1KHVA

Crystal structure of rabbit hemorrhagic disease virus rna-dependent rna polymerase complexed with lu3+
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
497
structure length
493
Chain Sequence
b'FCGEPIDYRGITAHRLVGAEPRPPVSGTRYAKVPGVPDEYKTGYRPANLGRSDPDSDKSLMNIAVKNLQVYQQEPKLDKVDEFIERAAADVLGYLRFLTKGERQANLNFKAAFNTLDLSTSCGPFVPGKKIDHVKDGVMDQVLAKHLYKCWSVANSGKALHHIYACGLKDELRPLDGKKRLLWGCDVGVAVCAAAVFHNICYKLKMVARFGPIAVGVDMTSRDVDVIINNLTSKASDFLCLDYSKWDSTMSPCVVRLAIDILADCCEQTELTKSVVLTLKSHPMTILDAMIVQTKRGLPSGMPFTSVINSICHWLLWSAAVYKSCAEIGLHCSNLYEDAPFYTYGDDGVYAMTPMMVSLLPAIIENLRDYGLSPTAADKTEFIDVCPLNKISFLKRTFELTDIGWVSKLDKSSILRQLEWSKTTSRHMVIEETYDLAKEERGVQLEELQVAAAAHGQEFFNFVCRELERQQAYTQFSVYSYDAARKILADRKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-DIRECTED RNA POLYMERASE
publication title Crystal structures of active and inactive conformations of a caliciviral RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Rabbit hemorrhagic disease virus
molecule tags Transferase
total genus 167
structure length 493
sequence length 497
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2001-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1khvA05
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1khvA03
4.10.8.20 Few Secondary Structures Irregular Luciferase; domain 5 DNA/RNA polymerases 1khvA01
3I0RB 3MEGB 3MEEA 4IKAA 1JLBA 1S9EA 1TQLA 1N5YA 2YKNB 1UWBA 3IRXB 4K4XA 2WOMA 2R8JA 1MU2B 1U09A 5F8IA 4IG3A 4EO8A 5KG1A 2R2TA 1S1WA 3NMAA 2R8HA 4R0EA 1RTIB 4KAIA 2WONA 4ZHRB 2BQ3A 2HNZB 4RW7A 5C25B 3DMJA 2IJFA 2D41A 3LP0A 3DLGA 1SH0A 3V4IA 3DRRB 3TQ1A 3M9OB 3BGRB 3C6TA 1RT3A 2ATLA 3OL9A 1JLFB 1S4FA 5KFJA 3MR3A 1EETB 4NYZA 2WK4A 3LP2A 2QE5A 1HQUA 1S1TB 3MECB 4TYAA 4URGA 4R5PA 2AGPA 2JEFA 4KKOA 4EBEA 4O3RA 1C1BA 4LSLB 3M8QA 1VRTA 3Q8SB 2JC0A 3CJ0A 5JUMA 3KLEB 4DL5A 2FVPA 2FVSA 3DRPB 2W9BA 5KFIA 4LQ9A 3OL8A 2BE2B 4KHRA 5J2NB 5C42A 3MR2A 4IH7A 2JLEA 3VQSA 1S9GA 4MK7A 3I0RA 3MEGA 2C2RA 4X2BA 4FS2A 2YKNA 3IRXA 4MKAA 4ZP9A 3CJ2A 1MU2A 3H4DA 1OS5A 4RU9A 2IA6A 2D3UA 5HROB 2HNDB 3PJWA 4K4UA 3QIPB 5L9XA 1RTIA 4NLYA 4G1QB 4ZHRA 2HNZA 2QV6A 5C25A 3RBDA 3H5YA 4LQ3A 5KFUA 3DRRA 2VG7B 4ED0A 1RA6A 3BGRA 3FDSA 4TQRA 4KFBB 4ECXA 1JLFA 2O5DA 5J1EB 3BQ2A 1EETA 3MECA 1S1TA 4YP3A 1K1SA 4WYLA 4LSLA 4J9PA 4IDKB 3KLEA 4K50A 1SV5B 3BSOA 3DRPA 1R0AB 4Y2CA 2BE2A 4WZMA 5J2NA 3GV5B 1N56A 1N4LA 2VA3A 1TL1B 2YNGB 3GIJA 1RA7A 4WE1B 3M9NB 2J6SA 4HYKA 2BQRA 3QGHA 3GV8B 2UVRA 4KV8B 1MMLA 2HNDA 3NL0A 2ZKUA 5KT3A 5HROA 3QIPA 3SFGA 4G1QA 4RUAA 2WB4A 4Q44A 2W8LA 2VG7A 5KFBA 2IM1A 4YR3A 2IBKA 4K4SA 4KFBA 4RW9B 2AQ4A 3GV7B 5J1EA 4MIAA 5KFTA 3IN5A 4U7CA 1HYSB 2XGPA 3LP1B 2HAIA 4IDKA 5KFWA 1SV5A 4WFXA 4R8UB 3V6KA 1R0AA 1RYRA 4I2QA 1LWFB 4TLRA 3KK2B 1C0UB 3BSAA 3KK3B 4O44B 3QZ7A 1TL1A 2YNGA 3RB4A 1JLQB 3HKWA 2I5JB 2UUTA 1S0OA 4WE1A 3I5AA 2DPIA 4Q43A 5KFFA 4WZQA 2GIQA 2BANB 4KV8A 4M95A 3EPIA 4DEZA 3EPGA 3G6VA 4ZVFA 4ZMMA 1TVRB 2FLNA 1RT1B 2OH2A 5KFQA 1GX6A 2YNIB 4NLVA 2IC3B 4K4WA 4HKQA 3H5XA 4O3QA 4RW9A 3IGVA 2UUWA 3LANA 4RUCA 5KFYA 4IG0B 3TAMB 5KFKA 3PW4A 1HYSA 5L1JA 3KOAA 3FRZA 4WXOA 2V9WA 5F8MA 1DLOB 3KLFB 3JSMB 3LP1A 5KFXA 2E9RX 4NLDA 4R8UA 2HWIA 4ECYA 1LWFA 4KSEB 3FQLA 3KK2A 3PVXA 2D3ZA 1C0UA 1S1UB 2HWHA 3DLEB 3EZUA 4IOBA 4TY9A 4ID5B 5KFRA 1C0TB 4O44A 3KK3A 4ZPDA 1SUQB 5DQIA 4H4OB 4KO0B 1JLQA 2I5JA 2YKMB 2OPQB 4ECRA 3T5LA 2JEIA 4IRKA 4F4XA 3C6UB 3G86A 2EC0A 3GQCA 4ZPAA 2BANA 5FDLB 4ZP8A 5KG2A 2GC8A 2VG6B 3DI6B 1EP4B 1QUVA 4F4ZA 1TVRA 4J9RA 1RT1A 3GIMA 2YNIA 2B6AB 2IC3A 4M94A 4EYIB 4URQU 3N6LA 1FKOB 3DOLB 5KFLA 5KT5A 3OSPA 4IG0A 3TAMA 4NLUA 5F8NA 5KT7A 3GIIA 4YQWA 1DLOA 1HARA 4MKBA 4Y34A 3KLFA 3NBPB 2W9AA 3JSMA 4O4GB 3MFHA 4ECTA 2IMWP 3LAMA 3T5KA 5DLGA 3DYAB 1SH3A 4NLRA 4YR0A 4FS1A 5HP1A 1LW2B 1S1UA 3DLEA 4ID5A 1C0TA 4O3NA 2YNFB 1SUQA 2HNYA 4H4OA 4KO0A 4YR2A 2V0NA 2YKMA 1TKZB 2OPQA 5CYMB 2IAJB 3GYNA 2V4QA 2FLPA 3N6MA 3C6UA 2R2RA 2R2SA 4ED1A 5FDLA 1JLCB 3T1AA 3DI6A 2VG6A 4F4YA 5DG8A 1EP4A 1LW0B 3KK1B 4DL7A 4EBCA 4B3OB 4K4ZA 1S10A 1IKXB 2B6AA 2WRMA 3HVTB 2FVQA 3KLVA 3T5HA 3CVKA 4XPEA 1FKOA 3DOLA 4EO6A 4IFYB 4F4WA 5F9LA 3KLHB 5HLFB 3OL7A 5DLFA 4J9LA 4OL8A 1NHVA 3KLGB 3NBPA 4O4GA 4I2QB 2ILZA 3RB3A 2FLLA 4URSA 3DYAA 4IH5A 5EDWA 1S6PB 2RDJA 1S1XB 4ECVA 3UR0A 1LW2A 1NHUA 4MH8A 5J2MB 3E01B 1T05B 2YNFA 3MFIA 1W25A 2FJXA 4WXWA 3KHHA 4TYBA 3LALA 2BRLA 5KT2A 1JLAB 1S49A 2IM0A 2CJQA 1TKZA 2IAJA 3QYYA 5CYMA 5I42B 1K1QA 5L1IA 1S0NA 4KHMA 2ILYA 1RT2B 2VG5B 4PUOB 4NRTA 4WYWA 1IKVB 4DL6A 1JLCA 3M9MB 3V81B 4IR1A 3IG1B 1LW0A 3KK1A 4GC7A 1RTDB 4B3OA 4RW4B 1FKPB 1S0MA 1IKXA 4ECSA 4RZRA 3HVTA 4O4RA 3FSIA 1YVFA 3BQ1A 4QWDA 5DQHA 2C22A 4JUZA 1QE1B 2C2EA 4IFYA 3I5CA 3KLHA 3DOKB 5HLFA 3QLHB 4MIBA 4TY8B 3M8PB 3KLGA 4PWDB 3V6DB 2FJWA 1IKWB 5KG0A 1TKXB 3H5SA 4RW6B 3JYTB 1S6PA 3QO9B 1S1XA 1JKHB 5C5JA 2AGQA 1RT7B 5J2MA 4KBIA 3E01A 5KG4A 1SH2A 3PJXA 3BR9A 5EWEA 2AU0A 1TL3B 1S9FA 1T05A 1N6QB 3GIKA 1QAIA 4K4YA 4MFBB 3Q8PB 4ED6A 1JLAA 2XC9A 5I42A 4QWCA 2ZE2B 1RTHB 1RT2A 1RAJA 2VG5A 4PUOA 1IKVA 3DRSB 1HPZB 3H98A 4RW8B 3RB0A 3H2LA 4ICLB 3RB6A 1DTTB 4IFVB 3V81A 4NLQA 3IG1A 1JIHA 3HVAA 1RTDA 3ISND 2ASDA 4KE5A 1FKPA 4RW4A 5KFHA 