1KHVA

Crystal structure of rabbit hemorrhagic disease virus rna-dependent rna polymerase complexed with lu3+
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
497
structure length
493
Chain Sequence
FCGEPIDYRGITAHRLVGAEPRPPVSGTRYAKVPGVPDEYKTGYRPANLGRSDPDSDKSLMNIAVKNLQVYQQEPKLDKVDEFIERAAADVLGYLRFLTKGERQANLNFKAAFNTLDLSTSCGPFVPGKKIDHVKDGVMDQVLAKHLYKCWSVANSGKALHHIYACGLKDELRPLDGKKRLLWGCDVGVAVCAAAVFHNICYKLKMVARFGPIAVGVDMTSRDVDVIINNLTSKASDFLCLDYSKWDSTMSPCVVRLAIDILADCCEQTELTKSVVLTLKSHPMTILDAMIVQTKRGLPSGMPFTSVINSICHWLLWSAAVYKSCAEIGLHCSNLYEDAPFYTYGDDGVYAMTPMMVSLLPAIIENLRDYGLSPTAADKTEFIDVCPLNKISFLKRTFELTDIGWVSKLDKSSILRQLEWSKTTSRHMVIEETYDLAKEERGVQLEELQVAAAAHGQEFFNFVCRELERQQAYTQFSVYSYDAARKILADRKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-DIRECTED RNA POLYMERASE
publication title Crystal structures of active and inactive conformations of a caliciviral RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Rabbit hemorrhagic disease virus
molecule tags Transferase
total genus 167
structure length 493
sequence length 497
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2001-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1khvA05
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1khvA03
4.10.8.20 Few Secondary Structures Irregular Luciferase; domain 5 DNA/RNA polymerases 1khvA01
5K14A 1JLEA 1S1WA 4TY8A 4NLOA 4KB7A 1TQLA 5EUHA 5FDLA 3KLEB 1NNDA 2UVUA 4O3PA 4NLSA 4K50A 4ZVGA 3C6TB 2W8LA 4URQU 2VA3A 5KT2A 1C1BB 1DTQB 4O44A 5DG9A 2R2TA 3Q8QB 3MEGB 3OLBA 4WXOA 2YNFB 4ED8A 1D1UA 2FJVA 3I0RA 3PW4A 2ILYA 1C1CA 3Q8PB 4K4VA 5I3UB 4HYKA 1JLFA 4MK7A 2D41A 3EPIA 1HYSA 3CJ4A 3QZ8A 2OPRA 4RW7B 5KG3A 5HROB 1S9GA 5DLGA 2FLPA 1N6QB 2WRMA 4KHRA 1RT4B 1T03B 2J6TA 5KFWA 4J9OA 2AX0A 4IDKA 1KHVA 4RW9A 4ECXA 1R0AB 3IS9A 3DYAA 3V4IB 4NLYA 1OS5A 1RT2B 5F8HA 3D5MA 3LP1B 4GC6A 3QO9B 2BRKA 3G6YA 3LP0A 3BGRB 4R5PB 1S6QB 4IH7A 1CSJA 3DOKB 5EWEA 3LAKA 4J9SA 1S6PA 3DOLA 3G6VA 4NCGA 1RYSA 1J5OA 4NLUA 2IA6A 5KFAA 3GIMA 3MEDA 3LP2B 1UWBA 1S1VA 5F8IA 5F8MA 1HNVB 3E01A 3KLGB 3M9NB 4TYAA 2IM2A 5KT4A 4Y34A 3V6DB 5C42B 2UVWA 2B6AA 3MECB 1T05B 5HBMB 4JV0A 5KG0A 3I5BA 3ITHA 1LWCB 1LWFB 5J2QB 1RA7A 2W9BB 5KT5A 4RUAA 1C0UA 2FJWA 1RDRA 4KAIA 4KKOA 1KHWA 4Q43A 5KG6A 4NLVA 1HPZB 1S1UB 2IAJA 3CJ3A 1TKZA 5DQIA 2YKMB 5KFCA 1GX5A 4K4UA 1TVRA 3GIIA 2VG7A 1IKXB 3BSCA 2R2RA 1TKTB 4I2QB 5J1EB 3SI8A 4RNOA 4KFBB 4IH6A 4H4OA 2JEJA 2YNIA 4ZVHA 2XC9A 3N6LA 1BQMA 4R8UB 5EWGA 3Q8SB 2JEGA 2QV6A 3QGGA 4IRKA 4RW4A 1IKVA 3HVWA 3FQKA 3RB6A 1TL1B 1RTIB 4TY9A 2UUWA 4IG0A 5K14B 1JLEB 1S1WB 4TY8B 5FDLB 4XO0A 3TVKA 2C2RA 2XWYA 1QAJA 1D0EA 3RAXA 3KK3A 4K4ZA 5KG1A 2AWZA 2E9TA 3I5AA 1N5YA 3MTKA 4O44B 4LQ9A 4F4WA 5F8LA 4O4GA 3NBPA 1ZTWA 3I0RB 1C1CB 2ZKUA 5JXSA 3DLEB 3RBDA 4Q8FA 4URSA 1HQUA 1JLFB 3VQSA 1HYSB 1N48A 1T3NA 3CWJA 2OPRB 4MFBB 4IKAA 2BR0A 1SH3A 4YQWA 5KG4A 1QAIA 5KT6A 4DL7A 4JV1A 2HWIA 2VG6A 3NMAA 4NRTA 1S9EB 1REVB 3T5LA 4RW9B 4IDKB 2R8JA 4ECZA 4IQXA 3IS9B 3DYAB 3I0SA 1RT1A 2BE2A 4RNFA 2IC3A 4J9MA 2RF2A 3H5SA 2J6UA 1TP7A 4ZP8A 3FSIA 3DMJA 3E51A 4YMEA 1SV5A 3DRPA 5HP1A 3LP0B 1TKXA 3RB3A 4ZVEA 4I2PA 3PJXA 3KOAA 5F9LA 3NL0A 2IJFA 1S6PB 3QLHA 4IFVA 4EO6A 4F4XA 4EYIB 3DOLB 4TYBA 5L1LA 3PW0A 1J5OB 2AU0A 5KFFA 4RW8A 1S0MA 3IRXA 3MEDB 1UWBB 3QYYA 4DL5A 1S1VB 3E01B 1DLOA 5C5JA 1XR6A 1FKPA 4QWDA 3RAQA 3PJWA 3TAMA 3IN5A 1JKHA 2ZE2A 2B6AB 3HHKA 4RZRA 4G3IA 5KFKA 4O4RA 4EO8A 1VRUA 4J9QA 1HMVA 2ILZA 2YNGA 3ITHB 3T19A 4MK9A 5KFIA 4ECRA 4ECYA 4EBEA 3DI6A 2C2DA 5L1IA 1C0UB 3JYTB 3FFIA 2XGQA 4EBDA 1C0TA 4KKOB 5DQGA 2HNYA 4KO0A 1LW2B 2IAJB 4ICLA 4NLXA 1TKZB 3CDUA 4KBIA 5CYQB 1TVRB 3GV7B 2VG7B 2CJQA 4EYHB 4K4YA 3V6KA 4XPEA 3OL7A 3KLIA 4G1QA 2FVRA 1JX4A 2YNIB 5EWFA 3PR4A 1NHUA 4RNHA 3M8QA 5D3GA 1BQMB 1U09A 2DPJA 4RW4B 1IKVB 4IH5A 4YR2A 3OHBA 3GILA 3KHRA 1HQEA 1RT5A 3OL6A 5KFNA 2R8KA 4IG0B 3ISND 1IKWA 5KT7A 3IGNA 5KFBA 1EETA 5J2PB 3KK3B 5KFUA 1RT3A 3H40A 1S1XA 1N5YB 2VG5A 3H5UA 4NLWA 2WONA 2YNHB 3H98A 1RTDA 4O4GB 3T1AA 3T5JA 2OPSA 3NBPB 5CYMA 4RU9A 3BQ0A 4Y2CA 2ZD1A 2XI2A 4K4WA 4MKBA 1HQUB 3PW5A 1XR5A 1RT7A 1LWEA 3KJVA 5KT3A 3UDLA 2XCPA 2XGPA 3KK1A 3JSMA 2HMIA 4FBTA 4NLGA 1RTJA 1TV6A 2VG6B 3MR5A 3DM2A 5DG7A 1QUVA 3DLGA 2AGOA 4WFYA 3I0SB 2JEFA 1RT1B 2BE2B 3DRSA 5KFHA 3FQLA 5C24A 2IC3B 2RF2B 3UQSA 4B3OA 3DMJB 4IFYA 2XI3A 1SV5B 4TQRA 3SFGA 3DRPB 1TKXB 2I5JA 3LANA 4I2PB 3Q8RB 4TN2A 2IMWP 4K4TA 3IG1B 5KFXA 3QLHB 4ZMMA 4IFVB 3NGDA 5J2MA 1DTTA 3RBEA 4RW8B 5KFEA 4ED1A 3IRXB 1IKYA 2I1RA 1SH0A 2HNZA 1JLAA 2JC1A 1FKPB 3N6NA 3TAMB 2BRLA 2W9CA 1JKHB 2ZE2B 3PW7A 5JUMA 3H5YA 5KFPA 1S1TA 2IBKA 3MR2A 4ID5A 1VRUB 1HMVB 4XPCA 2R2UA 3GV5B 3DI6B 1T03A 3FFIB 4QWEA 4U7CA 1DTQA 5KFQA 1C0TB 1FKOA 3QIPA 4QWBA 2OPPA 2HNYB 4KO0B 4QWCA 2FVSA 4MK8A 3KLHA 4R0EA 1JLCA 2V4RA 1BQNA 4MH8A 5I3UA 4DL2A 5DLFA 3IGVA 4WFZA 3UPFA 3HKWA 4TXSA 4ECTA 2OH2A 2IJNA 3KLIB 4G1QB 2WB4A 1S4FA 4Q45A 3ISNC 4WYLA 5KFJA 5KFRA 3M8QB 1MMLA 2WOMA 5KFOA 3QZ7A 3CDEA 5I42A 4DEZA 2E9RX 1S9GB 5HLFA 4ECWA 1HQEB 1RT5B 2V4QA 4HKQA 1JLBA 4ZPAA 2HAIA 4WFXA 1HARA 2JC0A 3I5CA 4ED7A 1EETB 4ZPDA 3OL8A 4K4SA 2RDIA 3M9MB 1RT3B 1S1XB 5F9NA 4ECSA 4ECVA 4RNMA 3KNAA 4RNNA 3PW2A 2VG5B 