3OL7A

Poliovirus polymerase elongation complex with ctp
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
461
structure length
461
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMCLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGCDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYCVKGGMPSGCSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYRRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords Polymerase
publication title Structural basis for active site closure by the poliovirus RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 143
structure length 461
sequence length 461
chains with identical sequence E, I, M
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 3ol7A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ol7A02
1T94A 1HNIA 3C6TA 3KK3A 4O3OA 5C25B 1TVRA 3G6VA 4JV1A 3OL7A 3H5SA 1T3NA 4Q0BA 2F8EX 2JLEA 2YNHB 1JLBB 4KO0B 3G6YA 2ASDA 3RAQA 4ECWA 3G6XA 3KK1A 1EETB 1LWCB 3CJ0A 2RKIB 4K4WA 2FVSA 2R8KA 3GIMA 2B43A 1C1BA 4ED3A 2J6SA 3BREA 2J6TA 2GIQA 2AWZA 4KV8A 2HNDA 4KE5A 3I5CA 2R8IA 4TQSA 5L1IA 4RW8A 4YR3A 4ED1A 1RTIB 2W8LA 3TQ1A 2ZE2A 4O3SA 1I6JA 5KFGA 2BR0A 1WNEA 3OL9A 2V4RA 4LSNB 4ICLA 1HARA 5EWEA 3V4IB 5HROA 2C2EA 1RT3B 5KFLA 5KFDA 3LP1A 3T1AA 4I2QA 1HQUA 2WHOA 1T05B 4O3PA 5KFBA 2OPPA 1SUQB 5KFOA 4RW9A 3CJ4A 1HYSA 3MFIA 3KLFB 1TQLA 4K4TA 4EBCA 4Y2CA 3JYTB 2CJQA 1N6QB 2IA6A 4ZP8A 3DLKB 1C2PA 1ZTWA 3KMQA 2ATLA 3M8PB 2IMWP 2WONA 2BE2A 3DRPA 4WFZA 5HBMB 4Y3CA 3DLEB 3M8QB 4IG3B 1S9GB 3MEGB 4TY8B 4IR1A 4DL4A 1RT1B 3PJXA 4IFYA 1QE1B 3QLHA 1RT6A 1HPZB 1S9EB 4QW8A 1LWEB 3GV5B 3MR5A 4Y2AA 1C0TB 4IH5A 2JEIA 3ICLA 5EWFA 3ITHA 3KLEB 5J2PA 4HKQA 1LW2A 3IGNA 1TL3B 3T19A 4LSLB 2ILYA 2VG7B 3DOKA 3NAHA 2V0NA 3MECB 5KFQA 4IH6A 4WE1A 4ZPAA 5J1EA 3KLGB 3V6JA 1FK9A 3DOLB 3KMSA 4IQXA 1VRTA 2YNIA 3C6TB 3I5AA 1MU2A 3PJWA 4ZMMA 2HMIB 5DG9A 1JLFA 2C2DA 1RTJB 3NBPA 4J9OA 4XPCA 3OL6A 1RAJA 1TL1A 5KFIA 3KK1B 1EP4A 2CKWA 3T5KA 3KLIB 3TAMA 3BR9A 3KHLA 3V81A 1S0NA 1JLEA 4GC6A 4LQ3A 4ZP9A 1C1BB 2J6UA 4ZVHA 3E51A 5F8IA 5DGAA 2B5JA 4QW9A 3UQSA 2C22A 2FVQA 1FKPA 2WRMA 2E9RX 4RW8B 4O4GA 3N6NA 2ZE2B 4Q43A 4PWDB 3LP2A 2XCAA 3QIPA 4ICLB 2AGPA 1Z4UA 2C28A 4RW6A 3RBDA 5CYQA 5KT3A 3LP1B 3GQCA 4I2QB 5F8GA 4WXOA 1JLGB 1K1QA 3BSAA 3KK2A 2XWYA 1S6QA 3FFIB 1OS5A 4RW9B 2BRKA 4ZPCA 3NL0A 1C1CA 3E01B 3ISNC 3I5BA 4RZRA 3M9OB 5L1JA 1HYSB 4IKAA 1LWFB 5DQIA 1SH3A 5C5JA 3BSOA 1R0AA 2YNFA 4ED2A 1CSJA 2WONB 4K50A 3VQSA 2BE2B 2AGOA 4PUOA 3DRPB 5KG3A 4X2BA 2IC3A 4EO6A 4YQWA 4QWAA 2IM3A 1JLQB 3HKWA 4MK9A 4FS2A 2BANA 3RAXA 4IFYB 3PR5B 3QLHB 3JSMA 4IFVA 3DMJA 1RT4B 5T14A 2ZKUA 3H59A 3ITHB 5J2PB 2ALZA 4EYIB 4ZHRA 1IM4A 3UR0A 1REVA 1RTHA 3DOKB 4KB7A 1N5YA 4NCGA 2IBKA 2OPQB 4WZQA 5KFWA 1U09A 2JC1A 5J1EB 4NLOA 4J9KA 1IKVA 1VRTB 1TP7A 2YNIB 1TKXA 4I7FA 3OHBA 3DDKA 1IKWB 2O5DA 3CJ3A 3GIJA 1MU2B 1RT7A 1TKZA 3GV7B 2UVRA 4XPEA 1QUVA 3NBPB 4J9QA 4FS1A 3QGGA 5DGBA 4ZVGA 5KFMA 3BQ2A 1EP4B 4M94A 2R8GA 4O3RA 1HQEB 3Q8PB 4ZPDA 1BQNA 5CYMB 3H5XA 1JLEB 5EUHA 4FBTA 3JSMB 1S1XA 4IOBA 1NNDA 4TLRA 1S97A 3DLGB 5KFCA 1S6PB 3RBEA 3LAKA 4Q8EA 1S1VA 2B5JB 3V6DA 4URSA 1JLAB 1HMVA 4DL7A 2FVRA 1JX4A 1NHUA 1XR6A 5F9NA 3BQ0A 2R2RA 4O4GB 4F4XA 5DG8A 4K4SA 3CDWA 3MR6A 1TV6B 3LP2B 3EPIA 5C24B 2IJNA 3FDSA 4RW6B 4Q45A 5HLFA 1RYRA 3QO9B 2R2TA 2D3ZA 1C0UA 2YKMB 1DTTA 5J2NB 5I3UA 2FLNA 4R0EA 4ECYA 1C1CB 3LAMA 1S9FA 4H4OA 4RU9A 3Q8RB 3KHHA 3PHEA 5L1KA 2ASJA 1SV5B 3DYAB 2HAIA 3BGRA 4RNMA 5KFSA 1HNVA 4Y34A 1R0AB 4RUAA 2R2SA 3OLBA 2D41A 2JEJA 5K14A 4PUOB 2IAJB 2YNGA 3IN5A 4MK8A 3DM2B 3RB6A 5KG6A 3LP0A 2B6AA 4B3OA 2VG5B 3QGHA 2RDJA 3H4DA 2WK4A 1MMLA 4J9MA 4WZMA 1JKHA 3DMJB 3IS9A 4IDKA 3PW0A 4IRDA 1UWBA 4ECQA 4IG0A 5KFNA 2QE5A 3CJ2A 4ZHRB 1REVB 1RTHB 3IGVA 4O3NA 4QWDA 1N5YB 4NCGB 4IR9A 4RUCA 5D3GA 4TYBA 4KAIA 1HNIB 3H5YA 3KK3B 2ASLA 2DPJA 4DL3A 4URQU 1TVRB 2AQ4A 4I7FB 1TKXB 4Q0BB 4MFBA 4QWCA 3KJVA 5DLGA 4G1QA 3T5LA 3CWJA 3DRSA 4NZ0A 2VG6A 5KT5A 2FLPA 1RT2A 2UUWA 4EEYA 3I0RA 3G86A 4TXSA 2AU0A 4NLVA 5KG2A 4J9LA 2YKNA 2W9BA 3OHAA 2XGPA 4IRKA 1S1XB 3GIIA 4ED7A 1K1SA 4I2PA 4KV8B 5C25A 2HNDB 1BQMA 5KFRA 3DRRA 2WOMA 1S1VB 1S10A 4NLSA 3MF5A 2VA2A 1JLBA 3V6DB 2E9ZA 1HMVB 5KFJA 1N48A 3N6LA 4NLQA 3C6UA 3BJYA 3PW2A 1LWCA 3KOAA 5HROB 2RKIA 4EO8A 5JXSA 4YR0A 3GILA 3CJ5A 2W8KA 3V6HA 3PW7A 1JXLA 3Q8SB 2OH2A 1HQUB 1RT5A 4Q44A 2OPPB 4ID5A 2JEGA 5KFKA 3M9MB 2UUTA 3CVKA 5KFEA 4RNOA 5HLFB 1DTTB 5KG7A 4DL2A 3PZPA 5KFUA 1DTQA 2XGQA 4K4UA 4H4OB 3T5HA 4U6PA 4KFBA 4LSNA 3BGRB 2W9CA 4IH7A 2R2UA 3T5JA 3DI6A 4J9SA 3IG1A 1S1UA 4J9PA 5HP1A 1S49A 2HWIA 3M9NB 5K14B 4NLWA 1W25A 3UDLA 2YNGB 2XC9A 4ECUA 3CO9A 2BQUA 3LP0B 1FKOA 4B3OB 1RT6B 1S1WA 2WB4A 3LANA 4KKOA 3KLFA 3KLHA 3BQ1A 5JUMA 3JYTA 1N6QA 1LW2B 4Q8FA 1SH0A 1JKHB 3IS9B 4IDKB 4XO0A 1JLCA 2FVPA 1UWBB 1IKYA 3D5MA 3OLAA 4IG0B 4YP3A 3MR2A 4WE1B 1D1UA 3DLEA 1S0MA 3M8QA 4IG3A 1FK9B 4R8UA 4RNNA 3FQKA 3MEGA 4ZP7A 4TY8A 5D3GB 2HNZA 3I0SA 3BSNA 5KG5A 3OSNA 3CIZA 4NLXA 3HVAA 4R5PA 1JIHA 4NLPA 1HPZA 4K4XA 1JLFB 4MFBB 2HNYA 4LQ9A 2BRLA 4TY9A 4G1QB 3KJVB 5J2MA 2AGQA 3DRSB 2I5JA 4ECVA 1TL1B 1TL3A 3IRXA 4LSLA 