1KHVA

Crystal structure of rabbit hemorrhagic disease virus rna-dependent rna polymerase complexed with lu3+
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
497
structure length
493
Chain Sequence
b'FCGEPIDYRGITAHRLVGAEPRPPVSGTRYAKVPGVPDEYKTGYRPANLGRSDPDSDKSLMNIAVKNLQVYQQEPKLDKVDEFIERAAADVLGYLRFLTKGERQANLNFKAAFNTLDLSTSCGPFVPGKKIDHVKDGVMDQVLAKHLYKCWSVANSGKALHHIYACGLKDELRPLDGKKRLLWGCDVGVAVCAAAVFHNICYKLKMVARFGPIAVGVDMTSRDVDVIINNLTSKASDFLCLDYSKWDSTMSPCVVRLAIDILADCCEQTELTKSVVLTLKSHPMTILDAMIVQTKRGLPSGMPFTSVINSICHWLLWSAAVYKSCAEIGLHCSNLYEDAPFYTYGDDGVYAMTPMMVSLLPAIIENLRDYGLSPTAADKTEFIDVCPLNKISFLKRTFELTDIGWVSKLDKSSILRQLEWSKTTSRHMVIEETYDLAKEERGVQLEELQVAAAAHGQEFFNFVCRELERQQAYTQFSVYSYDAARKILADRKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-DIRECTED RNA POLYMERASE
molecule tags Transferase
source organism Rabbit hemorrhagic disease virus
publication title Crystal structures of active and inactive conformations of a caliciviral RNA-dependent RNA polymerase.
pubmed doi rcsb
total genus 167
structure length 493
sequence length 497
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2001-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1khvA05
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1khvA03
4.10.8.20 Few Secondary Structures Irregular Luciferase; domain 5 DNA/RNA polymerases 1khvA01
4KHMA 4ZPBA 1SUQB 3N6NA 4IR1A 1TVRB 4ZVFA 1JLBA 4TYAA 2CKWA 1TKXB 3DOKB 4TYBA 2J6SA 1LWEA 1TL3B 4ID5A 5HP1A 3I0SB 3MEGA 4K50A 3PHEA 4DEZA 2ATLA 3MEEB 3GV5B 2WONB 3D5MA 2HWHA 3MFIA 1D0EA 2J6TA 3CDWA 3T5HA 3DI6A 1HYSA 3M8PB 5C24A 2BANA 5KT5A 4RNOA 5D3GB 5EUHA 3GYNA 1SUQA 2WOMA 4ZPDA 1RT3A 3BR9A 1JLBB 5KT2A 4Q44A 2UVWA 2XI3A 3H40A 4MK9A 4ECXA 1J5OA 1C1BB 4JUZA 5KFLA 3I0SA 4J9LA 2OH2A 2XC9A 3CDUA 2AGQA 5KG4A 4H4OB 3BSAA 4O3OA 3GILA 4PWDB 5K14A 2VG5B 1TQLA 5KFGA 3Q8QB 4O3RA 2HWIA 4YMEA 5J2NB 2YNHB 3M8PA 1FKPB 4WXWA 5KG5A 4NLRA 3M9NB 1HPZA 2WOMB 3DLGB 5HROA 1FKOB 2FVQA 5J1EA 4Q0BA 4RW7A 5HBMA 1RTHB 4FBTA 1IKXB 1S1WA 4H54A 4URGA 2VG7B 3PJXA 1R0AA 1TP7A 4ZPCA 2ASJA 1MU2A 2UUWA 1QE1A 3E51A 2XCAA 3RB6A 1XR7A 1NNDA 5JUMA 2AGPA 3MECB 2IM1A 2E9ZA 2YNHA 3SFGA 1FKPA 3KHGA 3T5JA 2HNYB 4LSLB 4O4RA 2R8KA 1RYSA 4H4MA 1RTDA 4J9SA 4NLDA 3DOLB 5J1EB 2B6AA 1HNIB 4YP3A 1IKYA 3IS9A 4KO0A 4KV8B 1RT7B 4MKBA 2VG7A 4I7FA 4JV0A 5F9NA 5DGBA 3HKWA 2RDIA 3KLGB 2W8LA 2XGQA 3CJ5A 3CDEA 1DTTB 1N5YB 1BQMA 4XO0A 4TY9A 1I6JA 2W9CB 1N48A 4B3OB 1FK9A 3ISNC 4ED2A 4J9NA 2BR0A 4QW8A 4ZHRB 3H4DA 2IA6A 3LAKA 4O3SA 2R8GA 3UPFA 1C0TB 4EYIB 3N6LA 1UWBA 1ZTTA 2OPSA 3MTKA 2V9WA 5KFZA 3KK2B 4Y2CA 2R2RA 2C28A 1RT6B 4TY8B 2VG6B 1JIHA 3ISND 4WYWA 3QIPA 4I7FB 4QWCA 4NZ0A 2YKNA 4K4VA 1JLCB 1S1XA 5KFWA 2IC3B 3JSMA 4YR0A 4ZMMA 3LALA 2AQ4A 1SH3A 4WFXA 3V4IA 3DRSB 2W9BB 2FVRA 2FJVA 4ZHRA 1S6PA 1TL3A 3DM2A 3I5CA 5EWFA 3KJVB 1EETA 3TQ1A 2OPSB 5DGAA 5F9LA 3ITHA 3QGIA 5J2PA 1T03A 4TN2A 2VG6A 1KHVA 4IH7A 2JEIA 3OL7A 2YNGB 4IQXA 5F8IA 2WTFA 3H98A 1TKTB 3DLEA 4IH5A 4RW8B 5KFDA 4NLYA 2JC1A 4O3QA 1RYRA 2DPJA 4NLXA 3DMJB 2OPPA 2RKIB 3Q8PB 3GIKA 1QAIA 4IRDA 5KFOA 2OPQA 2B43A 4DG1A 3DRRB 3I0RB 5KFRA 4RU9A 1IKVB 1N6QA 1S6PB 4ICLA 4IOBA 1HQUA 3DRPB 5CYMB 3G86A 3KLHA 4Q8FA 4G3IA 5J2MA 3HVAA 3LP1B 1S1UB 2ZD1A 5EWEA 5I3UA 1T03B 4PWDA 4ECUA 2IM2A 3QIDA 1EP4A 1HNVA 3FQLA 3DYAB 2BRKA 2WRMA 1VRUB 1T05B 4WE1B 4IFYB 1U09A 1BQNA 3QGHA 4RZRA 2YNIA 4IDKB 4R5PB 3CJ3A 3PW0A 4ED8A 1S97A 4EO8A 1R0AB 3G6YA 2I1RA 4QWBA 5C5JA 3H59A 3IG1B 2BQUA 3QO9A 2I5JB 2W8KA 3Q8SB 3BQ0A 3I5AA 2IJNA 3V6DB 4ED3A 2OPRB 2RF2A 4MFBB 2FLLA 3DYAA 4I2QA 5I42A 2HNYA 4LSLA 5KFAA 3T1AA 2ILYA 3PW5A 3KK1A 4IFYA 2ZE2B 2BE2B 3DOLA 1BQNB 1JLAB 4TQSA 3DLKA 5KFTA 4IR9A 4WFZA 1IKYB 1JKHB 1REVB 4KO0B 4KV8A 3EPIA 4ED6A 3MR3A 3CWJA 2J6UA 4O44B 3MEDA 4MK8A 3QO9B 5KG3A 4RW4B 2I5JA 3C6TB 3UQSA 4K4SA 5J2QA 5KG7A 2UVUA 2RF2B 3H5XA 1FK9B 2D7SA 3OHBA 2V4QA 4IFVA 2IAJA 4LSNB 5KFQA 3SI8A 4GC6A 2IBKA 3OL8A 1LWFA 4KHRA 2R2TA 4EBCA 5KFKA 3KK2A 1JLAA 5KG1A 2V0NA 1S4FA 1T3NA 2HNZB 4QWEA 4O3NA 2FVPA 5HLFB 3MFHA 1JXLA 3NAIA 1SV5B 1C0UB 4J9RA 4HYKA 2O5DA 1S1XB 3CJ2A 5KFXA 4RUCA 2R8IA 2R8JA 1S6QA 4EO6A 5KFPA 5J2QB 4QWDA 5KG2A 1JX4A 4LQ9A 3BJYA 1RDRA 5JXSA 1HMVA 4URQU 1RT5A 3D28A 4EYHB 1KLMB 3BSNA 1LWFB 1S48A 3RB0A 5KFJA 4NLOA 1HQEB 3RB3A 3NBPA 3IRXA 5DLFA 5DLGA 1XR5A 3KLVA 3M9MB 3KLIA 2YNGA 1TVRA 4RW6B 5KFYA 1LWEB 1C1CA 1RT1B 3CJ0A 3BSCA 4J9MA 4ED1A 4Q45A 3PR5B 3C6UA 2R8HA 3KK3A 5CYQA 4DL6A 1TKXA 3DOKA 2D3ZA 4GC7A 4PQUA 4ID5B 4U7CA 2DPIA 4KE5A 3BSOA 1RT4A 3LAMA 1TKZB 4DL7A 5KG0A 2YKMB 3V81B 5D3GA 3BGRA 1CSJA 5F8JA 3DI6B 3RBDA 4K4XA 1C2PA 1KHWA 4ECQA 2AU0A 5EWGA 4XPEA 4WE1A 4ED7A 1S10A 3C6UB 2JEFA 1K1SA 3OLBA 4OL8A 5KFVA 3FRZA 3KLEA 4IG3B 4IH6A 3OSPA 3UDLA 1VRTB 4NRTA 1NHUA 5DG9A 1DTQA 1RT4B 5J2NA 2FJXA 3GIJA 2E9RX 5K14B 3CO9A 2R2UA 4KBIA 2UUTA 1RA7A 3DLGA 4O4GB 4PUOB 4TXSA 4RW7B 5HBMB 4FS1A 4JV2A 1RTHA 2BQ3A 5KFSA 1N4LA 1HPZB 3I5BA 5HROB 2UVRA 3BQ1A 2RDJA 4DL2A 4K4ZA 4Y34A 2BE2A 1MU2B 3KHLA 4ECRA 2C22A 3JYTB 4O3PA 3FFIA 3KLFA 1S1TB 4RNNA 3PW4A 3M8QA 1HARA 4NLGA 1SH0A 4IRCA 3MECA 4NCGA 3TAMA 2HNDA 2JC0A 4O4GA 5C42B 2FVSA 2VA2A 2C2RA 4M95A 3T19A 4H4MB 5KFCA 4EEYA 4KAIA 2VA3A 4ZP9A 2ASLA 