2IM1A

Crystal structure of poliovirus polymerase complexed with ctp and mn2+
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stabilization of Poliovirus Polymerase by NTP Binding and Fingers-Thumb Interactions.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
molecule keywords poliovirus polymerase
total genus 135
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 2im1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2im1A02
5KFMA 4QW9A 4IKAA 4Y2AA 1HNIB 1LWFB 4NCGB 5DG8A 4IRDA 2HWHA 1MMLA 1D0EA 3LP1B 4O3PA 1TKZA 5FDLB 5C24A 3GYNA 5KFOA 2RDIA 4QWAA 5L1KA 1N48A 1QAJA 4TY8A 3RAXA 2YNIB 5DGAA 3FQLA 5EDWA 4J9NA 3KLEA 4GC7A 3I5BA 3MEEB 4M94A 3LANA 3M8QB 4RW6B 4JV2A 4NLSA 1RDRA 2OPRA 2YNHA 3LP2B 1RT6B 3MFIA 4MIAA 5KFRA 3MR6A 4TY8B 1JLAB 2ZKUA 4RZRA 4ECTA 5CYQB 2C2RA 2AQ4A 4TY9A 4J9QA 1RTIB 5KFGA 3KLGB 2VG6B 3M8QA 4NLTA 1RTDA 1K1SA 4PQUB 1LWEB 1QUVA 2YNHB 1TL3B 2UUTA 3I0RB 3QZ8A 1TKTA 4RUCA 5KT5A 3IG1A 3OL6A 2YKNA 3PW0A 4RW8B 3HVAA 3BSAA 4ECZA 3PJWA 3BQ0A 2W8LA 5HP1A 4YR3A 3KLHB 1RTHA 1S97A 1W25A 4MKBA 3SFGA 4ZVEA 4ID5B 5F8GA 1BQMA 1NNDA 4QWCA 2XGQA 1T05B 4Q8EA 2AX0A 3MTKA 3KK3B 4DL4A 1IM4A 3BJYA 3H4DA 4RNOA 3DRSA 4Q0BA 5KG6A 2WRMA 2IC3A 3QLHA 3DOKA 1IKVA 4F4YA 4G3IA 3IS9B 2IJNA 1SUQA 1DTQB 4RW7A 3FDSA 3T5JA 5KT6A 3GV8B 1N5YB 4WXOA 1C2PA 1LWCB 1RT5B 4MK9A 1JLEB 2OPPB 4H4OB 1KHWA 1S1WB 1HNIA 2ZD1B 3IGNA 5HROB 4ZPAA 2E9TA 3DOKB 4Q8FA 5KT7A 4R5PA 4TQRA 1FKPB 1S1VB 4Q43A 5D3GA 4YP3A 1C1CB 3OL7A 1EETB 1IKXA 1K1QA 1GX5A 3CIZA 4IOBA 3LP0A 4IG0A 3V81A 5KFQA 5KFJA 2VG7B 1C0UB 1JLGB 1HMVA 3QO9A 2UVRA 3ISND 4NLQA 4K4XA 4Y3CA 4IFYB 1TQLA 4OL8A 1HNVA 3I5AA 5DQIA 1QE1B 2ASLA 3RB0A 3V81B 5I42A 2UUWA 2IJFA 2OPSA 3EPIA 2OPRB 5F9NA 3CJ0A 3LAMA 3GIJA 4ECQA 3QGGA 1TL1B 4KSEB 2AGOA 4B3OB 2YNIA 2I5JB 1FK9B 4IQXA 2OPSB 1JLCB 1TKXB 5EWEA 2HWIA 5F8HA 4WYWA 4MIBA 3FRZA 5KG4A 4URGA 4KKOB 1RTJA 2VG5A 4TQSA 1RT6A 4J9PA 1R0AA 5L9XA 1RT4B 3MR3A 1JLCA 2BR0A 3ICLA 4RW4B 5K14A 2BRLA 2ALZA 2J6UA 3TQ1A 4O4GA 5KFKA 1R0AB 3BGRA 1HYSA 3HVTA 2IAJA 5F8MA 3KK3A 5KFIA 2WHOA 1JXLA 1IKWB 3G6XA 4DG1A 1S6PA 2RKIA 4WFXA 4O3NA 2OPQB 4ECUA 2VA2A 4XPEA 4K4UA 3IS9A 5J1EB 2IAJB 3BR9A 4IG3B 3DI6A 2IA6A 3DYAB 4LQ9A 3G6VA 3QIDA 5CYQA 4J9OA 3BSCA 1N6QA 1TP7A 2C28A 1S9FA 4G1QB 1DLOA 4QW8A 5KFHA 1FKPA 5KFWA 2AGQA 3KLFA 4IG3A 2ILZA 3KMQA 3QGHA 2JLEA 1S1UB 1MU2B 4IG0B 3DOLB 4RNHA 2YNGB 5DGBA 2IMWP 2UVUA 5JUMA 4K4WA 1LW0A 5C42A 4J9LA 4JV1A 2YKMA 3SFUA 2D3ZA 3DOLA 4EO8A 3GILA 4FS1A 1UWBA 2ASJA 5KFTA 3QIPA 4KAIA 4RW9B 1ZTTA 1KHVA 5KFYA 2R2TA 2B43A 3LP0B 1S0OA 2FJVA 1LWFA 4ZPCA 2QE5A 1LW0B 4NCGA 4ZVHA 1GX6A 5C42B 5KFBA 3NGDA 5HBMB 2HMIB 2HMIA 4HKQA 4GC6A 2GC8A 3FSIA 4Y34A 1HNVB 3QLHB 2WONB 3NAIA 4ICLA 4ZMMA 1ZETA 3DRPB 3D5MA 5J2PB 4ZP9A 4K4VA 3T1AA 4O3RA 3BSOA 1N5YA 5J2MB 1JLEA 2OPPA 4H4OA 3UDLA 1RT3A 3TAMA 1TKTB 4RUAA 1TL1A 1RA6A 2WONA 5DQHA 4KBIA 1LW2B 3DRPA 4DL3A 2ATLA 1JLFA 4DL2A 4NLUA 3DLEB 4O44B 4RW8A 3MFHA 1TKXA 2E9RX 3T5HA 3UPFA 4QWDA 3KLVA 1RT3B 3TAMB 1S9GA 3PJXA 5I3UA 4WXWA 4NRUA 1T05A 2FVQA 1RT4A 3M9OB 3I0RA 5KT4A 1JKHA 1NHVA 3HKWA 3KK2A 1RT1A 3JSMA 2YKNB 5DG9A 4EBCA 2BANA 3MECA 3OSPA 4ECVA 2O5DA 2DPIA 2AGPA 4RNNA 3LP1A 4URQU 4ECXA 3KLHA 2UVVA 4G1QA 4F4ZA 4DG1B 3LAKA 3IN5A 1DTTA 1S1XA 2BRKA 3NBPA 3DLGB 3V6DB 3DRRA 3PW4A 4O4RA 1I6JA 3OLBA 1S1VA 3DM2B 1BQNA 2JC1A 4HYKA 3QYYA 4KHMA 1DLOB 1RYSA 1C0UA 1JLGA 2WK4A 2YKMB 2D7SA 1SUQB 2B5JA 4IR1A 4RW7B 4KFBB 3V6HA 3DDKA 1C0TA 4PWDB 4H4MB 4I2QA 1EP4B 3DMJB 2R8JA 3IRXB 4EYHB 4I2PA 3EZUA 5DLGA 3MEGA 3M9NB 4R5PB 2YNFB 3E01A 5HBMA 3G6YA 3KHLA 2GIQA 3H4BA 4MK7A 3RBEA 5KFSA 4ED1A 1HQUA 1HPZA 1S6PB 2EC0A 3H2LA 3MR5A 2J6TA 2HNDB 3CJ5A 2R8IA 3PW7A 1IKXB 5CYMA 3GIMA 3OHBA 2RF2B 1FKOA 4J9MA 2R8KA 3JYTA 3CVKA 3KJVA 3PR4A 5HP1B 2W8KA 4KKOA 4QWEA 1RTJB 2VG5B 2WOMB 1QE1A 4ECWA 3GV5B 1CSJA 5J2PA 1ZTWA 4WE1B 4DL5A 4NLVA 2HAIA 3RB3A 2FVCA 5KFEA 1T94A 4KB7A 3HHKA 3DRSB 2F8EX 1RT2A 5KFDA 4K4YA 4DL6A 1JLAA 3UQSA 1FK9A 3CWJA 2IM1A 4KO0B 2FJWA 4ED0A 2IM2A 3FQKA 2XGPA 1LWEA 4DEZA 3KNAA 1TL3A 3QIPB 4RW9A 2V4QA 5HLFA 1S0MA 2OPQA 4ZP6A 5F8LA 1N56A 2QV6A 3GIKA 1SV5B 4EEYA 4LQ3A 3OSNA 4O3OA 2R8GA 4R8UB 3N6MA 3DYAA 2W9AA 1JX4A 4QPXA 4ZVGA 3NKYA 2VG7A 4RW6A 3OL9A 3MEDA 4RNMA 3KLFB 4LSNA 2BANB 3MECB 2WTFA 3GQCA 1XR7A 4R8UA 2R8HA 1IKWA 4RU9A 3KLIA 1S48A 3KOAA 1REVA 4I7FB 3GIIA 3PZPA 2YNGA 4X2BA 4Q0BB 4O44A 3H5SA 4EYIB 5J2QA 2B6AB 3DI6B 3UR0A 3Q8RB 2FLNA 1S0NA 2V4RA 2XI3A 1LWCA 1S9EB 2ZE2B 4YQWA 3V6JA 3MEGB 4TLRA 1NHUA 5EWFA 1Z4UA 2IM0A 3E01B 4IH6A 5KFNA 2AU0A 3TVKA 5J2QB 1HQEB 4MFBB 1RYRA 3H5UA 4Y2CA 3CDWA 4H4MA 1S9EA 2ZE2A 3C6UB 1BQMB 3RB4A 3DLKB 1RT7B 1S6QA 2RDJA 2WB4A 2BE2B 2DPJA 3BQ2A 4K4ZA 2WOMA 2YNFA 3QO9B 2JEIA 2HNZA 2HNYA 2XWYA 4U7CA 4U6PA 2C2EA 4NLYA 4IFVB 3NBPB 1LW2A 3NL0A 1JLBB 2WCXA 4YR0A 3V6DA 5CYMB 4IRCA 5KG5A 4NRTA 3CO9A 5KFFA 4EO6A 3T5LA 3N6LA 2W9CA 2HNZB 1BQNB 5KG7A 3OHAA 1RA7A 4J9SA 2ZD1A 3SI8A 4KHRA 4FBTA 4ECYA 2FLPA 4IRKA 4K4TA 1S1TB 4KV8B 3H98A 1VRTB 5DLFA 5D3GB 2FVSA 4ED8A 4PWDA 4K4SA 3H5YA 4PUOB 4ZHRB 2AWZA 4URSA 1JKHB 3KK2B 3JSMB 