4QW9A 3T19A 1ZTWA 3KHGA 2UVWA 3HHKA 4DL4A 3I0SB 2WTFA 5EUHA 4Y2AA 1QE1A 2R8IA 4Y3CA 2IM2A 3QGIA 2E9ZA 3DOKA 5F8HA 1BQNB 2AX1A 3QLHA 4TY8A 4GC6A 3M8PA 1LWEB 4PWDA 3V6DA 2C28A 2B5JB 4QWEA 1IKWA 3N6NA 1CSJA 1IM4A 1S6QB 4TXSA 4F50A 2W7OA 4ECWA 4ED2A 5HP1B 2VA2A 1TKXA 4RW6A 1JXLA 3CO9A 3QO9A 3JYTA 1JKHA 4J9KA 4ED7A 1RT7A 2HNYB 3DDKA 3PHEA 4EBDA 1N6QA 2JEJA 4NLTA 1T94A 3CWJA 1TL3A 4RNNA 4J9OA 1J5OB 4Q8EA 3BSCA 1RDRA 4MFBA 5KG3A 1NNDA 2R8KA 4DL2A 2RKIB 1Z4UA 2FJVA 2AX0A 2BR0A 3CDEA 4JV2A 4J9MA 2ZE2A 1RTHA 3H59A 2XWYA 4NRUA 1KHWA 3DRSA 1HPZA 4RW8A 5J2PB 2ZD1B 3MEDB 4ICLA 4TQSA 3I5BA 3UPFA 1DTTA 3KJVB 5CYQB 3FFIB 2C2DA 1QAJA 4IFVA 3ITHB 2IJNA 3KMSA 3V6HA 3OLBA 4I2PB 2XCPA 2R2UA 5EWFA 3PZPA 1D1UA 2YNHB 2XCAA 4O3SA 3I0SA 3D5MA 2W8KA 4MK9A 3BSNA 3CDUA 2WHOA 5KFCA 3BQ0A 1D0EA 3NAIA 1HNVB 1HNIB 4QWBA 3E51A 4ZVEA 1BQNA 4NZ0A 1HQEB 3KMQA 1LWEA 1RT6B 4Q8FA 2B5JA 3G6YA 4H54A 4EEYA 1S6QA 3TVKA 5EWGA 1FK9B 4NCGB 2HMIB 3PR5B 5KFSA 3RAXA 2AGOA 4WFZA 4JV1A 1RT4B 2B43A 3OSNA 1J5OA 1T03B 1LWCB 1T3NA 4O3OA 4IR9A 2ASJA 1HMVB 5KFEA 3H40A 2RKIA 3Q8RB 1VRUB 4ECZA 3IGNA 3MR6A 4H4MB 4ZVGA 4QW8A 3OHAA 4RNHA 4K4TA 2OPRB 4DG1B 3H4BA 4PQUB 3NKYA 2XI2A 5J2PA 2ZD1A 3MEDA 1I6JA 1KLMB 4IRCA 3KJVA 1S48A 3FFIA 5CYQA 5F9NA 5KFAA 3ITHA 3PW2A 4I2PA 5KT4A 1GX5A 1TKTB 2XGQA 2YNHA 1C2PA 5KG6A 3PR4A 3OHBA 3IS9B 2AWZA 1JLGB 4IH6A 4QWAA 3LAKA 2W9CB 4ZPBA 4ZPCA 5HBMB 1RTJB 4NLPA 3CJ5A 1HNVA 1HNIA 2OPSB 5KT6A 1ZTTA 1RYSA 4G3IA 2FVCA 1HQEA 5C24B 5K14B 1RT6A 2F8EX 3H5UA 2CKWA 4FBTA 1ZETA 2DPJA 1FK9A 4NCGA 3NGDA 5J2QB 2HMIA 3CDWA 4K4VA 1DTQB 3DLKB 3OL6A 4I7FB 4LSNB 2J6UA 2V4RA 1RT4A 3DM2B 3MTKA 4RNFA 1T03A 1LWCA 3NAHA 5KFPA 1HMVA 3KHLA 4NLGA 1C1CB 1VRUA 2I1RA 2BRKA 1BQMB 3QZ8A 4H4MA 1IKYB 5KG5A 3KHRA 1TV6B 2OPRA 4DG1A 1RT5B 4J9QA 4PQUA 5L1KA 5KG7A 1KLMA 3RBEA 2XI3A 3PW0A 4TN2A 4ZVHA 3MR5A 5F8GA 1TKTA 4KB7A 4XPCA 2W7PA 4QPXA 1WNEA 3IS9A 4XO0A 1JLGA 4NLXA 3OLAA 1REVB 3CJ4A 3KLIB 5HBMA 2W9CA 3CJ3A 3PW7A 1RTJA 2ALZA 2UVUA 4RNOA 2OPSA 5KFGA 5C24A 1XR5A 5K14A 4ZP6A 5DG9A 4FBUA 3UQSA 4ZP7A 5D3GB 2UVVA 4Q0BB 3V6JA 5J2QA 3QIDA 1DTQA 3DLKA 3ISNC 4LSNA 4I7FA 4U6PA 4ED3A 4IRDA 2J6TA 4NLOA 2FVRA 2OPPB 3DM2A 5F8JA 3BREA 4YMEA 1JX4A 5I3UB 4ED8A 1C1CA 4Q45A 2RF2B 1BQMA 1S1VB 4RNMA 1IKYA 4MK8A 2JEGA 1TV6A 1JLEB 1RT5A 5DG7A 3MF5A 2RDIA 2D7SA 4IQXA 5DGBA 3MEEB 5KFMA 1JLBB 3SI8A 1S9EB 3QGGA 3HVWA 1N5YB 1UWBB 2WOMB 2BQUA 4IG3B 1TP7A 4EYHB 1XR7A 5F8LA 3KLIA 1REVA 5KFDA 3GILA 3KNAA 2ASLA 4ECQA 1S1WB 3RAQA 4J9NA 1XR6A 3Q8QB 2WONB 3G6XA 4RW7B 4ECUA 3BJYA 3DMJB 2R8GA 3LP0B 1KHVA 3DLGB 5KFOA 4J9SA 5DQGA 3V4IB 4NLSA 5D3GA 1S97A 3C6TB 3D28A 4NLWA 1RT3B 3SFUA 3CIZA 5L1LA 4Q0BA 3T5JA 4JV0A 5DGAA 3ICLA 2JC1A 3LP2B 4R5PB 2E9TA 5T14A 5JXSA 1HQUB 2OPPA 1N48A 2IM3A 4KKOB 3FQKA 5I3UA 1C1BB 2GIRA 3M8QB 1VRTB 4O3PA 3UDLA 2W9BB 4DL3A 2RF2A 4WFYA 1S1VA 5KFZA 2WCXA 5KFNA 3PW5A 1JLEA 5C42B 5KFVA 1S9GB
chains in the Genus database with same CATH superfamily
4AYBD 1MU2B 4EK2A 3FNNA 1MWZA 2ZH7A 4KAIA 4DPTA 1JJ2R 1U0HA 1O6XA 4UOHA 1CPZA 2ROPA 4CNYA 2EC2A 4LSLB 3Q8SB 3CJSA 2CQ2A 1VQLS 2HHPA 3N79A 3SEOA 2LEAA 3R5AA 4CDIA 1VC5A 2ZOMA 1KKHA 1TAQA 3K5PA 4ZHRA 3MURP 1TTHB 4ECXA 4OZLA 4KY3A 4ZLJA 2KT3A 1SV5B 1SJQA 3MCMA 4GO5X 3PNIA 1SBRA 4OLOA 3JQKA 1RA7A 1NJZA 1FNMA 1FD2A 2BQRA 3W2VB 2WB4A 2NYHA 1X4GA 4CM2A 3PFOA 4I56A 1RKJA 2FGOA 1C0UB 3BSAA 4YHHJ 1X0PA 2ZWOA 1FDAA 2HZAA 3MAQA 4QU7A 4DR4F 1SJRA 3IGVA 3MCOA 5JVGQ 3PW4A 3M2RB 3KK2A 2U2FA 4Z2XA 2WBMA 3L4BC 1YZ6A 2LDIA 3EZ5A 2KKHA 4YB6A 3QFWA 3MZIA 4ZP8A 2CVEA 2GC8A 1SIWB 2CPZA 2F65A 1HHSA 4Y65A 2HYIB 4IO9Q 3KLFA 1UPPA 1T95A 3HFZB 4DV2F 2K8GA 3GSDA 3C8YA 1RLCL 2LEBA 1X9SA 1P8GA 3CC7S 5DV9A 4ZLPA 3VGVA 2FHJD 1NLKL 3T1AA 4MAKA 3KK1B 2B6AA 5HATA 3OL7A 2DY9A 4J9LA 2YX1A 1N54B 2M0GB 4DSEA 3TVYA 4URSA 1FTRA 1B99A 2KFYA 1FHTA 2RDJA 3S8SA 5CCLA 2MGZA 3GFZA 3MM9A 4LBPA 3JAMU 1HIYA 4B9LA 3HFVA 3T1HF 2QLBB 4NRTA 4WYWA 1DRZA 3V2UC 2XHCA 1QE1B 2OEKA 3CJQA 2V2ZA 3EYZA 1S6PA 5C5JA 1YSJA 5EWEA 1TL3B 1FF2A 4J5OA 4MFBB 1IBLJ 4RU2A 3T1YF 1CJTB 1U48A 2E66A 1YG0A 3MPDA 3RGIA 1FKPA 4WF9Q 4Y2AA 2DXFA 2IM2A 1UMJA 3D54A 2E9ZA 2AX1A 4USVA 1LWEB 2DRDA 3MMAB 4ECWA 5HP1B 1U1OA 1JXLA 2HNYB 2VD3A 1TUGB 5RUBA 3CWJA 2BOPA 2R8KA 3CD0A 3R7SB 2MQNA 3LWLA 2D68A 1KHWA 4TQSA 4F26A 3A1YG 1D1UA 4IOAQ 2EK1A 2EEYA 3KUGA 5F0WA 5DZ6A 3T6BA 4Q8FA 2FZGB 4H54A 3EDQB 4ED5A 4NCGB 1RI7A 4WFZA 5H1SV 2B43A 2O67A 3ETMA 2KYZA 3MMBB 3NS5A 3US5A 4C0BA 4ZLLA 1LKZA 3IS9B 4ELVA 3TJAA 1ZETA 2VFVA 1AFJA 2LCWA 3Q23A 3QFHA 3OTOJ 1RT4A 4B3SF 2YKPA 3GJSB 4E98A 2QLWA 4FVMA 2GJFA 2I6WA 4PG5A 1WNEA 3FKBA 3HJFA 2OPSA 5KFGA 2W2PP 5C24A 1XMQF 3JTNA 3UQSA 2KVQE 5D15A 3OTCA 4LSNA 1LXNA 3VAMA 4NZ7A 1UVIA 3THTA 5F8JA 2DTJA 3L7UA 3GFHA 3K0JA 3QATA 1TV6A 1JLEB 1RT5A 2AEMA 2CNOB 4ZIWA 1NB2A 3MEEB 1JLBB 1AUDA 2ZZNA 2WOMB 4DPWA 3KLIA 1Q8BA 3TOQA 4P2XA 3N5BA 3HXMA 4KKOB 1RJJA 3UNYA 1OJ4A 2DK2A 4CP5A 1S1VA 3W8PA 3PW5A 1DJ0A 4PPZA 1S9GB 3IRXB 4X62J 4OX9J 1QLNA 2CQGA 1EETB 4Z7CA 4A48A 4WIIA 3M8QA 1HKAA 2PFDA 2FVPA 4F3OA 1GFWB 1K0TA 2KI2A 1ELOA 2C2RA 2YH1A 1RWOB 1MU2A 1RISA 1PBUA 2RNEA 2QV6A 1NJXA 1Y0HA 1FRJA 3GPAA 2LECA 1U1NA 2GAHC 4YP3A 4OX7A 1Q81T 4LSLA 2IFXA 4RUBA 1RWWB 