2IM1A

Crystal structure of poliovirus polymerase complexed with ctp and mn2+
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stabilization of Poliovirus Polymerase by NTP Binding and Fingers-Thumb Interactions.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
molecule keywords poliovirus polymerase
total genus 135
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 2im1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2im1A02
4MK8A 4ZVFA 1HYSA 3BQ1A 2B43A 2OPQB 4I7FB 4QW8A 3V81A 3CJ0A 3I5CA 5C42B 1HQEB 1JKHB 2D3ZA 2VG6B 4YQWA 3OHAA 1REVB 1TKZA 4NLOA 4ECWA 3LP1A 3PW4A 3OL9A 3H4BA 2FJVA 1JLQB 4ZP9A 2HWIA 4MIAA 3DI6B 5KT4A 3GV8B 1VRTA 4WYWA 2WHOA 5KG1A 4J9OA 2D7SA 5J2QB 3SFGA 1LWEA 2OPPB 5KFFA 3T5LA 4KO0B 2AQ4A 5HP1A 4O4RA 3PW0A 2YNHA 2ZE2A 4J9QA 1J5OB 1C1CB 1JLAA 2D41A 5HP1B 2ASJA 4G1QA 2C2DA 5KFBA 4R8UA 2YKNB 3IS9B 5KFEA 2UVWA 1J5OA 2R8IA 1D0EA 1TKTB 1JLCB 4G1QB 1JLQA 3PW2A 3DRSB 1ZTWA 2IC3A 4ED2A 3CJ5A 2ALZA 1IM4A 4O3OA 4KO0A 3BSCA 1T03A 1XR5A 1LWFA 3I0RA 1TV6B 3QGIA 2RDIA 3CJ4A 3V4IB 5F8MA 3ICLA 2AX1A 3KJVA 2HWHA 4PQUB 3KHLA 3HHKA 3LAMA 3OL7A 3D28A 2OPSB 3QLHA 3RAXA 5HLFB 3CO9A 2UVRA 4TYAA 5C42A 5CYMA 2FLLA 2YKMB 4ZP8A 1C0TB 2FVQA 3V6DB 4QWBA 3KLIA 1TP7A 4GC7A 4TY9A 4EO6A 3GIIA 3H5YA 5J2PB 1N6QA 1RT7A 1S9GA 4IFVA 1DTQB 3CJ3A 3ISNC 3KLHB 4EEYA 1N6QB 4IH7A 3CDUA 4K4SA 5KFTA 4EBCA 1S0MA 3M9OB 3Q8PB 4Q8EA 2IAJA 4ZP6A 1RA7A 3RB3A 1KLMB 1QAIA 1IKWB 5I3UA 1T3NA 5J2PA 3KLFB 2JEFA 1HMVA 4ZHRA 1N5YB 2I5JA 3Q8RB 1RAJA 3CIZA 1VRUA 3NBPB 5EDWA 1JIHA 3MEGB 3FQLA 5DGAA 4I2QB 3BSAA 1LWFB 1S48A 4KBIA 3H5XA 3UR0A 1S1XA 3IRXA 4O44B 4I2QA 4TQRA 4J9MA 4O3RA 4TYBA 4LQ3A 5D3GB 3LP2A 2VG7A 2FLNA 2F8EX 1HQUA 3FFIA 1S1VA 2YKNA 3DRRB 3KLFA 2XI3A 4EBEA 4QPXA 4MK7A 5DQIA 1C1BA 1RT1A 