4F4YA 1LW0A 4M94A 3PVXA 2WONB 1RTDB 4Q8EA 2OPSB 5CYMB 4ED6A 1ZETA 2R8IA 4ZP7A 5L9XA 5KFTA 3FRZA 3HVAA 2ZD1B 1S9FA 2W7PA 4M95A 2W8KA 2IM1A 3BSOA 1TL3A 3PHEA 4ZHRA 4NCGB 2AGQA 4ED3A 3EPGA 4LSLA 4O3OA 3UR0A 1JLGA 1RT7B 1LWEB 2R8GA 3KJVB 2JLEA 3KK1B 3FDSA 3JSMB 2HMIB 3GYNA 1RTJB 1TV6B 5DG8A 4DL6A 3M8PA 3QGIA 4I7FA 4MKAA 4TQSA 4IG3A 3BJYA 1S0NA 3MEEA 3DM2B 3DLGB 4PQUA 3QGHA 2OPQA 5C25A 5C24B 4LQ3A 3GIKA 4B3OB 3T5KA 1SH2A 4IFYB 4MIBA 2J6SA 4FBUA 1C2PA 3OLAA 1RTHA 2I5JB 3MFHA 2R2SA 4J9LA 1FK9A 1JIHA 4DG1A 5J2MB 1RT6A 3MR3A 2D3ZA 5KFVA 4FS1A 3CO9A 1IKYB 4O3SA 4QWAA 2HNZB 1JLAB 3OHAA 2FLNA 4H4OB 1JLQA 1YVFA 1MU2A 3MF5A 1QE1A 5J2NA 2W9CB 2B43A 3NAHA 3DLKA 2AGPA 1IM4A 1S1TB 4RW6A 1KLMA 2B5JA 3LAMA 4ID5B 5KFSA 5KFZA 5KFDA 4YP3A 2VA2A 4O3RA 3CJ5A 3V6JA 1GX6A 3BREA 4H4MA 2EC0A 2W7OA 1W25A 3V6HA 4J9KA 3RB4A 1HNIA 2RKIA 5KFMA 5KFLA 2W9AA 2BQRA 1I6JA 2FJXA 4NRUA 1RA6A 1FKOB 3DRRA 3EZUA 3QIPB 2OPPB 4KV8A 5KFGA 5EDWA 3KK2A 1T94A 3V81A 4WZMA 3KLHB 1JLCB 3SFUA 1EP4A 2WCXA 3TQ1A 4KHMA 3DLEA 1BQNB 3MR6A 2YKNA 4J9NA 4NYZA 2V9WA 4IRCA 4ECUA 5DGBA 4F4ZA 4QW8A 2GIQA 4MFBA 2O5DA 4LSNA 4YR0A 4Q0BA 2WOMB 5I42B 4TLRA 1S10A 3KHLA 5L1KA 4FS2A 3RB0A 5HLFB 2V0NA 1REVA 1S9EA 4NLDA 1SUQA 1JLBB 2HNDA 3D28A 3CIZA 4JV2A 4J9RA 3GV8B 3CJ0A 1XR7A 1S97A 2FVQA 2BANA 4NLRA 4ED2A 5DQHA 4PUOA 4DL3A 1LW0B 4MIAA 3QIDA 4U6PA 4DL4A 4PWDA 2GC8A 2FVCA 5HP1B 4WE1A 3OSPA 1ZTTA 2UVRA 1TL3B 4ZHRB 5KFYA 3C6UA 4Y3CA 4NZ0A 2IM3A 3HVTA 4LSLB 3H4DA 1JLGB 2UVVA 1VRTA 1DLOB 2ASDA 4QPXA 4KSEB 1S48A 3KMSA 5F8JA 5T14A 3KLFA 3M8PB 5J2PA 4RUCA 3KHGA 3OL9A 4I7FB 2WK4A 2ATLA 4IG3B 3MEEB 2YNGB 3KLEA 2C2EA 4Y2AA 3JYTA 4PQUB 2OPQB 3GQCA 4NLQA 5C25B 3C6TA 1WNEA 3H5XA 2JEIA 1RAJA 2UUTA 3DDKA 1LW2A 2E9ZA 4X2BA 1C1BA 2FVPA 2FLLA 3BQ2A 3MEGA 2YNFA 4ZPCA 1RTHB 5CYQA 4WYWA 4ZP9A 4ICLB 4ZP6A 1N4LA 1FK9B 3CJ2A 1NHVA 3G86A 4DG1B 2ASLA 4IRDA 3ICLA 1RT6B 3H2LA 5F8NA 3BQ1A 4YR3A 2WTFA 3H59A 4O3NA 2AQ4A 4IR9A 4RW7A 2IM0A 5DGAA 1JLQB 5J2NB 1MU2B 1QE1B 5HROA 5D3GB 3DLKB 2WHOA 2R8HA 1N6QA 4KE5A 4RW6B 1RT4A 1KLMB 2B5JB 2BQUA 1S0OA 5KG2A 2D3UA 1R0AA 4K4XA 3G6XA 1IKWB 1K1QA 4H4MB 1K1SA 1HNIB 2RKIB 1RT2A 3PR5B 3V4IA 1RYRA 3LP1A 3MFIA 3DRRB 3V81B 4KV8B 3KK2B 2YNHA 3QO9A 3BGRA 4R5PA 1S6QA 2CKWA 2QE5A 1EP4B 3DOKA 4JUZA 4J9PA 2C28A 2ASJA 3N6MA 2YKNB 2BQ3A 3CDWA 3BSNA 3CVKA 3LP2A 4LSNB 4NLPA 1HNVA 2GIRA 3KLGA 2RDJA 4Q0BB 3PZPA 3BSAA 3V6DA 4O3QA 5C42A 4IR1A 3MECA 5L1JA 4WZQA 1N56A 1T05A 5HBMA 1JXLA 2DPIA 1SUQB 2HNDB 5KG5A 4EEYA 5KG7A 1LWCA 1LWFA 5J2QA 2W9BA 4H54A 3M9OB 2C22A 4ED0A 3DRSB 3LALA 2F8EX 2BANB 1S49A 4PUOB 2D7SA 2HWHA 2AX1A 4ZVFA 1HPZA 1S1UA 3T5HA 4PWDB 3IG1A 4NLTA 2YKMA 4WE1B 4QW9A 2ALZA 3KHHA 1IKXA 1TKTA 3NKYA 3BR9A 4I2QA 5J1EA 2XCAA 3GIJA 4WXWA 3NAIA 1DTTB 4ECQA 4KFBA 4F50A 3C6UB 4IOBA 4OL8A 4EBCA 3HVTB 1Z4UA 3OSNA 4URGA 3H4BA 1VRTB 5F8GA 4Q44A 4GC7A 4R8UA 3KLVA 4ZPBA 3KLFB 3KMQA 1TL1A 1RTIA
chains in the Genus database with same CATH superfamily
1MLAA 4O3PA 2Y0BB 2AT1B 4M94A 2YNFB 5A6WA 3AOBA 2B8PA 2JRSA 2ATCB 4B9MA 1Q5YA 2GJFA 2WRMA 2L48A 1JK9B 2AIRB 1AFJA 4NA2A 2ZC4A 1TK8A 4FPRA 1TMMA 3UNYA 2EVZA 4NLUA 3E01A 2JH3A 4OIXA 4YOEA 2DNRA 3A3NB 2FY8A 3UD5A 3MM8B 4NZ7A 1AW0A 2YKMB 5IV4A 3GIIA 1FJGF 3SI8A 4KFBB 4QBUA 4QYZK 3Q8SB 4P7TA 2CJXB 3W1YC 1S1WB 3TVKA 2XZWA 2QSFA 3RAXA 3C15A 2H9ZA 3GPAA 3POTA 3MTKA 4LQ9A 2QL5B 1YIJS 2IDEA 3M8SA 2PDAA 3RBDA 5HVFA 1FVSA 3CWJA 2VDIA 2IA0A 4LRAA 2Q43A 3TZWA 3NMAA 1REVB 1I94F 3BBFA 3G8QA 2IVMA 3UVJA 3OR1B 4YMEA 4PXEA 1CVJA 1NUEA 4I2PA 3QLHA 4E8UA 3M7VA 2DVIA 2HFNA 1PCAA 2HURA 3TAMA 3PTWA 5KFKA 4PG8A 3GWCA 3BBCA 2LDIA 4LUBA 2FUG9 1HNWJ 4NLXA 2NXEA 4KBIA 4LRBA 4RJVA 1OM2A 1VLOA 2CJQA 1M5KC 1SQGA 2MZRA 4ANCA 2XYGB 3PXGa 1CJTB 1B7FA 4ZLPA 4DUTA 3HHLB 4O4GB 1WG5A 3NBPB 3BYPA 2W1BA 4Y2CA 1NZ8A 4MKBA 2R7WA 3L7UA 2VONA 5HSPA 2ACMA 2A3JA 3D3CJ 2N3LA 5LOQA 4N76A 3CMAS 2R7OA 3DRPB 4X4RA 4K4TA 1U49A 4IFVB 5J2MA 1NMEB 1DTTA 2E1AA 2I1RA 3M1VB 1U1QA 4JI3F 5JUMA 4ID5A 4Y2KA 1VBXA 4JV5F 4A8YA 1Q81T 4U7CA 1DTQA 3WQPA 3ZXWA 3HXMA 2RS2A 3H90A 5DLFA 4DDFA 1IWGA 2UV8G 1WG1A 1MMLA 2XHWA 4UOFA 2ROPA 4MTPA 2MZTA 5F0WA 5GADI 1HARA 3LQVA 4HVZA 1Q4RA 3K58A 2DNOA 1RTDB 5A6PA 2RNEA 4OJ1A 1EQ0A 2ZD1B 5B0FA 2IM1A 3BSOA 3CGIA 2KTQA 4Y28C 2MKKA 4B3RJ 1K0TA 4ETXA 3DM2B 4A8SA 3VAGA 5DM7Q 1VQPS 4ZJQA 3GU0A 1K47A 3GG0A 4DG1A 3A13A 1Y3KA 2O01C 3T41A 4ZK7M 2ZDPA 4PG6A 3BBBA 4DPWA 2W9AA 2FJXA 3DRRA 2HK2A 3D66A 3W9IA 1FJEB 1X5SA 3MM6B 1HIYA 3MMJA 3I9ZA 4TKTA 2BABA 1SKSA 6AT1B 4NEYA 1WWHA 1QSSA 2NREA 2W2OP 3KUGA 3CJ0A 4KGZB 4DHVA 2MQOA 3DGPB 5AJ3F 2CQIA 2YQ1A 2HAFA 2AJQA 2GX8A 2BM0A 2R7UA 3PV8A 3O8WA 2OI2A 4HLBA 4X65J 1FRJA 1G6BA 2E1PA 4U8VA 2MY7A 2KM8C 3CTRA 4WYWA 1H2UX 3MMAB 1FK9B 5F8NA 4NYOA 1WHWA 1FWPA 3AOCA 3PRBA 4OYWA 3ZZYA 4DV6F 3WIUA 2D3UA 2Y1IA 1K1SA 3P4UB 4NYPA 4G6VB 1N0VC 3OJUA 3CVKA 1NCLA 1R27B 2G2YA 1O6XA 4KIAA 2H1YA 2JNJA 1LWCA 2AJ4A 5E7OB 5J2QA 3W8PA 2M9KA 2XS7A 2F8EX 4WP9A 1BA3A 1VJQA 5IC4B 4ZVFA 2KRRA 3OFEA 3W66A 3KNGA 5AE1A 4IOBA 1SIWB 3RU0A 5LMUF 4B9UA 4I6WA 3TEHB 1M90T 4UQGA 2RAQA 3BGOP 4UOCA 2VA3A 1GK8A 4ED8A 4NXNF 3QZ8A 2QJ3A 4RW7B 4MKVA 4N56A 2M3DA 2XYHB 4J9OA 1VOMA 4C3LA 4OYZA 1OS5A 5F8HA 3ZTQA 3J7ZT 4RPFA 