2XMUA 2LYVA 2M4MA 1F0XA 4ITSA 5LXYA 1SJQA 4E98A 2RH3A 2XI3A 4J9LA 1S49A 5HP1A 2Y1JA 5K14A 5KT4A 1SVDA 1S79A 3R6GB 3PJXA 2AWZA 5F8GA 1WG1A 5K5MA 5E0OA 4O23A 4PYDA 5L46A 5FDLA 1Y5IB 1ZA2B 2GQCA 4CLZA 1N34F 2BANA 2I9SA 4UUXA 4ZN1A 4DR2J 2VZ9A 2GS8A 3I5AA 1HBMB 4M1KA 3TX8A 1VQ5S 2HSEB 1HMVB 1BMQB 4OZ2A 1HBNA 2BW2A 2QMWA 2DRAA 1LEOA 1CJTA 1VRUB 3PO5A 2MPUA 1Q8KA 4NASA 4K4SA 2GMHA 3FUYA 2RUSA 1APSA 1B0VA 4GVLA 3HT3A 5DETA 2XNRA 1X5OA 3CCZA 4IRCA 1UVKA 4X64J 5L1JA 4V1Ak 2PO4A 2GHWA 2MJUA 3VAHA 1TP7A 2V2ZA 4O3OA 4ED2A 3JSMB 2IDLA 2DY9A 3NS5A 3EWGA 5CZXA 3MM5B 3MMJA 2F8HA 4QU7A 1QSYA 3NRBA 1FWKA 1Q7YT 4EBDA 1XTZA 3MFIA 4M5HA 5I42B 3FBEA 2DHGA 1MLAA 3DRXA 1L3KA 5D3GB 1S9FA 4X4SA 3MCOA 1XNRF 4ALZA 2UUTA 1HHSA 2J8AA 4Y00A 4F7VA 3DU6A 3W5XA 1YRXA 2MDAA 2QA1A 4PG6A 2M52A 2HG4A 2XS2A 1VQPS 2F7VA 3KDOA 1B7FA 1ZPVA 2BA9A 3I6PA 1IVZA 3TAQA 2OP5A 1KKHA 2DNNA 3CJ3A 3PV8A 5DDOC 3MMAA 4X2BA 2IVYA 1TMJA 5JJBA 2FHJD 3ET6B 3TAPA 1ZYQA 3VWSA 2DITA 2W4PA 4GC7A 2YQ0A 4C4WA 2H5EA 2WHOA 2NYIA 3WZ0A 5F3TA 1SKUB 1XWLA 2DNQA 4JI2J 5EX0A 4LF5F 2WB4A 4XTTA 2DNLA 1DZ5A 1K0TA 1WI8A 3AA9A 3PACA 3DYAA 3KLGB 5HQMA 1PC4A 3T1YJ 3I0SB 3BM7A 1U6BA 1M90T 2RE1A 2K1RA 1VLOA 5IC6B 1CJUA 3CJKB 3MPVA 4DV7F 3A8EA 3H90A 2EFOA 4KC5A 1NJXA 1KLNA 1U49A 2C2NA 2XTJP 3LWLA 4EBCA 3MD3A 4ES1A 4DUYF 1RWNB 4QWDA 1DLOB 2FVCA 4KRWA 1BQNB 4ZHRA 3UN5A 3WX4A 4KHPF 3DLJA 1IKVB 1E6YA 1SCJB 2DISA 2OI2A 4EFAC 3VHQA 2NZ4A 3PFOA 1AYEA 1S1TB 2V67A 3HDSA 3HULA 2F4VJ 1UUJA 5IT4A 3BBBA 3NOGA 2BJEA 2AIRB 2KH9A 1HW8A 1JLQA 3ZFVA 5L9NA 3SQOP 1NB7A 1HYSB 3UW1A 1TL3A 2W8LA 3MXHP 4K59A 5E41A 2CKWA 5GADI 3N4WA 1V9OA 3CSKA 3T9NA 4DPWA 1MWQA 5JXSA 4K5SA 3GJTB 1CULB 1LK5A 1Q5YA 4HT7A 5CYQA 1FDNA 1RACB 2DNMA 4HH0A 3V6KA 1N5QA 1EQ0A 1N5YB 2OUGA 3NOCA 4ZJQA 2ZHAA 1ZH5A 