5CYQA 2W7PA 2JEGA 5DQHA 5K14B 4RNMA 1RT1B 5CYQB 1EP4B 3T1AA 3OSPA 2WOMA 3DDKA 5KFRA 1TL1B 5HBMB 1S49A 3JSMB 2BQ3A 4NLGA 3DI6A 5JUMA 5D3GA 1D1UA 1RTHA 3M8QA 4K4VA 1LWEB 4F4YA 1FKPA 3PJXA 5DQGA 3H5SA 3IG1A 2B6AA 1QE1B 4ED6A 1RYRA 1RTIA 4NCGB 1JLBA 3N6LA 5KG7A 2OPQA 3PR4A 4WXWA 4RU9A 3V81B 4LSNB 2W9AA 4FBTA 3FSIA 4F50A 3HVAA 2W7OA 1TKZB 2HMIA 5KFIA 4XO0A 1K1QA 2BQRA 2IM0A 3KHGA 1T03B 5KFQA 1LW2B 1FKPB 3BREA 4IFYB 3MR5A 4I2PA 4Y2CA 3I0RB 3V4IA 3IG1B 3GV5B 4ED0A 3RB0A 2O5DA 2GIRA 3FQKA 2VG5A 4RZRA 4YR3A 4ECYA 2YNGB 4B3OB 2CKWA 4DL7A 5KFPA 1XR6A 4YP3A 3IGVA 3KLVA 3DLEB 2R2TA 1IKXB 1CSJA 4WE1A 1TKXB 3V6DA 2WOMB 2XCPA 5L9XA 4NLQA 4IG0B 3E01A 3QYYA 3NAHA 2R2RA 4J9PA 1HNVA 5FDLB 1S1XB 2ZKUA 1KHVA 5KG5A 5KFJA 2WTFA 1NHVA 4K4YA 3ITHA 4IG3B 5J2QA 1RT4B 5F8JA 1VRTB 2IBKA 3LP2B 2UUWA 1DLOB 4O3PA 1SH3A 3KLGB 1MU2B 2XCAA 4IG3A 3TAMB 3OL8A 1RDRA 1DLOA 3I0SB 2R8KA 3QO9B 5DGBA 1KLMA 4EYHB 1BQNA 1HMVB 2I5JB 4M94A 3NBPA 4QW9A 1S1WA 2HNZA 5KG3A 4ECTA 3QIDA 4ZPBA 1JLEA 4MKBA 4QWEA 1TVRB 3KLEA 3M8PA 4RW6B 2BQUA 1ZTTA 2V9WA 3LANA 3Q8QB 1S9FA 2IAJB 4TLRA 4MH8A 3QIPA 2WK4A 3V6JA 4MKAA 3NKYA 5F9LA 5J2MB 3GILA 4KE5A 4JV0A 2ATLA 1RT3B 2OPSA 5EUHA 2OH2A 3GIKA 1C0TA 5KT5A 3KLIB 5CYMB 1OS5A 2YKMA 2JC1A 4ECUA 2AGOA 4OL8A 1LW2A 4IFYA 1FK9B 1MMLA 5J2NB 4KHRA 4LSLB 5C5JA 3C6UA 3KLGA 4ECRA 5KFAA 3UDLA 2W8KA 4DG1B 2VA3A 4DL4A 3PZPA 4RW7B 1TV6A 4WXOA 2B6AB 4ZMMA 3KJVB 2R2UA 1T05B 4H54A 4DEZA 5HROB 4ZVHA 3SI8A 4IR9A 1RTIB 1ZETA 4X2BA 2W9CB 2YNFA 2R2SA 5I42B 3LP0B 4KKOA 4IR1A 2HNDA 4ID5A 4ECQA 4RNHA 2AX0A 4ID5B 1JLCA 1TL1A 5HBMA 3JYTA 3JSMA 4MIBA 2FJXA 2E9ZA 2RKIA 1RT2A 4K4WA 4DL2A 3MECA 1YVFA 3RBDA 5KFUA 3DM2B 4KFBA 3H40A 4XPCA 3MR6A 4K4UA 3GYNA 5KFCA 3GIJA 2VG7B 4RNOA 3LP0A 4KKOB 4J9KA 3OLAA 2UVVA 5C24B 