1S1TA 3KHHA 2XCAA 3I0SB 3ITHA 3LALA 4IFYA 1T03B 4IR9A 4KO0A 2HNDA 5F8IA 1T3NA 2GIRA 3VQSA 1OS5A 3JYTB 4NLPA 4ZP7A 1DTTB 2IC3B 4O4GB 1IKVB 2XCPA 2FVRA 3BGRB 3CJ3A 1HYSB 3RB6A 4LSLA 5KG0A 2W9BA 3E51A 3KLIB 4I7FA 4J9RA 3EPGA 3V6KA 1RT5A 1S4FA 1TKZB 2I5JA 3MF5A 4IDKA 1HARA 2RKIB 2ILYA 5KG2A 3CDUA 4Q45A 4F4WA 4DL7A 4LSLB 2W9BB 4F50A 4EBEA 2JEFA 3KMSA 1C0TB 1TV6A 5F9LA 1JIHA 3IGVA 3KK1B 3V4IA 4I2QB 2R2RA 2CKWA 3RBDA 4IDKB 2BQRA 2BQUA 5L1IA 4NZ0A 1S1XB 4RW4A 3BSNA 1JLQB 4NLRA 1SH2A 1VRUA 5C25A 4MK8A 3MR2A 2B6AA 5HLFB 1HPZB 1HQUB 3PVXA 1RTHB 3KK1A 3V4IB 2UVWA 3HVWA 3DM2A 3HVTB 1XR6A 1J5OA 2J6SA 5DQGA 4WFZA 1C1BA 4XO0A 1RTIA 3Q8PB 2RF2A 3KLGA 3D28A 3G86A 5T14A 2JEGA 3CJ2A 2R2UA 2B5JB 4KFBA 3C6TB 4R0EA 4MKAA 1S10A 3IG1B 5J1EA 2FLLA 4B3OA 1IKYA 4I2PB 5L1JA 3RAQA 2ASDA 3KHRA 3DLKA 4WZMA 4NLGA 1N6QB 2I1RA 4ED7A 2D41A 3N6NA 1RT1B 4KV8A 5HROA 1SH0A 1IKYB 1VRTA 1FKOB 3Q8QB 4ED6A 4JV0A 5KFAA 3KLEB 3MEEA 1S1UA 5KFZA 4YR2A 2BQ3A 4ED2A 5KFLA 1EETA 5J2MA 2XI2A 5EUHA 4F4XA 2W7PA 2D3UA 3H5XA 1SV5A 1HQEA 4MFBA 3CDEA 5JXSA 1JLFB 4WE1A 5KG1A 5DG7A 1TVRA 1S49A 5FDLA 4NLXA 3M8PB 4TYAA 2AX1A 3GV7B 1S1WA 1RT7A 1S6QB 3BREA 4WZQA 3PHEA 2BE2A 1KLMA 2JEJA 5I3UB 3MEDB 2CJQA 5F8NA 4ICLB 2VA3A 3T19A 1REVB 1EP4A 3DMJA 4TYBA 2E9ZA 4QWBA 2JC0A 3ISNC 4JUZA 4NYZA 5C24B 2W7OA 1KLMB 4EBDA 5KFCA 4ECSA 4NLDA 4XPCA 4ID5A 4IH5A 2IBKA 3PW5A 2C22A 5KFXA 4IH7A 3CJ4A 4ZVFA 3Q8SB 4ED3A 2VG6A 5F8JA 4Q44A 2XC9A 4KE5A 3M9MB 3H40A 4J9KA 3PW2A 1RTDB 4PQUA 4PUOA 1WNEA 4ZHRA 3DLGA 5KT2A 3T5KA 3DRRB 5K14B 1N4LA 3LP2A 4FS2A 5KT3A 1UWBB 3I0SA 3ITHB 2V0NA 5EWGA 1T03A 3FFIA 4YMEA 3KHGA 2FJXA 5C25B 4K50A 3C6TA 1QAIA 3BQ1A 3OLAA 4RNFA 1RT2B 4ZP8A 4WYLA 1C1CA 2OH2A 4IFVA 1JLBA 5L1LA 1J5OB 1XR5A 1C1BB 3FFIB 4MH8A 3QGIA 1HMVB 2V9WA 4FBUA 1YVFA 2W9CB 5KFUA 5KFVA 4ZPBA 4TXSA 3NAHA 3I5CA 3C6UA 4WFYA 5I42B 1DTQA 1SH3A 3DLEA 4TN2A 5KFPA 1TV6B 4ECRA 5J2NA 3KJVB 1MU2A 2FVPA 3QZ7A 2HNYB 5KG3A 4ZPDA 4O3QA 4NLWA 1S9GB 1JLQA 1VRUB 3PR5B 3H59A 2R2SA 1RAJA 4M95A 4NLOA 2IM3A 4LSNB 4H54A 1U09A 1TVRB 2C2DA 4O3SA 3NMAA 5J2NB 3M8PA 5C5JA 3OL8A 1D1UA 3IRXA
chains in the Genus database with same CATH superfamily
5DJBA 2DBBA 1V3ZA 3DC2A 4Y2AA 5HJXA 1LWFB 1VQOS 1MNEA 3OFHA 4AXIA 1VC5A 4LBHA 4DDFA 1JJ2R 2GO9A 2POKA 3M8RA 2YWHA 3LP1B 2WW8A 5DO2A 1TKZA 2RS8A 4HL9A 5C24A 4A8YA 3UD3P 4I4BA 4CM2A 1NB7A 4JI1F 4C3KA 2NREA 1OSCA 2DIVA 2FJEB 2Z57B 4ZVPB 4PKDB 2CPZA 5AXLA 1B3TA 2V8HA 2ROGA 4C8KA 2DR7A 4ILMA 2MZTA 3PKMA 3RTVA 1UUJA 4ATNA 3CCQS 4U7UK 1D09B 2DK2A 3ELHA 3I5BA 3TJ9A 1U6FA 3UDCA 3PKYA 3PX6A 3M8QB 1KD1T 1UETA 4L75A 4NLSA 2UP1A 3LP2B 3MFIA 5LMUJ 1ZH5A 5KFRA 2BXJA 2CPHA 2GW8A 1LXNA 2CPXA 2HIYA 4J9VA 2G13A 3TJAA 1BE4A 1NRKA 2ZKUA 4ECTA 3GFHA 2C2RA 4IOAQ 2UZAA 3AX5A 4K2JA 3T1YJ 4NLTA 2AJ4A 1K1SA 4I1TA 4P73A 4PQUB 2DGOA 2DKOB 2UUTA 3AD9C 3K89A 3QZ8A 3NMRA 2QLFB 3P96A 1TKTA 1FJEB 2Q1LA 1GFWB 3OL6A 4LT6A 1OPIA 1YIJS 4EUVA 5CD4H 3JB9k 3FZBA 2H5JB 2C42A 2UXDJ 3HVAA 4LF5F 4GKKF 5K5MA 4ECZA 2O67A 3MM6A 3MZIA 2I6WA 1EB0A 1IBKF 4NEZA 2AYGA 3CJ8A 2G2ZA 2GVDB 1K9MT 3IC1A 3SFGA 1T05B 4ID5B 2DXEA 5D0EA 1ZAXA 4CDIA 1J5EF 1IM4A 1XNQJ 3VAKA 3DRSA 1L3UA 2IC3A 5T41A 1U2RA 3AB4B 3DOKA 4ZOSA 2V63A 2MKYA 4F4YA 1AUDA 1WG5A 2IJNA 4G3IA 3D0GE 2HHWA 3T5JA 4P6QA 5LSOA 3RBXA 4NI2A 1RT5B 1SJ3P 2MSTA 1VC6A 1XNRF 2PMWA 4OZ5A 2ZD1B 3IGNA 4Y65A 4CIOA 4JI4F 3NNHA 5CD4A 4B9MA 4DMZA 3SCLE 1WEXA 4Q43A 2C3OA 5D3GA 1FWKA 2GMJA 1C1CB 2YBVA 4G65A 4YP3A 1SXLA 1YDLA 1GMWD 1GX5A 3V81A 3R1HA 3LP0A 4B3TF 3THPA 1PAUB 4CCHA 5KFJA 2DNNA 2XLKA 4OYPA 1C0UB 1HMVA 4MTPA 5U47A 4C48A 1U02A 1HW8A 2BX6A 2K06A 4IFYB 1TQLA 3QBCA 2NR0A 1HNVA 2LCWA 5F0UA 2ZVIA 2ASLA 4JI0J 2HVIA 3MCOA 5BYRA 2ZH1A 2XO7A 5AXKA 3WX8A 2FGCA 3DDNA 2R4FA 1WEZA 3FBEA 2LA4A 1NDPA 3MUVP 1OPZA 2C2KB 2HURA 3HULA 3H2VE 3D3BJ 2ZC4A 4B3OB 3U02A 1GK8A 2KRRA 1FK9B 4IQXA 2JWNA 2MQOA 1M5KC 2KJWA 3HJVA 2M70A 2K8GA 1XK8A 1Y0HA 3KDOA 1KVIA 1YQHA 3EGNA 2FTRA 4KKOB 5A0YA 1FRHA 4X4SA 1VDHA 2UU9F 4X84A 4J9PA 2R7SA 3D1HA 4LVNP 2W2PP 4DCJB 3GPAA 2MGZA 3Q89A 2APOA 1RT4B 4DUZJ 1MW7A 2CYYA 3ICLA 4RW4B 3V2UC 2IRUA 2U2FA 3ET6A 5K14A 4ERDA 5KFKA 1R0AB 3HVTA 1SBRA 3GWCA 2HVHA 4CM0A 3KK3A 2GCFA 4X4NA 3LWLA 1X4HA 1XMQJ 3MAAB 3G6XA 2AJ2A 3GMGA 3OQ2A 4DWIA 3OPKA 1S6PA 2OGUA 2QA4G 2LDIA 2GHPA 1CBKA 5FLXY 1H74A 1KDNA 3EVMA 2IAJB 3JQKA 4USIA 4X65J 3DI6A 3ILOA 1IJFB 4RO0A 2B9XA 3J7YI 3ZNUA 1JNRB 3G6VA 5CYQA 2L9WA 5K8PA 5F3TA 1RGVA 2DNQA 5KFHA 2MKSA 2FIUA 2AGQA 3U7JA 3PEJA 2FJDB 3MM7B 4IG3A 5GMEA 1KKHA 2FDNA 3KLFA 4JI3F 1VQNS 3QGHA 4ZIWA 4CT8A 1C4AA 4HDHA 1HA1A 4ZPTR 2NYHA 3D4JA 2ZEJA 3S01A 3SCJE 5DGBA 1N33J 2IMWP 2UVUA 4WP3A 3UWTA 5M2RA 1WJ9A 1LW0A 4JV1A 2XS5A 1WACA 4J9LA 1S5ZA 1FT8A 2AEMA 2YKMA 2VIHA 1HHSA 1FD8A 4X62J 4EO8A 1UZHA 4QZVB 1XMOJ 2HFSA 3A3PB 2ASJA 2B4PA 4WK3A 2WB1D 1Y5LB 2FJVA 1VQPS 1UEUA 2J76E 4ZPCA 5BJRA 3TAPA 2RUSA 1WC0A 1GX6A 3FC9A 3S7RA 1TMJA 2HMIA 4GC6A 1UPMB 3VZHA 5E41A 1NKCA 4DFPA 3NOGA 4ZMMA 3QLHB 3MMAB 2RHSB 3D5MA 5J2PB 2DTJA 4O3RA 4RL1A 3BSOA 4P74A 2DB1A 4U8VA 1VMBA 2N3LA 4H4OA 1TL1A 1RA6A 3DHXA 4KBIA 1RAOA 