3NGDA 2B6AB 2F8EX 3FQKA 4MKAA 4YQWA 5KFIA 4U6PA 1DTTA 4FS2A 3OL9A 1S1TA 1S9EB 3KLGA 5DG8A 5KG6A 3DDKA 3MR2A 1C0UA 1JLEB 1Z4UA 1K1QA 3OLAA 4ED0A 3RAQA 3MEGB 1RA6A 4NLSA 2HNDB 1RT2B 3LP0B 5C42A 4F50A 1RT6A 4YR2A 2ZKUA 4DL4A 1IKWA 1KLMA 5KFFA 2AGOA 1HYSB 2BRLA 3H5UA 3MEEA 3KHHA 2BANB 4NLVA 3RBEA 2GIRA 2E9TA 2WB4A 4RW9A 4ECZA 4K4UA 4Q43A 4MIAA 4NRUA 3MR6A 4WZMA 3KHRA 4J9OA 3V4IB 3JSMB 1D1UA 2XI2A 4RW6A 1S1VB 1JLEA 1J5OB 1C1BA 3KJVA 1RT3B 3QZ7A 2V4RA 2ASDA 1RT2A 3LP0A 3ITHB 5J2PB 3DRSA 3V6KA 2BQRA 2CJQA 4PQUB 2VG5A 4ZP8A 1TKZA 1GX5A 3DLEB 3BGRB 4R8UB 4RW9B 3CJ4A 3CVKA 3OHAA 4WZQA 2IM3A 2OPQB 3TVKA 2D41A 1S1VA 4ICLB 3DMJA 2OPPB 4F4XA 4EBDA 3NMAA 4RNHA 4KKOB 2HMIA 3LP1A 2ZD1B 1N6QB 4NLQA 3MF5A 1HQUB 5CYMA 5KFUA 4IG3A 3KLHB 1JLFA 3PW2A 2YNFB 5J2MB 4ZVGA 3KNAA 5I3UB 1EP4B 1HNVB 3G6XA 2GIQA 3T5KA 3PW7A 5KT4A 1QAJA 1S9FA 4X2BA 2FLPA 4QPXA 4G1QA 1S0MA 2W9AA 4IDKA 5KFBA 2WK4A 1RTDB 3MR5A 5KFMA 1S9GB 2YNIB 3IG1A 1HNIA 1S0OA 4NLTA 3JYTA 5DG7A 1RT7A 4TQRA 2AX1A 3KLFB 1JLFB 2AWZA 4K4YA 2YNFA 5DQGA 3Q8RB 3QLHA 1N5YA 4NLWA 3QGGA 4IG0B 1C0TA 3V6DA 2ZE2A 2W9CA 4JV1A 1RTJA 4B3OA 3HVTB 4G1QB 3PVXA 3DLKB 3QYYA 5C25A 3LP2A 4MIBA 2ILZA 1SH2A 5F8GA 4ECSA 4TY8A 1N56A 3RB4A 4WFYA 3V6JA 3CIZA 1REVA 1YVFA 2IC3A 3C6TA 3EZUA 5KT7A 4Y2AA 4ZP7A 5EDWA 4MK7A 1GX6A 2YKNB 4O44A 4IKAA 4WXOA 1JLCA 3SFUA 3BREA 4RW4A 2W9BA 3V6HA 1OS5A 1LWCA 2IAJB 2B5JA 3DM2B 3GV7B 1EETB 4ZVHA 1RTJB 1W25A 3KMSA 3NL0A 5F8LA 3EPGA 4ECYA 3N6MA 3LP2B 1RTIB 4NLPA 4DL5A 2AX0A 4URSA 1IKWB 2D3UA 4I2PB 1DLOB 4RNFA 1ZTWA 5L1IA 2WCXA 4ECTA 2FJWA 2IM0A 4RW8A 1QUVA 4DL3A 3GV8B 1LW0B 5HLFA 4ECWA 3NAHA 1TKTA 1NHVA 3DRRA 3I0RA 3T5LA 1LW2B 1LWCB 3DRPA 2IJFA 2RKIA 1MMLA 4DG1B 3ICLA 1IKVA 4NYZA 2ALZA 5KT6A 1RTIA 3H2LA 3KLIB 3GIMA 4I2PA 1S1UA 5C24B 5DQHA 3IRXB 1IM4A 3OSNA 2IMWP 1S49A 4J9PA 5L9XA 1C1CB 4Y3CA 1RAJA 1RT1A 2JLEA 4R8UA 1LW0A 1S0NA 2W7PA 5CYQB 4Q8EA 4LQ3A 2QV6A 1VRUA 3FDSA 1T05A 5T14A 3IGVA 1LW2A 3E01B 4QW9A 3FSIA 4ZP6A 3KK3B 3PZPA 4KFBB 5KFHA 4KKOA 4H4OA 2W7OA 4MH8A 5KFNA 4F4WA 4R5PA 3PR4A 2XGPA 2HMIB 2XCPA 4HKQA 4RNMA 4K4TA 5F8MA 2C2DA 2YKMA 3V81A 3GIIA 3NKYA 5DQIA 1WNEA 1FKOA 3KK1B 2JEJA 4Q0BB 2HAIA 2OPRA 4MFBA 2C2EA 4FBUA 4I2QB 1IKXA 1S1WB 5FDLA 5KFEA 5I42B 5L1JA 1TV6A 2UVVA 1JKHA 3E01A 3UR0A 5F8HA 3VQSA 1DTQB 4KFBA 1QE1B 1S9GA 1JLGB 2EC0A 3KLEB 3BQ2A 1VRTA 4EBEA 3QZ8A 2XWYA 3H5SA 4R0EA 3KMQA 4M94A 3HVWA 3MEDB 4YR3A 4ZPAA 3HHKA 3QLHB 4KSEB 3M9OB 4ECVA 2QE5A 5L1KA 3OL6A 4IG0A 4PUOA 1T94A 3G6VA 3HVTA 4IFVB 3IS9B 4LSNA 1ZETA 3IGNA 3KOAA 3FFIB 1TV6B 1JLQB 3LANA 5C25B 4F4ZA 4K4WA 5F8NA 2HNZA 4J9QA 1TL1A 3M8QB 5FDLB 3IN5A 1SV5A 5L1LA 2FLNA 1JLGA 1BQMB 4QWAA 2JEGA 4XPCA 1S6QB 4F4YA 2WHOA 4ZVEA 3H5YA 4WYLA 2GC8A 4NLUA 5HP1B 4NCGB 3TAMB 1UWBB 2B5JB 4TLRA 3GQCA 4J9KA 5KT3A 4KB7A 4RUAA 2WONA 1XR6A 3NBPB 3RAXA 1HMVB 1RT5B 3PJWA 3QIPB 2FVCA 3H4BA 1JLQA 4IRKA 2R2SA 1S9EA 1HQEA 1DLOA 1TL1B
chains in the Genus database with same CATH superfamily
2P5VA 2NREA 3R2DJ 4KGZB 3HSGA 4TU9A 3DNCA 1SUQB 3N6NA 1L3UA 4IR1A 1AYEA 1HWJA 1JLBA 3AHPA 2HHSA 4M5HA 3TX0A 4Q2MA 3LQVA 4CH1A 4DV1J 3MAHA 1YBTA 4ZVUB 2AJ2A 4DR2J 1AW0A 3I0SB 2CPHA 5B0AA 2I8EA 4DEZA 5HJYA 3IWLA 3TZZA 3MURP 4WU3A 2HWHA 3ZZOA 3GV5B 2V6AA 4NA1A 4ZVQB 3EXYA 3U02A 5JJBA 2FJDB 3G71S 1UAWA 4DX6A 3DI6A 5B0FA 4F0KA 3US5A 2ROGA 2BANA 5C24A 4RNOA 4A8MP 2GQQA 3GYNA 2RHSB 1U2FA 4ZPDA 1HBOA 2A6MA 2KJVA 2YWWA 1RT3A 3BR9A 3FNNA 3HX9A 4Q44A 1D8ZA 2UVWA 4M5IA 4FF3A 2V68A 1ZTWA 1WACA 3BS9A 1N34J 1J5OA 4ENOA 3F41A 2L9DA 2BX6A 3A8IA 2PGCA 2AGQA 4YB7A 3GILA 4OYBA 2Z8QA 3QFHA 3AXMA 2HWIA 1NSKL 2YNHB 1PCAA 3HHDA 4LF6J 3M8PA 1CG2A 2CA9A 4DV3F 1KVKA 3R7NB 3J7A1 2KYZA 2WOMB 3DLGB 1R27B 4DU8A 2VV5A 3N01A 4M8LA 3K89A 3GE9A 5HBMA 2RVJA 3OVAA 2ZZTA 3HI9A 1WC3A 4URGA 2MY7A 4QYZK 2AYEA 1VQNS 1RTZA 4PG6A 1TP7A 4ZPCA 3QT7A 1MU2A 2PC6A 3NRBA 2UUWA 4DZDA 4C11B 2FGCA 7FD1A 1VQ5S 4HACB 2EEYA 1NNDA 5D77A 4CO1A 4K0KF 3CC4S 5BYRA 4OHXA 2YXLA 1UWAA 1FKPA 3KHGA 4AXIA 5FLXU 4LVOP 4LSLB 2NXNA 2R8KA 5I4MA 4PWWA 1KQSR 3MGJA 1CJKA 2ZEJA 2XSJA 2LA6A 1MW7A 1NRKA 3DOLB 3JAMY 5J1EB 3VAIA 4YP3A 2GGPB 1PGZA 1F5CA 1F9HA 2B9WA 1RT7B 3IS9A 2VG7A 1FI4A 4PCQA 5IC4B 4JV0A 2LECA 2NXCA 3VAHA 1HFEL 4ERDA 2RDIA 1FFGB 2MZRA 2YKQA 1XERA 1XNRF 2KG0A 1NB2A 3JXOA 2MGZB 2R7UA 4TY9A 3DOMB 1I6JA 3MMJA 3ISNC 2NR0A 4V19X 4OL8A 2YVSA 3LGMA 2VU5A 3C19A 2V9WA 1UWBA 3MTKA 5KFZA 3KK2B 2R2RA 2OFHX 3W8GA 2VG6B 3N9UC 3AQOA 1CEZA 4WYWA 2G2YA 3QIPA 3BDPA 1Y11A 1Y10A 4NZ0A 2ZH4A 2CZ4A 3R1LA 1IBLF 1S1XA 1YZ6A 1T9WA 2JVOA 4YR0A 2Y0SD 1RAAB 2OGUA 1RQ0A 1FEHA 5C7PA 3SQOP 4AL7A 5DZ7A 4N76A 3HHEA 1SH3A 1O8BA 1RAOA 1KC8T 1WG5A 4OYPA 2V8GA 4BBYA 1TL3A 3DM2A 3IR6B 2M5YA 3IWXA 3PYEA 3AH6A 2HFZA 3HCXA 3JTOA 3TQ1A 2WW8A 1K8AT 3MM8B 2YWFA 2CQHA 2B4OA 3R5GA 2BQUA 4U9RA 1TL4A 4ES3A 5EX0A 3C14A 3D2WA 1QTNB 2YNGB 2ZM6F 3VALA 1J5EJ 5D6GA 3VAMA 2WTFA 2K1RA 4Q5VA 3N28A 5HK4A 3OTOJ 1PIEA 1NDCA 1TKTB 2XULA 2Z2LA 4IH5A 4NLYA 1XMOF 2DPJA 2HFNA 2ZH1A 1SVDA 5AJ3J 3TA2A 5LM7E 4LSZB 2EFOA 3IA0A 2MZ1A 2LQJA 1IKVB 3QMQA 4FP9A 2UUBF 4IOBA 1HQUA 5CYMB 4OJ3A 3V4MA 1AFJA 5J2MA 2BYCA 3LP1B 1S1UB 4FF2A 4R25A 2IM2A 1CJVA 4YB1P 3C3LA 2MZTA 4WFBQ 1DHMA 4DFMA 1YK9A 1EP4A 3LGHA 