3E51A 5EWFA 1HQUB 3FFIB 4MK9A 2HNYA 2C2EA 1NHUA 4RW4A 4O3SA 5KFGA 4NZ0A 1RT5B 4MFBA 1FK9A 4ZHRB 2DPIA 4LSLA 2RDJA 1S6PA 2WONB 5DLFA 3KK1B 3OL6A 3QGHA 4DG1A 3N6NA 1LWCA 1Z4UA 5L1LA 4Q44A 4RUCA 3DLGA 2FJWA 2I1RA 2BRKA 4EO8A 3EPGA 2R8HA 4IKAA 3BQ2A 1QE1A 3BJYA 2ILZA 1RT6B 3DRPB 2C2RA 4J9RA 2WB4A 3MEDB 3BGRA 3IN5A 4KB7A 5F8GA 1C1BB 4ECVA 4ED1A 4ZPDA 4H4MA 4NLPA 3FRZA 3QZ7A 1S1WB 2HNZB 3DLKB 4FS1A 3M8PB 4RW6A 2IM1A 3DLGB 4RW9A 3KK2B 2FLPA 1TL3B 3CJ2A 2J6TA 4NLYA 5T14A 5KT6A 1UWBA 4ECXA 3RB6A 2JEIA 3QO9A 2E9RX 4DL6A 3CWJA 4IQXA 1FKOB 5KFZA 5C25B 4NLVA 1K1SA 1HNIB 3DLKA 3KNAA 4O4GB 2R8JA 1IKWA 5I3UB 1EETA 4RW9B 2IM2A 4K50A 4IG0A 1N5YA 3ISND 5FDLA 2GC8A 2ASDA 2YNIA 1SH2A 1LW0A 3BQ0A 4J9SA 4TQSA 3MR2A 4JV1A 3T5HA 2RF2B 4R8UB 2YNFB 3BGRB 3MF5A 2IJNA 4H4MB 1IKXA 2C28A 1SV5A 1HQEA 5KFDA 4PWDB 3MTKA 4IFVB 1WNEA 5KFOA 3KLHA 3V6KA 5KG2A 4ZP7A 2VA2A 4FBUA 3UQSA 4F4ZA 1GX6A 2W8LA 3DOLA 1DTTA 3RB4A 4Y34A 4NRTA 2AWZA 1C0UB 4Q0BB 5DG7A 1N56A 1S9EA 3C6TB 1DTTB 1C2PA 4PUOA 1S0OA 4PQUA 5DG8A 3DMJB 3DYAA 2OPRA 1HYSB 3TAMA 5EWGA 3G6YA 2J6UA 5DLGA 5KFMA 2FVPA 4RW4B 2JEJA 1TKTA 2QE5A 4R0EA 1RT5A 4MFBB 1RT3A 1BQMB 3MFHA 4TXSA 4HYKA 3QZ8A 1HPZA 1N4LA 3DOLB 1IKYB 4WFXA 1JX4A 3JYTB 2YNIB 5K14A 4KV8B 2B5JB 3GQCA 5KT3A 2FVSA 1LW0B 4Q43A 1JLEB 4K4TA 1JLFA 3D5MA 1EP4A 2OPPA 2AGQA 3DM2A 4KFBB 2B5JA 4JV2A 5KFHA 4WZQA 1S1VB 1S1UA 2YNHB 3DRRA 2AGPA 1JLFB 3HKWA 2IMWP 1RTDA 1C1CA 1JLAB 5KG0A 3NL0A 2IM3A 2EC0A 5HROA 5I42A 3H4DA 4FS2A 3MEEB 1R0AB 1EETB 4I7FA 4QWCA 2HNDB 2VG6A 5L1IA 3CVKA 4ECZA 2BRLA 3MEEA 4ED7A 1R0AA 4G3IA 3QGGA 5J2NA 4Q0BA 5DG9A 4RUAA 3BR9A 4WFZA 4URSA 4ZPAA 2JC0A 5KFVA 4QWAA 2E9TA 3SFUA 3C6UB 4IDKA 1JLBB 4RW8B 1NNDA 4KSEB 5F8IA 4ZPCA 1S10A 1RT6A 2CJQA 2UUTA 2YNGA 3TVKA 1IKVA 4DL3A 4TY8B 1RT7B 