1URNA 2AEFA 3O5TB 1U4BA 4CM2A 1S12A 3TAMB 5KFRA 4C2MA 4ZCIA 4ECVA 4CZCA 3DOMA 5BR8F 1ZBTA 3A13A 1HPZB 3T6JA 4K7QA 4HTJA 1FRJA 5D15A 5DQIA 2DNOA 5IV4A 4K50A 3KLIA 2DNPA 2DK2A 1J27A 1UVLA 3OQ2A 1RQ0A 2FHJA 1TL7A 5HVGA 3K8VA 2VBYA 1XQIA 4QIFA 3D67A 3AD7C 1RJJA 1C0UA 1KTVA 2RUGA 2FLNA 4PUOB 2CWXA 4HT5A 2YH0A 3V81B 1GMUA 3AD9C 4YR3A 2UVWA 3PKMA 2AJFE 3EYZA 4DV1J 2RRAA 1NSAA 5AXNA 1F9HA 3NS6A 1PJ6A 4OYWA 2X1AA 2GNKA 1P1TA 2IJNA 4BC7A 1R8AA 3DRRA 5KFIA 2CJAA 4B3SF 2JFKA 2IRYA 4LVOP 3D5MA 1OIAA 4ZITA 2ZH2A 3TUJC 3RB0A 2UXBF 1IKWA 2CPEA 2DXDA 3H25A 3OV7A 1UL3A 4P71A 3OUYA 3WIUA 2OFGX 2BJ9A 4DR3F 1KQKA 1JMTA 4FF4A 1NJIT 2H9ZA 3GB0A 3LAKA 1AZSB 4EBEA 4NXMF 5KFLA 1NK7A 4YEAA 2HLUA 2CDRB 5KFOA 4YOEA 2XTCA 4WXOA 1D0EA 1Q82T 4Q8EA 3LP0A 3I31A 4G6VB 3UDCA 4FS2A 3ZO7A 1PYOB 1YKWA 4H4KA 2WK4A 3SCKE 4ELUA 1VLYA 2PEHA 1NSPA 4DXLA 5D4LA 4P2SA 1RCXB 4R8UB 2MQ8A 4M5KA 1P27B 1WD6A 2XZ2A 2LU2A 3ITHB 2EFGA 3CC7S 1FERA 2XCPA 4HACA 1UETA 4QZVB 3JS9A 4LF6J 1ROFA 4DR2F 5A2QU 2V8PA 1YRTA 3G8TA 2VPWB 1S0OA 4KV8A 1FRLA 1J5OA 3O44A 5HQ8A 4Q44A 2KVQE 2CA9A 1EB0A 3T1HJ 3SMZA 3PYEA 3LTOA 3DXSX 4ZLNA 2E1PA 3TUPA 1ZZNA 4PXBA 2FB0A 2M8HA 1BE4A 1R0CB 4MKBA 1RTZA 2NSCA 2BRLA 3KMQA 2W2PP 2GVZB 4R0JA 4KSEB 4WFZA 2MKCA 2C3OA 2PD1A 4DX8H 4JP8A 3SSRA 1GTHA 4B3MJ 3DLKB 4J90A 3LW5C 2AZ3A 3GCWP 3LALA 3LPYA 2CUYA 1KWMA 3EJMA 3MCNA 2MSTA 3R27A 1N4LA 2HQGA 2E5LJ 4Q8FA 4ECZA 4YP3A 3MOZA 1RAJA 1S1UA 1U2CA 2YBVA 2R7UA 1WHVA 3KUHA 1ZA1B 3VZIA 1PBUA 3P5TL 1Q4RA 2RQCA 2HZCA 4JI3J 1UW4A 3OSNA 2C2MB 3RB4A 3IMQJ 3RAQA 4OYPA 2JC1A 3G71S 2HRYA 3GSIA 2RU3A 2H65B 2R7SA 2J7WA 2ZFHA 3R1HA 3HT0A 4JI2F 3IG1A 3RW7A 1U7LA 4WE1B 3C6TA 2A1BA 2IM1A 2JFDA 1NKCA 1VYAA 1SH2A 2N3LA 2BE2B 2J0SD 1DTTB 5E33A 3HHNB 2VKZG 4CO1A 5KTQA 1DAXA 3BREA 1FJCA 1N56A 