1MWZA 3DYAB 1WKKA 3D1HA 5K8PA 2RU9A 2AEFA 3M8RA 3MWBA 4JI1J 1HBNA 2V8HA 4IFYB 4XDCA 3PY8A 1U09A 2LU2A 5IT0A 1EX8A 1GK8A 4IDKB 2DYAA 4ED8A 3RW6A 3ZZPA 2XMJA 2BUNA 1S97A 4M5LA 2VJUA 1KSPA 1RCOB 4AT1B 1XWLA 3FZBA 2AKWB 4CO5A 2HQCA 2OEMA 2HFUA 3BKFA 2E66A 2GIFA 2OPRB 3L7PA 4ED3A 2FLLA 3DLBA 1QTMA 3NGUA 3O44A 5I42A 4KPYA 5KFUA 5HATA 4HEA9 1NDLA 1GAOA 1T0TV 2W24A 4C8YA 2RS8A 2A0FB 2E5GA 1BQNB 1JLAB 4ITSA 4Z7YA 2LYVA 1WTFA 3SCJE 5KFTA 3CCSS 2RT3A 3G8SA 1JKHB 3EPIA 1IJFB 3PYFA 5IS2A 1IBMF 1G2EA 3LH2S 4AL6A 4P2FA 1VK3A 5F0UA 3C6TB 1R0CB 3UQSA 1U26A 5J2QA 2W4DA 4B3SF 4HHUA 2UVUA 2FB0A 1FK9B 2D7SA 4AFFA 3K8WA 4IFVA 4LSNB 2CPYA 3SI8A 5H9EJ 3M2UB 1LWFA 2VJVA 3RRGA 3NWGA 2E5JA 2I9SA 4YN3B 3RW7A 1UVNA 1URRA 2V0NA 1R43A 2ZBPA 1T3NA 1X9MA 1VJQA 2HNZB 2NLWA 1JB0C 2EG2A 3W65A 4HYKA 2DIVA 1UJ5A 2HHPA 4RUCA 5IWAJ 2F3JA 3DRYA 4NOHA 5LJ5Y 4QWDA 1UFWA 3BGOP 3B54A 2LQ9A 2EK6A 2G9OA 3BSNA 4UY8T 1MSWD 2B51A 5KFJA 2K3KA 3M9MB 3PM9A 3ETOA 2YKPA 2J0XA 1SL1A 1AZSB 2EXUA 3GIRA 3MUTP 1EIYB 2JSXA 4F4KA 1S77D 1TAQA 2MKHA 3GJSB 2O3DA 2MYFA 1RT1B 4FDFA 2QX0A 3C6UA 3KK3A 4DL6A 3SZ2A 2MHNA 1AUDA 4J9VA 3FCWA 1SC3B 2V4JA 2RILA 4ID5B 4YB5A 4OI1A 2IVMA 4C8LA 3QRRA 2OEKA 4DX8H 1UVJA 2DISA 3SBMA 3BV8A 1OSDA 1CBKA 1RZMA 1X4CA 1SQFA 2J7WA 2Z2MA 4RUHA 3MHYA 1DURA 3I4HX 4K4XA 3M8YA 1C2PA 1E6VA 3OTCA 3VR1A 1VQMS 2J8SA 1VFJA 2BVZA 2XLJA 2LKZA 3TUZC 1V5IB 2PT0A 2R7QA 5LJ3Y 1K1SA 3OLBA 2E1CA 1ELOA 5M2UA 3MXHP 5ETSA 3AXKA 3GLJA 5KFVA 2KH9A 1X4EA 2VF3A 3UDLA 2MTLA 3FVYA 4NRTA 1JNRB 1SC4B 3W2VA 1RT4B 5LSLA 5DG9A 3HSJA 4DN9A 2VDIA 2B4UA 5IQQA 3T9NA 3TW0A 2UUTA 1AROP 4DV2F 2OMOA 4LFAJ 4O4GB 3M6VA 1HW8A 3H90A 2NYIA 2KN4A 2W4CA 1N4LA 4QIVA 2P2CB 1ZAVA 2RUSA 3CCES 2VPZB 1FE4A 1M1GA 1UJ6A 4RO0A 3KUHA 2GV1A 4Y34A 2ZVSA 4ETXA 3HPOA 3KHLA 3MPDA 2PI4A 4B3SJ 1B7YB 2XY5A 4RLEA 3KLFA 3RGIA 4LBIA 3PW4A 1GXUA 3M8QA 3NXZA 2D1CA 5B7WA 4UZBA 1H72C 3H8YA 5L38A 3SSSA 2QLFB 2V2KA 2VPXB 3MECA 4C9DA 2HNDA 2FVSA 3C15B 1FRJA 1V3RA 2YPYA 5C42B 2C2RA 1NSAA 1X31C 3CCMS 4I6WA 1DAXA 2LCWA 2XMTA 1OM2A 4DUZJ 1PBUA 3IC1A 4NE9C 2UUBJ 4ZP9A 2FY8A 3HD1A 4GO7X 3FQKA 3W64A 4HDHA 2KKHA 4ZJQA 5CA5A 1GFWB 5KOXA 3OVSA 4F8RA 4U6PA 3JAMU 3EJMA 4WCEQ 2HYIB 1A0OB 2H3EB 3FBBA 2F4VJ 1VBXA 2ZWOA 4JI2F 1VISA 3ENQA 1JLEB 4EFAC 1Z4UA 1SKWA 4WP9A 3EX7B 3KUEA 1HKAA 2EK1A 4M5DA 1SJ4P 4USIA 4OJGA 8RUCA 2PMWA 1IKWA 1KLMA 3J7YI 2YQ3A 3DHXA 3SCIE 3MEEA 3UDVA 4ZIVA 1HI0P 3KHHA 2V2QA 1KR4A 3RBEA 2GX8A 5LMUF 4KGVB 8AT1B 5GADI 2XB2D 1H3DA 4NRUA 4NA3A 4DR1J 1SIZA 1LFPA 1UZHA 2C3MA 2JLFA 3TJAA 4RW6A 2MQQA 1NJZA 4OI0A 4MKYA 3KJVA 2HG4A 2V4RA 3LP0A 4OLPA 1H7XA 2GVDA 3DRSA 5J2PB 3V6KA 4FYYB 1TU0B 4KGMA 2DGUA 2I2YA 5IOLA 4ZP8A 4J9UE 1JMTA 3F56A 2CNNB 4CWBA 1U8SA 4KHPF 2X3GA 3BGRB 1T7PA 1OPZA 3W63A 1L5UA 5DV9A 3OFGA 2OPQB 2J9EA 3TVKA 3OJSA 1S1VA 2AF6A 2IIHA 2Y1IA 1Q79A 1T3OA 2KHDA 1FF2A 1NBEB 2XZ2A 3OFEA 4KPCA 4NLQA 2WVFA 1BQXA 1HQUB 1X8DA 5CYMA 4IG3A 1QM9A 2JWNA 3RUBL 4KT0C 1Q1KA 4K7QA 5J2MB 3KNAA 3QT8A 2ROPA 3DKDA 2GIQA 3HF5A 3CJKB 4L76A 5L9NA 1FTRA 2CNKB 3GFXA 1NPKA 5C2CA 3EDQB 4DR4F 2VH7A 2BDPA 3CCJS 2I0XA 1U6FA 1L3KA 1Q7LB 1WOSA 1EHWA 4B3RF 3PACA 1LEOA 3PKMA 2K3IA 2XSFA 1YG0A 1B0PA 2NCKL 2ZH5A 1YITS 4HDGA 4NLTA 2DY1A 4HH1A 3JYTA 1FRMA 4QR2A 5DG7A 1S0OA 1ZPVA 3DRXA 3ONQA 4LRDA 4A8WA 1JLFB 1KS2A 3KXDA 1DFDA 5DQGA 1HHQA 3Q8RB 4JI4F 2AZ3A 2DCUB 1BE4A 2E1MC 2HGLA 2LDYA 2H4YB 1RUSA 2ZE2A 4ILMA 5F41A 2MMYA 2MKYA 3MM7B 4G1QB 4K8RA 3UR3C 3PVXA 4F0MA 2BZ2A 2ZZNA 5LSRA 4CNZA 2FIUA 4MIBA 5E3AA 3M30A 3G4SS 2PO4A 3R27A 4OI4A 1QD1A 2ABYA 2C2NA 4OZ3A 4CTAB 1N56A 3HFVA 3MPYA 5EN1A 2IC3A 3EZUA 5KT7A 4M1KA 4C6AA 4ZP7A 5EDWA 4MK7A 5LSOA 2RS2A 4WXOA 1RHMB 1V3ZA 1ZM3A 3WZ0A 3NS7B 3A3NB 3ILIA 4DS4A 2YWHA 1WDDA 2FYXA 3K59A 4RU2A 1EETB 4FYDA 1RHJB 4ZVHA 1W25A 2Y8YA 2FJAB 3IM9A 3ILJA 3KG4A 3R5BA 3EPGA 4LFCJ 2DGSA 1M5HA 3Q89A 4NA2A 5D0GA 5CXTA 4DL5A 2AX0A 1PJ7A 2D3UA 4I2PB 1NKBA 2MQPA 4I64A 1YKWA 2EFGA 2MLZA 4HI1A 5L1IA 5D15A 4DV4F 4PXBA 3NCQA 4ANEA 3ADAC 4X4SA 1U1QA 4JI5F 5B08A 2J0SD 1ICEB 3ZTQA 2E1AA 4JI8F 1RHQB 4DV2J 2V50A 3DRRA 1VDHA 2M3DA 1LWCB 2VL1A 2KVQE 4F2RA 3DRPA 5A76A 1YRUA 2HQDA 3RZAA 2E7XA 2A1BA 3W66A 4DG1B 3ICLA 1RISA 1WC0A 1EAYC 2QIFA 3DGPA 4DMZA 3H2LA 1QDUB 3D6FB 3SSRA 2AYGA 1I5OB 4ANDA 5HMZA 5L8RC 5C24B 4PXDA 1IM4A 3OSNA 1S49A 1PKUA 3TWZA 3D0HE 1ZA1B 5L9XA 2IRYA 4QBUA 5A0YB 3AY0A 5CCMA 5HSPA 4DCJB 4C0BA 2W4PA 5CYQB 4B9MA 2CWXA 3GSDA 2HBZB 2RAQA 5A8KA 2P6SA 1VRUA 1VMBA 3D0GE 3IGVA 4QW9A 4FF4A 4PG5A 1MROA 5KFHA 4KKOA 4MH8A 4JI3F 2ZVIA 4P52A 3W5ZA 5H9FJ 4DV5J 2LA4A 4ES1A 2PMHA 4Z37A 4RNMA 3MOJB 5F8MA 2C2DA 3M6XA 3JSBA 3UDEA 4ED5A 2BE9B 3NKYA 2BJ8A 2UV8A 4WIIA 1WNEA 4YDXA 4Y00A 5DETA 5DQIA 5D4PA 3W9HA 1FKOA 2QTWA 3PRBA 4CNYA 2N82B 4X65J 1E6VB 2MY8A 2VASA 1RWPB 1EJ7L 4X62F 2C2EA 1U49A 1S1WB 2JRSA 4TNOA 2MKIA 4LFBJ 3E01A 1DY3A 1UUJA 1TL7A 4P74A 4CLWA 4DZ6A 2KDOA 1JLGB 1OY9A 5B09A 3KLEB 2RQKA 4EBEA 2MDAA 1HLWA 1RWXB 3KMQA 2OMLA 4YR3A 4ZPAA 3QLHB 3M9OB 1P1LA 2Z30B 1CC7A 3PIOQ 3T1YF 1U25A 2QE5A 3KFWX 5IV3A 2MEWA 2ROEA 3ZC4A 1AT1B 1N5TA 1UJ4A 4PUOA 1JXVA 2D74B 4OZLA 5AE2A 3F73A 4A8OA 1EQ0A 1DARA 4DPTA 3VAFA 2XS2A 3O2IA 1Q8KA 3KOAA 3EGNA 3IGNA 1SJRA 4MJKA 3OR2B 4QZVB 