4ICLB 3T19A 4O3NA 1RTJA 1IKVB 2BE2A 4IH6A 5J1EA 3RBEA 3VQSA 2C22A 4TY8A 3DOKB 2BR0A 4ICLA 4EYIB 3NGDA 4URGA 2HMIB 4RW8A 1LWCB 3G6XA 4J9LA 1TVRA 3KLEB 2V4QA 4Q8FA 2DPJA 2GIQA 2ZD1A 3HVWA 1RYSA 3KK3A 2W9BB 5HLFA 2XC9A 5C24A 3LALA 5KFLA 1FKOA 5C25A 3TQ1A 1QAJA 2HNYB 4GC6A 3IGNA 1TQLA 4NLSA 3KMSA 4RNNA 1KHWA 2V4RA 3I0SA 4IOBA 3T5KA 1JLGA 3M9NB 1U09A 4WYLA 3M8QB 3KMQA 5KFYA 3KK2A 3H5UA 1S1UB 3M9MB 1N48A 3BSOA 2RKIB 2J6SA 1TL3A 2ILYA 4WZMA 4R5PB 1SUQB 2XGPA 5F8NA 5KT7A 3MECB 4K4ZA 3PHEA 4IRDA 1QUVA 2IJFA 2ZE2B 4U6PA 4WE1B 5KFXA 4R5PA 4K4XA 4Q45A 4ECSA 2ASLA 3KHRA 3IS9A 2R8GA 2FVCA 1JLGB 1HPZB 2D3UA 1GX5A 2XGQA 1BQMA 3Q8SB 3MFIA 2W9CA 3MEDA 4M95A 4ZVEA 5F8LA 3V6HA 4O4GA 4KV8A 1IKYA 5KFSA 1HARA 3H59A 4KHMA 3LP1B 3CDEA 1SH0A 1S9GB 3H98A 4I2PB 5EWEA 1C0UA 4O3QA 3OSNA 4WFYA 4RNFA 5JXSA 2QV6A 3C6TA 4TN2A 3KK1A 4NLRA 1UWBB 1S9EB 3DYAB 4PUOB 4U7CA 4NLTA 2OPRB 1W25A 3DMJA 1S1TB 4NLDA 5KG6A 4LSNA 3GV7B 3CDWA 4NLUA 3PVXA 3UPFA 1JXLA 3QIPB 4KAIA 2UVUA 3PW5A 1SV5B 5J2MA 4PWDA 3MR3A 3EPIA 3DOKA 1XR7A 3GIMA 3BSNA 3PW7A 1S6QA 2IC3B 2JLEA 4QWDA 2IA6A 3PJWA 3DRSA 4NLWA 3FDSA 4F4WA 1SUQA 2V0NA 4ED8A 3T5JA 4IRCA 4YMEA 3G6VA 5L1KA 4IRKA 1RTHB 3H2LA 1RT2B 3OLBA 3KOAA 2RF2A 3NAIA 1S4FA 5KFNA 2BANB 1BQNB 3QLHB 5KG4A 4NLXA 4URQU 2AU0A 4JUZA 5KFWA 3OHBA 1VRUB 3I5BA 1HNIA 4IH5A 2WCXA 4F4XA 3HVTA 4H4OA 2HAIA 3MEGA 3ITHB 1JKHA 1S0NA 1RT4A 4RW7A 3IRXB 4O44A 3HVTB 4H4OB 1T05A 2FVRA 1MU2A 3KK3B 2BANA 2W9BA 2ZD1B 4ZVGA 5KFKA 4NRUA 3N6MA 4ED3A 1RTDB 5F9NA 3G86A 3DLEA 4EBDA 5F8HA 1S97A 4LQ9A 1S6QB 1T94A 3EZUA 1TKXA 2BE2B 1RTJB 5J1EB 3RAQA 1HNVB 4Y3CA 2XWYA 4DL5A 3E01B 4YR0A 4NYZA 5KT2A 5L1JA 3KHHA 4Y2AA 4B3OA 3NMAA 1REVA 3LAKA 1DTQA 4YR2A 1S6PB 2WONA 2XI2A 4XPEA 3DRPA 1RA6A 1S1TA 1I6JA 3I5AA 4IDKB 4HKQA 4J9NA 2VG5B 3PR5B 2WRMA 4NCGA