2E5LJ 4Y6IA 4LF4J 1JLFA 1CJTA 1S4EA 3GCWP 4J7CA 4DL2A 2A0FB 2CPYA 5B0AA 2FC9A 3T5HA 1P9QC 2DGUA 1RT3B 2VBXA 1CVJA 3SQGA 3UNYA 3DN9A 4ZLNA 1YJTA 2FHJD 4LFCJ 4HTJA 4U9RA 3TQEA 4NRUA 5J1PA 2FVQA 4NYPA 4OYBA 1M0SA 1EQ0A 2V2QA 1RXOB 1WHWA 4KYZA 4C2MA 3IXQA 1GTEA 1P9YA 1X0FA 1RT1A 1NUEA 3I9V9 2E1RA 2YKNB 4KGVB 1V9OA 3MEKA 4M8LA 3DLHA 3MECA 2QFIA 4WJBA 1KTQA 3OR1A 1I5OB 4HT7A 4PABA 2HHHJ 3LP1A 1QAXA 4URQU 3GR1A 3M2RA 4WIQA 3SDEA 4A4JA 4DV5J 4F4ZA 4ECXA 3LAKA 4LREA 1VQ5S 2ATCB 1DTTA 2BRKA 2CWKA 2PDAA 3GJQB 3ZTOA 1L3TA 4QBUA 3DRRA 4O4RA 2HK3A 1I6JA 1X9SA 1RHRB 4BWMA 3M30B 1BQNA 2DH8A 4B9TA 1BWEA 3CCSS 4FKXA 2LEBA 3R7NB 3L9ZA 2NPFA 1MMNA 4OYAA 4IR1A 4S0MA 1SPBP 4KFBB 3V6HA 4ED4A 2V50A 2CJAA 3S6EA 3D1OA 4QIFA 2EXUA 1HBUB 2IA0A 4LUBA 5DLGA 5E33A 4M5GA 2DGSA 2YNFB 3TJ8A 3UO0A 3HLUA 2EVZA 2WVEA 3T9NA 3RBEA 1N32J 4ED1A 2DRAA 3MR5A 2NQPA 2BJEA 1DRZA 4JI5F 2HNDB 3CJ5A 3PFEA 2B3TB 4F3MA 2RQCA 3FRYA 4ZLLA 4C8ZA 3KWMA 4FPIA 5CYMA 3GIMA 1FERA 3M8WA 2AYEA 1FRMA 3JYTA 3TOQA 3CVKA 3KJVA 2Z58B 4QWEA 3MM8A 1RTJB 2WOMB 4CLWA 1FXDA 2DIUA 4LR7A 1FRLA 1TK8A 4JI8F 1BGXT 1RSCA 2CJYB 2OEMA 4L72B 4PPZA 5IV4A 4HI2A 4F7VA 3MM9A 1KVKA 4FYWB 3NNCA 4QR0A 2VKRA 1FXRA 2E1MC 1FEEA 3IO1A 3K5OA 4KGMA 4RJVA 4XTTA 5CH7B 3DRSB 3CCRS 4K4YA 1T7PA 2CPEA 1R6VA 3FEZA 5A8WB 4KO0B 1M5SA 3EUNA 4QR1A 2FJWA 1HQ2A 1IM6A 1FESA 4I64A 1H38A 4KPYA 1UEKA 4DEZA 2G2OA 3PYFA 1WUUA 2CG8A 2OO4A 2GAGC 2LQ8A 3QIPB 2OPQA 4RW9A 2AYBA 2MY8A 2CJKA 1HW9A 2GQCA 3PTWA 5IS2A 4ENOA 2LU2A 4EEYA 4LQ3A 1SL2A 1SKRA 5HSPA 3MOJB 7FDRA 2V9KA 3DYAA 5IFMA 3P6YC 5EGYA 5H9EK 2PC6A 1RBLA 4ZDNA 1OY8A 3NKYA 3NGKA 1GEHA 4LSNA 1X31C 2ZITA 2O1PA 5ETSA 4ZVUB 3GQCA 2XQCA 4R8UA 4DR4J 1IKWA 2M5YA 4DR1J 2BKPA 2QYGA 1S48A 3CMQA 5HQMA 3QRPA 5A8KB 2MDAA 5DDOC 5T7LB 3CGIA 3D6MB 4U7UD 2H4YB 2QC3A 3O2IA 3FEXB 1SB6A 2HHSA 2GVZA 3DXBA 3RZAA 1EQMA 2E7XA 4K59A 2ZH5A 2HZAA 2XI3A 1S9EB 2ZE2B 4YQWA 3J80U 4TLRA 2FQQB 2IM0A 3FCVA 4IH6A 4HACA 4QOTA 4CWBA 5J2QB 1IQZA 2A2DA 4OZ2A 4NYOA 1HQEB 2KG1A 3GB0A 2XSJB 1IR2A 3N4WA 1WOPA 2CZVC 3D9BA 3RB4A 3FBFA 1XN9A 2BE2B 2WB4A 2N3OA 4HH1A 4E98A 1MROA 3L7UA 3OTDA 4ANDA 2DNZA 2CQGA 4F3OA 3CC7S 2HNZA 3BH7B 2HNYA 1AFJA 4U6PA 2C2EA 4USUA 1LFPA 3AD7C 4F0KA 3NL0A 2RIJA 3V6DA 1S57A 4IRCA 4N76A 5KG5A 4NRTA 2OFHX 2RDDA 1S6UA 4Z2XA 4YOEA 1QSLA 2MLXA 4BS2A 3ISZA 1N5SA 2E1AA 2QA1A 3ZZ0A 4Z7YA 3MCMA 4HH0A 4FBTA 2ZD1A 1CJKB 3M6UA 2RB7A 4KHRA 3M8ZA 2AJ1A 4K4TA 3BH6B 3CNQP 5ETTA 4KV8B 2KFYA 2FLPA 3U1MA 1GNKA 5D3GB 4B3RJ 4PWDA 3H5YA 2F63A 3PRVA 1TR0A 3CJSA 1JKHB 3CDBA 4F0MA 2N4DA 5IWAF 1U1RA 1IBLJ 3GCXP 3AXMA 2P5VA 3M2VB 2XCAA 2BJ7A 2KG0A 3JXOA 2JFDA 3I0SB 3ITHA 3UVJA 4IFYA 3TA1A 3W64A 2OI2A 5F8IA 4HI1A 2VPZB 2FHOB 4JI2J 2GIRA 4F02A 4G6VB 4FNIA 3VQSA 1SVDA 2KT5A 2RU3A 1L3KA 4PG8A 3BGRB 3MAHA 2RD5C 2UV8A 3Q22A 1YX2A 1B4SA 4J9RA 4N77A 1UAWA 2LQ5A 3FSYA 3E8OA 4BLGA 3TUZC 1HARA 2RKIB 2FLNA 3W61A 2MKKA 2ZBQA 1QSYA 4RBTA 4Q45A 2HS4A 3P8BB 2G1DA 1U1KA 4LSLB 3KTQA 4EBEA 2JEFA 1C0TB 1EJ7L 1TV6A 3LWMA 3MPWA 3IGVA 1F2GA 4I2QB 2R2RA 4QJVA 2BQRA 4F8RA 3EYZA 1S1XB 4RW4A 3G6ES 2DNYA 5EX0A 5L1IA 5C25A 3OXLA 1ZBTA 1RP5A 2MQPA 1HPZB 2LYVA 2PA8D 3PG9A 3V4IB 2GGPA 2QL5B 2XS2A 1V5VA 3HVTB 1RWXB 2XNQA 3CDAA 4WFZA 3W8GA 4DUTA 5DQGA 2X1AA 2RF2A 1NJZA 4OFZA 1FVQA 3D28A 3DFEA 4AUKA 3QJJA 2R2UA 2GS8A 2B5JB 4RBVA 2J9EA 2UUCF 2HVZA 5HMXA 3TAQA 4GKKJ 5D0GA 1Q16B 4MMOA 1WF2A 1Q86T 2OMLA 1EAYC 2ASDA 4UT4A 2WSCC 3DLKA 2XTEA 4NLGA 2WSFC 2BM1A 5FD1A 1H0HB 3N6NA 1RT1B 5IM0B 2FLOA 4KJIA 3POTA 4NXNF 1SH0A 1R6YA 1W2BR 1FKOB 1PSDA 3W1YC 3KLEB 2CJXB 5KFZA 1AFIA 2ROEA 4EGLA 1UZDA 2BQ3A 3GYXB 1LFWA 5J2MA 2DHAA 3KUEA 1V3SA 2L3MA 1U8WA 2W7PA 3ZZPA 1GT8A 3GFYA 1XNRJ 4OHYA 2Z2ZA 3H5XA 1XJWB 2Y1LB 3MMBA 4USVA 4A8KA 1Y10A 3VV2B 3CDEA 3TO8A 3GLJA 2HPUA 1S49A 3H0PA 4A8QA 2E7WA 3M8PB 3M32B 2AX1A 4CLYA 1S6QB 2H4WB 2IPOB 2PD1A 3BREA 3WX4A 4B9VA 4I6WA 2E29A 3ZTSA 4ETXA 5I3UB 1VBXA 3NGSA 3NXZA 1DY3A 2HFOA 5F8NA 2DGWA 1FDBA 1REVB 2E9ZA 4PXDA 4QWBA 3TX0A 3ISNC 1H7WA 4WP9A 1FJCA 4JI0F 2A3JA 3D1QA 2HBZB 4PWUA 2VOOA 1UL3A 3ADAC 3CD0A 5AE2A 1HI0P 3UN5A 1OYEA 2LFVA 2OIHA 4ZVFA 2QG9B 5IWAJ 1IBLF 4XDDA 1DQAA 4EU0A 1WC1A 3FKBA 3H40A 1NCLA 2DXFA 3EGVA 1NSKL 2QN6B 4YY3J 2ZWOA 2V1SA 3SYZA 4ZHRA 3PW2A 4PUOA 2W4DA 3T5KA 1OQ3A 1WTFA 3ET6B 3ILJA 5K14B 1IBMJ 2YXLA 4JI2F 2HGMA 1FDNA 1UWBB 4GKJF 2Y1RI 5EWGA 4B3SF 4O0IA 4U96A 4YMEA 1UVMA 4KGZB 4K50A 2CQ1A 1CC8A 2H9ZA 3MAAA 3W5ZA 2MSSA 3MI7X 2N7CA 2FZCB 4WYLA 1LXJA 4YB6A 2R3VA 5A6PA 4IFVA 1Q4RA 2LQBA 1JLBA 4KIAA 1T0TV 5L1LA 3HO1A 1PBUA 3NCQA 2XY6A 3AAWB 2BOPA 4IQMA 3QRQA 3U27A 1CLFA 3KKFA 2GHWA 1YBAA 1GMUA 1SC6A 2BUNA 2DCLA 1CEZA 3NLCA 5KFVA 2KJVA 2Y3YA 1D8ZA 4I69A 2CFXA 4I0WA 3I5CA 5H9FJ 1SL0A 1DTQA 1UFLA 3WQPA 4LF6J 1SH3A 2NUUG 4KT0C 3TA2A 3AOBA 3MGJA 2DHSA 4TN2A 4DLEA 5J2NA 4FF2A 4UQGA 4QYRA 2YH1A 3QZ7A 1ZAVA 5GMKa 4ZPDA 3US5A 1GQEA 3R1LA 3H59A 2R2SA 4M95A 4PG6A 4LSNB 2DEIA 2OAUA 4H54A 3VTIA 1TVRB 3CD5A 2YPZA 4D3GA 1RWUA 3J7Z5 3AX3A 4HDGA 5C5JA 1VK3A 3CPWR 4M5DA 3OL8A 3MCNA 1EZZB 3HFKA 2OFGX 5T7LA 1YHQS 2NZCA 1HBOB 4IKAA 1HNIB 1RHJB 1UWAA 