4C48A 4RX6A 3VQTA 5AXNA 5IT4A 2DK2A 2XB2D 5ETSA 2HVHA 5KG0A 1HBUB 2CYYA 1RGVA 3ITHA 3M6XA 1QAXA 3UN3A 3ZTRA 1N34J 1K0VA 3HHEA 3M2VA 3I96A 5CCMA 3PRVA 2QFJA 2GMLA 1PIEA 4QIEA 4ID8A 4RWWA 3RB6A 1JLEB 3B8HA 5FLXU 3LOUA 3ISZA 4CLKA 3GR1A 5CA5A 5CH7B 3G9CA 3ET6B 3PYDA 2IPOB 2OSRA 2O1PA 4UUXA 1N48A 5A0YA 3WX4A 1QAYA 3MD3A 2J9DE 4X62F 4JOUA 2R8JA 4C8LA 3M8WA 2VIHA 2DGXA 2U2FA 5KYVA 3I55S 1A7GE 3GTYX 2F7VA 1BMQB 1YGYA 2C3UA 5HP1A 2Z57B 3KOAA 5HMXA 3IWXA 2IYGA 1J5OB 3EGNA 1O51A 4JB8B 3MCMA 1L3UA 1X5PA 2X1AA 4XPEA 2DGUA 4RNHA 4C8OA 2CQ2A 3R27A 2PC6A 4CO1A 2CQPA 3D6TB 2N7YA 3FBCA 1SIZA 5RUBA 2CQCA 5A76A 5KT3A 3UDLA 2XCPA 2ZWOA 3KK1A 1VQ4S 2HMIA 2MY8A 2KXFA 3GYXB 2ZDOA 2HFUA 5L9NA 3R7BB 4K7QA 4A46A 4JV5J 3SFGA 1Q8LA 3MURP 4G1IA 4QJVA 1X4HA 1AZSA 4HTJA 2VPZB 1PO6A 1TL7A 3BYRA 4IYQA 2HNZA 5IM0B 2UXBJ 4LJMA 3KJFB 2BJEA 4QR1A 1U6BA 5KFQA 3VR1A 3KLHA 4R0EA 1JLCA 4FXDA 1MN7A 3S8SA 4ES1A 3IGVA 2DCUB 4TXSA 3WDOA 4HL9A 3PW0A 3ISNC 5KFJA 1FD8A 1MMDA 3EVMA 4HKQA 2Y9HA 6FD1A 2VG5B 4FYXB 4FN5A 4RKUC 4L74A 2PGCA 1TKDA 1M5VC 2DXDA 3A4TA 5DRKA 1U1MA 3FDSA 1UW4A 5DG8A 2O66A 3DU6A 3M8PA 4I7FA 2OPQA 2FJDB 3T5KA 4IFYB 3I32A 2AEJA 1R0BG 1CS4A 4O3SA 1FDAA 4L3KA 3QRQA 4DR7F 2B3TB 1Y5NB 1SKUB 2BW7A 2LXIA 3TZZA 4J9KA 5KFMA 1FKOB 2N4CA 5KFGA 5HQLA 4PXDA 1BQNB 2MLXA 1U7LA 2LU2A 4NWBA 3PFOA 3J7YI 3RB0A 3TQEA 4USHA 4QR0A 4U95A 2OTJS 4AL6A 3NNAA 5ETLA 4DV1F 1HI8A 2LQ8A 5DQHA 4DL3A 2DXFA 3RW7A 1RCOB 4LF7F 1HLWA 4DZ6A 4LF9F 1XNQJ 1S48A 3GSDA 2XG8A 3HM9A 1XERA 3TUJC 3CPWR 2YNGB 3JYTA 1RWNB 1RAJA 3DDKA 3TAPA 2DB1A 3QNWB 3IM8A 1T02A 3CJ2A 3TA2A 4M5IA 4P2SA 3DFEA 2F9JA 2ZKTA 5J2NB 3R1LA 2KFNA 2ALYB 1N6QA 5HN0A 2B5JB 4H4MB 1HNIB 4LFAJ 2NR0A 4C3KA 2YKNB 5G0RB 2Y3YA 2V69A 3Q8YA 4I67A 3V6DA 3ELHA 2RS8A 2DPIA 5LMUJ 5I4MA 2HS3A 1Z2LA 2ZZMA 1FRHA 2CG8A 2LYVA 5LM7E 3BH7B 1S59A 2JHEA 1HFEL 4DCJB 2ALZA 1UCNA 2XCAA 4ECQA 2NSCA 1TL5A 3MI7X 1TL1A 2MGZA 5FDLA 3AH6A 3VVTA 2DNZA 4J91A 4ZITA 9RUBA 3MEGB 2QEXS 3PM9A 1WEZA 2VBXA 4FF3A 3O44A 1RT4B 2J6TA 1U0HB 2P5VA 4IDKA 3D1HA 3BGLA 4L6V3 3V4IB 1ZAXA 1PYSB 4CO5A 4IH7A 4ZVSB 2F4FA 2LMIA 2VASA 3I4HX 5HJXA 5K9FA 2FYXA 4XIUA 4RBUA 2XMKA 4OX9J 1VLYA 3BZQA 2AYGA 2RSQA 2MZ1A 1RDRA 2YPZA 1VQOS 2I8EA 5DQIA 4DOZA 2GA7A 4EGLA 2R2RA 4OI6A 5HATA 5CD4H 3CC4S 1UWAA 1UVJA 3N6LA 1I5OB 2QV6A 3I4PA 3HSGA 1A0OB 1RAGB 3KK3A 3VAKA 2IY5B 3HSZA 3DOMA 1SI9A 5HQ8A 1KSPA 1BGXT 2APOA 2NZCA 2VQEF 2FD2A 2BOAA 3C19A 2DHSA 4DPOA 4NRTA 1U24A 4DV0F 4FF1A 1RISA 4C97A 3QBCA 4RNFA 2K1RB 3MAAB 1CLFA 3LP0B 1TKXA 1QJHA 2M8HA 5KFFA 1U48A 2OAUA 1U1KA 4F02A 1JKHA 3P96A 1RAFB 3NGKA 4KHPJ 2XGQA 1H7WA 2BEFA 1HQ2A 1NHUA 2D3OR 4IH5A 4CO4A 2YQ3A 4ES2A 4IG0B 3UCZP 1S1XA 4KTQA 3W3SA 1YRXA 3T1AA 2OPSA 2A0FB 3S6EA 1UFKA 4DV4J 1H74A 1K73T 1U6ZA 2ZOFA 3NGSA 2D68A 4NASA 3DMJB 1SV5B 3FBFA 5CXTA 5D4LA 1RTZA 4OI4A 4ED1A 4J9UE 1Q79A 4V1Ak 1W2BR 1PC4A 3H0PA 1DHMA 3LGHA 4LIWA 4FF4A 1TAUA 2YWKA 5ETKA 2VQFJ 3UDEA 2YPYA 1YSJA 4KT0C 3M8QB 4QYZJ 1ZBTA 3PW2A 1RWXB 2LA4A 2DKOB 2R9LA 3CCLS 4FPIA 3KJVB 3JSMB 2NXJA 1R0CB 4ALZA 1XMOJ 1RWKB 4DUYJ 2KM8B 2RT3A 5C24B 4FBUA 3M8YA 4A4JA 3OLAA 1RTHA 2R2SA 2W01A 4ILMA 3Q86A 2N7CA 3CJRA 3W5XA 5KOXA 4FS1A 2XSJB 3UD4P 3PKMA 4AXIA 4E98A 3C46A 1S1TB 3MMBA 3MM9A 3BREA 5KYTA 2EC0A 1T03B 2DISA 4M5KA 1KQFB 2MQ8A 4OLPA 2WCXA 1L3TA 2V9WA 1UFWA 3M30B 2O5DA 3BKTA 2CPJA 1REVA 4NLDA 4ENOA 1RAHB 4J9RA 2K3IA 1X4EA 1LXJA 3CJKB 2BANA 5GAHI 3L7OA 1WHVA 4BC9A 4BLGA 4MIAA 4U6PA 5HMZA 1Q1KA 4MIWA 1JJ4A 1IQTA 3AQPA 1H3DA 1IUJA 4C8ZA 4PCQA 2BJ9A 3HK2A 1DLOB 2FJAB 4W4MA 2DNYA 3T6JA 2KH9A 2DBBA 4F2RA 2C2EA 4FNIA 5E2QA 5C25B 1KONA 2AYMA 2PE8A 3SDEA 1N4LA 1NHVA 2HVZA 5A8KA 2IJRA 1SL0A 2CPYA 4O3NA 4JI0J 2ZEJA 2FGOA 4CLZA 3G6XA 1IKWB 1K1QA 1IBKJ 1RT2A 1NJZA 4UUWA 2ZHAA 4P7VA 3DOKA 4JUZA 1U1RA 1UVNA 2V1TA 4QIGA 2G4BA 2QSWA 4JI4F 3PIOQ 2LEBA 2EKNA 2HS4A 1RHJB 1CJUB 2WVBA 1EKSA 4LF8J 4CLUA 3M1VA 4BWJA 3IAM9 1Q8KA 1SJ4P 1RU2A 2VC1A 4C7QA 2DT9A 5GAEU 4F4YA 3B54A 2NUHA 3ILLA 4KB7A 2LECA 3AWRA 4ZVGA 1KKHA 1KTQA 1SC1B 2DGWA 1WF1A 4ANEA 5HROB 9ATCB 4E0DA 2OTLS 1NHKL 3DU5A 3OUYB 3QO9B 3M2RA 2YKPA 2HGNA 5HANA 3N01A 3W9JA 2CDRB 2B9XA 2KB2A 3PO4A 3EXCX 3MECB 5GMKa 1LWFB 2OELA 4W90B 3THTA 4KKOA 1KHWA 2XMMA 2IAJA 1S1UB 1H0HB 2VG7A 1UEKA 3FZBA 4O23A 3D6MB 2XC9A 5EWGA 1F5AA 3DRXA 3HVWA 3TOQA 2JDJA 4DN9A 1KVJA 2W24A 4EWTA 3PHTA 1C4AA 4K4ZA 2ZM6J 2QMWA 3GG1A 1SL2A 4NMLA 4P73A 3HJFA 2GJIA 4ZIVA 1D9DA 3VVUA 1NK4A 2VDHA 5FIIA 5KT6A 1Z1ZA 3VWSA 3UCUP 1R8PA 3RYLA 2HZCA 5IQ6A 1S6PB 3DOLB 2H51B 1M5PC 1S1VB 2GJ2A 4C98A 3BDPA 1NO8A 3FGVA 2KRBA 3EX7B 3IWLA 4ANDA 4WIQA 1V5VA 2X1BA 1HI0P 1VRQC 1HWIA 5J1NA 4EYHB 4NZ6A 5ETOA 4RL1A 5EWFA 5D15A 4L72B 2HBYB 4RW4B 1HQEA 2DNMA 3H40A 3MR7A 2RJZA 2B9EA 3H98A 5SZTA 1LOUA 4LSZB 1VI7A 1X4BA 2VPXB 2XZDB 1HQUB 3AOAA 4GKJF 2UZAA 2R7SA 1VISA 1ZA2B 4D3GA 1W2IA 1O8BA 3HKZD 1JMTA 3PFEA 4ZKAA 2I5JA 2IMWP 4EI2A 4QU7A 1FKPB 4DMZA 2W9CA 4BS2A 1C4CA 1QSLA 2R2UA 3GV5B 1YZ6A 3FFIB 2HNYB 4MT1A 2YTCA 1LFWA 3SZ2A 1U1LA 5KFRA 3QZ7A 1RP5A 5HLFA 4K5SA 2RVJA 2W7AA 1F5BA 1JLBA 4OHWA 1HHQA 4HHUA 1AUSL 2RDIA 1PC5A 2GVDA 2MJUA 3O1LA 2DO4A 4LSLA 3UR0A 3AHPA 2JLEA 3OTOF 3PY8A 2RQ4A 2YX7A 2AEFA 4OI2A 1UVMA 4B3OB 2J6SA 2EW9A 