4ZVFA 2V4QA 1LW0A 4F4WA 4ECSA 3TAMB 4ECZA 3V81B 1N4LA 1RTDA 3KLGA 2RF2A 1S4FA 3NMAA 3DOLA 2DPIA 2V9WA 2W9BB 3PW5A 3KLVA 4PQUA 2R8HA 4TQRA 2BQRA 5EDWA 4I2PB 5KFZA 1FKPB 4K4ZA 1BQMB 2HMIA 3DRRB 2WOMB 5F8JA 1RTJA 5C42A 4EYHB 1NHVA 4RNHA 2AX0A 4O44A 3C6UB 2FVCA 2W9AA 1DLOA 1KHVA 3KLIA 3QIPB 4ECTA 3QZ7A 5CYQB 5KG0A 1RT5B 4DL6A 4WXWA 3KK2B 4MIBA 5KFFA 4FBUA 4ID5B 1IKXA 4H4MA 1XR7A 1S6QB 3MTKA 2IM1A 4K4VA 5EWGA 2RDIA 3LALA 4RW4A 3BSCA 5I42A 1RA7A 2OPRA 5DQGA 3NKYA 4F4ZA 1GX6A 1DTQB 4EBEA 1J5OA 4PWDA 2XI3A 2YNFB 4KFBB 2W9CB 5F8LA 4RW7A 2D3UA 4G3IA 2I1RA 3DI6B 4MKBA 4WFYA 2IC3B 2OPSA 3IG1B 4NYZA 1S1UB 4WFXA 1JLGA 5HP1B 4DEZA 2BANB 4O4RA 3Q8QB 3KHGA 1GX5A 3FFIA 2AX1A 5KT2A 1XR5A 4J9NA 1FKOB 2ZD1A 3E01A 4DG1A 1S1TA 4IFVB 4URGA 1S1WB 4O3QA 4KKOB 1LWFA 3MEDA 3ISND 4KHMA 3KLHB 5KT7A 3MEEA 4MK7A 1JLCB 3H40A 3SI8A 1IKYB 5J2QA 1VRUA 1KLMA 1TKTA 4TN2A 4WYLA 4ED0A 4R8UB 3H2LA 4J9RA 4NLUA 1IKVB 1JLQA 2HNZB 3FRZA 3I0SB 3FSIA 3QIDA 2XI2A 1TKZB 1RT7B 5FDLA 5KT4A 4ZPBA 4K4YA 4R5PB 3CDEA 3SFGA 5KFXA 2HNYB 1RT4A 5J2MB 4NRUA 3H4BA 4F4YA 4IRCA 2I5JB 3IRXB 4RNFA 1T03A 4DL5A 1LW0B 5KFTA 3RB4A 4MIAA 2BQ3A 2WTFA 2IJFA 1BQNB 2OPQA 1YVFA 3HVTA 1RTDB 2JEFA 3GV8B 2RF2B 5DLFA 3HHKA 4KHRA 1IKWA 2E9TA 4MH8A 2YNHA 4KO0A 4F50A 2FJXA 2D7SA 4PQUB 5KFYA 3OL8A 4NLGA 3H98A 5KFVA 1RYSA 1RDRA 1EETA 3RB3A 4WYWA 4H54A 4TYAA 4NLRA 5C42B 2W7PA 4MKAA 1QAIA 4O44B 3QGIA 1DLOB 3CDUA 1HQEA 3PR4A 2ILZA 4NRTA 5CYMA 2GIRA 3MFHA 4GC7A 5L1LA 5KG1A 3DLGA 1C0UB 1S6PA 4ZVEA 5I3UB 4U7CA 3UPFA 1IKXB 3EZUA 5L9XA 3KNAA 4H4MB 5DQHA 1RTIA 2R8JA 1JLAA 3GYNA 4RW4B 5I42B 2OPRB 2IM2A 3V4IA 3PVXA 2EC0A 3SFUA 2VA3A 4JV2A 4ECXA 1RT3A 1HNVB 3GIKA 1J5OB 4EBDA 3MR3A 2UVWA 1TV6A 5C24A 1T05A 2UVUA 4RW7B 2FJWA 1SUQA 4ED6A 2FLLA 4NLTA 2IM0A 2WCXA 4M95A 2OPSB 4JUZA 3QO9A 3OSPA 4OL8A 2B6AB 2YKMA 2GC8A 3FQLA 5J2NA 3QZ8A 5KFPA 3H5UA 3KHRA 1D0EA 3V6KA 4NLYA 2ZD1B 2HWHA 4DG1B 1S1TB 3DLKA 4YR2A 5F8MA 3MEDB 2JC0A 3EPGA 1SV5A 3DYAA 3M8PA 4QWEA 3HVWA 5KG4A 5DG7A 3RB0A 4JV0A 5HBMA 1SH2A 3MEEB 5KFHA 4ED8A 4HYKA 1RA6A 2UVVA 5J2QB 1VRUB 1S9GA 1KLMB 1TKTB 4QWBA 2IAJA 3DM2A 1RT1A 5F8NA 2W7OA 1QE1A 1N56A 2XCPA 5F8HA 1S9EA 4YMEA 3PW4A 1LWEA 1C0TA 5KT6A 1QAJA 4ZP6A 3N6MA 2VG5A 3KLEA 5FDLB 3TVKA 1KHWA 4ECRA 1ZETA 2VG6B 2VG7A 1RT2B 4KSEB 1S48A 3I0RB 3NGDA 2QV6A 2FJVA 3D28A 4QPXA 3NAIA 3MECA 3QYYA 5F9LA 2C2RA 1T03B 4KBIA 1ZTTA 2YKNB 5KFAA 1S0OA 3HVTB 4NLDA
chains in the Genus database with same CATH superfamily
3GR1A 1LOUA 1TVRA 2HVEA 2WSCC 5GAGI 4OV6A 3TZYA 1NKBA 2ACMA 1FERA 4PXBA 3OTCA 1AZSB 2VBWA 3I4HX 2LXFA 4O3SA 2A2CA 1I6JA 2X3DA 4KH1B 2V4RA 1KVJA 1XERA 1CJTB 4OI3A 1D9AA 2BACA 3KNGA 1HBOB 5HL7Q 1VBXA 3JYTB 4ILMA 1RWPB 1ZTWA 2E5IA 5HBMB 4B3SF 3MEGB 1LFWA 1RAGB 3W60A 2L48A 1S9EB 1HPZB 5BR8J 5IT4A 2LA4A 1VQ5S 3MECB 3V6JA 2PE8A 1CEZA 3HHLC 3LW5C 2QIFA 3V81A 2IVMA 5GVQA 3AHPA 3E51A 2B5JA 3T1HF 1HLWA 4I67A 3RTVA 3NXZA 2D9OA 2MJUA 3HMJG 1WOOA 2A2DA 4PXDA 1QJHA 1LKZA 4L72B 3NL0A 3MMCA 4YB5A 1MROA 1NSPA 3R27A 2FGOA 5LMUF 4EO6A 3AQOA 4R0JA 3HKWA 3W63A 3DMJA 2ZKUA 5K5MA 2I6WA 2VC0A 3GG1A 3M6UA 4NLOA 3EDRB 3G96A 3QGGA 1XJWB 2OMLA 4MKVA 1HI0P 2B5JB 2KM8B 2IVFB 4OV1A 3GFXA 1RLCL 2DGOA 2R2RA 4BC9A 2YBVA 1NHKL 3HSJA 2FLNA 4LFAF 3K57A 3MMCB 2ASJA 5L1KA 4HTJA 1MROB 4PPZA 2DGWA 3SDEA 3DHXA 2CQGA 4C8KA 4W92B 1VS3A 3JTNA 3DMJB 1U6BA 4NEZA 1HNZF 3Q2SC 2N7CA 1NK5A 3OXFA 1WKJA 4DL3A 4CO2A 2HS4A 4F2SA 4DF8A 4LJMA 3R6GB 1Q1KA 2XHWA 4MKYA 2V2KA 3NNAA 4X65F 5KFJA 3C6UA 4USTA 2R7XA 1RBLA 5E3QA 5KFKA 1CPZA 3IR5B 4OYWA 1IN0A 3ZC4A 3UR3C 2F5GA 2P6SA 3I82A 4Y28C 3SDEB 1D8ZA 2I2YA 2MQ8A 2MZJA 4YFUA 3L3CA 4DR6J 3DNCA 2Y1JA 1N6QA 3OT9A 4WE1B 1X4GA 4OZ2A 2B51A 2YKQA 4NLXA 5CABA 4NE9C 3EGWB 1TL1B 1TL3A 4ZVFA 2DGUA 3MM5B 3QT5A 4KGMA 4K4ZA 3T6JA 2HMIA 3D4JA 4BLGA 1RTJA 1T9YA 2G1DA 3TANA 3C6UB 1UVLA 3VHQA 3MR7A 2H5EA 1HL6A 4L76A 4QR0A 2OPSA 2EXUA 2HBQB 3LGHA 1GX5A 4HLBA 5IT9Y 9ATCB 1P9YA 1U1MA 3N01A 4ED0A 4NLUA 1NPKA 4W98A 1VR6A 1W26A 4OZNA 3UVJA 5KFXA 2BJ1A 1RT4A 4IRCA 3WZ0A 3MMBA 2JEFA 3BGOP 4ZS6A 3DOMB 2P9EA 1EETA 2KYXA 2W7PA 1CLFA 4NRTA 2XMTA 3BGFA 2JSXA 1RBOB 2RUSA 1RACB 4ZCIA 5E33A 5F0WA 4PKDB 4EBDA 3AY0A 4LVOP 1VQ4S 3NGSA 2JDJA 3R3TA 1FDNA 2OPSB 1U1KA 3AAWB 4JI3J 3H5UA 3DYAA 3M8PA 1B3TA 5KFHA 2LFVA 2CA9A 4FPRA 3OVAA 4I69A 5IS2A 1IBMF 2ZHBA 2PMZD 2R7UA 3UVJB 2J8SA 3PY8A 3UWTA 3MMBB 2N82B 2D3O1 3KK3A 4RBTA 2C3UA 5IWAJ 2BVZA 3RRHA 1EETB 1OYEA 1N33J 5ETSA 4ED3A 4DI6A 2VBZA 2ZH5A 2BJ7A 2CADA 5ETKA 1AROP 2DGQA 2OPPA 4HI2A 2Y1IA 2Z4PA 1NK8A 4CT9A 1C2PA 3M8PB 1X4BA 1XMQF 4WIQA 3IRWP 1ZAWA 3MR5A 2V0NA 2PDAA 1WI8A 4DV1F 2UU9J 2OUGA 2H4YB 4JI1J 2F4FA 2MKYA 1MN9A 1JLFA 4XPCA 1RAJA 3BPSP 1WELA 3KHLA 2DH7A 3ZNJ1 4ZVHA 3D1OA 4QW9A 1L3SA 4C48A 2NXUA 4UOFA 5HMWA 1U2CA 4RWXA 4Q43A 3H42A 2KL8A 1PIEA 2C28A 1VQ9S 2G1HA 2ZBCA 1N54B 2BRKA 4LF1A 1NDLA 3OJUA 2F65A 2R7TA 1SH3A 2DHSA 1WOSA 5H9EK 1CSJA 4MK9A 1VQ6S 2V4JA 3FBBA 3QT7A 1REVA 1Y11A 1N5YA 2IBKA 4DV3J 4GVBB 2AMCB 1NPPA 1TKXA 4C0BA 1U47A 3DDKA 2HHWA 1UVKA 1L3UA 4M5HA 2JLGA 2PI5A 2GW8A 2HLUA 3MGJA 4NXMF 1S6PB 1X60A 2HS3A 2FUG9 2XMKA 1SVDA 4Q45A 1I5OB 2YKMB 1DTTA 