2CZ4A 3BGUA 3R97A 2LEAA 4ES2A 2M8DB 1KONA 1WKJA 1U7LA 2XYGB 4O3PA 1X60A 2MQQA 2F8MA 5FDLB 3C2PA 2CNLB 2YWGA 5KFOA 3VGVA 2CQHA 3IA0A 3NRBA 2DY9A 2V68A 2ZNYA 3R6LB 2ACYA 5L1KA 3J81j 1U48A 1X8DA 1YRTA 3VGSA 2QRRA 2C2ZB 3CD7A 1QAJA 5I3QA 1SJ4P 2YNIB 5DGAA 3MDFA 4A8MP 4WBFA 3PM9A 2ZHBA 4J9NA 1RWNB 1F3VA 3MEEB 5AE3A 3LANA 4DSFA 5B09A 3AA8A 4X66F 2LU1A 2O66A 2OPRA 2ZH4A 1RT6B 3HSZA 3WDOA 3PYEA 3QGPA 4DU7A 5CCLA 1Q81T 4CNYA 1X9MA 4RZRA 3L4BC 3KLGB 1S76D 3M8QA 1RTDA 5HK4A 2ZDOA 5HI7A 4JI6F 2ZBIA 2BMBA 4OZ1A 4RKUC 4GVBA 1CJKA 2ZKTA 2AZ3A 1TFYA 1HKAA 3AOCA 2YKNA 1B0VA 5MLCV 3M6XA 3BPDA 2ZJQQ 1AROP 3EX7B 1Q79A 5HP1A 2H5EA 3VAIA 2B51A 2MHNA 3AA9A 2I2YA 4YR3A 1T9TA 1RTHA 3M2RB 1P27B 2XEXA 3SDEB 4EFAC 4F67A 3UCGA 4DL0C 1UA0A 1NNDA 4GO7X 4W4MA 1YGYA 2ZDPA 5KAKA 1HBNB 2DGVA 4OI3A 4OJGA 4ZVRB 1FNMA 2KM8B 4DL4A 2HZVA 4B9UA 2AJQA 2EG1A 4RNOA 1HWKA 3MM5A 3EZOA 4DV6F 1R8HA 5HAOA 4KHPJ 2FD2A 2IYGA 3FDSA 4LR9A 5KT6A 4DPUA 1N5YB 4WXOA 2LEPA 1C2PA 5CCMA 1JLEB 4XAKA 1N5TA 1KHWA 5JJBA 4WFNQ 4Q8FA 1XERA 4ZPAA 2E9TA 2W1BA 3DOKB 4PQAA 3CTRA 5KT7A 5GADI 1X4CA 2XTDA 1ZA1B 5FJ4A 1S1VB 3R6GB 4LF6F 4U8YA 3OL7A 1YJ7A 3C15B 4IOBA 4C0BA 1M5HA 4DS5A 1DARA 1B0TA 2K3IA 1SQEA 4FDFA 2EFOA 2EPIA 3MWBA 4FF3A 4Y3CA 3KJQB 4OL8A 3VAHA 4USJC 5LOQA 4OZLA 3NS5A 3R27A 4LF9J 3BEGB 4LRAA 3V81B 3RB0A 2MQ8A 1V3RA 2UUWA 2QX0A 2OPSA 3EPIA 2DH9A 1R7IA 1QVFR 3G9CA 5F9NA 2GJFA 4XDCA 2X51A 2HS3A 3LAMA 3CCVS 1C4CA 2JOQA 3QGGA 4OHXA 3AJDA 1U24A 2AGOA 1BY9A 1Q95G 2MQNA 1T95A 2YKOA 5DM7Q 2I5JB 1TKXB 3P45B 5LL6d 2HWIA 5F8HA 3ENWA 4WYWA 4MIBA 3ZC4A 4URGA 2ZH8A 4ER8A 3OR2B 1IXKA 4WTYA 4TQSA 5IXUA 1CS4B 4NZ6A 2RUGA 1NDKA 4D3HA 5CA5A 4WFBQ 3CCJS 3QRRA 3BKUA 3TX8A 4N5SA 4DR6F 5ETQA 2QMXA 3UDVA 1V5IB 4V19J 2WSEC 2VJVA 5E2QA 3WC0A 4P9SA 2Y1IA 2DHHA 1OM2A 3IM8A 3M8YA 1WHXA 2BJ3A 1ZZFA 3TQ1A 1RU1A 3VAFA 3BGRA 1S0VA 2V4JA 2BJ8A 3I87A 5F8MA 3N0VA 1S7IA 1HWIA 2WHOA 1JXLA 1FI4A 1IKWB 2DH7A 3T9ZA 5DDRC 3QATA 3MD3A 4AT1B 4OI0A 2E66A 2RKIA 5ETNA 4JB8B 1U47A 3GG1A 5L38A 2GVDA 3R2CJ 2BEFA 2D68A 3BR9A 4NE9C 3BPSP 1KS2A 1QVGR 4NZ7A 2IDEA 3ZFVA 1T9YA 1S9FA 3HF5A 4G1QB 1DLOA 4QW8A 5K8MA 2I8EA 1MLAA 1TL7A 2MZJA 4FNHA 1OYDA 3QPIA 1RHMB 1S1UB 4UW2A 4DX8H 4LSZB 4RNHA 2D69A 4HR2A 2M7SA 2CNNB 2JLFA 2QYCA 4DV1F 5D77A 1RBAA 2ZWPA 5JUMA 3MPYA 3BGFA 1WDDA 3IP0A 3MHYA 3SFUA 2R7VA 1Q53A 2D3ZA 1MWYA 1LEOA 1LNQA 1NH7A 1UWBA 4C7QA 1R8PA 1EX8A 2DGXA 3QT8A 4OHWA 4DV3F 3AWRA 2XSFA 3LP0B 1ZM2A 2R2TA 1GAOA 2QE5A 5E3QA 4ZITA 1LW0B 5A2QU 2Y8YA 3H2UB 2M9KA 2HIQA 2BVZA 4CI0B 1YKWA 3M1VB 3RU0A 3T6JA 5HBMB 5IQ6A 5LMNJ 1RAIB 3FSIA 1GH8A 1HNVB 3CJKB 4ICLA 5DDPC 3NAIA 4Q7AA 3FUYA 1UEVA 3RR8A 2XZ2A 4QU7A 1WHVA 2CQ2A 3H8YA 4V1Ak 2OPPA 5J2MB 3UDLA 2FJAB 2V67A 3TAMA 3JAMU 1TKTB 1LK7A 2N4CA 3DHWC 4L73A 2G2YA 2Q79A 4RUAA 2MGZB 1LKZA 3ZZUA 3MMAA 3TZYA 1YBTA 3IWXA 3HHDA 4DL3A 2E1PA 5DZ6A 1KEKA 3P4UB 4KRWA 5E3PA 2IIHA 4ZVQB 5L46A 4WCEQ 2ZH3A 1H72C 1M1GA 3VHQA 3T1HF 2DR9A 4NCAA 2F4VF 4ZK7M 4DV0F 3CIMA 4NEYA 3BO3A 5I3UA 3A8KA 4WXWA 2OTJS 5ETRA 3TUIC 1T05A 4KH0B 1RT4A 2LQ9A 5HQ8A 3I0RA 2XWXA 2DNLA 2CVEA 1Y00A 4F4AA 3HXMA 2H5IB 3UFCX 3JSMA 4JYAF 5DG9A 2Q3PA 2BANA 3R5CA 2D3OR 2GFFA 1MSWD 1X5OA 1WORA 2GHVC 4ECVA 2DPIA 2JVRA 1M1HA 1S59A 4L76A 3ZNJ1 3QWUA 1UJ5A 2DJWA 3ZZYA 5K8OA 4P2FA 3IN5A 3W63A 2UVVA 1URNA 1S1XA 1B7YB 3BV8A 3L7PA 4X64F 3NBPA 4USTA 3UNGC 4WKRA 4DSKA 1Y3KA 2KT3A 3OLBA 5CYJA 1YJVA 3LF0A 1NJIT 1OO0B 4CNZA 2EWHA 4AFFA 2GGPB 3SSRA 1NSQA 1VFJA 2W2QP 1VQYA 4CO4A 1YSJA 1M5OC 5F3ZA 1RYSA 1C0UA 1SCJB 2YKMB 4OZ0A 5E3RA 3KHLA 3CMES 2B5JA 4W92B 2PE8A 1GMVA 3MMJA 4RW7B 1YJRA 5HMYA 2XS7A 3DDKA 4H4MB 4TU9A 4ES1A 5IOLA 2R8JA 1FJGJ 4EYHB 3EZUA 1FO1A 3LGHA 3RRHA 2N7YA 2F4FA 4KTQA 4LMZA 3H4BA 1T8EA 4MK7A 4OYOA 3C16B 1HQUA 2OUGA 4HTIA 2EC0A 4MIWA 5HQLA 1NHKL 3PW7A 1IKXB 2UUCJ 1VYAA 3B82A 4RUHA 1RB0A 2AD9A 3OHBA 4J9MA 1FKOA 3W9IA 1FXLA 3DKDA 4KQZA 1ITPA 4GO5X 5HP1B 1VLOA 4LRBA 4KKOA 4AL5A 4C6AA 1QE1A 2H65B 2KXFA 2WVBA 4O0NA 3GV5B 3ZXWA 5J2PA 1ZTWA 1PJ7A 5AXMA 4DL5A 4NLVA 2HAIA 3RB3A 2FVCA 1U0HB 2I38A 3SCIE 1T94A 4KB7A 1VQ7S 3HHKA 4DL6A 5HJYA 1JLAA 3MOZA 2XM3A 4KH1B 4FF1A 2CZ9A 4ED0A 3FMBA 2ZBPA 1CJVA 2CJBA 3FQKA 3O6QA 1RCOB 3KNAA 2V94A 2VPXB 5HLFA 2I9SA 2VV5A 5HANA 1K47A 4I68A 1YWXA 2CQIA 4UZCA 4CO1A 5L9NA 5A8WA 4ANEA 3GIKA 1N56A 4PRFA 3OSNA 2K3KA 4C8YA 2IY5B 3C8YA 3W9HA 4NL5A 4O3OA 4DQIA 3PX4A 5FIIA 4C0HA 3AFGA 4QPXA 2IDLA 2JHEA 2WBMA 1EKSA 4C9DA 1WC3A 1F5CA 6FDRA 3OL9A 3MEDA 4RNMA 3KLFB 5LM7E 3MECB 1Q1KA 4X4QA 4GRSA 1BUXA 4FVMA 2R8HA 2DO0A 3KLIA 4CH7A 3PZPA 3GIIA 1QLNA 2KRBA 4DV0J 2FZKB 1WC4A 3SSQA 4Q0BB 4WF9Q 4O44A 2MZQA 1E6YB 4UOGA 1R0BG 3GR0A 2B6AB 4A48A 2BE9B 3UR0A 4LFBJ 1CJUA 3E2EA 2IRYA 3VR1A 2OMOA 1N54B 2HAFA 2IJRA 3GU0A 1LWCA 1R0CB 4AXJA 1SI9A 3OJUA 2V4RA 2Z2LA 3A3NB 2ZZTA 4B3MF 1Z4UA 3TEHB 5KFNA 3JSBA 4PWWA 4ZJQA 1Q78A 2QA4S 3OFGA 1WWHA 3OR2A 5HVHA 3C14A 1RYRA 4OJ3A 1RI7A 2W7AA 3SCKE 3CDWA 1S9EA 2ZE2A 2Q6CA 1S99A 3BBFA 3QMQA 2Y9HA 2KU7A 4LR8A 1RT7B 2H48B 1PILA 2OHDA 3AJ1A 2DPJA 4DV7F 2YNFA 2WOMA 1VI7A 3Q8YA 3QO9B 2X7IA 4AD6A 2W01A 1VCTA 2KHCA 