2KN4A 2J7UA 4QPTA 4KGVB 2HHWA 2UXDF 3TRGA 3UR3C 2B43A 3O2IA 4TU7A 4ZVPB 1KLMA 1WKKA 3OFGA 1I6JA 4CIOA 4NRUA 2OPPB 4KV8A 4ZS6A 2PO4A 3KG1A 4CTAA 4PAAA 5DGBA 1KWMA 2B4OA 2GIQA 4PG7A 1UMJA 4Q0BA 1P27B 3CEDA 1GEHA 3HT3A 1VJWA 4NX9A 1X4DA 4JV2A 2YWWA 1XR7A 2KJWA 2ZWPA 4FYWB 1T9UA 4PWDA 2FVCA 1NBEB 3NLCA 4B9TA 1WEXA 1UA0A 4DFKA 3BV8A 4ZHRB 2XMJA 3U1MA 3G8SA 2BOPA 1VRTA 2ASDA 2YX1A 1NAQA 3KMSA 4DLEA 4IG3B 3A8KA 4CWBA 4C0OC 1BE4A 1K44A 1T7PA 1H2TZ 4P6QA 3LH2S 1JLQB 2P6TA 5IS2A 2BQUA 4N8NA 4C4WA 1R0AA 2RKIB 5IC6B 5ETTA 2OJ3A 2QZ8A 3N6MA 1YKWA 1HNVA 2Y0SD 3PZPA 4IR1A 4WU2A 3UCGA 3D67A 2VL1A 3MUTP 3SV4A 2F4VJ 1S49A 3UFCX 2AJ1A 1HHSA 5J1EA 3GIJA 5IM0A 4IQMA 4C9DA 2FZKB 3HVTB 1ZAVA 1S6UA 2OEKA 4YB6A 5KT4A 3QAEA 4TY8A 3UN2A 2ZH8A 1MWQA 2B0GA 4K50A 3C6TB 2R2TA 5DG9A 2ILYA 3JS9A 5A8WA 4DCOB 3CC7S 2CVIA 4OYXA 4DPYA 1HYSA 2U1AA 4O0IA 1RADB 1TUVA 1VFJA 3GIRA 4KHRA 5B09A 1BXNA 3LP1B 2J7KA 4K59A 1VIXA 2AD9A 2IM2A 4DR3J 2UVWA 2C2MB 2KZMA 2C1EB 2ZBPA 3MPWA 2UUCF 3VGSA 4P71A 1QTNB 1R3NA 1HPZB 1TKZA 5KFCA 3TX0A 2M8DB 2DR5A 3J81Y 4V19X 4LFBJ 5BYSA 1Q7YT 1YJRA 4R8UB 1PYTA 2FY1A 4CI0B 1EAYC 4XO0A 1ZAWA 2GO9A 3AJDA 2HIQA 3TEGA 4CZCA 1X0PA 4J7CA 3QJPA 4RR5A 4GVBA 3DLEB 3PX4A 4P2FA 3R7SB 1BQXA 1M5HA 4USMA 2O67A 1QAIA 1JWWA 2V2KA 1UPPA 4N47A 3A3PB 2DITA 3PJXA 1RWVB 2QMXA 2CQGA 3IRXA 3FEXB 4DQIA 3E01B 4QWDA 2D74B 3EDRB 2YNGA 3OXLA 3FUYA 5AE2A 4DPUA 4MK9A 3GFXA 4UTGA 3E2EA 1C0TA 2NUUG 2XWXA 4U7UK 3NS7B 4K4YA 4ZPTR 1YJVA 1Q82T 3OL6A 3NNCA 3C15B 3POTB 3SCLE 2VICA 3CD6S 2MQNA 3SCIE 3JAMU 1R8CA 4B3TF 4QYRA 3KG0A 4F3QA 2MXYA 5DG7A 3TX8A 1S0VA 4OZJA 3UVJB 2XI3A 4TQRA 3PACA 5CQGA 4X4TA 1DZ5A 3QT6A 4I2PB 3QLHB 2ADCA 3OXFA 1MN9A 1IKYA 3R5BA 2VJVA 3TAMB 1F9HA 5ETRA 3FEZA 4DR6F 4LR7A 1PBAA 3VALA 2HZAA 4HR2A 2IJNA 3JQMA 3CDEA 3OTOJ 2JC0A 1RJJA 3TJ8A 3M9MB 5F9NA 1RK8A 3KNAA 3R3TA 3CCTA 1VR6A 1RACB 5L9XA 4KPCA 1U1PA 3EPGA 2CPZA 4ELVA 2XM3A 3QGHA 1FX2A 3AA8A 3AB4B 5IV3A 1GXLA 5J2MB 1N33J 3OR2A 2H3EB 4H4OB 1MU2A 3HZEA 3C3LA 4DR4J 1M1HA 4ID5B 4M1KA 1Q0NA 3TUIC 1AT1B 3CT9A 3SFUA 2XZTB 3L4BC 5AE3A 4YHHJ 3OTBA 5LSLA 4CO0A 1J2VA 2AJ2A 4BCAA 4F0KA 1JB0C 2EI5A 1S79A 2FVQA 4NLRA 1F9FA 3TNVA 2UVRA 3MXHP 3W8GA 1H98A 2M52A 4USJC 4OYMA 4QPXA 4KSEB 3R5JB 3KLEA 2GGPB 3PNIA 5IT9U 4QCLA 1Q78A 1ZM3A 4DF8A 2WVCA 1IR1A 4F4KA 4ZP6A 2ZBRA 4DG1B 2XMWA 2FQQB 2VBWA 5BR8J 2XMTA 3DHWC 4YY3J 3RRKA 3UO0A 2QYGA 4GRSA 5KTQA 4ED4A 3D2WA 2MHNA 2HFVA 3KKFA 3DRRB 3MZIA 4JI8J 3BGRA 1S6QA 1RWPB 1BWEA 3UDCA 3EGVA 2EBEA 2QLBB 4JI1J 1N5VA 3TWZA 3QRRA 1RWUA 4JI2F 3DLHA 3DRSB 2DYAA 5E33A 3EJMA 2BKNA 2E66A 1DQAA 2W2NP 2QYCA 5F8GA 1VBKA 2BKPA 3I6PA 2AP6A 3O6QA 1FFSB 5EUHA 1O0PA 3G71S 1BLUA 2L9NA 1G4CA 4WU3A 5L46A 5KT2A 3U27A 4WXOA 3BPDA 4ATNA 2KDOA 5IOLA 2IIHA 1JLFA 4P75A 2RU3A 2DHAA 4C6AA 2DRBA 1EHWA 2V2QA 2NZ4A 3F73A 3MPYA 3G6VA 3BS9A 1PJ5A 2XLKA 2V1SA 2DNNA 2SXLA 4DPTA 4LF6F 1UETA 1QTMA 1D9AA 1LWCB 5J2QB 1FRKA 4LFCJ 3AJ1A 3H25A 3H2VE 3MUMP 1AUDA 2EK6A 3JTNA 3L95X 4DQQA 1GT8A 3GJSB 2CZ4A 2CQ1A 2YNIA 3UD3P 1BQMA 5ITHA 1YBAA 1R7IA 3MM5A 1QVGR 2E9TA 3P5TL 4Q8FA 1HL6A 2EFVA 4Z7CA 3D68A 4LRCA 5ETNA 1D3WA 2AYEA 2BE2A 4WKYA 2E5GA 2Z2MA 1TP7A 2ZH1A 2HG4A 4EYIB 4GO7X 2ZJRQ 5CZVA 1DLOA 3HD1A 2ZE2A 2DR6A 4CP5A 4RZRA 3EVOA 1X9WA 3LGNA 3ITHB 2C2DA 1Q8BA 3M2VB 2NXUA 5DQGA 1FRXA 4KO0A 1LW2B 4ZDNA 1KEKA 1YZ7A 4KQZA 3A8IA 2P8IA 1PJ7A 3WX8A 2FVRA 2V94A 1U09A 4YR2A 1IKWA 1UW9A 2LXFA 1N36J 2YWEA 4TLQA 4LF5J 4HT5A 4JI6J 3OPKA 2EK1A 1WORA 1XMQF 2RDDA 4GKKF 5A0YB 3OT9A 2K06A 1XR5A 3ZZPA 3AT1B 3DN9A 4DR2F 1F60B 2LQ9A 3X3UA 1X9SA 3Q8RB 3AX3A 5BYRA 4V19J 2JC1A 2MKIA 5CHCB 5H9EK 3Q83A 2B4PA 2WW8A 1OY6A 3VAMA 1X5OA 2R7TA 2ZH6A 3MPDA 2J0WA 3PX6A 1L3KA 3UPFA 3HKWA 4ECTA 1SCJB 1FESA 4Q45A 2BJ7A 4J5OA 2CWXA 1EJ7L 3KUEA 4CH0S 1ZM2A 3OVBA 1S9GB 2VU5A 4ECWA 1HR0F 1LK7A 4K4SA 4L75A 5SUHA 4DF4A 3MTJA 3OUYA 3GP9A 2MJNA 2W7PA 5LMNJ 3GFYA 4NCGB 4O3OA 2MKCA 2HRYA 3KK1B 2HMIB 3M6UA 3GYNA 2WVFA 2QA4S 2EFNA 2JSXA 2HQCA 4B02A 4DX7A 1TL7B 2HNZB 3TR5A 2M88A 2MZQA 1QE1A 2AGPA 2I0XA 2PI5A 1IM4A 1OQ3A 4ZVQB 5KFDA 1F6TA 3AD9C 2M70A 3V6HA 2JEJA 3KLHB 1JLCB 1IBMF 5HO4A 3BKFA 2NQPA 4QW8A 3P49B 3GMGA 1ZM9A 1FNOA 2KKHA 4OJHA 3MAQA 4AL7A 1ELOA 2F8MA 3R2DJ 1WC5A 3OFHA 1GMWA 1H73A 3VCDA 4U96A 3H4DA 5F8JA 1N32J 3M8PB 4I7FB 2OPQB 3H5XA 5EN1A 4N7TA 2YVSA 4ZP9A 1TAQA 2YKOA 3ICLA 2LLZA 3DRYA 2HHSA 1G7CB 3UE2A 4F26A 4K4XA 4F3OA 1FFGB 3AAWB 1VBYA 1HNXF 4DR5F 1WC0A 4QZVB 3W60A 4B17A 2BQ3A 2R42A 4OQJA 2VFTA 3MPUB 1U0SA 3KLGA 1SC6A 2CDQA 4FNHA 4WBFA 1HNZJ 2W9BA 4H54A 1U4BA 2CJAA 1S12A 3T5HA 2NSBA 2XULA 4J90A 2HYIB 2DGQA 1M5SA 1D8YA 1W26A 4WP3A 4C3MA 2YX4A 2DRAA 4PWWA 3CB4A 2IRUA 4USIA 3OLBA 5IQQA 2D41A 1GMUA 2HGLA 2PI4A 4Y2MA 1N6QB 3TO8A 4DSKA 1VQSA 3TA1A 2XMUA 1AA1B 3LW5C 3IS9A 3DYAA 4LF6J 5E3QA 4NLYA 2BRKA 2V34A 4N8OA 2DGTA 2HSEB 2PT0A 3LAKA 3CW2C 5KFAA 3ETMA 1CQMA 3V6DB 3K89A 2UU9J 2VKRA 2CJKA 2RMLA 1C0UA 2D3O1 1HWJA 2RRNA 3R1HA 8ATCB 5LL6d 1GX5A 2LEPA 2CADA 2HWTA 3TJAA 2W2MP 3DHXA 2VJUA 3QGGA 4CT9A 1TL1B 2MGZB 5D0HA 5FDLB 2C2RA 2AF6A 3NNHA 4F4WA 1HWUA 2HKEA 2L08A 2DNQA 5M2PA 2COLA 1H38A 1T8EA 1CEZA 2R7QA 2CZVC 1PYOB 1SH3A 3ZNJ1 5DDRC 1S9EB 5IT0A 4IDKB 2HQIA 4ECZA 3DC2A 2RF2A 3H5SA 