4K4WA 5F8NA 3C16A 3HJVA 2HVZA 2NPFA 4CLPA 3J81j 3OTOF 2OSRA 4YHHF 3IN5A 3DHWC 1KLNA 1ULRA 1A6LA 3HZEA 3UN3A 3AOBA 3GP9A 4B3TJ 2UUCF 4DX5A 2HGMA 5KYTA 3DXBA 2IY5B 1G1XA 2WHOA 4F02A 3H5YA 1RAFB 2QT7A 2PEBA 2UU9J 2L3MA 1T95A 3WC0A 4NXNF 1VHFA 2K7JA 1OWXA 2HLTA 2B5JB 3AX5A 3GQCA 4PG4A 2Q6CA 4DCPB 2KG1A 4CLSA 5KT3A 2ZOMA 2ERRA 2WONA 3PRDA 4PQAA 2R9LA 4WFAQ 1L3TA 4ELTA 3LTOA 2NYHA 3TUJC 1NK6A 5H9FK 5LMUJ 2HVEA 4WIQA 4P73A 4ELUA 3HT3A 2Y3YA 1LKZA 5FDLA 4A47A 4ZPBA 3IWNC 3M6WA 4OV6A 2CIMA 1KVJA 3IMQJ 1RHKB 4TYAA 1HHSA 2CKWA 2J6SA 2HZVA 2HS3A 1LWEA 1TL3B 1GTHA 3BPSP 4OZJA 2OD4A 5HP1A 1RWUA 3N5FA 4USWA 4X66F 1BD6A 4G1IA 3PXGa 3M05A 4FYVB 5ETPA 4CI0B 3OV7A 2FJEB 2V67A 4WP8A 4ZDNA 1RXOB 1E6YB 2ZBCA 3DLJA 2BKOA 5KT5A 3VGUA 5EUHA 5D3GB 1FESA 1SUQA 3AFGA 1GMUA 1SPBP 1JLBB 4OFZA 3H40A 2C3UA 1N0VC 2FGOA 2GO8A 5IC6B 4UOGA 5CD4H 4ECXA 1FJCA 1RWNB 1ZAWA 4JUZA 4QR1A 1Q5VA 3I0SA 4J9LA 3TI0A 2XC9A 2DNGA 2BM0A 4H4OB 4MYUA 2PFFB 4EUVA 4C8KA 2P6TA 1JQGA 2CQ3A 2HFOA 2VFUA 5KFGA 2VICA 1HD0A 3I9ZA 3TARA 2DR9A 5HVGA 4OX9F 3QJJA 3MCMA 4WXWA 4NLRA 4USTA 5IZHA 5ETKA 1QSLA 1H38A 2CJAA 4EI2A 3EYZA 2Y0BB 3KG0A 4ZKAA 3QWUA 3CEDA 3K5MA 1EKRA 3ZXWA 2IYIA 3HXMA 1VC0A 3C66A 2HHWA 2VDHA 4JI8J 1MN7A 2DGTA 4Z7CA 1VBYA 1H2VZ 3PIPQ 1U1RA 1BA3A 5CCLA 3TVYA 4I68A 4PZVA 3T41A 3JS9A 2DNKA 2XCAA 4N56A 2G13A 5JUMA 1U1NA 3T1HJ 1NK4A 1WC6A 2NSBA 2YNHA 2ACYA 2XLIA 5D0RA 1U1LA 2ZUGA 4NZ7A 2UZAA 1RYSA 1WC1A 2LXIA 4NLDA 4J9SA 1R8BA 2RH3A 1REGX 5FIIA 1LQ9A 3W9JA 3OW2R 1HNIB 1FWLA 4BWMA 2ZJQQ 2XYHB 4A48A 1NEEA 5F9NA 3AJ2A 5DDOC 2YX1A 1QVGR 3KLGB 1ITPA 1RADB 3SV4A 1DTTB 3J7ZT 4BC7A 2ZHBA 1BQMA 2QMUB 2KFYA 2HBQB 2CQ0A 1H74A 1Q4RA 2FHJA 3NWRA 2W9CB 1FK9A 4DWIA 4LREA 1Q78A 4CM0A 4U67Q 2BR0A 4ZHRB 2IA6A 4AL5A 3M2UA 3LAKA 3RG6A 3FZ2A 1WSVA 3NOGA 4ID8A 2OPSA 4GVBA 2ACMA 2C28A 1RT6B 3NCRA 4TY8B 2CDQA 1B4SA 3CCLS 4DSJA 1RKIA 1CQMA 3ISND 3M30B 1NK7A 3QJLA 1KDNA 4QWCA 1X4AA 2K8GA 4FYXB 2OSQA 4Y2MA 1U2RA 4DU7A 3M8ZA 2QSWA 4PG8A 2GMHA 3T6JA 5KFWA 2IC3B 3GFYA 1B70B 1Q95G 4PEOA 1FX4A 4QIGA 5M2RA 1FWKA 3FJ2A 1BLUA 2MGZA 3V4IA 5D4LA 4DV3J 2FVRA 3I87A 1WHVA 4UQGA 1S6PA 2M8HA 3HULA 3WDOA 3I5CA 4X62J 3D1QA 2FJVA 1UKUA 1EETA 2W7AA 3BGFA 3MM5A 4QIFA 3EGZA 5F9LA 3ITHA 5LL6d 2PA8D 4P10A 2AW0A 4CO0A 2VG6A 1KHVA 2X1BA 3MMAB 4I0WA 4LUBA 5H9EK 1U2CA 1LK7A 4YDDB 4IQXA 5HQLA 4DV0F 2ZBIA 3W2WA 3H98A 2Y1JA 4LFBF 4YFUA 3DLEA 2JFKA 4RW8B 3N79A 4DSKA 2G0IA 3R5JB 3SCLE 4NLXA 3Q8PB 1JJHA 4DOZA 2NXJA 4RU9A 4MTPA 5KFRA 3CSKA 1HR0F 4ICLA 3TQEA 3D0IE 4Q8FA 2LQBA 3G86A 2BEFA 4DQPA 1URNA 3CCVS 4G3IA 5I3UA 1DRZA 2ZD1A 5EWEA 2HRTA 2W01A 1HA1A 3QIDA 4D3GA 5B0BA 4OHWA 1CS4A 2QLWA 3O6QA 1YJRA 4FXVA 3FQLA 2K1RB 3ZTRA 3P96A 2BRKA 2WRMA 2V69A 4U8VA 1KQFB 3GYGA 1IJEB 3NCPA 4FKYA 2JH3A 4LRBA 3QATA 1NCLA 1M5PC 4CRJA 4EK2A 4R5PB 5D8HB 3M2VB 4EO8A 2HBRB 2QA1A 3IR7B 3CW2C 3SMZA 1BY9A 3L95X 5HJXA 2OLWA 3K57A 1RAGB 3QBCA 1QSYA 2I38A 4LF5J 4U7UK 3BQ0A 1IBCB 2UXBJ 2RF2A 2HZAA 1F9EB 2N7YA 4NI2A 3PO5A 1S5ZA 2HNYA 3PW5A 2J8AA 2POKA 4LR7A 3T1HF 1HBNB 4IFYA 2FDNA 3T3FA 1SJFA 3DLKA 2COLA 2AMCB 3HT0A 1S76D 4IOAQ 4K59A 4KO0B 4KV8A 1REVB 1H7WA 4WBFA 4C98A 1RSCA 4ED6A 3MR3A 4OZ1A 1VQ8S 2MSSA 2X3DA 4O44B 1FDAA 2F40A 3MEDA 2R7OA 5E3RA 5KG3A 4L75A 1DQ8A 3G8QA 2XM3A 2ZZMA 4K4SA 4ATNA 2M4MA 2MSTA 4OYWA 3M4XA 2DXEA 4OLOA 2ATCB 1FO1A 3H5XA 3OHBA 2FZCB 3RJMB 5KFQA 2RQMA 3J81Y 1NJIT 1NHKL 4GC6A 2R2TA 1X4FA 4EBCA 3M2RA 3AB4B 2QL7B 4A8XA 2GMLA 5KG1A 1S4FA 3A8JA 2MB0B 1RJJA 4P7VA 4O3NA 4TU8A 5HLFB 1JXLA 2XEXA 4OZ5A 1SV5B 4ZCKA 3FEYB 3TUIC 1VCTA 3CJ2A 1GQEA 1VBKA 2PFDA 5K8NA 2UXDF 5KG2A 3W1YC 3MUMP 4LQ9A 3BJYA 1RDRA 2QLBB 1HMVA 1Q16B 1XQIA 3NLCA 2BW2A 4URQU 4FKXA 1SL2A 4KH1B 5A8RB 4NLOA 3OPKA 1WEZA 3RB3A 3NBPA 1TKDA 4M5KA 3L7UA 5DLFA 1CJUB 2FZKB 2HK2A 3BGUA 4DF4A 1XMQJ 1FRLA 5B0GA 3KLIA 1TVRA 3VZHA 2KXFA 3DU6A 4DFKA 2H5IB 3KUGA 1C1CA 2KT2A 1X0PA 4NEZA 2HRUA 1VQYA 2APOA 3BR8A 1P27B 3BKUA 3FC9A 3MAAA 3CD7A 5GMDA 4WFNQ 3PW2A 1SI9A 1IWAA 3A8KA 4J5OA 5KG0A 2FHMA 3CJTA 1RWKB 1QSSA 2EKYA 1CSJA 3BGRA 3G82A 1CVJA 5F8JA 3DI6B 2D69A 2VONA 4ZN1A 5ETLA 1UETA 3AOAA 2AU0A 4ZLLA 4XPEA 2YY3A 4WE1A 3U27A 3C6UB 4NPOA 1S10A 4DV6F 4XDDA 4IG3B 1XTZA 3OSPA 2HQ3A 1NHUA 2RHQB 3Q86A 5J2NA 3SYZA 1ZYQA 2FJXA 4WJBA 4YEAA 4LF4J 2VPWB 2R2UA 2MKSA 2EFNA 1RA7A 4FNHA 2AEMA 3MM9A 5HAOA 5BXIA 4RW7B 1D9AA 4IOCQ 1VQ9S 3W9IA 4FS1A 2DGWA 3JQKA 2YH1A 5KFSA 2HHVA 1WDTA 4K2JA 3HVRA 2UVRA 3BQ1A 4DL2A 1O51A 1D9FA 1KTQA 1L3VA 2AYBA 1ZPWX 2BE2A 1MU2B 2HFSA 4A8FA 3JYTB 3L3CA 5B0EA 3FFIA 1KWMA 3EZ5A 4P2SA 3IR5B 2C3YA 1S1TB 2XTDA 4RNNA 2CNLB 1HBMB 4J37A 2EC2A 1NLKL 2Q6BA 4NLGA 3CTRA 5JMNA 1EB0A 5KAKA 3QSYB 4IRCA 3Q8VA 4N47A 3TAMA 5I3QA 3NY0A 4DUZF 3OR1B 2M70A 4FPIA 4USKA 3NEKA 3PYDA 6FD1A 3TUPA 4HVZA 4LRCA 3T19A 6AT1B 4HI2A 1CJTA 2NXUA 4QYRA 5SUHA 4ZLJA 2QA4G 4ZVTB 2E5LJ 2RDDA 2CQBA 4DR7J 2F8EX 4HT5A 4MKAA 3UD3P 3HD2A 3MPVA 2DD8S 3ISZA 3S6EA 5BYSA 3B4DA 4O0NA 4DR3F 3KLGA 4GKJF 5KG6A 3DDKA 1U0HB 4YOEA 1C0UA 3QRPA 3OLAA 4ED0A 2QN6B 3RAQA 3MEGB 1RA6A 2HNDB 1GXTA 2KB2A 4DS5A 4F50A 2JOQA 2DEJA 1RI7A 2EPIA 3PDNA 3IFEA 2ZKUA 4P72A 4YR2A 4NMLA 5AXKA 3ZFVA 5KFFA 1S7HA 2UP1A 4H4KC 2HHQA 1HYSB 2ADBA 2P9EA 1N36J 1FDBA 3CB4A 5E3CA 