2IM1A

Crystal structure of poliovirus polymerase complexed with ctp and mn2+
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords poliovirus polymerase
publication title Stabilization of Poliovirus Polymerase by NTP Binding and Fingers-Thumb Interactions.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
total genus 135
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 2im1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2im1A02
1YVFA 4ZVHA 4WZQA 4KO0A 1R0AB 1N5YB 4NLPA 4IOBA 3FRZA 1JKHB 3JSMB 4I7FA 3DM2B 4RW8B 4RW9A 4TN2A 1RTJA 3KK2B 2BQUA 3M9MB 4PWDA 1HQEA 3CIZA 2YNFA 1HNVB 2WB4A 2RF2B 3I0RA 3V81A 3RBDA 3DOKA 1DTQB 2VG7B 3LP2A 5KFDA 3E01A 5HLFA 1KHWA 4ZP7A 2RKIA 5J2QB 2OPQB 3MTKA 1JLAB 5F8HA 5F8MA 3DOLA 2W9CA 3LP1B 1BQNB 3M8QB 1HQUA 3DYAA 2VA2A 2V4QA 3N6LA 1JLEB 1C1CB 1S6QB 5KG0A 5KT4A 3HVTA 2ASDA 1QE1B 3BJYA 2OPPB 4URGA 3BSOA 4ZP8A 2GIRA 1J5OA 3RBEA 1IKVB 1LWEB 3TAMA 3IGNA 3NKYA 4NLVA 1JLFA 1WNEA 2R2RA 4G3IA 5KFTA 3MEGA 3NBPB 4KHRA 3DRSA 1S9EB 4IH5A 5KFYA 1QAJA 3BQ2A 5F8LA 4EO8A 3KLIB 2R8HA 1VRUB 1HARA 4NLSA 3UR0A 5J2MB 5KFJA 4YR3A 2UVWA 4RNHA 2HNYB 2QE5A 5KFHA 2IA6A 4RW7A 1DTTA 1TVRB 5KFOA 5KFAA 2YKMB 2FLLA 4TXSA 5J2PA 1KLMA 4MKBA 4GC7A 1BQMB 4O4GB 1RTIA 1S1VB 4MFBB 1HYSA 1S0MA 5KFSA 5FDLA 5J1EA 1RT7B 4MIBA 1C0TA 5I3UB 2BQRA 3QLHA 3T1AA 2XCAA 4KAIA 3V6KA 2IBKA 2FLPA 2IAJA 3DRRB 2YNGA 1RT5A 3IG1B 2VG6B 5KT2A 4JV1A 2AWZA 5DQIA 5JXSA 3BSCA 5K14B 4K4VA 1IKYB 4MK8A 2C2RA 3CJ3A 4O3NA 3PW7A 1JLQA 4KO0B 4ID5B 5C25A 2IC3B 2FVQA 1S49A 2BANA 2DPIA 2YNHA 1Z4UA 4ZVGA 5KG5A 2W7OA 4J9RA 4IG3B 4RW9B 1GX5A 4RNOA 3V6DB 1NHVA 3RB0A 4DEZA 4ECWA 1RT1B 1N6QB 2YNFB 2BQ3A 1HMVA 3I0RB 3H4DA 4Y2CA 3DOKB 5KG4A 1IKXB 3LP2B 3SFGA 1K1SA 3E01B 5HP1B 3BSAA 2OPSA 5KFCA 1SH0A 2C22A 3OL7A 3EPIA 2W9CB 2ILYA 4ED0A 3D5MA 3KLGB 2XGPA 1R0AA 1T3NA 1JKHA 4KHMA 3RB6A 2HAIA 3SFUA 4J9PA 4HKQA 3KK2A 2WONB 1RA6A 2XI2A 3GIJA 2W9BB 3KLHB 4K4TA 4ECXA 2BE2B 1HNVA 3DRPA 4ECUA 4Y34A 4TYBA 3GQCA 1DTQA 4X2BA 1NHUA 3MEGB 4NLQA 5DG9A 3Q8RB 2AQ4A 5J2QA 2OPQA 2E9TA 3C6TB 2HWIA 5KFBA 2V0NA 2QV6A 3V6HA 3LP1A 1BQNA 1JLBB 3BR9A 4TYAA 5EDWA 1JLEA 5EWGA 1DTTB 3G86A 3KMQA 1LWCB 1QE1A 5F8NA 3LAKA 2D3ZA 1RYSA 1LW2A 1SH3A 3BSNA 1RTIB 1LWEA 1IKVA 3DMJB 2FVCA 4RNNA 1S0OA 1HYSB 4RZRA 4MKAA 5KT6A 3Q8SB 3KLVA 5FDLB 4NZ0A 3NBPA 1ZTTA 2C28A 3QLHB 4DL7A 1S9EA 2GC8A 4K4WA 1TQLA 1S4FA 3FQLA 4O3OA 2YNGB 4WYWA 3KLIA 1KHVA 1VRUA 1OS5A 3CJ0A 3T5KA 3ITHA 4ECZA 2R8GA 4U6PA 3EZUA 1S1XA 5C5JA 1TVRA 3KJVB 2YKMA 2FJVA 4IH6A 4O4RA 2HNDB 4O4GA 2ZD1B 1S1VA 5C25B 4MFBA 3OL8A 1C2PA 2YNHB 1REVB 3BREA 2GIQA 3E51A 4IG0B 4NLDA 4XO0A 3GV5B 1RT7A 5I3UA 2HMIB 3OHBA 4NLGA 4QWEA 3DRRA 4OL8A 1K1QA 3IG1A 5DGAA 2IMWP 3QGHA 2VG6A 2AGOA 3M8PB 3MR2A 3H5UA 4PUOB 5K14A 1IKWB 1IKYA 2I1RA 4TY8B 3SI8A 5DLGA 4NLXA 5KFXA 4ID5A 4IDKB 3KMSA 2IC3A 4EBEA 3KHGA 2FVPA 1FKPB 4IG3A 3IGVA 3V6DA 3PW2A 3RB3A 5EWFA 2B6AA 1RT1A 5J2NB 3FDSA 1N6QA 4RW6B 3DRPB 1RTDA 5KG1A 4O3QA 2F8EX 1IKXA 2B5JB 4WYLA 5HP1A 3QGIA 1JLGB 3NMAA 4K4ZA 4KBIA 3DI6B 3KLGA 2R2SA 5KFUA 3GIKA 2V4RA 1RT6A 5DLFA 4ED8A 4G1QA 4NLYA 4TLRA 4ZPCA 3DLKA 3GIIA 2BR0A 2WONA 4FS2A 1FKOA 1LW2B 3HVAA 3KLHA 2W9BA 2IM1A 2IM2A 2BE2A 3MEEB 3V6JA 3PJXA 2ASJA 3QO9A 2W9AA 3I0SB 1N56A 2AGQA 3KLEB 4URSA 4ZPDA 1VRTA 3M9OB 3CWJA 1N4LA 3C6TA 3IS9A 1XR7A 1LWFB 4ZVFA 5KFGA 5KFFA 4ECTA 4NLWA 3OHAA 1JIHA 5KG3A 5DGBA 1JLBA 3ITHB 4O3PA 1XR6A 2E9ZA 4PQUB 1S1XB 4DL5A 3H4BA 4O44B 4M94A 1LWCA 4ZPAA 3PW5A 4IFVB 2YNIA 2IM0A 4ED2A 3DMJA 4ZP6A 2XGQA 3UPFA 3TVKA 5F9NA 3NAHA 4NLTA 4WE1A 1EETB 1TKZB 3ISNC 5L1IA 4TY9A 4QW9A 1ZETA 1S1WA 4U7CA 3UQSA 1W25A 2UVVA 3PZPA 2EC0A 4FS1A 3HHKA 4QPXA 3RB4A 5D3GA 4EYIB 3MR5A 3GYNA 1S10A 4LQ3A 3KJVA 2R8IA 3NGDA 3FFIA 2R2TA 5T14A 1C1BB 4IRKA 2HNDA 2JLEA 4K4SA 2ZD1A 2BRLA 4KE5A 4URQU 1REVA 4FBUA 4IG0A 2HNZA 3GIMA 4IR1A 2HMIA 2AX1A 4O3SA 2FLNA 2JEJA 2C2EA 2B6AB 3KLFB 1HPZB 2JEGA 1RTDB 3DDKA 1U09A 4KKOB 3M8PA 5KG2A 5KFEA 3D28A 3LAMA 1SH2A 1IKWA 4TY8A 3T19A 2ZKUA 3QYYA 3KK1B 1EP4A 3MEDB 3EPGA 4ED3A 4Y3CA 2D41A 1N48A 5F8IA 4IDKA 4K4YA 2J6TA 3KOAA 1RT6B 3CJ2A 5DQGA 4G1QB 1FKPA 4NCGB 4NLRA 3C6UB 3DLKB 3OL6A 1S9FA 2FVSA 4J9OA 3LALA 1FKOB 4XPCA 5J2NA 1D0EA 4RW6A 4QWDA 2HWHA 4H54A 3QO9B 1XR5A 2B5JA 2W7PA 1VRTB 2XCPA 1IM4A 3OL9A 3GILA 1JLGA 1TL1B 2XWYA 3IS9B 3G6XA 1ZTWA 1QAIA 3PR5B 3DI6A 2AX0A 5CYMA 3T5HA 2WRMA 3HKWA 1FK9B 3H40A 3CDUA 3DLEB 1S97A 4TQRA 2YNIB 2WTFA 2JEFA 3MEEA 1RT4A 1TP7A 4MIAA 5L1JA 5KT5A 3I0SA 4WE1B 3KLEA 5KFIA 3V4IB 3IN5A 1RA7A 1S1WB 1I6JA 1LWFA 4NRTA 2I5JB 3MR3A 3IRXB 1JLCB 5D3GB 4PQUA 3QIPB 4ECYA 4O44A 3NL0A 1RTHA 5L9XA 5DG8A 2AGPA 2JC1A 4IFVA 2IJNA 3FFIB 4Q8EA 4H4OB 1TKXB 2DPJA 4ZMMA 4J9LA 5F8JA 5I42B 5KFWA 2HNZB 2ASLA 2UVRA 3MFIA 1EETA 1TKZA 4ED1A 4Q0BB 3BGRB 2RDJA 4K4XA 3MECB 2ALZA 4LSLB 4YQWA 4ICLB 4J9NA 3H2LA 4DG1B 3UDLA 3JYTB 1RYRA 4F4YA 3GV7B 4F4XA 5C24A 3OLAA 1DLOA 1UWBB 1TV6A 4ECVA 1EP4B 2D3UA 1C1BA 2CKWA 2ILZA 2YKNB 3I5CA 3ISND 1CSJA 2RDIA 4QW8A 3VQSA 3KHLA 4YR2A 3PW0A 3G6VA 4ECRA 5CYQA 3KLFA 1HPZA 4IH7A 4Q44A 3PR4A 4KKOA 4F4WA 4EO6A 1MMLA 