3Q89A 3FSIA 5DDOC 3CMQA 1IBLF 4RUHA 2XS5A 3PDNA 2XTEA 2CXEA 4KH1B 1FWLA 4OLOA 1XR6A 1XNRJ 3R5DA 3I56S 1RE1B 4O4RA 1VRUA 4ECYA 4JI5F 2VBZA 2WAQD 2KFYA 2E1MC 1Q5VA 4EMDA 3FSXA 1SL1A 2DPJA 3FZ2A 4ZIWA 2R8KA 1RT5A 3QFWA 3M4XA 1EETA 3KK3B 4FKYA 4NE9C 3ZZUA 3DOMB 4Z7YA 3IR6B 1TZ0A 1NKEA 1RT7A 1AB8A 1RHMB 4U9RA 3WC0A 3MR5A 5D4PA 4X66J 3PX0A 2ZOMA 5GVQA 3NP5A 4Y2IA 1UAWA 4CNZA 3UQSA 1TKXB 2F9DA 4TN2A 1RQ0A 2LCWA 3LWLA 1M1GA 1JKHB 5D0RA 3GZ7A 3UN5A 4NMXA 2Y1RI 2C3MA 4QIVA 4MK8A 1YLXA 3K5LA 1NLKL 4JP8A 4DL2A 1Q53A 3VTIA 2OEMA 5I42A 3F44A 1JNRB 1WTFA 4OI1A 3DXSX 4WFXA 2HVIA 1HI1A 2DNHA 3I5CA 3NGTA 1S1XB 5JMNA 1KDNA 2OPSB 3RJMB 1ZETA 3U02A 3HVAA 3EVWA 4HACA 2AGQA 4JI7J 4PQAA 3AQOA 2EXUA 3MEKA 3MUVP 1SBRA 1TR0A 2CG4A 3HMJG 3QGIA 4DXLA 4LMZA 1CBKA 3SCJE 4L76A 3ILOA 1C2PA 5KFVA 2X3GA 4XDCA 1YVFA 1NDKA 2DH9A 4RW6A 5KFSA 3CJ5A 1FXDA 3TARA 5KFLA 4DV3J 2ZZTA 1DBDA 3DLEA 4Z37A 1QSYA 2XNQA 1NK5A 4YR0A 1X9MA 4D3HA 4ZVTB 2PSZA 2V68A 4USUA 1QDUB 1S97A 3CSKA 2OEJA 1RU1A 1WHXA 1ZPWX 3EM1A 3C6UA 2IYIA 3CUNA 2HHXA 4Q2LA 2GQ2A 4RBVA 2VPYB 2G0JA 3T9NA 1RTHB 4OX8A 1NSQA 3VAHA 3K8VA 5FD1A 3TVYA 5D3GB 4EZ6A 3MMBB 3MM9B 3NS5A 2UUBJ 1Y3JA 1QUPA 2P9GA 2DGVA 5FLXY 2DR8A 2QA4G 4C8KA 1VQMS 4XTTA 4UQTA 3BSNA 1CJVA 1WOPA 3G8TA 3OTEA 5JVGQ 3BN4A 5HBMA 3D4JA 5F3ZA 5KG7A 5M2RA 2KFZA 3M9OB 3CCJS 2BANB 2BACA 1KP6A 3NMRA 4LRDA 4I4BA 1A6LA 4GC7A 2E7VA 2ZJQQ 2HHHF 1RTIA 1FEHA 4ELUA 4DU8A 2G13A 4MYUA 1XMBA 3SDEB 5I3UB 4M5LA 5A8KB 2HBZB 4HYKA 2K3KA 1QVFR 4DFPA 2HHVA 5E3CA 1RT2B 3DOKB 1RHRB 5F8MA 4Y34A 2B6AA 3FCHA 4P72A 2I2YA 4RUAA 3ENAA 1TL4A 4Q43A 3N0VA 4YS2A 4CH1A 4WJBA 4H4OA 1J27A 4DUZJ 2ZJPQ 5ADZA 2IFXA 5EGYA 1N5YA 4HDHA 4C0BA 1LQ9A 2MKYA 1HW8A 4IOCQ 1IBLJ 5JXSA 2HQ3A 1JXVA 1IM6A 3CCUS 3VQSA 4I6AA 2MLZA 4MFBB 1NJWA 4IKAA 5KG4A 2E5LJ 2FHJD 4CDIA 4IQXA 3EZ5A 3I0SA 4DV7J 3M2RB 3TVZA 5BJRA 3HCXA 4CLYA 2YBVA 1T0TV 1Y10A 1WF0A 4AQYJ 4EO8A 5IXUA 4ZVOB 2GGPA 5KFIA 3GFZA 4KKOB 3ZZTA 2C2KB 3BH6B 2IAJB 3E8OA 4NI2A 2JX2A 1S4EA 4B3MJ 2VG7B 1DY3A 1FA0A 2AZ3A 5E5NA 1UP1A 3R6GB 3M8ZA 1SVDA 3R2CJ 3R5GA 5KFBA 1X4GA 2CNKB 1RT3A 5E3PA 1N5SA 1HBMA 2NXCA 4F3MA 1NK0A 3NGUA 2AMCB 5GAGU 1UEVA 3PEHA 4DJBA 2JEFA 3DRSA 1KN6A 2ZH4A 1YI2S 3IR5B 1U8WA 2KVIA 2JWNA 1G1XA 2F1FA 4M5DA 2RU9A 2YWFA 1FDBA 3P45B 5KOWA 3T6BA 4QU6A 5LJ5Y 2Q66A 5A2QU 4P52A 3KDNA 1VQNS 4QWEA 3D1OA 1A9NB 3DXBA 4NL5A 4A8XA 4WFZA 4B3SJ 2GAHC 4FYDA 5IWAF 3VZHA 2J9EA 2HFOA 3ZTSA 1HQEB 4XAKA 2V4QA 4DSIA 1XWLA 4KGXB 4DR1F 2FGCA 1S9FA 2W8KA 1Q16B 1JLGA 2V5HG 2MEWA 4S0MA 1YITS 1S0NA 1J5EF 2FZGB 4YFUA 3IBFB 1SH2A 1FHTA 1RXOB 2I5JB 1DQ9A 2YKAA 2VOOA 2RB7A 2AZ1A 1RHKB 2W9CB 3NAHA 2XO7A 1FRLA 5DDQC 7FD1A 2AHOB 3LAMA 5KFZA 4CNYA 1NH7A 1ZOTA 4F7VA 3V6JA 3TI0A 2YWHA 3QJLA 1KFDA 1T94A 3QT7A 1WD6A 1EP4A 1MWYA 4J9NA 4NYZA 3C14A 1TUGB 2HZVA 2JFDA 2BUNA 5L1KA 4DV2F 4CQ1A 3B82A 5HLFB 2V0NA 3WZ0A 4K0KF 1JLBB 3CIZA 3W2VA 4NXMF 4PUOA 2GVDB 1X0FA 1IR0A 1KD1T 1FJGJ 3IFEA 4LSLB 3CJTA 2XQCA 1W7WA 3OL9A 1N0UA 4Y2AA 2VFSA 2ZUAA 1LW2A 1TK0A 1C1BA 1MG7A 3Q8VA 3BQ1A 4EUVA 2XS2A 5B0EA 5B08A 1KLMB 1OPZA 5H9EJ 4ZCKA 1I51B 4ILRA 1I94J 2J0QD 1RYRA 4KV8B 2XEXA 3NCQA 3DNCA 4R5PA 3EGZA 4CTAB 4ZVUB 3DCAA 2B7BB 1N88A 3JTPA 2KZZA 6FDRA 4Q0BB 3HPOA 4P74A 1N56A 2BDPA 1X8DA 1Y7PA 2AJ0A 2V8DA 1OY9A 4OHZA 3T1HF 2D7SA 4CYUA 4PWDB 1FWKA 1U6FA 1IKXA 2HVDA 3T1YF 4I2QA 4ED3A 1G2EA 3SQGB 2PIIA 1VRTB 4HH0A 2RUGA 4HI2A 1RZMA 2CQBA 1FRIA 2QFIA 2UXCF 3I0RA 3Q8UA 2H5IB 1FE4A 4HHHA 4FF2A 3OW2R 4OHYA 1S9GA 4ITSA 2AW0A 4BBYA 2E7WA 4PZVA 1FT8A 3VGTA 1R0AB 2HGMA 4ZLNA 3MMCA 1SPBP 1NK6A 1ZZFA 4J9SA 2QLJB 4NCGA 2WB1D 4QR2A 2QRRA 2KHCA 1HNVB 2QT7A 4LR8A 4JI3J 5IFMA 2CIMA 4PG5A 4CO3A 1RA7A 3K59A 1B99A 3OTCA 3W62A 2CVEA 4K4UA 2ZBCA 3CCRS 4P2MA 5J1EB 4FYVB 2I38A 5CZXA 4DSLA 4OFZA 4IRKA 3B4MA 3CCVS 4WKRA 3HULA 4TY8B 5B0GA 5JJBA 3O5TB 5KG1A 4UY85 2VKZG 1AXQA 2QIFA 5A8WB 1HYSB 2HQFA 3BPSP 2M7SA 3EE3A 4TVAB 3DLJA 5B0DA 3JSRA 2M0GB 3GE9A 1NDLA 4USWA 4ZVEA 3NL0A 3J7YU 3MAHA 3R97A 1F0XA 3RRHA 2C2NA 1HMVA 2JJ4D 4K2XA 2ZVSA 1TKZB 3GJTB 4OZ2A 3IRWP 5AXLA 4G1QA 1SQFA 4USVA 2PEBA 4YUDA 3AXKA 1SC4B 3AODA 1P9YA 3OVSA 2BM1A 3QT8A 4GVBB 1ZS6A 5AJ3J 3PW5A 4A8FA 2QLWA 4AD6A 1AYEA 1RTJA 2FZCB 2AGOA 5DZ6A 5E3AA 3HFVA 1KQGB 3NGDA 2PA8D 4P9SA 1D09B 2R4FA 3S01A 3IRXB 3QWUA 1R6VA 1JLAA 3PW7A 3H5YA 3MR2A 4DV6J 2K7JA 1DJ0A 3U1NA 2LQJA 1C0TB 1VYAA 2BA9A 1IXKA 2LEAA 3BO3A 2DO0A 2OD6A 1FCAA 2ACYA 4WYLA 5KFOA 3K17A 3BF4A 4ILLA 4BDPA 4PR6A 1RAEB 1T95A 3PRDA 3D9BA 3PVXA 4KY3A 2H65B 5KFTA 3W64A 2RHSB 5IZHA 4CLFA 2NPIA 1X7VA 2R8GA 4YDXA 3ADAC 1JJ2R 4DL6A 4C0HA 2C42A 3V4MA 2BKOA 4J9LA 4NXNJ 2V8PA 1SKWA 3CC2S 4NCAA 1IKYB 4QWAA 4A8OA 1G3OA 1H7XA 4X4NA 3A8JA 4MMOA 1FJ7A 1KR4A 4K0KJ 2BQRA 2J9CA 1R43A 1HNWF 4I68A 4KHMA 2N4DA 4WK3A 3RUBL 3HT0A 4OYBA 4IRCA 2CA9A 2DXEA 4FS2A 1S9EA 3T3FA 4HEA9 2HNDA 1IJEB 4EZ9A 2IRYA 2C2ZB 3G4SS 5D8HB 2BBEA 3MOJB 1ZTTA 4LR9A 2VC0A 2RQCA 1U47A 2ZVIA 5B0CA 3KLFA 5J2PA 1VQ9S 5DETA 2GIFA 3EWGA 3ENQA 4NLQA 4M5JA 1VDHA 2V67A 4UZBA 3OR2B 3S7RA 4PXCA 2GZOA 2J8SA 2IM0A 2FC9A 1MU2B 1GTEA 4KE5A 1WUUA 2MB0B 4X62J 2KU7A 4ZLLA 3MFIA 3GCWP 2VB6A 4J37A 4A8KA 4IO9Q 1UJ5A 3R8YA 3LP2A 4KYZA 3ZZ0A 4X4PA 2RDJA 2F40A 5C42A 5L1JA 4IO1A 