2F8MA 3H90A 4ZS6A 1B7YB 4B9UA 4WZMA 4NA1A 2VBYA 1FA0A 5LJ3Y 4KT0C 1EIYB 2X1GA 3ISZA 1IBLF 2XS5A 3D3BJ 4ANCA 2VKRA 2IBKA 2W25A 3G8QA 3GV7B 1F9EB 3R1HA 4U7CA 4X4UA 2VC1A 4LF6F 1SV5A 4I67A 4O44B 1SC1B 4RBTA 1MSWD 4LR7A 2MKHA 3L09A 3W2VA 2CIMA 5D4PA 2YNIB 2IC3B 4NWBA 4O3QA 4DSJA 5LSOA 5KFKA 2PI4A 1VBYA 1C0UA 4DV7J 5KFRA 2X7IA 4KH1B 1RHKB 4PKDB 2AMCB 1K8AT 2V1TA 5FDLB 2CQHA 4OMFG 2HBYB 1WEXA 4F4ZA 4A8XA 3G71S 2HQDA 3MPVA 2HVZA 3OSPA 2FTRA 2IVFB 3BGLA 3M8RA 1CQMA 3M2RA 4MKBA 4R25A 3W61A 3TR5A 1VYAA 3KYLA 2ZH2A 2MKSA 4F8RA 3OTOF 1UEUA 3FC9A 4KJIA 4AD6A 4F4YA 3OW2R 1YJRA 4PR6A 4IUFA 4C8KA 4DMZA 2G13A 2OEJA 4OYMA 1TZ0A 1VHIA 4OZ0A 1AXQA 2RVJA 4AXIA 1C4CA 4K5SA 4RL1A 1FDDA 5DM7Q 3LQVA 3T9ZA 4OZ1A 4ZVRB 2DHAA 3M9MB 3IG1B 3CDAA 3KK1A 3D6HB 4O4RA 1E6VB 2HIYA 4JUZA 1KVJA 3I5CA 1NUEA 3W5YA 3PFEA 5LMNJ 3GMGA 2AU0A 3W1YC 2JDJA 1YHQS 2LP4A 4F2SA 1DTTB 3S01A 1T9XA 4JI2J 3T19A 2UVWA 3HHKA 1VIOA 1QE1A 2BABA 2F1FA 1NSKL 1BGXT 1UFKA 4OI4A 2B5JB 4X62F 1WC1A 2WVFA 1RAHB 1TL3A 4OX9F 2DGUA 4MFBA 2ZZMA 4CO3A 2L9DA 1Y3KA 1CJTA 2C2DA 4EWTA 4WKYA 1N5QA 3GONA 4I2PB 1TMJA 3D5MA 4KIAA 3ENAA 5FLXU 2G2YA 1LWEA 3CJRA 3MMAA 3G6YA 4P71A 3QT8A 2JSXA 4I68A 2CNLB 1NZAA 4B3MJ 4V19X 2CPIA 2G0JA 2LQJA 4PYAA 2MZRA 4RNHA 1VISA 4ZCMA 2J9DE 2ROEA 2P9CA 4QWAA 5HBMB 3CJ5A 1YBTA 5GAGU 3MUVP 4NCGA 5J2QB 3CDWA 1KQKA 3EJMA 3SCIE 2VFSA 2AYGA 2DBBA 3MMBA 2ZUAA 2LYVA 2OTLS 2I1RA 3QZ8A 1I1GA 2OO4A 4QIEA 1YKWA 4DQIA 4KB7A 3IS9A 2XQCA 3P49B 3SQOP 3O44A 1PBAA 5ETLA 2A3JA 1IQZA 1UCNA 3M7VA 5I3UB 4LF8J 3BEGB 4USMA 1IXKA 3D6FB 3BYRA 3QGGA 4DV7F 4H4KC 2BQUA 4J9VA 1AT1B 1WC5A 4J9NA 4ECUA 1KHVA 2IIHA 5DQGA 4NLSA 3VAIA 2BYCA 4CYUB 1S12A 4F3QA 2E9TA 1X9WA 1VQ4S 1RWMB 4DN9A 4WFYA 1FNOA 1JLEA 4IQMA 3T6JA 3D9BA 1RWVB 3MEEA 4IKAA 1OY9A 1JLBA 2WOMA 4C97A 1VQYA 3ZNJ1 3C19A 2CJBA 3C2PA 3BBFA 3PACA 4FYXB 2QN6B 5L9NA 1S4FA 4KKOA 4O3RA 2A2CA 3WX4A 5K20B 2DYAA 2ZOFA 3OL8A 3ENQA 3VQSA 3AB4B 2V8PA 1S9GA 3KUEA 1SC4B 3IRXA 4MKAA 2YQ1A 4NLYA 2K7JA 3RBDA 4DV0J 4CO2A 2N4CA 3S1TA 1EETA 2RRBA 3HSZA 2HGMA 2XYPB 1FE4A 2NS1B 1NJWA 5LMNF 1LXJA 1QY7A 1PYSB 5ETKA 4F0MA 4ZN3A 4Q7AA 2W8LA 2ZDOA 4RUHA 3QAUA 5DO2A 5HI7A 1UVLA 3OR2B 3HKWA 1KBRA 1HWLA 2BA9A 4P2SA 4DEZA 4L73A 2QEXS 5E3RA 2PSZA 3N5FA 1KTVA 2UUWA 4PRFA 2JVOA 2X51A 2A6OA 3DLEB 1C0TB 4O44A 3WHIA 4B3MF 1DQ8A 3PJ9A 2HFVA 4YOEA 4J7CA 1U02A 1FWPA 2YNIA 2IC3A 3PTWA 1N34J 1D8YA 2WSFC 3LAMA 2CZ4A 3NS6A 4FYVB 4DFMA 4DWIA 4Y00A 5FDLA 2KFZA 3NWRA 1T8EA 5FJ4A 4ZIVA 4DR7J 3DRYA 2LMIA 2AD9A 2UUBJ 4GKKF 1M5HA 4I2QB 2VICA 2VPZB 2QC3A 2NUHA 1CQNA 5I42B 3CC2S 1RT2B 1JQGA 2VG5B 1IKVB 5GADI 2WVBA 5A0YB 4K59A 4LF8F 3BGUA 2EWHA 4X4TA 4TNOA 2U1AA 3OVSA 1RUSA 3ZZYA 4DPYA 3UCZP 1FERA 2RJZA 3JYTB 5LOQA 2AGQA 2BV3A 4N5SA 2FB0A 4DCOB 3PYDA 3DKDA 2DH8A 8AT1B 2ZE2B 4ZCLA 4RWXA 4CI0B 2Q66A 2ZC3A 3IG1A 5U47A 4KE5A 1E6VA 1N5SA 4WJBA 1VK8A 2NSCA 2NPFA 4QWEA 3N6NA 4X4RA 1PILA 4C8LA 1KC8T 1XK8A 5D0HA 3OVAA 2B9YA 1S57A 4QBUA 2RKIB 4YY3J 2NXEA 3G87A 1DTTA 3MMCB 2YVSA 4DQSA 1TU0B 2XCAA 2BW2A 3J7YU 2M8DB 2MLYA 1RT6B 1REGX 2B5JA 2DGSA 3IR5B 3LPEA 4DZDA 4DV0F 3PDNA 4OQJA 1LWCB 1L3VA 2CWXA 2VONA 3JSYA 2IRUA 2K3KA 1PYOB 3TWZA 1IWGA 4I2PA 1KOOA 1MW7A 1GX5A 2JVRA 3JSBA 3MGJA 1DTQB 3DM2B 4NLGA 2Z58B 1IBKJ 1FJGF 2HQIA 2DGOA 6FD1A 3PHTA 3PW0A 3MR5A 3RJMB 2W7PA 2YTCA 3GZ7A 2HHSA 5HBMA 2UVUA 3JSRA 4HDGA 2NXJA 4Q0BB 5J2QA 5H9FK 2J6TA 2M7SA 5HMXA 1PKUA 1S9EB 1EB0A 1U8SA 4LF5F 3G6XA 1KNZA 2XM3A 2H4YB 3V4IB 1XNQJ 2J76E 1S97A 1UAWA 3I82A 3K5MA 3MAHA 1FESA 5T14A 1S0VA 5I3UA 4DLGA 3UCUP 4OZ5A 3NGTA 4DV5J 3DHWC 2HS4A 4CIOA 4JYAF 1U09A 2GW8A 1FRLA 4LRCA 1VC0A 3DRRB 3OXGA 5J1NA 4CYUA 4PXEA 2XLJA 1VFJA 2DGQA 4DR7F 3DLHA 1PAEX 2UUBF 1R27B 3CCZA 3LA0A 4DDFA 2HG4A 1KVIA 1UVJA 3G8TA 5T41A 4Q2LA 3AXMA 5AE1A 2Y1RI 3FUYA 2MQPA 1KEKA 5ETPA 2AHOB 4NPOA 1RA6A 3ZXWA 2KXHA 1X5PA 4C3KA 1WI8A 4Y2CA 2P9GA 2V69A 5HSPA 3TA1A 3N28A 3R1LA 3UNGC 1RE1B 2IHR1 2XY6A 3GV8B 2BJ9A 2DNPA 2YKOA 3QJJA 2FYXA 1CJUB 2VKZG 1TMMA 1X4BA 2MKYA 5D8HB 1F9HA 3ZZPA 3KTQA 4P7TA 2ERRA 2O1PA 2XZDB 4ZVFA 3EDRB 3SV3A 2AT1B 5MLCV 2FHKA 1VR6A 3TRGA 3OD2A 3M30B 4LRAA 4HACB 3RYLA 5KYVA 2VPYB 1XERA 3JSMB 1N0UA 3OR2A 3D3CJ 5EWFA 3S7RA 4ZPDA 4TLQA 2WB1D 2DR9A 2P8IA 4HL9A 2NZCA 1WHXA 4EYIB 2HFSA 3P4UB 4YQWA 1G7CB 2IMWP 4K7QA 3DLEA 1ZM9A 1C0TA 1HW9A 1QTMA 4U7UD 3PX6A 1SCJB 3HHLB 5JMNA 5IC6B 2OMOA 1XN9A 1IBKF 2NXUA 4NYOA 4K4ZA 1IR0A 3CMES 4UUWA 2H9ZA 2RS2A 1OSCA 4EO6A 2P2CB 4OL8A 5HJXA 2Y8WA 1ROFA 2CWKA 5D0RA 2YX7A 1S1XB 1NHUA 1N0VC 1W25A 2FJXA 4BWJA 5A2QU 4PEOA 4DJBA 4ERDA 5CCMA 1RACB 2H3EB 5ETTA 3QGPA 3BBCA 1YWXA 2KDOA 2KFNA 3FBFA 3JTOA 3R7NB 1N32F 3CSKA 2MQOA 1XNQF 2IY5B 2BACA 4L3KA 3I56S 5I42A 4CM0A 1RTHB 1HBUB 1UA1A 1RT2A 2VG5A 1IKVA 5A0YA 5IV3A 1R7IA 2HVEA 5DDPC 2CAJA 1WSVA 3AH6A 2HIQA 4L74A 4GC6A 1IM4A 2VA2A 4JP8A 4K5RA 4G6VB 3JYTA 1KTQA 4DS5A 3HM9A 2YQ3A 1KQGB 2EVZA 3RR7A 3OJSA 2VOPA 1U0SA 2ABYA 2ZE2A 2ZBRA 2XLKA 2Z57B 3IM8A 1X9MA 3PEHA 2QMWA 1K47A 5HK4A 2WHOA 4L76A 3IWNC 4CLKA 5HMZA 1KS2A 2YXLA 3C3LA 3RAMA 2BKPA 3OSNA 4O3OA 1WSRA 2H48B 3HLUA 4DV1F 2RKIA 2D74B 4NEZA 4DQQA 3MMCA 3Q2SC 3E8OA 3LAKA 3BYPA 1RT6A 3AA8A 3HSDA 1R8AA 2OJ3A 4I7FB 4C9DA 1LWCA 3GYXB 3NAHA 1CC7A 2CPEA 