3KK3B 4FBTA 3KK1A 1S1TB 3MEDA 4H4MB 4WXWA 2AU0A 4Q8FA 4ECSA 3LP0B 1TL3B 4JV2A 3T5JA 4F4ZA 1T05A 3CVKA 4NCGA 3C6UA 4IQXA 1RAJA 3KHHA 2JC0A 2R8KA 1RT4B 4R8UB 3QIDA 2J6SA 1RDRA 3RAQA 4NLUA 3HVWA 2WCXA 3MR6A 1D1UA 4R0EA 5L1LA 3I5BA 2VG5B 1TL1A 5KG6A 3MFHA 4LSNB 2W8LA 3TQ1A 4KV8A 3CDWA 3H5YA 5DG7A 3CDEA 1FK9A 5C42B 4RW4B 1RTHB 3DLEA 4ZP9A 3H5SA 1T94A 1RT2B 4I2PB 2FVRA 3NAIA 1C0UB 3H5XA 5DQHA 3QZ7A 4B3OB 5KG7A 1T03B 3G6YA 1JX4A 4IR9A 3V4IA 1MU2A 5KFPA 2R2UA 3Q8QB 4YMEA 4GC6A 4O3RA 1QUVA 2W8KA 2B43A 2I5JA 2OPRA 4JUZA 3IRXA 3N6MA 1JLCA 3H59A 3GV8B 5C24B 3QIPA 3DLGB 4ZHRB 1DLOB 1TV6B 4J9KA 4JV0A 2WOMB 4KFBB 4RNFA 4H4OA 1TKXA 5HROB 1S9GB 4MK7A 5I42A 4R5PB 4Q0BA 3CJ4A 3BGRA 4EYHB 4WFYA 5CYQB 3PW4A 4DL2A 4ZPBA 3CO9A 4DL3A 1SV5A 3MECA 2ZE2B 2XC9A 4WFZA 1SUQB 1TKTA 4I2QB 4ICLA 4LSLA 4QWBA 1S0NA 4DG1A 3JYTA 5KFNA 4RNMA 1RT3B 3KNAA 5F8GA 1UWBA 1HNIB 4EBDA 4EEYA 3PJWA 4IFYB 4NLOA 2UUTA 5KFKA 4QWCA 5CYMB 4XPEA 1S1UA 2YKNA 4IRDA 4RU9A 1T05B 4RUAA 3QZ8A 4PUOA 3I5AA 1S6PA 4I7FB 4KB7A 1GX6A 4IKAA 5JUMA 2IM3A 4HYKA 2JEIA 5HBMA 3ICLA 1RTJB 4PWDB 4K50A 1HQEB 2E9RX 1S48A 3KK3A 2VA3A 1S1TA 3V81B 2OH2A 4H4MA 4K4UA 3LP0A 1LW0A 4KV8B 5HLFB 1TL3A 2RKIB 1JXLA 2WHOA 3DOLB 2V9WA 4YR0A 4RUCA 3QGGA 2ATLA 4WFXA 2UUWA 1HQUB 1N5YA 3DYAB 3JSMA 2FJXA 3DM2A 4RW8A 4R8UA 5F9LA 3HVTB 4YP3A 1NNDA 2C2DA 4MH8A 3FQKA 2CJQA 4ZVEA 2WK4A 3OSPA 1J5OB 1MU2B 3FSIA 3TAMB 4IRCA 2RF2A 2VG5A 3MF5A 2O5DA 1JLFB 4Y2AA 2VG7A 4LSNA 4WXOA 2OPRB 5KFLA 4TQSA 5KFZA 3DRSB 5EWEA 2J6UA 1JLAA 5C42A 4RW4A 4NRUA 3H98A 4ED7A 4M95A 3M8QA 4ECQA 3LANA 4KSEB 1RT2A 3T5LA 5KFMA 2UVUA 4I2PA 1S6QA 1C1CA 4RW7B 1C0UA 4B3OA 2OPPA 3Q8PB 2D7SA 1T03A 2BRKA 5J2PB 1KLMB 3PHEA 5KT3A 2R8JA 4DL6A 1SV5B 5J1EB 1TKTB 1C0TB 3OLBA 4MK9A 3RAXA 2IAJB 3BQ1A 1RT5B 3DLGA 2IJFA 4LQ9A 4ZHRA 3OSNA 5J2MA 3KHRA 4J9SA 2HNYA 2WOMA 4KFBA 4EBCA 5HROA 3PVXA 1S1UB 4J9QA 1S9GA 5L1KA 4Q45A 4DL4A 4NYZA 3CJ5A 4R5PA 1JLQB 1BQMA 2XI3A 2BANB 4ED6A 1S6PB 4WZMA 4Q43A 3M9NB 5KFQA 2FJWA 2ZE2A 1SUQA 5HBMB 5KT7A 4I2QA 4QWAA 4F50A 5KFVA 1RT3A 5KFRA 1HMVB 4J9MA 3N6NA 1HNIA 4IFYA 5EUHA 3BQ0A 1LW0B 2OPSB
chains in the Genus database with same CATH superfamily
4DUYF 3PG9A 1C4AA 4OYPA 1SC1B 2ZEJA 2JZ5A 2VHGA 4X62J 1Y00A 1HBUA 2RKIA 2RDDA 2A3JA 3FEYB 3DOMB 1JLEB 2GFFA 2HURA 1WNEA 4IH5A 1O51A 1VI7A 2QE5A 2V6AA 5IT9Y 2C2NA 3OXFA 1MN7A 5I3UB 2IBKA 3QLHA 3PEJA 1RT5A 1WF2A 4JV1A 4EI2A 4W92B 1Q7LB 1VFJA 5RUBA 2WB1D 1KRPA 2W7OA 1NHVA 4ZVSB 1N6QB 4BC9A 1HMVA 3I0RB 4Y2CA 4JYAF 2W9CB 2DIUA 1T3NA 4HKQA 4TYBA 3SCLE 3GQCA 3QWUA 4C8YA 1X9MA 4CRJA 1ZZNA 4C0OC 2BVZA 3GCWP 5FDLB 4I6YA 1VBZA 3C66A 4PG4A 1G1XA 1AA1B 3ZZRA 4FYVB 1RBAA 2O1PA 1C2PA 1REVB 3S7RA 1S76D 4M63A 5CZXA 1YKWA 1NH7A 2UU9J 2QG9B 3WX4A 2R3VA 3KHGA 1HBMB 2F4FA 3ZZ0A 3WZ0A 4B02A 3GPAA 2XG8A 3JSRA 1RP5A 4HI2A 4KBIA 5BYQA 3I32A 3C3LA 5DLFA 1LK5A 4DCPB 4DU8A 4LIRA 2L9NA 1LW2B 3EZ5A 3I0SB 3IAS9 1VRTA 5LJ5Y 2HIQA 3THTA 2OEKA 4TY9A 4ZLJA 1QVFR 1SPBP 5E3QA 3J80Y 4A8YA 2F63A 3ZZTA 1UEVA 3LGMA 3MPYA 1GNKA 3RTVA 2B6AB 3PJ9A 4WJBA 1S79A 3P6YC 4KH0B 3KK1B 2OO4A 5B0AA 3IR6B 2MKSA 6FD1A 1FKOB 4XPCA 2X3DA 2FYXA 3BKUA 1S6OA 3G6XA 3U02A 3W7BA 3CJ8A 2OHDA 2W2OP 3TEHB 1S97A 3F44A 3TZXA 2JX2A 1W2BR 1I6JA 4NRTA 5EX0A 4ZITA 1XERA 1SIZA 3EUNA 5F8JA 2HNZB 5D8HB 4UOGA 2HHQA 1BGXT 2IJRA 3GV7B 5A8WA 2VFUA 4N8NA 2RDIA 3AD7C 1N34J 2KVIA 2MQPA 2XZTB 4KKOA 1S1TB 3MEDA 1RWNB 3MMBA 3W9HA 3KHHA 3PXGa 4DZ6A 3NNAA 2R8KA 1Y5IB 3I5BA 3AB4B 1BY9A 4I69A 4DS4A 2XBPA 4RW4B 3IR7B 4C3KA 3QSIA 1NKCA 3UW1A 2EC2A 4O3RA 3N6MA 2KTQA 4JV0A 1HWJA 4RNFA 8AT1B 2LA6A 1TKXA 1XEZA 4AE5A 2Z8QA 5A8RB 3MD1A 1FKAF 3BBCA 3HSDA 3VGSA 2VICA 4ZIWA 1SV5A 4JI5J 2VJUA 3HJVA 4CNZA 1TAUA 1F5CA 4J90A 4EBDA 3DRYA 2YKNA 5HVHA 1WEXA 3D0GE 1PAUB 3KUEA 2JEIA 1EQMA 1LFWA 1YJWS 1FRMA 3IBWA 4JI4F 2RIJA 9ATCB 2DO0A 1SXLA 1SKWA 4NI2B 3FMWA 4B3MJ 1S5ZA 1LEOA 2FJEB 3BBBA 3K89A 1NM2A 4UZCA 1QAXA 1PJ6A 4NPOA 1JLFB 1FEHA 2QA4G 4WK3A 2BJ1A 1U26A 2B4OA 5H9FK 2Y3YA 1GK8A 1S6QA 3TZYA 4HH1A 4O23A 3FZ2A 3NP5A 1IBCB 3THPA 4ZLNA 4HT7A 4LVOP 2RHSB 4U67Q 4FDFA 4J9SA 2A2CA 5HROA 2ZBQA 4E0DA 2DGSA 4C0BA 2AJQA 4LMZA 1HA1A 1VLYA 2H51B 4NXMF 3E2EA 3M9MB 3BF4A 4WZQA 1R0AB 5D0RA 2DR7A 4TN2A 4UOHA 2DR5A 3OQ2A 4DF4A 3D2WA 4ETXA 3CJQA 1JLAB 2W7AA 1WSVA 4F2RA 1Q5YA 4DSEA 2UUCJ 2OPPB 3OPKA 3BSOA 2DT9A 2E7WA 1FT8A 2DGWA 1PAEX 4MYUA 1KN6A 1QUPA 4DFMA 3RJMB 2F3JA 2J7WA 1VGYA 2XLKA 4UY85 4NEYA 4RW7A 2PT0A 4ZCIA 3GSIA 4YDDB 1U1QA 1J5EF 2GGPB 1UEKA 3D68A 4LR7A 1VC5A 3AODA 2HVHA 1K44A 1IBLF 3A3NB 2CPDA 2JHEA 3VGVA 4DEZA 2QEXS 2ZH9A 1IKXB 2XGPA 3NNHA 2HAIA 3KK2A 4OQJA 3HZEA 5IM0B 2ACYA 3WIVA 2C2OB 1YJTA 4X2BA 3MM7B 7FD1A 1R0CB 4LFCF 2YQ3A 3UE2A 2GQCA 4RBVA 2GA7A 5E7OB 1DTTB 2BMBA 3BBFA 2N4DA 2KFNA 1HYSB 5LMNF 3ZO7A 1U25A 3CCLS 3D54A 2X1FA 2M5YA 2V8PA 4M5HA 3UVJB 1X4HA 4MFBA 1RT7A 2HBYB 5E2QA 1FA0A 2KZZA 3MR2A 4LRAA 4CO2A 4ID5A 3KMSA 3CJTA 4CLFA 4ES3A 1HWUA 3ELHA 4RW6B 5KG1A 4M5IA 5D6GA 4G1QA 1SJRA 4TLRA 3GIIA 2XEXA 4NYOA 2ASJA 2W9AA 1VISA 1N56A 2G2OA 1TL5A 1RXOB 2Z58B 1UA1A 2QSWA 1RQ0A 1CJVA 5GAGI 3VAMA 4DV4J 1RKJA 5HQMA 