3SYZA 2Z2YB 4EEYA 2H54B 1U8SA 4LIRA 1XC9A 1UVKA 5D78A 2M2BA 2VZ9A 3D3BJ 4DV5F 3IMQJ 4QW9A 1S99A 1PILA 1OYEA 4WXWA 4KC5A 3TYTA 2CJ9A 3H4BA 3KLVA 4B3RF 1L3SA 3KMQA 1RAAB 5K14A 3KLEB 4FVMA 4C8MA 4URQU 4O44A 2FJVA 4YN3B 4I0WA 2B4UA 2HQGA 2P9EA 4ZCMA 3HFKA 1RBAA 3RGIA 2XBPA 4RW9A 2O3DA 1T9TA 4B9NA 3BGRB 1S6QB 1RYSA 2DNLA 3MEDA 2V8HA 2B9WA 5B0BA 1VCTA 3AA9A 1V3ZA 2BXJA 3CO0P 4KAIA 4TNOA 2RQKA 3OBIA 4PWUA 1TVRA 2LXUA 3NGRA 3OJSA 2XMAA 2DD8S 4K5RA 1SQEA 4OX7A 4X65F 2MLYA 3FQKA 3BB5A 2BYCA 4KGMA 3TJ9A 4WPAA 1M5OC 1FXRA 4LBHA 1JLFB 1HWKA 4RLEA 2BR0A 4DL7A 3UI3A 2W4DA 2OMLA 1YDLA 3RB3A 1UVIA 1HBNA 1JJCB 2RH3A 2CQ4A 4RW8A 3C16A 1GAOA 1FNMA 2DR9A 4X84A 5T7LA 4DR7J 5GAHU 3VV2B 1F2GA 3RR8A 3M32A 3FVYA 3CDUA 4OZ5A 3GV7B 2GVZA 4L3NA 3D7SB 2OLWA 1RKJA 2W25A 2YNIB 5D3GA 2BMBA 1BQMB 1YG0A 4CLTA 4MAKA 3PYGA 3KHRA 1KTVA 3MM5B 2MKHA 3A1YG 1HW9A 4DV1J 2ZBQA 1P1TA 1XIQA 1YRUA 2QL7B 4LF7J 2XLIA 1T9XA 4GVLA 4LF9J 4PRFA 2E1CA 1TV6A 3SEOA 3ZC4A 2AJFE 1IN0A 3GCXP 1VHFA 2BE2B 3P8BB 3BN7A 4ZMMA 2G9OA 3L9ZA 5KFEA 2R3VA 5K5MA 2ZE2B 2IBKA 3G96A 3TA0A 1Q86T 3CDBA 1N34F 2QA2A 1X4CA 2ZC3A 3QIPA 4KO0B 4QWCA 2ZHBA 2FJEB 1P6TA 3KG4A 5I3UA 2OD4A 2WZ1A 4UF4A 2WOMA 2HAIA 3NXZA 4KJIA 4RNMA 1KC8T 5F0UA 2F8HA 1U02A 1URNA 3MEEA 1SKRA 1DARA 1YJNS 2CQHA 2RE1A 1VS3A 3UW1A 2MPUA 2A6MA 2BJ1A 2P9CA 4FP9A 4A8MP 3IR7B 2DEJA 3MR3A 1IBCB 2KI2A 1F5CA 3OHAA 3PCOB 3MF5A 1V9OA 3MCSA 3I31A 5A8RA 2VA2A 4NA3A 5L38A 3KK2A 5EDWA 4WZMA 1RBOB 3TQ1A 2H48B 1F9EB 1BWVA 4ECUA 4F4ZA 4P2XA 4MFBA 2WVEA 4EU0A 1S57A 3DLLQ 3IXQA 1GTHA 1SUQA 1IVZA 1FTCA 3NCRA 3W2WA 3GV8B 1NXIA 2CPHA 3QIDA 2A2DA 1WC3A 2HW3A 4WE1A 3AD7C 1I3OB 5KFYA 4USTA 1IR2A 5K8MA 4DQSA 2ASLA 2DHHA 2WK4A 2Z8QA 3JTOA 1FRMA 2PN6A 3GQCA 5JVHQ 4HHJA 4DSJA 2IHR1 1S5ZA 2E9ZA 1R8AA 4ZPCA 1Q8IA 3WBZA 5D77A 1L5UA 2UXBF 2VQEJ 1ZPVA 3H2UB 1QE1B 2Z56B 1CPZA 4AUKA 3LO3A 1P9QC 2PEHA 4DV0J 3EYZA 2L9DA 2D9PA 2R7RA 1WJ9A 2CKWA 4WFAQ 2ZNYA 5HL7Q 1SJ1A 1CJKA 4DV5J 4R25A 5KAKA 3QRPA 2GIRA 2CZ9A 2M5YA 4O3QA 1RBLA 2DNKA 2BVZA 5KG5A 3M2UA 3RRGA 4ED0A 4M5GA 2W4PA 2P6SA 3N4WA 3FKBA 3NAIA 4EBCA 1CG2A 3B4DA 2A2CA 1X4FA 1KRPA 1Q95G 2YKQA 4F8RA 1NNDA 3SSRA 2VPWB 3Q8QB 1UZDA 1WDDA 4DSEA 5DLGA 1KHVA 1ROFA 2RRBA 4HT7A 1CULA 2XNRA 1CSJA 3NRBA 2ZH3A 2DHGA 2FC8A 4F36A 1UWBA 5F8IA 3KLGB 1E6YA 4U8YA 4TYAA 1VK3A 3B78A 3JAMY 2W9BB 1X4AA 3M6VA 3GYGA 4LRFA 3HI9A 2BW2A 1KOHA 2XTJP 1XNQF 4Q5VA 2LQBA 2MYFA 5CAAA 1PBUA 2ZITA 2EWHA 1IKVA 2QL9B 4TY9A 5GAGI 1XN9A 1WOSA 2BJ3A 5F8LA 2FLOA 2P2CB 2ZKUA 3V2UC 4PG4A 2IMOA 4CM2A 3FJ2A 4YQWA 3JSBA 4R0JA 3RBZA 2K8GA 3J7A1 3IS9B 3DYAB 4J9MA 3QQCD 4LFAF 3R9LA 1FD2A 4WFBQ 1YTYA 1L3VA 2IJFA 4F4XA 4EO6A 4CO2A 1S0MA 4DL5A 3HHKA 2DGSA 4X64F 1VQ8S 1FO1A 3DI6A 1KVIA 1C0UB 1NM2A 3LA0A 1H6KX 1TMJA 2B51A 4ZA1A 1AROP 2XLJA 4M5MA 3OL7A 3KLIA 4UT4A 2CPDA 1QLNA 3TZXA 2B56A 4DI6A 4DX6A 3SSQA 3K5NA 2WONA 5CYMA 2DR7A 3N79A 3A3OB 4K4WA 4M8LA 3FCVA 4FBTA 5LT5A 1NK7A 3HO1A 3HHLD 3LTOA 3KYLA 3WC2A 1QUVA 2EKYA 2CQDA 2HEKA 2Y8YA 2RF2B 1DQ8A 1OJ4A 2VOPA 5LXRA 2RQMA 3SQGA 3AB2B 4OX9F 1NPPA 5KFPA 3QT5A 4A8QA 1VRUB 1R89A 2OSQA 3W5ZA 4QWBA 3CE8A 3PYEA 2FVSA 5IT9Y 1RWOB 5MLCV 1VQ7S 4WFNQ 3THVA 4OX6A 2LVWA 4CCHA 1NB2A 2PFDA 2QN6B 1S4FA 1S77D 3K8WA 4DQRA 4DEZA 3HF5A 5D6GA 4JI4J 1RT5B 5H1SV 1PAUB 4ZPAA 1EETB 5DM6Q 4ECSA 2E7XA 4B9VA 3OD2A 4RNNA 1LW0A 3SXLA 1MMNA 2MSTA 1V3RA 1RT7B 3RZAA 4ED5A 3T9ZA 3MM7A 2GNKA 3J80Y 3OVAA 4LQ3A 3GIKA 1H2VZ 1GQEA 5F3TA 3JXOA 3MFHA 1TTHB 1UVLA 2ZH9A 3K0JA 4OYIA 3RAMA 4PPZA 1RB0A 2QC3A 3DLKA 1YJTA 4KHPF 4AE5A 1LWXA 4X4UA 4C8NA 2W7OA 3BGUA 3GFHA 4EFAC 3V81A 1B7YB 1FVQA 1RWMB 1U1OA 1RHUB 5I42B 2RD5C 2DIVA 3ZNUA 4I64A 5ETVA 1NDCA 2M4MA 1OY8A 4DV4F 3FNNA 4HACB 2IM3A 2UVVA 2W2PP 3OV7A 3BEGB 1ULRA 5C2CA 2F63A 4KPYA 3CCWA 4IR9A 2E29A 5DGAA 2HHUA 4RW6B 5LSRA 2CQ3A 1VK8A 1FFWB 2VQFF 4J9PA 4H4KC 1JNZB 2VF3A 1YK9A 1IJFB 5LJ3Y 3GB0A 3BSAA 1T05A 1EIYB 3ETOA 5B7WA 4Y6IA 3DGVA 1MROA 2JZ5A 3M6WA 1TKTA 3NKYA 5THWA 1FNXH 3C6UB 3NWGA 2G2OA 1XMOF 4DUYF 3QAUA 4NLOA 1HBOB 1GH8A 1OWXA 4AXJA 1JQGA 3US5A 1VQYA 3C2PA 1C1CA 1TU0B 2OPRA 4GKJJ 2QGFB 3QSIA 2ZHOA 3KXDA 5KFWA 2AX0A 3AFGA 2H4YB 2G0CA 2OIHA 3D5MA 4GC6A 4PPDA 4CH7A 3G6YA 4C11A 5C2GA 5EWEA 5K8OA 4DN0A 4Q7AA 1CJVB 2IDLA 2ABYA 3EZOA 2EG2A 5HBMB 1FXLA 4JV0A 2FHOB 1UFLA 3CJ3A 3DLBA 1FE0A 1B4SA 3EXYA 1ITPA 3BSCA 1OO0B 2JEGA 2Q6CA 2KHDA 1YJWS 3H7HB 1RTIB 2UUWA 5BXIA 3AD8C 1D0EA 4E2FB 3K7RA 3ENWA 2V4JA 3ZZZA 4XDDA 3CJ8A 3EUNA 1GXTA 4JI0F 2KT2A 2MTLA 4JV1A 5LXYA 2VG6A 1RLCL 3T5LA 1IBKF 2VHGA 3N28A 4X64J 1RT1A 2IC3A 2RIJA 4ZP8A 2NYIA 4OHVA 1VMBA 3CNQP 2AU0A 3HDSA 4GO5X 5C5JA 3RAQA 2FB0A 3PJWA 2UXDJ 2B6AB 3ZFVA 2KT5A 4MYTA 3T19A 4TU8A 4EBEA 2DH7A 4X4QA 2ZUGA 4LF8F 2H4WB 2V50A 1FEEA 1PKUA 5E0OA 1JX4A 4BC7A 3UWTA 5KT7A 1T9YA 2C3OA 1N5YB 2C3PA 5GMEA 4HTIA 1NSKL 3Q24A 2MKSA 1LWEA 2GV1A 5HQMA 4DPXA 3DLGA 4WFYA 3I0SB 1KQKA 2ZNZA 3LANA 1LK5A 5AT1B 1CC7A 2HBQB 3VAJA 2L41A 3IM9A 3R5CA 1KVKA 2BRLA 2CJBA 4DX8H 1Y11A 4X4VA 1UPMB 5E41A 2OHDA 5HMWA 1QD1A 2WVDA 4NI2B 5L8RC 1RHQB 2V4RA 2JVOA 1WOOA 2J9DA 3N9UC 3NOGA 1WDTA 3EDQB 1TFWA 2Z2ZA 2VFRA 1NKCA 4ZPDA 1ACMB 2ZM6F 1RT3B 1HBMB 3ILJA 3CJQA 2K7KA 2DRDA 2GQQA 3RW6A 3W61A 1TL3A 2L3MA 1KOOA 1VQLS 