chains in the Genus database with same CATH superfamily
2CG8A 4MK8A 1LFPA 1Q81T 3CUNA 3BQ1A 2B43A 4M5LA 4NXMF 1HBMB 3MI7X 5GMDA 3CJ0A 4I6WA 4U7UK 3CCES 4LFBF 4DJBA 3QT6A 3OHAA 4DV5J 3VAJA 5HVGA 4NLOA 3HDSA 1RXOB 1RU1A 2RJZA 4ZP9A 3D9BA 2DGOA 2QYCA 4BWJA 2MQMA 3SSRA 4AD6A 5KT4A 3GV8B 4J9OA 2D7SA 4DF8A 3MPYA 2JL9A 2OPPB 2CDRB 4ZA1A 3H2UB 4F4KA 4CLPA 4O4RA 1ZBTA 1ZAWA 2ZE2A 2H4YB 3MD3A 2FZGB 1FNXH 1C1CB 4OLOA 4RL1A 2ASJA 4ILLA 4U8VA 1U2CA 4R8UA 3EGZA 2YKNB 3D66A 3OQ2A 2LEAA 1KFDA 2ZBCA 4WIQA 5B0AA 2YKQA 2R8IA 2V94A 5IT9U 2DNGA 1JLCB 2FJAB 3TZZA 3BKFA 3GR0A 3DRSB 3NCQA 2F7VA 1KSPA 2IC3A 4ED2A 2L48A 5EHHA 4C8MA 3CCRS 5FJ4A 4LRAA 3AAWB 3FEZA 4MTPA 2B4UA 1XEZA 4RUHA 5A8WB 1LWFA 1WEZA 1T03A 1TV6B 4CLSA 3EX7B 3MXHP 3J81j 4K0KJ 3D6TB 3ICLA 2XSFA 1PKUA 3POTB 4TLQA 1VQ9S 2DR5A 2J7KA 4PQUB 4DQPA 2UVVA 1VQ6S 3OL7A 3QLHA 3DRXA 4F67A 4B3TJ 4NA2A 2UVRA 4X4UA 4DR7F 5C42A 2BW7A 2B4PA 1T95A 3ONQA 4C3KA 2FLLA 4GKKF 2V9KA 1SC6A 3HD1A 3KG1A 4RJVA 3V6DB 3D1HA 3KLIA 3GIIA 5F0WA 4DL0C 1HI1A 3QBCA 1RT7A 2LQJA 4HL9A 4CRJA 1IBLJ 3HFVA 4OJHA 2XYPB 1CJVA 2N7YA 3CJ3A 3ISNC 3MAAB 4EEYA 2V4JA 2EFNA 2VH7A 1S0MA 4LSZB 3M30B 3M9OB 3W65A 2GS8A 4FVMA 1UVJA 4OJ3A 2XZTB 2QJ3A 3OD2A 1NPPA 5LJ5Y 1HMVA 2H1YA 4ZHRA 3SXLA 5J2PA 2JEFA 1I94J 4DPWA 3Q8RB 5EDWA 2MSTA 2FHMA 3MEGB 1J2VA 5D4PA 4I2QB 1G7CB 5E3CA 3TJAA 3V2UC 4CLKA 1S48A 5CYJA 1QSLA 1RWKB 3C8YA 4Y0FA 3UR0A 3AY0A 4I2QA 3UFCX 4J9MA 3OVBA 4HLBA 3MMBB 2P6TA 5AXNA 4RBTA 3TUJC 3TW0A 5CD4A 3CPWR 2FLNA 2F8EX 1QTNB 3KLFA 3DRRB 2YKNA 4NXNJ 4E8UA 1OYDA 1HNZJ 1WSRA 1C1BA 1RT1A 2VL1A 2X3DA 1PCAA 3NGRA 4Q2MA 5CYQA 5IT0A 2A6OA 1VQKS 3TZWA 2JEGA 2F4VJ 3MOJB 2VPWB 1RT1B 2DH9A 1EP4B 5CYQB 4CO1A 2WOMA 3OSPA 3DDKA 4QR2A 1Q86T 1X4AA 2OEMA 1S49A 1UJ5A 3W2WB 