1VQ4S 4UOFA 1Y5LB 1BGXT 5AXMA 1PBAA 2WB4A 4BC9A 4ECZA 1DJ0A 3OXLA 4GO5X 4G1PA 3K7RA 3W8PA 2C3PA 1NPRA 4MIAA 3MR6A 3KHRA 2KU7A 2XMMA 3B8HA 3S1TA 5IXUA 2XI2A 4CYUA 2MXYA 1C1BA 1RT3B 3QFWA 3LWLA 3D67A 1RT2A 3UWTA 2D9OA 1RABB 3Q8UA 3BBFA 2GFFA 3R5CA 4DV7J 2BQRA 1OYDA 3MR7A 4PQUB 2VG5A 4JI0F 5HI7A 1R6VA 2FC9A 1TKZA 2UXCF 2V8VA 2V9KA 2WW4A 1QLNA 2Z56B 1U48A 3W61A 4R8UB 3CVKA 3OHAA 4WZQA 3R2CJ 2YKOA 2UXDJ 2N4DA 1B7FA 5HVHA 3JQJA 4EBDA 4F4XA 7FDRA 1C4CA 1F1BB 2E5HA 2CNOB 3POTB 3B4MA 1UEVA 4LT6A 4OYMA 2HMIA 5K9FA 3VGSA 1UPPA 1UPMB 3MF5A 2YNFB 4QPTA 2JX2A 5I3UB 1NKCA 1EP4B 3G6XA 1OJ4A 2E1RA 4KYZA 5KT4A 1NO8A 2HHUA 4HACA 4MIWA 3I31A 1HI1A 2KT3A 3H0PA 3JQMA 4JV5F 3CMQA 2H51B 3GFHA 3SEOA 4U95A 4IDKA 2MQ8A 5HMWA 2XY6A 2VC1A 1CJKB 1NXIA 1X5OA 5H1SV 1N36F 4ELVA 1S9GB 1IR0A 4B9UA 3IG1A 2GVZB 3D3BJ 4UY85 3B82A 3O5TB 1RT7A 4TQRA 4A8QA 4QQBA 2KJWA 2AJ0A 2ZH7A 4NEYA 2BV3A 4KC5A 2OKQA 3ELHA 2V8PA 1GEHA 3L4BC 4BHQA 1NK0A 3LO3A 4ZCIA 1N5YA 2OI2A 3DDIA 3QGGA 4CCHA 4IG0B 1C0TA 2NXEA 3NGRA 3OT9A 5GMKa 4JV1A 4B3OA 1A9NB 5ETMA 2WSCC 2ZNZA 5A6WA 2VFRA 3OR2A 1Y0HA 2ILZA 3T1YJ 3J80Y 2VQEF 2C2OB 4F25A 1FRIA 2K7KA 3MMBB 2C2MB 3SSQA 3HHLD 3V6JA 1FD2A 3C6TA 1YJ9S 1XMOJ 2J0QD 2KTQA 5A8WB 2ZBQA 1GX6A 4KQZA 3O3LA 2DGVA 4IKAA 2V1TA 3TOQA 3A3OB 4UOCA 3LGNA 1OS5A 2IAJB 4BS2A 2B5JA 4JB8B 3WBZA 3UNYA 1RTJB 2GJFA 3KMSA 1CPZA 1RK8A 3LP2B 1H6KX 1RTIB 3SDEA 4DR6F 2EI5A 2NS1B 3AD8C 3J81U 5AE1A 4HH0A 4PR6A 4RNFA 1VC6A 1YLXA 2FHKA 2F8HA 3G6ES 1QVFR 4CT9A 1N5VA 2QGFB 5FLXY 4DL3A 2DH7A 1QUVA 4H4KA 4AQYJ 3GV8B 1LW0B 2KL8A 3D54A 3H2VE 5A2QU 2Q3PA 5HLFA 1NHVA 3I0RA 1LW2B 2RKIA 4LBPA 1VRQC 3DLHA 3ET6B 4GRSA 1UA0A 4RWXA 4ANCA 1IKVA 1PAUB 2EWHA 2G2ZA 3A12A 3K58A 3VV2B 1S1UA 1CULA 3GONA 4OYZA 5U47A 4DQSA 1OPIA 3M32B 2IMWP 1UZDA 1RT1A 4Y3CA 1RAJA 1AZSA 3CCRS 2VHGA 1N8RT 1HNZJ 1S0NA 4OZ2A 1WG1A 2W7PA 1S4EA 2XNQA 2AV5A 2QV6A 1T05A 3FSIA 3AD9C 1XEZA 4LF9J 3EWGA 4OYOA 3KK3B 2OD6A 1MG7A 4F4WA 2AP6A 2VBZA 2ZH9A 2XCPA 4OHZA 5GAEI 4DQIA 3O8WA 4CLFA 1PYOB 2FUG9 2OAUA 2PDAA 1ZZNA 2BABA 1UA1A 1VOMA 4B3MF 3UNGC 2DIUA 5CHCB 4CO4A 3LWMA 4B9SA 3QGPA 2QL9B 1YZ7A 1YX2A 2CG4A 2R3VA 3G82B 4P2XA 1D3WA 3VAKA 4X4QA 1YIJS 2RRAA 2A6OA 4MFBA 4FBUA 3I6PA 3QPIA 4I2QB 5AXNA 3A3PB 4LVNP 5L1JA 1KRPA 1T11A 2B8QA 2YQ1A 3RBZA 3LOUA 1NDPA 4KFBA 3IBCB 4Q7AA 3TZXA 4NCAA 1VS3A 4ILLA 1YDLA 4RJVA 5IWAF 3BQ2A 3QZ8A 4I56A 1SKRA 3BH6B 2HQGA 2DT9A 3GFZA 1RLDA 3HVWA 4RL1A 1WWHA 4LF5F 4B08A 1I1GA 2CPFA 2Y9HA 1BC6A 1BWEA 3OL6A 3T9ZA 2DGQA 2DNQA 4PXEA 3HVTA 1HBUA 4IFVB 3IS9B 1OSCA 4LSNA 1FCAA 2ZHOA 3LANA 1TV6B 4M5NA 5C25B 4BLGA 4F36A 3PCOB 3RRHA 2HAFA 2YWEA 1TL1A 2B4PA 3M8QB 3OD2A 4W90B 2FLNA 4F3OA 1TFWA 1JLGA 4EU0A 2JEGA 1V9OA 4XPCA 1S6QB 5T7LA 3CE8A 4F67A 4DXLA 2KFZA 4ZVPB 2HWTA 3KDOA 5B0DA 3TAMB 4B9TA 1UWBB 4TLRA 1S57A 2RU3A 1UEUA 4RUAA 4ZLNA 1PC4A 4KHPJ 1FFWB 1FD8A 2V2VA 3QIPB 3G8TA 2FVCA 4IRKA 1JLQA 2WSEC 4IQMA 1DLOA 4M5JA 4DV1F 2WB1D 2H48B 1BWVA 2VIHA 4RBUA 2XMAA 4ZVFA 1RBLA 1ZZFA 4QU6A 2CJXB 3EE3A 1XK8A 4XTTA 1TKXB 2H4WB 2FPHX 4TYBA 4ZCLA 3ZO7A 1R31A 1T8EA 2N4CA 2DR7A 1IR2A 2FLOA 3IBWA 3MEGA 4OQJA 4PYDA 2ATLA 1IQTA 2WONB 1Z1ZA 3D5MA 2CJKA 3MFIA 2DRDA 1D0EA 2W1BA 2XO6A 2WVDA 2D9PA 3PFEA 1BXNA 4CO3A 4DR7F 1VIXA 2FZGB 3K17A 3MCOA 4EWTA 3M8PB 5RUBA 3H20A 3T5HA 4I6AA 4F2SA 2IRXA 2HURA 2PN6A 2YBVA 5KYVA 2BJ3A 4B02A 3J7Z5 2N3LA 2WOMA 3BN4A 3NS6A 5CD4A 3FBFA 5KT2A 4DSLA 2XI3A 1MLAA 3I55S 2FC8A 1SBRA 2WVBA 1H0HB 1Q86T 1PC5A 1B64A 3HHLA 1HWKA 3ZZUA 2PMZD 3DU5A 1JJ2R 3CDUA 2DNOA 3GYXB 2OO4A 1FFSB 3PFOA 1F5BA 1FDDA 2JHEA 5KG4A 5KTQA 1JK9B 5E2QA 1TQLA 3AODA 1BMQB 1V5VA 3Q8QB 5CQGA 2GHWA 4YMEA 3W2VB 4A8YA 1VBZA 1IBMJ 2BACA 3HZGA 3Q23A 1FRKA 2KT5A 5KG5A 4CT8A 3M9NB 4OX8A 4C3MA 4X64J 2MQMA 4FZVA 2DNNA 1HPZA 1J5EF 3GG1A 3A1YG 1XNRJ 4Q0BA 2BBEA 3E2EA 1RTHB 3LF0A 2GGPA 5A2QY 1IKXB 3TVZA 3Q24A 5CYJA 2QL5B 4DV7F 4DSFA 1FXLA 1IWGA 4FXWA 5G4DA 3Q8YA 3VVUA 4LF1A 3GIIA 2ASJA 3IP0A 2LMIA 1Y4ZB 1ZM2A 1YBAA 4GVLA 4F26A 3PTWA 1XN9A 2AJFE 2CPEA 1XR7A 3JSRA 2IM1A 3M1VA 3PG9A 4ZPWR 4LFCF 2Q1LA 2XTEA 1RLCL 3VF0B 3K0JA 3U7JA 1VR6A 1HD1A 2ZKTA 3BB5A 5F0WA 1RTDA 3BEGB 2RRBA 1PILA 4N8OA 4JI5J 3CD5A 3CJ8A 4KO0A 4KV8B 2QFIA 4NL5A 3UW1A 4DPXA 5J1PA 1VI7A 3EGVA 4I7FA 1TTHB 4JP8A 3U1NA 3HKWA 2CQGA 2W8LA 2XS7A 2IVYA 3DC2A 3CJ5A 3UD4P 3OTDA 3HFKA 3ENAA 4N5SA 2DHSA 4RBTA 4DFJA 1WI6A 2B9EA 4OX6A 1N48A 4O3RA 4ED2A 4QW8A 3TZWA 1Z2ZA 1U6ZA 3HSZA 1KQGB 3K5PA 1G4CA 3N6LA 3B6BA 2OIHA 3UI3A 3BYPA 3MM8A 2DTJA 4Y2CA 5ADZA 3JTNA 5DDRC 5ETTA 1GMVA 3KNGA 4A8SA 1HWLA 2NZCA 2YKNA 2DNMA 4K4VA 4B3MJ 1JLCB 2QC3A 1LWXA 3J80U 3JSMA 5A8WA 4F04B 2E1PA 2GMJA 2NUHA 2AQ4A 3BYRA 8ATCB 5IM0B 3K5OA 3P45B 1Y00A 4CM2A 3W5XA 3OUYB 4ZHRA 2RSQA 5IT9Y 5EWFA 1IBKF 4F7VA 2OPSB 2JFDA 2V8DA 3GG0A 3QGIA 1JXEA 2HS0A 1MMNA 4GVBB 4TN2A 4ED4A 1VQPS 4V19J 2MLYA 4OV1A 3HMJG 2UUCJ 2VKRA 1TAUA 1GXLA 2FJBB 2QZ8A 5F8IA 2XZDB 1HNXF 4J91A 2GZOA 1TUVA 1RYRA 1ROFA 2WZ1A 1EZZB 3DMJB 1H2UX 2OPPA 2WVEA 3CJSA 5D4OA 3W3SA 3MAAB 5KFOA 3BF4A 2OPQA 2B43A 4DG1A 3DRRB 1N6QA 1IQZA 2CPZA 2NQPA 1S6PB 3MOZA 3DRPB 1YJTA 5T41A 2XYGB 3GSIA 4HHHA 3DCAA 5GMEA 3R7SB 4PWDA 3BZQA 1RAEB 1IN0A 3AX2A 2KRBA 2CYYA 3C14B 3PNIA 1U0SA 1HNVA 1CULB 3OBIA 2CQCA 