3ZZRA 2RIJA 1FHTA 3HULA 3KHHA 3O1LA 4EI2A 2R2SA 2VBYA 5K14A 4Z7YA 1H2TZ 2YWHA 3LPEA 1U26A 1KONA 2B4OA 2FZCB 1REVB 3D0GE 5AE2A 1N5YB 2P9CA 1TKXB 2VFTA 4KR0B 4A8YA 2ZBQA 3W65A 2XGPA 2AYEA 3CW2C 1YLXA 5HQ8A 4AUKA 4JI0F 3UCGA 3ILOA 1U02A 2GQCA 1T02A 3KOAA 4YR0A 2W8KA 3V6HA 5AE1A 1HNWF 4Q44A 1IJEB 2QLFB 1T9TA 1DTTB 5EX0A 1QTMA 4M8LA 4K4UA 2AF6A 4U6PA 4DQSA 1U0HA 2Q43A 1S1UA 5K14B 3CO9A 3QFHA 3OR2A 5F41A 4G6VB 2J0WA 2ZZNA 1HWJA 1KOOA 2HBYB 3OSNA 2DJWA 2HNYA 5J2MA 3GPAA 1NXIA 2I5JA 2RF2A 3MCNA 1HBNA 2GMJA 2MSTA 5FIIA 4GRSA 1RLDA 5I4MA 2MY7A 4U7UK 1U48A 5CYQB 4WXWA 4LREA 4FBUA 2EW9A 2GO8A 5HN0A 1FDDA 1U0HB 2I1RA 1S1UB 1JLGA 3AFGA 1U1PA 3E01A 1UPPA 2BDPA 2LU1A 3OR2B 3D6FB 4X4NA 3H40A 2IYIA 4EGLA 1UVMA 3SFGA 4C11A 2HNYB 5J2MB 2I5JB 5D4LA 5A6PA 1VQ7S 2RF2B 1EKRA 1HBNB 2EFNA 2D7SA 1GEHA 2AJ1A 1RDRA 4A8QA 1UZDA 1QAXA 4MKAA 1DZ5A 2XB2D 4OHYA 2EVZA 3HHDA 3CDUA 3PR4A 5DETA 4DWIA 3ZTOA 2GHWA 1X4AA 2ACYA 5D4OA 4P71A 3J7Z5 2NYIA 1QSLA 9RUBA 4K0KJ 5E2QA 2XHCA 2KVQE 5B7WA 1NO8A 2DB1A 1BLUA 3TWZA 2K2PA 2FLLA 2WCXA 4OL8A 3OSPA 4L75A 3MCSA 3QZ8A 2UUCF 7AT1B 2F63A 3RU0A 3C15A 3R7BB 2H1YA 3GCWP 4TNOA 2B8QA 6FDRA 1N56A 2DNMA 2QSWA 3PACA 2W7AA 3FUYA 4C11B 1XIQA 1VHFA 4KBIA 2OJ3A 4HHUA 1HNIA 3GE9A 1DHMA 4CLLA 5E3RA 1FF2A 1ZBTA 1R0BG 3KK1A 4LF6J 4K4WA 3KJFB 4FYXB 4N77A 1YHQS 2J6TA 3VF0B 5KOWA 1TK8A 4KV8A 3I5CA 1BMQB 4TQSA 1HW9A 4B3TF 3TQ1A 2ZE2A 4DS5A 4N7TA 2C2EA 3BS9A 5K8OA 2HQIA 4O3PA 3W2WA 4EBCA 4DZDA 2HG4A 5ETTA 1G7CB 1TKDA 2IMWP 2ZHOA 3FSXA 4FYYB 2VICA 4N8NA 3HF5A 3ICLA 1O0PA 1NSKL 3AX2A 5BJRA 2ILYA 1QDUB 3M2UA 4QR2A 5B0EA 4IQXA 3TX8A 3QWUA 5A76A 2NREA 2ZDOA 4LF2A 1IWGA 3G8TA 2MQMA 1EIYB 4J9OA 1FJEB 3KK1B 1DY3A 1EP4A 1FXLA 2E5LF 4OI0A 1X5OA 3M8ZA 2ZE2B 3I31A 3S7RA 1U1OA 1NLKL 1S99A 2QT7A 3MM8A 3BSAA 4LBHA 1X9MA 2RVJA 3DDNA 3FFIB 3GR0A 3W2WB 5IFMA 3BSOA 3OPKA 3VQSA 5C7PA 4C6AA 5KG3A 3WX8A 1PAUB 1SIWB 1JLQB 5BXIA 1VQLS 1S77D 1HA1A 3Q22A 2NYHA 2IIHA 2UXDJ 1TFWA 3M2UB 4FXDA 2Y8YA 1K8AT 1R43A 3CJ3A 1SL2A 2LQBA 2V5HG 4XPEA 2RT3A 3W61A 4J9QA 1HWUA 1EP4B 1YX2A 3LWLA 4ZPDA 4WIIA 1UFLA 2BW7A 2XYHB 2ABYA 4KHPF 3V6DA 4X4UA 4TVAB 1WDTA 3BQ0A 1FJGF 3MR6A 4NASA 3MM8B 3EVOA 4DV0J 1PO6A 3OFHA 1S9FA 2HGMA 3DLJA 3GJRB 3THTA 1W2IA 1CQMA 1NBEB 2J9DE 5AT1B 3CCUS 2KFYA 3FCWA 2DEJA 1XTZA 4NZ6A 4KJIA 4WZMA 2ZEJA 4LRDA 2KKHA 4N5SA 2V34A 3HFKA 3CD0A 4G1QA 3CWJA 2HAFA 2NUHA 2J0XA 1OQ3A 5KT5A 3IO1A 1HWLA 3HLUA 2YWEA 4WK1A 3MUMP 1S10A 2JNJA 3V6DB 2XLKA 1LWCA 3TUZC 4DV2F 4A8MP 1O6XA 4DXLA 3VAHA 4UOCA 2XC9A 2OO4A 3KLHA 2B56A 3QMQA 2C3PA 2YKPA 2MGZA 3FQKA 3R5GA 4CRJA 1SKWA 2ZH6A 4LQ9A 4G1QB 4CTAB 2B4VA 4ECSA 4ECZA 1LW0A 3TAMB 2M0GB 2D9PA 3B54A 2J8AA 1WTFA 1WHYA 2MZQA 2BQRA 4PQUA 5CHCB 2HHHJ 2R4FA 2PIIA 2R42A 2DTJA 1RU1A 4FXWA 4DL6A 4USVA 3MTKA 2MYFA 1YRTA 2WBRA 1RZMA 3I56S 4D3HA 4ZOSA 4RW7A 2DY1A 2CZ4A 4RL1A 5ETRA 1XR5A 4URGA 3KLHB 3HZEA 3VAJA 1KLMA 2MGZB 3H2LA 1YZ6A 1N88A 7FDRA 5F3ZA 1F1BB 2VV5A 3NS6A 1K44A 2Z57B 1LW0B 2BQ3A 2IJFA 1SBRA 2OPQA 3CCRS 5DDPC 2V94A 4PQUB 2YNHA 2U1AA 4DFKA 4DPXA 2N4DA 1QAIA 2CJBA 2ILZA 2MZRA 2DIVA 2FHJA 2RS2A 2ROGA 3M1VA 2U2FA 4U7CA 5L9XA 4A8OA 2KXNB 2VQFJ 1WUUA 3VGSA 1UEKA 3GIKA 2CQ1A 4A47A 3MMAA 1TV6A 2F8HA 2UVUA 4RW7B 1H2UX 4LRAA 1F9FA 4X4PA 3BO3A 3CCJS 1F2HA 3W7BA 4X4SA 1FX2A 1M5VC 3IAS9 3IMQJ 2QLJB 5E7OB 1KLMB 2MEWA 3ADAC 2IAJA 1CC8A 3FC9A 5IXUA 1NZAA 4B9TA 5MAOA 2CJYB 4F02A 2V8VA 3NRBA 2YNHB 3QAUA 4Y0FA 1KQFB 3G87A 4A8SA 4DPTA 4LBPA 1FE4A 2NXNA 5EN1A 2RB7A 4OYBA 1SI9A 2NSBA 5LSOA 2AJQA 3M05A 3M1VB 4JI4J 2HNDA 3GSDA 4X66J 2O01C 1VISA 3FEYB 3OL9A 1L3VA 1V5IB 1NUEA 1FNXH 2HRYA 3ZXWA 2QLWA 1NB2A 2XQCA 4Y2CA 2CJQA 5B0AA 3T9NA 4DR4J 1YI2S 5GAHI 3GV5B 3T19A 2FIUA 3NAHA 1KEKA 1GFWB 2C3YA 1S0NA 3UQSA 4LF4J 1J2VA 2F9JA 3FZBA 5CZXA 2OFHX 4Y2IA 2MB0B 4LIRA 2CDQA 1KDNA 4CIOA 2DRDA 2E1AA 2YTCA 3CCLS 2ZKTA 1RWMB 4JI2F 3S1TA 2QGFB 4DUTA 2WAQD 5KFWA 1IKVA 4ETXA 3OHBA 3TOQA 2D69A 2FQQB 3GIJA 1TKZA 5GADU 3I55S 2B9XA 1IR0A 1LV5A 3L4BC 5GAEI 2Y3YA 4C0OC 2HZVA 4PG5A 1FWKA 5IV3A 3GG0A 1X4DA 4QCLA 1R8BA 4M63A 3EPIA 1U2RA 1KNZA 3JSYA 1TAQA 3QJPA 4HHHA 4RU9A 1SV5B 4DSKA 3R2CJ 3TA1A 1HHSA 3OLBA 1IBLF 1KVKA 3PYDA 5KG6A 4RUBA 3K5OA 3EDQB 4DDFA 2AIRB 3O2IA 4J9MA 2LDIA 2H65B 3IGVA 2ZNYA 4ZJOA 4IR9A 5D3GA 4V19X 3MZIA 2KJWA 4CLZA 4PWUA 2B0GA 2AJ0A 2UV8G 4YY3J 2HHSA 2Y0BB 3HFZB 1B70B 3DRRA 2QMXA 3CE8A 2G2OA 2A1BA 2Q1LA 2HK3A 1ZPWX 3RG6A 3P8BB 3X3UA 1OJ4A 5KFUA 4F26A 2XGQA 3Q0AA 2J76E 2QX0A 2V50A 4QIEA 2QZ8A 1W25A 2VH7A 3LPYA 4DLGA 1ZZFA 2LKZA 3PYFA 3BM7A 4IG3A 4B9SA 3J7YI 5D3GB 3I0SA 5H9FK 1RJJA 4ZVTB 5IM0A 4OZ3A 1G1XA 4KGXB 1A7GE 4F4WA 3PHTA 4GMKA 4YEAA 3GJQB 1FEEA 2YH0A 4ZLJA 3EICA 3CULA 3DRRB 4ERDA 1GTHA 3LTOA 2W9AA 1P8GA 3TZXA 2CRLA 3M2VB 2XS2A 3CDAA 4DSJA 4FF4A 4CLYA 1J27A 3KUEA 4P6QA 3BSCA 2DITA 3RGIA 4G1PA 5DQGA 1OPIA 1XMOJ 4EBEA 3FK4A 1H38A 2YNFB 1NK4A 1WOPA 1RABB 3EE3A 3KHGA 1ZETA 5SZTA 4LFCF 1V9OA 1VRUA 2KYZA 3QWPA 6AT1B 4ZVPB 1BWVA 3JQJA 2M8DB 2AZ3A 3I0SB 1YBAA 1N5QA 1RAIB 2Q79A 4NCBA 2IPOB 2VHGA 4MIAA 2KXFA 1BQNB 5HAOA 2DRAA 3H20A 3HPOA 3C8YA 2DKOB 5CXTA 3CCSS 3P96A 4X64F 2XG8A 2R7WA 1CJVB 5I3UB 