1KHVA

Crystal structure of rabbit hemorrhagic disease virus rna-dependent rna polymerase complexed with lu3+
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
497
structure length
493
Chain Sequence
FCGEPIDYRGITAHRLVGAEPRPPVSGTRYAKVPGVPDEYKTGYRPANLGRSDPDSDKSLMNIAVKNLQVYQQEPKLDKVDEFIERAAADVLGYLRFLTKGERQANLNFKAAFNTLDLSTSCGPFVPGKKIDHVKDGVMDQVLAKHLYKCWSVANSGKALHHIYACGLKDELRPLDGKKRLLWGCDVGVAVCAAAVFHNICYKLKMVARFGPIAVGVDMTSRDVDVIINNLTSKASDFLCLDYSKWDSTMSPCVVRLAIDILADCCEQTELTKSVVLTLKSHPMTILDAMIVQTKRGLPSGMPFTSVINSICHWLLWSAAVYKSCAEIGLHCSNLYEDAPFYTYGDDGVYAMTPMMVSLLPAIIENLRDYGLSPTAADKTEFIDVCPLNKISFLKRTFELTDIGWVSKLDKSSILRQLEWSKTTSRHMVIEETYDLAKEERGVQLEELQVAAAAHGQEFFNFVCRELERQQAYTQFSVYSYDAARKILADRKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords RNA-DIRECTED RNA POLYMERASE
publication title Crystal structures of active and inactive conformations of a caliciviral RNA-dependent RNA polymerase.
pubmed doi rcsb
source organism Rabbit hemorrhagic disease virus
total genus 167
structure length 493
sequence length 497
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2001-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1khvA05
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1khvA03
4.10.8.20 Few Secondary Structures Irregular Luciferase; domain 5 DNA/RNA polymerases 1khvA01
5KFVA 3V81A 5KG0A 4O3OA 4RW6A 4DL2A 3FQLA 1RTJA 1EETB 4H54A 1S9FA 3D28A 1S10A 5EWGA 3ICLA 2FVQA 4JV1A 5J1EA 1W25A 4NLOA 4RW7B 4WE1A 3T5HA 2XI3A 4Q45A 2XI2A 1S6QA 5F8GA 3KNAA 1HQEB 1YVFA 1S1WB 4RNNA 4YR3A 4ECXA 3DOKB 5F9LA 1JLEA 2IJNA 2OPQA 3H5UA 4O44A 5C5JA 2VG6A 4ZP7A 4LSLB 1IKYA 1ZTTA 4ZPDA 1KLMA 4J9QA 4MKAA 2W8KA 4K4TA 2WONB 4KFBB 2FJVA 1TL3B 1N48A 5DGAA 5KFIA 4ZP8A 5F8NA 3DDKA 1HPZA 3MECA 5KFOA 3MEEA 3GILA 2YNHA 2VA2A 4ED1A 1S6PA 3KHHA 5I42B 4Y3CA 1ZTWA 1K1QA 1RTHB 1EP4B 3FFIA 4OL8A 5F8LA 1FKPA 1HMVA 2YNIB 4WYLA 3GIKA 1S9EB 3IG1A 4IG0B 2WRMA 3BSAA 3DRPA 4WXWA 1JLGB 1LW0B 3TAMB 4DL3A 4IG3B 3G6XA 4TY9A 4F4ZA 5HLFA 1DTQB 2YKNB 2C2DA 1VRUA 2BANA 3I0SB 5J2QA 3M9MB 2ILYA 5C42A 4ECTA 2XCPA 3CDUA 3GIMA 3Q8PB 5DG7A 4I2PB 1TVRB 1BQNB 2AGQA 2YKMA 3DLKB 1TKXB 3QLHA 4ZVFA 2GC8A 5KFDA 1IM4A 2UVWA 4RU9A 2DPIA 3GYNA 2OPSA 1RDRA 4G1QB 2IC3A 3C6TB 3FSIA 1R0AB 4HKQA 1C0TB 2R2UA 5KT5A 2IM1A 1S1TA 2R2SA 1C1BB 2FVCA 1RT2A 4QWBA 3T19A 5KFYA 3GV8B 2IM3A 5C24A 3OL6A 3V4IB 5KFAA 4IFVA 2R8HA 4K4YA 4IDKA 4TLRA 4URQU 5KG6A 1JLQA 5KFJA 1QAJA 3E01A 1T94A 5DG9A 2HNZA 3VQSA 1XR7A 4QWDA 3KHGA 4Y2CA 4J9NA 2AQ4A 5EDWA 3PJWA 5FDLA 5KG1A 4DG1B 4PWDB 2VG7B 3OSPA 4ED0A 3KLEA 4WZQA 3MEDA 2IMWP 5KFSA 3IRXA 5KFKA 2V0NA 4EO6A 1SV5B 2W9AA 3H2LA 1DTTA 5HROB 4KV8B 5KFRA 4R5PB 2XCAA 4M94A 2OPPA 2R8GA 4RW4B 3QYYA 2YNFA 3UDLA 3KK1B 2R8JA 1S1XA 3MR6A 5KFXA 1JLCB 2JEJA 4NLRA 3CO9A 4TYAA 3ISNC 1JKHA 4URGA 3KK2A 5KFQA 3DYAA 1OS5A 1HARA 5HBMA 4TQRA 3RAQA 1LWEA 1MU2A 1S9GB 4I2QB 2IA6A 2J6UA 3FDSA 3PW2A 2AGOA 1J5OA 3OHBA 3LANA 3DMJB 4QWEA 3HHKA 4KE5A 2ZKUA 3V6DB 2C28A 3QO9A 1IKXB 2HAIA 4NCGB 5I3UA 3SFGA 2BQ3A 3QGIA 5KFCA 5HP1B 4MFBA 1TL1A 1N4LA 1C1CB 1RT4A 3HVTB 3JYTB 4NRUA 4J9LA 4EYIB 3NGDA 3PW4A 2ALZA 1LW2A 1S6QB 4WFYA 3DRRB 1RAJA 1IKWA 3M9OB 2WCXA 4ECWA 2ATLA 5F8MA 1T03B 1JLEB 4I7FB 4PQUB 1TKTA 2HWHA 1JLAA 3DI6B 3LP0A 5KT2A 2RF2A 4YR0A 1JLFA 2BQRA 3PR4A 4K4SA 4H4MB 4RW9B 4TY8A 3KLFA 1T05A 2AWZA 3QIPA 1TV6A 4YMEA 3H4BA 1TP7A 4U6PA 5KFMA 3DRSB 2I1RA 3C6UA 4J9OA 3KJVA 3LP1B 4ECUA 2ASJA 4TN2A 1S1VA 4RW8A 2IM0A 3CIZA 2RDIA 3CJ5A 4DL4A 2W9BA 4IOBA 2OPRA 2WOMA 3H5XA 1RA7A 1NHUA 4Q44A 3T5JA 5CYMA 3RAXA 4QW8A 4B3OB 1RTIB 3I5BA 3GV5B 4X2BA 4Y2AA 4ZMMA 2YNGA 3KMQA 5DLFA 3CJ2A 2RDJA 2VA3A 4KO0A 1ZETA 2ZE2B 1TKZA 4LQ3A 1HNIA 1BQMB 3BQ1A 1HNVA 1HQUB 4K4UA 3KLGA 1RT6B 4NRTA 3BSNA 1JLBB 3LALA 2C2RA 2B5JA 3DLGB 3DM2A 4ID5A 1N5YB 3DLEB 1S1UA 3MFHA 3IGVA 4XPEA 3MEGA 2C22A 2IAJA 4R8UA 5KT4A 1RT3A 1C0UA 1LWFA 4Q0BB 3I0RB 1TQLA 1JIHA 3T5LA 2JC1A 1UWBB 5EWEA 1RT7A 3CDWA 4GC6A 1S48A 3KLIA 5C25A 3ITHB 4TQSA 1SH0A 4ECZA 4IDKB 2B6AB 2IM2A 4ICLB 2W9CA 2J6TA 3DOLB 3NKYA 1FK9A 4RUAA 3H4DA 5J2MB 2QV6A 1XR5A 3LP2A 5KFGA 4DL7A 3SI8A 2D3UA 5J2PB 1LWCB 4MK9A 4NLTA 3V6JA 3G86A 1SUQB 2WHOA 2RKIB 5J2NA 4KB7A 4RW7A 4GC7A 1FKOB 4Q43A 3E51A 4NLQA 1HYSB 1D1UA 1HQEA 4K4VA 2I5JB 1S1WA 1DTTB 5KG2A 2O5DA 4Q8FA 4ED8A 1REVB 2OPPB 3M8PB 2BE2B 2HNYB 4KBIA 1RTDB 2V4QA 4LSLA 1K1SA 4J9PA 3G6VA 2V4RA 3TVKA 4ZHRB 2D7SA 2WONA 4IFYB 2JEFA 1MMLA 2B43A 4KFBA 1IKVB 4KHMA 1TL3A 3IS9B 4MH8A 5KT6A 3H59A 3KMSA 3KK2B 4Q8EA 4RNOA 1LWEB 4KSEB 4ECYA 1RT5B 5DQGA 2D3ZA 4RZRA 2AGPA 2BR0A 4H4OB 5L1IA 5I42A 1RTHA 4IR9A 2HWIA 4O4GB 2HMIB 4ECSA 4IR1A 4JV2A 3OL8A 2UVRA 2YNIA 3RB3A 3NL0A 1S9EA 4DL5A 3PW0A 4IG0A 4J9MA 5KFLA 3D5MA 1JLGA 1LW0A 4KKOB 3TAMA 4IG3A 3JSMB 2C2EA 5CYQB 1DTQA 3H5YA 3BGRB 4QWAA 2FLLA 3I0SA 5KFWA 2BRKA 4QPXA 2ZD1B 1LW2B 3KK3B 1QE1B 4ZPBA 4I2PA 2WTFA 3N6NA 4ZPAA 3KLHA 1TVRA 2XGQA 1BQNA 4M95A 2JC0A 3DLKA 2WK4A 1TKXA 3NAIA 4NYZA 4WYWA 3NBPB 4IH6A 4IRDA 1VRTB 2IJFA 4XPCA 2FJXA 3OLAA 4TY8B 4URSA 3GIJA 1DLOB 2CKWA 2VG5B 3MTKA 3M8QB 3QGGA 4G1QA 4F4WA 3C6TA 3V6HA 4PUOB 1C0TA 1XR6A 1S0OA 3V81B 4RW6B 5KFHA 1KHVA 4EBDA 1C1BA 1RTJB 3RB6A 1RYRA 4DL6A 5KFBA 4RW8B 4NLWA 