1N33J 4OI6A 3S7RA 4RW6A 1T9TA 1HNXF 2ZH8A 1SQGA 1NSQA 3R5AA 1Y11A 1G6BA 3H2VE 1I1GA 1AXQA 3VQTA 4Z7YA 4B9MA 1YG0A 4K4VA 1JLBB 3DDNA 1WC5A 5HP1B 1Q16B 2JDJA 1NJYA 5KT2A 3M7VA 3ENQA 4HH1A 5HROB 4IO1A 2VIHA 4ANCA 2I5JA 1TV6A 5EWFA 2HNYB 3VZHA 5T14A 1FVQA 4B9VA 3NGKA 4MFBA 2Z58B 1HD1A 3Q86A 4NPOA 1HQUB 1ELOA 2DR6A 3BS9A 4CT9A 3CDBA 1FT8A 5D78A 3HD2A 2CG8A 2HGNA 2AP6A 2UVUA 2OPPA 4QIEA 2RU9A 1JXVA 3GP9A 1UVNA 1TL1A 2IAJB 3UD3P 1S0MA 2ZWPA 1BWVA 4OJGA 4RW9B 4ED1A 1FRIA 2HYIB 2BACA 1BC6A 1QE1A 1IBMF 2DHSA 3BGOP 3EGWB 3ZZRA 2BDPA 4LR7A 4F02A 3TZWA 1WJ9A 4B9UA 4BWJA 2DHAA 2GMLA 3SCIE 4WFXA 4I2QB 2PE8A 4ED7A 4AL6A 1SIWB 1HBUB 3D66A 3QIPB 2GO9A 2Z4PA 1TKTA 2CNKB 2KFNA 3W9IA 3K89A 2VG7B 2MZJA 4I2PB 2J5AA 1QVFR 4RWXA 2KRRA 1SL2A 1DTQA 3QAEA 4RX6A 2VFTA 2ZH6A 4IRDA 2DGVA 5GMKa 1CS4B 4PRFA 3ZNJ1 1WF0A 3KTQA 3FDSA 2X1BA 5IS2A 4DV1F 4NMXA 1P9QC 4QYZJ 4B3OB 3BGRA 4I56A 1RGVA 3J80U 4LF9J 1E6VA 3H98A 2YNGA 1IJEB 3HXMA 1XERA 2V2VA 1XMBA 3QO9A 4CO5A 1LKZA 2Z2ZA 5ITHA 1LK7A 4ZIVA 3VGSA 4YUDA 4DPXA 4C9DA 4FYDA 2HVHA 2OEMA 5GVQA 1F9EB 2XCAA 4XDDA 1PIEA 3H7HB 2RVJA 1UAWA 1Y5LB 3SBMA 4NLRA 3GIIA 2QIFA 3LOUA 2CG4A 3DI6A 4I4BA 5HAOA 5KOWA 2CPHA 4K0KF 2KM8C 3EX7B 1YBUA 3M6VA 1WACA 4YB6A 1IBLJ 3M8ZA 4BC9A 1FKOB 3KLHA 3CJRA 5KFZA 1U45A 4YHHF 5IT9Y 2FZKB 4G1PA 3W1YC 2ZH7A 4MK8A 4P75A 1QAYA 5AE1A 3IS9A 5B0AA 2J6SA 1RYSA 4A8WA 3F73A 4MH8A 3SXLA 3K5NA 3TJ9A 5ETNA 3EPIA 2RHSB 5J1NA 2R8JA 4LF6F 3PVXA 1T94A 4C0BA 1UWAA 2X3DA 1SJ1A 1Z4UA 4MIAA 3FSXA 3B78A 4LT6A 2OFHX 2GCFA 3PM9A 4HDHA 2QGFB 4F4XA 3Q23A 3T1HF 3FCHA 2MJNA 3ULHA 1JJ2R 1U8WA 1UA0A 5CXTA 2NREA 3PZPA 2W01A 4ZA1A 4ER8A 5M2PA 1IJFB 2AEJA 1PCAA 5EDWA 1PYTA 2W9BA 1CQMA 3OTOJ 1CJVA 4I7FA 3OFGA 5CYQB 3G96A 3HJVA 4Q0BA 3HKZD 2K7KA 4DV3J 2YWFA 3EVWA 3R97A 4NEYA 4USVA 