3DI6A 5JUMA 2HVDA 3T1YJ 3NXZA 1SKWA 1KEKA 2DGWA 3MPVA 1LWEB 1T7PA 2PD1A 2LQ8A 4DV6J 3DNCA 4XK8C 3DU6A 1QE1B 4JI6F 5C7PA 4CH7A 2OSRA 3V81B 2CZVC 5M2UA 4LSNB 2QLWA 5FIIA 5LMUJ 2HGMA 3IBWA 3MCMA 2ZOGA 1TKZB 3VF0B 3US5A 1Q95G 2F40A 3P8BB 4KPCA 2IM0A 2BQRA 1T03B 2CJBA 1FKPB 3MR5A 5HL7Q 2YKPA 1T0TV 3I0RB 3V4IA 1SJRA 2FY1A 1IVZA 1HBNB 1RTZA 1NCLA 1VHFA 2XBPA 3LGMA 2KXNB 4ED0A 2FLOA 3R2DJ 5KOWA 4DCPB 1X5PA 3CCMS 4A8FA 2AIRB 5KFPA 3ILLA 3CCLS 2DCLA 2YWEA 3KJFB 2ZJPQ 1EKRA 2VBYA 3HHDA 2XYGB 2CQ4A 3CD5A 1RACB 3VCDA 1NRKA 1F2GA 5CD4H 1FRMA 2R2RA 4IQMA 2ADBA 4P6QA 1TAUA 1PAEX 1LKZA 2ZKUA 5KG5A 2HIQA 5H1SV 2XMVA 2WTFA 2MPUA 3A3NB 3FBBA 4K4YA 3CJSA 3MMBA 4IG3B 5J2QA 1KC8T 1FJGJ 5F8JA 1WKJA 2P5VA 1XMOF 1UEUA 3JTPA 3KJQB 3KLGB 1TK0A 2IBKA 2V2ZA 1MU2B 2BE9B 3BO3A 1LV5A 3ENVA 3QSIA 3TAMB 1T9XA 1A0OB 2AJ1A 1WELA 2PIIA 4A8OA 3BZQA 5L39A 3UD4P 2R8KA 1X9WA 3AXMA 1KLMA 4HHUA 2N3OA 5IXUA 1NK6A 1URNA 4AFFA 5FD1A 2OFHX 1L3VA 4LFCJ 3IBCB 2I5JB 1WI6A 3M8ZA 2XMJA 1H72C 3NBPA 5KG3A 2VFSA 3IM9A 3P45B 3QIDA 4YB6A 1GMUA 3A8JA 1R8CA 1FA0A 3M8PA 2MKKA 2BQUA 4ZIWA 2BDPA 2K3IA 3BGUA 4NI2A 2IVFB 3IC1A 3P5BP 4KPYA 1W2IA 1WSVA 1XNRJ 4OIXA 4ZN3A 3Q8QB 4WPAA 2IAJB 1KTVA 1OPIA 4DV3F 4DR5J 1SCJB 2C2NA 3NWRA 4PG5A 4MKAA 4FF4A 3O6QA 1LXNA 3TRGA 5F9LA 2JRSA 1CULB 4DR6J 4JV0A 4UQTA 4F36A 4BC7A 1RT3B 2ZWOA 3W2VB 2DR7A 3GIKA 4R0JA 1FT8A 2CAJA 2QLBB 3K59A 4B9SA 1JNRB 1VC5A 2YKMA 2M2BA 3T6BA 4ECUA 2U1AA 1VR6A 3HHLA 3L09A 4OL8A 2XTDA 1WC5A 1NB2A 3W8GA 3KNGA 3HT0A 4LSLB 4YB7A 5E33A 1U47A 3G4SS 3UDLA 2W8KA 2VA3A 4DL4A 1XTZA 3ENWA 2M88A 2VB6A 1OQ3A 1NK0A 4OZ3A 1U1MA 1U8SA 1SVDA 2RQKA 3POTA 1VQ7S 4ZVHA 1Y00A 2C2ZB 2MKSA 5LJ3Y 2R2SA 2YNFA 3I9ZA 3VGTA 5I42B 3LP0B 4ZCKA 1Q5YA 4EI2A 4YB5A 2B9WA 2QMXA 5BYSA 2BJDA 1F9FA 4RO0A 