4X4TA 2XWYA 3MM5B 3MPVA 2PGCA 4NLYA 4OX8A 3BM7A 5SZTA 3HT3A 4DFJA 1BD6A 1EKRA 1GXUA 1T3OA 2QLJB 4J90A 2B7BB 2VUGA 5CYMB 3D3CJ 1NMEB 2M88A 4AE5A 3A1YG 4EO6A 5LMUF 4ZIVA 3I96A 1QSSA 2COLA 2HRYA 2X3GA 2W9CA 2J9CA 2HNZB 3JQJA 2MHEA 4C98A 1RA7A 3ONQA 4DCOB 4LFAJ 5KG7A 3SI8A 4ECYA 5IT9Y 5K8NA 3HJFA 3H98A 1GMWA 4DS4A 1VRTB 4O23A 5D4LA 5DLFA 2KKHA 4ED8A 4K4SA 2XZWA 2J8AA 2ZJPQ 1YLXA 3TW0A 2RSQA 1DQ8A 4FXWA 3K2YA 3Q23A 2F3JA 3FNNA 1O6XA 4J9UE 3TEGA 1TL7B 1R3NA 1HR0J 2RAQA 2VFSA 3J7A1 4OYWA 4KO0A 3OR1B 4W98A 4CLUA 1TL4A 2DVIA 1Q5YA 1H2UX 3KUGA 1T3NA 4RU2A 1ZOTA 4JOUA 1FRIA 2HBRB 1KQKA 5HVGA 3I55S 2JLGA 3PHEA 4ZP7A 1DTTB 4O4GB 1HNXF 1IKVB 4N47A 2AYMA 3CJ3A 1HYSB 3E3XA 3D54A 2CQ3A 2F65A 3V6KA 3EPGA 5CQGA 4DR5F 1S4FA 3M7VA 4M5NA 2I5JA 2ZBCA 1VGYA 3C19A 4GVLA 2BE7D 2Q6BA 2CIMA 2BA9A 3OJSA 3N5FA 1XMQF 4MYTA 3LGNA 4F50A 3VVUA 3DRXA 5GVQA 3EDQB 1XC9A 4MKYA 4X66J 3KK1B 1JIHA 5THWA 4ZCLA 4JI4J 4PPDA 1KFDA 3KG0A 4YN3B 1YJWS 1JLQB 3QFHA 4NLRA 5D0HA 1WI8A 2MZRA 2XYPB 3IM9A 2NSBA 3DLLQ 3RG6A 1RISA 3LGMA 5SUHA 2XSJA 5A8RB 1RTHB 3EWGA 2DY1A 4OV6A 2JRSA 2PMZD 1XR6A 4FPRA 1G6BA 4XO0A 1C1BA 3Q8PB 1J5OA 1RTIA 1UPPA 4B9LA 2JEGA 2XB2D 1HBNA 3MUMP 2BKOA 4PR6A 4R0EA 4DQPA 3IG1B 5A76A 1SKWA 4ZN3A 2LQJA 1K0TA 1IKYA 4I2PB 5L1JA 4U67Q 3J7YU 3KHRA 2FHKA 3OD2A 3H20A 4YDXA 5KTQA 3UR3C 3PHTA 2I1RA 5L8RC 1IR1A 2LA6A 4KV8A 1VQ8S 2UUBF 1Q8BA 4ZN1A 4E8UA 1YITS 4FYDA 1NK5A 2BV3A 2WBRA 2VU5A 1S1UA 4YR2A 3UD5A 4KHPF 2NXJA 5KFLA 2AZ1A 2M4MA 2EKNA 2XI2A 5IM0A 3ZZRA 3R5DA 4CLZA 3KNGA 2FB0A 2L9NA 2XMWA 4MT1A 4CLFA 2ZOFA 1WEYA 2JFKA 2KXHA 4MFBA 5DG7A 1FX4A 2M8HA 4TKTA 3DCAA 2E5LF 1XTZA 1S1WA 1X5SA 2CXEA 2OEKA 4WZQA 2L9DA 1T9VA 2WZ1A 1KLMA 3MPUB 2MPUA 4QPTA 1N34J 2JEJA 2VBYA 2E5JA 3PACA 2QJ3A 2P9GA 2C1EB 2J0QD 2CJQA 2WVFA 2J0WA 4OYIA 2QFJA 4ICLB 1Q8IA 3K59A 4YEAA 3MM6B 2VA3A 1KSPA 2JC0A 4X65F 2W7OA 3QQCD 4EBDA 2JVOA 3LH2S 4UY8T 1IWGA 1NK8A 3JS9A 4N41A 4ID5A 3C16A 4DR2F 2FY1A 2GVZB 3GFZA 4N7TA 3IBCB 1HNZJ 3IWNC 3PW5A 2WW4A 1CS4A 4ZLJA 2OEJA 5GMDA 4IH7A 2VH7A 3CJ4A 4H4KA 2VG6A 2A18A 1BMQB 4DF4A 1KP6A 4WU3A 4HACB 1F1BB 4G1IA 3G8SA 1WNEA 4PXEA 5IQQA 3DLGA 4NA1A 5KT2A 1N4LA 1VQ6S 1SC4B 4FS2A 4UY85 1S79A 4K2XA 4CO2A 2C2MB 3HHLC 5KT3A 3OTOF 2V0NA 3EE3A 3M2UA 1T03A 2HGNA 3CSKA 4C4WA 2YWEA 3KHGA 3IWLA 4DR6J 3CMAS 2HFNA 5C25B 3F41A 4DV4J 3B54A 3THVA 3DLBA 4FF4A 4ZP8A 1K8AT 3CCMS 1C1CA 4KGXB 1SC1B 1Q0NA 3EJMA 4FXVA 2OLWA 3RRKA 3W9JA 1Z2LA 3PDNA 1NO8A 2ALYB 3ETMA 3RW7A 4AQYF 3HHLB 1KFSA 4OI1A 1HMVB 6FD1A 3MPDA 2V9WA 4ELVA 4RX6A 3CCWA 5KFUA 3D6FB 2V34A 2NS1B 4Q2MA 4ZA1A 3C6UA 4FN5A 1AZSA 3R7BB 1U2FA 1TUVA 2FUG9 2BACA 3R5GA 1ZM4A 4Z37A 2DNRA 1FVSA 3DLEA 3Q8UA 3QT6A 4A47A 4FKYA 5MAOA 1B7FA 5KG3A 1VJQA 1UVJA 2XY7A 2VODA 1S9GB 2XMAA 5B0GA 4P75A 3MXHP 1VRUB 3TNVA 2FZGB 2C3MA 4M5HA 1RAJA 5ITHA 3P3DA 2GJ2A 1U09A 4O3SA 1R43A 4C11A 3NMAA 1SIZA 4NWBA 5J2NB 1YRXA 3M8PA 3NGUA 3R7SB 2XBPA 4LFCF 4GC7A 5A0YB 8AT1B 2V4QA 3OXFA 3KG4A 5KFMA 1HNWJ 1RCXB 1TU0B 5DG8A 2JJ4D 5K20B 2CQ4A 1EIYB 4NXMJ 2RQKA 2R7UA 2J9DE 4IRDA 2HWHA 1CJUB 5F0WA 4CH1A 1MMLA 2DNGA 1D0EA 2IYIA 5M2PA 3I9ZA 2V69A 4DR7F 2RU9A 1QD1A 2YTCA 4IO1A 1OY6A 1VISA 2HYIB 4W90B 3Q24A 2F1FA 2PEBA 4KR0B 2CDRB 1UTAA 4J5OA 4TY8A 3RJMB 3CUNA 3FQLA 4I6AA 4ZPWR 5LMNF 3QAEA 5BYSA 1TELA 3RR7A 4M94A 5ETMA 2KZMA 3D2WA 2GMHA 4HHHA 4Y0FA 4JI7J 1X5TA 3M4XA 1RDRA 3W7BA 2YNHA 3HDSA 4C3LA 4AL7A 4MIAA 4L3NA 4Q2LA 2RRAA 1SKUB 3CCLS 2W4CA 2DITA 2JZ5A 1JLAB 1RACB 2VFTA 2Z2YB 5CYQB 2NXNA 2HS0A 4J9QA 2AQ4A 2RRNA 5KFGA 4DLGA 1NZ8A 3O44A 5JMNA 1CQNA 3RGIA 1QUVA 3I0RB 3KJFB 3QAUA 2DR6A 2V2VA 5GAEU 3TVZA 1KTVA 2EFVA 4RUCA 5KOXA 2D74B 3T1HJ 5RUBA 1NEEA 5LXYA 3SXLA 1SQFA 3PW0A 5B0FA 4IYQA 4RW8B 1O0PA 3D66A 1NK9A 2XHWA 3BQ0A 2CUYA 2W8LA 1FJ7A 4OHZA 3X3UA 1W25A 1WELA 2PA3A 4CLSA 2VDIA 3I32A 4K5SA 4FYXB 4C3MA 4QWCA 4JYAJ 2XGQA 3BF4A 2AV5A 3OUYB 2VPYB 1HBMB 1FNXH 2V5HG 3HI9A 3MTKA 4M5LA 2HKEA 3BJYA 1ZTTA 4Q0BA 1FFSB 1RLDA 4CO3A 5KG6A 5LJ3Y 2WRMA 4RR5A 3QLHA 1IKVA 3MMBB 3IS9B 1VQKS 1DTQB 3UE2A 4RW7A 4LF8J 3EMTA 1VQSA 4DV4F 1FTRA 3GV8B 1LWCB 1RWOB 2LMIA 4MK9A 4H4OB 3M32A 2QEXS 1VR6A 1R8CA 1RWKB 1F5BA 1HNIA 1P8GA 5HROB 3JTNA 5AXNA 3EDRB 3UCZP 2H54B 4CTAA 1FKPB 2ZC3A 4FYVB 1QDUB 1RAAB 3Q0AA 1NK4A 1FF2A 2KFNA 2MKIA 1EETB 1IKXA 2DHXA 1ELOA 3HCXA 4IG0A 2G0CA 2LDYA 4CH0S 1NXIA 4OX7A 1JLGB 1VHIA 3QO9A 3ISND 1PYTA 1DQ9A 1SJQA 2VFUA 1NPRA 4DBQA 3I5AA 1CG2A 4RWWA 1QE1B 1B0PA 2HLTA 5D4PA 4L74A 2P6TA 2CNKB 4DR3F 5I42A 3TUPA 2XYHB 2IJFA 1HWUA 1TMMA 2C3YA 2OPRB 2CJ9A 3IAS9 4UOCA 5LT5A 1HHTP 2YX4A 2HRUA 3CJ0A 1U0HA 1RAFB 3GIJA 2HHTA 4KSEB 4UUXA 5IC4B 5K9FA 2DGQA 2YNIA 1F3FA 2ZFHA 4FZVA 3VAJA 1W7WA 2QSWA 3JTPA 2OPSB 1JLCB 3OFEA 4N8OA 3W65A 3JAMY 3TWZA 1VQ4S 2UXCF 5KG4A 3FRZA 4ANCA 1BXNA 2VG5A 1NK6A 1N8RT 1RT6A 2ZH2A 2XULA 4Y2IA 4IUFA 3BGOP 2KYZA 4DHVA 3OXGA 4ES3A 2QT7A 5L9XA 4DQQA 4BBYA 2BR0A 3WZ0A 1RAHB 2ASYA 4LF7F 4KC5A 2MJUA 5IV3A 1Q5VA 2ALZA 2J6UA 1S0OA 4NCBA 2W25A 3A13A 4O4GA 2OD4A 5HL7Q 2G9OA 4ELUA 1HYSA 1I94J 2CDQA 2CQBA 3OTCA 4ID8A 2ZUGA 5HMZA 4JI7F 4M5KA 1AW0A 3M6WA 1S72S 2DXDA 2O3DA 