2JLEA 3M9NB 5J1EB 4RNFA 3KOAA 3V4IA 1N6QA 4WE1B 4ECQA 2R2TA 3H98A 4TXSA 5JXSA 1WNEA 4EBCA 5CYMB 4MK7A 2HNDA 2OPQB 5JUMA 4K4ZA 3EPGA 4O44B 4RNHA 5KT3A 3RBDA 2VG6B 4YP3A 5KFZA 4PWDA 1IKYB 4G3IA 4ED3A 3CWJA 4RNMA 1JXLA 1KLMB 4F50A 2E9RX 1HNIB 1S49A 3N6LA 1HNVB 1RT1A 3PW7A 3QIDA 4KV8A 4R5PA 4ZP9A 1HPZB 2B5JB 3MECB 3MEEB 5K14A 5KG4A 2YNHB 4IRKA 1SH2A 1S1UB 1S6PB 5KT7A 4RW4A 3H5SA 3PW5A 5D3GA 2IAJB 3KK1A 3FFIB 4HYKA 4QWCA 1FKPB 1HMVB 3BQ0A 3MR3A 3IG1B 3Q8SB 3UR0A 2GIQA 3DRPB 4O3SA 2D41A 4WFXA 3KLIB 4NLDA 3MR5A 4IRCA 3TQ1A 5HLFB 4JUZA 5EWFA 2ILZA 4K4XA 1S9GA 1VRUB 2BANB 4I2QA 5J2QB 4YR2A 5L1JA 5C42B 4EEYA 3FRZA 2UUTA 3CVKA 2J6SA 1KHWA 3DMJA 3V6DA 2YKMB 3HVWA 3QLHB 1IKXA 4NCGA 2WB4A 1GX5A 2BRLA 3CJ3A 5HP1A 5J2NB 1T3NA 3BJYA 1C1CA 2OPSB 3HVTA 3JYTA 4O4RA 2AX1A 2IC3B 4ZVEA 4ECRA 3GQCA 2FJWA 4J9SA 3LAKA 3KLVA 3DRRA 4LSNA 1T03A 1D0EA 2DPJA 4I7FA 4PQUA 1S97A 1S1TB 3DI6A 3Q8RB 2ASLA 1RT2B 3CJ4A 5KG5A 5DQHA 2ASDA 2W7OA 4IH7A 5KFNA 3PJXA 3I5CA 5C24B 3PR5B 3QZ7A 5F8HA 4H4MA 4IFVB 4RW9A 3EPIA 5KFUA 3BQ2A 3QGHA 4F4YA 1JLQB 2E9ZA 3BREA 1S4FA 3E01B 4NLXA 1Z4UA 2HNZB 2OH2A 4ZVHA 3DRSA 5T14A 2E9TA 3FQKA 3T5KA 3RB4A 4EBEA 3HVAA 3LP1A 3N6MA 5FDLB 1EETA 1SH3A 4YQWA 3KLEB 3MEDB 4MIBA 4QW9A 3IRXB 3BR9A 3NMAA 3SFUA 3PVXA 2FVPA 4NLUA 1CSJA 4MKBA 3DOKA 3MR2A 3HKWA 3OL7A 3G6YA 2AX0A 4B3OA 1RTIA 3KHLA 2YNFB 3BSOA 4JV0A 5F9NA 3I5AA 3OSNA 2EC0A 1S1XB 5F8JA 3KLHB 2ZE2A 2BQUA 1BQMA 3EZUA 5EUHA 4K50A 1HQUA 3PZPA 1RT6A 4NLYA 2GIRA 1U09A 1JKHB 1JLBA 4F4XA 4DEZA 3DYAB 1I6JA 2F8EX 3DLGA 5HBMB 3IN5A 1MU2B 1N5YA 3DLEA 2XWYA 4O3RA 4NLPA 2UVVA 3UPFA 4U7CA 4MIAA 1EP4A 4WFZA 3GV7B 1J5OB 5DG8A 1JX4A 4Q0BA 3I0RA 1RA6A 4WXOA 5DLGA 3QO9B 2XC9A 1UWBA 2UUWA 5I3UB 2AU0A 3ITHA 4MFBB 4ECVA 2YKNA 1TL1B 4IKAA 5F8IA 1RT4B 2R8IA 1N6QB 2B6AA 3BSCA 4ICLA 3DOLA 1IKWB 1RYSA 3OLBA 5J2MA 2HNDB 1TKTB 4FBUA 1JLAB 1QUVA 3LP0B 4XO0A 2RF2B 5J2PA 1JLFB 5DQIA 1LWCA 3GIIA 1SUQA 2RKIA 3KLFB 1T05B 3QIPB 1FKOA 4R0EA 1TV6B 2R8KA 1RT1B 1HYSA 3CJ0A 3OHAA 2I5JA 1R0AA 2JEGA 3C6UB 1N56A 5K14B 1GX6A 1REVA 3KJVB 3M8PA 2FLNA 2BE2A 2HNYA 1C2PA 2FVSA 1RTDA 1S1VB 3IGNA 5KG7A 4ED2A 4K4WA 4IH5A 5D3GB 2IBKA 2W9BB 3Q8QB 4ZVGA 1S0MA 4TYBA 4O3QA 2OPRB 2WOMB 4ZHRA 4EO8A 4FS2A 4IFYA 5L9XA 3OL9A 1IKVA 4NLVA 3IS9A 5L1KA 4WZMA 4O3NA 4ED6A 5L1LA 2FLPA 2CJQA 4NZ0A 3UQSA 2W7PA 4DG1A 1RT5A 4RUCA 2YNGB 2VG7A 3MFIA 5KG3A 4H4OA 5KFTA 3RBEA 4FS1A 4KO0B 3MF5A 4O3PA 4O4GA 2HMIA 2XGPA 1TKZB 1SV5A 4ED7A 5KFFA 3NAHA 2V9WA 1NNDA 5DGBA 3QZ8A 3KLGB 1S0NA 5HROA 3KHRA 4FBTA 4IQXA 2QE5A 4KKOA 2R2RA 3DM2B 4KHRA 4ID5B 4LQ9A 3JSMA 3V6KA 4ZPCA 5CYQA 1QAIA 3BGRA 4J9RA 3MEGB 4MK8A 2W8LA 4ZP6A 2ZD1A 4R8UB 1RT3B 1NHVA 3PHEA 1C0UB 1QE1A 1LWFB 4LSNB 3KK3A 4EYHB 3CDEA 5KFPA 2JEIA 5KFEA 3LAMA 1JLCA 1RT7B 3RB0A 3NBPA 1VRTA 5C25B 4Y34A 4J9KA 4NLGA 2W9CB 1DLOA 2VG5A 3M8QA 3ISND 4NLSA 4KAIA 3T1AA 2UVUA 1FK9B 2FVRA 4PUOA 3LP2B 3H40A
chains in the Genus database with same CATH superfamily
2HFUA 2ACMA 5E3QA 1RTJA 3POTB 3SV3A 4B3SF 3EX7B 4I69A 2EVZA 1S6QA 1S1WB 4YR3A 3TO8A 3K17A 4LJMA 4P73A 3T1YJ 5H9FK 5D4LA 1KOOA 5F8NA 3MECA 3HI9A 4ZCMA 1SJFA 4NMXA 2VA2A 2BJ8A 5HMWA 3D3CJ 1T02A 5I42B 2KXHA 2OTLS 3R7BB 3QBCA 3ISZA 3SXLA 5EN1A 3K89A 5DRKA 1JLGB 2CQBA 1FX2A 2YKNB 5GAHU 5C42A 3CDUA 1SKRA 2AYGA 5F3ZA 2CA9A 1JQGA 5HO4A 2LVWA 1FWPA 4V19X 3M6XA 3PACA 3UN3A 3EDRB 2HFOA 3NWGA 5KYTA 5KG6A 2EFPA 2FLOA 3MGJA 4WZQA 2ZOFA 1SXLA 5KFKA 2ZEJA 2CYYA 1OYEA 4JV5J 4JB8B 3FBEA 4JI2F 1UFWA 3P5TL 1Y10A 3THTA 1I94F 4X62F 2C3PA 5KFQA 3DYAA 3DCAA 3C3LA 2QYGA 1IXKA 4QWEA 5E3AA 2V4JB 2QJ3A 1YJUA 4OI1A 1EAYC 8RUCA 3GPAA 1GXTA 5ETKA 1HNWF 3VAMA 2FYXA 3RAMA 1F9HA 5IQ6A 1H98A 4IOBA 4UOCA 4P2SA 4X4PA 2XO7A 2BV3A 1T7PA 4JYAJ 1RBOB 1Y00A 3J7YI 1RADB 4DZDA 4JI1J 5E3RA 4KO0A 3NWRA 1ZETA 4LQ3A 3LALA 1HIYA 3H8YA 4V1Ak 2HQ3A 4R8UA 4Q0BB 3DFEA 4LRFA 1X9SA 2Q6BA 4DL7A 4WP8A 2DH7A 1JB0C 1LK7A 3H20A 1RWVB 4C9DA 4JI6F 3P3DA 1HI0P 4C11B 2XY6A 2QSFA 4DV0J 3O6QA 4RWWA 3D6MB 4H4OB 2L41A 3KTQA 1FD2A 3FCHA 2I6WA 5F0WA 3WDOA 5IFMA 2MMYA 3IWLA 4KKOB 1DTQA 3HPOA 2FLLA 2MKJA 3LF0A 3N6NA 1ZH5A 4UQTA 3D6FB 2WK4A 2B51A 1NKEA 3FCWA 4URSA 3DKDA 4O0NA 1C0TA 1S0OA 4DV1F 4PAAA 1T9XA 1RYRA 1VI7A 1K44A 3HJFA 1GXUA 3DNCA 2JHEA 4RNHA 2GZOA 1H6KX 2KJWA 3WBZA 3N6LA 5KTQA 2XMUA 2B56A 5KG4A 4X4SA 5DDOC 2V50A 1I1GA 2HG4A 2RRAA 2CJXB 2NLWA 3JSRA 1UVJA 4I2QA 2AT1B 3RG6A 1M5KC 4RO0A 2YKMB 3I4PA 1S5ZA 3V4MA 2WB4A 5B08A 2A6OA 4ECXA 4LSNA 2QN6B 1S97A 2UZAA 5KG5A 1PG5B 3HHEA 4D3HA 4OIXA 2QX0A 1M1HA 5DDRC 3KLEB 3EGWB 2PT0A 1CPZA 4WF9Q 3HKWA 3G6YA 3E2EA 2NPFA 4QYZK 3W64A 4DOZA 2WVEA 2AJ4A 2W1BA 3TARA 3PG9A 4QOTA 3C46A 1EP4A 4ZCLA 3RGIA 1X9MA 3IMQJ 2PI4A 1N6QB 4JI2J 4UZCA 1SKSA 4FYDA 1I94J 1R0BG 2FPHX 2CJBA 1M5SA 1T05B 2R7WA 4EK2A 3CSKA 3MOZA 4K5RA 1S0MA 2WOMB 3R5GA 3T1HF 1WOPA 3SYZA 3MF5A 5GMKa 2F9JA 1RWNB 2B9YA 4OYXA 4M5NA 3QT7A 4NYOA 3AA9A 3GJRB 3LAMA 4ZVUB 3TP2A 2XTCA 1X7VA 3CT9A 2W9CB 1XBWA 2DITA 1QD1A 5D4PA 2JVOA 4USHA 2Y9HA 5K9FA 3PEJA 4CLFA 4GKJJ 4I1TA 3FZ2A 2KZMA 3B4DA 1ZTTA 4OX9J 4F26A 2V1SA 3SIPB 1BXNA 4ED1A 1RCOB 4H4KA 5CCMA 1S6OA 1PJ6A 1K1QA 4HACA 4NX9A 5E5NA 4X4TA 3GIKA 1L3SA 3MM7B 1WC3A 4ZVQB 3FK4A 3TAMB 1Q7LB 4TY9A 2BANA 1BE4A 2QLBB 