4WE1A 2MLYA 3MM9B 3C15B 1SQFA 2DIVA 2LECA 2EPIA 4MAKA 3NGDA 4K4SA 4ETZA 4F02A 2BKOA 3D7SB 3UNGC 2YXLA 4FPIA 1HPZB 4YHHF 2PC6A 3M6VA 1MMDA 3NG8A 2MJUA 4CH1A 1HNZF 4ZK7M 4NLRA 3PCOB 4DV6F 4QWDA 2KM8C 1IM4A 4QIWD 4K2XA 4LF8F 2K8GA 2EG1A 4XDDA 4TQRA 4MT1A 4F3QA 4WF9Q 4E98A 2E7VA 3NL0A 3M6XA 2IJNA 3FFIB 2Z2ZA 3GWCA 1WDDA 5KFWA 2ZVSA 4DBQA 3FNNA 4PWWA 4DV1F 1I51B 4ITSA 1XC9A 1C1BA 2CKWA 2G9OA 4X4VA 1TL7A 3GU0A 3QNWB 2AT1B 1ACMB 2HZVA 4IH7A 2IA0A 3LH2S 4XK8C 5D0HA 1U1LA 4ZCKA 5FJ4A 2WAQD 1FJGJ 3CVKA 3R6GB 4IQXA 5HMXA 3HXMA 1NRKA 4NLUA 3HVWA 4AXIA 2W8LA 3PM9A 4Z37A 4KV8A 3LA0A 3L3CA 1N32J 4WP8A 3MPVA 2CQGA 2G0CA 5HATA 2ZWOA 1U1RA 5BXIA 5C24B 2OFHX 3I4PA 3M2RA 3LGHA 4MK7A 1GXTA 4OJGA 3AX2A 2DNKA 5KFNA 2AYMA 5B08A 3OT9A 2JL9A 1FE4A 4OI4A 4LF1A 4X4OA 4P74A 1RHKB 4DOZA 4ED5A 2D69A 1RTJB 1FCAA 1N33J 2MKIA 4HHUA 1S48A 1WKKA 1BHNA 4K4UA 1B0TA 2D68A 3M32A 3VF0B 3W64A 4PKDB 3JXOA 2M3DA 2FHJD 4JP8A 1FFWB 4WXOA 1RBOB 3I87A 5B0BA 4DN9A 2GO8A 4KSEB 3T5LA 1MG7A 2XHWA 4DSLA 4X4PA 2BKPA 3BQ1A 3EJMA 3HZGA 5D77A 2O01C 4DL4A 4DPTA 1S6PB 2YWKA 1CVJA 4BLGA 2F8MA 3LPYA 5KFRA 3VAFA 2J0QD 5CCLA 5CYMA 1KFSA 1RAHB 4NLPA 5K9FA 2WVEA 3BYPA 2LQJA 2UXCJ 2OPQB 5F8HA 2MQLA 3R5GA 1HQUA 2E5LF 2FPHX 2GIRA 1EZZB 1LWEB 2P9EA 1RU1A 1H2TZ 2OUGA 1QAJA 2BJEA 1E6VB 3S6EA 2R8HA 2MKKA 4RPFA 1XNRF 3MMAB 2XSJA 5KFOA 4DS5A 4C11B 4MIBA 3PEHA 3R5CA 2FLPA 1YQHA 4PXCA 4X65F 2BOPA 3TANA 4LF5F 2FVQA 5K8MA 1CQMA 4ZVGA 4CH7A 2HW3A 3BGFA 2R7SA 4DSKA 4HTJA 5E3AA 3Q8VA 4OZ0A 5KFCA 5MLCV 2HFZA 3PO4A 4LF6J 4EU0A 4J7CA 4DZDA 1NK5A 2BUNA 1HNVA 3CCZA 2RS8A 5J2QA 4C3MA 4USUA 3G86A 1LWCB 5BJRA 3SDEA 1U1PA 2MQOA 2RRAA 3BSNA 1RTIB 2FVCA 4RUHA 1YJVA 1T95A 3MM5B 2YVSA 4DPUA 1TQLA 1VBXA 2BACA 3IR5B 3ITHA 2CDRB 2DRDA 1YBAA 4IH6A 4B3TF 4OZ5A 4QWEA 3DRRA 2MJNA 2HIYA 1K1QA 1NLKL 2GS8A 1FE0A 4W98A 1WACA 3CDBA 2Z2YB 1DFDA 2E1AA 1FTCA 3DRPB 3HKZD 3W9IA 2AP6A 1PCAA 2XZ2A 3KLGA 2RNEA 2HHWA 4GO5X 3BS9A 3C46A 3PYEA 2AGQA 3CWJA 1XR7A 5KOWA 2UUBJ 1Y11A 1FVSA 3D6TB 4PQUB 2HQDA 2CADA 4NLTA 1EETB 1XMQF 4M5LA 5G0RA 4Y0FA 5L1IA 1X5OA 3MURP 4JI0J 1UP1A 3PY8A 2VOOA 2R2TA 4DUZJ 2B9YA 2DGVA 1VMBA 4OJ3A 2OELA 2FJBB 2C42A 2F9JA 3OVSA 2XLIA 3HSZA 5KFEA 3AT1B 3PNIA 1SH2A 1IKWA 4X66F 3PX4A 1NK8A 2J6TA 3O3LA 1I1GA 1KTVA 3GILA 2HBRB 2HHVA 1JLGA 2AX0A 3HKWA 4R25A 3JAMU 1F9FA 4ER8A 2JEFA 1QM9A 5H9FJ 1KD1T 2XS5A 3S8SA 2UV8A 2VQFF 1F2GA 1KDNA 4DXLA 2N82B 2JSXA 3I31A 3W2WA 3KJQB 5DJBA 4DV7J 2XNQA 5DDPC 3I6PA 2I9SA 3TUZC 4B9SA 2ILZA 3EZOA 3VQSA 2DCLA 2QJ3A 2KYXA 4ZN1A 4Q2MA 2LXIA 4DN0A 2DRAA 1VLOA 3LP0B 5A0YA 4HVZA 4P75A 4ZCLA 1V3RA 2JC0A 1MROB 4X64F 2HEKA 5JVHQ 3K2YA 2AD9A 4K5SA 4LSNB 3TQ1A 5DDOC 3FBEA 3M1VA 2W4PA 3LW5C 3K17A 1HR0J 1A9NB 1LFPA 5M2PA 4GKKF 1U1OA 1RWKB 4JI3J 1FHTA 5L46A 5LSLA 3MECA 1SUQB 3KUGA 1UWBA 5KFKA 3NGRA 1JXEA 1S1UA 4NWBA 3ET6A 2HHTA 4FF2A 1VHIA 1UVIA 2EFOA 2FY1A 1FXRA 3QT5A 3EX7B 2FGCA 4ZKAA 2ROPA 2NXJA 2EBGA 3TAMB 1RHJB 3HFKA 2DNHA 1RWOB 2MQ8A 4JI6J 3DRSB 4NRUA 1C1CA 2YQ1A 1DJ0A 4DPXA 4LRBA 5J1EB 3HHLB 3VAKA 5J2MA 1S9GA 1BQMA 4LJMA 2ABYA 2GAGC 4OZJA 1FJ7A 4BWJA 4HDHA 2CRLA 2F1FA 1KS2A 4ZIVA 4ZVHA 1RWXB 1KOOA 1GMUA 3NCPA 2C2MB 3E01A 2GV1A 4ED4A 2DR9A 3CJKB 1BQNB 1N5QA 3HSJA 3GB0A 3SCIE 4NLVA 4C4WA 4TU7A 2QYCA 2YWFA 4MMOA 5KFHA 3MUTP 2P6TA 3KDNA 1C0TA 4DR6J 4JB8B 5A6PA 2LQBA 1SIWB 4KO0B 1FDDA 2IRUA 2BANA 3BPDA 4J9RA 3NLCA 4HEA9 4X62F 1N88A 3RBXA 2C3YA 3GMGA 3OTEA 2HHSA 5HP1B 1SH0A 3ZFVA 2V4JB 4KH1B 2C3PA 1RA6A 3K8VA 3O6QA 1T02A 3MEGB 4RX6A 3IWXA 2MZSA 3DOMA 1JLBB 4DR1F 1JLEA 3KTQA 5GAGU 2DNOA 2ZNZA 2BXJA 3ETMA 2C28A 3FQLA 4K4WA 4USWA 2YNGB 2MKYA 3R9LA 2Q6BA 1YK9A 2B56A 4O0NA 3KUHA 4NLDA 4IG0B 3F56A 5I3UA 4KTQA 4OI2A 2IMWP 4QCLA 3DGPB 3PRDA 3M7VA 4DX7A 4KJIA 3L9ZA 1N6QA 1F0XA 4HTIA 3A4TA 3C14B 3B4MA 2CJBA 2QMUB 1RT6A 2BR0A 4F7VA 2QLFB 3MEEB 3V6JA 4Q7AA 1APSA 1HWKA 2KVQE 4C7QA 1WKLA 3HT3A 5KFGA 1YBUA 1M5OC 5CYJA 4NLWA 2PFDA 5KG3A 2A2DA 4FP9A 4YB6A 4GRSA 3M30B 2IM0A 5F9NA 4U96A 1S1WA 1M5KC 3TAPA 1U0SA 1WHVA 2R7QA 3HCXA 1UMJA 1TAQA 4MKVA 1OQ3A 4KGXB 2DJWA 1A0OB 1REVA 5EHHA 2AX1A 3MCMA 4FKXA 1RTDB 4N77A 2QFJA 1NSAA 4F04B 2HHHJ 5LL6d 3GSDA 1N0VC 2RQ4A 3LAMA 3R5AA 1EP4A 1VYAA 4B9TA 2IDEA 1F5AA 6AT1B 2B7CB 1HBMA 3QJJA 2FVSA 3TP2A 2G2ZA 4J9OA 2H3EB 4YB7A 3CMES 1XR5A 3CCWA 2W7PA 2M88A 1FRXA 1TKDA 3T5HA 4GVBB 2XQCA 1CS4B 1S6UA 2FHMA 3GJTB 3I0SA 4B3SJ 5KTQA 3Q0AA 1KVIA 4N8OA 2ZH8A 1JJHA 4W4MA 3M2UB 5DG8A 4DV2F 3B82A 1UCNA 4KIAA 2NXNA 1IJEB 3PTWA 1NK6A 5F3ZA 3JAMY 2HGLA 4ECVA 4FF1A 1Y5LB 5CD4A 2QO3A 3FKBA 5DM7Q 4QYZK 3KG4A 4EO6A 3EGVA 5D78A 3KK1A 4PG5A 3US5A 2IVFB 4WXWA 5K20B 5GMDA 1H98A 1S57A 2K3IA 3QIDA 2E5GA 2MLXA 4YOEA 1FX2A 2BM1A 4JYAJ 2Y8YA 2Y9HA 2R2UA 1K8AT 3W60A 1M1HA 2RT3A 1Q7YT 2NLWA 2VPWB 1ZM2A 1WTBA 4FYDA 1N34F 1VQYA 3RRKA 2XC9A 2OMOA 5HK4A 1RT3B 3U1MA 3OVAA 2MGZB 1B99A 1HBNB 3CEDA 4UQTA 4I4BA 3ICLA 2KI2A 3QAUA 2VA3A 1S1TA 1ROFA 4DLGA 1Y10A 4RUCA 1RJJA 2V8GA 4D3HA 1DQAA 4OLPA 4U7UD 4YP3A 2BJ8A 1N0UA 1YWXA 1RUSA 2J9DA 4I68A 1X4GA 4RW4A 1Q82T 2FZGB 5D15A 3THVA 1R89A 2D7SA 2BRKA 1DHMA 1MNEA 1AFJA 1TKTB 2GVDB 