1WC5A 4DG1A 4I67A 8RUCA 2ADCA 4ECUA 2KT2A 2J7KA 3N28A 4K4UA 2MZSA 2ZOGA 2LP4A 1HWJA 3K58A 2IA6A 2BKNA 3J81U 2E5IA 3D6TB 4LQ9A 5DRKA 2MQMA 4YS2A 4NPOA 4J9OA 3FCWA 4FXDA 4PG7A 3Q86A 4H4KC 2QMUB 5KFWA 3NGTA 4B3RF 4ZVOB 2FGOA 1NDCA 2EC2A 2CPDA 3MM9B 1TZ0A 3UCUP 2PI4A 5IZHA 3C15A 3DOLB 4WPAA 4K0KF 1WKLA 2NCKL 5I3PA 4JV5J 3DGVA 2YNGB 4LFBF 4OX6A 3H25A 1H73A 1RWVB 3LPYA 3VGTA 2PI5A 2YQ0A 5C42A 1RAGB 2XMMA 1HFEL 2NXCA 4YHHJ 2VQFF 1ACMB 1RE1B 2AW0A 1HD1A 2CQDA 4FS1A 2VOPA 1QY7A 3GILA 1Y9OA 5BXIA 2E7VA 3QIPA 4RW9B 3M2UB 4Q8EA 3JTOA 4NCGA 2HWTA 3EGZA 3NGDA 4FP9A 2KFZA 2KM8C 1KN6A 2IRXA 2GMLA 2GC8A 1QUPA 1A7GE 4M5IA 4LF8F 3PXGa 4DV7J 1WG1A 3IR5B 4CYUA 1BQXA 3IBWA 2WONB 3R5BA 4K7QA 1DAXA 3DRPB 2CPJA 2V2KA 4K4VA 1NJYA 2JX2A 2Z4PA 1LQ9A 3OTEA 4EK2A 2BZ2A 4F25A 3G4SS 1VBKA 1X7VA 3CO0P 4WK1A 3T3FA 4P52A 2NLWA 3RW6A 3WIUA 2CQ0A 2VFVA 2VPWB 1LW2B 4ILLA 1H2TZ 5A8KA 1UA1A 3CEDA 4NLUA 1NM2A 3DLEB 4BC7A 1TKXA 2FYXA 2VFRA 2XZTB 4QWDA 4YB1P 3TAMB 3EXYA 1UJ4A 1S9GA 1LOUA 3PJXA 4PG4A 1AXQA 3I82A 1WSRA 1IVZA 2KYXA 1YZ7A 3KDNA 1NSPA 2XMJA 4UF4A 3M9OB 4CP5A 1TAUA 2NYIA 4OZ3A 1U6BA 1A0OB 1NHVA 3KK2A 4B3SJ 2GA7A 3I31A 2V8PA 4DOZA 1Z2ZA 2KVQE 2FY8A 2WVDA 3QSYB 2XTCA 3BB5A 1PJ6A 4B9SA 2YKQA 2O5DA 3VAGA 1HNXJ 4QIEA 1G2EA 1MROB 1RWWB 4NXNJ 4DN9A 2CNOB 3KLHA 4G1QA 4DZ6A 3K5LA 3WIVA 4P10A 3G82B 4ZS6A 3IMQJ 4AYBD 2ZHAA 3V6DB 3DLGB 3KFWX 3B78A 2W2MP 1SJRA 1S1VA 1Z1ZA 2ZH7A 3DDIA 3VCDA 5A8RA 2DT9A 2IBOA 1IN0A 1LWXA 1XQIA 3SIPB 4HYKA 3QYYA 4MAKA 4FYYB 1DLOB 2MQLA 4OLPA 3L09A 2WK4A 4L3KA 2NUHA 1SUQB 2CG4A 5GAHU 2ERRA 1Q7YT 2G0JA 2ZZMA 4PWDB 4XK8C 1PAEX 2Q43A 4USWA 1EP4B 2P6SA 2HZCA 3IBFB 3CB4A 3FGVA 4I2PA 3GP9A 2M0GB 3MEGA 3M9NB 4R5PB 2V1TA 3E01A 3N5BA 4Y2KA 3DOMA 2GIQA 5HBMA 3G6YA 2JNJA 5D4OA 5KFSA 2J6TA 1S6PB 1RJJA 4LF5J 4PYAA 1U1MA 2GQ2A 2RE1A 2RILA 3TRGA 2VC0A 3BO2A 2RQMA 3I4HX 1U0SA 4DPXA 3BDPA 2R8KA 4OV1A 3CCTA 5DDQC 2H51B 4ITSA 3AD8C 2W8KA 1FEHA 2RHQB 3M1VA 2CA9A 4WIIA 1J5EJ 2EK1A 2F7VA 3K7RA 4ECWA 2DNKA 3K5MA 1TTHB 1CSJA 1M5VC 3CE8A 1B70B 1JNZB 1Y11A 1SL1A 4B02A 2BW7A 3G8QA 3N01A 1JQGA 2CPIA 4YHHF 2ZM6F 3FK4A 1PKUA 4UQTA 4ELTA 5DZ7A 1R89A 2ZNZA 3UQSA 1G3OA 2YH0A 3CWJA 2F40A 2IM1A 2ZVSA 3BBBA 1NJXA 1GXTA 1REGX 1FKAF 1LWEA 1TL3A 2PSZA 2Z0GA 1KRPA 1NKBA 2HGLA 1AYEA 1FRJA 1X5PA 5F8LA 1RHKB 2QV6A 4B3TJ 1SV5B 5CAAA 4PAAA 4LF2A 5ADZA 5J1NA 2QMWA 1FFGB 1VS3A 3FVYA 4PYDA 3ZTRA 1F2HA 4I56A 4P2SA 1JX4A 1UVIA 4ZCKA 2YX1A 1AUSL 5E0OA 2WTFA 2X1FA 2BANB 1YTYA 2L48A 2IVFB 4LF1A 1UFKA 3ZTQA 3BZQA 3T1YF 1D8YA 4OIXA 1YRUA 4RU9A 4I7FB 3W62A 4DR2J 7AT1B 4DSIA 2Q66A 2B8QA 3F0NA 2IVMA 4X2BA 1CJTB 5GAGI 2FJBB 3H5SA 4JP8A 4WU2A 2XMUA 3MMCB 3NWRA 3G87A 3I6PA 1URRA 2C2OB 2K1RA 3Q8RB 1S0NA 1XIQA 1IBKJ 1I3OB 1N0UA 1D3WA 1IJEB 2CQPA 4QU6A 4OYXA 1E6YA 2QTWA 3OTOJ 3HHLA 3TVKA 1PC5A 3NNAA 4DUZF 1JMTA 1G4CA 3K8VA 4RBUA 5GADU 3PO4A 2Y0BB 3OV7A 5IC6B 3S1TA 4DFKA 3CD6S 4H4MA 4F3QA 3C6UB 1AZSB 2D3O1 1NPPA 1UKUA 1S6QA 1HBMA 2FC8A 1MWZA 1QJHA 5BYQA 2DNHA 1MWQA 4K4ZA 4OI2A 3W2VA 4AQYJ 2JEIA 3C14B 3OFFA 2QL9B 4U7CA 3D68A 2MLZA 4YR0A 3ZO7A 5H9FK 2NXUA 1DHMA 2Z2MA 2R42A 5KFFA 4ZCIA 1ICEB 3BBCA 3AODA 1TKDA 4J9SA 1BQNB 3L95X 7FD1A 1ZYQA 5CXTA 4IRKA 4ETZA 1CC7A 1FCAA 2B4OA 1S1TB 2OKQA 2JL9A 1U1NA 3K8WA 2MY7A 2ADBA 3Q2SC 2KXNB 4CLKA 1KNZA 3DGPA 1U4BA 2AMCB 4X4VA 1Y5IB 4PXBA 1XEZA 3R3TA 4JI3J 1KQSR 4PUOB 3K0JA 4ZHRB 3Q8VA 2AWZA 4M5JA 3JSMB 3A8JA 3RBZA 3NS7B 2M3DA 2Z56B 3KYLA 3D0IE 3ZTPA 3OBIA 1HNWF 1AT1B 3JQMA 4LRDA 2HNDA 2VC1A 2X1GA 1S12A 4QCLA 5JVGQ 1R27B 2QA2A 3BYRA 3FBBA 3BDEA 3GZ7A 3H90A 2CAJA 1D9FA 4P7VA 1FD2A 2LLZA 3W2WB 4X62F 1PYSB 3L3CA 3JYTB 2FVRA 2XCPA 1B64A 5KG0A 3HZGA 2W9BA 3KLIB 5EX3A 5AE1A 2A6MA 1OIAA 1HI8A 4X4RA 2UU9J 1TKZB 2ZM6J 4DV6J 4AL6A 1SKSA 4IDKA 5D6GA 3W8PA 2B56A 5DS7A 1SJFA 1RK8A 4DJBA 3J81Y 4DL7A 1CQMA 2QSFA 1X4AA 2ROPA 5F9LA 1KBRA 2BOAA 4RWXA 4CYUB 1KVJA 3RBDA 3LA0A 4OYMA 1PYOB 4NX9A 4NZ0A 2XMTA 2VHGA 2BYCA 3BSNA 4Q5VA 1JJCB 5LXRA 4MK8A 3MR2A 1E6VB 1MN7A 2B6AA 1HQUB 1VK8A 2BW2A 3CC4S 3FSXA 3PVXA 4Z7CA 3KK1A 2UVWA 5G0RB 3HVWA 3DM2A 3LO3A 1I1GA 1F0XA 2J7UA 4CQ1A 2EI5A 3R5JB 4CLLA 1FRXA 3G86A 3NCRA 4DI6A 5T14A 3DU6A 3C6TB 4RPFA 4P72A 4DPTA 1S10A 1IBCB 5GAHI 4Y00A 1HHQA 3OVBA 3RAQA 3VQTA 3D6HB 5M2UA 1RBOB 1NDLA 3LTOA 2QL7B 5KOWA 4ED7A 4GMKA 3T41A 2OJ3A 3GONA 4USHA 5HROA 1VRTA 1IKYB 5EHHA 2BJDA 4ED6A 4CTAB 2NPIA 5KFAA 1N33F 3MEEA 4LBIA 1CJVB 1IR0A 4ED2A 4C0OC 1EETA 3B4DA 2GO8A 5EUHA 1F9FA 1XMOF 3EM1A 1EHWA 3SZ2A 2KDOA 1HQEA 4TU8A 1VQ9S 2KO1A 4WE1A 2UUBJ 1FX2A 3L7OA 4DX5A 2MJNA 5G4DA 2BE2A 1YZ6A 4EWTA 1OMSA 3MEDB 3NP5A 1RQ0A 1BLUA 3PY8A 4CRJA 4OJ1A 1EP4A 3NG8A 2GAHC 3Q83A 4KY3A 4JI5J 2P2CB 3QSIA 2HVEA 4JUZA 2QLXA 2EK6A 1KLMB 1XWLA 5C24B 4XPCA 3J80Y 4LF4F 4ED5A 1VBYA 1UJ6A 1RKJA 3A3OB 4IO9Q 2HK2A 2IBKA 1GXLA 3ENVA 4I6YA 2C22A 5KFXA 1N6QA 2FHMA 3PNIA 4ZVTB 4DCPB 4ED3A 4Q44A 5HATA 1D9AA 2XC9A 2Z30B 4KE5A 3M9MB 4J9KA 4DF8A 1RUSA 2XG8A 4JI8J 4PQUA 2KB2A 3SMZA 5LSRA 2UXCJ 1X4BA 3GG0A 2G0IA 3LP2A 1W2IA 5A2QY 1X4EA 4DV2F 3I0SA 3ITHB 2E44A 1F9HA 3UVJB 2MZ1A 2DRDA 3SV3A 3FFIA 2KVIA 2B8PA 1QAIA 