5I3PA 5F3ZA 4RWWA 5DJBA 1UW4A 4K5RA 1VRUB 1W26A 3HDSA 4LR9A 4NX9A 2MPUA 3PEJA 2HRYA 3VZIA 1MROB 1BQNA 2G0JA 2P9CA 2B9XA 4KR0B 2YNIA 2XMKA 3S7RA 1CC8A 1F3VA 4G65A 1G3OA 1SCJB 1R0AB 1DBDA 2ZDOA 1NH8A 2I1RA 2F4FA 3EUNA 3H59A 3SQGB 2B4VA 3QO9A 1NSQA 3TO8A 3ZTPA 4C11A 3BO4A 1YWXA 2I5JB 3RR7A 2W8KA 2E5LF 4DV0J 3Q8SB 2RQ4A 4ZVRB 4C8MA 1V6HA 4DQQA 1KNZA 5HMYA 3DFEA 2JVRA 3DYAA 1ZM4A 5E7OB 4B17A 2DXDA 4LSLA 4FPRA 5KFAA 2ILYA 3T1AA 2R7RA 3KK1A 1N54B 3P5BP 2ZE2B 1N5QA 4X4TA 2E44A 2BE2B 4CO2A 4TQSA 4WU2A 2HIQA 2CJBA 1SQEA 3AA8A 4WFZA 4CDIA 5MLCV 4DLGA 4IR9A 2XLKA 1IKYB 2Z2ZA 2V63A 3M2VA 3L09A 4CLUA 2RMLA 5ITHA 5B0CA 1N52B 2DNRA 1L3SA 4RW4B 5LXRA 3MAQA 3KWMA 4ETZA 2BKNA 2X51A 2HQFA 3ULHA 5KG7A 2R7WA 2JZ5A 3THVA 4JYAF 2DBBA 2HK3A 1IR1A 2A18A 2RF2B 2V4QA 1VQLS 3P6YC 3SCKE 4CH7A 1VQOS 2N7CA 4QR0A 3OL8A 4KHRA 4WP3A 2BJ9A 5KFKA 2BJEA 4J7CA 4F0HA 1JLAA 5DM7Q 5GAHU 1B99A 2CQDA 1S7IA 2XYPB 4ZPVR 3V2UC 4QWEA 4IUFA 4LJMA 3CJQA 2UV8G 5ETRA 1WOOA 1X5PA 2R42A 1X4DA 1C0UB 5E41A 4J9RA 2O5DA 3KK1B 4WKRA 1RU2A 1S1XB 3GCWP 1S12A 2OFGX 1RBAA 4NZ6A 4EO6A 4K0KJ 1WKJA 5KFPA 2CQIA 5J2QB 1NUEA 1TUGB 1X4BA 3KTQA 1R89A 1RT5A 4PAAA 4EYHB 1KLMB 1O5JA 1LWFB 3FSXA 1SKUB 3RB0A 1HQEB 1RBOB 1T03A 2CVEA 3IRXA 5CZXA 3TX8A 5AE3A 1LFWA 2YX7A 1OO0B 2EW9A 2AJ4A 2ZDPA 3CT9A 3RU0A 3KJFB 1F5AA 3VHQA 1WF2A 3G9CA 4QU7A 4CLZA 2GS8A 2L48A 3KKFA 3KJNB 4RW6B 5KFYA 1KBRA 1KOHA 4J9MA 2XMUA 1PJ6A 3BSCA 3ZZRA 4Q45A 2F4VF 1U47A 4Y0FA 1UFLA 1XMBA 1TKXA 2RRNA 2D3ZA 2XO7A 4PQUA 1I94F 3GU0A 2DPIA 2YH0A 3BSOA 4KE5A 1BHNA 1NJWA 1UVMA 1RT4A 3A4TA 3D9BA 1TKZB 3G2XA 4DL7A 3PO4A 1NK8A 1UFKA 4EZ9A 2YKMB 2YKAA 5D3GA 3UCZP 2FHJD 5IT4A 5L46A 4PKDB 1OMSA 1F60B 3UFCX 1SJ3P 2DJWA 4KH0B 1IVZA 1NMEB 4CIOA 4ED7A 2C1EB 2G0CA 2JEFA 3PRVA 1FNXH 3NG8A 2H9ZA 4I6YA 3FRZA 2GAHC 2HHHJ 3H25A 1TL7B 1T9UA 2B3TB 4IO9Q 3OVBA 1DTQA 2M9KA 1YI2S 1G6BA 2JJ4D 2W2MP 4OYIA 2HFVA 4MAKA 4CLKA 2D3OR 3DLGA 3M6UA 3AB2B 2CPDA 3D6TB 3JSYA 3GCXP 1VC5A 5HBMB 3NS5A 4DPOA 2BQ3A 2NUUG 1HPZB 2V34A 4OX9J 1SB6A 3HP6A 4DR6J 1U8WA 4D3HA 2R7VA 4K4ZA 3EMTA 2A2CA 2C22A 3KG1A 4L73A 1OY6A 3TJ9A 4ZJOA 4HR2A 1QJHA 5DGAA 3TYTA 2OUGA 2XMVA 1HARA 4YB6A 3M7VA 1SH0A 1NZ8A 3L9ZA 3U1LA 1D09B 4NCGA 4NWBA 2L08A 1VK8A 4O4GA 5DRKA 1RE1B 3GWCA 3GR1A 3LW5C 2VA2A 2IDLA 4HLBA 3H42A 5KFCA 1XBWA 1TMJA 4DR3J 2GO9A 2ASLA 3NGDA 4OZ0A 4GKKJ 1TMMA 2V2ZA 1TL5A 1KTVA 4OMFG 1HIYA 2Y1LB 1S1TA 1S9EB 5LMNF 3K5LA 2GCFA 2J5AA 3VVTA 1WSRA 2W2NP 3D6HB 4LF9F 2B8PA 4XIUA 4E0DA 1S59A 4UT4A 1R8PA 2CZ9A 1B0TA 4DFPA 1Y3JA 3BBCA 3LP0B 2CDRB 3C15A 5AT1B 4DBQA 5C42A 1OYEA 2VBYA 4TU7A 4P75A 3R97A 2CG8A 4X4OA 5LT5A 3MPUB 4Y28C 2AGOA 2BRLA 3H5UA 3MMCA 1R8CA 2GIRA 2E9TA 3GJTB 3MD3A 3DN9A 4RW9A 4Y2IA 3IXQA 4K4UA 4N7TA 4ZLPA 4C8OA 1E6YA 4J9OA 1D1UA 4WZMA 2AYMA 3V4IB 3QT5A 2V94A 1JLEA 5HMXA 2BJ7A 3QZ7A 2DNYA 2ASDA 3ITHB 9RUBA 3AX3A 3G96A 1Q5YA 1WELA 2VKZG 1KQKA 2ZBRA 1F6TA 4ZN3A 5HANA 4DI6A 3T6BA 4C2MA 1TELA 2ZH8A 1ZOTA 2DNZA 2O66A 1GX5A 2ZOFA 5IV4A 1NK5A 1RB0A 1FVQA 1NZAA 3SXLA 3F44A 3LPEA 2AHOB 1NM2A 3DMJA 4W98A 1YJNS 2UUAJ 4B9VA 3THTA 3NMAA 3CC2S 4KKOB 1N33F 3LP1A 3IRWP 2ZD1B 4LRAA 4DPUA 1CQNA 5DDQC 3WX8A 2DH9A 3UN2A 5DDPC 4ZIWA 1JLFA 3BDEA 3AD7C 3TRGA 5K20B 2ADCA 4ZVGA 3T5KA 2AJQA 4UW2A 1DZ5A 1GH8A 5L39A 2DY9A 1QAJA 4LF7J 2F7VA 1OIAA 1S9FA 3H2UB 1RKJA 2PI5A 3W60A 5ETVA 4U96A 4B3RJ 4X2BA 2FLPA 2XSJB 4PRFA 2HSEB 1NJXA 1S79A 3QAEA 4AUKA 4DSEA 4NYPA 2QFJA 4A46A 2GA7A 3MD1A 4WPAA 2VUGA 3PV8A 5KFMA 1K9MT 5SZTA 2YNIB 4FF1A 3N4WA 3OJUA 4DL0C 1X0FA 2AX1A 1AUSL 2AWZA 3ZNUA 4K4YA 2VC0A 2YNFA 1FXRA 3SQGA 3DOMA 1HNWF 4OI6A 3W7BA 3QLHA 2DGXA 4ZITA 2HLUA 3CJRA 2DCLA 1YHQS 1RCXB 3BH7B 3D68A 3HVTB 4I69A 4X64F 2VQEJ 1MMDA 3RRKA 3LUYA 1X9SA 2Q66A 1IBLJ 3FGVA 2DO4A 3N5BA 2BKPA 5EX3A 4TY8A 3QRQA 4PABA 1U1KA 4EZ6A 1TZ0A 3CIZA 3UDCA 1REVA 5GVQA 1KKHA 1QUPA 1VLYA 1WEYA 2VPYB 4JOUA 1VQKS 3ZZYA 4I4BA 4ZK7M 5AJ3F 4O44A 1I94J 4QOTA 2LXFA 3V6HA 3SFUA 2B7BB 2GW8A 5HQMA 2W9BA 1N5SA 1DQ9A 3M8SA 1FJEB 4EGLA 4LFAF 5E33A 3QSIA 2VD3A 3FMWA 2BJ1A 1H73A 4DV4J 4ECYA 3N6MA 4NLPA 2PA3A 3EVWA 2MZQA 3EXCX 1IKWB 3M2RB 4LIRA 2A2DA 4URSA 3SIPB 2DRBA 1HW9A 2IRUA 2WCXA 2NZ4A 2IM0A 3CCWA 4WF9Q 4PXCA 1FERA 1KD1T 3NAHA 1TKTA 4DJBA 3T5LA 1UVLA 2G1DA 2IJFA 2DHGA 1VQ7S 1MMLA 2FHOB 1V3SA 3I82A 4YHHJ 2CVIA 4BWJA 3KLIB 2RD5C 1HNZF 3FBCA 3GIMA 1QAXA 3B78A 4I2PA 4ZJLA 5DQHA 2HHXA 1R3NA 1WOPA 4J9PA 4FYWB 4L3NA 2LU1A 1MWYA 1C1CB 3MM6B 2AIRB 1NPPA 3QQCD 5CABA 4Q8EA 2LP4A 2KXHA 2DNLA 4AXJA 4ZVOB 3HHLB 5T14A 1NK9A 4ZP6A 1R0BG 4DF8A 4KJIA 1F2GA 3PZPA 1K0TA 2M52A 3NOCA 4H4OA 4M5MA 1WHYA 2ZC4A 2ZUAA 2N3OA 3PR4A 1SXLA 2XGPA 2DR8A 4M63A 3VAJA 3O1LA 4OIXA 4HKQA 4K4TA 1U1MA 1T9VA 3H7HB 2ASYA 2YKMA 4YUDA 3WHIA 1JJCB 1U1PA 3S8SA 2AZ1A 1F2HA 3G87A 2WBMA 2E7WA 4UTGA 2HAIA 1K44A 2OPRA 5THWA 1GTEA 4C0OC 2B56A 5BR8F 3GR0A 5KFEA 5I42B 3J7YU 4CLLA 2CQPA 1JKHA 1T9TA 5F8HA 1IUJA 4OJ1A 3VQSA 4JI1F 4IYQA 2IHR1 6FDRA 1RWWB 2QO3A 3TAPA 1S6OA 1SJQA 1XJWB 3PHTA 2U2FA 1VJWA 2OTLS 3H5SA 2HHHF 3L7OA 4M94A 3MEDB 3HHKA 1RWOB 4CH0S 2XBPA 1A7GE 3X1LB 5C2GA 5L1KA 3FRYA 4DLEA 2LEAA 3R7BB 1LNQA 3MM9B 4ZOSA 3AJDA 3G6VA 4X4NA 2XWXA 1ZETA 2Q43A 1RHRB 1FT8A 2HZCA 2HNZA 1PG5B 4J9QA 5FDLB 2KFNA 4KGXB 