3PFEA 4Q5VA 1F2GA 1TQLA 4YS2A 2HKEA 4KFBB 4YDDB 1RHMB 3AXMA 4B3MF 3G8QA 3AT1B 1T11A 2NPFA 4EMDA 1WF2A 3MM8B 3DGVA 1RWPB 4WJBA 4PPDA 1Q78A 2ZD1B 4ZVSB 4B9LA 1SC3B 4I0WA 1UJ6A 2R7RA 1K1SA 3CF5Q 2OLWA 1RYRA 3D6TB 2LQJA 2DXFA 3ZNUA 2B5JB 2QL5B 1FFGB 1BQMA 1VQ4S 3MGJA 1EKSA 3TWZA 3D1HA 4UY85 2JEIA 2B4VA 4J9QA 2DEJA 4TU8A 3NMRA 2LEAA 5J2MA 3H2LA 3G86A 2ZC4A 3MR2A 1PJ5A 1S1WB 1HW9A 2C2ZB 2NSBA 2VL1A 3NKYA 3CIZA 2YKAA 3C16A 4DN9A 3PIPQ 2RT3A 2L9WA 2UU9J 1FESA 2FVPA 2QFIA 5B0CA 2XWXA 3M2UA 3ISZA 4QR2A 2OO4A 2A2DA 4LSLB 3LP1B 2MHEA 1S99A 1N33F 1RTJA 1YJ9S 2A2CA 3BN4A 1JKHA 3NBPB 1GTEA 3ZZUA 5T41A 4EUVA 4J9NA 1WORA 4RUBA 4PQUA 4ERDA 1VBYA 3MUVP 3SDEB 4NOHA 2G1HA 2HHSA 1U1LA 3IR7B 2JRSA 2MKHA 4PWDB 2CQGA 3KJVA 4NZ7A 4ED6A 3MF5A 4QJVA 3LP0B 4DL2A 2B3TB 3KWMA 1URRA 4NMLA 1C1CA 2F63A 2AV5A 2RF2A 1VQ8S 1U2RA 4Q43A 2V8HA 3GCXP 3GLJA 3OHAA 2DH9A 3KMSA 1SUQB 4JB8B 2O3DA 1NMEB 3M30A 2XWYA 3MEGB 4O4GB 3RAMA 3BH6B 4JI6F 3CNQP 2HNZA 2C2EA 1PAUB 3NS7B 4HI1A 4LFAJ 4KPYA 4ED4A 2KHDA 1CQNA 2XMTA 5U47A 4FXDA 1HL6A 3TQEA 1X4DA 4IG0A 3RR7A 4DFPA 1B0TA 2DXEA 2EXUA 1Q81T 2MY8A 4DR1J 2HFUA 2CQCA 3GE9A 4F67A 4BBYA 3HPOA 2FC8A 4BDPA 2MSSA 5DLFA 9ATCB 3PW5A 4RWWA 3A8KA 2VKRA 1T8EA 1TR0A 5I3QA 1K9MT 4WKRA 2F5GA 4B02A 2IA0A 1YX2A 4IH6A 1L3TA 3Q22A 2XEXA 3BO3A 2NS1B 4FNHA 2XYPB 4KT0C 2GZOA 3EZ5A 2ZE2B 4X4NA 1LWEB 3QLHA 3OLBA 1N36J 3M8RA 4F0HA 3CW2C 2XSFA 2Y1RI 3OL7A 4F8RA 4O4RA 4B3RJ 1S6UA 3HFKA 1REVB 1NK6A 4CTAB 2YWKA 3TO8A 2BJDA 3GJRB 4F26A 1LWCB 2LLZA 2W7PA 2QRRA 3UCZP 1B7YB 4FNIA 4NCGB 4CIOA 4J9RA 3QZ7A 4D3GA 3P45B 2EKYA 3O2IA 4TN2A 3FSYA 4C98A 2K7JA 4A8OA 4AXIA 1HNIB 3RRKA 3PX4A 4USJC 1EHWA 5D0HA 3G87A 5K8OA 4XPEA 2H5IB 3D3CJ 1WOSA 1TFYA 4LSZB 4IR9A 1HR0F 4U8VA 5B09A 2VDHA 1U6ZA 1I3OB 3HHLC 1U0HB 2CJQA 2I8EA 