3KUGA 2YWFA 3OR1B 1OWXA 4FPIA 3J81Y 1QVFR 3UD3P 4NL5A 1MMNA 2FZCB 1MN9A 1FO1A 5D8HB 3UD5A 1HFEL 4LF7J 5M2UA 1ELOA 1X4EA 1YG0A 2BKOA 1DQAA 4D3GA 4ELUA 4FDFA 2M3DA 4DV1J 4RW4B 2C2OB 2DNNA 4WK1A 4F3MA 1IR1A 2KDOA 3C14B 4KGKA 1UVKA 3DLLQ 3B4MA 4TYAA 3D54A 1OS5A 3RAQA 4ZVOB 2PFDA 4K5SA 2A10A 2BJ1A 1SC4B 2L9NA 2BQ3A 4L75A 1TL1A 3N28A 5HI7A 1H0HB 2SXLA 1T9WA 1JLEB 5AXKA 5SUHA 1TKTA 4CO0A 4A8KA 4RW9B 4HH1A 2B7BB 3KLFA 2DIVA 2YVSA 1REGX 3C6UA 4C2MA 1R31A 1SC1B 4I68A 2Z4PA 1T0TV 3HHLB 1X5OA 5IC4B 1HWIA 3BM7A 1HL6A 1TKZA 1HNVA 3JQKA 2LU1A 1B0TA 1NHKL 4HT5A 1S1UA 1FJEB 4C3KA 4MMOA 2KVQE 5D6GA 2DY9A 3JB9k 1Y11A 4PKDB 5KFGA 5L9NA 4MK9A 3HX9A 5BXIA 5LSRA 3L7UA 1D9FA 1ZS6A 1HBUB 4CCHA 1C4AA 4ED8A 2HHPA 3O2IA 2MGZA 2MKHA 1R8AA 5LOQA 1TL3A 2BR0A 1N33J 1UWAA 7AT1B 2YNIA 5KFLA 4DBQA 1LW0A 1N0VC 3I0SA 4CYUA 1TKXA 4I4BA 2HFNA 4NEYA 3R7SB 4TY8B 2CKWA 3RBXA 4ANDA 3HDSA 2FD2A 2OSQA 3RB6A 4KPCA 4TXSA 2RAQA 5AE3A 5CYMB 3OD2A 4C0OC 2AJ2A 2V8VA 2AYMA 4X66F 3QSIA 4YS2A 1S49A 1IBLJ 4OX7A 4OHZA 1NSAA 3G2XA 1KONA 2J0XA 1U8SA 2HK2A 4UW2A 3DLBA 2HFZA 4QR0A 4B02A 2RIJA 1VRUB 1XTZA 5J2QB 3AODA 3DMJA 4GO5X 3I82A 1PBAA 4KC5A 3QLHB 3VAKA 2DY1A 1XNQJ 1T3NA 4ECRA 4IQMA 3Q8UA 4IH7A 2RSQA 4J9VA 1JXVA 3EICA 2OH2A 3QMQA 2LA6A 1X31C 1MG7A 4IOAQ 1T11A 1FNMA 3HULA 1WOSA 2ZVSA 2UXDJ 2F8HA 2PO4A 3L09A 3MR2A 4FZVA 1T9YA 4IO1A 2YNFB 3O1LA 3PIPQ 1I6JA 1X4HA 2X7IA 2HSEB 1E6VA 1U6FA 1RAOA 1GT8A 2XC9A 4PYDA 3D9BA 3P5BP 2YKNA 2B6AA 1HLWA 4BCAA 4DR5F 5ETNA 2DNRA 3PNIA 5LSOA 4I0WA 2EFOA 2GMLA 2IBOA 5CD4A 5I4MA 3HSJA 1UJ6A 1ZPVA 2VFSA 1BD6A 3GFYA 4ED6A 1ULRA 2DXEA 2W7PA 3NGKA 1RT5A 4CO2A 4AL7A 3NCRA 4O3PA 2XGPA 2O01C 4DPYA 3A4TA 1BWVA 4KHRA 4F0MA 4J9RA 3MEGB 2Q1LA 4ZP6A 2GQ2A 1PGZA 2MZ1A 2XZTB 2CPHA 2YX4A 1RAHB 3QT5A 3LTOA 2FVRA 3TX8A 1Y5NB 3AXMA 3OTEA 2V4JA 2XMVA 3ICLA 2V69A 4NLOA 1X0PA 2AEFA 4Q45A 1N88A 2ADBA 2J7KA 4LSLB 3D7SB 1N34F 2BJEA 3QRPA 2M2BA 3BYPA 4G1PA 1RTHB 2GMHA 4DI6A 2QLFB 2WRMA 2MY7A 3RBZA 1WKLA 3T9NA 4DLEA 2HWTA 2ZJRQ 4LMZA 1TAQA 3W7BA 4NASA 1KFSA 1HKAA 3M6UA 3CD6S 2WVFA 1R6YA 4CO3A 1UZHA 1R0AB 4OFZA 4GKKF 2AJQA 1RT2A 2LDIA 4B9SA 4AYBD 3JAMU 2KT2A 1KEKA 5THWA 3GB0A 1CQNA 3E01A 5DG9A 4J9NA 5FDLA 4DG1B 3TUZC 3MEDA 4WU3A 3KWMA 3WIUA 4B08A 1XMOJ 3IRWP 4YOEA 4OJ3A 3BF4A 2RMLA 4V19J 1S1XA 4JI8F 3SCKE 3TAQA 2IA0A 1FRXA 1RCXB 2YKOA 1N32J 3ENWA 1NDKA 4KE5A 2Z2ZA 5KFCA 3NGDA 3CEDA 3D1OA 2RF2A 2DHAA 1DBDA 5A8WA 1MSWD 2UUCJ 4CT9A 5KFMA 3W2VA 3LW5C 3B8HA 3CJSA 3BH6B 3RAXA 4P10A 3IR5B 4U7UD 3RR7A 4JI3J 2LEBA 1X4FA 4K4UA 3AD8C 3DLEB 2KM8B 1VFJA 2JWNA 3RRKA 4B9MA 2X3DA 1I51B 4ZJOA 1MW7A 4TQSA 1SH0A 1WKJA 3HHNB 4HDGA 3P45B 2VPZB 5J2MB 3R5BA 2IYGA 5J2PB 4UOGA 3OW2R 1LXJA 1U1RA 4KBIA 1J2VA 2HFVA 3KDNA 5C2GA 2N4CA 4Q8EA 3W63A 3MCOA 5DQGA 4I6YA 2DO0A 4IR9A 2HWIA 4JV2A 2XTJP 2XLKA 2DCUB 3CCMS 1TK8A 1LW2B 5IV4A 1RHRB 1XNRF 1QAYA 1YRXA 1Q86T 2LDYA 3I55S 2FJXA 4JI5F 2IPOB 5M2RA 3W5XA 1G2EA 1XR6A 2KG1A 2H54B 4LF5J 1C1BA 1N6QA 4WE1B 3TEGA 1URNA 1FERA 5JUMA 4KYZA 3PRDA 2V68A 3C66A 3MXHP 1NUEA 1ICEB 3PV8A 5DV9A 4QWCA 1IBMJ 1CJVA 3BPSP 3CULA 4Y6IA 1H3DA 2HQFA 5EWFA 4B3MF 2E5JA 1KHWA 3THPA 4PG4A 1PCAA 3JYTA 4Y2MA 1YJ9S 2IC3B 3CJTA 5GAGI 4LF8F 2R3VA 1S1TB 1U45A 4DFPA 2ASDA 4KT0C 4ZPTR 4LRCA 1B7YB 3FQKA 4EBEA 1VQOS 4TNOA 3Q86A 1SH3A 3GR0A 3PEHA 3ZTQA 2OJ3A 1CJTA 2DNKA 4GKKJ 3HFKA 1TU0B 2GMJA 2ZE2A 2MKYA 4A8XA 3W61A 2DH8A 4DPUA 3PHTA 1Y3JA 1NEEA 2FC9A 3M8RA 4P7TA 5DG8A 2XLIA 3IBCB 3U27A 4F0HA 1WDDA 2R7SA 2I38A 1OYDA 3W62A 5ETTA 1JLAB 3LP0B 3FUYA 3WHIA 2HHUA 3QIPB 1XMQF 2Z30B 3P49B 1FRHA 2HBYB 2G1HA 2U1AA 1KVIA 4O3QA 3IM9A 5L9XA 3OL9A 2G4BA 5L1KA 2FLPA 4X4QA 3UQSA 3GR1A 1KOHA 3Q2TC 1HW8A 3VGUA 1NNDA 5DGBA 2OEJA 5CYQA 4AD6A 1RT3B 3PHEA 4ZVTB 1C0UB 2EC2A 2GAGC 3GFZA 1RT7B 4FVMA 4DR4F 4Y34A 3UVJB 2D68A 2LP4A 1N0UA 2X1AA 3CJKA 2FVQA 5A8RA 3N4WA 4P2MA 1JLEA 2MJUA 3HD2A 5A8KB 2DHGA 1KLMA 2FJVA 1S6UA 3CUNA 3CC2S 4KPYA 1EHWA 1EKSA 2HVHA 1S6PA 1FTCA 2DKOB 1HMVA 4GO7X 3BKUA 1WKKA 4WXWA 2FJBB 1R8PA 4M1KA 3C19A 3CCJS 2KH9A 1HBMA 3M4XA 2V63A 3EWGA 5AXMA 2XCPA 5JJBA 2IFXA 2POKA 3R6LB 4ZVFA 4X84A 2BOPA 2ZH7A 2ZZMA 5CAAA 1S7HA 3H42A 3DGPA 2FVCA 1VQ7S 3CJRA 5C24A 4AQYJ 3V4IB 4CTAB 4IFVA 5B0CA 2DGXA 5IT9U 1LOUA 2HK3A 5H9EJ 2IMWP 1TL4A 4JI5J 3PIOQ 4U67Q 3PTWA 4ALZA 3W5ZA 3G8QA 2ROGA 1VQ9S 1FJGJ 2PI5A 4N8NA 1HBOB 3K59A 1HARA 1S9GB 2HVIA 4YHHF 4I6AA 1Z2LA 1J5OA 1R8HA 2QZ8A 3V6DB 1AXQA 3QGIA 4EYIB 1M1GA 1U25A 2JRSA 3DRRB 2VFVA 4I7FB 2V8PA 1BUXA 4TY8A 2XNQA 4B3MJ 1IR2A 4K2XA 1E6YA 3A8IA 4DS4A 1N36F 2RDIA 3S01A 3H5XA 2CG8A 4WFBQ 4Q44A 1OIAA 5CYMA 3CMAS 2ZZTA 4QW8A 1AUDA 2Y0BB 2ZITA 4QPTA 1CJKA 1C4CA 1YBTA 3CJ2A 2QL5B 3HSDA 2VKRA 4DV3J 2VOOA 3T9ZA 3PX0A 5KT4A 1U1MA 3KFWX 1TQLA 1JIHA 3T5LA 1JWWA 3CDWA 5CD4H 3ITHB 2J6TA 4ICLB 4C8LA 3SI8A 2MYFA 3UW1A 4NLTA 1SUQB 3J7YU 4GC7A 3QSYB 1HQEA 4LF9F 4LUBA 3UR3C 1JJ4A 4UZBA 1REVB 2CJYB 4ZITA 2V4RA 1J27A 3F56A 1S4EA 4M5JA 1IKVB 3GP9A 1ZAVA 1JNRB 1IBKF 5A6PA 2RS2A 3PW0A 4IG0A 4NWBA 4K8RA 4YUDA 3W3SA 1U2CA 3NS6A 2VDIA 3PJ9A 1VJQA 2B4OA 1QE1B 1B70B 3CGIA 4IRDA 3HFVA 2F3JA 4B3RF 1RSCA 2L08A 1XIQA 3B54A 1SJ4P 4ILLA 1VIXA 1OQ3A 3MUVP 4MTPA 2G0IA 2DNYA 1KWMA 1PILA 3J81U 4G3IA 3R6GB 3RYLA 1HW9A 3ZXWA 