3JAMU 2D68A 3GYNA 3CD7A 4JV2A 1U2FA 2EFPA 1RQ0A 3LGNA 5LSRA 2ZC3A 2IM0A 3QO9A 2AEJA 1YJRA 2R7VA 4CH0S 4USUA 1MNEA 4TU9A 4NZ7A 3UDCA 4DX6A 1RA6A 1GT8A 1VRUB 1K73T 2E66A 2V8PA 3FMWA 1IQZA 1N34F 1VOMA 4JI6J 3DXBA 4PG4A 2EBGA 1FVQA 4Q0BA 4OZ5A 1EJ7L 4KQZA 2FVSA 2B43A 4FKYA 2ASYA 2B8PA 2V68A 4L3NA 4QIWD 1M5OC 2FJDB 2W8LA 5ETVA 5KFGA 1X4FA 4LSNB 2RRAA 3B4DA 2V1SA 2BJ3A 1XMBA 2JFDA 2WW8A 2ZITA 3OV7A 1CJKA 2G4BA 3DFEA 3KMQA 2ATLA 4L3KA 4Y3CA 2QC3A 3O5TB 3HX9A 3GB0A 1NEEA 2ZOGA 3PJXA 1S6OA 3KUGA 1S6UA 2GA7A 4FYVB 4CH1A 3AOBA 3SIPB 1R6YA 1C4AA 3R1LA 3NGTA 3CJSA 4LRBA 1LQ9A 1RAEB 4ZMMA 1U8WA 2C2DA 2H51B 3BZQA 4ZKAA 4Y65A 3IBWA 3T1YF 3RBXA 1OO0B 4OX6A 3M4XA 2CJ9A 1UPMB 4PAAA 1SC4B 4NEYA 3QGPA 2DH8A 3SCKE 3ISNC 4K5SA 4WFBQ 2CVIA 1LWFB 4YN3B 5AXNA 3MM9A 1OQ6A 3EMTA 2IC3A 1PBUA 3MM7A 3FMBA 5KOXA 3CGIA 3PR5B 4EYIB 3MI7X 1RTHA 4KB7A 3MPDA 4WZQA 5IC6B 1X7VA 1TP7A 1M5HA 2V1TA 1AFJA 1YWXA 3CIMA 3OTOJ 3JSRA 4ZLLA 4G1IA 2GX8A 5JJBA 1NNDA 3DLGB 4I56A 3A8IA 3T6BA 1XR6A 2Z2LA 3W64A 2AJ4A 2GV1A 1RYRA 2KG0A 4FYDA 1C0UA 2CJXB 2YY3A 4OYAA 5KFSA 4QPTA 3VQTA 4XDCA 5J1NA 6FD1A 1FDBA 2VG5B 2CPZA 3OFFA 2FHOB 3SQOP 2W24A 1RTHB 3N4WA 4M5DA 1WC3A 1L3TA 2GS8A 4HVZA 4P75A 1NK0A 4QWCA 3M30A 3GFZA 2M4MA 2WSFC 2YKNA 3WIVA 1D09B 3GIIA 4NA3A 5K9FA 2VA2A 2PMHA 1ZYQA 2CQ4A 4ZPVR 3BJYA 3CJ5A 4GKKJ 3D68A 4L74A 2UUTA 4NA1A 2KT3A 3VALA 1BUXA 1X8DA 2CWXA 2X51A 4OZ1A 2Z2YB 4C3KA 2UXCJ 1ZZNA 1KQGB 1AT1B 2O3DA 1H72C 5GAGU 2IYGA 3RW7A 1CULA 3QAEA 2HWTA 1V5VA 4C4WA 1F3FA 3PNIA 3MEKA 2GIFA 2KTQA 3VR1A 3DLEA 3M8QA 2HFZA 2UUBJ 5ETQA 1YJ9S 3AXMA 5CCLA 1WEYA 1WWHA 3M30B 4E98A 3KLGA 3PW5A 5F8JA 3JB9k 4AE5A 3AA9A 3HHLD 4CNYA 3EJMA 2L08A 3KLIA 3QIPB 4ECTA 2UUAF 1VQNS 1B7YB 2QTWA 4RW4A 4OYIA 2KN4A 2VL1A 4OX8A 4U95A 4PWDA 5H1SV 4KPCA 3CPWR 1T3OA 2RILA 1VBZA 2AX1A 5KT2A 4USKA 5ETNA 3W8PA 1CULB 3TRGA 3TZZA 2FY1A 2V2ZA 4K4YA 2M7SA 3F73A 2DNOA 5CCMA 1LXNA 4LSZB 5HMXA 1HD1A 3H98A 2FHKA 1RYSA 2WVCA 2F4VJ 4DR2F 4BDPA 4LR9A 1HQEA 5ETLA 5L1LA 3HCXA 3P49B 4RW4B 4P2FA 2AHOB 1SJQA 3BB5A 4ECXA 4NXNF 2V67A 5C24A 4B9MA 1TK0A 2CDRB 4TU8A 3R5JB 3U1NA 1H6KX 3DLKA 4GVLA 4JV0A 2GJFA 1FTRA 3BKFA 1LWEA 1UJ4A 3F44A 1RT2B 1E6YA 3L95X 2ZZTA 5KFAA 3NS7B 1DURA 4ANDA 4UUWA 1XNRJ 3NNCA 1T3NA 4ZK7M 2RDDA 5AXLA 2A6OA 4KGKA 1Y00A 2ZM6F 3GIMA 3CUNA 3TARA 2GIQA 3BGUA 2VQEJ 1UMJA 3M8YA 3C16A 1YIJS 2VFSA 4K4TA 1RSCA 3DLKB 3ZZUA 1T8EA 2EKNA 2WONA 3AB2B 2N3LA 4WFZA 3E8OA 4FNHA 1FA0A 4DS4A 1OSCA 4K2XA 4QW8A 1LWEB 3UN5A 1UETA 2FJBB 1M5KC 4L6V3 1E6YB 3BV8A 1TL7A 5DG9A 1RTZA 2KH9A 4LF7J 5K8PA 4ZCMA 4GC6A 3TA0A 2R7QA 2J7KA 5F8IA 2APOA 4KRWA 3N6NA 3PFOA 3CT9A 3QT8A 3C16B 4RW6A 4DJBA 3RBDA 3C46A 2XWYA 4RZRA 1UKUA 5L1JA 1U6ZA 2BJ9A 2MKCA 1R0CB 1FWPA 2WONB 2RHQB 2AGOA 4X2BA 1S4EA 5T14A 1V3ZA 3H59A 2QEXS 1KQSR 1U09A 3OXGA 3GV7B 2JJ4D 4HEA9 2H48B 1TL7B 2KI2A 4M94A 1AW0A 3H5XA 1NZ8A 3A13A 3JTPA 3RBEA 1UVNA 4JYAJ 4Q8EA 3CB4A 1HD0A 3CDBA 3MPWA 4DL7A 1JX4A 1YJNS 3W9IA 3A8JA 1YSJA 1IR2A 4CWBA 5DG8A 1UAWA 4RW6B 4M5GA 4BHQA 5J2NB 3DGVA 1BE4A 2KM8C 3GYXB 2CPIA 1S7HA 4ER8A 1T9WA 2CFXA 2AEMA 5LJ3Y 1VRQC 5B0BA 2WK4A 1DQAA 3PYEA 2LEAA 2OMOA 1HW8A 3Q86A 3MCMA 1S0VA 2PC6A 4KH0B 4OJ3A 1N48A 3N6LA 4WFNQ 2YH1A 3Q8SB 1SC6A 3CVKA 5LJ5Y 2I9SA 3OJSA 4IH7A 4YDDB 4J9SA 2Q3PA 1CJUB 2V8DA 4OIXA 4B3RJ 3D7SB 5HQMA 2WB4A 2POKA 3W5ZA 4B02A 4Z2XA 1MMNA 3C3LA 2FVPA 1RWVB 3OLAA 2J9EA 5HMYA 3HVAA 2RS8A 2KO1A 2C1EB 4TY9A 3D0HE 4LSLA 2OGUA 2W25A 2OEMA 1FD8A 1I94F 3DOLA 2R8HA 4EYHB 2Q6BA 5DZ7A 3ILIA 5A2QY 1R31A 2QSFA 4Y00A 4O0IA 4UUXA 4WBFA 4LMZA 5THWA 3CCVS 2D3UA 4G3IA 1GXTA 1FTCA 1ICEB 2BANB 4JI2J 2FLOA 3N79A 4OX9F 3PYGA 4K59A 1Q95G 4P72A 4KHMA 4MK7A 3SI8A 2BM0A 2G2YA 4YHHJ 3DC2A 4DR3J 1ZA1B 3H4BA 1T03A 1JJ4A 1N36F 1RAAB 4JI5F 4F2RA 4KHRA 2E9TA 1J5EJ 2H54B 1RK8A 4NA2A 1M0SA 1TELA 4UOGA 1V3SA 4GC7A 3MURP 3AA8A 4JI8F 5DQHA 2DH9A 2JL9A 3RJMB 3T41A 3BN7A 3V4IA 1RT3A 5IT9U 2FJWA 1IM6A 3HKZD 3R9LA 2HVDA 1IQTA 1D0EA 3V6KA 5LMNF 5DG7A 3IM8A 1S9GA 1CS4B 3DM2A 1RT1A 2ZUAA 4J5OA 1UL3A 5KT6A 2UP1A 4PCQA 3I0RB 2Z58B 1T03B 5D4PA 3H5SA 2R7RA 1EB0A 1FFGB 2EG2A 3VVUA 2KVIA 3SCJE 1NH7A 1Y5LB 3MWBA 1TTHB 3EM1A 1TL5A 2W01A 1WNEA 1RB0A 2MHNA 3V4IB 5EWEA 1VQOS 1RT3B 3G82B 5DDOC 4HT5A 3FVYA 1WEXA 3J81Y 2IJRA 3VGUA 3KLFB 4DQIA 3V2UC 1S9GB 4IR1A 4TY8B 2JRSA 1RT1B 4WCEQ 4XIUA 1RT6A 3PG9A 1OYDA 3NOGA 2VB6A 2X1FA 1QM9A 4FNIA 4DFMA 5IT0A 3M8WA 4HACA 1FRXA 1GMWD 3VAFA 2QJ3A 2UXBF 4ALZA 2CIMA 3ONQA 2R3VA 3DCAA 3ZZ0A 5DGAA 1RWNB 2OSQA 2DNKA 1N32J 2FVQA 5M2UA 4PABA 4O4GA 1BD6A 4QZVB 3W8GA 1JJHA 3KK2A 1VGYA 1QY7A 1FO1A 1C1CA 2LCWA 3CD6S 2LDYA 1R0AA 4B17A 3I96A 3JSMA 4IFVA 4DV6F 2GVZA 4DUZJ 4ZPWR 4DCOB 1FRIA 1FT8A 4DR5F 4HACB 3DU6A 1YGYA 1RT7A 4LF5F 1VIXA 3ETMA 4E0DA 2OLWA 4F3QA 1VQSA 5CYMB 5EUHA 3ISZA 1M5SA 2OTLS 3BKUA 3MCOA 4JBCA 4IO1A 4O4GB 1QAYA 3HSDA 3GU0A 1XWLA 4ZVSB 4LFBF 3QRPA 4TU7A 4C8NA 1C1CB 3BGRA 1HNVA 1R0AB 2VJUA 3WIUA 3QBCA 4MTPA 1GK8A 2MLYA 4MK8A 5DO2A 2B6AA 4CYUA 3IS9A 4IRDA 1DBDA 3BDEA 3CJ2A 4V1Ak 2B9EA 4KY3A 2QG9B 3ZZPA 3X1LB 1WC5A 4PR6A 1WTBA 1ZM2A 3G86A 2G2ZA 4J9LA 3TEHB 1XNQJ 1RCOB 4O23A 3R6LB 2QMWA 1UW9A 3ZZYA 1HQUB 