1HHSA 3GR1A 2NPFA 3OD2A 5A8RA 3KG1A 1RI7A 2W4CA 2R9LA 4USTA 2ZH6A 5ETVA 3N6NA 3HJFA 1F1BB 1JKHB 4RW8B 4J9VA 5HSPA 2YNFA 2RSQA 4C98A 3DOKA 2VG7B 5KFDA 4Z7CA 3IC1A 3Q2TC 2KYZA 4G3IA 1JLFA 4I56A 2ZDPA 3PKMA 1FJEB 5SUHA 3I9ZA 3J81U 2K3KA 1L3VA 2IVYA 3NOGA 4K7QA 4LFAJ 2FLLA 2WZ1A 1VQLS 1K0TA 2XCAA 4CO3A 2H9ZA 3W5ZA 5AXKA 1T9UA 5LXYA 3FCWA 2BX6A 1OYEA 4N41A 2FQQB 4O3NA 4NMXA 1GX5A 3MAAB 4NCBA 1TMJA 1ZM3A 1IBKF 2GMLA 4RBUA 2DHXA 4KRWA 2R7RA 1R0AA 1W7WA 2XLJA 1SL0A 1Q79A 5IWAF 2K7JA 3GIJA 3CC7S 2ZJQQ 4EK2A 2AQ4A 4YS2A 2HWIA 2VODA 2Q43A 2QV6A 4AYBD 1O6XA 4GKJJ 3SV4A 3ZC4A 2OEMA 3R2CJ 2GC8A 1RTZA 4CZCA 5ITHA 4P52A 2R8GA 2FJVA 4YUDA 2GGPA 2UXBF 2BE9B 4DQRA 3JQKA 3K58A 2AEMA 4JI7J 1TZ0A 1ZA2B 2F8EX 2W2PP 1IKXA 3LTOA 3NCQA 2DHAA 3EMTA 2V4RA 5H9EK 5D4OA 2NZCA 2PSZA 2BW7A 3OTCA 2DNPA 3MM7A 5U47A 3M9OB 4D3GA 4X4TA 4JI4J 1VBKA 4M94A 4PEOA 3PW5A 1BWVA 1A6LA 4BCAA 1TKZB 4QU7A 1W2IA 1ZETA 3KDOA 4EYIB 3GYNA 5C2CA 1CULB 5A8KA 5T14A 2V1SA 1EJ7L 2RD5C 4N76A 2YPYA 3CGIA 3DDKA 3TQEA 3T19A 2ZKUA 3QYYA 2YKQA 3EPGA 3D4JA 4K4YA 5DQGA 3PHTA 1YBTA 3IM8A 4RW6A 3W61A 4OX9J 3QO9B 3B78A 1H0HB 2MPUA 2HZAA 1SB6A 2KHCA 3KYLA 3AA9A 2VQEJ 2WVDA 3D6MB 4OYWA 2RHQB 5D3GB 4ZJLA 3HD1A 4Q8EA 4DV5J 2MMYA 2ZZMA 1T9VA 3QBCA 4KHPJ 3MM9A 3C15A 4ICLB 1NSKL 2KB2A 5ETNA 1X9SA 1HPZA 1TMMA 2Z4PA 2FD2A 2NUHA 4H4MB 4J91A 1KFDA 4R0JA 2CPXA 2MQQA 3OBIA 3IXQA 1YRTA 2WCXA 4KGKA 5DZ6A 1NPKA 2W4DA 3FGVA 5A6WA 4LFBF 2AJFE 1OSDA 3M8ZA 1UJ6A 2B4PA 1T03B 1TK5A 4IR9A 4DX6A 1QY7A 2AIRB 1SC6A 4OX8A 2HVIA 4DWIA 1X4EA 5CH7B 5CYQB 1DURA 3QMQA 2P2CB 4DDFA 1T9YA 3M2VB 5LMNJ 2KFZA 4IFYB 1WEYA 4PYAA 2FC9A 2COLA 2L08A 1U1KA 3PYGA 3QT7A 4RO0A 3KWMA 5B7WA 5HBMA 1YRXA 4DX8H 4CLWA 4WBFA 4X4QA 5GVQA 1N32F 3CTRA 5F9LA 4L3NA 1KR4A 3FQKA 4MH8A 5EX3A 5DDQC 1N5SA 2CWKA 4N56A 3T9NA 4F8RA 2U2FA 2BABA 3G82B 1VRQC 3RZAA 1UVNA 1WWHA 1QVGR 2WBRA 1O5JA 4LSZB 3ILOA 3H8YA 4CLKA 1N33F 5KT7A 4A8WA 2R4FA 1B4SA 1LW0B 3CT9A 4C0HA 1P27B 3LOUA 3UDVA 2Z56B 3JSMB 1X9WA 1T9XA 1RTJA 3GE9A 4QQBA 2MZRA 2RF2B 3SXLA 5F8MA 2MY8A 1RISA 2XS2A 1YZ6A 2E44A 2CZ9A 1QE1B 1NPRA 2QLXA 3Q24A 2GAHC 3CJRA 3GFXA 1K9MT 3J7YI 2JNJA 2YKMB 3LO3A 1EKRA 3RAMA 4WWSA 1VQKS 2FGOA 4K5RA 3QSYB 3V6KA 2P9GA 4CLZA 2G4BA 5KT2A 3B54A 5JXSA 2XMWA 4H4KC 1X4AA 1AYEA 3NGSA 3UFCX 3MMCB 2HHUA 2HRUA 2JRSA 4DV1J 5CD4H 4L6V3 3A8JA 4PG7A 2IFXA 3G71S 2OPQA 2R7VA 2PMWA 3BN4A 4TYAA 2L9DA 2LCWA 1S0OA 1LWEA 1NZAA 2XNRA 2CJAA 3L95X 2Y1LB 4C8ZA 1E6VA 3R97A 3J7ZT 3GG0A 2I0XA 2CJ9A 3MMAA 3I82A 4ZVUB 4N5SA 2YNHB 4C11A 2FJAB 3CDAA 3L4BC 1UZHA 3MUMP 2EFQA 2MQMA 3GG1A 3AD9C 1O0PA 1FKPB 2J7UA 1PYOB 2A6MA 1TL4A 4OYZA 3GIKA 1S0VA 3TUPA 2IM1A 1B0PA 1LWFB 4IO9Q 2HRYA 3BM7A 5DGBA 2PI5A 1LWCA 6FDRA 4IFVB 4ZS6A 2YH1A 3MM5A 1D3WA 3PIPQ 5IXUA 2UVVA 3HHKA 2DK2A 3BV8A 2QA4S 4URQU 3HK2A 2FUG9 4DPWA 1NEEA 4QJVA 2W1BA 2JEGA 2DXEA 1TTHB 2BOAA 2JVOA 3POTB 4ZPWR 2X7IA 2RRBA 2IRXA 2CQ3A 3TI0A 1X5PA 2UUBF 1TL1B 2CNNB 2ZNYA 4OYAA 2YWWA 3N5BA 1K73T 3MOJB 2J0WA 1DARA 3MR3A 2D9PA 1U6FA 3UCUP 4PQUA 4DUZF 3QIPB 4ECYA 2AJ1A 4CCHA 3V4MA 2DPJA 1EETA 1FESA 2AZ3A 2ZHBA 1HNXJ 2ALZA 2ZVIA 1BUXA 3SSSA 1CSJA 2QRRA 3KHLA 2ZITA 3CCSS 4ECRA 1U8SA 4P72A 3PR4A 2E5IA 3I9V9 4ILMA 4KYZA 2HKEA 2HYIB 4JV2A 1T05A 1OY9A 4X65J 1U0HA 5AJ3F 4LF5J 4R8UB 5IT9U 3CDEA 1RE1B 3RRGA 5IT4A 4I2PB 1Y0HA 4DV7F 2CXEA 2VBZA 2DNGA 2OPRA 4CT9A 1H2UX 4ALZA 2FDNA 2GVZB 3QJPA 4WFYA 1VJQA 3DRXA 1HNIB 4AXJA 3D0HE 3UCGA 3OR1B 4I7FB 1TK8A 5JUMA 2IM3A 2C2KB 1CLFA 4DCJB 3L7PA 4F3OA 3LP0A 1GEHA 1PJ5A 1MROA 2YX7A 2CJQA 3FSIA 4DCOB 2O5DA 4Y2AA 4LSNA 2OKQA 2RUSA 3J7Z5 3MAQA 2DHGA 2UVUA 2HFVA 4QIEA 2QSFA 3PX6A 2J7KA 4WU2A 3JB9k 2CFXA 2WSFC 1KNZA 2BJ3A 3RAXA 3EWGA 2IAJB 1YJ9S 3CO0P 5E33A 3KHRA 4L3KA 2OFGX 3PYFA 2XMJA 1JLQB 2KZMA 1KP6A 4Q43A 1SUQA 4ZPTR 3DLJA 2XY5A 1QJHA 1Y7PA 1XMQJ 1RWWB 4IOBA 2AEFA 5LMUJ 2EWHA 2HWTA 3CIZA 4JI6F 2VV5A 5H9EJ 4UQGA 3WIUA 3HHLC 2E1PA 3M8QB 3NGKA 3RBEA 1IKVB 3MCNA 3TAMA 2QTWA 3J80U 5KFTA 3NBPB 2ZUGA 1YSJA 3DRSA 1DQ9A 1WC1A 3KLIB 3G4SS 1HARA 3UR0A 1WG4A 1PBAA 2WW4A 1FXLA 1V5IB 4O4GB 3MGJA 1S0MA 5J1EA 3P3DA 4J5OA 1DY3A 2CQDA 2VQFJ 1IKYB 4M1KA 1UVLA 5C25A 2IC3B 2P9CA 5ETTA 2C22A 3OL7A 1XNQJ 2AYGA 1FRLA 3PO5A 4KHMA 3FBFA 1YLXA 3G8QA 2BE2B 3MEKA 4Y34A 4OHXA 4M5JA 2AHOB 1JQGA 1BQNA 3O8WA 2XO6A 2MY7A 4PG6A 4L75A 5H1SV 4OLOA 4BBYA 1ZTTA 3QLHB 3O5TB 3PRVA 3MDFA 1FVQA 5L8RC 5IZHA 2HNDB 3UI3A 4C48A 2GHWA 3EDQB 1NMEB 2Q66A 1EARA 5CA5A 3SI8A 4TY8B 2ZWPA 2PEBA 3TA2A 5DLGA 4AQYJ 1OM2A 5KFXA 2B8PA 5T7LB 1ITPA 3LWMA 4WIQA 3FDSA 4F36A 2M0GB 4P10A 5HP1A 2KXHA 3DI6B 1F9HA 4NLYA 1EAYC 3DLKA 3HVAA 3CD5A 2F7VA 2CG8A 4CO1A 4WCEQ 3IS9A 3QPIA 4OHYA 1JLBA 2DR6A 3HP6A 4ELTA 3P4UB 1JJ2R 1L3SA 4EWTA 2VUGA 1W25A 2E5JA 2F4VF 4IG0A 2JEJA 3OFHA 4DR3F 5B0FA 2MSSA 2AJ4A 3DGPA 3MR7A 2ZOFA 4ED3A 2K7KA 5DM6Q 2V2VA 3RW7A 3QT8A 5A76A 4OMFG 1VRTB 2FTRA 2O3DA 2XWYA 2RE1A 4OZ2A 1ZS6A 2PA3A 1ZAVA 1URNA 2VJVA 4W90B 3MEEA 1WSRA 3VTIA 3MM8B 1RA7A 4AL5A 3TJ8A 1FXDA 5LJ3Y 2Y0SD 4ATNA 3TJ9A 3M30A 1P1LA 4OI1A 4RLEA 4ZMMA 1Z2ZA 2HVDA 2W25A 3D3BJ 2LU1A 4S0MA 4DHVA 4UUWA 2C1EB 1SKRA 3MCOA 