2B5JB 3MMCB 4WFAQ 4DR1F 2F40A 3FFIB 3OVSA 5G0RA 5A6WA 1RTZA 2GIQA 2NSCA 3TX0A 3W65A 2LXFA 3EZ5A 4DR3F 2CJAA 4LT6A 5GAHI 2OGUA 2BRLA 3BJYA 4O4RA 4ZVEA 4ZVRB 1P9QC 4HHHA 3AAWB 4CO5A 1R0CB 5KFNA 2GNKA 1L3UA 2C2ZB 5F8HA 3I96A 4TU8A 2R7VA 3I9V9 2R7UA 4HI2A 4M5HA 3SQGB 2FVPA 1HWLA 1NDCA 3TAPA 1GH8A 2B3TB 5F8JA 3VAHA 1L3TA 2W4DA 2HVZA 3RZAA 1MU2B 4Z37A 4NLPA 2OMLA 2Y0SD 1WC4A 5LMUF 2UUWA 4DUYF 5F8IA 1P8GA 2LECA 4ANCA 1IWAA 2X3GA 4FBUA 5DQIA 1UW9A 4KRWA 4CNYA 1FKOA 1R0AA 3OFFA 2JEGA 1N56A 3FMWA 5K14B 3BV8A 2XLJA 4IH5A 2W9BB 4ZVGA 2OPRB 5K8NA 4MKVA 2LU2A 1RZMA 2AV5A 4DG1A 3RBEA 2IRXA 2VZ9A 1VC5A 4PYAA 5KFFA 1VQYA 3KHRA 1TUWA 3BGRA 2ZD1A 4DFJA 2CWKA 2AJ1A 2DHHA 4F02A 5B0BA 4CDIA 2NPIA 1RWPB 4NXMF 3KG0A 1PAEX 1WEZA 3LP2B 1SB6A 4LFBJ 4LFCJ 3Q24A 4FKYA 4O44A 2F65A 3UCZP 2VBXA 4U9RA 3TZZA 4MKAA 2W8KA 2H5EA 4ZP8A 3G82B 3DDKA 1X5SA 1N52B 5GMEA 2DR9A 1DJ0A 2E7VA 3KHHA 4DFKA 5F8LA 3DDNA 1KQGB 2J8AA 4WU2A 1A9NB 4PWUA 3Q8PB 2ZWOA 1YRUA 2GC8A 4NZ6A 4EUVA 3HHLD 3OTDA 1D8YA 1YBUA 3C6TB 1PSDA 4UF4A 4OX8A 3F0NA 3HMJG 1DQ8A 1R8CA 2HQIA 4ED4A 3VQSA 4QWDA 4DV2F 4ED0A 4MT1A 2MDAA 4KV8B 4WFNQ 4M94A 5LMNF 2J9CA 3R5AA 3M8WA 2CZ4A 2OAUA 2VPYB 2XQCA 1N8RT 4CLWA 4P2XA 3PW2A 2MQQA 2CPXA 2OFGX 3MM9B 1J5EF 1SI9A 1TFWA 4MFBA 5HQ8A 3VAIA 3OUYB 1LW2A 1AW0A 2OO4A 2M5YA 1FFGB 1NM2A 2ACYA 4K4SA 3HHDA 4B3TJ 3JQJA 1AZSB 4E98A 1S1VA 4O23A 3RJMB 1NPKA 2AD9A 4Y65A 2RT3A 1RT6B 4NRTA 3EUNA 2C2RA 4UOHA 2XB2D 2AW0A 4J91A 2FJAB 4A48A 2QLXA 2XZ2A 4OX6A 1UAWA 3DOLB 1I5OB 1XR5A 3GCXP 4ZPWR 3V6JA 4Q43A 1MWZA 1OM2A 4DDFA 1VQSA 2BE2B 1F3FA 2V4QA 3TUPA 3PYEA 4ENOA 3CCQS 2JEFA 4DV4F 4PG7A 3H59A 1RWWB 1PKUA 4ETZA 2B0GA 5DZ6A 1SQEA 3S1TA 4QIWD 4DR7F 4L73A 2ROEA 1U7LA 4IG3A 3KK3B 4U8VA 3RTVA 1DARA 3D0IE 3M1VB 1YK9A 3PM9A 2XTDA 1RK8A 2BM1A 2NREA 4RW6B 3SDEB 1UJ5A 3CCZA 3DGVA 5KFBA 4RNFA 3Q23A 3EE3A 3GU0A 2OPQB 5F3TA 4DV5F 5KT3A 1FE4A 1IKYB 3BDEA 1JMTA 4LVNP 2RU3A 1EARA 1HNIB 5DM6Q 3QIDA 4ZP9A 1HPZB 1BQXA 2YNHB 2EK1A 5D0GA 1KN6A 3PW5A 3BQ0A 2CZVC 1U49A 3DRPB 1SIWB 5HLFB 3ZTRA 3FRZA 1OY6A 2XMWA 2CPDA 3P6YC 4HTIA 2GS8A 1D0EA 3J7AN 4PQUA 4C8YA 2HLUA 3PJXA 4H4MA 4TVAB 4XAKA 2YPYA 1Z4UA 1BA3A 1VQ8S 3EVOA 1GTHA 2W7AA 4MAKA 4W98A 1R3NA 3OL7A 1RTIA 2JSXA 4YDDB 4NZ7A 4CLLA 4JV0A 4F3OA 3OSNA 4C3LA 3PZPA 1UA1A 3NP5A 3DLGA 3ZZRA 5A2QY 3I56S 4KR0B 3R5JB 3DXBA 2V67A 4BDPA 1RA6A 3L7OA 2LMIA 3ENAA 1X9WA 2BW2A 5I3UB 1ZOTA 3BSCA 5LMNJ 3VF0B 2HNDB 2D3O1 1JLFB 1LWCA 1G4CA 4LF4F 3A8JA 2EBGA 4RUHA 1SVDA 3M32B 1J5EJ 3MM8B 4IFYA 3IS9A 4WZMA 3H0PA 1GQEA 1RWOB 2EG2A 2GHVC 4ID5B 1UCNA 4ANEA 1QTMA 4M5LA 4G1IA 1GK8A 3TYTA 5IWAF 2HHSA 1OY9A 2VG5A 1V3ZA 1FK9B 3PKMA 5KFVA 3V81A 4O3OA 4HI1A 2KFNA 3DOKB 1T3OA 3SCJE 3LO3A 2BEFA 2Z2MA 4J9QA 1Q7YT 1GMWD 3VZIA 1FKPA 1NH7A 3IWNC 4ZLJA 4F04B 3IG1A 2BA9A 3M7VA 4BHQA 3TZYA 3N9UC 5DG7A 4I2PB 1BQNB 3DLKB 3MUTP 2FHJA 2ZUGA 4PG8A 1FRJA 1G3OA 3O44A 2DO4A 4ZN1A 2MLZA 3ZC4A 2Y8YA 3UN5A 2PFFB 4DR7J 2IM3A 1TUGB 1QUPA 5KFAA 3L3CA 2AQ4A 1XR7A 3CC4S 1SBRA 3FJ2A 3PJWA 5FD1A 4MKYA 2OMOA 4CLUA 1UZDA 4NYPA 4JI7F 4NA2A 3G8SA 4CO4A 3UDLA 3UDEA 3KK1B 5IT0A 2AJ0A 4DV5J 3KUEA 2VD3A 4ELVA 1O6XA 3DHWC 3AXKA 2C28A 2KI2A 1PC4A 4Y2IA 5HP1B 3MMAB 2JNJA 1VR6A 2F4VJ 3HVTB 3OVAA 2ZM6F 2ALZA 2ATLA 2WCXA 3LOUA 2VL1A 5F8MA 3LPEA 2AWZA 1TV6A 2XY5A 3LP1B 1A7GE 2BOAA 3R9LA 2DNOA 2DK2A 4CLZA 4C8NA 2BZ2A 3T5JA 1NJZA 3GV5B 4Y2AA 2K3IA 5EX3A 4KHPF 5DLFA 2L3MA 1XC9A 2JX2A 1JLBB 2B5JA 2HAFA 4CRJA 1RBLA 2QGFB 2LYVA 3L7PA 3IBFB 2KL8A 4QCLA 1Z1ZA 3W2WB 4CLYA 2QV6A 2QLJB 2YX7A 4HHUA 1VS3A 2DRDA 4RW7A 1U26A 2I5JB 1SPBP 3DRYA 1WEYA 1K0TA 1NK4A 1G7CB 3MAAA 3WX8A 4YY3F 3TVKA 2WONA 4M5KA 3ILJA 2UUBJ 3IO1A 2DGWA 4O4GB 2HMIB 5DS7A 3CCRS 1YZ7A 3VGVA 2EFNA 2C2EA 1DURA 4A8SA 4N76A 3DOMB 1XEZA 1GFWB 3QNWB 1F3VA 1Q79A 1VBZA 3MMBB 4OLPA 3X1LB 3M8QB 3V6HA 2WBRA 1X4GA 2XSJA 2IRYA 1HBNA 2DRBA 2NCKL 2JLEA 1ROFA 1WNEA 4N8OA 5DO2A 3GSIA 2VG6B 3GYXB 5T7LA 1FD8A 4FYWB 2MEWA 2XSFA 2XYPB 1R7IA 4R5PA 5K14A 4EI2A 3V5RA 2HKEA 4X4OA 2D3OR 4F2SA 3SEOA 1PYTA 4YR2A 4CM0A 3MM5B 4A46A 4HHJA 4X65F 1CJUB 2FHOB 2DBBA 1RHJB 2V2KA 2CG4A 2OPSB 4DCJB 2KYZA 1JJCB 2FC8A 1JLQB 3BN7A 1S4FA 4RJVA 3T6JA 2L48A 4Z7YA 3GMGA 2E1CA 3BR9A 4Y0FA 1KFDA 1FJ7A 1H73A 3PVXA 3OTOF 4LF2A 2E66A 4DPTA 5A0YB 3OXGA 2DNMA 2A2DA 4BBYA 5GAGU 3MPYA 2GIRA 4NLYA 4LBHA 3IR6B 4WCEQ 1YX2A 3VTIA 5IC6B 2DXDA 3IXQA 1RAGB 1TR0A 1IR0A 4P72A 5ETMA 1RT1B 1X60A 3CJ0A 3QFWA 3D0GE 3KJVB 2VJVA 2F7VA 1NSKL 2ZM6J 3FSXA 5L1LA 1RAIB 3W5YA 2HHHJ 3K57A 3KNGA 2XG8A 1DHMA 5HMYA 4B9LA 2YWGA 1MWYA 1A0OB 3M30B 4WIQA 1S99A 3CDEA 1FF2A 2JEIA 4ZVPB 3NBPA 5C25B 3MHYA 2WSCC 1NK0A 1UPPA 1VQNS 2CQ0A 3ULHA 1W25A 2G2YA 4K7QA 5IM0A 4N7TA 4QBUA 3H5UA 2DVIA 3O3LA 4JI4J 1EB0A 2I9SA 2KB2A 3JSBA 2VIHA 4KFBB 1N48A 2F63A 2EFQA 2GX8A 3F73A 4LFAF 2VV5A 3IC1A 2ILYA 3M2RA 2C1EB 4KH1B 3GYNA 1RDRA 4FNIA 3PYDA 2R2SA 2ZHOA 1TL7B 1W7WA 4QZVB 2MXYA 1CLFA 2HQGA 3OL6A 1VHIA 4DWIA 2UU9J 4URQU 5LSLA 2J9DA 3RU0A 2RS8A 1UA0A 2J0QD 3VVUA 2DEJA 2Y1IA 3MR7A 5HROB 3RRHA 1B7FA 2C3YA 4M5DB 2FJEB 2K1RA 1WOOA 1JLCB 3UO0A 1JKHA 1QTNB 2HIYA 2W2OP 2OP5A 5HBMA 2IA6A 3KDOA 2J6UA 2AGOA 3UI3A 4ZA1A 3UNGC 2EI5A 4C8MA 4C8ZA 1IKXB 3DC2A 3OTCA 3C16B 4WFYA 1NPPA 1WG1A 4OI0A 