3A13A 4NASA 3W5YA 4CTAA 3CXCR 1BQMB 3I4PA 3P8BB 2A10A 1YRTA 4N8NA 2Z57B 4AYBD 5DM6Q 1WF0A 3RBXA 2BOAA 1FJGJ 1B0VA 1P9QC 1Y9OA 2GC8A 2P8IA 4NLUA 1G7CB 5HVFA 2KHCA 2MQLA 3ETMA 4X84A 4NCGB 5HP1B 3CC7S 2XQCA 3C46A 4L3KA 4J9KA 2ZITA 1XR6A 3TEGA 2W2OP 2BOPA 1X60A 4E2FB 2R2SA 2O67A 4UQTA 1XIQA 4KHMA 1VQSA 2HEKA 2IPOB 3CNQP 4TVAB 5LXYA 2MQOA 4DR5J 2MZSA 4HL9A 1TVRB 1FNMA 1APSA 2F9JA 3DOKB 4OHYA 4M5DB 2DGOA 4RUBA 2V4JB 4ID5A 3VWSA 2J9DE 4K50A 4X65F 2OELA 4PWUA 4DSIA 3PHEA 3FMBA 4USVA 1S6UA 3MEEB 1SJ1A 4V1Ak 1UCNA 3FEXB 3MMAA 1U45A 3CDWA 2W25A 1UVIA 3HLUA 4LF8F 2EFPA 3QNWB 4C0HA 1HYSA 2HS4A 1IM6A 5JVGQ 4W92B 4Z2XA 3AQPA 1HWIA 3VTIA 5CH7B 5K8MA 2GQCA 1WHWA 1VLOA 2XTCA 1WEXA 2UUAF 4JI7J 2XY7A 5G0RB 1K73T 1N33J 4MK9A 3PX4A 3PJ9A 2H65B 2KI2A 2ZNYA 1C1BB 5KFLA 3U1MA 1HHTP 1NJYA 1N88A 2OH2A 3I56S 4PWDB 3BSAA 4O3OA 1R6YA 2VG5B 1MNEA 2BA9A 2RB7A 5K14A 2JLGA 1FKAF 3PKYA 5J2NB 3TA0A 3PYGA 5A6PA 1UW9A 1FKPB 2B7CB 7AT1B 4N77A 1AB8A 2BJDA 1ZM9A 1F0XA 5HROA 1FRHA 1SIWB 1W2BR 1HNXJ 1FKOB 3MDFA 5J1EA 4O0IA 4RW7A 2FVQA 3AJ1A 4FBTA 2LXUA 1S1WA 1P8GA 2MJNA 4H54A 4UZCA 2KO1A 2VG7B 3PJXA 1R0AA 2IDEA 1WI8A 4NCBA 3KYLA 4F3QA 1T9XA 5K8OA 1NB7A 4PG7A 4LF8J 4Y2KA 1QE1A 3E51A 3CJKA 3RB6A 1SC6A 2Y1RI 3E8OA 2AGPA 3VAGA 3MECB 2E9ZA 3AA9A 4GMKA 4ZPTR 4DCOB 3SFGA 4MMOA 2HQIA 2D68A 2DKOB 2IMOA 3OXGA 2E7VA 2HNYB 3TA1A 4O4RA 3T5JA 4DX7A 3BN7A 4H4MA 3THPA 3IO1A 2B6AA 2CPJA 2HGNA 5IQ6A 3X3UA 2LQ5A 4I1TA 1IKYA 4AQYF 4MKBA 2BXJA 1RAHB 1TK8A 2M0GB 4K5SA 4P7TA 1WKLA 3JTPA 5D0EA 2CADA 2EBEA 2XGQA 1RHUB 3CDEA 1N5YB 3DDNA 1Z2LA 1PJ5A 4XO0A 3RR8A 5HO4A 2AEJA 1MN9A 4B3OB 2SXLA 1GMWA 2LEBA 4J9NA 1YJWS 3D66A 2XG8A 3H4DA 5MAOA 2E5IA 1GNKA 4O3SA 1ZH5A 2R8GA 2R7TA 3UPFA 1C0TB 4EYIB 1ZTTA 4JI0J 3BM7A 5ETNA 1K0VA 4DDFA 1JIHA 1U1OA 4ZCMA 3CO0P 2DB1A 4I7FB 4WKYA 3R5DA 3OQ2A 1NAQA 1SQGA 1YRXA 1CLFA 3V5RA 4C7QA 2WVCA 4ZMMA 4UUXA 3LALA 1FNOA 2V5HG 4WFXA 4DV6J 2WAQD 3DRSB 2W9BB 4JI2J 1FJGF 1GMWD 5BR8J 3KJVB 3FK4A 2GVDB 5J2PA 4CLYA 1FA0A 1CJVB 2D3O1 2DNHA 4OHVA 4IH7A 2JEIA 4C48A 5IFMA 3OL7A 3FEZA 4CQ1A 4XAKA 1C4AA 4DHVA 1RGVA 2XTJP 2CQ1A 4USMA 3RAMA 2PIIA 5KFDA 2JC1A 2Z58B 4P2MA 1GT8A 1WD6A 4O3QA 2ZJPQ 3GIKA 2RKIB 1QAIA 3OXFA 4IRDA 2KXNB 3TP2A 4WK1A 3ENVA 3I0RB 2JL9A 4LBHA 3QAUA 3KLHA 2CWKA 2DRAA 2QYCA 3IAM9 2DEIA 1QY7A 4XK8C 3HVAA 5BJRA 1T03B 4DN0A 3UCUP 2HHTA 4ECUA 2QA2A 1HR0J 4B9LA 3VCDA 3CCQS 3MZIA 1KVIA 4NI2B 1F3FA 2HVIA 4AD6A 5A8KB 1J2VA 1LK5A 2B0GA 1T05B 1IXKA 4WE1B 2DNPA 2KVIA 3QGHA 2X1AA 4RZRA 2RJZA 1TFYA 3CJ3A 5J1NA 3PW0A 4DR1F 2VBWA 2KM8C 1R7IA 3NGTA 3NGSA 3G6YA 4QWBA 4KRWA 3CUNA 5C5JA 1M5VC 3IG1B 5EHHA 3CD6S 2F5GA 2R4FA 3LA0A 4FVMA 4X4PA 2B9YA 1YJUA 1SL0A 3FKBA 2Y8WA 1YBUA 3E3XA 3I5AA 5E3QA 2IJNA 2C2ZB 1FWPA 4MFBB 3V6DB 3KJQB 2Z0GA 4I2QA 1U24A 2A3JA 2GHVC 3TZYA 2J7UA 3AT1B 2ZH2A 1TK5A 3Q2TC 3VGTA 3DOLA 4OZNA 3I96A 5FJ4A 3ZTSA 4KTQA 2X7IA 1KONA 2QRRA 3EM1A 1X9WA 4C97A 1M5OC 4A8KA 3K2YA 2Q79A 2C42A 2J6UA 3CWJA 3P5TL 5CAAA 5DGBA 3C2PA 2ZH3A 1LV5A 1OQ3A 4MK8A 2H5EA 1VYAA 2FD2A 3QO9B 3EGWB 2I5JA 2PD1A 2HVHA 4FNIA 2VQFF 4OYAA 3HHLC 2NSCA 3F0NA 3Q22A 1ACMB 4RKUC 4ZVSB 1SKSA 2IAJA 4A4JA 2IBKA 4OI2A 1WG4A 2ZM6J 3WQPA 3KK2A 5ETOA 3S01A 2ZWPA 3MCSA 1LOUA 1Q8IA 1RAIB 2LDIA 4EMDA 3ZZZA 2K2PA 3CCUS 4QIEA 2FVPA 1X5SA 1P6TA 2H5JB 3MFHA 4W4MA 3NAIA 5E5NA 4DUYJ 2DK2A 3WC2A 3HO1A 3FCHA 5KFXA 4FN5A 2R8IA 3UD5A 2R8JA 3NNCA 1FRXA 1S6QA 2EVZA 5T7LB 2XHCA 3MUVP 1PAEX 1RACB 3K8VA 1JX4A 3AWRA 2QEXS 1ZA2B 5JXSA 2VFVA 3D28A 4OX7A 3R9LA 5GAGI 1S48A 1IBKJ 3MM5B 2XS5A 3BGLA 5GAGU 1J27A 3MCNA 1WJ9A 1WTBA 3DGPB 2LEPA 1XR5A 3KLVA 5DLGA 4HT7A 1WC4A 5A0YA 4WTOB 2YNGA 3NGKA 4KY3A 1WUUA 1H2TZ 1KFDA 1Q8LA 3FBEA 3WX4A 1U02A 1LWEB 4CYUB 3CJ0A 4ED1A 2J6TA 4JYAJ 4MT1A 3PR5B 2R8HA 2R7XA 4DR4J 2BE7D 5CYQA 1SC1B 3DOKA 3TJ8A 4DR5F 2VB6A 5LOQA 4NXNJ 1T9YA 1ZAXA 4GC7A 3ZNJ1 4RBVA 1PO6A 1XNQJ 4U7CA 3BBBA 1UMJA 3LAMA 3UVJA 3HFZB 4U8YA 4RR5A 3V81B 4L74A 1CJUA 2VOPA 4QYZJ 2VQFJ 4IO1A 4K2XA 1D9DA 1Q81T 3RBDA 4DUTA 1CS4B 5HQ8A 2GHPA 1NKEA 2CAJA 2BMBA 1N32F 2V1SA 1KHWA 4ECQA 5EWGA 1U4BA 1UL3A 3POTA 3WIVA 3WIUA 3OFFA 3NMRA 2KZMA 3R8YA 2IFXA 1FDNA 4NXMJ 2J0WA 2WSFC 4IH6A 3KLEA 1M0SA 5E3PA 2HVDA 2U1AA 1VRTB 2YQ0A 2M2BA 4X66J 1HBMA 3ZTOA 4DUYF 1XMQF 3GIJA 2E9RX 4MYTA 5K14B 2Z4PA 3CO9A 4ZA1A 4KBIA 3IM8A 4DV5F 3GPAA 4R0JA 3OR1A 2OJ3A 1YQHA 2JNJA 3OTEA 4TXSA 4ES2A 3CDBA 4PUOB 2WBRA 4JV2A 2VODA 1RTHA 2J9CA 4LF4F 4QCLA 5HROB 3I5BA 3I32A 2NPIA 3CCTA 1CJTB 1Q82T 2RDJA 4C4WA 2DH8A 2PSZA 2ZFHA 5D4NA 1KFSA 3J7AN 2XNRA 4ECRA 1AA1B 2YX4A 2CPIA 2YWKA 4O3PA 4JBCA 3MEKA 4UF4A 2G4BA 3ILOA 2UU9F 4TLQA 2MJUA 4X4VA 2KM8B 1FHTA 3FSYA 2L41A 1FEEA 2MZJA 4RPFA 3D4JA 2I6WA 5GADU 3R5AA 2JC0A 3UE2A 3FUYA 2F63A 1Y7PA 3CMAS 2QSFA 2FQQB 4M95A 3HM9A 3TAQA 1Q53A 3HSDA 1Y5IB 4H4MB 1M1HA 2M88A 4EEYA 4KAIA 1Q0NA 4LR8A 4UUWA 2B6AB 3BKTA 3EVOA 5HN0A 1NH7A 1K47A 1PSDA 2GAGC 9ATCB 5KFIA 3CD0A 4YQWA 1DTTA 2RNEA 4FS2A 2J76E 3PX6A 2KZZA 3OL9A 3HK2A 5DG8A 4DR2F 3MR2A 3HKZD 1AXQA 2ZHAA 3TANA 2HW3A 1K1QA 1M5SA 5IT9U 4NLSA 3DLLQ 1RT2B 1U7LA 1X7VA 1P9YA 2VBXA 3UCGA 1RT6A 3GZ7A 3AOCA 3OFHA 3DXSX 3MI7X 3UN5A 1WHXA 1D8YA 4DL4A 4USJC 4QJVA 1KOOA 1HL6A 4Y6IA 3KDNA 4ILRA 2BANB 5E0OA 4NLVA 2XZWA 