2A0FB 3AA8A 4YR2A 1KWMA 2AJ2A 2B3TB 5B0CA 3KK3B 3Q2SC 4OFZA 3HLUA 2DNNA 4LRDA 1GT8A 4B3SF 4DFKA 3ILJA 4EZ6A 3RAQA 5LXRA 1UPPA 4R0EA 3AY0A 2Z57B 3H5YA 4GVBA 1A7GE 1MMNA 2W2QP 3DGVA 1CS4A 1Q53A 1RWMB 5KFPA 5IS2A 3ONQA 5A8WB 5A2QU 4ZHRB 2IBOA 3M2UA 4J9KA 1AUSL 2R7XA 4DR1J 4ZPBA 5B0GA 4RNMA 3W8PA 4OX6A 4HLBA 3MMBB 1BLUA 4KB7A 2QN6B 2GW8A 1WOPA 2H48B 4K50A 1E6YB 2GMJA 2Y1JA 1XQIA 2IHR1 2LLZA 2CPFA 3OFFA 3DM2A 3ILIA 1NNDA 3R8YA 2C2DA 1TK0A 3VALA 1J5OB 3MF5A 1VIOA 1AXQA 2OJ3A 1G7CB 2V69A 3J7YU 2UXDF 2B0GA 1OJ4A 3M8RA 3QRQA 4DL6A 1SV5B 3D66A 2JFKA 4LUBA 4TU8A 5IOLA 2HSEB 2HNYA 1Q8KA 2QL5B 3RRHA 1EKSA 1RT3A 5BYRA 3GYXB 1H38A 1KVJA 2MGZA 4ERDA 1YVFA 5D4LA 3ILLA 4FYYB 1HBNA 1HQ2A 1S77D 2BQUA 4WFAQ 3IA0A 2WB4A 5E3PA 1YJ7A 1NUEA 4YY3J 1KHWA 1WF1A 2EXUA 1UA0A 3DXBA 3BO2A 4PPDA 1S6QB 2NXUA 8ATCB 2ASDA 4ZDNA 3NKYA 1S9EB 2VPZB 1VRUB 5KFJA 1VJWA 4ZJQA 4DQQA 1KEKA 3T1AA 5BR8F 3NNCA 2EFNA 2VH7A 3TWZA 3IG1B 4G1PA 2RQCA 5DQIA 3HHNB 1UJ5A 4A8KA 4DV2J 1R8AA 1MW7A 3MM6B 3RB0A 3DDIA 3I55S 3SFGA 3TOQA 5K8PA 2VONA 1JKHA 1WD6A 4UT4A 2KT2A 2G0JA 3AOBA 4P7VA 1AB8A 3AXKA 3V6HA 2DNMA 4LFAF 1TUVA 3M8YA 2VBYA 3DMJB 2QZ8A 1FWKA 3V2UC 4OI6A 1S1XA 3GIRA 2CWXA 4QIGA 1D9AA 3CUNA 3LUYA 3NOCA 5FLXU 2HMIB 2Q79A 4JI1J 5CZVA 3QGHA 3CXCR 4K8RA 3R27A 3MAAA 5HVFA 2ZH7A 4PABA 4O3QA 3VGTA 4UOFA 1AUDA 3T3FA 4GKJF 5LSRA 2CPJA 4USJC 2VKRA 3AH6A 2XYHB 3AQOA 3LF0A 3PJXA 4F25A 2PE8A 1B7YB 1ULRA 3VZIA 3A8IA 2B8QA 2F8HA 4PYDA 1CJKA 2EC0A 2V67A 3CCUS 4I67A 2J9DE 4TVAB 3MCSA 2A18A 4JI7F 3BN7A 4OV6A 1FX4A 3T9ZA 4EFAC 2C2EA 3NRBA 2PEHA 1H74A 4MYTA 5F8IA 2RUGA 3ZTRA 2BZ2A 3H2VE 4G1QB 4C8LA 3LALA 1V6HA 2QMXA 5CAAA 2CPYA 4DQSA 1TUGB 3PR5B 3GFZA 2NXCA 3CDUA 1AT1B 1EHWA 4KPYA 1UFKA 4DF8A 1FF2A 4WE1B 1ZPVA 3NGTA 1UVKA 3K8WA 2KU7A 1JLCB 4V1Ak 1QSSA 4TU9A 2XM3A 2UV8G 3PYDA 2CNOB 3HI9A 4H4OB 3OTBA 1SCJB 1TKZA 4ED1A 2MXYA 2CQ0A 1U1NA 1WDTA 4Q2LA 4FF4A 3EGNA 3UDLA 3G9CA 1K0VA 2DNLA 4DV3J 1CULA 1NH8A 2R7WA 1AZSB 3ISND 4QW8A 2DHHA 1BC6A 4OX9F 2MQNA 4HI1A 3IO1A 4QR1A 4QBUA 1JMTA 4M5DA 3K5NA 3K5MA 3GTYX 2APOA 4MIWA 4ZCMA 4IOCQ 2VQEF 1VQNS 2H5IB 4HT5A 4KPCA 3CPWR 3MR6A 1CG2A 1F6TA 1IBKJ 4DV5F 3ZZYA 1RT2B 3NGUA 2FVRA 1C0UB 5DQHA 2NR0A 4KHPF 5IWAJ 2K1RB 4P2SA 3HHDA 4OZ3A 4N7TA 5JJBA 3GONA 4JV5J 3RYLA 4ICLA 1XMBA 1R43A 1SI9A 4CH0S 1OPIA 3PJWA 2HVZA 2WVCA 5D4NA 3HHEA 1LK7A 5A2QY 3V81B 2UXBJ 4G6VB 1FFGB 4H4MA 2YX4A 1UVJA 5HLFB 4KV8B 2WHOA 5E5NA 1VC0A 3HULA 2WK4A 1FRIA 2XY6A 5KFZA 2V8DA 3OR2B 2WSCC 4ECQA 2NYIA 1T03A 3DC2A 2MZ1A 1ELOA 1Z1ZA 4LQ9A 3Q86A 4EBCA 1IBMJ 3PVXA 4NYZA 3T1YJ 5CHCB 3M9NB 4WZMA 3S01A 1X8DA 1FTRA 3M2VA 2A1BA 4GVLA 3PRBA 3SMZA 4IFYA 5EUHA 3HO1A 2OPSB 3SCKE 3KJFB 4E2FB 2VU5A 1LKZA 4NZ6A 3HF5A 2DGUA 3R1LA 3LP2A 2OTLS 2KRBA 3WDOA 2VA2A 1L5UA 2RS2A 1YITS 3ZTOA 3G82A 4DV0F 4ES1A 2QLBB 4PXDA 1X0PA 3CW2C 1T9TA 3IWLA 4OYMA 4MK8A 1NJZA 4IUFA 4IG3B 4RNOA 2KHDA 1GMVA 3EPIA 3D5MA 2HK3A 5AXLA 2AZ1A 2JJ4D 2C3UA 5GMKa 3Q8RB 4NLQA 1CJTA 1TELA 3A8EA 3TW0A 2WBMA 4OZ1A 1QE1A 3GYGA 2D3ZA 1U2RA 3CCMS 3K5OA 2MKHA 4MKAA 1R31A 1S4FA 1UVMA 4LFBJ 3KJVB 2YKMA 3AHPA 1X4CA 1TR0A 4ZLLA 3GV5B 4OL8A 5DS7A 2V2QA 3H5UA 2V34A 4PUOB 1V3ZA 1WTFA 3TNVA 3CCRS 3PIOQ 2FVPA 3PW2A 2XMTA 4P7TA 2EKYA 2YWGA 2OGUA 2B5JB 2EBEA 1X4DA 4EZ9A 3UCZP 3MMCA 5FLXY 4DR2F 1V9OA 3P49B 2IM2A 2JOQA 3CCJS 3AJ1A 1RLCL 1B3TA 3VQTA 5B0DA 2WW8A 1JIHA 3ITHB 3G96A 4ZPAA 2EKNA 3GJSB 3HVRA 1WC0A 2L48A 1SL1A 1VIXA 2DY1A 2ZZNA 3QT6A 4F0HA 3VAJA 2K2PA 2X1AA 4FBUA 1VQPS 5F3TA 1KVKA 4GO7X 2DBBA 2XMKA 2G2YA 2B4VA 1FKPA 3P45B 3OL6A 3A3OB 4QIFA 3EVMA 3GFYA 4X4NA 4A4JA 3TVYA 3BGUA 1X60A 3KKFA 1QD1A 2WTFA 2ERRA 1RT4A 1SKUB 1TP7A 4MIAA 3V4IB 2P6SA 1LWFA 3TA1A 2UUAF 2AKWB 4FXVA 4IFVA 1WC4A 2XTJP 3CULA 1K47A 2GO9A 4LF9J 4WFNQ 2ASLA 2HQIA 1KQGB 2RDJA 3LWLA 2NSCA 3H2LA 4DG1B 1F9EB 3OLAA 4NL5A 5AXMA 5ETQA 3MI7X 3R7BB 1FDBA 1VQ5S 4Q44A 4OI3A 3DDNA 4P6QA 2AU0A 4ECSA 5GAHU 4I1TA 3A3PB 1YJNS 4JI2J 1RGVA 2CVEA 1NB2A 1TL1A 3BYRA 1PO6A 1GAOA 3QAEA 4Y2KA 2UP1A 1HNXF 1H73A 2XSFA 2CQBA 2YKAA 4YMEA 2KL8A 1N5TA 3QIPA 4RBTA 2NPIA 3OW2R 4R5PB 2CQHA 3ULHA 4K0KF 3M4XA 5JMNA 1J2VA 3IM9A 5F8GA 2CYYA 5A0YB 1MWYA 4ZJOA 1N5VA 9RUBA 3EGWB 3AX5A 4FNIA 2RB7A 4B08A 2L3MA 5LSOA 5I3PA 3SQGB 3DOLB 2KT3A 3M1VB 1N5YA 4R8UA 2M4MA 3HVTB 1DQ8A 4CO5A 1OIAA 3L7OA 1YTYA 5EWEA 3QQCD 5KFMA 4I2PA 3IFEA 1SJ3P 1KLMB 3TVZA 3W2VA 4B9MA 5CCMA 1S1UB 4J9QA 1OWXA 4Q45A 2GVZA 3ET6B 1IUJA 3DFEA 4N47A 2MKJA 4ELUA 2FJWA 3GCXP 1RCOB 1D09B 1HNIA 3QATA 4DX5A 3OR1A 3DLHA 4I7FA 1U2CA 4RW9A 4FXDA 1FWPA 1M5HA 1SC3B 1DTQB 4ZP7A 1KOHA 1GTHA 1LXJA 1C1CB 5KT4A 1M5PC 1DAXA 2CG4A 4ZP8A 2BYCA 1SBRA 2R2RA 4WP9A 5KFYA 1WC5A 3CD0A 2PDAA 2ROEA 5J2MB 2XMVA 3CB4A 1LV5A 2BJDA 2JVRA 4MKBA 1BQMB 1GFWB 1FRHA 1T0TV 2VC0A 2MKCA 2OD4A 5HQLA 2IAJA 2AYBA 5F41A 2FLOA 1WC3A 1N54B 1JLQA 2ZJPQ 5LMUF 1TFWA 1U2FA 1NJIT 3OVBA 1RT1B 3H4DA 5JVGQ 3ZZZA 2XULA 3E01B 2EEYA 4PWUA 2H4YB 5HL7Q 3RB6A 3P8BB 2WONB 2WSEC 4CT8A 4ECUA 4TLQA 1RK8A 3W62A 2VIHA 3C6TB 1RWPB 5ETRA 5EDWA 5EWGA 3KNGA 1RHUB 1IKVA 3P96A 3RU0A 3E3XA 1BQXA 1PKUA 5AJ3J 1WKJA 4ES2A 3NBPA 3MWBA 