3QJLA 2MTLA 2VQFF 1WUUA 1DRZA 4ES3A 4U8YA 3CDAA 3DRSB 2JL9A 4PWWA 2Z56B 2ASJA 1K73T 2NQPA 2HQDA 1UVMA 2PIIA 1NJYA 1SKWA 4B3OB 4DV7F 4ID8A 1HNIA 3BQ1A 1HR0F 4WTOB 3KLGA 4AXIA 2QMUB 4USJC 2KHDA 3THVA 4GC6A 4Z7CA 3FEYB 1IM6A 4ECZA 2EW9A 1U1OA 5D0RA 2RKIB 1BC6A 3E51A 4X64F 2DB1A 2E5LF 1BLUA 1RLCL 4GVBB 3D6HB 2D7SA 1FDAA 3QATA 1M5OC 5KT6A 1CC7A 3GWCA 3A3NB 1LWEB 4IOCQ 2DNGA 5IXUA 3SCIE 3I6PA 2MJNA 1MROA 4OJHA 2AJFE 1WACA 3JSMB 2DR8A 4NXNF 3H5YA 2VONA 1RLDA 3FBFA 5HAOA 4OZLA 2MSSA 3NNAA 4PCQA 4DL2A 2CQ3A 5HL7Q 3W60A 4EBDA 5J1EB 2DNHA 3H98A 4EBCA 2HNDA 4C8KA 4ZN3A 3LGNA 1UL3A 2OLWA 1H2TZ 1MWQA 2DNZA 2GJIA 1VJWA 4G6VB 3LQVA 2HHVA 2HRTA 1O8BA 2P9CA 2HRYA 4KQZA 1RJJA 4H4KC 4NLDA 1LXNA 2UUTA 3QPIA 2CXEA 1NO8A 1S57A 2OHDA 2U2FA 1EJ7L 4NCGA 2LCWA 3NOGA 1OSDA 5DETA 4K0KF 2PA8D 2XBPA 1Y4ZB 3QZ7A 1FFWB 2AF6A 2CNOB 4CT8A 2Q3PA 3K7RA 4YN3B 1U1LA 3DOKA 2JJ4D 1QDUB 2CUYA 2LQ8A 3LA0A 3SSQA 4A8FA 5F9NA 2KYXA 4U95A 2GVDB 5IOLA 2H9ZA 2UXCF 2A3JA 3M8SA 4B9UA 1F9FA 3P4UB 4FYVB 2W2PP 4LVOP 1H74A 3SSSA 4HH0A 2ZOGA 4NI2A 4N5SA 1L3VA 3M2VA 1IKWB 4TU9A 4XO0A 5H9EK 3GIIA 4HR2A 3OR2B 1RABB 2Y1LB 1GX6A 2GO8A 1RTDA 3AJDA 2R42A 4ED2A 4DUZF 3Q8QB 4DX5A 1P27B 4USTA 1HA1A 2YBVA 2XS2A 2VC1A 2RVJA 2VQFJ 3FGVA 1TMMA 2BABA 2K7KA 5HMXA 4ZPCA 3EYZA 2J7WA 1VQMS 4DV7J 4WKYA 4I64A 1CULA 2UVUA 2BYCA 4N77A 3IWXA 2ALYB 4DMZA 3AY0A 3MMAA 1YBAA 4RNNA 3M2UA 1ZZFA 5F9LA 5C5JA 4CLKA 4CNZA 1RAEB 4K4TA 2YWEA 2WZ1A 5KFOA 3MEEA 1T8EA 1RWKB 5HQMA 4MJKA 1LK5A 4Y3CA 1S9EB 3QQCD 4X64J 3IAS9 2MQNA 1HWJA 4PPDA 1TVRB 4GMKA 2VBZA 2UVWA 1B3TA 2DPIA 1Q0NA 4G1QB 2R2UA 4A8YA 2LQ5A 3DU5A 9ATCB 2IM1A 3VR1A 2B9XA 2QA1A 4NXNJ 3W2WA 2HS3A 5DDQC 1Q8IA 1WC1A 2GGPA 5KG1A 4PWDB 8ATCB 4CP5A 3IRXA 1SV5B 5HN0A 2DEIA 4MIWA 1W2IA 5EX0A 2MQOA 4CIOA 4WP3A 3KKFA 5KFXA 1EQMA 2Q43A 2K8GA 3C2PA 2RNEA 4JOUA 1NK5A 3LGHA 2UXBJ 3E3XA 2ABYA 2MZQA 2HAIA 4I6WA 3D0HE 3RR8A 1C1CB 1RT4A 2ZUAA 3R2CJ 3ILIA 5GVQA 1T03B 1CS4B 2W2QP 5A2QU 3OFGA 3MAQA 2PA3A 1X0FA 4LBIA 4DR6F 2KO1A 4M8LA 2PEHA 3BGFA 3BBFA 3BN4A 4ZLNA 1SJQA 4B3SJ 4K0KJ 1Y3KA 1HI1A 3CD0A 3Q22A 1FWKA 2RDJA 5L39A 1AFJA 1HQUB 2R7RA 1N5YB 4BS2A 5IT9Y 3D68A 1UJ4A 3I0RB 1UWBB 2DXFA 2CJKA 3UE2A 2YH1A 1YHQS 2ZBRA 2NXCA 4OZNA 1Q5YA 2B4VA 2CPFA 1PJ5A 3MM6B 4NLQA 4Q8FA 2MQMA 4DHVA 1V3RA 2HNYB 1HNZF 2AEMA 2JH3A 3KUHA 3RW7A 4MH8A 1RHMB 3NGSA 2W4CA 1RB0A 3F44A 1FRIA 3CNQP 3Q89A 5L1IA 2VFRA 2UVRA 2GW8A 4FF2A 3RB3A 2D74B 3QAUA 4FXDA 4ZPBA 2ZDOA 3NAIA 4IH6A 1VRTB 4X62J 1P1TA 5AJ3F 1DLOB 1Q53A 2V2ZA 4PUOB 3RUBL 2AIRB 2V5HG 3HK2A 1RTJB 1OQ6A 5BR8F 3R7NB 4FVCA 3TOQA 3ET6A 3AT1B 2J9EA 2NS1B 2R7TA 3EPGA 4FP9A 4UQGA 2MZJA 1HNWJ 1KP6A 1RT1A 2QL7B 4U7UK 3MECB 3K5OA 2QEXS 4JBCA 1JJ2R 3P96A 4P75A 3MR3A 3PXGa 5C42B 1PYOB 5J2NB 3WQPA 1ZM9A 4DV6F 2WAQD 4EZ9A 3DI6A 3CJ4A 2QA4S 1FDNA 3QGHA 2BJDA 2E9ZA 4USVA 5T14A 1N5VA 3IAM9 5IV3A 4QW9A 1YIJS 1FRMA 3FBCA 1VK8A 3HVRA 2EG1A 1RKIA 2RQKA 4JI6J 2OI2A 4CZCA 1WC6A 1BQMA 4K50A 1U02A 3U1LA 1U0SA 3DYAB 3NNCA 1VRQC 2GHWA 5GADU 3UPFA 4XTTA 4WXOA 2R8IA 3DN9A 2MHNA 2CADA 5K8OA 1ACMB 4CWBA 1QUVA 4Y28C 4PQAA 4OQJA 1HYSA 3M8PA 1TL7A 3IGNA 2VOPA 4ZHRA 1XK8A 3SV4A 5JVGQ 2OELA 4XDDA 4KO0B 3HLUA 1TZ0A 1Z2ZA 2MZTA 4N47A 5HROA 4IQXA 4F4AA 4R8UB 2AYEA 2QO3A 3ZTOA 3MDFA 4FYYB 2OEMA 4BC9A 1JLCA 1CBKA 2OFHX 4J9KA 3NCQA 4OYZA 2CQ1A 3T1AA 4NLSA 1IJFB 3LPYA 3N79A 1S10A 1YJVA 1HNXF 1FTRA 4DSFA 2ZHBA 2C2NA 3M6WA 1XJWB 2FDNA 1WG5A 2DGOA 4OL8A 2EK6A 2ZH2A 1G6BA 1BY9A 2CQCA 3VAJA 2WVCA 1DTQB 3EDQB 1HNZJ 5DJBA 4UT4A 3AHPA 1NPRA 4OYMA 4LIRA 3TVYA 1IM4A 4J7CA 4A8QA 2CPIA 1X8DA 4LIWA 4ILMA 1PO6A 1FKAF 1C0TB 3KJQB 3T19A 1YJWS 2M52A 1RE1B 3H90A 2R8HA 1ZZNA 2HNZA 3N0VA 1GMUA 2GVZA 1PBUA 2HVEA 4NA1A 2IDLA 2I2YA 4LRAA 2B4PA 4N56A 1VCTA 1ZM3A 3HZEA 4NLRA 1UEUA 2MY8A 2HGNA 5HK4A 1LWEA 4I2QB 1U0HA 3T1HJ 4LRDA 4JI0F 3QO9A 4YB7A 1O5JA 2OUGA 1VK3A 3PYFA 4DSKA 2GJ2A 2DNLA 3ZZYA 1WHYA 1VYAA 4ECUA 2DR5A 1P9YA 2G2ZA 2DRAA 2XMJA 1D8ZA 1MLAA 1WF2A 2YNGA 1ZM2A 2NUUG 2KU7A 3QRRA 1H7WA 1NU4A 2N3LA 3DM2A 2UV8G 1RU2A 1LWFA 1IWGA 5D0HA 1BHNA 2BW7A 3PY8A 1NZ8A 4A8WA 1WD6A 4Q5VA 2HFSA 3POTA 1UPMB 4FKXA 1S1WA 3MCNA 4QJVA 3U7JA 2O67A 4LF6F 4ECYA 2AGPA 1NRKA 5I42A 3QWPA 4RBTA 2YQ3A 3NL0A 5E0OA 2HZCA 1JLGA 4QWAA 5E33A 1EQ0A 2JC0A 4M63A 1FE0A 4WIIA 3VCDA 3QGGA 1NB2A 4OMFG 5ITHA 2F9DA 2D69A 2W24A 3HP6A 2BJ3A 3M9NB 2PDAA 2VUGA 3HZGA 4OYWA 2CJ9A 2CPJA 2DGSA 4RNMA 3A8KA 3RRGA 2HIQA 3Q0AA 1YQHA 4QIGA 4IRKA 4AL5A 2KN4A 4HACB 4OI4A 1HNXJ 5ETVA 1VQLS 2ILZA 2CVEA 2BANB 3G9CA 4EEYA 3AH6A 3CVKA 3BB5A 2DHSA 4FXVA 4IYQA 1F0XA 4DR2F 1RP5A 2Z58B 3CPWR 5F0UA 2AX1A 4J9SA 4YB1P 3KLVA 2DPJA 3ZZ0A 3Q8RB 2C3UA 3BQ2A 1ZA2B 3FEZA 2QA4G 3RB4A 5F41A 1OMSA 3HVAA 4YQWA 1U2FA 4F4KA 1CSJA 4CI0B 4DQQA 2FHJD 1CVJA 2EC0A 2EKYA 3ZTSA 3K2YA 4FF4A 1XN9A 3AX2A 3ETMA 4U7CA 4MIAA 2B9EA 1AROP 1JX4A 4Q0BA 2YKQA 2J5AA 3HT0A 1TL1B 4DPWA 4WWSA 2IIHA 2K06A 1TKTB 1HHQA 3EVWA 2GCFA 3BO3A 3VHQA 3KLFB 1VMBA 2NYHA 5DDPC 4JV5F 3C6UB 4JI0J 3D66A 2PSZA 1GXLA 1NBEB 1PJ7A 5D3GB 4C11A 3C15B 4LSZB 4OZ1A 4RUCA 1VLOA 4H4OA 4X66J 1TKZB 2CAJA 1SV5A 1TUVA 1SL1A 4KKOA 4LQ9A 2P5VA 2V1TA 3TQEA 5KFEA 2QLWA 3ZNJ1 1F5AA 1XERA 3N5FA 2FUG9 1RKJA 2LKZA 4XDCA 1RU1A 3M8YA 5GMDA 2FIUA 4A47A 