4J90A 3GJQB 1HBOB 4PPZA 4Q43A 4PYAA 4LF7F 4JV5J 2QA4S 2AT1B 2P9GA 2RUGA 1Y3KA 2CQ2A 4USUA 5IM0A 1S1VB 4L72B 3JSMB 1M5KC 1J5OB 2ZC3A 3EZOA 4C3LA 4HTIA 3ET6A 2R7SA 4O23A 1NSPA 1Q8BA 3CF5Q 2CJQA 2UXCJ 5ETQA 2DHHA 4P9SA 4OI3A 1N0UA 3D6MB 4CLTA 1TK0A 1FVSA 1UVKA 4OYXA 4LF6F 2VOOA 4C8ZA 2QMWA 1FE0A 2GNKA 3MMCB 4JI4J 1EQMA 1KN6A 3GB0A 2X1GA 3DLEB 1HI8A 1UTAA 2BW7A 3P3DA 4RX6A 4RW9B 1KP6A 3CJ4A 4S0MA 3CMES 4YS2A 4GKJJ 4CZCA 2IM3A 2ZJRQ 5KOWA 3GJRB 4P6QA 1W2IA 2D41A 3BO3A 2IYGA 4ICLB 1FJ7A 2OPPB 4RNHA 4PPDA 3RTVA 1S72S 3CULA 1I3OB 5D0HA 2GVZA 5JVHQ 1N6QB 3CDAA 3AAWB 1UP1A 2J9DA 4HHJA 3KLHB 1JJ4A 3BPDA 3LPYA 2LFVA 4P71A 1HNVB 3PW7A 2KYXA 5DS7A 2GJIA 1ZS6A 1VGYA 3W62A 1HQ2A 5AXLA 1O0PA 4JI6F 3EICA 1DQAA 1P1TA 2XZTB 1UEKA 3M1VB 3HHNB 1YGYA 4QPXA 1WORA 1OY8A 2QG9B 3CGIA 3MM7A 4G1QA 4LRFA 1PYTA 1KEKA 2W9AA 1S0MA 5KFBA 1TR0A 2IVFB 2WK4A 1RTDB 2CQ4A 2VA3A 2HIYA 4LIWA 3MR5A 3P49B 1HNWJ 1LXNA 5CZVA 2MQNA 3RYLA 1HNIA 4OJHA 3MMBA 1MWQA 5DZ6A 2HPUA 3ZZTA 4C3KA 5GAEU 4USHA 2G1HA 2F1FA 2IJRA 4E8UA 4F3MA 2BM1A 5HL7Q 3KLFB 4U7UD 3HJFA 1YSJA 2GJ2A 3NNHA 2L9NA 1RU1A 4NLWA 1R8HA 4L6V3 4JI6J 2Z2YB 3BO2A 4LMZA 3V6DA 2ZH6A 2AJ1A 2W9CA 1RTJA 1NU4A 3DLKB 3GMGA 3QYYA 2EFVA 2QMXA 4BCAA 4M5GA 3LP2A 3SDEB 2CXEA 4CP5A 5C25A 4QIWD 2DHXA 4ER8A 1N32J 4HTJA 1SH2A 5F8GA 4DQRA 4ECSA 1QAYA 1VIOA 2JDJA 5K5MA 1RP5A 4WFYA 3K5NA 3RB4A 4JI7F 2LQ8A 1S0VA 2JEJA 1YVFA 3CIMA 2YTCA 3MPWA 4Y2AA 2YKNB 2F65A 2VZ9A 3N0VA 1XNQF 1JLCA 2CJ9A 1U0HA 2EBGA 3BREA 4RW4A 2KRRA 4DPWA 1LWCA 1YJ7A 5D78A 2ZOGA 3DM2B 3GV7B 1LXJA 2DXFA 3NNAA 4FVCA 3UO0A 1W7WA 3R3TA 3NL0A 2EG1A 5F8LA 3OUYA 4C8NA 3JB9k 1FXDA 3Q83A 3Q0AA 1Y5NB 1DLOB 2CFXA 3MTJA 1JWWA 3CPWR 3R6LB 3M32A 4LF2A 1B3TA 4ECTA 5DO2A 2FJWA 2PEHA 4RW8A 3R1HA 1R8AA 1VHIA 2YWGA 3W2WB 2W2QP 4ECWA 4TKTA 3FCVA 2M7SA 4BDPA 4YY3J 2OP5A 2IA0A 4N41A 2H54B 1T02A 2ALYB 3DGVA 2CJYB 2EKNA 4MKVA 2F8MA 1BUXA 1WC5A 2IBOA 1H98A 3Q2SC 4KGKA 4NYZA 2ALZA 4WTYA 5KT6A 1RTIA 2FTRA 3I9V9 5LMNJ 2FY1A 2DVIA 2OEJA 3IRXB 5FD1A 2RQCA 2H1YA 1X5TA 2DR5A 5BYQA 1RWMB 2CPXA 2JLEA 1RWVB 4G6VB 4R8UA 4B3TF 4X4UA 1LW0A 4NYOA 2C2KB 5G0RA 2MKKA 2AD9A 2J7KA 3QWPA 2LVWA 4LQ3A 1VQ6S 1I51B 3FDSA 2XHWA 3C8YA 4X4RA 1LW2A 3E01B 4Q2LA 1PYSB 4KFBB 2HMIB 2MKCA 3GTYX 4ALZA 5KFNA 4R5PA 2W7OA 2O01C 3A8EA 2O1PA 1XC9A 3CCZA 3OTBA 3QJPA 3UVJB 1X4HA 2HKEA 2CUYA 4NMXA 3V81A 3SV3A 2M8DB 1YTYA 2EFQA 3MM6A 4E98A 4ZS6A 2C3OA 3D1OA 4Q0BB 4YY3F 3D7SB 1FX2A 3IAS9 4WWSA 3TEHB 4UOHA 3TR5A 1IKXA 2LLZA 1TV6A 2UVVA 1X4GA 2MLXA 2GQ2A 3UR0A 1WF1A 1F9FA 2DO0A 2QLJB 3C16B 4KIAA 1DTQB 2VFSA 1QE1B 1S9GA 2DITA 5EGYA 1HWUA 5GAHI 4B9NA 2EC0A 3QT6A 4I67A 1VRTA 2G2OA 1FTCA 1ZBTA 2XWYA 4R0EA 4NXMF 1TUWA 2OHDA 2RIJA 2UXBF 1NDKA 3M8WA 4KSEB 4ECVA 2CRLA 3ENWA 4AE5A 3ZZ0A 5F3TA 1EKSA 4IG0A 1Q7YT 1T94A 4WK3A 4GKKF 2F9DA 2HBYB 3PX0A 2DHAA 2DR6A 2L9WA 2QLXA 3EDRB 3FFIB 5M2PA 1JLQB 4JI3J 4F4ZA 3PEHA 1N34F 4DPYA 1S99A 1YJVA 2MKJA 2MHEA 5L1LA 4FXDA 1SV5A 3NP5A 2RE1A 2W2PP 2OTJS 1M1KT 3R6GB 3VGVA 4QWAA 2X1FA 1AFIA 1U6BA 4F4YA 3D3CJ 3IBFB 4Y65A 4ZVEA 4WYLA 1OQ6A 1M90T 3EVMA 3VQTA 1EARA 2CZVC 2K06A 2XMWA 5A8RA 2QJ3A 1O6XA 4KB7A 3TNVA 4F4AA 3NBPB 1HBUB 1HMVB 3RAXA 1RT5B 3ILLA 3PJWA 2YPZA 3H4BA 2E29A 1JNZB 3P4UB 1S9EA 1HQEA 2QYGA 2VFTA 2PE8A 1TL1B
chains in the Genus database with same CATH topology
2P5VA 2NREA 4TU9A 3DNCA 1SUQB 3N6NA 1L3UA 4IR1A 1HWJA 1JLBA 3AHPA 2HHSA 4Q2MA 3LQVA 4CH1A 3MAHA 1AW0A 3I0SB 2CPHA 5B0AA 2I8EA 4DEZA 3MURP 3IWLA 3GV5B 4WU3A 2HWHA 3ZZOA 4NA1A 5JJBA 3EXYA 3U02A 3G71S 2FJDB 1UAWA 3DI6A 5B0FA 3US5A 2ROGA 2BANA 5C24A 4RNOA 4A8MP 2GQQA 3GYNA 1U2FA 4ZPDA 1HBOA 2KJVA 3FNNA 1SKSA 1RT3A 3BR9A 4Q44A 3HX9A 2UVWA 1D8ZA 4FF3A 1WACA 3BS9A 1J5OA 3F41A 2L9DA 2PGCA 2AGQA 4YB7A 3GILA 2Z8QA 2HWIA 2YNHB 3HHDA 3M8PA 1CG2A 4DV3F 2KYZA 2WOMB 3DLGB 1R27B 2VV5A 3N01A 4M8LA 5HBMA 3GE9A 3OVAA 2RVJA 3HI9A 4URGA 2MY7A 2AYEA 1VQNS 4PG6A 1TP7A 4ZPCA 1MU2A 2PC6A 3NRBA 2UUWA 4C11B 2FGCA 7FD1A 1VQ5S 1NNDA 5D77A 4CO1A 4K0KF 3CC4S 5BYRA 4OHXA 1FKPA 3KHGA 4AXIA 4LVOP 4LSLB 2R8KA 5I4MA 1KQSR 3MGJA 2XSJA 2LA6A 1MW7A 1NRKA 3DOLB 3JAMY 5J1EB 3VAIA 4YP3A 2GGPB 1PGZA 1F5CA 3IS9A 2B9WA 1RT7B 4PCQA 2VG7A 5DGBA 4JV0A 2LECA 3VAHA 1HFEL 4ERDA 2RDIA 2MZRA 2YKQA 1XERA 2KG0A 2MGZB 2R7UA 4TY9A 1I6JA 3MMJA 3ISNC 2NR0A 4V19X 4OL8A 2YVSA 3LGMA 2V9WA 1UWBA 3MTKA 5KFZA 3KK2B 2R2RA 2OFHX 2VG6B 3N9UC 3AQOA 4WYWA 3QIPA 4NZ0A 2ZH4A 2CZ4A 3R1LA 1IBLF 1S1XA 2JVOA 4YR0A 2Y0SD 1RQ0A 1FEHA 4AL7A 4N76A 3HHEA 1SH3A 1O8BA 1KC8T 1WG5A 3TI0A 2V8GA 4BBYA 1TL3A 3DM2A 3IR6B 2M5YA 3IWXA 1PO6A 3AH6A 2HFZA 3JTOA 3TQ1A 1K8AT 2WW8A 3MM8B 2YWFA 2CQHA 2B4OA 4U9RA 1TL4A 4ES3A 5EX0A 3D2WA 2YNGB 2ZM6F 3VALA 5D6GA 3VAMA 2WTFA 2K1RA 4Q5VA 3N28A 2XULA 1TKTB 2Z2LA 4IH5A 4NLYA 1XMOF 2DPJA 2HFNA 2ZH1A 3TA2A 2EFOA 3IA0A 2MZ1A 2LQJA 1IKVB 3QMQA 4FP9A 2UUBF 4IOBA 1HQUA 5CYMB 4OJ3A 3V4MA 1AFJA 5J2MA 2BYCA 3LP1B 1S1UB 4FF2A 4R25A 2IM2A 4YB1P 3C3LA 2MZTA 4WFBQ 1DHMA 4DFMA 1EP4A 1MWZA 3DYAB 3D1HA 5K8PA 2RU9A 3M8RA 3MWBA 1HBNA 2V8HA 4IFYB 4XDCA 3PY8A 1U09A 2LU2A 5IT0A 4IDKB 4ED8A 3RW6A 3ZZPA 2XMJA 2BUNA 1S97A 1KSPA 1XWLA 3FZBA 4CO5A 3L7PA 2E66A 4ED3A 2OPRB 3DLBA 2FLLA 4KPYA 1QTMA 3O44A 5I42A 4HEA9 1GAOA 4C8YA 2W24A