2OTJS 3W66A 3KLIA 2FY8A 5L9NA 4FXWA 4O4GA 3E51A 1Q1KA 2GIQA 1NK7A 1X31C 2V1TA 1XNQF 2QA1A 3M8PB 1IKYA 4IYQA 4IDKB 2IC3A 2EFGA 2I8EA 1G3OA 5J2NB 4UTGA 3MZIA 2H1YA 2O66A 4B3RJ 3TX8A 2QGFB 1NDCA 1D9FA 2DEJA 4JOUA 1RCXB 4CO4A 2BE2A 3CCVS 2DHSA 4DJBA 2VKZG 3OHAA 4NA3A 2QT7A 1RHMB 4O44B 2YNIA 1YGYA 1UETA 3ISNC 2CIMA 3ZTQA 4CM2A 3PZPA 2HGMA 4AQYF 2PMHA 4PQAA 3MR5A 5K8OA 5K5MA 2HNDA 3N79A 3BO3A 3C2PA 3GIMA 3ZZPA 2J76E 3HFZB 3KFWX 4RWWA 4TY8A 3IMQJ 1IXKA 3KOAA 1RT6B 2HLTA 5T7LA 1RBLA 3HPOA 3TX0A 3BGOP 2PD1A 2GJIA 1FERA 4F0KA 3DI6A 2WRMA 2LEAA 4NXNJ 2RQKA 1S1WB 5FIIA 5HI7A 4NEZA 2XWXA 4AL6A 5L9XA 1RTHA 3JQMA 4Q0BB 1JB0C 2EW9A 1U8WA 4OV1A 2C3OA 2LFVA 4WIIA 1H7WA 1DLOA 1TV6A 1EP4B 2LA4A 1SJ4P 3WX8A 2DVIA 2HBZB 2V68A 2GJFA 1IR2A 1HHTP 1U49A 1XWLA 2P8IA 1SQEA 1TL3B 2VG5B 4CLTA 4EMDA 1VQSA 2B51A 2E5HA 1HHQA 1S4EA 1X5TA 1T94A 5KG7A 3MM8A 1JX4A 4FPRA 5MAOA 1MU2A 2GCFA 4RR5A 4GC6A 1QUVA 3GV8B 3DLGB 4UY8T 4KFBB 1WOSA 3QGPA 3R3TA 4BWMA 2UZAA 2YKOA 3BKTA 4DPYA 1U47A 2YH0A 3FMBA 4QWCA 4XPEA 2M2BA 3HD2A 3K5LA 1SC4B 1CC7A 1HQEB 3KK3A 3C8YA 2IRYA 1J27A 2KXFA 3AB2B 4OZNA 1VQ9S 3I56S 3QJLA 5IQ6A 4M95A 1OSCA 2ZFHA 3ENVA 5SZTA 4CLSA 3PHEA 1REGX 4F26A 3OLBA 1VQ6S 4YDXA 3JTPA 4ZHRA 2CPIA 3CD7A 3TAQA 4ED6A 2ZZTA 2GNKA 3OUYB 5EN1A 4F50A 5GAEI 4I6WA 4AL7A 3EXYA 2F4VJ 2DH7A 1E6YA 3I0RA 3O44A 4M5NA 2VPYB 4DR3J 3MTKA 3M8WA 2ZC3A 2W9CA 4P73A 5ETLA 5E3CA 1YDLA 2Y1RI 1HI1A 1J5OA 3BH7B 3EVOA 2XTEA 4YR3A 4FNHA 1GXUA 4YEAA 1TVRB 5KFAA 4TXSA 2HQ3A 1S1VB 4UOCA 5KFSA 5FDLA 4X4UA 3NY0A 4V19J 4CM0A 3FRYA 3B4DA 5K14B 3C16B 1S49A 3N4WA 2YX1A 3TEGA 2YY3A 1YIJS 3V6DB 2M8HA 8RUCA 4YY3F 2BJ7A 2YNFB 4USIA 3DOKB 1M1KT 1K1SA 2R7UA 5ADZA 2CPHA 1Q4RA 2N7CA 1U24A 2XS7A 2W9BB 3GZ7A 1XIQA 1T11A 2DGTA 1LW2A 2GQQA 1HL6A 4RZRA 4EGLA 1S9EA 4O3OA 1VRUA 2E7XA 3T5KA 4F4KA 4MJKA 1PYTA 1R3NA 2VC1A 2ZM6J 1HFEL 3R7SB 4NLGA 2W01A 1YRUA 1IWAA 1MN9A 1P6TA 3IG1A 1CC8A 2AGOA 2KXNB 2CAJA 2PGCA 4DR4J 2K06A 2E1RA 1F2HA 2NXEA 3MM6A 2B6AA 3ZXWA 3CC4S 1P8GA 1MWQA 1JNRB 1FNXH 4UZBA 2N3OA 2CZ4A 2KT5A 4E8UA 4DR7J 2HQFA 4ED8A 5LOQA 1F3VA 3EDRB 4FS2A 1FKOA 3LQVA 4QR0A 1Z2LA 1WHWA 3WHIA 2GZOA 3DMJA 2XGQA 3UPFA 3TVKA 4CIOA 3DLLQ 4JI1F 2Y0BB 4I6AA 2KFYA 3AD8C 4C97A 2FHJA 3UQSA 1B0VA 2YTCA 1VQOS 4FS1A 2A6OA 2EVZA 3RB4A 3AAWB 3K0JA 2CJXB 4IRKA 2RRNA 2UXDJ 2HNZA 4IR1A 3B8HA 2HMIA 4HR2A 3CCQS 3QRPA 3KLFB 2DR8A 1UEUA 2HRTA 1NK0A 3D28A 4FVCA 4J9UE 3DHXA 3TZZA 1CPZA 3TO8A 3SBMA 3A12A 4NCGB 4V19X 4CP5A 3H25A 1D0EA 2QMWA 4OJ1A 1HI0P 4C8NA 2GHVC 2XCPA 3NWGA 1HI8A 3JTOA 1FK9B 1D8YA 2DY9A 2DD8S 3DLEB 5IT0A 2O67A 4LF7J 4Q5VA 3IN5A 2YQ0A 5AXNA 3IRXB 5A8KB 4J9LA 2BJ9A 1VOMA 5IV4A 2J8SA 4C3LA 4LSLB 5M2UA 4F4YA 4F4XA 2VDIA 2CVIA 1U4BA 2U1AA 3NCRA 3SCJE 3I5CA 3TZWA 2HHPA 3EM1A 3OTOJ 4ELVA 1MMLA 1S7IA 4PG8A 5BR8J 1HNWJ 4C8MA 4Q8FA 1U6ZA 4F4ZA 2JLGA 1YI2S 4ZVOB 1BXNA 5L1LA 3MFHA 2LVWA 4NI2A 1QAYA 5I4MA 1NJXA 4B3OB 2HAFA 3G6YA 2LYVA 1RAAB 3Q8QB 3RBZA 4WPAA 2W8KA 2B43A 4HDGA 4DV3F 1JLCA 2BW2A 2B7BB 1Q5VA 2WOMB 2W2MP 4H4OA 3D1OA 3PW4A 2ZE2B 4WFZA 3H90A 4I2QB 1S0NA 1S99A 2QLJB 4NOHA 2AMCB 1AZSA 4RUAA 3QZ8A 4LBHA 3CC2S 4PWDB 2BE7D 2E9RX 4CNYA 2OH2A 4BS2A 2JWNA 3R6LB 3VAHA 2XYGB 2NCKL 5ETKA 2UUWA 3DYAB 4DMZA 2HQGA 4YFUA 1WORA 1XMOF 5HQ8A 3FCHA 3N0VA 4PXEA 2J6UA 1JLAA 5E3RA 4ED7A 3LANA 1RT2A 4JV5F 1C0UA 4Y6IA 2OPPA 2M8DB 1CJUB 5LM7E 2K1RA 2L41A 4KQZA 1RAIB 3HHLD 2IJFA 3HM9A 3EXCX 3OXLA 1M1GA 2F9DA 5HANA 5L1KA 2CPZA 1OPZA 2ZBCA 5HBMB 4K59A 1XTZA 1R7IA 1FRJA 2GMHA 2IY5B 3M6UA 1L3KA 2ZHOA 2DXFA 3PFOA 3IBFB 3V81A 2VBWA 1HWLA 2GIFA 5HLFA 2FZKB 3LP1B 2RH3A 2V4QA 3E8OA 2BEFA 5FD1A 2WVBA 3P5BP 2V5HG 4URGA 5IM0A 1WUUA 2QX0A 2KO1A 4ZVRB 2Q6CA 1EQ0A 3OR2A 1IBMF 4NLSA 2KRRA 4RNHA 3T1YF 3IP0A 2DB1A 1DTTA 2DH8A 1HYSA 2OP5A 2BQRA 4KAIA 1IM6A 2VG6B 2XMMA 4OIXA 1FDAA 1X7VA 4M5MA 3PW7A 3UVJA 1P9QC 2DPIA 5KG5A 1H7XA 2IDLA 2XB2D 1NB7A 4AUKA 3VAGA 2OPSA 2YWHA 4OYOA 4M5KA 2EK6A 3MMJA 1ZA1B 2JLFA 1SVDA 1T9WA 2MDAA 1RHRB 5KFBA 1G6BA 3X3UA 4NYPA 3FUYA 3KG0A 5IC6B 3W1YC 4YB5A 1OQ6A 4OYBA 1KHVA 3EZUA 2ZHAA 5J1PA 2VDHA 4XTTA 3BGLA 3N5FA 3ZZUA 4BDPA 3SQOP 2D74B 3N9UC 3D1QA 4IG3A 3JSYA 2DITA 4JI8J 4P71A 5KOXA 3HSGA 4JBCA 4WFBQ 4HACB 4YN3B 4ZLPA 4CYUB 3DNCA 4U8YA 3RG6A 2AYEA 2ACMA 2V8HA 2MZQA 1I5OB 2YKPA 3VCDA 4ZPDA 1U1MA 5GMEA 4PZVA 1XR6A 3MTJA 4U7UK 5DO2A 2CQIA 3NAHA 1WG5A 5B0EA 4AD6A 2GJ2A 3TUIC 3KJVA 2R8IA 3FFIA 2ZKTA 3AOAA 2R42A 1U09A 2C2ZB 1WC6A 4PUOA 3KJNB 2ZBRA 2Z2MA 4NZ7A 3R2DJ 1WJ9A 2J8AA 2D9OA 4H54A 2B5JA 3OL9A 2DNQA 1IWGA 1VK3A 4FVMA 3PX0A 1UFLA 1JJ4A 4OX7A 5KT5A 3DN9A 3U27A 3R7NB 2HLUA 2IYIA 2I5JB 2HFUA 1HIYA 1TFYA 1GQEA 1Q81T 1ZZFA 5I42B 5GADI 4X4SA 2DNZA 2HS3A 4J9NA 3Q8YA 2DXDA 4Y28C 1RYRA 4DSJA 5C24A 3T1HJ 2D3UA 4CLLA 2GQ2A 4B9LA 1RABB 4DV0J 4LRCA 3EE3A 3BDPA 1LXNA 4WKRA 4F4WA 1HBOB 1Y9OA 2NREA 3DU5A 3VAIA 3FEXB 2M70A 2W2NP 4LVNP 3ETOA 1RACB 3MAHA 2OSRA 1RDRA 3I4HX 2ZH5A 1VK8A 2XZWA 2JFDA 2IMOA 3BEGB 1HD0A 5C42B 4WK1A 4ZP9A 4LF9F 3CNQP 1ZOTA 3H5XA 1HLWA 3V4IA 2HVEA 2ZOMA 3MHYA 5D0GA 2ALYB 3K59A 4OZLA 4I64A 4P2XA 3GR0A 1RAFB 4DL3A 1NBEB 2ASYA 4DG1A 5GAEU 