3NOCA 3BQ1A 3OLAA 4N56A 2R7WA 1NPKA 2QZ8A 4DV5F 2P8IA 3UN2A 1X9WA 2HQCA 4P71A 1J5OB 4DPYA 1C1BB 2R9LA 5GAGU 4CLPA 4DUYJ 2AEFA 1JXVA 2HBYB 2EFQA 1YVFA 2NXEA 3SEOA 2W9CB 2C3PA 2R7TA 4ZPBA 4QR2A 2AJ0A 4TXSA 3W5XA 4PEOA 1MMDA 4OMFG 2J0SD 3QJLA 4WFYA 6AT1B 4J37A 4B08A 3PIOQ 2YY3A 1G7CB 2AP6A 2F8HA 1TV6B 3UD4P 2FVPA 4WP8A 4O3QA 4DR4F 5DM6Q 2YVSA 3PR5B 2EBGA 3FBCA 5E7OB 2IM3A 1R8AA 3AOAA 3NS6A 4HT5A 2AIRB 4OZJA 2F4VJ 1NU4A 1UP1A 4NA2A 1N32F 5D8HB 3NWGA 2YPYA 2XO6A 1SC3B 2CPFA 2VQEF 3SSSA 3GSIA 4LVOP 3O1LA 4NASA 1M90T 4QW9A 2DISA 1YJUA 4EZ6A 4NCGB 3VZIA 3UN3A 1H6KX 5HVFA 2VBZA 5E3AA 4UOHA 2GX8A 2Z8QA 4P7TA 2VQFJ 2HBQB 4PZVA 3GYNA 1H98A 1BHNA 2RDIA 1RTZA 5C2GA 1Y7PA 4QWAA 1N52B 1N48A 3AB2B 5ETPA 4A8SA 3EGWB 3RAXA 3HHNB 4C8MA 3HK2A 5EDWA 3KLEA 1NK0A 1HWLA 5H9EJ 1TUWA 3CJRA 1NBEB 4RW6B 4BWJA 1U6ZA 3W66A 4DQRA 4JV2A 1TUGB 2GV1A 3IR7B 3LQVA 3MR6A 3HT0A 4TY8B 1CULA 3SBMA 2F9DA 1F6TA 4DXLA 1PC4A 2C3UA 2J9DA 4OLOA 1WC6A 1RTIB 4TY9A 3I56S 2MXYA 2VG6B 4WFAQ 4YUDA 2X1BA 1LWEB 1P6TA 2YNHB 1TL3B 4HHUA 5LJ5Y 2MTLA 3GJSB 3LW5C 4OX9F 4ZCMA 3RAMA 5KT5A 1V6HA 2RJZA 3IG1A 2G4BA 1K0VA 4LIRA 1J27A 1ZA2B 3HM9A 3FCHA 3IAM9 3MR7A 1X0PA 1YG0A 3BSAA 3PJWA 4B9NA 1NJWA 3KLHB 1S97A 4B3MJ 3QFWA 4MKBA 3TUJC 1RU2A 2M2BA 3TR5A 3V4MA 5JVHQ 1U1PA 4P2MA 4ZVEA 5F8GA 1BQMA 2Y8WA 2M52A 2HRTA 3HD2A 1AA1B 1FFWB 3HMJG 1X4FA 2ZZNA 1AB8A 2AX0A 3B8HA 3KK3B 1B99A 1SJ1A 3H4DA 1VQLS 2RVJA 1H2VZ 4DV2J 2ZHOA 3FJ2A 3W2WA 1WKKA 3CJKA 3THTA 1SUQA 3OUYA 2QIFA 3ZZOA 2V2ZA 2K1RB 1F5AA 3D7SB 3G8TA 1M1KT 3PYGA 3KG1A 4LJMA 2OPPB 3JSYA 2EFNA 1S1WB 1UW9A 4F36A 3MTJA 4TQRA 4R5PA 2MMYA 3GIRA 1PG5B 1U26A 2JDJA 4QQBA 3CF5Q 1EARA 1VHFA 2G1HA 4DUYF 4QYZK 5EN1A 2EG2A 4C11B 4LFAF 3DU5A 1K1QA 3CIZA 5KFQA 2VG7B 2B9WA 2BABA 2YKAA 3W2VB 2UVRA 4NLQA 4K4XA 1E6VA 1WF1A 4B17A 4X4OA 5DQIA 1FNOA 5CABA 2QLBB 2ZH9A 2CVIA 2W2OP 4LBPA 2HFZA 3SV4A 2HSEB 1HR0F 1LV5A 2OSQA 3HHEA 2D9OA 3MUTP 2DR8A 1PJ5A 1RAEB 3BKFA 3PRDA 4ECQA 1TL1B 2E1CA 1FWPA 2B0GA 2XMKA 2VQEJ 2LXFA 4C8LA 2RQ4A 2BBEA 2MYFA 3ILIA 1X4GA 1FWLA 5EWEA 4CZCA 1IUJA 3LOUA 1ULRA 2DR5A 2RT3A 1RTJA 4DR5J 2EBEA 4EZ9A 1HLWA 1CPZA 2DD8S 1R0AA 4RLEA 3MR3A 2HMIB 1JLCA 4TNOA 2BDPA 2NZ4A 1JWWA 1UCNA 3MD1A 4ZJLA 2KH9A 2V8GA 5C7PA 2VD3A 2BRLA 5E3CA 2F5GA 3J7AN 2N82B 2KL8A 3M8SA 4LIWA 2R7XA 2IAJA 1QTMA 3K5NA 2EEYA 3LUYA 3UDEA 3HP6A 5KFIA 1PIEA 1U2CA 4A8FA 1K44A 3BO4A 4V19X 3AQPA 5BR8F 4O3NA 4C97A 4WFXA 4ZLPA 2OPQB 3A8IA 4PG5A 2VA2A 4XPEA 2EW9A 1NK7A 1PO6A 3IS9A 4N8NA 2V6AA 4E2FB 5J1EB 1TAQA 3MM7A 4IG3B 2HHUA 1PCAA 5C2CA 2QGFB 3DYAB 3CT9A 3QIDA 4YB7A 3BSCA 4OX9J 1OY9A 3CW2C 2K7JA 1OSDA 1TP7A 3P5TL 3VGUA 2C28A 2DO4A 2IMOA 2OELA 1WG4A 1L5UA 1FKPA 2YWFA 4ZJOA 2ILZA 3KMQA 5ETVA 3F56A 1FDDA 2JLEA 4YY3F 1MU2B 4IG0B 5FLXU 2CWXA 2QLWA 1IQTA 2A1BA 2A10A 3IRWP 1ZZNA 4G1PA 1QM9A 4GKJJ 1RKIA 5L39A 4K4WA 1RHUB 1NAQA 1T11A 2EFGA 2VASA 2W24A 3BR8A 5GAEI 4EMDA 4DQSA 2YKPA 2PO4A 3DOLA 3HHLD 3K5PA 2SXLA 4JI1J 1Y3JA 1UVLA 2OTLS 3GJTB 5KFTA 2IFXA 1J2VA 3EXCX 1KHVA 4KAIA 5KFYA 2B43A 1P1TA 2DCUB 3ZZZA 1LWFA 4ZVHA 1H3DA 5C42B 5KFBA 2BJ1A 2AEJA 1IWAA 2CADA 2H1YA 4HKQA 4QIVA 3G2XA 2PFDA 4Y34A 2MLYA 1ZETA 1N34F 5ETLA 4ZP9A 1W26A 3T1AA 2MKJA 4ZVSB 1N5YA 1YJ9S 2YQ1A 3IFEA 3TZWA 2LXUA 1JLEA 1O8BA 1BWVA 1Q7LB 2YWWA 1RT3A 2MB0B 3WBZA 3MM8B 3SQGB 2WONA 1T9XA 5DQHA 3DRPA 3PRBA 2B9EA 1BC6A 5B0BA 2ATLA 4RW8A 3MFHA 4O44B 2VJUA 2E5GA 2RH3A 3K17A 2E9RX 5B0EA 3VALA 3UPFA 3R9LA 3KLVA 2EKYA 1RZMA 4DN0A 1Q82T 3R2DJ 1DFDA 3CJTA 2DNMA 4OQJA 2UXDF 2R7RA 2QO3A 2FPHX 3PJ9A 3U1NA 2PMHA 1FDAA 2MEWA 2CQCA 3PYDA 2KI2A 1RABB 3PIPQ 1FA0A 5KT4A 1JKHA 3HKWA 3ULHA 4EBCA 4BC9A 3N79A 1XBWA 4MJKA 4USKA 4JBCA 3OSPA 1XNQF 5H1SV 3CC2S 2AGPA 1WSVA 2MKCA 4P2XA 2HFVA 4WTOB 4RNNA 1LK5A 4PXCA 3N9UC 1IBMF 1FRKA 1UVKA 1KOOA 3DNCA 3HFZB 4DG1B 4UZBA 2HQ3A 2B4VA 3CXCR 2VONA 3PW4A 2D1CA 5ETOA 1RWMB 1UW4A 3AHPA 3ILLA 4F0HA 1JJHA 4F26A 5CZVA 2XLIA 2RNEA 2UUAF 5G0RA 4E0DA 3DM2B 3PO5A 2JC1A 4LRFA 4KHMA 1A6LA 3VAMA 3AQOA 3VVTA 1JLGA 2D7SA 4BHQA 3NEKA 2PFFB 3AJ2A 1C0TA 2YWKA 1N0VC 1CULB 3TYTA 2NSCA 5AJ3J 3MURP 1FE0A 3DMJB 4I2QA 3R8YA 4JI6J 3QT7A 3IRXB 1PBAA 3EVOA 1ZM9A 2PN6A 2Y1JA 1KQGB 3NY0A 1N36J 1F60B 4HLBA 5CHCB 1HPZA 3TARA 3H2LA 1P1LA 3KXDA 2FHJA 2BJ9A 3HFVA 4PCQA 2R8IA 3UW1A 1G1XA 4UUWA 2B4UA 2RF2B 2ZBRA 3G71S 4J91A 1HNZF 1HD0A 2DNOA 3PR4A 2RMLA 2VG5B 1SIWB 2RRBA 2VKZG 2V8DA 1WI6A 1TL5A 3OVSA 3KUHA 4WWSA 1U1QA 2HQIA 3AT1B 3A8EA 4WE1B 1N5QA 4USMA 2UXBJ 1VLYA 2HQDA 3SQOP 2LVWA 2EFPA 5KFEA 1VC0A 5KFDA 2F8EX 1RT2A 3POTB 1ZPWX 1S7HA 5B0DA 3ZZTA 1FK9A 1X4DA 3H7HB 1Q8KA 2AKWB 2KN4A 1DZ5A 3JSRA 4F4KA 2IM2A 3DXSX 4C8NA 3V5RA 2XGPA 1S0MA 4OI6A 3TA0A 4M5MA 1TK5A 4DPOA 3AX2A 4ZP6A 2B9YA 1PGZA 3UI3A 3M2VA 5D0RA 2VB6A 2ACMA 3WHIA 1RWPB 1NH8A 3QT5A 4UTGA 2R8GA 1T9WA 4R8UB 3N6MA 4K8RA 1FHTA 2HG4A 2W9AA 4ZVGA 3DRYA 2HLUA 3FEYB 1MN9A 1VQMS 4QYZJ 2VG7A 4RW6A 4LF9F 4HVZA 4OJHA 1U1OA 2DEJA 1XR7A 1I51B 3ENAA 2XTJP 3CCUS 1Q8LA 4DSJA 4CLTA 1U45A 3KOAA 1REVA 4CT9A 2YNGA 1U8SA 2H3EB 2VICA 2UV8G 4F2RA 3C66A 4EYIB 2KZZA 5J2QA 2HVDA 1ROFA 3DI6B 1F9EB 3HSGA 2CRLA 