2VODA 5J1PA 3OFFA 4PQUA 3NWRA 2RRAA 3GJRB 4ETZA 2V2VA 2XSFA 2AEMA 1YJ9S 1RT6A 4M5DB 2QMUB 1NU4A 3KDOA 2FLNA 4DZDA 1VBZA 2V8VA 4A47A 4Q2MA 5CD4A 4IRDA 4YB7A 1IWAA 3CDAA 4WWSA 3MR6A 4PXBA 1R8BA 3ULHA 2R7VA 3KUHA 2GMJA 1NKBA 4LSNA 4TLRA 1S10A 2EG1A 4L73A 4ED2A 2UUCJ 1NK9A 2OFHX 1E6VA 4OYOA 5H9FK 4USKA 1V6HA 2ASYA 4NZ0A 2VD3A 1JLGB 3MDFA 3G82A 2VH7A 1WACA 2DH8A 3KHGA 4W98A 5ETMA 3HVRA 3GSIA 1WNEA 4X2BA 3EGWB 2FLLA 2YNFA 4ICLB 4X4SA 3W63A 3SQOP 3G2XA 2JFKA 3CCQS 4WIIA 2HPUA 4ELTA 2JL9A 1B0PA 3W9HA 4U67Q 4CLPA 3L7PA 1S0OA 3LWMA 1NJIT 5B0AA 2IRXA 1UA1A 1KFSA 2QE5A 2GO8A 1EP4B 2B7CB 1TELA 1XEZA 3C14B 2Z30B 1MSWD 4BWMA 3J7AN 2Z2LA 4PEOA 5I3QA 3PG9A 3W2VB 3SIPB 3MM8A 2IVFB 4LF4F 3VGUA 4PUOB 1TK5A 2YKMA 2QO3A 5G4DA 4KFBA 4ZN1A 2W2QP 4M63A 1X60A 3D54A 3IWNC 3SBMA 4DSFA 3VHQA 1S1WA 3R5AA 2W8LA 4Z2XA 1V3SA 1C1BB 2A1BA 4G1PA 1S7IA 3PW4A 2GMHA 3WHIA 1SB6A 4B3TJ 3JSYA 4AT1B 2DGOA 2F3JA 3OR1A 1I1GA 3TZYA 3Q0AA 4R5PB 3H42A 1ZA1B 2BJ8A 2IA6A 4UZCA 1FTRA 1LEOA 4FXVA 1T9VA 3CCES 3JQJA 3LPYA 2Y8WA 2FJWA 2I6WA 1U25A 4DBQA 4CYUB 4NLVA 4DR6J 1IKXB 3FBBA 4I2QB 4ZCLA 4OMFG 3HHNB 3MOZA 3MWBA 2V8GA 3I87A 2XTCA 3ONQA 4N77A 1XQIA 2Q79A 1QAJA 1CJTA 3W7BA 2YXLA 1P8GA 3P3DA 2HFSA 3HHLA 4O4GA 2N82B 3NBPA 3HSDA 3I0RB 4WF9Q 1DAXA 1WC4A 1Y0HA 1XK8A 1N5QA 2Q3PA 2HWIA 2HBRB 2LKZA 3MMCB 2J6UA 3VAIA 3DRPA 2POKA 4IFVA 4J9VA 5L1LA 3CXCR 3P6YC 4DS5A 2KXHA 2XMVA 3CD7A 3O3LA 3CIMA 2OFGX 4WCEQ 3TUZC 2ILZA 4ECRA 1HD1A 2F4VF 3QPIA 1B0TA 2AKWB 1NJXA 3KJQB 5CYQB 4LF1A 1RKIA 3IP0A 1HHTP 4DCPB 1WELA 5KFNA 4I56A 2XY6A 2J5AA 1K9MT 2QLXA 1NPKA 3RTVA 2YNHB 1RTDA 1Y5LB 2DCLA 2ZD1A 3FMWA 4CLWA 2CFXA 3H20A 3HJVA 2E1RA 4OZ3A 4NLGA 2XGPA 1KNZA 1NH8A 1X31C 5K8NA 4ZOSA 3DM2A 3NG8A 1WEYA 5HVGA 1WTBA 3SSSA 5GAEI 4KH0B 2Z58B 3VZIA 2CWKA 3IBWA 1N5TA 3B6BA 4DR3F 4DQPA 1PSDA 1HMVB 3HP6A 5E3RA 2MDAA 4AFFA 4F0HA 3HLUA 3K5OA 2JVRA 4MH8A 3MM6A 2WW4A 4LFBF 2XYPB 4G1QB 2Z0GA 2NLWA 2E9RX 4YDDB 1NEEA 5D0GA 4JI2J 1REGX 2ERRA 1WC6A 1RAIB 3DGPA 3VF0B 4LVOP 2LFVA 3IBCB 3PHEA 4QQBA 2KT3A 4UY8T 3QMQA 3TP2A 1BD6A 1RTJB 1RSCA 2CNNB 4PKDB 2E5HA 3HSJA 3BJYA 2K2PA 3VAFA 2G1DA 4BHQA 3MMAA 1FK9A 4FVCA 5ETQA 4DL0C 2X3DA 3CO9A 1JLAB 3QWPA 3NCPA 4O3RA 1HD0A 1Q7LB 3J7Z5 2ZBIA 2XTDA 3EZUA 4I1TA 2KXNB 4AL5A 2CNLB 1SJFA 2W4CA 1UUJA 4MKYA 1RWWB 1Y00A 2HRTA 1F2HA 8AT1B 2DNGA 4F0MA 1S72S 4MJKA 2OKQA 3NY0A 4LBIA 2QTWA 4RU2A 1OQ6A 4KR0B 5T14A 2VFVA 2GQCA 4PYDA 1JXEA 2JEIA 2UUTA 5DV9A 4UOHA 4HI1A 4TU9A 2WTFA 3H59A 1KBRA 4QIWD 4RW7A 4F2SA 4CM0A 2VBYA 2I9SA 2PA3A 4PYAA 3PR5B 4Y00A 2H5EA 4WK1A 3BO2A 4LF4J 4NLPA 1UTAA 4ZLJA 3ENVA 4C8YA 2HNDB 1HBUA 3FC9A 1VHIA 2HWHA 2QG9B 4DFMA 3CCZA 2YWGA 2CRLA 3FSYA 5D4NA 1Z4UA 4Y65A 4WP8A 2QLFB 1OPIA 4ZPBA 3KLFB 5J2PB 2B4VA 5D4OA 2OP5A 1JLEA 1U45A 4NEZA 5EHHA 4OHXA 4NLSA 4IOAQ 4UOGA 1YHQS 1N33F 3ET6A 5DS7A 4ZN3A 2J8AA 2FIUA 3NOCA 2XHCA 1XMQJ 2PFFB 4DR4F 4GKKJ 2E5JA 2GCFA 1BY9A 4ECXA 1P1LA 3PKYA 4DR2J 3G6ES 1VC5A 2DTJA 4YHHF 1SC3B 1J5OA 3U7JA 2JLGA 1NB7A 4OV1A 3LP2B 5C42B 1SJRA 2OMOA 1OYDA 2JLFA 5HJYA 3BGFA 1B0VA 2E5IA 3UDVA 3F56A 2MQQA 5K14B 4ZVRB 1HR0J 2Y1LB 5A2QY 2AWZA 3I5AA 4O44B 2MKJA 4OZ1A 2FTRA 4K8RA 2YY3A 1U2RA 1MWZA 5BR8F 1RAOA 4URSA 3NS6A 1KQSR 2OGUA 1T3NA 4YY3F 2ZFHA 1M1KT 4RW9B 3Q22A 1NPRA 4JI8F 5HAOA 3RR7A 4JI1F 3D0GE 3MEDB 3QYYA 4G3IA 4OJ3A 4OI3A 1LNQA 1RLDA 1GMWD 3K57A 1TVRB 1IBMJ 2HS0A 1V5IB 4CLLA 1YX2A 3R6LB 8RUCA 3ISND 3SCKE 2DNPA 3RBXA 5EX0A 2NPFA 2VG5A 3H5UA 1RUSA 4IUFA 2KVQE 3D0IE 4RU9A 1U2CA 2YH1A 4I6YA 3BKUA 1GXUA 2QX0A 3S1TA 4F4AA 4ES3A 2R7XA 1KLNA 2D1CA 4OZ0A 2EFPA 1OSDA 2HHQA 1UJ4A 5KFHA 3FQLA 1URRA 2MMYA 4NOHA 3G87A 4IFYA 1HBNB 3IG1B 1FKAF 3RBEA 5C7PA 4RW8B 3C16B 3FMBA 1SXLA 1SH0A 2Z4PA 3GR0A 4C2MA 3IA0A 5T7LB 4FXWA 4XPCA 1HBOA 4LFCF 2BE7D 2HQDA 3QFHA 3M32B 2IBOA 1FKOA 2CNOB 3E3XA 1HNXJ 4DR5J 3THPA 1BQNA 2GVZB 3DDIA 2X7IA 3A12A 4X4OA 1F1BB 1AFIA 1Y5IB 3H8YA 4K2JA 5K8PA 4YB1P 1WC1A 4ED7A 1D9FA 1EX8A 3MPVA 1NZAA 1N8RT 1D8ZA 4ED6A 4NA1A 2R8IA 4ZP7A 4M95A 3AX2A 3JB9k 4JYAF 2DY1A 1TV6B 3ZO7A 2AYBA 4TQSA 3BR8A 1APSA 4M5NA 3TAQA 2KYZA 3QJJA 4I69A 1JIHA 4DS4A 3W65A 2MHEA 5CABA 3X1LB 3V5RA 5J2NA 1EQMA 2B5JA 1CQNA 2BV3A 4OZNA 5D0EA 2CAJA 2BZ2A 1GX6A 3FBEA 4H4MA 1W25A 1HNIA 3Q23A 1LV5A 3QIPB 2DIUA 1UEUA 2YKNA 3C66A 5G0RA 4CLSA 2WOMB 1ZM4A 5CYJA 2LDYA 1N36F 2HLUA 4LF5F 1WSVA 4JI6F 1JJHA 3D6FB 2GC8A 3M8RA 2B9YA 3WIVA 4Y3CA 4LBPA 5GADU 2B8QA 1FERA 2ATLA 2ZZNA 3MEEB 3BQ2A 3MEGA 2C2OB 3R7NB 1PGZA 4YR3A 1VC6A 3DKDA 3SV3A 1GMVA 3M05A 2CUYA 4B9SA 5A8RB 1RT4A 1U0HA 2BX6A 5KG2A 2BE9B 2X51A 3V4IA 2HK3A 3KK2B 3QGPA 2J0XA 2EPIA 2C28A 1S7HA 1RABB 2Q1LA 3SMZA 3VGVA 4WZQA 1SUQB 2ZH2A 4Y0FA 1DURA 3W2WB 2C22A 1RCXB 4JI5J 2WSCC 4NLTA 4WE1B 5LMNF 1Z2ZA 3BR9A 1DTTB 1FDDA 2V63A 4OL8A 3UNGC 3OSNA 4Q44A 4RUBA 1UZHA 5M2UA 2UVUA 2LU1A 1DTQB 1WKLA 2ZH5A 4OJGA 1MNEA 2F65A 3Q8PB 4OV6A 3CJ4A 5KG3A 3ZTOA 4ZJOA 3OXGA 4LF2A 2K1RA 3MAAA 1R31A 3GLJA 3LP0A 2FJBB 5LSOA 4HH1A 2CQ0A 1CJKB 2MQLA 1M0SA 5HMYA 5GMDA 3GIMA 3M9NB 5I3PA 2WBRA 1GNKA 1N52B 3I5BA 3M2UB 5KT5A 1LKZA 3D0HE 2HFZA 1YBUA 2D9OA 2PMZD 5H9FJ 4IH6A 3N5BA 4LREA 2XY7A 1N32F 1YBTA 1O5JA 5BYQA 4IG0A 1CC8A 4W92B 3MHYA 3AXMA 3LPEA 3IO1A 3CCMS 2HLTA 2FDNA 3J80U 2DHXA 3IC1A 