1HW9A 5AE3A 3VGUA 1I3OB 1NPPA 3RW6A 4DR5F 1T05B 4JI2F 4C8OA 3I5AA 1U0HB 4DQPA 1S6PA 3FCVA 2EFVA 3D6FB 4K2JA 1NJYA 1VQMS 1JXLA 4C2MA 4XAKA 2ATLA 2H5EA 3WC0A 3OTDA 5CABA 2KG1A 2OPRB 2CPEA 2GX8A 4H4KA 3FJ2A 2OI2A 5IFMA 5J2PB 2NUUG 4DR2J 2ZC4A 1Q95G 4AFFA 4MK9A 2LEBA 3DLBA 2KN4A 4DPOA 1S7HA 5HMWA 4B9UA 1ICEB 2D3O1 3DXSX 3CJ5A 3VZHA 4R5PA 4RUBA 2V2ZA 2XTDA 1YJRA 1PC5A 4QYZJ 4ZN3A 2G1DA 1BMQB 3UDCA 1JK9B 5D4PA 2YBVA 1X0FA 4Y2MA 3SQGA 3DOLA 5M2RA 3PFEA 3HVTA 1UJ4A 4J37A 4KHRA 3NMRA 5F8LA 1RWUA 4A48A 4PCQA 3O1LA 5C2GA 1KLMA 4BHQA 1RTIA 2ZH2A 3R5DA 3LPEA 1YX2A 1NDKA 5D0EA 3SEOA 1KQKA 4L76A 2UUAJ 3S1TA 1LNQA 3GP9A 3CJ3A 3V5RA 2CQCA 1BE4A 7FDRA 2H4WB 2YPZA 2DKOB 2CQ1A 1Y3KA 2DEIA 2HGNA 1NXIA 2NYHA 4ANEA 3ENAA 2EG2A 5DDRC 3KLHB 4K4TA 4ECXA 2AV5A 3DRPA 2MHNA 5LT5A 2VD3A 1DTQA 4NE9C 4ID8A 2VBXA 3WC2A 2RMLA 3Q8SB 4NZ0A 3G87A 1OS5A 3CJ0A 3MPWA 3U1LA 4U6PA 1I94J 5C5JA 1P9YA 3VHQA 5C25B 2ZD1B 3HMJG 4LBPA 4A8OA 3T6JA 4PRFA 5DGAA 1UW9A 4U95A 3IWNC 1ZBTA 3EVWA 1HKAA 1AROP 3IGVA 5EWFA 2F40A 1RT1A 4K0KJ 1FNOA 5KFUA 5F0UA 4ZPCA 2WONA 2V9KA 1KQSR 3KLEB 1KLNA 4URSA 1Q8IA 3C6TA 4ZVFA 4ECTA 4XDCA 3Q83A 2LQ5A 3TR5A 1N36J 3L09A 2KH9A 4TNOA 4RU2A 1WELA 3AFGA 1BWEA 3CF5Q 1NAQA 3VWSA 1S10A 2LEPA 4CO0A 4KE5A 1UW4A 4U8VA 2E1CA 4B3RF 3M8PA 3FEZA 1PG5B 1RB0A 1N48A 2D41A 4IDKA 5BYSA 3CJ2A 4LR8A 3C6UB 3AJDA 3DLKB 1S9FA 2CZVC 5J2NA 1LWXA 3QFWA 4I0WA 3FSXA 3IS9B 2D3OR 1R8PA 4LF4J 1B70B 4M5GA 2OLWA 4KR0B 4ZPVR 2LKZA 2QLWA 5KFIA 2VFSA 2YWEA 4A8FA 3NS5A 3G2XA 1S59A 4O44A 3BO4A 1NDPA 2JC1A 2UVRA 1W26A 3BGRB 3C19A 4K4XA 4CLUA 3JYTB 2RU9A 4CTAB 3LGNA 1N52B 3G6VA 2G0IA 3TA0A 2P5VA 5THWA 2CQ4A 3ZTPA 2Y8WA 2ATCB 1PBUA 1OYDA 2FHOB 1R6YA 4A8SA 2QA2A 1RAJA 4NXNF 2R7OA 1KQFB 3BKFA 2J9EA 4O0IA 1UUJA 2ROGA 1RLDA 3H2UB 1SKSA 2HK2A 3MD3A 5G4DA 4HHHA 1NCLA 2QL7B 2DNYA 3WBZA 2F65A 2UU9F 2H65B 4LF2A 4HHJA 2PN6A 4Q0BA 1RAGB 2V2KA 4DL2A 3CO9A 1C4CA 3SSRA 1CBKA 3HHLA 3KNAA 4Y00A 1WOOA 2RJZA 4NLOA 1OMSA 1SQGA 1NKEA 4RU9A 3UN2A 3TARA 2B4UA 5HMZA 4IKAA 3K5PA 4LR9A 4CLPA 1HBUB 1TL3A 2RKIB 4WU3A 3SSQA 2QYGA 1KC8T 2VASA 3UO0A 2FIUA 4DUYJ 4FF3A 3Q23A 4FYWB 3H42A 4DUTA 2VG5A 2KKHA 5HJYA 2HZCA 4TQSA 3D6HB 1M5SA 4QOTA 2B9WA 3AX3A 4IQMA 3CJKA 4A8MP 5DRKA 3OFEA 4ZVTB 3A1YG 2HPUA 2R8JA 4UW2A 1RT5B 4P2FA 3DLGA 3W9JA 1VQ7S 4KFBA 2DRBA 4LT6A 2V63A 1AW0A 5ETSA 5KFQA 1CEZA 1RADB 2C3MA 3VVTA 2RU3A 1HMVB 1LQ9A 3P5TL 2PMZD 4WKYA 1YHQS 4KO0A 3DM2B 1HQEA 4UUXA 1RAOA 2V4JA 3U1NA 3N6LA 5KG0A 1P1TA 4FN5A 3MEGA 1S72S 2H54B 1U6BA 3BQ2A 1SJQA 3W8GA 2UVWA 4NMLA 2HNYB 3D1HA 4U9RA 2HFSA 4FZVA 1Q16B 3J7AN 2YNGA 2C2RA 4K4VA 2XYPB 4IO1A 2B9XA 3KXDA 3OUYA 3GJQB 4ECWA 3UN5A 4MKYA 3BSAA 4ED0A 1NU4A 3D0IE 4OI0A 2H5JB 2PIIA 2XI2A 4TKTA 1VCTA 2LXUA 1ZH5A 2Q1LA 4PR6A 3C14A 3UN3A 5DG9A 2V0NA 3BR9A 1T3OA 2I2YA 3KMQA 5F8NA 1RYSA 1Y3JA 4JI5F 1SH3A 1AFIA 4RNNA 3SZ2A 1UKUA 1FWLA 4WYWA 3UWTA 2LDYA 3M8SA 1QLNA 3T6BA 1TVRA 1HWIA 4RKUC 4O4RA 1S1VA 5HAOA 1GXLA 3BREA 3SV3A 4XO0A 1GMWD 3CJSA 5K14A 1NK9A 4B3MF 3NWRA 2CDQA 4CWBA 3K7RA 4USMA 1Q8BA 7AT1B 3C16A 3H20A 4EBEA 2HQCA 1UFWA 2VL1A 4OHZA 3V6DA 1RTDA 4WYLA 4GMKA 4KGVB 4ZA1A 2R2SA 2W9BA 3BH6B 1URRA 2PO4A 1QSLA 2CQPA 2ZM6F 1S1XB 1XN9A 3H4BA 4DQIA 2KJVA 5GADU 3UR3C 4WTYA 4DR4F 1KKHA 2NSBA 3RR7A 2JLEA 1NSPA 1NDLA 1WF0A 5C7PA 4Z7YA 2FLNA 2NS1B 1UPMB 2CA9A 2QL9B 4NX9A 4KKOB 5KG2A 4DR7F 3OFGA 3MEDB 2UUCF 2IIHA 2G1HA 2HWHA 3AOCA 1MWZA 1WI8A 2VB6A 3ENQA 5B09A 5GAHI 2DNRA 3NXZA 3J7A1 1Q8LA 4Y65A 2OD6A 5L1JA 2IYGA 1CJKB 4ZVQB 2AGPA 4ILLA 1TKXB 3NS7B 1PC4A 3MFIA 3AJ2A 5L38A 4B17A 5E0OA 1VQ8S 3JSBA 3DKDA 2IVMA 2YKNB 5L39A 4F67A 3N28A 3KLFA 4USVA 3PACA 2M7SA 4FYXB 1OO0B 1FI4A 3DHWC 4NCGA 4LF7F 2KDOA 1IR0A 1U45A 3UD4P 4X4RA 2E66A 1FK9A 4RL1A 5CXTA 2FZCB 3DLEA 4ANDA 3NAIA 3QZ7A 3GJRB 2V50A 3MUVP 1NZ8A 1RSCA 3IRXA 3BZQA 3H59A 4A47A 2FB0A 2Y1IA 5HROB 4EYHB 2AJ0A 3OTOF 1IN0A 1TKTA 4LSLA 1X4FA 1HNWF 1FNMA 2GVDA 3AWRA 4M5DB 4EEYA 2UUTA 2J9CA 2VPXB 3TRGA 2DGOA 1VR6A 3A13A 5T41A 1GX6A 4HYKA 3Q89A 2BBEA 1VHFA 4PPZA 1JWWA 4QZVB 1F5BA 3AQPA 4DLEA 3Q8UA 4NXMJ 3QGGA 4DV4F 1ZM4A 4RW8A 4IRCA 1QDUB 1T8EA 2VG7A 1H6KX 1FEEA 2AF6A 1N8RT 4KT0C 1FRKA 4RW7B 4B3OA 3RGIA 2G13A 5KT3A 1R6VA 3QFHA 3JS9A 1B7FA 1CQNA 2HBQB 2BDPA 2VF3A 4A8QA 2WOMA 1R8CA 4L72B 1PSDA 4F4AA 2ZH3A 4ZVPB 2MTLA 2ZE2A 4I2QA 1J5EJ 2OSQA 4J9MA 1BD6A 3BQ0A 4G1IA 1IBLJ 2LMIA 2XMAA 4PWDA 3KK2B 1QSYA 1GH8A 1RAEB 3RBDA 1IR1A 1PILA 1WHYA 3DYAA 3SIPB 2X3GA 1ZYQA 3IGNA 4C9DA 3G8TA 2BA9A 4HH0A 4LFCJ 2IA6A 1TUWA 4GC7A 1CJUA 4MFBB 3GFHA 1RT7B 2E29A 4DL0C 2ZDOA 1FJGF 2BKNA 1XBWA 1IQZA 3BSCA 1NSQA 1WI6A 4ID5B 5IC4B 5CQGA 2CNLB 3M05A 2XO7A 1H3DA 1VDHA 2BQ3A 3OJSA 3LP2B 3CCES 2DO4A 1MLAA 4A8XA 2ILYA 4LBIA 1HW8A 3AXMA 1UAWA 3N01A 3G6ES 1FDNA 5AE1A 1IQTA 2CNKB 2OEJA 2E9TA 3LP1A 3W63A 2Z0GA 2E1MC 1CJVB 3F41A 3RR8A 1G4CA 2DH9A 5KT6A 3KLVA 4DFPA 3EGZA 4AT1B 3CE8A 4ECZA 1VBYA 2JH3A 3HDSA 5ETPA 3OL8A 2BM0A 1RZMA 1V3SA 2AW0A 2VFVA 1RKIA 4OHWA 3OHBA 4Y2IA 1M0SA 2VG6A 2I1RA 3H7HB 4XIUA 1DBDA 1KTQA 4NLXA 5DETA 1IJFB 1PJ7A 2DCUB 4YHHJ 1NKBA 1CJTB 3NMAA 4K4ZA 4USKA 1VQ4S 1UZDA 