1SL1A 3NP5A 1RWKB 3VWSA 1DTQA 4I6YA 4LRFA 3BGRB 3DGPA 2HBZB 2QRRA 1FKOA 1NCLA 3GIRA 3JYTA 4CYUB 1SH0A 3I32A 3IS9B 1IKYA 1S12A 4E2FB 3ENVA 1FK9B 3MAQA 3MEGA 4ZP7A 4P52A 3IR7B 2XWXA 1HPZA 1JK9B 3ZZTA 1U45A 4U8YA 3VZHA 2V9WA 4DPYA 1FKPB 2F1FA 1NHVA 2AX0A 1HR0F 4FZVA 1TUWA 2HKEA 2LA6A 3JQMA 2G0IA 4DPOA 2DO4A 1KRPA 1DTQB 3M2RA 4NX9A 3HT3A 1KS2A 5J1PA 4MKBA 4HT7A 3DGPB 3KG1A 4O4RA 1RAOA 1FKOB 4DL2A 5AJ3F 1Q7YT 1NK9A 1IKYB 2Q66A 5ADZA 4TN2A 3M7VA 2MKKA 3IAM9 2E5JA 1G6BA 3SYZA 4DL5A 1FX4A 2JHEA 3CCMS 2E1CA 3A8KA 1KFSA 4YDXA 4HTIA 4F50A 2F9DA 4NLRA 2HEKA 2RUGA 2V8GA 1WHXA 3WC0A 2VPXB 4LR7A 3NY0A 5KG1A 2XMWA 2UVWA 1WKKA 3MR3A 3M2RB 5M2RA 2VFRA 5D0RA 2KZMA 2BE7D 2HLTA 4YR2A 2FB0A 2LYVA 4QBUA 4HYKA 1NDCA 4IYQA 3SSSA 1UVJA 1FEHA 4KPYA 4Y2MA 4C3LA 5T7LA 1OSDA 2VG6B 1WC6A 2MKHA 1OY9A 4LF9J 2OELA 4Q5VA 3ULHA 1RBAA 2GHPA 5C25B 4CLTA 2ASDA 3I9ZA 1VHIA 2OKQA 3K58A 2RKIB 2EK6A 4HDHA 1FXRA 3TO8A 4OHXA 2QA1A 5LSLA 3AOAA 4RW8A 4ANEA 1W2BR 2YWFA 2K7JA 1TL4A 3T1AA 2WHOA 1BWEA 3K8WA 2V2VA 3FKBA 1SQGA 1Y5IB 4RKUC 2ZOFA 2IFXA 2MQLA 2JEIA 3IGNA 5T7LB 4N47A 3ZNUA 5A8RB 1ZAVA 4WE1A 2NZ4A 2K3KA 1VRTA 2FHMA 2Z2MA 2MJNA 1TL1A 1RAFB 2LMIA 2DHAA 4CT8A 4C8LA 3MM5A 2HFOA 2J6UA 4RW8B 5LXRA 2ATCB 4OYPA 2PI4A 4OZ0A 1ZM9A 2CNNB 4K8RA 3TR5A 2RH3A 3PFEA 3MXHP 2MPUA 4PEOA 3P3DA 3THVA 4P7VA 3P5TL 2DNRA 1T9UA 4B9VA 4QYZK 1RWUA 1IM4A 3DHWC 4DV4J 1KFDA 2JC1A 1N5SA 4WFAQ 3K8VA 4ES2A 1VRTB 1IKWB 2CPXA 1NMEB 1U7LA 2GAHC 2FZKB 1WHVA 5DGBA 3G4SS 5KFMA 4PG6A 2MTLA 3CCQS 1A0OB 3DOMA 2IDEA 2JVOA 4FYWB 2DNGA 2MQQA 2I0XA 2ZBIA 2XTJP 5HLFA 1F5AA 2AJFE 4R0EA 3EXYA 5DM6Q 2OP5A 3IFEA 4XDDA 4ZN3A 1I51B 1M90T 4NWBA 4DR6F 4ELVA 1I3OB 4YB7A 4DR1F 3QGHA 4M5NA 2XMVA 3UFCX 2CNLB 1YJ7A 4HHJA 1VC5A 3AJDA 1NH8A 3EZ5A 1Q0NA 1HHTP 2XS7A 4U67Q 3AH6A 4M5IA 3IM9A 4J9UE 3H25A 3TVZA 3W2VA 5HROB 3GILA 2GCFA 4F3MA 3W9HA 4DUYJ 5HLFB 1KP6A 1DQ8A 3D0IE 2XEXA 5MLCV 2W9CA 1PCAA 1S1WA 4MAKA 1Q7LB 3CTRA 4B9LA 1JLCA 3Q89A 5BYRA 4I4BA 2VASA 2HNZA 5KG5A 3CIZA 1JIHA 3BN4A 1QUPA 2KRRA 1N0UA 3NMAA 2JFKA 3MD3A 2FY8A 4DV7J 4WKRA 5KTQA 3MDFA 3SXLA 2N3OA 3AWRA 1KHVA 3W2VB 3OD2A 1U1RA 5GAHU 1SKUB 3TA2A 2DXFA 2DRBA 5ETOA 2CG4A 4IUFA 2HURA 1S6QB 3LALA 5I42A 2PA3A 3S8SA 3VAIA 1P9QC 2R9LA 2W9CB 2OEKA 1YDLA 4JI3F 4B3MJ 1YJTA 2M8HA 1SQFA 1S1WB 4O3QA 1VJWA 3MEEA 3UNYA 1Z2ZA 1JLCB 2CPHA 2HNZB 2FZGB 2XI2A 2ZNZA 2DEIA 3OTBA 1VQMS 2PO4A 2WTFA 4M1KA 3P5BP 5HVFA 4GVBA 5IWAF 3PIOQ 4TYAA 2QA4S 5E0OA 4XTTA 1N33F 1EAYC 1S6PA 3RUBL 3EZUA 2R8JA 1B0VA 4IQMA 2K3IA 5I42B 2VA3A 2AW0A 2OI2A 3S6EA 5CYJA 3QJJA 2YKMA 3HK2A 3ZTQA 5GAEU 3EPGA 1VLYA 2MMYA 3MEEB 2HYIB 1UJ6A 1JNRB 3D6HB 4EMDA 2MSSA 2HS0A 4AT1B 2L41A 1NM2A 1LXJA 1PC4A 2UU9F 2E5GA 3N5FA 4JI1F 3G6VA 4J37A 1Z1ZA 3FBCA 1JLBB 3RAQA 3J81j 3G6XA 2FDNA 2ZVIA 2V9KA 2HFVA 4C3MA 3SCLE 1PYSB 1WF1A 5GADI 3LP1A 2YXLA 1T7PA 3MUVP 1HYSA 1B64A 2RQCA 2HZCA 3UD3P 2XZTB 5H9FJ 3UNGC 1OPZA 2Z2ZA 3CXCR 3ITHA 1R8PA 1FRLA 3DOKA 4DV3F 1WC4A 1SIZA 4C8ZA 1N0VC 3PJWA 3K5MA 3NBPA 2RQ4A 2ADBA 4LUBA 4F3OA 3D6TB 2BMBA 2C22A 1TZ0A 4Z37A 1HBUB 3J7YU 4LF8J 4UQTA 1Z4UA 3I4PA 2P5VA 5CYQA 3LP1B 5ETPA 4P2XA 2DR9A 1Y10A 5CH7B 1HYSB 4IKAA 2DNNA 2IY5B 5HATA 4PUOA 4QWAA 4YQWA 1RP5A 4S0MA 3V4MA 5HMZA 4AQYJ 3ITHB 4ZHRA 3DOKB 4NCGA 2BOAA 3SBMA 4ATNA 1EQ0A 1U1QA 1OWXA 3UN3A 3G6ES 2BKPA 3IR6B 3NBPB 2JWNA 1F5CA 3L9ZA 2R8GA 3NNHA 2PSZA 5KFCA 3UCZP 1D3WA 3HM9A 3CDWA 1HNXJ 2V69A 2R2TA 2BW2A 2FJEB 4DCJB 3EX7B 4RNMA 3EVWA 4RUAA 4P10A 2LECA 3PV8A 1Y5NB 4PUOB 4I68A 3LP0A 1JXEA 3GFYA 2DHHA 1KBRA 2BOPA 2WBMA 4KIAA 4IDKA 2WVFA 4IG0A 4ZHRB 2XLIA 1GAOA 4NCGB 3GONA 4FP9A 3G2XA 3T5LA 5HI7A 3DN9A 4NZ0A 1T95A 4TXSA 5KG2A 4ED7A 2AEFA 4DU8A 2PT0A 2HQFA 4JI7J 5KAKA 2OH2A 2C2ZB 5DJBA 2XY5A 2CPFA 1Q16B 3Q2TC 5B09A 1F6TA 3DI6A 3T5JA 2J7WA 3UE2A 5RUBA 4NLWA 2BQUA 2RSQA 5B08A 3LP0B 2FPHX 1LW2B 4IDKB 4IG0B 4RNNA 1UTAA 1X9SA 3H8YA 2C2MB 4ZITA 5AE3A 2NCKL 1M1HA 2QA2A 3PO4A 1UJ5A 1S4FA 2CAJA 1IBKJ 4TQRA 1S57A 1WORA 1XK8A 1VFJA 4TKTA 3TUPA 5KFFA 4K0KF 4K4VA 1RU2A 4C9DA 3NKYA 2RU9A 3HHNB 2HHUA 3RYLA 3DI6B 2NS1B 1MSWD 4WFXA 3FFIA 4DG1A 4DR7J 3ISND 5KT7A 4CLWA 2PGCA 4FVMA 1ACMB 1YJVA 2E44A 1JLQA 2Z0GA 2QA4G 4FDFA 2X1BA 4A8KA 1NK6A 3BO2A 2PEHA 5DLFA 1FRMA 1KKHA 3ZO7A 2LXIA 3OL8A 1SC3B 4LF6F 4R25A 3HFVA 2GIRA 4IOAQ 4X62J 2RMLA 2QLXA 4OI1A 1YRXA 3JS9A 3B82A 3IBCB 1MG7A 2LQJA 1DAXA 1NK7A 1PSDA 4JUZA 4JV5J 2DHGA 3R7NB 2RHSB 1SJ4P 4DG1B 2EEYA 3RB0A 2ZH3A 2ZUGA 4K5RA 2W7OA 2HHTA 3PW4A 3MUTP 4ZP6A 3AXKA 2LQ9A 4ECRA 1CBKA 5FLXY 2O1PA 4F7VA 4QPXA 3NAIA 4ZN1A 2C2RA 4EUVA 4JV1A 2F8EX 2VF3A 2FD2A 2X1AA 2YQ3A 2QMUB 5HO4A 3OBIA 1C1BA 3MOZA 5L39A 4ID8A 2KT2A 1NJXA 1VLOA 2XM3A 4ED1A 4I2QA 1P1LA 2MZ1A 2AT1B 1RWXB 4ZP8A 2DR8A 2H5IB 1YJUA 3D1HA 5HSPA 3NCRA 3WHIA 3N5BA 1FVSA 1S7IA 2MZTA 2CQ3A 2UXDF 4QIVA 4Z7CA 2O67A 3BYPA 2B7BB 4CM2A 4RR5A 2COLA 3MAHA 1H2VZ 3R1HA 2HHPA 4CTAA 1WG5A 3TAMA 3BR9A 1C1BB 3QRQA 3HO1A 3EXCX 1H73A 4UZCA 3LP2A 4USHA 5KT3A 2ZZMA 2EFQA 4I2QB 4DV0F 3G71S 3EYZA 3QSIA 1YKWA 4B9NA 2EWHA 2HIQA 4CLFA 2Y8WA 1Q8BA 2GO9A 4B3SJ 3RAXA 1RADB 3BH6B 1AFIA 2ALZA 2XMJA 2GJ2A 4QIGA 3R5BA 4GO7X 1MWQA 3OFEA 3UDVA 2FYXA 