3DMJA 3E51A 1SV5A 2UV8A 2YH0A 1CULB 5F9LA 2UUAF 4TYBA 2MZJA 2H5JB 1KS2A 1OSCA 1UWBB 1E6YB 1Y4ZB 3IN5A 3I82A 3LGMA 1HNZF 1VQ5S 2FHMA 3L09A 4OYPA 2NXNA 4OZLA 1NDPA 4ICLA 2X1GA 1U2FA 4PABA 3M8QA 1X5TA 1YJ7A 3OHBA 1IKVB 2C3YA 5ETPA 4U7UD 4NCBA 2A6OA 3QSYB 3BQ0A 1XTZA 5AXMA 1N54B 3HX9A 3KJVA 1HKAA 3JSMA 2WBMA 1OMSA 1S76D 3MCNA 2XO6A 5C24A 4A8WA 1UL3A 4FKXA 3KFWX 1R8HA 2CPIA 3MCOA 3J81U 2J76E 3I9V9 3FEYB 4P10A 1NRKA 2OUGA 2XSJA 2UU9F 1S1TA 1YJUA 2VFUA 3LF0A 3CF5Q 4CRJA 5HI7A 3DI6B 2ADBA 1T03A 3ZZRA 2G0IA 3KJNB 2NS1B 3Q2SC 7AT1B 1ZH5A 2OH2A 3M30A 3KLIB 2WB4A 2KL8A 4B08A 3Q2TC 1FDNA 4JYAJ 3PIPQ 1U26A 3CJKA 4ERDA 1WG4A 2WONB 1H72C 2KG1A 1UKUA 1LXNA 5CYMB 3FRZA 3HHLC 3F0NA 2ZH7A 2G2ZA 2HHHJ 2GHPA 2D69A 5C25A 2GFFA 2GW8A 2CPEA 4MIBA 3ZTPA 2EC2A 4ER8A 1FX4A 1SJQA 2DY9A 1XNRF 1FF2A 1FI4A 1WKJA 1K8AT 2A10A 2FPHX 4YP3A 1WI6A 1EARA 2G1HA 4WTYA 4ZCIA 2NYHA 1VC0A 3BM7A 3KHLA 3EMTA 3D28A 2CPXA 3HHDA 3GJQB 4KRWA 3KTQA 3CD0A 1FJCA 1EZZB 1LW0B 1CJUA 5HP1B 4DX5A 4JBCA 4RBTA 4GMKA 4FDFA 2YQ0A 1BHNA 4HDGA 2UP1A 4X66F 2GS8A 1GFWB 3MM7B 4AYBD 1F3VA 2RHQB 2ROEA 2DEIA 2EFGA 2FVPA 4F04B 1S6OA 5CYQA 3G86A 3ILIA 3H2LA 2QA1A 2MZSA 4FZVA 3C8YA 5HROA 3DLKB 1DFDA 3TANA 1EB0A 2HRUA 3L3CA 5HK4A 4LT6A 2Y1JA 3IAS9 5DDPC 3V81B 4N5SA 2YNHA 3QO9A 2JOQA 2MQPA 3CDWA 4O0NA 2V9KA 4DFJA 3MECA 1WSRA 1WF2A 1JXLA 4F25A 1LWFA 3LALA 3OQ2A 3CCSS 2VUGA 1S1UA 4JI7F 1AZSB 3AJ2A 4F50A 1OIAA 3AY0A 5T41A 1TQLA 1UJ6A 2HHPA 3HZGA 2F5GA 3PJ9A 1D1UA 1T3OA 2KO1A 1T9WA 4K4VA 5K20B 4MK7A 3EPIA 2WSEC 4YEAA 3RG6A 2FLPA 4ZJLA 2J7WA 3QATA 4FYYB 4DV3F 5AXKA 1PAEX 3DDNA 1S6PA 3DOLA 1XBWA 1QY7A 1S1VA 5FJ4A 4UW2A 1T05B 4XK8C 4NPOA 1MW7A 1MROB 2A18A 5KG6A 2N3OA 2CJYB 1TKTB 1PG5B 4RNOA 1CS4B 4ZVHA 4A48A 2EEYA 4RW4A 5IWAJ 2J0SD 4M5HA 1EKRA 1YRTA 4H4KA 2XWYA 3ZZOA 3HFZB 5EX3A 2EFQA 4DR1J 1ZTWA 3P5BP 1RI7A 1C1CB 2UUAJ 1HQUA 1HWLA 2OPRB 2OO4A 1Y9OA 4DLGA 2UUBF 4B9LA 4G65A 4OI0A 3K5PA 3D1QA 3CD5A 1SJ3P 1J5EJ 2X1FA 3HD2A 4C11B 1NJYA 3NEKA 3EICA 1FKPA 3AX5A 7FDRA 2KG0A 3LUYA 4J9QA 1VGYA 2Q6BA 3MD1A 5L1IA 2GAGC 3FFIA 3JYTB 4EBDA 2HNYA 1PJ6A 3V6KA 2EBGA 2GHWA 4WTOB 5DJBA 3PR4A 1R6YA 5L39A 3GILA 4DV2J 4QOTA 3CMES 4RWXA 3IGNA 5KFUA 4NXMJ 3GONA 4NLWA 2V4JB 3T5JA 4CT8A 2XI2A 5DZ7A 5MAOA 4F67A 2VV5A 1B70B 1BUXA 3MGJA 2MSSA 2VG6B 1YWXA 1ZYQA 1RT1B 2IC3B 1NSAA 4B3OA 1BC6A 1VIOA 5KFXA 1HA1A 3N6NA 2PMWA 2HIYA 2KJVA 4QIFA 1B64A 2OPPA 3F41A 4N41A 3JQKA 1VQKS 3KWMA 3K2YA 4ZPWR 1QM9A 4DUZF 2ZOGA 2HVEA 2FHKA 5DO2A 3OL8A 5CCLA 3CULA 4ECVA 3T1HJ 2PD1A 4Q8EA 2XZ2A 1NSPA 4DWIA 2PMHA 4ZHRA 3T1YJ 2DJWA 2E5LF 1LWEB 2LA6A 2E44A 1TFYA 4MKAA 4IG3A 3DLGB 4DV7F 3D6HB 2UXCJ 3PEJA 3TW0A 4YB5A 2D3ZA 1JLQA 3CJSA 4AQYF 2LQ5A 2GHVC 2RILA 3BDEA 3FRYA 3RB4A 2RKIA 2FHJA 1RA6A 2NCKL 4LVNP 1U1NA 3OTDA 4B3MF 2EFOA 2MQMA 2CPFA 1WI8A 3FK4A 1NK8A 1YQHA 1DRZA 1VQ6S 3W5YA 1IQZA 4EK2A 4DL4A 3OSPA 4KGKA 1B3TA 3U1LA 1TL3B 2V6AA 3HVTA 1F3FA 1WHYA 4RUCA 3BO4A 4PQUB 5U47A 2L9WA 3C6TA 2RUSA 2V2ZA 1LFPA 1RT6B 3PYFA 3PO5A 2XY5A 2AQ4A 1XJWB 5F41A 4RO0A 3N5FA 2WHOA 2R8HA 2ROGA 4DU7A 2LP4A 2HHTA 3FCWA 3LP1A 1ZZNA 4OYAA 2ASJA 3A8EA 5HVHA 4B3SF 4LSNB 1TUWA 2BJDA 1ICEB 4ZPVR 2KYXA 1T11A 2WSFC 2AV5A 2IVYA 3J81j 2AX1A 1HPZA 3IG1A 1E6VB 3KHHA 4URGA 3G82B 4R8UA 3TUPA 3K5MA
chains in the Genus database with same CATH topology
1S1WA 4TY8A 2CQBA 1FRIA 2UXCF 2ZH8A 4O3PA 2B0GA 4K50A 3R5AA 2W8LA 3C6TB 4Z2XA 1V3SA 2R2TA 1C1BB 4M94A 5DG9A 2A1BA 4G1PA 2YNFB 3I0RA 5A6WA 3PW4A 2ILYA 2GMHA 2JRSA 5A8WA 3CC7S 2CVIA 4B9MA 1FE4A 4FF2A 1HYSA 2U1AA 4O0IA 3OW2R 1TUVA 1VFJA 4OHYA 1S9GA 4ITSA 2WRMA 1SB6A 4KHRA 2AW0A 4BBYA 2L48A 3JSYA 1JK9B 2E7WA 1FT8A 2DGOA 2F3JA 1R0AB 1AFJA 2HGMA 4NA2A 5B09A 3MMCA 3LP1B 1NK6A 1ZZFA 3OR1A 1I1GA 2ZC4A 3Q0AA 2J7KA 4FPRA 4R5PB 1TK8A 4J9SA 4K59A 2EVZA 4NCGA 2WB1D 4NLUA 2IA6A 4QR2A 1VIXA 2QRRA 2KHCA 3E01A 1HNVB 2AD9A 1FTRA 2JH3A 2IM2A 4FXVA 2UVWA 2QT7A 2KZMA 5IFMA 2CIMA 4OIXA 4YOEA 4PG5A 4CO3A 2DNRA 3CCES 1RA7A 3MPWA 3LPYA 2UUCF 3MM8B 2FJWA 3K59A 4NZ7A 1AW0A 1U25A 3OTCA 4DBQA 4NLVA 1HPZB 1R3NA 1TKZA 2YKMB 2CVEA 5KFCA 4K4UA 3GIIA 2ZBCA 1FJGF 1IKXB 2M8DB 3CCRS 4I2QB 5J1EB 3SI8A 2DR5A 4ZCLA 3J81Y 4V19X 2I38A 4KFBB 4QBUA 4OMFG 5CZXA 5BYSA 4DSLA 3HHNB 4OFZA 3MOZA 1Q7YT 3MWBA 1YJRA 2V8GA 4R8UB 3I87A 3Q8SB 2FY1A 4CI0B 4IRKA 2XTCA 3ONQA 4P7TA 3B4MA 3CCVS 4WKRA 4XO0A 1ZAWA 1S1WB 4N77A 2GO9A 4TY8B 5B0GA 2Q79A 3TVKA 2XZWA 5JJBA 3O5TB 2QSFA 1QAJA 3RAXA 3W7BA 5KG1A 2HIQA 2H9ZA 3POTA 1X0PA 3MTKA 1P8GA 3P3DA 4LQ9A 4CZCA 4UY85 3HHLA 4O4GA 2VKZG 2N82B 1YIJS 3NBPA 3QJPA 3I0RB 3M8SA 1AXQA 4WF9Q 2PDAA 3DLEB 3RBDA 2QIFA 3PX4A 5A8WB 1FVSA 1DAXA 1HYSB 1Y0HA 1XK8A 1BQXA 3CWJA 2M7SA 1M5HA 2IA0A 2O67A 2Q43A 1N5QA 2Q3PA 1QAIA 3DLJA 2HWIA 5B0DA 1JWWA 3NMAA 3JSRA 2V2KA 1REVB 1I94F 2LKZA 2M0GB 3G8QA 4N47A 3GE9A 2IVMA 2DITA 3MMCB 2J6UA 3VAIA 3OR1B 4YMEA 3DRPA 4PXEA 1CVJA 4ZVEA 4I2PA 3PJXA 3NL0A 2POKA 3QLHA 2QMXA 4IFVA 4E8UA 2CQGA 5L1LA 2DVIA 3IRXA 3J7YU 3CXCR 3MAHA 3FEXB 1F0XA 3E01B 4DS5A 2HFNA 4QWDA 4DQIA 3P6YC 2KXHA 2XMVA 3CD7A 3TAMA 3RRHA 3O3LA 3CIMA 2D74B 2OFGX 5KFKA 4WCEQ 4PG8A 3TUZC 1HMVA 2ILZA 2YNGA 3OXLA 5AE2A 3GWCA 4ECRA 4MK9A 1HD1A 2LDIA 2F4VF 3QPIA 3GFXA 1B0TA 4LUBA 3E2EA 1C0TA 2NUUG