3UR3C 5GAHI 2BRKA 4WCEQ 2B0GA 1R8PA 4TN2A 1AA1B 4P10A 3FMWA 3RR8A 4OX6A 1VQSA 4LVNP 1XR5A 1U24A 4ES3A 2ZH8A 1DTQA 4ILRA 1W2IA 3DM2A 4YMEA 3J7A1 2KHDA 3TUIC 2UU9F 1U49A 5C7PA 3EVWA 2ACMA 1TR0A 2LQBA 4PXDA 1PC5A 1F0XA 5DJBA 2CVIA 2QZ8A 2GVZB 4DCJB 3JS9A 1RU2A 4O0NA 4A8KA 3MM7B 4BC7A 1S1WB 2P6TA 4CTAB 2DO0A 2MXYA 4Q0BA 1RT3B 2HPUA 3JB9k 3LP2B 1AW0A 2C3OA 1NCLA 1Y3JA 1UFWA 1FDNA 3G8SA 4C3MA 1S9EA 1RTIB 5H9EK 2BQ3A 2GCFA 3BH6B 2JFDA 3V4IA 1V3ZA 1Y00A 4WP9A 3HHEA 1K44A 2XO6A 3R5GA 3KLEB 5THWA 3DRPB 3AT1B 2KTQA 2FC8A 2M3DA 5IWAF 5DS7A 2I38A 3DRRA 1IQTA 1YRUA 3BSOA 4G1IA 4J90A 1UFLA 2YBVA 3R5JB 3GIJA 1VJQA 3UDEA 4A8WA 3QJPA 5KT3A 2ZKUA 4LRFA 3ELHA 2IM1A 1WTFA 2AQ4A 4NOHA 4DR2J 3ADAC 3NNAA 3HMJG 3RW6A 4N76A 3TYTA 4TLRA 3TA0A 2QYGA 2I2YA 1FWLA 2OSRA 3QZ7A 5LM7E 3RB4A 3DRXA 2HHUA 5KFFA 3DGVA 2GIQA 3HP6A 4M95A 4A4JA 2OH2A 1RT1B 2Y1IA 1P9YA 1CJUA 1AUSL 1H3DA 4KHPJ 2R7SA 5DETA 1SUQB 3MD3A 2YKMB 3HD1A 2G9OA 4ZPAA 5CXTA 4IOCQ 1EP4B 4X65J 4FKYA 3ETOA 3RBZA 1UKUA 3M30A 4ZCIA 4YS2A 4HACA 2BBEA 3Q22A 3ZZOA 3JSMA 3HO1A 4O4GB 2IVMA 3BN7A 5ITHA 2N82B 1FFWB 2ASYA 2E7XA 2W2OP 3CCES 3CCRS 2V4QA 5ETMA 2CQPA 4YUDA 3BDEA 1RWPB 1SXLA 1R8CA 4IFYB 3KLHB 1Q79A 3KLGB 4F4AA 1T05B 1ZAVA 2RQ4A 3J81j 1N8RT 3LALA 5KT2A 1T9TA 2M5YA 3HHLA 4DN0A 1IBMJ 2MY7A 1IWAA 1H74A 5GAEU 3EXCX 5F41A 3ZO7A 3K89A 5GMKa 2OUGA 4NA3A 1NK4A 4PWDB 1KP6A 5D77A 1EKSA 2M52A 1NPKA 3QO9B 1S1XA 2CG8A 1NBEB 1O0PA 2XC9A 2PMZD 2ZNZA 3VZHA 5DDRC 3B4MA 1P27B 2LA4A 4QW9A 3GTYX 4Y3CA 5HQMA 1Y5NB 3M1VB 3CCVS 2GNKA 3SMZA 1YJUA 3PHEA 4EBDA 1FTCA 2JEJA 4NMXA 5AXNA 1WHYA 1RTHA 1HBUA 4LF9F 4NRUA 3SYZA 2FHMA 1RP5A 1R8BA 4X4QA 2MHNA 3EGNA 4DR3J 2KRBA 4DX6A 3TVKA 4FVCA 4MIWA 2QFIA 3GIRA 5EGYA 3IGNA 3C46A 4CLLA 1KLMB 1S48A 2EBEA 1YX2A 2G1DA 1WOSA 4I6YA 2NXNA 2LLZA 3SQGB 2M8HA 3HPOA 2J9CA 3IBWA 3GE9A 3WC0A 1LOUA 3CULA 1W2BR 5K8OA 2HW3A 3TI0A 1WDTA 1BQMB 4DR2F 1IKYB 1NPRA 2EBGA 5KG7A 2RB7A 5F8GA 4Q2MA 4UY8T 2MY8A 5KTQA 3ILIA 1NJYA 1WG5A 2LA6A 4I7FA 2FVRA 2OPPB 3D7SB 3CCWA 1X4FA 1R6YA 4NL5A 1H72C 1VHFA 2G2OA 4KHPF 2PE8A 1VQMS 5F8LA 5KFDA 3KNAA 3QRQA 5BR8J 2R7WA 4X65F 2H54B 2JC1A 1WUUA 2P6SA 2AZ1A 3QSYB 3OXFA 2BKOA 3MUMP 4K2XA 4ZVPB 3EGZA 3QRPA 1FVQA 2GVZA 1AZSB 5F3TA 2YKNB 3P6YC 3CJTA 3MM7A 4TKTA 1S1WA 2YWWA 4CTAA 3GCXP 1H73A 2CDRB 3FCVA 4DU7A 1RT3A 2WW8A 3VALA 2Z0GA 3LWMA 4NYZA 3AWRA 3GJTB 2QE5A 3LP2A 2UXCJ 3W9JA 2RQKA 2ZBQA 1ACMB 1GMUA 3A8EA 1FRMA 2ZBIA 3Q8UA 4FS2A 3AX2A 4AL6A 4MYTA 1RTIA 4X4NA 3TW0A 2XG8A 2PGCA 2RAQA 2B51A 3W66A 2O5DA 3KLEA 4K50A 3DRPA 1VBZA 1HNZJ 4OYAA 4CRJA 1VC6A 4DR1J 1VQ9S 3RTVA 4ZVOB 3UVJB 2DITA 1RAIB 5CA5A 2QL5B 4YR3A 4MIAA 4EI2A 1HYSB 3UWTA 1G4CA 1UP1A 2X1BA 3H0PA 5LMUJ 1HWKA 2RH3A 3HZEA 3LH2S 4P2FA 3QMQA 2UUTA 3MHYA 2PN6A 3HD2A 3T3FA 1PSDA 3AFGA 1IJFB 4ZMMA 2XLIA 3H5XA 1WG1A 5KFYA 3POTB 5L1JA 5IXUA 5F8MA 3BF4A 4NLDA 2HWIA 2WSEC 2M70A 4DR3F 2D3ZA 3NWGA 4H4OB 4KO0B 3FEYB 3BKUA 2YWGA 1KQSR 3A8KA 3G86A 3B8HA 1XBWA 2VG6B 1RHUB 2VQEJ 1RT1A 1KQFB 3K59A 1GAOA 1HI1A 5KT7A 3KDOA 3GIIA 6FDRA 4N8OA 2X3GA 3IP0A 4UY85 1M5VC 4O3NA 3M8WA 1SUQA 3VTIA 2YKMA 5CYMB 1WKLA 2B9EA 2R2SA 4ED1A 1EP4A 4QYZK 2AF6A 3BPDA 1NPPA 3IXQA 4QR1A 3A3NB 5HLFB 1ZZNA 4A46A 4O4GA 1UETA 3GJQB 3I4PA 2Z2ZA 4IH5A 1NKEA 3GSIA 2C2KB 1BMQB 2BRLA 1WEYA 1B0PA 2Z2YB 2FJAB 2HBRB 4HI2A 4JI1F 1N5TA 4QWDA 4IFYA 3KLHA 3CCMS 2ZH1A 4ID8A 3KLGA 1JXVA 2XZWA 5KG0A 1T05A 5BR8F 2CRLA 1YTYA 2EFNA 1GXUA 4CLWA 1VQ8S 4RW8B 2J9EA 3THVA 1YJTA 5EUHA 4WTOB 2RIJA 2IVYA 4PWDA 2Y1LB 3ULHA 3QO9A 5HVGA 3CO0P 4UOCA 4L3NA 1CEZA 4USJC 1KLNA 1A7GE 1Z4UA 2UXCF 3K8VA 3KMSA 3JQMA 1VQ6S 2YNHB 4DF8A 1HNVB 5ETRA 3M1VA 2GO8A 4EEYA 2XSJB 2VBXA 2EFOA 2DGVA 2QSWA 1T3NA 3SSSA 5H9FJ 4BHQA 2VASA 4ECZA 3OJUA 3FBBA 1XWLA 3NKYA 3SIPB 5F9NA 1C2PA 1HNZF 3G82B 4ZPBA 1SQGA 4DR1F 5IC4B 2CG4A 3RRGA 2HGNA 4I0WA 4K4VA 3OL6A 4B9TA 4FPRA 2RD5C 3MOJB 4DSIA 1XTZA 1BWVA 4USHA 1KLMA 3BV8A 2HHXA 5LMUF 3VGUA 1TL7B 3H2UB 4EZ6A 2HQCA 1REVB 1QAXA 3SQGA 3PW7A 3SXLA 1RBAA 4LREA 4FBUA 1T02A 4ZP7A 1L3TA 5IQ6A 4OYZA 5ETVA 1WHWA 4JI4J 2DHHA 1BQMA 3H2VE 1IKYA 4YB7A 1T7PA 1XEZA 2RDIA 1QM9A 1OY8A 1GK8A 4P72A 3AA9A 2VC0A 1ZBTA 1Y4ZB 3PCOB 2VIHA 1N88A 2VQEF 2OPPA 3EXYA 3M6UA 5LSLA 3HHNB 2VJVA 1Q86T 2QA4G 1S59A 5C42B 2HFOA 4B3TJ 3RZAA 2R2TA 2XTDA 1QAYA 3HVRA 3NP5A 4LVOP 2MMYA 2AGPA 2JC0A 4KHRA 3GWCA 4IH7A 2KL8A 4MK7A 1AZSA 2YKNA 1UW4A 4KYZA 1OQ3A 3QIPB 5KFUA 1OM2A 3T41A 5KOWA 2Y8YA 4NYPA 4J9PA 4UT4A 2Z56B 3H42A 3GV5B 4DUYJ 4X64J 4EGLA 3U02A 1IUJA 2J6SA 4PABA 2UVRA 2R7XA 2XMVA 4Q44A 1FX2A 1VMBA 4RW9B 1RK8A 3IN5A 5CZXA 4OJ1A 2OKQA 4I4BA 2ZOGA 5LXRA 1HWUA 2R42A 2N3LA 3AJDA 4E0DA 4WZQA 3AD9C 2DNRA 3EPIA 3UVJA 1OO0B 1JK9B 3G6VA 3NCQA 3WIVA 1HYSA 3EZOA 3PX0A 2XMUA 2AIRB 1NK7A 2HRUA 5GAGI 3OTBA 4IRKA 2EC0A 1JMTA 1NAQA 1QUVA 3GIMA 2LQ9A 4OYBA 5KFLA 2LEPA 4M5MA 3POTA 1OPIA 3NBPB 3ZTSA 5D78A 1DY3A 1UWAA 4YR0A 2JHEA 4LFAJ 2M88A 3ILJA 7FDRA 4DR6J 4H4OA 4KO0A 3UD3P 3GYNA 4NA2A 1O5JA 3J80Y 2VG6A 1QSLA 2L48A 3D6TB 4EBCA 1S10A 1IKXB 2WVEA 4UOGA 1GNKA 1CBKA 3CCTA 3NNCA 1T9VA 4ES2A 2J7WA 2PMWA 3PM9A 1GXLA 5CYMA 2CJQA 3X1LB 5SUHA 5CYJA 4JI4F 4PAAA 2ADBA 1HR0J 2QT7A 5HJYA 5HLFA 4A8MP 4MIBA 2DXDA 3M8PB 3V6DB 1IKWB 3HSGA 3H5SA 1JKHB 