1O51A 1NCLA 1YJ7A 2AMCB 3TZXA 2A2CA 1FI4A 2XI3A 5F8GA 3MCSA 4JYAF 1YDLA 3A3OB 1AFIA 2MGZB 4JI1F 1NSPA 1SJRA 1JK9B 3PFEA 3CDBA 4KGXB 1TL3B 1XMBA 2J0WA 2YY3A 1KLNA 1AT1B 3BH7B 3WC2A 2XMMA 5AXLA 2YNIB 1LW0B 4BWJA 3I0SB 3GIMA 2ADCA 1CEZA 1V5VA 2YKMA 1TKXB 4LF6J 5ETOA 3VALA 2GJFA 2RU9A 4C8OA 2BM0A 2IVMA 2E1PA 5KFYA 3GCWP 2W4PA 2DGVA 4DR5J 2KTQA 1ZM4A 3BGUA 3KLEA 2MKIA 4ERDA 5AE1A 1U48A 3H2LA 1QM9A 1UFKA 2RQ4A 2PGCA 1FRLA 3JTOA 2I8EA 2R8JA 3AOCA 4XK8C 3GTYX 3R2DJ 3MD3A 2I0XA 4TQRA 3N5BA 4W92B 2BX6A 3TUJC 3LUYA 3DMJB 2R7QA 3A12A 3G87A 5LT5A 4ZKAA 4J9LA 4C0BA 4FN5A 1WF0A 1EKRA 1JNZB 2IVFB 2X1BA 4MYUA 1QSLA 5AT1B 3KG1A 3NS7B 3TEHB 1T05A 2BE7D 2EPIA 2YWKA 3OTBA 4J9OA 1UW4A 4DXLA 4DR2J 3CIZA 2KT5A 2WOMA 2XS7A 1RWUA 4TU7A 3H2VE 3NOCA 5LJ3Y 2YKPA 1N34J 3BYRA 3CB4A 1GEHA 1E6VB 5B0EA 5CABA 3GZ7A 2B6AB 2CQ2A 2W9CA 4RUAA 1K47A 4J37A 4OYAA 3I9ZA 4OHVA 1IQZA 3G86A 5J2NA 4DSLA 3BKTA 2YKAA 2CQIA 3NGTA 2V2QA 3UCUP 2CFXA 1MMLA 5KYVA 1ZBTA 3KMSA 1RT5B 1WHXA 3TRGA 2BJ7A 1S79A 3MM7A 1VIOA 3JSYA 1H7XA 3TAMA 1G1XA 1YGYA 4C98A 2XGQA 4ZCKA 4JI8J 4EWTA 2FHMA 4NYZA 1HD1A 2LXUA 4W4MA 3GIJA 3OR1A 1FWLA 1NK9A 5I3PA 4DL6A 1V6HA 1WWHA 4KY3A 4ECQA 5HVGA 1RGVA 3PDNA 2AP6A 3RBDA 1JJHA 3QJJA 1Q95G 1FT8A 4BC7A 4RW4A 3H5SA 2XO6A 2IAJB 3HF5A 3BR8A 1QJHA 1MN7A 3O8WA 3C14A 3OBIA 4E2FB 3GG0A 4O3SA 2D41A 1K8AT 2JFDA 2N7CA 3FNNA 1NXIA 3ZZTA 2J6SA 2WVDA 4OI3A 2E1MC 2R4FA 2HQCA 1SJ3P 5BYRA 2PMZD 4GKJF 5L38A 4Y2KA 4DLGA 2PN6A 2KM8C 1RT2B 4QR1A 4OYOA 1RACB 2F4FA 1BWEA 3EPIA 3W9HA 4RW9A 4OX9F 4DU7A 3H2UB 5HJYA 2V9KA 3E01B 1X4DA 4ZVHA 4OJ1A 2LEAA 5FDLB 2M0GB 3K8WA 3MEDB 4UUXA 2H65B 1WI8A 1F5BA 3HHLA 2O1PA 1IUJA 1T95A 3K0JA 1S1XB 5EUHA 1Y7PA 3HT3A 3MOJB 1FVSA 1Y5LB 5CXTA 3M6VA 1XNRJ 1F60B 2RF2B 4TKTA 4RX6A 1HHSA 4LF7F 5A8WB 1KVJA 3JTNA 1HBUA 3W2VB 2IDEA 4PRFA 2APOA 4Z2XA 3Q8YA 4NLVA 2ZJPQ 4QIEA 4O3NA 4AT1B 2CPZA 1F1BB 1SQFA 3BBBA 4PXBA 3TJAA 1GTEA 2HVDA 3NAHA 4A8MP 1F2GA 2M7SA 2QE5A 2NZ4A 3GG1A 4EYHB 3SMZA 2ZHAA 5KFPA 3TR5A 1T9VA 2W2MP 4PG5A 4HVZA 1O0PA 2V8HA 2UV8A 3FQLA 2C2KB 1YVFA 3EZOA 2CZ9A 4LF8J 3CE8A 5FJ4A 1QY7A 5L8RC 1DY3A 1HWUA 5DGAA 3DRXA 3K5PA 3GILA 2LEPA 1WI6A 3TUIC 1ZTWA 5B0GA 1FEHA 1K0VA 3FZBA 1N5QA 4DL3A 1LWXA 2C2DA 1VRUA 5J2QA 4KIAA 1DAXA 2CQPA 4NOHA 3QLHA 4KGZB 4DF8A 4UTGA 4RU9A 3TANA 1H2UX 4C3MA 5JMNA 3HD1A 1C1BB 1V5IB 4X4NA 4NE9C 3W9IA 1FHTA 1NH8A 2E7XA 1QAJA 4DN9A 2DIUA 3G4SS 5K8PA 4Y2CA 2BUNA 1N33F 3HCXA 2E5HA 2V0NA 1XMQJ 4ZOSA 1ITPA 5KFRA 2B4UA 3TI0A 3QYYA 1RBAA 2YNFA 2CNLB 4FYXB 2XWXA 1CJVB 2JEJA 2A1BA 3ISNC 2QMXA 3ZO7A 1B4SA 2OIHA 3HHKA 1SCJB 4C7QA 3OQ2A 1U8WA 3K5MA 1D3WA 2FB0A 3JYTB 4IO9Q 3PX6A 4DCPB 4YR0A 2JVRA 3DLHA 3PR4A 1UEKA 4DR4J 2Q79A 1IBLF 2BKNA 2V94A 2PMWA 3H4BA 2M70A 1N5SA 4QIVA 2IM0A 3GJQB 2UP1A 1NAQA 1OPIA 1CJTB 2QIFA 2KXNB 1M5PC 2DHXA 1UP1A 1GAOA 3U02A 2ZE2B 3R8YA 4WPAA 4DCOB 3BSNA 1XNQF 1D9AA 1VQPS 3MFHA 3AQPA 2HHQA 3IGVA 3MEGA 4HLBA 4CH0S 2MQ8A 1S48A 1KS2A 1NK6A 3J7A1 1KTQA 4IDKB 3ZZUA 1FDBA 1BMQB 3JQMA 2WHOA 5CZVA 3ZTPA 1U24A 1UVIA 3PO4A 1D1UA 2UXDF 5LXRA 3TVZA 1M1KT 1V9OA 4LSLA 1DQ9A 2OEKA 3O5TB 2ROPA 3CCVS 4L72B 3W8GA 3OFHA 3KK2B 2P9GA 1FEEA 1RTHA 4IR1A 4ECSA 3OL8A 3MEKA 3U1NA 4JP8A 2FQQB 2YH0A 5CYQB 5KFWA 2EKNA 4ZPAA 2IJFA 4PG6A 4YHHJ 3EGNA 2VICA 3DLJA 1VC0A 2ZWPA 3CMQA 3CJKB 4ZDNA 5A8RB 3CTRA 2R2TA 1WHVA 1H2VZ 2YWHA 5JXSA 2VJUA 1D9DA 1UKUA 4MK7A 3GSDA 2DCLA 3C8YA 3OVBA 4ED3A 1JXLA 1KLMB 5GAEU 5KOWA 5MAOA 1F2HA 1LNQA 5K5MA 1S6PB 4I56A 5D3GA 1N36J 4HYKA 1HMVB 3C15A 3AJ2A 3TQ1A 3WC0A 3BGLA 1HBMB 3ILLA 3OPKA 3G96A 3HVWA 1B0VA 3BO2A 1FXLA 2DJWA 1EIYB 1Y9OA 4PEOA 4HT7A 1GMWA 3DGPB 3UNYA 5C24B 3IBWA 4IFVB 2ZZNA 2NXEA 2QC3A 2DR6A 2ZH6A 5B09A 3TW0A 3NMAA 2G13A 3L4BC 4NLUA 4MKBA 4L3KA 4LF9J 3FVYA 3F41A 2X1GA 4K2JA 2BDPA 2QRRA 3WIVA 4F4XA 2F8EX 3DLEA 1IBKJ 1KSPA 2B7CB 2P9EA 3GV7B 1J5OB 2P8IA 2ZKTA 3A1YG 4YDXA 4LR8A 4M5MA 4NA3A 4RU2A 1I3OB 3M05A 3VAFA 5J2MA 2UUAF 5J2PA 1XMOF 2Z2YB 3FEXB 4B3RJ 3R3TA 1E6YB 2FVSA 2EFVA 3HSZA 3V2UC 5AXNA 2QG9B 2ZBCA 2BE9B 1UUJA 2KG0A 5J1PA 3FSYA 1CJKB 1N32F 3UFCX 4ED7A 5LM7E 3QZ8A 4P7VA 4C48A 1X4CA 2LFVA 4MK8A 2W8LA 1U2RA 4DR1J 1DZ5A 5D0EA 4P9SA 4ITSA 2UUCF 5HATA 1LEOA 4DR3J 2RHSB 3D28A 5EWGA 3IR7B 4WE1A 2ZH9A 2XI2A 1HQEB 1TAUA 4FF1A 4JI3F 3M8ZA 5FLXY 2RE1A 1F5CA 3K8VA 3CCUS 4WYLA 4IG0B 1RXOB 3R27A 4F4ZA 2CNNB 3OFEA 3WX4A 3OXFA 2HGMA 1MMDA 1IVZA 6FDRA 2IC3A 2K2PA 4Q2LA 3AB2B 4OJGA 4GVLA 1S1TA 5LMUJ 4QR2A 1S76D 2MKSA 4F7VA 1YI2S 4DUYJ 2F5GA 5KFJA 1QSYA 4PXCA 2IHR1 2VG7B 3GFXA 4USIA 5AE2A 5KFSA 5EGYA 1Q8LA 2KZZA 4HTJA 2HHWA 2R8GA 1R89A 2QT7A 2ZNZA 4YB6A 5RUBA 5G0RB 2O3DA 4BWMA 2VFTA 2NYIA 2LQJA 4LF5F 2BVZA 1Q8BA 3PCOB 3BEGB 5BYQA 4NRUA 2H1YA 3ZZPA 4ECWA 1JLAA 3LP0A 1NLKL 2YWWA 2BQRA 2KT3A 5D77A 2M8HA 2R9LA 1Q8KA 3QIPA 8AT1B 4U96A 2Y1JA 4NXMJ 4Q2MA 1TP7A 1LFWA 1IBMF 4DL4A 3A13A 2C3OA 1NK7A 3PYGA 3ZNUA 5ETRA 4ZMMA 2D1CA 3NEKA 4F3QA 2V8DA 5KAKA 3MCMA 2IAJA 1RT3A 1C0UA 1QSSA 5GADI 1RT7A 1ZAWA 4O0IA 2OTJS 2XHWA 3MMJA 3UVJA 2HYIB 2IM2A 3H4DA 5JVHQ 4J90A 5ADZA 3NCPA 4KB7A 1FKOB 1OO0B 5CYJA 3D1HA 4K4VA 2MKCA 2OPPB 5A8KA 4ZIWA 4ILRA 4F2RA 3KXDA 3G6VA 2AKWB 2ZVIA 2UUAJ 4KSEB 3R5DA 2HW3A 4DV2J 4LBPA 3L95X 1HQ2A 2Z2LA 3AD9C 3BGRB 4DN0A 