1OQ6A 1FDDA 3AQPA 5D4NA 3W5YA 2Z8QA 3UQSA 2Y3YA 3HVTA 2A3JA 2RKIA 3DGPB 1D9FA 1HWIA 2QG9B 1IR1A 1TUGB 2V4JA 1FJGF 5E3RA 1L3VA 2DKOB 3H40A 2BBEA 1PO6A 4QYRA 4FVMA 5HL7Q 2KM8B 4DL3A 2D3O1 5AXLA 3CJSA 1G1XA 2G13A 3EGZA 4LSNB 1EIYB 1T9WA 3DRSB 5F8NA 1N32J 3VGUA 3M9MB 4ZVTB 3KLEB 2UUBJ 1D9AA 3NAIA 2HWTA 2M2BA 3MR7A 3IM8A 1OY9A 1GQEA 1T03A 2G2OA 2KN4A 3Q8UA 1M5OC 2R7OA 3KJNB 3LGHA 3AHPA 5L1LA 2N4DA 4OZ1A 2EVZA 4A8SA 4DX6A 1RT1B 1VRTA 1H0HB 5IV3A 4UUWA 9RUBA 4K4UA 1FEHA 4JI7J 4PG8A 5I3PA 4O3RA 1SJRA 4LF1A 2ZBQA 2YTCA 2N7YA 2WCXA 5D77A 4F0KA 2Q3PA 4LF8J 4LREA 4X65J 2AEMA 2EK6A 4Y2AA 3KNAA 3PRDA 1ZOTA 4GC6A 2OPSB 3UWTA 4HTIA 3QT8A 3ISND 4H4MA 3RGIA 2BYCA 2IJRA 3K58A 3U02A 1S9GA 3DM2A 3ENAA 4M5MA 2FTRA 3M8QB 1VQNS 1FKAF 3HO1A 3VF0B 3I5CA 4N77A 4R5PA 4FPIA 3PIOQ 1SH3A 1D1UA 4DV5F 3U1LA 5AJ3J 1QAIA 1KQGB 3ONQA 3TJ8A 1J5EJ 1B0PA 3Q8PB 3IRXB 1RT7A 2IC3A 2CJ9A 4JI4J 2XMKA 3JAMY 5F9NA 2VC0A 3RR8A 4ZP9A 1ZS6A 1D09B 2BQUA 4FN5A 2KJWA 1WC4A 1G4CA 3POTB 1VR6A 3BO2A 3PHTA 2H48B 3FMWA 3G82B 4Y3CA 3P96A 3KK1B 1Z2LA 4USIA 2L9NA 2VG5A 3GMGA 4UTGA 2LQ5A 3CIMA 2AF6A 3TW0A 3KK2A 1S77D 1SC4B 2WOMB 3DCAA 4USUA 3W2WA 1YZ6A 4U6PA 3N9UC 1KSPA 4CT8A 2BQRA 1NHVA 2IFXA 3OR1A 1TL5A 1B70B 4RJVA 2YKNB 1WC1A 3KJQB 4RUCA 4KB7A 3K5OA 2C1EB 1SL0A 1FWPA 3P3DA 4DV4J 2D68A 4HKQA 1WKJA 1SV5A 1OY8A 4DQQA 2B6AA 3MTKA 2R8IA 4DV6F 2R7VA 5D6GA 3PW4A 4DR7F 1VGYA 2XTDA 2HQFA 4O3QA 4WIIA 2DBBA 3CMQA 2L48A 2B4PA 4DR1F 2RQ4A 4M5DB 2UZAA 2LXFA 4NX9A 3KHHA 4N8OA 3M1VB 3BQ0A 3MECA 3WHIA 1ICEB 3C14A 3FFIA 3GPAA 2CQPA 1VQMS 3TZYA 3FMBA 5A76A 2FUG9 1DRZA 4C7QA 3CCRS 4FXVA 2DR5A 1U24A 3DHWC 3H5XA 5F8MA 4IO9Q 4CLFA 1EP4B 3B4DA 2ZITA 4IDKB 4ED5A 2HQIA
chains in the Genus database with same CATH topology