4ZVRB 1PKUA 5D0EA 3A1YG 3LAKA 1JLAB 2FVRA 5B0GA 3T1HJ 4YUDA 2NUUG 4PQAA 4K4SA 3LP2B 4OYMA 1X31C 3M32A 2XSJA 4H4OA 1FRJA 2KT5A 2K8GA 4D3GA 2LXUA 2HAIA 4C0HA 4ZLPA 4M5JA 4USIA 4RUHA 1YBTA 2F3JA 5LMUJ 3UDEA 1HI8A 4DFJA 3KUHA 3H5YA 3OXLA 3AB4B 1TVRB 1I1GA 2UUWA 4EEYA 4WWSA 2AU0A 3B6BA 2DCLA 1ZOTA 1K1SA 4E8UA 2HHHF 2WOMA 2XTEA 4DCPB 1SKRA 4FF1A 1Y3KA 4C8YA 1KSPA 3M32B 1X4CA 1FXDA 2XSJB 3AOCA 3PZPA 4LFAJ 4H4OB 3L7OA 3T5HA 1OMSA 4OZLA 3BBFA 2R2UA 1NSAA 3WDOA 3IG1A 3AD8C 1B7FA 4P9SA 1R7IA 5D4NA 4Q8FA 2WVEA 2W4CA 5LM7E 3W3SA 8AT1B 3M8SA 4M5MA 2VD3A 1HNZJ 4UY8T 2XO6A 2BRLA 3FBFA 4NYPA 4ECVA 2V4QA 3V81B 1R27B 3VVTA 2CG8A 3IBFB 2J0QD 3ZZZA 2JX2A 3DXSX 1FCAA 2FJAB 8RUCA 5EDWA 2W2QP 2WOMB 4RNHA 3SZ2A 4X65J 4WTYA 2ROEA 3J7AN 4ED4A 1F3VA 4MJKA 3W5XA 2VQFF 2ZFHA 5EWGA 5CA5A 1PYOB 1GX6A 2EKYA 2WVBA 3F56A 4OLPA 3BYRA 3IG1B 1NJIT 3KTQA 5E3PA 3H7HB 2HW3A 3MEDA 2V6AA 2HHVA 1IWAA 3FRZA 2LQ8A 4KGZB 2BM1A 3VAKA 1K0VA 4RNFA 3HVTA 3UCUP 3HHKA 2NPIA 4W4MA 2VONA 4AL7A 2XULA 4H54A 1UA1A 3PRVA 3ZFVA 1RAHB 1H3DA 4JI4F 1PG5B 4P7TA 3UPFA 1BXNA 4X66F 4X4VA 1MN7A 2IVYA 2KRBA 3NS5A 2M3DA 3LWMA 3PVXA 2K1RA 1EX8A 4O0NA 1VJQA 1Q8KA 2RRNA 1DARA 1NDPA 1WG1A 1W7WA 4PXCA 3FQLA 4NLYA 1ELOA 1LEOA 3FRYA 4DR1J 4KTQA 1RKJA 2ZBRA 3MEDB 1SV5A 1RWOB 1L3KA 4DR4F 3O3LA 2NLWA 2CUYA 2XCPA 3D54A 3N6MA 1JXVA 4EU0A 3W66A 4KSEB 1URNA 2DNLA 4EFAC 3NGDA 3HP6A 3D28A 3TUJC 1ZTTA 3HVTB 3Q8UA 3UO0A 1A9NB 2NXCA 3D6MB 4ECWA 3ETOA 3IXQA 1FFWB 1LK5A 4LF4F 1H0HB 2ZH7A 5L1IA 4USWA 3TW0A 2DGSA 4ICLA 4GO5X 2K1RB 1YRUA 1QSYA 2MDAA 4OLOA 1RHMB 3MFIA 1TQLA 2N4CA 4DPWA 1SJ3P 1N6QB 4GKJF 2BE2A 1H98A 2QL7B 1IBMJ 2YPZA 2R7OA 1TL3B 2M5YA 4DN9A 5KFQA 1FDAA 1URRA 2AKWB 5IQ6A 1MU2A 2HMIB 3TQEA 1RTJB 2EPIA 5KFIA 1UP1A 2DNPA 4F25A 2WVDA 1NKEA 1HFEL 3LGMA 3FEXB 4JB8B 4ICLB 4RBVA 3M2VA 5F0UA 4C8MA 1TUGB 1U4BA 4EZ9A 4DF4A 5C5JA 2YNFA 3NGRA 2BE2B 3LA0A 2HQDA 1CC7A 1XMQJ 2ZC4A 3ZTSA 1RT4B 3CO0P 3DLLQ 1EZZB 4OX7A 2OD4A 4IOCQ 4DV1J 3A3PB 2AYGA 4FPIA 5D0HA 1DJ0A 1L5UA 1MU2B 2UVRA 2ZDPA 2X7IA 4YY3F 3R8YA 1BQNA 3PKYA 3U1MA 2QYGA 2KZZA 3RW6A 1WEZA 4URSA 1NHUA 3I6PA 3BGLA 1S59A 2H9ZA 4F4XA 2MHEA 3MPVA 3FDSA 1CJVA 3F0NA 2YWGA 3GZ7A 5I3UA 1GMUA 2PFFB 4OI6A 1YTYA 3DYAB 1M5PC 4ZA1A 2YNGA 3RB6A 4DX7A 1ZH5A 3QPIA 3QATA 3G8QA 4ZJQA 4ES1A 3PW0A 2F40A 3QJLA 4QWDA 3AODA 1Q53A 4DSIA 1P6TA 5DRKA 2ASLA 3KK3B 1VC0A 2XNRA 4OHWA 4AL5A 4DN0A 1D9DA 1WF2A 4K7QA 4XAKA 2DGVA 2W9BA 2IBOA 4NXMJ 3CJRA 3HJFA 3PW7A 3FZ2A 2XZDB 2EG1A 2OPPB 4AFFA 2DCUB 1XMOF 5D8HB 4LSNA 2Z30B 5I3PA 2CJKA 1Q4RA 5E3CA 2HWIA 1M1GA 2IRUA 3CJTA 2YNGB 1VCTA 1PBAA 5T41A 1SKSA 1HI1A 3KYLA 1HHQA 1WC1A 3BSNA 4MT1A 4R5PA 4NLPA 1JLFB 3AD9C 3FNNA 3KG4A 3NGKA 4CNZA 3SMZA 3PRDA 2I8EA 3A8EA 2W9BB 4DFPA 5KFZA 1D9FA 4JI0J 1Y7PA 5E5NA 2FVCA 2IRXA 5DDRC 2RRBA 1FJCA 2KHCA 1HNWJ 1NRKA 2HFUA 3RR7A 1LNQA 5I3QA 1SC1B 3ENWA 1FD2A 2XI3A 2BBEA 2ZJQQ 2HSEB 3BR8A 3GFHA 3Q8QB 2CZ9A 3VTIA 2H4WB 2V4JB 1LWFA 1X4HA 2YVSA 3PRBA 3BKTA 5KT4A 4ZPBA 4R5PB 5B0FA 4JI6F 1RISA 2HGLA 4JP8A 2E1MC 3D67A 2GFFA 4J90A 3R5DA 3UI3A 4BCAA 5A2QU 1SPBP 5KFYA 1ZS6A 5KFVA 1SJFA 1HWIA 2DGXA 1U1NA 5HQLA 3DLGA 1RTIA 1APSA 3P4UB 2Z56B 2MQPA 1SUQA 4ED6A 2QL5B 2LEBA 5IV4A 1ITPA 2CPDA 2JC0A 3HVWA 1SH2A 3LUYA 2CPJA 4AXJA 4DX8H 3L09A 2YPYA 3HHLA 3UD4P 2VG5A 3KLEA 2QFJA 2QV6A 3QYYA 2AYBA 3A12A 1T94A 1T9VA 3C6TA 2IA0A 5DDQC 3MM6A 4QIFA 2GAGC 5CZVA 1M1KT 2ZJRQ 4DQPA 1KOHA 4X4TA 2NZCA 4QU6A 1UFWA 2AWZA 4YR3A 1RTIB 2BR0A 2X3GA 1WC0A 1BHNA 2EC2A 1SUQB 2VKRA 3GCXP 3BBBA 2UUCJ 2W1BA 2OIHA 2X1GA 1U1LA 4OYXA 3PKMA 1H7WA 1Y0HA 3HHLB 1VYAA 4Y2AA 3KLEB 1EHWA 5J2PA 3ZTPA 3R5CA 1OY6A 4KT0C 4Q2LA 2K7KA 1UEUA 3C6TB 3A4TA 3MM6B 4ZLNA 3J80U 3OTOF 2JOQA 1TMJA 2B3TB 1R6VA 4LQ3A 2BKOA 4ZP9A 2YQ1A 1JMTA 5D0GA 4WP9A 3J81U 4B3TJ 3QIPA 1S5ZA 1JLGB 1K1QA 2GMHA 3L7UA 4ZPCA 3E01B 2GMLA 5DQIA 1N5VA 5AXKA 2OTJS 2XS5A 3OR1A 5J2PB 1KTVA 3BH7B 2DVIA 3W9JA 4J9KA 4X4RA 4I7FA 1QUVA 2FC8A 4FS1A 1DRZA 3CC7S 3BQ2A 4FBTA 2DR7A 2E5LJ 4TLRA 1P1TA 4RPFA 4ELTA 2VPZB 1BY9A 5EX3A 4ZCKA 4GKKF 5K20B 3G8SA 4OJ1A 4ECYA 4DSFA 4WK3A 1X0FA 2UXCF 3U1LA 3Q8RB 3PHEA 3WBZA 4ILLA 3C15B 2DT9A 3AJ1A 3IN5A 3TZWA 3RRKA 2CQ2A 2CQPA 1ULRA 1WG4A 4B3OA 2E7VA 4U9RA 5A8KA 2C2OB 3OR1B 2Z8QA 3U27A 3PDNA 2HVZA 1VC6A 2UUBF 2HBRB 4UQGA 1HNIB 4I7FB 1QVGR 3KJVA 3CD5A 1Q78A 2FLPA 1RT2A 4NMLA 1GTEA 2VIHA 3OHAA 4IRKA 4KV8B 1FRKA 4HDGA 5A0YA 1X5SA 4PG7A 4KHPJ 1Q5YA 1WSRA 3CJ8A 3HJVA 1FJGJ 2O66A 1XBWA 1JXLA 3GMGA 4RNOA 4OZJA 1BC6A 2VODA 1F5BA 1BQXA 3PX6A 1PILA 1U25A 5HP1A 4J9PA 4B3OB 2ZBPA 5B0CA 1FE0A 3AT1B 5A8KB 3RAMA 3UD5A 1KR4A 4QYRA 1SJ1A 3D2WA 1GXLA 2DHXA 2BJEA 3KJVB 2XZWA 4F04B 2W4DA 3NMRA 4DL0C 2HZAA 2RAQA 4MIWA 2W2MP 2EI5A 4HI1A 4J9VA 2F4VF 5A0YB 1VQKS 3NEKA 2L9NA 1DLOA 3B8HA 3C66A 4DV2J 3K7RA 3FCHA 2BEFA 1XR7A 1RHUB 3TVYA 2KJVA 4QYZJ 4PRFA 5HP1B 1OM2A 4J9NA 4A8FA 2WZ1A 3IWLA 3MPYA 4QR1A 4ITSA 2XSFA 1KWMA 3MTJA 4F4AA 3FSIA 4ZIWA 3QIDA 1AXQA 4WU2A 5FDLA 5CD4H 3C2PA 3PO5A 4RX6A 2QN6B 3THPA 2HVIA 3F41A 4DLEA 4P2SA 1YVFA 3GV8B 1XNRF 4FKXA 4NLGA 2M88A 2MLZA 3MPUB 1DLOB 3VV2B 1R3NA 1Y3JA 2HFSA 2VQEF 4BWMA 4B08A 3KNAA 3DDIA 1E6VA 5U47A 2B9WA 