2DGUA 2BRKA 2ZD1B 4DQSA 2RRBA 3D2WA 2RUGA 4W90B 2VC0A 1KC8T 2C42A 2DT9A 3QFHA 4DX8H 1KTVA 2GQQA 2IY5B 3V4IA 4CTAA 3QGPA 5U47A 4DJBA 4O44B 2AZ3A 3CWJA 5KT7A 3UDCA 1VC6A 2AZ1A 1HBOA 1FXRA 3MR5A 1Q78A 4JUZA 1S9GA 1B99A 3V6DA 1GNKA 4ED5A 2J7UA 2WBMA 2OD4A 3PRVA 3DRRA 4I7FA 3CCWA 2W7OA 1AB8A 1ZYQA 2EWHA 4AFFA 4OV6A 2RQMA 4NLXA 1LV5A 1FDDA 2O66A 4WK3A 3CF5Q 2VFUA 3QAEA 2CPEA 2NXUA 3K5NA 2OD6A 2N3OA 2LXIA 7FD1A 4DV4J 4DEZA 3IN5A 2XWYA 2UVVA 5HANA 4WFZA 2IJRA 4AQYF 3ITHA 3IM8A 4MFBB 2QTWA 2G1DA 4ICLA 2HLTA 3W1YC 1S59A 1B0PA 4ATNA 1SUQA 2Y3YA 2VHGA 4PXDA 1SKUB 4R0EA 1YJRA 3OXLA 3OHAA 2R7XA 4FF3A 4LRBA 1REVA 3TA1A 1C2PA 1S1VB 1FJGF 1SQGA 4FPRA 1IKVA 2AYBA 2HURA 3MFIA 2JFKA 5KG3A 5KFTA 3EXCX 1S0NA 2V8GA 3RW6A 2ZOMA 2ZBQA 1NKBA 3SCLE 3ELHA 1NHVA 1QE1A 5IQQA 1XQIA 3RB0A 5HSPA 2XMTA 3EXYA 1T9TA 3ZFVA 4OHXA 2AHOB 3NGUA 3AWRA 2CQDA 5ETLA 4JV1A 3L9ZA 4S0MA 1S77D 1Q81T 1IJEB 1RI7A 4DPXA 3VQTA 1U1NA 3TZWA 2CNKB 4C0HA 4WKRA 4AXJA 4ZPDA 2CVIA 1SIZA 4DV3F 2G0JA 3VV2B 3MMCA 3TJ9A 3FFIA 4EFAC 3EJMA 2B8QA 4IG3B 3CMES 1VQ4S 4FNHA 2AGQA 4USMA 2HS0A 5KFDA 4ZPVR 3VZHA 1URRA 3MPUB 2QYCA 3FSIA 3MPDA 5HQLA 2V34A 3QT8A 4K4YA 4IDKA 4TLRA 4X4VA 3R1HA 3KHGA 3D3BJ 4PPZA 3GFHA 2VQEF 4LF4J 3SQGA 2Y1RI 1PC5A 3NGRA 4AUKA 4CQ1A 1KR4A 3KK2A 1MU2A 2XEXA 3OT9A 1M5VC 1U4BA 2ZKUA 5IT4A 2XNRA 4HL9A 4OI6A 3P8BB 1L5UA 3LWMA 3R5CA 3A8EA 2DNQA 4ELTA 4PQUB 4WP9A 3US5A 4YEAA 1RHKB 4H4MB 5IWAJ 4A8OA 4F8RA 3GLJA 4TN2A 2VBWA 4YFUA 4UUWA 3D4JA 2W9BA 2OPRA 3UWTA 2P2CB 4DX6A 3BO4A 3MUMP 2CRLA 1RTIB 4X2BA 3KMQA 2HPUA 5B7WA 2EXUA 5H9FJ 3DLGB 4L3NA 1OJ4A 4NCAA 6AT1B 4J9UE 5EWEA 3BDPA 4DQIA 2ZH5A 4USKA 4Q7AA 3I32A 3NKYA 2Q6CA 5I3QA 3LP2A 4CM2A 1KQKA 1LWCB 2XZDB 3ENVA 5LJ5Y 3UD4P 2KHCA 5E3CA 3TA2A 4J9PA 1ZAXA 2D9PA 4LR9A 4IFYB 3IS9B 3G82A 5K20B 2BMBA 4P71A 4KTQA 3CCTA 3AJ1A 1X4BA 4HDHA 4DL5A 4JI7J 2DNPA 3VAGA 3PKYA 3A3PB 2OSRA 5E3PA 4DU8A 1GMVA 4E8UA 4WYWA 5D4NA 2E7WA 2ZJQQ 2VG5B 3KYLA 3C6TA 1YITS 2A0FB 1YZ6A 3PO5A 4OHYA 3V81B 2V6AA 4DUTA 3TWZA 3GONA 1VBXA 3K58A 1WORA 3HSGA 2KRRA 2RUSA 3JXOA 4ETXA 1BGXT 4KV8A 4OZJA 3AOAA 3LWLA 2KVIA 3BPDA 1FKPB 3IG1B 4WJBA 1NDLA 3UR0A 4QIFA 3MD1A 5L1JA 3VGSA 2VASA 4KHPJ 2MZRA 2VDHA 2XULA 2WSFC 3MM9A 4LFBF 3CJQA 2DGTA 4LFCF 3OUYA 2ZC4A 3N01A 3GIRA 2RB7A 3H7HB 2ASLA 2RQCA 3I5CA 4ZJQA 4RR5A 2AEJA 5H1SV 3J80Y 1Q5VA 2XYGB 3T5KA 1AZSA 2G2OA 5E2QA 4BLGA 4B9TA 3EM1A 1AUSL 2YXLA 1VHFA 2DD8S 4DQRA 2C3MA 3KLHB 4YY3J 3AOBA 2BXJA 1RT6A 3WZ0A 4AE5A 2DYAA 3TNVA 4USUA 2VQEJ 5DLGA 2QSWA 4KGMA 3NS5A 1TMJA 2CQGA 4J5OA 2VH7A 3GYGA 3ADAC 3CIMA 3DOLA 2JLGA 4ZCIA 1L3KA 3HKZD 4CO1A 3CW2C 1FA0A 1TV6B 5C7PA 2R8KA 3JS9A 3CC7S 2BE2A 4PZVA 2WVBA 1PYSB 2ZNYA 4TYBA 4FS2A 5J1NA 2ERRA 4R0JA 4NZ0A 1VLYA 2DISA 3DXSX 2VG7A 2Z8QA 3B82A 9RUBA 1ZPWX 2V9WA 3AX3A 3ENQA 3MURP 2E5GA 3KK3A 3BKFA 4F67A 3M1VA 1NMEB 1KQFB 4B3TF 1VQ6S 3H40A 2GQCA 4X65J 4RW6A 3SDEA 4H54A 1EETB 1S9FA 4RW7B 3EGVA 1LKZA 2MB0B 2OPQA 1IKYA 3MAAB 2WONB 3TA0A 1HPZA 2YNHA 2HBRB 1FJCA 4RKUC 1CQMA 3BSAA 3DRPA 3OTOJ 5HLFA 1HD0A 4TLQA 3G8TA 4QYZJ 4B17A 2J0SD 2W01A 3HJVA 3CCES 2ATCB 2KRBA 1CC8A 3S8SA 1S12A 1TFYA 1RHQB 1HHTP 1Q16B 2XSJB 1HBNB 3GV8B 1IQTA 2HZVA 1XWLA 5T7LB 5HVHA 3G6ES 4EO6A 2W9AA 4R5PB 2OPPA 1F9EB 3MR6A 1YJNS 3IP0A 3FDSA 1UEVA 2KFYA 1WSVA 5CZXA 3OHBA 3LANA 2EFGA 2QL9B 3FRYA 3SBMA 2FHKA 1S72S 5I3UA 3SFGA 4ZLPA 1VGYA 4DSEA 2VKZG 3S6EA 5KT2A 1JLFA 3B78A 4EGLA 4U6PA 2I1RA 3M32A 4WBFA 5CQGA 4LREA 4ZJLA 1UETA 2VF3A 4DPOA 3NY0A 3MM8A 2B8PA 1UVNA 1UTAA 2VA3A 3CD5A 5IZHA 4ID5A 3GJSB 3HXMA 3BBCA 2JC1A 4K59A 4LFAJ 3S7RA 1PAUB 5ETQA 5DZ7A 1FNXH 1FK9A 4P74A 1Q82T 4F25A 2RILA 2RD5C 5KG2A 1DTTB 5SZTA 2HBQB 1K1SA 3G71S 1WHWA 2B43A 2M4MA 4M5GA 1QLNA 3D5MA 5FLXU 2GHPA 2YQ0A 7FDRA 4QPXA 3MPVA 4CLPA 4I2PA 1D09B 1BQNA 3J7ZT 3DLKA 3CJ8A 3NBPB 2G9OA 5T41A 2Y8WA 3OLAA 4F4WA 4UY8T 1KHVA 4RW8B 3KOAA 5KOXA 5IM0B 2YPZA 4K4ZA 2X51A 5KFZA 2NZCA 2E9RX 3UN2A 3PW7A 4PR6A 3KK1A 1RISA 2KJVA 3Q8SB 3I4HX 3KLIB 4IRCA 3TJ8A 4K4XA 6FD1A 3M2RB 4OHWA 1KKHA 1HR0J 1GX5A 3CJ3A 5HP1A 3HVTA 2V2VA 1NZAA 2RHQB 4F0KA 4CLSA 3MTJA 3KJNB 2G0CA 4F4YA 3ZZZA 1S7IA 3MPWA 2X1FA 3LP1A 1YKWA 3HFZB 4MIBA 4P2FA 4QU6A 3MWBA 3UDVA 3NG8A 1FX4A 2N7YA 3KHLA 2NR0A 2E5LJ 4NMLA 2K1RB 3I5AA 2BACA 1U09A 1JKHB 1JLBA 4ZLLA 4OLOA 5HBMB 2XTEA 2A6MA 5CH7B 1MNEA 1N54B 4P6QA 3AFGA 4IUFA 1VOMA 1W2BR 3NLCA 4ECVA 3CD7A 2COLA 4ES1A 2LA4A 5B0FA 1KRPA 1NSQA 2MHEA 3HM9A 3CCSS 3HO1A 3VVTA 3JTPA 2QMWA 1TKDA 5L46A 3LGMA 2I5JA 4OZ0A 5MLCV 2FLNA 2MSTA 3W66A 1Y5IB 4EO8A 4P52A 2CJQA 2XMAA 1KNZA 4FS1A 2HMIA 1IN0A 2FGOA 4O4GA 3KLGB 4B9NA 2F4VF 1WF1A 3V6KA 1KQSR 2CDQA 2CWXA 1FESA 3DOMA 1YWXA 5E7OB 5D78A 1NKCA 3MMBA 4AL6A 2CIMA 4NLGA 3NNHA 3M8QA 2HHTA 1RWXB 1TK0A 1FVQA 2PC6A 1Q4RA 2F1FA 1VBKA 4CH1A 3I31A 1FFSB 3AA8A 2IJNA 2ZC3A 2K3KA 1WELA 4ZP7A 2VG6A 3VGTA 1QAXA 2RDDA 4OYBA 5KFIA 2HEKA 4DZ6A 4EZ6A 2GIFA 1NB7A 2E1AA 1MROB 4UOFA 4DQPA 4NCBA 1LFPA 3M9MB 3U1MA 4OYPA 3MM5A 4RL1A 1CJUA 3W9JA 2OPSA 3QRQA 2UXCJ 2D9OA 4HKQA 4DSIA 2ZH1A 3OV7A 2BJ9A 1V3SA 5KT5A 1WJ9A 4QWBA 5CHCB 1JLQA 3J81j 1NJIT 4CLTA 2H5IB 2JLFA 4X4RA 2UUBF 2IYIA 1FCAA 5A76A 2XCAA 5A0YA 5GAEI 2MLYA 1WTFA 4DUZJ 3I87A 1FNOA 3CO9A 2LLZA 1H72C 1KDNA 1P6TA 5D15A 