2J0XA 1ZM3A 1NB2A 3B6BA 2YQ3A 4XIUA 4NI2B 1HIYA 4OHVA 3V6JA 3MEGB 1NHUA 5EWFA 3E01B 3FMWA 2U1AA 3DOMB 3EICA 1QTNB 2AU0A 4NXMF 3MAQA 3TZZA 1GTHA 2PIIA 3D0HE 4MFBB 2GNKA 4OI4A 2WAQD 3H5UA 1SQGA 4A46A 3TZXA 1RLCL 3HPOA 3F73A 4Y2CA 1KWMA 3A12A 4DR7J 1BQMB 4DZDA 3DLKB 4NMLA 2RDJA 3VWSA 4F2SA 3BQ2A 1NLKL 3BKTA 3HX9A 1Y4ZB 4DPWA 4DR3J 3HVRA 3HSDA 3BGLA 3H42A 1NKEA 2UUAJ 4IFVB 2HQGA 1LW2A 1JLBB 1WHYA 1ZAWA 2WCXA 3NBPB 2W2NP 3RRGA 3CO9A 3EZ5A 2J5AA 3T5LA 3N6LA 2AJFE 2D9PA 3PFOA 3RUBL 3CULA 3OHAA 2GZOA 3GYGA 9RUBA 2XMVA 5AJ3F 4OYZA 4F04B 2DRBA 2IHR1 4QIWD 1JB0C 4CO0A 3U1LA 2FVSA 1N36F 1JK9B 1KLNA 4WKYA 2W4PA 2HHQA 1WF0A 4URSA 3KK2B 3TANA 4YDDB 3PV8A 1S1TA 4UOFA 3KHHA 2OSRA 1L3SA 3LALA 2P9CA 4DV1J 3QJPA 1T03B 4LRCA 5B08A 4IR9A 2KTQA 1FE4A 2Y0SD 3W5YA 2HW3A 4A8OA 2XNRA 2LKZA 2DYAA 5I4MA 1S77D 3W3SA 1OS5A 2VDHA 3F44A 4NLPA 1HBOA 2IC3B 3G82A 3RYLA 4TU7A 2HHHF 5D78A 1H7XA 3CJQA 1KOHA 4DV3J 3RB6A 4LSLA 3OW2R 3CCZA 2UXBF 1S6OA 3E51A 4I7FA 3GE9A 2A6OA 3FZ2A 1RT5A 3VF0B 1WDTA 4QIGA 4EI2A 3MF5A 2ZUAA 1I94F 2WVCA 3EVWA 3OT9A 2ILYA 4MKVA 1MG7A 1ZS6A 3PCOB 3CDUA 2GIFA 4TVAB 5KG2A 4F4WA 1RADB 3QNWB 1OJ4A 3R5AA 5LSLA 2W9BB 3I4PA 3KMSA 1O5JA 1R31A 2ZH6A 3V4IA 2MKHA 2CKWA 4IDKB 4DX7A 1TK0A 1OWXA 4HHJA 2BQUA 1T9UA 2V8VA 1SH2A 1VRUA 1UVNA 1APSA 1YI2S 2R7OA 5HLFB 5IT4A 1VIOA 4DX6A 4NA3A 2J6SA 3D67A 4MYUA 3WC2A 2E5HA 2L08A 5A6WA 1JXEA 3KLGA 5CZXA 2VF3A 3X1LB 3A4TA 1KR4A 1YBUA 3NCPA 3CJ2A 3OTBA 2DNPA 3HSJA 4DSEA 4KFBA 1R8BA 4K0KJ 3QWPA 4GVBB 4MKAA 3C3LA 2DGTA 3Q2TC 2P9EA 3TI0A 5J1EA 2C2NA 2FLLA 2GQQA 5IT0A 1VBZA 4B3OA 3IR6B 1HBUA 1L3VA 3ETOA 3J7ZT 2LXIA 4WZMA 1M5PC 1VIXA 3P5BP 1N6QB 2HHXA 2AT1B 2D41A 1FTCA 1VOMA 4HEA9 4DFMA 9ATCB 5B0CA 3Q8QB 4JV0A 4IOCQ 3G96A 2HHPA 4FVCA 5ETKA 2YX7A 3AY0A 3O5TB 1DJ0A 5DETA 1XMBA 1Y5NB 1JJ4A 5F41A 2A2CA 4ZPVR 3S8SA 4F4XA 2AHOB 1WTBA 1DURA 1DBDA 2VZ9A 2F9JA 4CO5A 5HO4A 2D3UA 1SV5A 5D4NA 4LF7J 5JXSA 1JLFB 2XLJA 5KG1A 4BCAA 1TVRA 1K73T 3M05A 5FDLA 4ALZA 4NLXA 4TYAA 3GV7B 4K5RA 1RT7A 3BYPA 4X4UA 1U1LA 3ENQA 3M6VA 2B7CB 1FJGF 4KGKA 3PX0A 2X3DA 4RUBA 5HMWA 5HN0A 3GJRB 2ZJRQ 3P49B 1U25A 3T19A 2I0XA 3DMJA 4L6V3 4TYBA 3HZEA 4NYZA 4ECSA 5KFCA 4NLDA 1UFWA 1D9DA 1VJWA 4Y28C 3TP2A 4DR1F 3TVYA 3MMCA 4IH5A 4OZNA 1NZAA 1HI1A 4C8OA 1N88A 1WOSA 2XHCA 4A8WA 3Q8SB 5F8JA 1RTDB 3PEHA 1U49A 1WOOA 3MCSA 1TFWA 1OQ6A 2KHDA 2K7KA 2PEHA 4R0JA 3DRRB 5IT9U 2K2PA 2OD6A 3O8WA 2HQFA 8ATCB 4JV5F 4ZKAA 2BM0A 2XY5A 2L41A 2JSXA 4U95A 3K57A 3BN4A 2PT0A 3AH6A 2LECA 3M30A 2ZOMA 3AXKA 2FJXA 1N5VA 2JH3A 3C46A 1HL6A 2O01C 2IVYA 2VBWA 1WD6A 3C6TA 4NOHA 5AT1B 4RNFA 2GJIA 1RT2B 4X4PA 2J7WA 3BS9A 4M1KA 2ABYA 2J8SA 5B7WA 2OH2A 1A9NB 3O3LA 1XR5A 4M63A 4DSLA 4X64J 3FFIB 4YB5A 4R25A 3LPEA 4MH8A 3QGIA 3BN7A 4FBUA 1UMJA 2AF6A 3OVAA 4DU8A 2HFUA 1KQFB 3NAHA 4Y2MA 3GTYX 3KJNB 3CCES 3B4MA 2VL1A 4ILRA 5BR8J 2V4JB 5E5NA 5I42B 1VRQC 3DGPB 5KFPA 3HKZD 3HD1A 4ECRA 2OP5A 5D15A 1MU2A 1RHQB 4M5DB 2DHGA 4YFUA 3KJVB 1O51A 2HNYB 3GSDA 4BDPA 2XZDB 4NLWA 2R7QA 3GFXA 4TLQA 3T6BA 1JLQA 3DLJA 4NMXA 1YJNS 1KC8T 2HHVA 4NLOA 3NGRA 1NSAA 2C2DA 1YK9A 1T02A 4KPCA 3W60A 4A8XA 1QAYA 1D1UA 3IRXA 2HEKA 1ZPVA 2RS2A
chains in the Genus database with same CATH topology
5DJBA 2DBBA 1V3ZA 3DC2A 4Y2AA 1LWFB 1VQOS 1MNEA 3OFHA 4AXIA 1VC5A 1JJ2R 4DDFA 2GO9A 2POKA 3M8RA 2YWHA 3LP1B 2WW8A 5DO2A 1TKZA 2RS8A 4HL9A 5C24A 4A8YA 3UD3P 4I4BA 1NB7A 4JI1F 4C3KA 2NREA 1OSCA 2DIVA 2FJEB 4PKDB 2CPZA 5AXLA 4C8KA 2V8HA 2ROGA 4ILMA 2MZTA 3PKMA 3RTVA 1UUJA 4ATNA 3CCQS 4U7UK 2DK2A 3I5BA 1U6FA 3UDCA 3PKYA 3PX6A 3M8QB 1KD1T 1UETA 1ZH5A 4NLSA 2UP1A 3LP2B 3MFIA 5KFRA 2BXJA 2CPHA 2GW8A 1LXNA 2CPXA 2G13A 1NRKA 2ZKUA 4ECTA 2C2RA 3GFHA 4IOAQ 2UZAA 4NLTA 2AJ4A 1K1SA 4I1TA 4PQUB 2DGOA 3NMRA 2UUTA 4ERDA 3QZ8A 3P96A 1TKTA 1FJEB 2Q1LA 3OL6A 4LT6A 1OPIA 1YIJS 4EUVA 5CD4H 3JB9k 3FZBA 2C42A 3HVAA 4LF5F 4GKKF 5K5MA 4ECZA 2O67A 3MM6A 3MZIA 1IBKF 2AYGA 1K9MT 3IC1A 3SFGA 1T05B 4ID5B 1ZAXA 1J5EF 1IM4A 3VAKA 3DRSA 1L3UA 2IC3A 5T41A 1U2RA 3AB4B 3DOKA 4ZOSA 4F4YA 1AUDA 4G3IA 2HHWA 1WG5A 2IJNA 3D0GE 3T5JA 4P6QA 5LSOA 1SJ3P 1RT5B 1VC6A 2MSTA 1XNRF 4OZ5A 2ZD1B 3IGNA 4Y65A 4CIOA 4JI4F 3NNHA 4B9MA 4DMZA 3SCLE 1WEXA 4Q43A 2C3OA 5D3GA 4YP3A 2GMJA 1C1CB 1SXLA 4B3TF 3R1HA 1GX5A 3V81A 4CCHA 3LP0A 3THPA 5KFJA 2DNNA 2XLKA 1C0UB 1HMVA 4MTPA 5U47A 1HW8A 4IFYB 1TQLA 2NR0A 1HNVA 2LCWA 5F0UA 2ASLA 2HVIA 5BYRA 2ZH1A 2XO7A 5AXKA 2FGCA 3DDNA 2R4FA 1WEZA 2LA4A 3MUVP 1OPZA 3H2VE 2ZC4A 4B3OB 3U02A 2KRRA 1FK9B 4IQXA 2JWNA 2MQOA 1M5KC 2KJWA 2M70A 2K8GA 1XK8A 1Y0HA 1KVIA 1YQHA 3EGNA 2FTRA 4KKOB 5A0YA 1FRHA 4X4SA 2UU9F 2R7SA 4X84A 4J9PA 3D1HA 4LVNP 2MGZA 2APOA 1RT4B 1MW7A 2CYYA 3ICLA 4RW4B 3V2UC 2IRUA 2U2FA 5K14A 5KFKA 1R0AB 3HVTA 1SBRA 3GWCA 3KK3A 2GCFA 4X4NA 3LWLA 1X4HA 3G6XA 4DWIA 3GMGA 3OQ2A 3OPKA 1S6PA 2QA4G 2LDIA 2GHPA 5FLXY 4USIA 2IAJB 3DI6A 1IJFB 2B9XA 3J7YI 1JNRB 3G6VA 5CYQA 2L9WA 5K8PA 5F3TA 1RGVA 2DNQA 5KFHA 2MKSA 2FIUA 2AGQA 3U7JA 3PEJA 2FJDB 3MM7B 4IG3A 3KLFA 2FDNA 4JI3F 1VQNS 3QGHA 4CT8A 1C4AA 4HDHA 1HA1A 4ZPTR 3S01A 3SCJE 5DGBA 2IMWP 2UVUA 3UWTA 5M2RA 2XS5A 1LW0A