1OPZA 3RB3A 1NH7A 4N47A 2YWGA 1RT3B 2Z2LA 4X2BA 2IVYA 1VIOA 3Q8RB 1VQOS 2AW0A 5JJBA 2R8HA 3AJ2A 2FHJD 4NA2A 3TAPA 1ZYQA 1N36F 1M1KT 4NRUA 1O8BA 3VWSA 4DQIA 2DITA 5HMWA 2W4PA 4A4JA 1S1XB 4GC7A 3DGPA 1BWEA 1UVIA 1U48A 4X4OA 5LXRA 3GIMA 4C4WA 4RNNA 2H5EA 2WHOA 1JX4A 2NYIA 3WZ0A 1UJ4A 1JLCA 5KG7A 5F3TA 2LKZA 1HARA 3LANA 1XWLA 2DNQA 5EX0A 2B51A 1NRKA 3QGGA 3HI9A 3MM9B 3M9OB 1X9WA 2M88A 2WB4A 4LF5F 4N76A 1WG5A 4N41A 3QIDA 2LCWA 2DNLA 1DZ5A 5M2RA 2D9PA 1K0TA 3F41A 7FDRA 2CJKA 1WI8A 2P5VA 4PG7A 3AA9A 3PACA 2RQKA 3DYAA 1FXRA 2U1AA 4ZCLA 3HJFA 3KLGB 5LJ5Y 2F4VF 2ERRA 5HLFB 3DLHA 2V9KA 3VAMA 1PC4A 2J6TA 2BABA 3I0SB 5CYJA 3M8SA 4C8LA 4K4ZA 3BM7A 3I5BA 5KFQA 1IKYB 1U6BA 4TKTA 3DDKA 1M90T 2J9EA 2HMIA 2YKOA 2RE1A 2K1RA 1D8ZA 4NLVA 1CSJA 2B4UA 2AQ4A 1H6KX 3NCPA 3M32B 3MD1A 3CJKB 3PR4A 1M5HA 3MPVA 1RT4A 1CC8A 2WB1D 4DV7F 1KTQA 2CPJA 2XB2D 5DO2A 3A8EA 3MMBB 2J7KA 3IC1A 4LSNA 2X3GA 4IFYA 1VJWA 1S9EA 1XR6A 2EFOA 5KFJA 1BD6A 5KG2A 4KC5A 1NJXA 1LFPA 1KLNA 2ATLA 3DRSA 1U49A 4DL6A 1NJZA 1LOUA 2HGLA 4F25A 4K4TA 4FXWA 3UPFA 4O3PA 3LWLA 2ZJPQ 4FS1A 5DG9A 4EBCA 3MD3A 1S1UB 4ES1A 2KI2A 3N0VA 3KLEA 4DUYF 3GG1A 4OHZA 1SJ3P 3Q0AA 4QWDA 1DLOB 2R2SA 3CGIA 2FVCA 2HS3A 2OPRB 1V3ZA 4KRWA 4KIAA 1BQNB 4ZOSA 1RTIA 5KFSA 4ZHRA 2OSQA 3WX4A 4KHPF 4G1QB 3DLJA 1LXNA 3SSSA 1IKVB 1E6YA 2DISA 2YX4A 4EFAC 1R43A 1SIZA 1S10A 1Q79A 4DG1B 3BR8A 4N56A 2NZ4A 3PFOA 1RT2B 1WEYA 1S1TB 5KFWA 5H9FJ 4RNMA 5D8HB 1KHWA 3V6DA 3HDSA 5F8JA 2KHCA 2RILA 3QJPA 1RT1A 2FY1A 1UUJA 5MAOA 2LU1A 5IT4A 2BVZA 4DQRA 4HLBA 2GW8A 4NZ0A 1FXDA 2BJEA 2KH9A 4JV2A 2GHVC 3C6UA 3DMJB 3BB5A 4C3MA 3I96A 2P9CA 1HW8A 1JLQA 3ZFVA 5L9NA 3IG1B 2MKIA 5KFTA 1AW0A 2E44A 2DGWA 2DGTA 1X7VA 3LP2B 1NB7A 1T7PA 3CCTA 3C6TB 4O44A 1HYSB 2PA8D 4OLPA 3UW1A 3N6LA 2ZHOA 1TL3A 1M5PC 2V2KA 4NLYA 2DGOA 3HVAA 4BHQA 3VAJA 2W8LA 4JUZA