4IR1A 4FF2A 2EXUA 1YJWS 2CPFA 2PFFB 2P9GA 2RSQA 4RNHA 2CJAA 1R3NA 1H7WA 1IR1A 2YQ3A 1NJYA 3HJFA 1NJIT 2Q66A 3VAFA 2VODA 4MIBA 2HBRB 4NEZA 1DFDA 4PEOA 4DUTA 2Z58B 4P7VA 4YEAA 2GO8A 3M4XA 3VZHA 3CCVS 3FJ2A 1X4EA 2Z2YB 4KH1B 2DNLA 4DCOB 4K4UA 5KFCA 2XO7A 4DSIA 1J27A 1H0HB 4HEA9 4J9KA 3PO4A 1U6FA 1B0TA 1WC3A 2Q43A 1TUWA 4MK9A 1K44A 2HNYA 1RQ0A 2DNKA 2N4CA 4NCAA 2DNHA 4RW4A 3FBEA 1IM6A 5KFGA 5K8NA 4O3SA 2AJFE 4YHHJ 5LMNF 2DPIA 2L08A 2MQLA 3M32B 4P10A 1FXLA 1UJ4A 2RDJA 1S6PA 3BB5A 3SZ2A 2HFSA 1Y10A 5HATA 4OX6A 3N6NA 3CD6S 2FD2A 3BKTA 3RZAA 1H38A 3MM8A 4UY8T 2MDAA 3VTIA 3PACA 4RUCA 2H51B 2XY5A 3NS7B 3MM6A 3OR1B 4L75A 4EO8A 3CXCR 2R8HA 1R8PA 3BQ2A 2A2CA 2W4CA 1GTHA 2W4DA 2XHWA 4TNOA 3S7RA 4A47A 1WTFA 1C4CA 2C2RA 1DHMA 4J9RA 1UZDA 3D0IE 3PEHA 1FRXA 4N8NA 3CCTA 1C1BB 4ECVA 4ILMA 5D4OA 3CGIA 4DLEA 4FYXB 1V5VA 4X4OA 3IWLA 3IA0A 3M8PB 3KUHA 2IM1A 2POKA 2A0FB 2W2MP 1OMSA 2GCFA 2J6TA 4ENOA 4AL5A 3TWZA 5T14A 1UWBA 4LRDA 3HZEA 2HHPA 1RAEB 2UXCF 4ANDA 1EHWA 2VUGA 2EFVA 2B9EA 2M0GB 5SZTA 2VDHA 1N34F 4OYPA 2RQMA 3KUGA 5KFZA 5C25B 5IWAJ 2LP4A 4NLVA 1K1SA 2JH3A 3KNAA 3DLKA 2WSFC 5A0YB 4NX9A 4JI7F 3MM9A 1YITS 1VQ4S 1EETA 2VBXA 1CPZA 4A8XA 3F41A 4IG0A 4L73A 2KT5A 1N5YA 1KWMA 2AHOB 3ISND 4HDHA 4ZLLA 2KB2A 4NL5A 2GC8A 5LXRA 4Z7YA 2ASDA 1SIZA 1XBWA 3BQ0A 4USKA 4OI6A 5F0UA 1P1TA 1N5VA 3AFGA 3PYGA 3TEHB 1VQSA 3BBFA 4LJMA 1HBNA 2C3MA 2RF2B 3WQPA 2YNFB 3BGRB 3MF5A 4PWWA 5AT1B 2W2NP 2XY6A 2IJNA 1O6XA 2PMZD 4JI4J 3H8YA 3A1YG 1HQEA 3I96A 4IFVB 2HG4A 4C0BA 6FDRA 2BJ3A 4ZCIA 4ZP7A 3B4MA 1GX6A 2F8HA 2UV8G 1YJVA 2D69A 3DOLA 5EGYA 4B9MA 4CLYA 4GVLA 1BMQB 4NRTA 2AWZA 5B0EA 3RB4A 4NXMJ 1C0UB 4OZ2A 1QJHA 3H7HB 1P1LA 2HS0A 1N88A 3LPYA 4YDXA 3C6TB 2OFGX 4DOZA 4LFCF 2MY7A 1RCXB 2YQ1A 1IWAA 3DYAA 3QWUA 4QPTA 2G0CA 