3SCJE 1SH2A 3VZIA 4RWWA 3GIKA 4KR0B 3T1HJ 3Q8PB 1CVJA 3H98A 2XWXA 3THPA 1GTEA 2MJNA 1FKAF 4C8ZA 4B3TF 2QRRA 4I6WA 1IBCB 5DM6Q 4OJ3A 4FF4A 1ITPA 1H2UX 5GMDA 4Q8EA 2DR7A 4NLTA 2J5AA 3T1YJ 2YWHA 2MZSA 4RW8A 1QAJA 3FFIB 1PO6A 1SKSA 5L46A 2L08A 5D4LA 3MPUB 4NZ0A 3KMQA 1ZM2A 2MZJA 4C6AA 1FK9B 5KFSA 1M90T 3A8IA 4OI6A 1U6ZA 2A18A 4H4MB 5AE3A 1UEKA 3A3PB 3M2UB 1OSDA 2YNHA 1A9NB 4DUYF 4X64F 3PIPQ 2V2KA 4IH6A 5HVFA 4NLPA 1HNVA 3H5UA 2CKWA 2V8GA 3OFGA 2XSJA 1FEHA 3NGDA 3DLKB 2BOAA 1X4CA 2OMLA 4UTGA 3R8YA 3CCUS 1IN0A 2HS0A 4PZVA 3JQJA 1MLAA 1D9AA 3G82A 4DS4A 5AXLA 5M2PA 5E3PA 1HBNB 2IDEA 5H9EJ 1PJ7A 4B3SJ 4ED3A 1I94J 2LKZA 2MLXA 1QJHA 1KD1T 3W63A 2POKA 2RF2B 1D8ZA 3MF5A 1EJ7L 2R4FA 4JI6J 2CPHA 1TL7A 2GFFA 2ASLA 1REVA 3ZC4A 1XMQJ 4I64A 1XR6A 2XY7A 4HH0A 5CABA 2HFZA 4CT9A 1NK5A 1GMWD 1G1XA 2IRYA 1OY6A 2CJKA 5A8RB 3V5RA 3DGPB 1VRTB 3CCLS 4DL3A 1UUJA 1H6KX 4DL0C 3I87A 1XNRJ 3OVBA 4J91A 4LFAF 3QQCD 2ZWPA 3CD7A 3RUBL 4DR6F 5B0EA 2Y3YA 2HNZB 4PG8A 5LXYA 2Z8QA 2JEFA 1HLWA 5J1PA 2D3O1 3AD7C 2FVSA 1Y5LB 1HL6A 2QMUB 5J2NB 5C42A 4LSZB 1JJHA 2QGFB 1H7WA 2GJIA 4ZA1A 1CJVB 4ZP9A 1SQFA 2IA6A 2HNDB 1P1LA 3PJWA 4FYWB 4K4UA 2YWEA 2XTEA 2AYMA 5A8KB 5FIIA 3CIMA 1PYTA 4WYLA 1HR0F 4XDDA 2K2PA 4UZBA 2RILA 4NXNJ 3LPYA 4HHJA 2PIIA 5EN1A 3FVYA 1QVFR 3JTPA 3QIPA 3TUPA 2RSQA 2KJWA 1IM6A 3B82A 2XGPA 2CPXA 1LWFB 2APOA 1PG5B 2MPUA 4JBCA 3TEGA 2EG1A 3IR6B 2HBZB 1YRTA 2GHWA 2R7VA 2W1BA 2BANB 2J0QD 5GADU 3MI7X 4RW9A 3TAMB 4LF6J 3KOAA 4F0KA 2JRSA 2ZM6J 1QTNB 4ECYA 3FQLA 4CLZA 2FUG9 5BJRA 3TP2A 3GJRB 2OHDA 2G0CA 2M4MA 2AW0A 4U67Q 1TK0A 2QFJA 5LL6d 3RBXA 4GMKA 2KM8C 4NXMJ 2KU7A 1X0FA 1UJ4A 1APSA 5GMEA 4QZVB 1RWUA 4M5IA 2KT5A 3DYAB 1L3KA 3E3XA 1LW2B 2EPIA 2V0NA 2FLPA 4B3OB 4B9SA 1PGZA 2XY5A 4YB1P 1ULRA 3NBPA 3RB3A 2FLLA 5I4MA 5EDWA 5E33A 4ECVA 3MFIA 2FQQB 1I94F 2HK3A 3QYYA 4JV5J 1P1TA 1ZAXA 3ILOA 4GC7A 3QT6A 1WG4A 1IKXA 2CNNB 1YVFA 3BQ1A 4M5GA 4C0HA 3MCSA 4JI6F 2C2EA 2B4VA 2BE7D 1RHMB 4TY8B 1HI8A 2GJ2A 4M5HA 1TKXB 1AYEA 3U1LA 5B09A 4HTJA 4KBIA 1S9FA 4OJHA 1KWMA 3C16B 1S4EA 3ONQA 6AT1B 5A6PA 2H65B 1S6OA 2BEFA 1XNRF 1I3OB 4DL4A 1U6FA 3M8PA 3V6DA 1IKWA 3H8YA 1UW9A 1JKHA 4ED7A 3UDCA 1HWJA 4DFKA 1OMSA 4USUA 1NNDA 1O8BA 3MCNA 3TUZC 2JJ4D 2BR0A 3FJ2A 5J2PB 4M5LA 5AJ3J 3OUYB 4UW2A 4WP3A 2CQ3A 1RGVA 3RW7A 4O3SA 4W98A 3HSJA 4MK9A 1UZHA 4U96A 4OV1A 3E51A 1HQEB 1B7FA 3CMQA 5D0GA 1NKCA 5AT1B 3PR5B 3IM9A 3R3TA 3C66A 4QR0A 1T03B 4ZCKA 2ASJA 2DY1A 4AT1B 2RQCA 4QW8A 3DHXA 3FFIA 1SPBP 4NXNF 1TKTB 3P3DA 2AKWB 4WKRA 2E5LF 2M2BA 1GTHA 5K5MA 1FK9A 1SVDA 2V4RA 4N77A 3OV7A 4ANEA 1S79A 4H4MA 5B7WA 3M2UA 1IVZA 2CPFA 3LTOA 1SJ3P 1H2VZ 2BXJA 1BE4A 1NU4A 3PYEA 2PMHA 5D3GB 2JX2A 4HEA9 4B9VA 3DLKA 3CCSS 2GS8A 2DR8A 2J9DA 2ZM6F 3K57A 1SJ4P 2CFXA 1ZAWA 5I3QA 1Q0NA 1N36J 1UWBB 3UN5A 4UF4A 3KXDA 2Y1JA 2DGWA 2LXUA 1S7IA 1HBNA 2OGUA 3CPWR 4NXMF 2IM3A 1FXLA 2HFUA 2RF2A 5KFNA 2CQDA 5KFVA 2EFPA 4CCHA 2Q3PA 2EW9A 2CQCA 3I0RB 4K4XA 3SV4A 4A8FA 3P8BB 3SSQA 5DDOC 2ZJRQ 3ILLA 1WF1A 5A8RA 1UTAA 3P45B 1R31A 2VFRA 3DGPA 4OV6A 3D1QA 1VQPS 2XMAA 1VRTA 3F41A 2BE2B 3GG0A 1QUPA 2VBWA 1R6VA 3F56A 4ZLNA 1QDUB 2HNZA 2KO1A 4QR2A 4DV6J 4JV5F 5CHCB 2OLWA 3IBCB 1DZ5A 4DPOA 2ALYB 2W24A 5J2NA 2BW7A 3V4MA 4E2FB 4AE5A 4C8MA 1CJVA 1WC3A 2HNDA 2C2MB 1WI6A 5B0FA 3U27A 4N41A 5A8KA 4C8OA 2BJ1A 1X5OA 2LU2A 2MJUA 2CPJA 2G1HA 4OIXA 1Q8LA 1JXEA 2D1CA 4JI0F 5L39A 1JLQB 2I5JB 1OWXA 2Y9HA 2SXLA 3ZZ0A 3VQTA 2CZVC 3UDVA 5A76A 1VQ5S 5AJ3F 1GX6A 1NDKA 2RE1A 5B0AA 4LUBA 3IMQJ 4QYZJ 4IG0B 3J7ZT 1WKJA 2YX4A 3LGNA 5KFXA 2KG0A 3F73A 1LWFA 1VIXA 4IOBA 2OIHA 2HWHA 4ID5B 2ACYA 4GVBB 2H5IB 3C6UB 1X31C 2BANA 1F2GA 3X3UA 3MMJA 3B6BA 2NLWA 3WX8A 5CQGA 4DXLA 3N6LA 2NSBA 3TAMA 2PO4A 1F9FA 2BM1A 4ECTA 2HBQB 2K3IA 1C4AA 5E41A 4QCLA 2F40A 5HP1A 2XEXA 1BWEA 2HNYA 2RDDA 4LFCJ 3NNHA 1LW0B 4FP9A 1LFPA 4HLBA 4P52A 2ZH9A 3T5HA 3MR7A 4F4WA 5E3AA 2NYIA 3DYAA 2JWNA 3K17A 4HT7A 2RU3A 3I96A 3UR0A 1LW2A 3E01B 3M8ZA 3KHHA 2DNMA 4FYYB 1LFWA 3F44A 1K1QA 4W4MA 3IAS9 1EQMA 4W90B 3V81B 2ZBPA 4B3OA 2E1AA 4WK1A 5DQHA 2QLXA 2MSSA 4GKKJ 1N36F 2BDPA 1Z1ZA 2JOQA 2NPIA 4ZJQA 2COLA 1RT7B 4XTTA 3PEJA 2CUYA 4WIQA 3CE8A 1GMVA 3ISND 3QWUA 2ASDA 2IMOA 3M6XA 1GQEA 4TY8A 2VL1A 4OYXA 1V3SA 3MD1A 2W7OA 1TKXA 2AJ2A 4F4KA 1HW8A 2JNJA 2EKNA 5K9FA 1J5OB 1KR4A 2LU1A 1ZM4A 3C16A 4LT6A 4JV2A 1QVGR 1XJWB 1TUVA 1UZDA 2W2MP 2FLOA 4YDDB 3V6HA 2QA4S 4CO1A 3BSNA 4PXCA 1BUXA 4LIWA 1RLDA 3M6WA 2YWFA 3VWSA 3R5CA 4C8NA 2ATCB 2DNNA 1SKUB 4DV6F 3RAXA 2AGOA 2MEWA 2AEFA 1VOMA 3HK2A 3H40A 3UCGA 4BBYA 4QIWD 4UZCA 3T9NA 5J2PA 3OUYA 3VV2B 5KT4A 4PWUA 1HQEA 3ET6B 4LFBJ 4USTA 4F25A 4RJVA 1T03A 3O8WA 2XYGB 4YEAA 3KHLA 2OI2A 3O3LA 1IR1A 5KG5A 4XAKA 2GVDB 1SKWA 3TX0A 4ZVHA 1F3FA 2ZHOA 1FX4A 1TKTA 1J2VA 2ZDPA 4XPCA 3J7Z5 2QO3A 1U6BA 3CW2C 3HT3A 1WHVA 3ISNC 1HD1A 3HJVA 1D09B 3ZNUA 2XTJP 4DCPB 1VQNS 1JX4A 4CLFA 1NSAA 2F7VA 1FJGJ 2UXDJ 4N47A 5KOXA 4CLSA 3R2DJ 2DXEA 2C3PA 3D0GE 2ZUGA 4IQXA 5KFMA 4EYHB 3TEHB 3DNCA 4CO0A 3G6ES 3KNGA 5D3GA 3D28A 1NK8A 2FHOB 4JV0A 1WC4A 3TO8A 3AOBA 2DR6A 2PI5A 3CNQP 3CT9A 3SCKE 2C3MA 4LF5J 3CMAS 1UWBA 3C15B 5F8IA 4ILLA 2FDNA 1X4DA 2F5GA 2E7WA 4PYDA 4LFCF 1X4HA 3PV8A 3OL9A 1JLFB 3MECB 4LQ9A 1FEEA 2PDAA 3IWXA 3MR2A 