1T05A 2E7WA 4NLTA 1VQPS 3OTEA 4WF9Q 3DLBA 2KFNA 5J2NA 5F8MA 2UV8A 5HANA 2E7XA 2MLXA 1TK5A 1HBMA 2L3MA 1NDKA 2YX1A 5FDLB 1S48A 5F9LA 2HQ3A 2D3OR 2K06A 4UOHA 5L8RC 2KXHA 4I6AA 3OL7A 4EZ6A 4LF7F 3G6YA 4BBYA 1LWCB 2BKNA 3AJ2A 2XMUA 1AA1B 1EKSA 4AL6A 2Q6CA 2CQCA 2HPUA 4HH1A 1E6VB 3Q8YA 3TEGA 5KFLA 2D1CA 1T05B 3TX0A 4BC7A 3BEGB 1U8SA 4RLEA 2WSEC 2GHVC 2PA8D 1FWLA 1CJUA 3US5A 4U8VA 4WPAA 2CPYA 5DZ6A 1HBMB 2R8KA 3K5PA 4IH5A 5HJXA 5EWFA 4HKQA 3KMSA 2NXJA 5GMEA 1NSQA 2I38A 1RHJB 3CCWA 2EK1A 3OL6A 2AP6A 1JLEA 4JYAF 2GGPA 3DLHA 4C97A 1VBYA 2UZAA 1RCXB 2WRMA 2E9RX 4ZPTR 1KC8T 2LQ5A 1QVFR 2AGPA 4BWJA 3KWMA 3LQVA 3CJQA 3MAAA 4P74A 3CF5Q 1OS5A 1HIYA 3D9BA 1TR0A 3KXDA 2AZ1A 2LU2A 4FS2A 2BANA 3N28A 1PJ6A 3SV3A 2OPQB 3R2DJ 4A8WA 2LEPA 1X9WA 3CCES 5C2GA 1N52B 2OAUA 2CQDA 3PX0A 4ZVGA 3Q8PB 4WKYA 1JLEB 4IOBA 1S97A 2GGPB 3K89A 3HXMA 1X5PA 2QL9B 5F9NA 1F2GA 3MMAB 1TV6B 2DGTA 2IJNA 4I0WA 3MAAB 3EUNA 1B0PA 2CZVC 4RJVA 3OQ2A 2B4UA 3HSGA 4EK2A 2VKZG 4P73A 4QQBA 3QRRA 2E5HA 3B4MA 4B3RF 1GMWA 2D41A 3AX3A 3M6WA 4Y6IA 2IAJB 1VQ8S 2RDJA 3KDOA 1FRHA 2C3MA 1MMLA 5D78A 1JKHA 1UWBA 3HVRA 4BS2A 1WD6A 1TAUA 4TYBA 1CS4A 2VOPA 4KAIA 2CVEA 3I0RA 4A4JA 4NLVA 5B0DA 3HI9A 5E41A 1IUJA 2CPEA 4CO1A 4I2PA 2HNDB 1BQMA 1YITS 4NLSA 1LWXA 3PW2A 3WQPA 3CMES 1U0SA 1RT5A 4YOEA 4DOZA 2JEGA 2XBPA 3M9MB 3PCOB 4KFBA 4GKJJ 2C42A 1UFKA 4K2JA 3G82A 5E3AA 1IBLJ 4ECUA 3EWGA 3SSQA 1IR1A 4CO5A 3KLFA 2FHJD 4KKOA 2ZH1A 4QU7A 2XLJA 2IRYA 4OI4A 1YBUA 2YKOA 1JKHB 2HQGA 1UWBB 2BA9A 4YB1P 1VI7A 5BYQA 1SB6A 4R8UA 4YHHF 4FVCA 4TY8A 5IQQA 4DR3F 3QFWA 4OMFG 4K4XA 2XY6A 2CJAA 4HR2A 4ZVOB 1N4LA 3FSYA 3K2YA 3M6XA 2ZJPQ 5A6WA 1J5EF 3J7A1 1G2EA 4I2PB 1BQMB 1QD1A 3SEOA 3NCQA 5F3TA 5HVHA 1R89A 1RT5B 1U49A 2IM1A 1RA7A 4CLKA 1J5OA 2P2CB 4CI0B 3C14A 4KFBB 5F8LA 5CAAA 1OY8A 4WFYA 4PWWA 4DEZA 1CVJA 2VZ9A 1B4SA 4KKOB 8ATCB 4YS2A 2AD9A 4X4QA 3Q24A 4R8UB 4J9RA 3H2VE 1IKVB 1AYEA 4FXVA 1TKZB 3GJSB 4F4YA 3QNWB 3MOJB 1T9XA 5KFTA 4NOHA 4F36A 1YG0A 4I1TA 1RKIA 4ES3A 2MKSA 3TYTA 1F9HA 2DK2A 4MH8A 4DU7A 1XQIA 2FJXA 2E1PA 1JB0C 2JZ5A 3LF0A 4X84A 2BJDA 5CYMA 1UVIA 4ZVEA 3CC4S 4ENOA 2FC9A 3PIPQ 1J5OB 2ZOMA 3C14B 2ZH8A 1FFSB 2J7UA 3K0JA 2GC8A 4MYTA 2VOOA 2HWHA 1CG2A 3VCDA 4LFCJ 4I6WA 2UVVA 3PM9A 5F8NA 3IWNC 1PC5A 3HHEA 5F8HA 5FJ4A 2BZ2A 3TVKA 1JJCB 1X5TA 3TJ9A 3N0VA 4DSEA 4F0KA 2DY9A 3DRXA 1KLNA 1S0OA 2YKAA 1R8AA 4O3OA 2XMAA 5CQGA 2D74B 4CO0A 4X64J 5CD4A 3TP2A 2J6SA 1IBCB 1FJ7A 1N32F 1RXOB 1UUJA 1Y9OA 3ET6A 4DV5F 3G9CA 3T3FA 1HQUA 1F0XA 4PXEA 5KFOA 5D77A 5K8MA 2BV3A 3I9V9 4F0MA 2M9KA 2IA6A 1PJ5A 2B7CB 4IG3B 4ETZA 3K17A 3RRGA 1RHRB 5IM0B 2NR0A 1AB8A 4DUZF 3M6VA 3A3OB 5LT5A 2BUNA 4HH0A 5J1EA 1FK9A 1N34J 2CQ0A 3I5AA 4DHVA 2C2KB 2H5JB 2P8IA 2VUGA 1Q79A 2BYCA 1P27B 1G3OA 4OFZA 1FKPA 3VZIA 3ET6B 3MMJA 2XCAA 5A8WA 3K5NA 4WXOA 4AXIA 4M5LA 1ZAXA 3I5BA 2V63A 3RBZA 3ENAA 1Q8IA 4K50A 1N5TA 2IM3A 2BXJA 2DNHA 1ROFA 1JWWA 4J7CA 4CZCA 3UR0A 3OTDA 2VDHA 4FN5A 5J1EB 1FESA 1YJWS 1QSSA 1BGXT 3BF4A 1HWKA 1XEZA 1XNQF 4X4OA 1O5JA 3FCVA 1OIAA 1VMBA 4Q2MA 1HMVA 2RQKA 3T1YJ 2IHR1 2ZVSA 2NPFA 3RZAA 5A8WB 3QQCD 3CJKA 1JJ2R 3QO9B 4I64A 2D3ZA 2L9DA 4NPOA 2AJ2A 4CM0A 4OHZA 1VK3A 4ZJLA 4A48A 1XC9A 3DU5A 2XZ2A 3O44A 4ZVQB 2RD5C 4O3NA 4RUCA 2XO7A 2AQ4A 4Q0BB 5D6GA 2VG6A 4AYBD 3CCTA 1KVIA 1T11A 1ZA2B 3DRYA 5FD1A 5C25A 1HMVB 1VBKA 3QT6A 4NLQA 3KJNB 2RKIA 1VDHA 4V19J 2H3EB 2HQCA 3CJKB 4PG8A 3JXOA 1X4EA 5KFEA 4WTOB 1GNKA 5KG7A 1CJKB 3VAMA 4LT6A 2XY7A 3J7ZT 4AD6A 1S49A 4N56A 2DR6A 4DBQA 3UDLA 1V3RA 3TAPA 3D5MA 3ILLA 3MR2A 1D1UA 2LLZA 1WDDA 2G0CA 4H4KC 2G13A 2AGQA 1YK9A 5BR8F 3OVBA 1UW4A 3T9ZA 2LVWA 2ZWPA 5A8RA 3KLVA 2CNKB 1NJYA 4RWWA 3KDNA 4A46A 2C2NA 2JH3A 5HJYA 4N76A 3NCPA 3NOCA 3QZ7A 4G65A 2W2PP 3JQKA 1DQ9A 1IKXA 3GTYX 2BABA 3HD2A 2OPRA 4F4KA 4F4ZA 1WJ9A 3R5AA 4PYAA 3MM9B 5HVGA 2IC3B 4Q7AA 4NYZA 3MM7B 2DXDA 4UZBA 3GSIA 2VFUA 5G0RA 4WP3A 2DNYA 3KG0A 1ZM4A 1GMVA 3IP0A 3GYGA 5J2QA 4JOUA 1TKTA 4LVNP 1PJ7A 4LIWA 5IZHA 4LF9F 2A6MA 3RB4A 4NMXA 3PEJA 2MY8A 1IKWA 4KO0A 3QGIA 3CSKA 3CEDA 2UUAJ 3NG8A 1C0UB 1GXUA 1IKXB 1F60B 2JVRA 2QYCA 2OPRB 2EC0A 3SSRA 1S79A 3LO3A 4M95A 2NQPA 2HHQA 3O8WA 4UY85 5G0RB 2RJZA 2OFGX 4CQ1A 3H0PA 5J2QB 4M5DB 1TKTB 4QWBA 2KB2A 2QLBB 1O51A 2YX4A 1GQEA 4YMEA 5L38A 2J5AA 3I87A 2GZOA 2VG7A 1UZHA 3IWXA 3ILJA 2YKNB 4NLDA 4TLQA 2DXEA 4KO0B 1VK8A 4LR8A 3CJ0A 2AV5A 4DR2J 1RI7A 4CLPA 3BREA 2YQ0A 3GP9A 4C98A 2ROPA 4KE5A 2R8IA 4QJVA 3PX4A 1NB7A 1HARA 5HROA 3SV4A 1REGX 4NXNJ 4DQRA 2A10A 5KFBA 4CLUA 3CJ4A 2GJIA 2Y0SD 1Y4ZB 3CMAS 1K47A 5EGYA 3DLEB 3M8QB 5FLXU 2RNEA 4IFYA 3QLHA 1EARA 1RGVA 4UTGA 1SXLA 4DV4F 2MZSA 2VG7B 4KC5A 4IH6A 3KLGB 4ZPAA 4DQQA 4CP5A 2WW4A 4Y2KA 5ETMA 3W62A 2CKWA 3T5KA 3KLIB 2ZM6J 4NL5A 3JTOA 2YWWA 1V6HA 3QSYB 2VPWB 2JLFA 1XN9A 4PYDA 3LH2S 4PWDB 1KTQA 3GQCA 5DS7A 2XTDA 1S6QA 3E3XA 5L9NA 1DFDA 4ED2A 4N41A 1S76D 2ZH2A 2VJVA 1AUSL 4UT4A 3U02A 2MQNA 1SCJB 4IFYB 3QLHB 3AQPA 3VGVA 3Q23A 2IDLA 5K8NA 3S01A 3EGVA 1N8RT 4F8RA 4OJGA 4O3RA 5DM7Q 1HQEB 2CWKA 3UW1A 4NCAA 2XTCA 2EFOA 2HGNA 2KU7A 3EVMA 5L46A 1JNZB 4WJBA 3GJTB 5C24B 1UA0A 4DUYF 2VU5A 1TFYA 4LBIA 3CC2S 2DO0A 2NXEA 3JSBA 3HSZA 