1HNZJ 1D8ZA 3JTNA 2XTCA 4DV6J 3QO9A 3QWPA 4MTPA 4KC5A 5KFFA 2VZ9A 2CUYA 4O3PA 1NK4A 1R8BA 2CQ2A 4DL5A 2KJWA 2NZ4A 2KM8B 4LF8J 3FSYA 2X51A 2MZTA 2XY7A 4QW9A 1XMOJ 4KGZB 4U7CA 4DU7A 2DISA 1MSWD 5D3GA 4ZOSA 1L3TA 3ZZOA 1C1BB 4RWXA 3CD6S 2BRLA 1TL7B 1UWAA 4JI8F 2UXCF 3RUBL 3J81Y 2DGQA 3CCTA 3H0PA 2QC3A 4OYXA 2RQMA 3L7UA 3VR1A 2L9WA 4LIWA 1H2VZ 4NA1A 3D3CJ 1ZTWA 4HACA 3CIMA 4CYUA 1G2EA 1YJUA 1JXVA 3JQJA 4L73A 2DGXA 3M2RB 4KGMA 4YQWA 4LF6F 2W24A 5HJXA 3U7JA 5CYQA 4FBTA 3FK4A 3J81j 3M32B 2XZDB 1RT4B 2MB0B 4IOAQ 3ENWA 2PFFB 2ADBA 4B9VA 5DG7A 4KY3A 1H72C 3H5SA 4EUVA 4C6AA 4G65A 1DZ5A 1OY6A 2ZBIA 1SJFA 5HVGA 2I5JA 1UL3A 1EX8A 3T1HF 2I38A 5AT1B 5I42A 3UDEA 3CJ4A 5HO4A 2BV3A 1L3UA 4QWBA 5CYMB 4DSFA 4IRDA 1HD1A 3T41A 4Z2XA 2J0SD 1HBOA 4RJVA 1GTEA 1LW0A 2N3LA 4YR0A 1HQUB 3JSMA 2FJXA 5IQQA 1V5VA 2V94A 1EB0A 4ZVEA 4JI0F 4UF4A 2RF2A 5E41A 1B64A 2LU2A 3R5JB 5KFLA 2M9KA 5AE2A 3ZNJ1 4CDIA 5C42A 1PYSB 1YZ7A 2XSJB 1FFSB 4QIVA 2E5LJ 4DFJA 4HL9A 3HFVA 1EIYB 1NO8A 3R5BA 2D1CA 2HG4A 2PI4A 1XNRJ 2XI3A 2HS0A 1Q78A 2Q3PA 4QWAA 3HX9A 5KFVA 2R7TA 1VS3A 3HT0A 1N5YB 3FRZA 4YB1P 3I96A 3TJAA 3ADAC 1OY8A 1HNVB 2HFNA 2FC8A 2POKA 5J2QB 2EFPA 1FD2A 3WQPA 2OAUA 2X1BA 3BJYA 3MPDA 3SDEB 3DU6A 3OJUA 1RWVB 1IVZA 4ANCA 3W2VB 1PIEA 4EO8A 2DTJA 1XJWB 5I3QA 1M5VC 2RILA 5J2PA 3QRRA 3DCAA 2EI5A 4WTOB 3DRRB 3FBBA 3ISZA 1WG1A 2AWZA 4CLYA 4L74A 2YNHA 1Z4UA 3CSKA 4RW9B 4B3TJ 1GMWA 2OMLA 5KG4A 5ETOA 2N7YA 2SXLA 3VVUA 3KLGB 1HR0F 4PAAA 3BPSP 1ZPWX 4ENOA 1YG0A 3SFUA 4J9PA 2VFRA 2Z30B 2LXFA 3GLJA 1X4BA 1F60B 1NHUA 4DSIA 2XHCA 5ETMA 3SYZA 4LRFA 2ZH1A 4JI3F 5F0WA 3BR8A 1D9DA 3IRWP 2LQ9A 1Q86T 3LAKA 4FKYA 4CI0B 2M52A 4QU6A 2VOPA 5G0RB 4DL7A 1T7PA 3VV2B 4P2MA 1FD8A 4USHA 3FC9A 1U7LA 3R1HA 4C8KA 3F73A 1KBRA 1IKWB 3D9BA 2MHEA 3RB3A 5KAKA 3EYZA 3D67A 2F5GA 2V8VA 1NHKL 3POTA 3QGIA 1JLGB 4OHVA 4X66J 4NA2A 3ZNUA 3TUJC 2MYFA 1DRZA 4DR5J 1Q0NA 3KLHA 3PV8A 2MSTA 2ZH4A 1N4LA 1I94F 1X5SA 3FBCA 2E9ZA 2ZUAA 4P9SA 4ED2A 4ZP6A 2J0XA 3NEKA 3W2WB 3W3SA 1VC6A 3UNYA 3FVYA 4QPXA 4LQ3A 2B9EA 1Y4ZB 2ZD1A 3B6BA 4O3SA 1XK8A 1SJ1A 3W5YA 2OIHA 4F2SA 4Y3CA 2HS4A 2LP4A 2ZBPA 1TU0B 4WP3A 4QR2A 4DI6A 5IV3A 2GHPA 1FJCA 3CMQA 3MOZA 1QAIA 1N36F 2N4CA 3H40A 2YNIB 1ZAWA 4DR6F 3W5XA 3KLEA 4X64J 2AEJA 4A46A 1ZAXA 1U48A 1QTMA 3A8KA 4QYRA 3PDNA 1WHXA 3UD3P 1LOUA 3G8SA 3TYTA 1WEZA 2IPOB 3W65A 3MECB 4QPTA 1KONA 3MPUB 1UWBB 4GKKJ 5K8NA 1FO1A 1O8BA 3K57A 2WVFA 3PW0A 4F0MA 3UD5A 4CQ1A 4LF4F 1QTNB 3BDEA 3FZBA 3T5JA 2KG0A 2ZOGA 3C6UA 4BC7A 2FJDB 3M6WA 4NCAA 1R27B 1SL2A 2J6SA 1M90T 4X84A 1D1UA 3BB5A 2CJKA 5KG6A 3CDWA 2MLZA 2HHXA 2ZJRQ 2XMUA 1RTHB 2FHKA 1ZM9A 4M8LA 2LDIA 2RAQA 4NASA 4JUZA 3MXHP 1DLOB 1TV6B 1KSPA 1S9GB 3BGRA 1F3FA 3IBCB 3PKYA 3JYTA 5EGYA 3X1LB 4CTAA 3IAM9 3F0NA 1S12A 2J5AA 4ILRA 2DYAA 2Z2LA 1PGZA 5HN0A 1JNZB 1U02A 1RHQB 2MZJA 1R0BG 2V9WA 4LREA 4WFXA 5DZ7A 1RU2A 1UTAA 4OJHA 3OXGA 2JDJA 3OSPA 1MU2B 2ADCA 2HFOA 2CJYB 3H98A 2RVJA 3M8QA 3CMAS 3OV7A 5HMYA 3Q22A 2I6WA 3Q8PB 2QIFA 2HHHF 3EICA 2PA8D 3NS6A 2A10A 1C0TB 2LQ8A 5J1NA 4F3MA 4PXBA 3OSNA 4OYIA 2VFTA 1R8HA 2QFIA 4B9NA 2X1GA 2BANB 1JJCB 1NJWA 2EK1A 3O2IA 3ZTSA 2MEWA 1Y5NB 2NQPA
chains in the Genus database with same CATH topology
3HJFA 4DUYF 1JKHB 1LKZA 2G1DA 4RW8B 4NZ6A 1C4AA 3HF5A 1JK9B 3UDCA 5D4PA 2DGUA 3R1LA 2YNFA 2RSQA 4C98A 2JZ5A 3DOKA 2VG7B 3LP2A 4Y2MA 5KFDA 1X0FA 3SQGA 1Y00A 1HBUA 2RKIA 2OTLS 3DOLA 2KRBA 2A3JA 3FEYB 5M2RA 3WDOA 3IC1A 2VA2A 3PFEA 1JLEB 2GFFA 3HVTA 1UJ4A 1L5UA 2RS2A 3Q2TC 2KYZA 1YITS 4J37A 4G3IA 1JLFA 1WNEA 4I56A 4KHRA 3NMRA 4IH5A 5F8LA 2ZDPA 3PKMA 1FJEB 5SUHA 3I9ZA 1O51A 4DV0F 1RWUA 4A48A 1VI7A 4PCQA 2K3KA 2QE5A 1L3VA 5IT9Y 2IVYA 3O1LA 2FLLA 1KLMA 4BHQA 4ES1A 1RTIA 2ZH2A 3R5DA 3OXFA 4PXDA 1X0PA 1VQLS 5I3UB 1K0TA 2IBKA 3QLHA 2XCAA 3PEJA 1RT5A 2H9ZA 1WF2A 4CO3A 5AXKA 4JV1A 3SEOA 5LXYA 1KQKA 4W92B 3IWLA 1Q7LB 4N41A 4MK8A 1VFJA 3S1TA 1NJZA 3CJ3A 4O3NA 3V5RA 2CQCA 7FDRA 2WB1D 4IUFA 1KRPA 2W7OA 2CQ1A 4IG3B 4RNOA 1GX5A 1Y3KA 4NCBA 1NHVA 2HGNA 2KHDA 1ZM3A 1N6QB 4BC9A 1HMVA 3I0RB 1IBKF 4Y2CA 4JYAF 2GMLA 4RBUA 2DHXA 3EPIA 2W9CB 4KRWA 3D5MA 2R7RA 2DIUA 1R0AA 1T3NA 2XLJA 5AXLA 1SL0A 2EG2A 1Q79A 2JJ4D 5IWAF 4HKQA 2K7JA 5DDRC 2C3UA 3GIJA 3CC7S 2ZJQQ 3KLHB 4K4TA 4ECXA 2AV5A 3DRPA 4TYBA 2MHNA 3SCLE 5LT5A 3GQCA 5GMKa 2VD3A 1DTQA 2AQ4A 3Q8RB 4NLQA 2HWIA 2VODA 2Q43A 2QV6A 4AYBD 3A8EA 3TW0A 3SV4A 3QWUA 4ID8A 4C8YA 1X9MA 2VBXA 2WBMA 4OZ1A 3WC2A 1QE1A 2D3ZA 2RMLA 3ZC4A 1U2RA 3CCMS 1ZZNA 3K5OA 4C0OC 2MKHA 4MKAA 3Q8SB 2BVZA 5FDLB 4NZ0A 1R31A 2GC8A 1S4FA 4I6YA 1UVMA 1VBZA 4CZCA 1OS5A 3C66A 3CJ0A 4PG4A 5ITHA 3MPWA 1G1XA 2R8GA 3U1LA 3ZZRA 4U6PA 5C5JA 3KJVB 2YKMA 2FJVA 4YUDA 3AHPA 1X4CA 5C25B 2ZD1B 3HMJG 2O1PA 1C2PA 1TR0A 4A8OA 1REVB 3GV5B 2GGPA 3S7RA 1S76D 2UXBF 3T6JA 4OL8A 4PRFA 4M63A 4DQRA 5DGAA 5DS7A 3IWNC 5CZXA 1NH7A 1ZBTA 3H5UA 3WX4A 4PUOB 1V3ZA 1WTFA 3K58A 3TNVA 3CCRS 3KHGA 3PIOQ 1HBMB 2FVPA 3PW2A 1AROP 1TZ0A 2XMTA 3IGVA 4P7TA 5EWFA 2F40A 3ZZ0A 2EKYA 3WZ0A 1RT1A 4B02A 2F8EX 2YWGA 1IKXA 2XG8A 2B5JB 2EBEA 3JSRA 1X4DA 3NCQA 4EZ9A 1RP5A 4HI2A 2DHAA 4KBIA 3UCZP 1FNO<