3NY0A 4OFZA 3Q83A 3I0RA 1CC8A 4JYAJ 2YH0A 4Y2KA 2V68A 4KTQA 1OPZA 2CQ1A 4NCBA 2H51B 1EARA 2XNQA 2E5JA 3W62A 3QBCA 1LWXA 3VAJA 3DLLQ 3FZ2A 2BE2A 4L72B 1S5ZA 2NR0A 2GO9A 5B0GA 2RT3A 5K8MA 1RBLA 2ZBCA 4DZ6A 4WFXA 4A8OA 1R3NA 1NO8A 4PCQA 3R6GB 2A0FB 3Q89A 4C48A 3RU0A 2CADA 3LANA 2GMHA 2F9DA 2V9WA 2W7AA 5E5NA 2E9RX 1ZM3A 3NMRA 3WZ0A 1JLQA 2I5JA 1FRHA 3CXCR 2OPQB 5HVHA 3U7JA 3MM5B 3G2XA 5BXIA 4M94A 4HI1A 1F5AA 4URQU 3DOLB 1U1LA 4IG0A 4YFUA 1U45A 4QYRA 1Q95G 1SH3A 3HI9A 3N01A 4LFBF 2X3DA 4ID5A 4QOTA 1NSQA 4GVBA 4DOZA 1V5VA 4JB8B 3DU6A 4D3GA 3C6UA 3K5LA 1PJ6A 2FVQA 3VVTA 4XPEA 4UOFA 1EHWA 5F9LA 5DLFA 4ZKAA 2XSFA 5CZVA 2N4DA 2KB2A 3OBIA 4O0IA 3N0VA 3KJFB 2V8DA 4DL6A 2UXDF 2VDHA 1LW0A 4RZRA 4OX8A 2E29A 3DOKB 4CLPA 3E01A 3PJXA 1QAIA 4KGZB 1CG2A 2AYBA 1F3VA 1KDNA 1HPZB 2ZJPQ 3BGOP 4FXVA 3EMTA 2MKCA 3V81A 4JI7J 2PA8D 1J27A 2DVIA 1YGYA 2WTFA 1Y5IB 3DOMB 1LQ9A 5M2RA 3D2WA 3R6LB 1S6QB 1N32J 4WK3A 1RT7A 3DDKA 1VS3A 2KG1A 4RNNA 2R7UA 2LQ8A 5KG3A 3TZXA 2AZ3A 3W3SA 2FJVA 3CDEA 2MB0B 2X1AA 2IBOA 2XWYA 3I5BA 3KJVB 4X4VA 2XCPA 4PG4A 4WBFA 4DHVA 3VCDA 2D9PA 4F0HA 1FFGB 2HQ3A 5EWGA 7AT1B 4JV1A 1J5OA 4PQUB 3PR4A 3KWMA 2V50A 3Q8VA 1B0VA 2LQ5A 5MAOA 1EKRA 4DV1J 5KFPA 1OIAA 2DNZA 4FN5A 4O23A 3RBEA 5IS2A 1KFDA 1SB6A 3PKMA 1FRKA 4QPXA 1UJ5A 1X5SA 3LO3A 2ALZA 3CJ4A 2QSFA 3EGWB 3ET6A 9RUBA 4V1Ak 3QT7A 1T3OA 4L75A 3QIDA 4IRDA 2DNGA 4U6PA 1DBDA 2ZFHA 3BO2A 4CH1A 2CYYA 2GVDA 2JZ5A 4QIFA 3SI8A 2XMTA 1N5YB 2B9WA 4IG3B 4GRSA 2C42A 2RHQB 2VJUA 2WONB 2I8EA 4RW7B 2HQGA 3LP0B 4J9SA 5DGAA 3IAM9 4NX9A 2RRNA 1HQUB 5IT9Y 3DLBA 1Q16B 2QTWA 1YJVA 4DFJA 2UU9J 4BS2A 1BD6A 3M4XA 1R43A 2W2NP 2K7KA 2MSTA 3AX3A 2NZ4A 3J81Y 4OHXA 4P75A 4DI6A 4OI2A 3GU0A 4NCAA 3G4SS 2EXUA 5D6GA 1UA0A 3I9ZA 4DL5A 3OFFA 1RWKB 4DX8H 2F8HA 2Z30B 5EX0A 3C15A 2K1RB 3OTEA 3H4DA 1YRXA 4LF1A 5HROB 2R7OA 3H5YA 3FDSA 4HHUA 4TQRA 1JLFA 5J1EB 3BQ2A 3AJ2A 3MECA 4Z7YA 1CJKB 5C2GA 2AP6A 1V3RA 1N4LA 2ZH4A 2PEHA 1TL1B 4B9MA 5IWAJ 1VI7A 3OT9A 4YHHF 4A47A 1DAXA 2UV8A 3IRWP 5IFMA 4MKVA 2HKEA 1S6UA 3RRHA 2BX6A 2V63A 4JI7F 4J9UE 3GR0A 3LP1B 1FJ7A 2MQQA 2XYHB 1RYRA 3V6KA 4I2QA 2O66A 4QIVA 2XZ2A 2MHEA 1YK9A 4LR9A 2GQ2A 5CH7B 2V2VA 1PCAA 2NREA 1D3WA 3HFKA 4MTPA 1UEVA 7FD1A 1TVRB 5KFQA 2WBRA 4K4WA 4WU2A 3A12A 3FRZA 1DLOB 3TZYA 3PVXA 1FD8A 2DEIA 2DHSA 3NGKA 3DI6B 4B17A 2MKIA 3K8WA 3EE3A 3BN4A 3SCLE 1FKOB 5KT5A 5D0EA 3BO3A 5F8NA 3AAWB 1M5PC 2PT0A 2GMLA 1M0SA 2FD2A 3U1NA 4FS1A 3CUNA 4ITSA 2YNFB 2KJVA 2BMBA 2E7VA 2YY3A 2OPQA 2KZZA 2IAJB 1L3SA 2WAQD 3C14B 2BJDA 3UW1A 1WOOA 3MM5A 3D4JA 4RX6A 1S72S 2RUSA 1HA1A 3MEKA 3DOLA 4H4KA 4LRDA 5D4NA 2EFVA 3ZTRA 1NHVA 2VB6A 5G4DA 3KJQB 4M63A 3FZBA 3O5TB 2FY1A 3IA0A 1JLAB 2IM0A 3K58A 3AOAA 3P5TL 1RTDB 1T9UA 2YKQA 1D9DA 4P6QA 2HHWA 5CD4A 4BWMA 1FCAA 1UVNA 1ZPWX 4C7QA 3R5DA 1HI0P 1RAJA 3UD4P 3RB6A 3PX4A 4NLQA 2DJWA 2XHWA 2K06A 2FJDB 2LVWA 3DOKA 5F8HA 1G3OA 4HHHA 2C28A 3BPSP 2MZTA 4ED2A 3KG4A 2VFUA 1T94A 3OR1B 1LEOA 1FDBA 2AX0A 2GA7A 1L3UA 1HPZA 1RCXB 2G0IA 2IJNA 1CULB 4A8QA 2R2UA 3DDNA 4ZK7M 3AODA 1U7LA 4RKUC 2HAFA 2YWKA 2HGLA 5KFCA 2L41A 2PFFB 3DOMA 1L5UA 4P74A 1S6QA 4M5DB 1NHKL 2DH9A 4I6AA 4LF9J 1VRUB 3PRBA 3DXBA 1B3TA 4U95A 4IRCA 3KJVA 2ZHBA 3BGFA 3OHBA 3MWBA 5IV4A 1WF0A 1JLGB 2B4OA 1VJWA 1KN6A 1UVKA 3JXOA 3AD8C 2HK2A 2VV5A 3MTKA 4RNFA 2JL9A 4QQBA 1C1CB 4DX7A 4PQUA 1AROP 2GGPB 4USIA 3MPWA 1KONA 3D67A 2O01C 2P5VA 1TFYA 3CJ3A 3KUHA 4ZVTB 1WOPA 1NB7A 5HANA 4ZP6A 1YJNS 1YBUA 4C0OC 4ENOA 3OFEA 3W64A 1OYEA 2JLFA 4MK8A 3TJ9A 4OI1A 5ETOA 4FPIA 3I6PA 4F7VA 3HCXA 2G4BA 5ETSA 5T7LB 1TAUA 5JJBA 2HRTA 2EFGA 3SFUA 3R27A 4S0MA 2J7UA 1W26A 1N48A 4R5PB 5JXSA 5HMWA 4O3PA 1M5OC 3M6VA 2CPDA 5KFZA 3L7PA 1K0VA 3MEGB 1N5YA 1YBAA 3W5XA 4IG3A 1LK7A 4HT5A 4X4PA 4R0EA 2WONA 4RW7A 2W4PA 2IJFA 1U1KA 3LP0A 5L38A 2ATLA 4ZN1A 5KFJA 1Q5YA 1HQUA 3CJ8A 4EBEA 2C1EB 1VLOA 3NGSA 1YI2S 4X2BA 3I4HX 2UXBJ 3J80U 1QSYA 3QT5A 4P2MA 1RZMA 3QPIA 4LQ3A 1F60B 1SC3B 4C4WA 2IRXA 5C2CA 3FSXA 1SIZA 2MKJA 1N56A 4OYIA 4FF2A 1H2TZ 2K1RA 4HYKA 5A6WA 2DCUB 4LIRA 4KV8B 1MMLA 5HROA 1MN9A 3TZZA 1PJ5A 4K4SA 1A6LA 3CEDA 5J1EA 3LOUA 4A8YA 1RU1A 1CJKA 3IC1A 3PYFA 4DSLA 2Q79A 4USWA 1TL1A 2ZZTA 4FXWA 2C2OB 3I5AA 3BH7B 1V9OA 5LSRA 1NK9A 4Y2IA 4TU9A 2NXCA 3AJ1A 1B0TA 4RUCA 3LP1A 4PQAA 3L9ZA 3FSYA 4GKJJ 1TL5A 4KGMA 3TVZA 1XIQA 5DQIA 1WWHA 4P73A 3BBBA 5KG2A 2DNYA 2OTJS 2C3YA 4OYWA 1TVRA 4J9RA 1VCTA 2UUCJ 2Y0BB 1DARA 5IOLA 4NLUA 1DLOA 2OD4A 3ENWA 3T5KA 3IR7B 2W4DA 2OSQA 1V6HA 3FRYA 2VU5A 1RSCA 3HKZD 3N6MA 2QL7B 3DI6A 4DL7A 2V8HA 3HVTB 3UN3A 1FKOA 1Q8IA 2V9KA 1ZOTA 3VGTA 3TA2A 5LJ5Y 3D66A 2YNFA 3R9LA 2IYIA 3G96A 4PXBA 2IAJA 4KHMA 2Z4PA 3C14A 4C11B 2DT9A 1U1QA 1FRIA 4JI2F 4RW4B 1RAEB 1HBMB 3D0HE 3GP9A 3VAGA 1BXNA 4ZOSA 3QLHB 1HHQA 1RXOB 2N7YA 2C2ZB 2FY8A 1WC0A 5HN0A 2HHVA 1H7XA 4WTYA 1JLAA 1Q7LB 4NEYA 4FF3A 5LT5A 3RB0A 3OFHA 3NOGA 4TVAB 2BJEA 4AFFA 1B64A 3ZFVA 1RTDA 4JI1J 5KFHA 1RWNB 4B02A 1I5OB 4DV4J 3M8SA 1Q53A 4ZDNA 4GVLA 1GT8A 3HX9A 2GZOA 3R5BA 2AYEA 3CGIA 3ZZZA 4J9OA 1MNEA 4DL2A 1B70B 1X4AA 4J9MA 3UN2A 2ZH3A 1NK0A 4Q5VA 1U25A 4OLPA 2CXEA 4LF2A 3PO4A 1NZ8A 2XMWA 1MWQA 4U7UK 1F6TA 2J8AA 3A4TA 3GG1A 3HHLD 4JI3J 2B7CB 1D0EA 3BDPA 3NAIA 2CNKB 4UUXA 2UXBF 2V4JB 2H1YA 