2MQOA 4ANCA 2JEJA 1FI4A 2HIYA 3WX4A 4MYUA 4KGVB 2R7SA 4ECQA 2QE5A 3EZOA 2ADCA 4CLSA 2ZH4A 2ZHAA 2DPJA 2V2QA 1GH8A 3H2UB 3W5YA 4W90B 3Q83A 4DV7F 1B0TA 1UCNA 2WB1D 1R8HA 3L7PA 3IA0A 5KFRA 2Y9HA 3MF5A 2FGCA 1JLBA 3H90A 2YWKA 4EO8A 2B9YA 4ID5A 2P6TA 3TI0A 4DX5A 3OVSA 4B3MF 3M9NB 1JQGA 2ERRA 3BQ1A 1A6LA 2VC1A 2DD8S 2XYGB 4YP3A 5AXMA 1S0MA 3VAGA 4ZCLA 2DBBA 2W2OP 3D3CJ 1QLNA 1Q5VA 2V8HA 5JVGQ 1SL0A 2ALYB 2GNKA 1RTDA 4PPDA 3NLCA 4PZVA 3AX5A 2DISA 5C42A 2KFZA 1PYTA 4O44A 1TU0B 3BDPA 2KDOA 3IC1A 1Q81T 4MIBA 1RE1B 4ID5B 1HBUA 1LFPA 2BX6A 3TUIC 3JAMY 4OI2A 1S1TA 3PEHA 4WYLA 3OUYA 4CH7A 2OD6A 1IJFB 5JVHQ 3BBCA 4LRCA 3D66A 3K59A 2J0SD 3ELHA 1RTDB 2DIUA 3C19A 1I94J 1X0PA 5G4DA 3RB3A 2HHXA 5C42B 4O44B 2VFVA 1SQEA 3HZGA 2IM2A 3SFUA 4USJC 2OEJA 4DSLA 3KFWX 3OFGA 1ZPVA 5SUHA 2HRTA 2IMOA 1S1TB 4OX9J 3CMQA 4OQJA 4F67A 2GQ2A 2PN6A 2RU3A 3OUYB 3CNQP 1QE1A 3DKDA 3K5LA 1C0TA 3D3BJ 2P9GA 3SCIE 4M5KA 2FJVA 1TUVA 1ZM3A 4C7QA 1N36J 2RE1A 4JI5J 4A8XA 2JLEA 2SXLA 1B99A 3CCZA 2L9WA 5IOLA 2AYMA 3MHYA 1EQMA 2DYAA 1VIOA 5H9EJ 4JI8J 4LF8F 2Y1LB 3D1QA 5KFDA 3FGVA 3NWGA 4CO4A 3WC2A 1MLAA 4RW9A 2KHDA 5EHHA 4KYZA 1T0TV 3FJ2A 5LMNJ 3POTA 3GLJA 3DRPA 4P2MA 1SJRA 2CQBA 4DL4A 2EBEA 4ILRA 4H4KA 3TJ8A 1QE1B 4AQYF 4IO9Q 1C0TB 2N7YA 1LW2A 4LSLB 1MW7A 3DOLB 2DR5A 2YNIA 1Q86T 4CDIA 4NI2A 5M2PA 2GQQA 2EFVA 2PMWA 4OHVA 1TMMA 3NWRA 1Q82T 4B9UA 4ZDNA 3U7JA 1HNXF 4YB6A 2HK2A 1YZ7A 1C4CA 1K9MT 5F8GA 2G9OA 2OSRA 2M2BA 3EGZA 4RW9B 2M52A 3M9OB 1K0TA 1WACA 3P6YC 3POTB 4FF3A 2VDIA 3DRPB 1R8CA 3V5RA 4DPUA 1LK7A 4USMA 3FBEA 1YQHA 1WI6A 2C3OA 3LOUA 1G4CA 1H7XA 2F7VA 2MKIA 2QO3A 1QTNB 2YNIB 2A0FB 2O5DA 1MWYA 2Y1RI 4RU2A 4F0HA 4UF4A 4NI2B 2UXBJ 1NPRA 1RWWB 1IVZA 2QFIA 2B4PA 3KJQB 1S1XA 5HK4A 3J80Y 1VQYA 1S1VA 3VGTA 4FF2A 4N8OA 4JI7F 2A18A 2E29A 2OHDA 2CNOB 1NAQA 3HT0A 4XK8C 4WU3A 2MKJA 3LAMA 3TNVA 4Y34A 4ZIVA 4QOTA 1D8YA 3DM2B 1NU4A 3H4DA 3BPDA 3E2EA 4EWTA 5KFNA 4DV6J 2BJ8A 3ZTRA 2EFGA 3GWCA 4ED5A 2ZH9A 2XYPB 1NJWA 4URQU 4MFBA 4DR5J 5DLGA 2J9CA 2VBXA 3DRSA 1MMDA 2PFDA 4LF5J 2BE9B 3N9UC 5LOQA 1IBKF 3TJAA 1FKAF 3M8RA 3ENQA 1S1XB 2XNQA 2ZWOA 2W2NP 1S1VB 2E9ZA 1UWAA 1KN6A 4DV5J 1HQ2A 5JXSA 1IXKA 4MMOA 1PAEX 1WHWA 2MXYA 1PGZA 3TAQA 4LFBJ 1Q8LA 1WKLA 2PEBA 4OYOA 5GMDA 5JMNA 1RHQB 1HKAA 2XMMA 4DR7F 1F9EB 1RT6B 4U96A 3LANA 2KG1A 4WP8A 4ELUA 3ZZOA 5JUMA 2GVDA 4XO0A 2PD1A 3OW2R 4DMZA 2CQHA 1RUSA 1WSVA 3R7SB 5D15A 2CYYA 4MFBB 5GMKa 3DRSB 3UN2A 2A3JA 3IRXA 2HFNA 3BO4A 3NGUA 2DPIA 4OYZA 1H74A 3EGNA 3W1YC 3A3NB 4ZVUB 2J9DA 4HL9A 3O6QA 4NYOA 3R97A 5KG0A 4X62F 4L73A 3KK2B 4RBUA 4C8OA 2DNZA 4H4MA 2RDIA 1FNOA 3SQGA 4OJHA 1WF0A 2LP4A 4JV5F 3P45B 4J91A 2FTRA 2ZD1A 3JSMB 4IFVB 2E1RA 5IC4B 2GVZB 5BYSA 2M70A 2GVDB 4U7UD 2CXEA 3PXGa 4CO3A 3HD1A 5LL6d 2G0JA 1O8BA 3RR8A 1CQNA 2NSCA 2CQIA 1RHKB 1KD1T 1RT7B 3CDEA 7FD1A 3PTWA 3Q8VA 4NRUA 3HDSA 1U6FA 3IRXB 1UEVA 1KQKA 4DZ6A 3KKFA 4C2MA 2DNQA 1MWZA 4WYWA 2F8MA 3MD1A 5ITHA 1AZSA 3PJ9A 3FEZA 3MFHA 1HR0J 1NJZA 4H4MB 1JLAA 3SQGB 1CJTA 1HNVB 1S72S 1U24A 2HVHA 2HRUA 3AD7C 1Z2LA 2B6AB 2VPYB 5KFPA 2W4PA 5C2CA 1HBOA 3KHRA 2ZD1B 2YX7A 4QWEA 5KG4A 5AJ3J 4RO0A 5HBMA 4ED8A 4CCHA 1NKCA 1AUDA 1FNMA 1S9EA 1QAJA 4UW2A 1KHWA 2RQMA 3B78A 3MECA 5LXYA
chains in the Genus database with same CATH topology
2KXHA 3GR1A 4I6AA 4PG4A 2EBGA 1LOUA 1TVRA 3G6VA 1FVQA 4J37A 3OL7A 1Z1ZA 4EZ6A 4Q0BA 4LF7F 2WSCC 4OZ5A 1JLBB 4BBYA 3G6YA 3RAQA 5GAGI 4KQZA 3G6XA 1LWCB 2FDNA 3AJ2A 1NKBA 2XMUA 2FVSA 2B43A 1FERA 4PXBA 2ASYA 3OTCA 2V9KA 4L3NA 2VBWA 4AL6A 4QIWD 2Q6CA 2CQCA 3I4HX 2HPUA 4HH1A 1M5OC 4C3MA 2FJDB 3SCLE 2W8LA 1E6VB 2LXFA 4O3SA 2A2CA 1I6JA 5KFGA 2V4RA 2KG1A 1X4FA 4LSNB 1KVJA 1XERA 1WF1A 5KFLA 5GADI 3LP1A 2D1CA 4OI3A 1D9AA 2RRAA 1T05B 4BC7A 3BEGB 3B4DA 1T7PA 2BACA 3MUVP 1XMBA 3KNGA 1HYSA 2JFDA 2WW8A 2ZITA 1HBOB 5HL7Q 3OV7A 1U8SA 3JYTB 1VBXA 4RLEA 1B64A 2RQCA 2WSEC 4ILMA 1ZTWA 2G4BA 3DFEA 3KMQA 2HZCA 2ATLA 2GHVC 2E5IA 3UD3P 5H9FJ 2PA8D 5HBMB 4Y3CA 3UNGC 1OPZA 4B3SF 3US5A 3O5TB 3MEGB 3HX9A 1LFWA 3GB0A 3CXCR 1NEEA 2ZOGA 3PJXA 1S6OA 2CPYA 1S6UA 1HBMB 1S9EB 1HPZB 2L48A 3K5PA 2R8KA 2GA7A 4IH5A 5EWFA 4HKQA 3ITHA 5IT4A 4CH1A 1R8PA 1FRLA 3DOKA 4DV3F 2LA4A 1VQ5S 3MECB 1R6YA 1SIZA 1C4AA 3V6JA 3R1LA 4C8ZA 3KMSA 1N0VC 2PE8A 1LQ9A 2I38A 3PJWA 4ZMMA 2C2DA 1CEZA 3K5MA 3NBPA 3HHLC 3CCWA 2EK1A 2RQ4A 3OL6A 2ADBA 2AP6A 3LW5C 2QIFA 4LUBA 3V81A 4F3OA 1JLEA 2IVMA 5GVQA 4JYAF 3BZQA 4ZKAA 2GGPA 4Y65A 3DLHA 3AHPA 3E51A 4C97A 1VBYA 2C22A 2B5JA 3IBWA 1TZ0A 4Z37A 3T1YF 3T1HF 2UZAA 1OO0B 4OX6A 2WRMA 2E9RX 1HBUB 2CJ9A 3M4XA 4ZPTR 3RTVA 4I67A 2D9OA 2MJUA 1KC8T 3J7YU 3HMJG 2LQ5A 4UQTA 2A2DA 1QVFR 2AGPA 1Z4UA 3I4PA 4BWJA 2P5VA 5CYQA 4PXDA 3LP1B 3KWMA 3LQVA 1QJHA 1LKZA 3QGPA 4L72B 3CF5Q 2DR9A 1OS5A 2DH8A 3SCKE 3ISNC 3NL0A 4K5SA 2CVIA 3MMCA 5CH7B 4YB5A 4WFBQ 1HYSB 4IKAA 1LWFB 2DNNA 1MROA 5AXNA 3MM9A 3R27A 1OQ6A 2FGOA 4PUOA 1TR0A 2IC3A 4EO6A 4YQWA 4QWAA 5LMUF 3MM7A 3AQOA 3FMBA 4R0JA 1RP5A 2LU2A 3HKWA 4FS2A 2BANA 3N28A 5KOXA 3CGIA 3V4MA 5HMZA 3PR5B 3DMJA 3SV3A 2ZKUA 3ITHB 4EYIB 4ZHRA 3MI7X 5K5MA 2VC0A 3GG1A 1RTHA 4KB7A 3DOKB 4NCGA 2OPQB 3M6UA 4WZQA 4NLOA 4A8WA 2LEPA 1X7VA