1QVGR 2H48B 4NCGB 4DSJA 3ZZOA 1N4LA 3PRBA 1R27B 1S6QB 3M9OB 2H3EB 2HWHA 4CH7A 1T9UA 2XHCA 4YMEA 3KJVA 1KBRA 4QYRA 3CJ5A 4DX7A 1RA7A 1NHUA 1ZA1B 2N82B 3I5BA 2XS5A 1R43A 2WW4A 4XPEA 2IRUA 2WB1D 1VDHA 2C22A 1SC3B 3M30A 3FBBA 4OV1A 4KH0B 5C25A 3CXCR 4NI2B 3AQOA 1WC0A 3Q8VA 3M2VB 3E8OA 2D3UA 4M5IA 3KG4A 2QFJA 2O5DA 1OPZA 5D4OA 1RTDB 2ZBPA 2CDRB 5K8MA 1EX8A 4KFBA 5M2PA 3IA0A 1YJTA 2BKPA 5C2CA 2C2MB 2D3ZA 4RZRA 2QFIA 3LH2S 3GJTB 2MLXA 2WTFA 3EGZA 3KLHA 3QT6A 1OY8A 4L74A 3T6BA 4XPCA 2YQ1A 3MTKA 1CULB 3PFOA 3SZ2A 1R8BA 3BS9A 3IFEA 5KFHA 4F36A 3CO0P 2MQPA 2XYHB 2XY7A 4ZK7M 2OKQA 3M2UB 4G65A 2HHHF 2HS4A 4NPOA 3K5LA 1U47A 2R7OA 4YP3A 4DL0C 2ZH4A 4LF1A 3SQOP 3UCGA 1U1PA 5HVFA 2JZ5A 3MEEB 1APSA 1SH2A 4DR6J 4M5DA 3T41A 2B9WA 2NSBA 4WFXA 2F8MA 4RBVA 2PD1A 5HJXA 2VPWB 1AA1B 1IKXA 1IBCB 2VPXB 3C16A 3LAKA 3AX5A 2W2NP 4JI4F 5DQHA 2M8DB 2E29A 2RRNA 5KFUA 3BREA 1KD1T 2GGPB 3DRSA 2E9TA 2BBEA 1EETA 1YLXA 2L9WA 2NUHA 3IRXB 2E5IA 5BYSA 1HWKA 1Q1KA 2MQLA 2AX0A 4B3OA 2Z57B 4ZVSB 1U1QA 2BQUA 3EZUA 4WTYA 4O3RA 1Y0HA 1K9MT 1WC5A 4A4JA 2PE8A 1H38A 2UU9F 4IKAA 1RT4B 5ETPA 4N41A 2FY1A 1VISA 3ETOA 2FTRA 3H25A 2RKIA 4EU0A 1F6TA 5AJ3J 2H5JB 1WEXA 3SSRA 2RH3A 2CPYA 5CCLA 4GVBA 5KG7A 2IBKA 4K4WA 1R6VA 5B0AA 5BR8J 1WDTA 2HRUA 1FRKA 1VBYA 2HHXA 2P6TA 4OZ3A 2E44A 3QJPA 4FBTA 4LR7A 3JSMA 1SC6A 2FZKB 4LSNB 1RWMB 2FGCA 2DGQA 2M88A 2KKHA 3ISND 1U6BA 3FCVA 2XMKA 5KG0A 1X4AA 2CQHA 3AD7C 5J1EA 3T5HA 3X3UA 2H4YB 3KNAA 4DV6J 2N4DA 1S0VA 3FMBA 1KVKA 1WG4A 1EP4B 4L76A 2M9KA 2VU5A 5IS2A 2DH9A 3G6XA 3NMRA 1SJ1A 3J7Z5 4ECTA 1M90T 3PX4A 2GAHC 1SL0A 2DR7A 4ZS6A 2QA2A 2WW8A 4UY85 4I67A 2A18A 3ET6B 3KJFB 1T94A 1NK8A 5EDWA 1RUSA 3OSPA 2JDJA 2MPUA 1M0SA 2CQ4A 2ZDPA 4RUBA 2MZSA 1DTTA 1YRTA 3OJSA 3J80U 1YSJA 1DFDA 3ILOA 2J76E 1NJWA 4QU7A 3ONQA 2NXJA 4URGA 2PEBA 2GVDA 4FXWA 3NXZA 1UMJA 3VWSA 2H4WB 4R25A 2WSEC 3EVMA 1PIEA 3PW4A 1RAJA 1IKWA 5LXYA 3Q83A 1X5TA 3DI6B 2ZFHA 3D6TB 5EHHA 4C4WA 3OR2A 1A6LA 2PMHA 2FY8A 3R1LA 2VB6A 3NRBA 4RW8A 1TELA 2E1RA 2FJDB 4OZ5A 3FC9A 2HGLA 4GRSA 5E41A 4OZ2A 1SL2A 3HHLC 1BQMB 1EZZB 2EEYA 4ES2A 2MKKA 2KXFA 5LL6d 3BGOP 3OJUA 4KGVB 2FZGB 3KLIA 3T1YF 4ER8A 4X4UA 2ASYA 1AYEA 1HYSB 2NXNA 3M8PB 4Y00A 4RLEA 2ZH3A 4C97A 2IMOA 4B9VA 4ZHRB 4KHMA 4RNOA 3D1QA 1S9EA 1NDPA 3DU6A 1YTYA 4J9MA 2YTCA 5FIIA 1W26A 4RBUA 3MI7X 4M95A 1TVRA 3W8PA 4OYIA 1RAAB 2K7JA 4C6AA 2ZBIA 1HI8A 1OSCA 2H51B 1VQKS 4ZIVA 4G1QA 4L6V3 1UFLA 4NLWA 3Q2SC 1RQ0A 2ZH8A 2HZAA 2JOQA 4MYTA 3MZIA 1LQ9A 2W25A 3D67A 2LQBA 4PWDA 4F50A 1HNVB 4OI2A 4PABA 2GFFA 1S1UB 2XZWA 2KFZA 1CG2A 1WSRA 3AB4B 2HBZB 1TTHB 2XM3A 3BZQA 3JAMY 4USWA 3FKBA 1C1CA 2FJWA 3GQCA 1T03A 1CS4A 3CCLS 3PR5B 2RJZA 1RHUB 3B6BA 2HNZB 2DTJA 3N6MA 4NEZA 2GVZB 5B0DA 1X5PA 2J8SA 2GO9A 1TL5A 3SFUA 2VODA 4CYUB 3MAHA 3BSOA 1HQUA 4KJIA 4QQBA 1U0HB 2LQ9A 1N5YA 3DDIA 2J9DE 2VBYA 4YB5A 3I0RA 3QO9B 4DF4A 1UWBA 2GV1A 1U6ZA 5DM7Q 2AU0A 5HMZA 1P1LA 5G4DA 2P6SA 4DV0F 1RYSA 3OLBA 2IVYA 4HEA9 2YX1A 3DHXA 2Q66A 1UVLA 3MM6A 4EMDA 2HNYA 1FXDA 4PXEA 4XIUA 3R97A 1M5HA 5CA5A 1WTBA 2UXBF 2GA7A 3QWUA 2YNGB 2EBEA 4RPFA 1TK5A 4DFMA 1B64A 1NJXA 3EMTA 1U1KA 2Z0GA 2R2RA 3DM2B 1QAIA 3T3FA 5BJRA 4DS5A 1LWFB 1N5TA 5ETSA 1VRTA 4RWXA 4E0DA 3GE9A 2L9DA 1VQ5S 1JXEA 1RAFB 1DLOA 4KAIA 4PUOA
chains in the Genus database with same CATH topology
1SB6A 3LPYA 5E3QA 1RTJA 2CQDA 3N79A 1S10A 4JV1A 3POTB 1YJVA 3SV3A 4B3SF 3EX7B 4I69A 2EVZA 1S77D 1Q81T 1IJEB 3Q24A 1S6QA 1HNXF 1RI7A 1S1WB 1FTRA 4YR3A 3TO8A 4DSFA 2ZHBA 4O44A 3VQTA 4LJMA 1U1NA 3UCZP 2VBXA 4C0HA 3M6WA 4WKRA 4U9RA 4AXJA 4ZPDA 2CVIA 5D4LA 2FDNA 4MKAA 2W8KA 1WG5A 1KOOA 2DGOA 1SIZA 2H5EA 4DV3F 4ZP8A 5F8NA 3DDKA 1X5SA 1N52B 3HI9A 3MECA 4ZCMA 1SJFA 2VA2A 3MMCA 2DR9A 1DJ0A 3KHHA 5HMWA 1T02A 5I42B 4DFKA 2KXHA 2OTLS 3FFIA 4OL8A 4EFAC 2EK6A 2ZH2A 5F8LA 3DDNA 1KQGB 1G6BA 3ISZA 3SXLA 5EN1A 1BY9A 2CQCA 2J8AA 3VAJA 5DRKA 1JLGB 2CQBA 4IG3B 4WU2A 1A9NB 1DTQB 2YKNB 4PWUA 5GAHU 3CMES 5DJBA 5C42A 1VQ4S 4FNHA 3CDUA 3Q8PB 1SKRA 2AYGA 5F3ZA 3AHPA 2AGQA 1YRUA 2HS0A 2GC8A 4NZ6A 4LIRA 4EUVA 5KFDA 3HHLD 4ZPVR 1IM4A 3TVYA 5HO4A 2LVWA 3OTDA 4A8QA 3VZHA 1D8YA 2CPIA 1X8DA 1URRA 3M6XA 4LIWA 1PO6A 3C6TB 3PACA 1FKAF 4V19X 2QYCA 3FSIA 1C0TB 1PSDA 2HFOA 4OX8A 3T19A 3NWGA 1YJWS 2M52A 3HMJG 1DQ8A 1R8CA 2R8HA 4K4YA 4IDKA 4TLRA 4X4VA 2HQIA 5KG6A 3R1HA 1ZZNA 2EFPA 2HNZA 3VQSA 2FLOA 4QWDA 3KHGA 3N0VA 3MGJA 4DV2F 4PPZA 3GFHA 4ED0A 2VQEF 4WZQA 2ZOFA 1SXLA 5KFKA 3SQGA 2Y1RI 2CYYA 2MDAA 4KV8B 4NA1A 4WFNQ 2I2YA 4M94A 1PC5A 2B4PA 4JI2F 4N56A 4AUKA 1UFWA 3P5TL 5LMNF 2J9CA 3R5AA 1ZM3A 2CZ4A 3HZEA 2OAUA 4CQ1A 1KR4A 4NLRA 2VPYB 1UEUA 3THTA 2MY8A 1N8RT 3KK2A 4X62F 2C3PA 5KFQA 3DYAA 1I94F 2HGNA 1LWEA 1MU2A 4I2QB 3DCAA 3C3LA 2XEXA 3PW2A 1M5VC 1IXKA 2MQQA 2CPXA 4QWEA 5E3AA 4JI0F 2OFGX 2V4JB 2ZKUA 1U4BA 3QO9A 4YB7A 3MM9B 5IT4A 1J5EF 2XNRA 4HL9A 1SI9A 4OI6A 1O5JA 1TFWA 4MFBA 1L5UA 3LWMA 1YJUA 3R5CA 5HQ8A 3A8EA 3VAIA 3OUYB 1LW2A 4OI1A 1AW0A 3NNCA 2DNQA 4ELTA 1VK3A 4PQUB 2OO4A 2M5YA 3US5A 4YEAA 2ACYA 4K4SA 4H4MB 4DSKA 2GJ2A 1GXTA 2DNLA 1HNWF 3ZZYA 3HHDA 4A8OA 3VAMA 4F8RA 3RAMA 1WHYA 4ECUA 5IQ6A 4E98A 4TN2A 1S1VA 2VBWA 1H98A 4YFUA 2DR5A 4UUWA 2DRAA 2W9BA 4IOBA 4O23A 4UOCA 2OPRA 2XMJA 4P2SA 4X4PA