2XZTB 2XO7A 2HMIB 5L8RC 3SBMA 3OR1A 2Q6CA 3I31A 3Q8RB 3RG6A 4BLGA 3OHAA 4DG1B 1FJEB 3K5OA 2HVIA 1CULA 3QJLA 2MQMA 2VDIA 3S6EA 5KG6A 1WORA 1RTJB 4AQYJ 4G3IA 3CTRA 2MTLA 1FVSA 4WFAQ 1YITS 1XMBA 4FBTA 1RWXB 3NS7B 4M5DA 2HHTA 3GYGA 3ZTQA 1YJ9S 2E1RA 2DB1A 3JAMY 2GIFA 1RAGB 1VRUA 4J9QA 1VQ7S 4FYDA 2AEJA 2CZ9A 4YB5A 4V19J 4MT1A 1JLGA 1JWWA 2XMKA 4RNOA 4USKA 2GHVC 2QA2A 1ZA1B 3SSRA 1GEHA 3LF0A 1XMOJ 3W9HA 4ED8A 1NDPA 1C1CA 3CCJS 3EM1A 2XTCA 2JEGA 1Y7PA 3SDEB 3W7BA 1S99A 1RQ0A 2GGPA 1WTBA 2B9XA 4GKJF 2OELA 5HO4A 1XR7A 4HVZA 3GILA 2VPWB 2GQQA 3DMJB 2R8GA 1ZH5A 2HVHA 3CIZA 3GCWP 3DDIA 2D69A 1NK6A 2VODA 3VR1A 2UUCF 3FQKA 3HHLC 4ETXA 3PKYA 1SL2A 1KVKA 4P7VA 2VZ9A 4DV3J 2KYXA 1HWIA 1ZPVA 2DRAA 2R8JA 3VVUA 1FE0A 5T7LA 3GR1A 4G65A 3BGRB 4U8YA 1R0BG 4ED0A 4R5PA 1KRPA 1S1TB 2Q43A 1TFWA 1R89A 3P5BP 2A1BA 5EX3A 3MEGA 4F04B 9ATCB 1OS5A 4RU9A 2VQFJ 3TAQA 3NGRA 5L9XA 4G1QB 2VPXB 2MKKA 4EU0A 3HT0A 4IDKB 1R0AB 2IYGA 2AJQA 2HVDA 2DKOB 1FXDA 2EK6A 4WE1B 1IR2A 4WFBQ 2DCLA 2D9OA 4CWBA 2KXNB 3W2WB 4DR5J 5ADZA 2O3DA 4LF7J 1FFSB 2V5HG 1S76D 4DPXA 3Q24A 4C3LA 4M5JA 4DV4F 4DUZJ 1M5SA 4PPDA 1VK3A 3A8JA 4N7TA 1S0OA 2LFVA 4KV8A 1A0OB 3EPGA 5BYRA 4NLVA 4TU8A 2B4PA 4JI3F 1N34F 4M1KA 4KSEB 2DNOA 3EZUA 3PG9A 2CQIA 4RPFA 3VHQA 3T5LA 2JEIA 2AJ1A 4F4XA 5KAKA 2ADCA 1VQKS 2WZ1A 4OHZA 4ZJOA 2ZKTA 2BM0A 5HAOA 1HARA 4Y34A 5DLGA 4AQYF 3K2YA 4M5KA 2E5IA 2VHGA 3W5ZA 4FDFA 3QRRA 5AXMA 1P9QC 2IPOB 2R2RA 4CH0S 4AL5A 4CZCA 4MMOA 3CVKA 4NZ6A 2HLUA 2XB2D 2ILZA 2A10A 3K5NA 4YN3B 5J2MB 2DGXA 4UQGA 3NEKA 5G0RB 1RAFB 2Y0SD 1XMOF 4PUOB 2FPHX 4ALZA 1V5IB 3HVTA 2JH3A 1SI9A 2UP1A 4KQZA 1RBOB 2J8SA 2KN4A 5DDQC 1N6QB 4FNHA 3TNVA 4K4YA 1MG7A 3LGMA 4ES1A 1G6BA 4OI0A 2DIUA 4YY3F 4KGKA 4ZVUB 1U8WA 4C11A 4WWSA 3H7HB 1J5EJ 1LV5A 2ZH5A 4DV3F 4RW4A 1NJIT 1HBMA 2KH9A 1ZZFA 3QGIA 3QLHA 3BM7A 2UUAJ 1BC6A 3M2VB 4J9KA 2N3OA 1FI4A 3UO0A 5A8WB 1YJWS 5IQQA 4KPYA 2L9NA 2ZD1B 4ZITA 3ITHB 1DQAA 3OLBA 2XULA 1GXTA 3LGHA 3BQ0A 1HNIB 4ZVEA 2VQFF 3FBEA 2I9SA 5B08A 4QIGA 4OZJA 1Y9OA 1VGYA 4ZVGA 2ZJQQ 2OPRB 5E3CA 1FJCA 1I6JA 2QJ3A 3PW2A 4WPAA 3M32B 1E6YB 2W9CB 4ELUA 5KT6A 4DPUA 5K14B 2V4JA 2HMIA 3H25A 3NGUA 1NMEB 4DR5F 4LF7F 4OJGA 3KHRA 4DG1A 2HQFA 3NG8A 2RMLA 3EUNA 1JJ4A 4DUZF 4YDXA 2V6AA 5B0DA 1RTJA 3MPYA 2LDYA 3ZZRA 3AHPA 1QD1A 4Y6IA 3PRVA 4FXDA 2BVZA 1NXIA 1N33J 3PRDA 2DH7A 1VLYA 4DFPA 4P9SA 1U2RA 5FD1A 4RNMA 3NCPA 2V8VA 5DGBA 4DV5F 3O2IA 1NDCA 1U1RA 1JB0C 3VF0B 3OTDA 2WSCC 1SL1A 2L3MA 3DLGB 3AXKA 3C6TB 4NLWA 1DFDA 3FCWA 2HEKA 1C1BB 2GIRA 2W9BB 2HFNA 2WCXA 2CDQA 3SDEA 1XQIA 1UPMB 2BKNA 1YZ7A 3VAKA 4EO8A 5KG1A 2RQMA 3WBZA 1Q4RA 3CD5A 5FLXY 3DMJA 3TQ1A 2ZVSA 3D1HA 4I69A 1YLXA 1U47A 2IA0A 4FF1A 3CJ0A 5JUMA 4HR2A 4TU7A 2JLEA 3KG0A 2XS2A 1T0TV 1X8DA 3CJ2A 1O51A 3W60A 3MOZA 1Q7YT 4J37A 4KGVB 2VG7B 3BGRA 3MXHP 4KFBB 1JNZB 1S1TA 3MTJA 4XDCA 2R7TA 1UL3A 3CC4S 2J0WA 1H38A 1F2HA 2VA3A 4C98A 2HRYA 2E1MC 3O6QA 3R2CJ 3QGHA 2ZC4A 4RLEA 4C2MA 3NL0A 3SFGA 4G1QA 4RUAA 3WC2A 2CPYA 1HD0A 2EKYA 2FZKB 3ZZUA 4NI2B 1J5EF 2BZ2A 2F4VJ 1JJCB 2XBPA 4M8LA 2QA1A 2HAIA 2B8PA 3KG1A 4IDKA 2W01A 3W9IA 1KFSA 1R0AA 3KK3B 2UUAF 1LNQA 1F5BA 2B56A 3DLJA 4WE1A 2DPIA 4Q43A 3ENVA 1SJFA 3HHDA 1DHMA 3W2WA 4CH7A 4X4OA 4BCAA 2FJEB 3F0NA 1S1UB 2CQBA 2H5JB 2JFKA 3DFEA 3GQCA 4B08A 2V34A 2GX8A 1FNXH 1I51B 1DURA 1T9YA 5E7OB 1XC9A 4EFAC 3MFHA 2E5GA 2ZVIA 3OPKA 1EX8A 1Y10A 4CQ1A 1TKZB 2F4FA 1JLCB 4ZJLA 5DG8A 2W2QP 3DC2A 1SC6A 3FCHA 3KLVA 1NEEA 1BLUA 3KDNA 1YJ7A 1WF2A 4DUTA 2HWTA 1WEZA 2AJ4A 2RRAA 4TYBA 2VF3A 4OHYA 1N33F 2DIVA 4ZVQB 4KH0B 4QPTA 3U1MA 4IR1A 4G1PA 4ECSA 1BHNA 2C22A 2DNHA 1LK5A 3NCRA 4WFNQ 1QSSA 4RW6B 2F63A 5B0BA 5J2MA 5E2QA 4B9NA 3TARA 1N5VA 1RAAB 3BR9A 2DNQA 2QL9B 1X60A 4CT8A 5G0RA 1S77D 4PUOA 3DRSB 2EFQA 3H2LA 4ICLB 1JNRB 2R7QA 1JIHA 3HVAA 3KHGA 4W92B 1HHTP 3QSIA 4Y2MA 5HL7Q 4C8YA 2W4CA 2MLZA 1N6QA 1FXRA 3BSCA 1EQ0A 3EX7B 4PWWA 4L6V3 4GO7X 1OQ6A 3MUTP 2AV5A 2KT2A 3MEDB 3HZGA 2VUGA 3HULA 3Q2TC 4ZVSB 1VDHA 4QWBA 4ZPWR 4B3RJ 1K9MT 3M2VA 4ER8A 4F2RA 2QG9B 1U2CA 3K7RA 4IR9A 1HMVB 5A8WA 5KFEA 1FWKA 2D3OR 3J7AN 2ZD1A 2OD6A 3ITHA 1HNWJ 4K2JA 3CJKB 2YKAA 2XGQA 5F0UA 4ZPCA 4BC9A 1ZTTA 1HNIA 1RYSA 2F8EX 3L7OA 3H20A 4NE9C 2F4VF 1YQHA 2WVCA 3TANA 1SL0A 2OPRA 1TUWA 3Q0AA 3M32A 1E6YA 2WW4A 3OQ2A 2E5LJ 3W8GA 3QAEA 3UI3A 4DF4A 3CCQS 2W9CA 5K14A 2UVVA 3D0IE 4NLOA 1SQEA 2F3JA 4RR5A 5KYTA 4Q45A 2GAGC 3ZZTA 4LBHA 5DG7A 2R7RA 5ETQA 3J7YI 4OHVA 2D7SA 3MM8B 2BJ7A 1NM2A 2FC9A 2DO4A 4ZPVR 1YDLA 2E1PA 3MM6B 1RABB 2OAUA 1NRKA 3TAPA 2PA3A 3KKFA 5KFOA 4RO0A 5L1LA 3T5JA 3ICLA 1RCOB 1X7VA 2YPYA 3UDLA 3MAAB 4MJKA 1X5TA 4EUVA 4NASA 3TX8A 2PC6A 4DBQA 1H0HB 1WD6A 2HURA 3EVMA 1TQLA 1VQOS 1N52B 2NCKL 2HLTA 2R8HA 3NMAA 2J0XA 5C25B 2D41A 3I9V9 3DLGA 1AB8A 3C6TA 3PYGA 1Q82T 1RHJB 4TYAA 1CS4B 1ZA2B 2ZITA 4K0KJ 1C1BA 3BO4A 2W9BA 2Z2MA 5KFIA 1NDLA 2KHCA 3AB2B 5HMYA 4N56A 2R3VA 2UZAA 1Y11A 1VRQC 1PIEA 1GH8A 2MZQA 2D3UA 3UD5A 1MROB 2FZCB 4ZPTR 2DHXA 1SKRA 4R0JA 4F3MA 4F67A 1FO1A 1K1SA 2DISA 1M5KC 1SJ1A 4JI8J 2YNGB 4AL7A 2WVDA 5CD4H 4DQPA 5IT4A 1MWYA 1U2FA 3B78A 2VG7A 2BJ3A 4OYPA 3D6MB 1Z2ZA 4KFBA 1MMNA 5KFWA 4R8UB 5AXKA 4HDHA 2DRBA 5JVHQ 5BYSA 2QX0A 3VAFA 2CJXB 2FLNA 3R7BB 2DEJA 4HKQA 4OZNA 2I0XA 4NI2A 4OHWA 4DQRA 1T11A 4ETZA 2CJYB 4Y0FA 3BKTA 4EZ9A 2ROGA 3BR8A 2PD1A 4B3RF 1HBOB 4JI0J 3KK3A 4ATNA 1TELA 1NSPA 3M05A 1RHQB 1RB0A 2MQLA 1ZYQA 1HNWF 3GFXA 2HHHJ 2W9AA 3VAHA 2GHPA 1S1UA 2L9WA 2RUGA 3TJ8A 4LBIA 1IBMF 3OXLA 4HH1A 2WRMA 4UQTA 5M2UA 2XMJA 2DNLA 3ZTOA 8ATCB 4DX5A 1NH8A 2B4UA 3O1LA 3PO5A 2ZHAA 3AX5A 4CLYA 4WXWA 3WQPA 1S49A 1TKZA 5L1IA 1S0NA 3FK4A 1JLCA 3GB0A 3NRBA 2ZEJA 4CLUA 2FJWA 2P9EA 4M5NA 4PG7A 2V94A 4NMLA 1RTZA 1H98A 5KG4A 2HSEB 5F3ZA 2X1FA 4ED6A 1CLFA 5K8NA 4U8VA 3NOCA 4IFVB 2HHQA 2CQ0A 3KJNB 3BKFA 1ZTWA 3A3OB 2AJFE 3I0SB 3L3CA 3LUYA 2R8IA 2Q1LA 4A8SA 4RBVA 1BQNB 2HZCA 4U9RA 1CSJA 4F50A 2QIFA 3HF5A 1U1MA 4RW6A 2RS8A 5IT9U 4D3HA 2LXIA 5IM0B 2XMMA 4K0KF 3DRSA 2J6UA 3DXSX 4ICLA 3N4WA 3UPFA 2KZMA 2BE9B 2B8QA 4MYUA 5CYQB 4KPCA 2CA9A 4MKYA 3PZPA 3J81U 4ILMA 2W8KA 2ZH6A 3CB4A 2ZNYA 2YQ0A 3WIUA 2VBZA 1F1BB 4CNZA 1RAOA 2C2NA 2GQCA 2AJ0A 4ELTA 2XI2A 3MEDA 4LF4J 4JI8F 2AWZA 2KXFA 2OFGX 2LXFA 1PAUB 4ED4A 1UJ6A 3B54A 2KM8B 1BY9A 1HMVA 3M8YA 5A2QY 3A13A 3AQOA 4K8RA 3TQEA 2FJBB 2B3TB 2XI3A 3CJKA 3BB5A 1G2EA 2KVIA 2CQ4A 4CO4A 1PC4A 2QLJB 5IT0A 3FBCA 4FKXA 4LRBA 3BREA 5EHHA 5SZTA 2VH7A 2HZVA 4OZ2A 4QU6A 5D4OA 2CJ9A 1KOHA 3HVWA 1NKBA 1FRXA 4ECQA 3RAQA 1IJEB 4LJMA 4PG6A 1HNXJ 3BJYA 1U0HB 2QLFB 5HQ8A 1HQ2A 2C3UA 2MYFA 1MN7A 4LR8A 2HHHF 4X66J 3MM8A 2VOOA 3DN9A 1RADB 2E44A 3MM6A 1M1KT 1P6TA 4ZHRB 3HDSA 1SH0A 3M9OB 3PY8A 3MR3A 2F9JA 2WK4A 1EAYC 1Q5VA 4URGA 3FMBA 2QYCA 1WELA 1DQ9A 3MAAA 1TK5A 2DNKA 2J7KA 4JI5J 3GFYA 1B4SA 2BUNA 5E3QA 3CF5Q 1W7WA 4F36A 1FT8A 3EVOA 5C25A 4OZ3A 3EICA 5K8PA 2IJRA 1WDDA 1CS4A 3MDFA 2Q6BA 2E1CA 2DHGA 3QNWB 4N8NA 3W65A 3R97A 3M9NB 3IBFB 4AXJA 4KRWA 4FZVA 1MROA 5KFBA 1T9WA 4EMDA 5KFTA 3TUJC 5AE2A 3KK2B 3DCAA 4I1TA 2YNGA 4DLEA 3IWLA 2MZ1A 4DSFA 3BS9A 3BZQA 3IO1A 2N7CA 5GAHU 1ICEB 3PIOQ 3I55S 4IO1A 2NUUG 4WXOA 3KLFB 2R9LA 2A2DA 1ZS6A 4R8UA 2FGCA 1AFIA 1HFEL 4TY9A 1YIJS 1TK8A 3B4DA 2V67A 4ECRA 3AQPA 3IFEA 4DSKA 5ETNA 2B6AB 4HTIA 3TZWA 4LF4F 4X4SA 2GV1A 3UFCX 2DR5A 4BDPA 1D9FA 5E0OA 4NLRA 4E8UA 2MGZB 1HBOA 3MM9B 2V2QA 1Q78A 1MMDA 4YR2A 3QWPA 3KFWX 2RHSB 2BJ8A 3E2EA 2RU9A 3ZTPA 2CJAA 3AY0A 1Q1KA 5GVQA 4OYOA 2Z2LA 3D1OA 2VFTA 3G9CA 1U1PA 2M9KA 1S6PB 4MH8A 5DZ7A 2B7BB 1BQXA 2DGTA 1K73T 1F5CA 3DU5A 2ILYA 1U26A 2E5HA 3EGVA 2UV8G 1WC6A 1U4BA 3FEXB 1S0MA 1FKPB 1S7HA 1X4EA 3FSIA 4ANDA 1VBKA 1WKKA 3D68A 3GLJA 3LW5C 2QMXA 3NLCA 1HNXF 3UE2A 1BA3A 3Q86A 5HQLA 2EG2A 2YPZA 4QWCA 4RBUA 2V1SA 1R8HA 4X66F 3FEZA 3NXZA 2OP5A 1RKIA 5I3PA 1VBXA 1TL4A 1RHRB 2H5EA 8RUCA 1Q8KA 4TXSA 1OYDA 2MDAA 3CO9A 4AUKA 1KSPA 4QJVA 1RDRA 1EZZB 4XIUA 2PEBA 5CAAA 3VGSA 3H59A 4LMZA 4DR4J 4IFVA 4JI5F 1R0CB 3I0SA 3CDUA 3WDOA 4Y28C 1M1HA 1BQNA 4DU8A 3Q8YA 1URRA 1RT4B 2MQ8A 5IM0A 4Z37A 5GAEI 2JLGA 3MR6A 3H4BA 4K4TA 4CLTA 1M1GA 5DRKA 4XK8C 5CYQA 2NQPA 5KFAA 1GMWA 5BYQA 4CO5A 3CD6S 2OPSB 4DV2J 2FVCA 5C24B 1NH7A 3SZ2A 2DPJA 4LSNB 4WP8A 4X84A 1TKDA 3CDBA 1TV6B 1WJ9A 1RT5B 2KRRA 2H4WB 5B0CA 5L1KA 3RRKA 2XNRA 2HS3A 1UVMA 4XO0A 3KLIB 4NLXA 3OLAA 2G2ZA 5IZHA 4KC5A 2OEMA 2DD8S 5DG9A 4FNIA 2A6MA 3V6JA 3L95X 1WACA 4KGXB 2J0SD 1Z2LA 1S1VB 3AOCA 2FHJA 4IYQA 2OFHX 3P96A 1URNA 2IDLA 4OI3A 1TP7A 4JOUA 2GMJA 3FGVA 3N9UC 3Q8QB 3PXGa 3EWGA 2XS7A 4F02A 2FIUA 3M8QB 3I32A 4WU3A 2EI5A
chains in the Genus database with same CATH topology
3I0RB 2KYXA 4AYBD 1S9EA 1HWIA 1ZPVA 4K4XA 2DRAA 3SV4A 2R8JA 1MU2B 3FNNA 1FE0A 1MWZA 5T7LA 2ZH7A 4A8FA 1RTIB 4KAIA 3SSQA 2BQ3A 1JJ2R 2GCFA 3GR1A 2JFDA 5DDOC 3V4IA 1V3ZA 1Y00A 3BGRB 2ZJRQ 1WF1A 1CPZA 3HHEA 2ROPA 5A8RA 4ED0A 4R5PA 1KRPA 1S1TB 4CNYA 1R31A 2VFRA 3DGPA 2Q43A 3D1QA 4LSLB 1VQPS 1VRTA 3Q8SB 3KLEB 2CQ2A 5THWA 3F41A 3DRPB 1VQLS 2HHPA 1TFWA 1R89A 2KTQA 2FC8A 2BE2B 3N79A 3GG0A 1QUPA 2VBWA 3SEOA 2A1BA 2LEAA 5EX3A 2M3DA 3MEGA 3F56A 3R5AA 1VC5A 5IWAF 2ZOMA 1OS5A 4RU9A 3TAQA 1TAQA 5L9XA 3K5PA 4G1QB 4ZHRA 2HNZA 2VPXB 2KO1A 4QR2A 2MKKA 5DS7A 4JV5F 2I38A 3MURP 3DRRA 5CHCB 2OLWA 4ECXA 4OZLA 1IQTA 4EU0A 1DZ5A 1YRUA 4DPOA 4IDKB 2KT3A 1SV5B 3BSOA 1SJQA 1R0AB 4G1IA 2IYGA 2AJQA 1UFLA 2W24A 4GO5X 5J2NA 3PNIA 1FXDA 2EK6A 1SBRA 3V4MA 4OLOA 4AE5A 3GIJA 1RA7A 1NJZA 4A8WA 1FNMA 4WE1B 4C8MA 1FD2A 3QJPA 4WFBQ 2BQRA 2DCLA 2HNDA 5KT3A 2ZKUA 2D9OA 1WI6A 3W2VB 5B0FA 2WB4A 2KXNB 3U27A 3W2WB 1X4GA 2IM1A 4N41A 1WTFA 5ADZA 5A8KA 4C8OA 2O3DA 2AQ4A 1X5OA 2LU2A 2MJUA 4NOHA 2V5HG 3PFOA 4I56A 2CPJA 1S76D 4OIXA 3Q24A 1RKJA 3HMJG 3NNAA 1Q8LA 2FGOA 4C3LA 4N76A 3RW6A 3TYTA 1JXEA 4DV4F 4TLRA 3TA0A 2I2YA 1C0UB 1M5SA 4PPDA 3BSAA 2OSRA 1VK3A 3QZ7A 2D1CA 3RB4A 3DRXA 4JI0F 5L39A 1JLQB 1X0PA 2HHUA 2I5JB 1S0OA 5KFFA 1FDAA 2GIQA 1OWXA 4KV8A 3HP6A 2SXLA 4A4JA 4M95A 3EPGA 3ZZ0A 3MAQA 5BYRA 3VQTA 2CZVC 1RT1B 2DR8A 1VQ5S 2OH2A 5AJ3F 1GX6A 2Y1IA 4DR4F 4NLVA 4QU7A 2RE1A 1SJRA 5B0AA 3IGVA 4LUBA 4QYZJ 4IG0B 5JVGQ 4TU8A 3J7ZT 3PW4A 3M2RB 2YX4A 3LGNA 5KFXA 2B4PA 4JI3F 1N34F 1H3DA 2KG0A 4M1KA 3F73A 1LWFA 4KSEB 3KK2A 1VIXA 2U2FA 2DNOA 3EZUA 4IOBA 2HWHA 4Z2XA 2CQIA 2OIHA 4ID5B 2R7SA 2WBMA 5DETA 1SUQB 2ACYA 3MD3A 2LDIA 3EZ5A 2YKMB 2KKHA 3T5LA 2G9OA 2JEIA 2AJ1A 3C6UB 4F4XA 4YB6A 4ZPAA 2BANA 5KAKA 1F2GA 2ADCA 3MZIA 4ZP8A 2CVEA 2GC8A 3X3UA 1SIWB 4IOCQ 5CXTA 1VQKS 1EP4B 2CPZA 3MMJA 3ETOA 4OHZA 2NLWA 5CQGA 1UKUA