2OPRA 5DG8A 3Q0AA 2W2QP 4JI2J 2GMHA 2H65B 5D0EA 3TAMA 4W90B 2DR9A 2JEJA 4RW4B 2M3DA 2QE5A 3SV3A 1HL6A 1HBUB 1RT5A 2QZ8A 1RT3A 3W2VA 1WOSA 4TXSA 3PIPQ 1YWXA 1N4LA 2VQEF 2W7AA 1ZH5A 1IKYB 1EB0A 3D3BJ 4LF8F 3JYTB 3GQCA 1Z1ZA 2FVSA 3GWCA 4ALZA 3ZC4A 3MMAA 2CWKA 2BA9A 1JLFA 1NKCA 1EP4A 2OPPA 1JK9B 1ZZFA 1X4DA 3DM2A 1UW4A 4KFBB 4JV2A 1UVIA 4WZQA 4I1TA 3HKWA 3HI9A 2M7SA 1JLAB 2ZZTA 1X0PA 1BD6A 3QJJA 1KTQA 1K0VA 4MIWA 1R0AB 2X7IA 1EETB 4I7FA 2MMYA 2Z0GA 3CJQA 2HNDB 5L8RC 4QWCA 3M8RA 2ZH1A 2DNOA 1UPMB 4PCQA 1R0AA 2RE1A 4GRSA 4X65J 4Q0BA 1A9NB 4RUAA 2K3KA 4WFZA 2YX1A 4Q5VA 4PG7A 4WWSA 4OJ1A 2VKZG 1GXUA 3SFUA 2KVQE 1P27B 1Q53A 2DTJA 4I64A 1JLBB 3QAUA 4A46A 4DUYJ 2CADA 3VAMA 1NK7A 4M5NA 1I3OB 1MROB 2BJ8A 5F8IA 2YTCA 1S10A 4N76A 5ETNA 3RRGA 2DT9A 4PXBA 1NLKL 1NHKL 2ZUAA 3AT1B 1RT7B 2J8AA 1ZPWX 1KKHA 2KT2A 1NK9A 4CIOA 4M1KA 2ATCB 3K89A 4QR1A 3VQSA 2QFJA 1VQOS 3DOKB 1UZHA 1TFWA 3I6PA 3W61A 3NGDA 4URGA 5L38A 1VK8A 2EPIA 2BZ2A 2RS8A 4RW8A 1VIXA 1TVRA 4OMFG 4UTGA 2E5LJ 5T7LB 2RRAA 1HHQA 2K7JA 1VHIA 3FUYA 3HVWA 3GJRB 2Q6BA 3KK3A 1RYSA 3NCPA 2HBQB 2UZAA 1JMTA 3CTRA 1F0XA 2OTJS 1FDBA 2AMCB 4DFPA 3HFKA 1R8BA 1JLGA 3M9NB 1X8DA 3ZZPA 3CB4A 1U09A 1FVQA 4NXNF 2DISA 2KFZA 4ANEA 4WYLA 2IFXA 2V1TA 3D68A 3K8VA 4B02A 3KK2A 3M9MB 3U27A 5KAKA 2MB0B 2K1RA 2RKIB 5IC6B 2XS2A 4WZMA 4CI0B 1LFWA 3AJ1A 1F3FA 1ZZNA 1X5SA 4N5SA 4TU9A 2E1PA 4WE1B 5KFXA 4ELTA 4XDDA 4Q45A 3KHRA 2KH9A 1HPZB 2FVCA 1PSDA 4EUVA 1BQMA 4ZS6A 3MEDA 4OFZA 1XNQJ 2V63A 1RWMB 3S1TA 2H9ZA 2IYIA 2HVIA 2OLWA 4DPXA 5CXTA 1CJTA 1F60B 1EIYB 3OSNA 3SCJE 1U1RA 5LMUF 5JXSA 3N79A 3KK1A 1T8EA 4JV5J 4P74A 4NLRA 4AQYF 1UWBB 1YIJS 1S9EB 3O5TB 3EE3A 4JI1F 1JJHA 3DMJA 2V50A 2HRUA 1S1TB 4UOGA 4OI3A 5IOLA 4ZITA 4OHXA 3G82A 3FBFA 3Q23A 2KZZA 2XMUA 3UPFA 1JXLA 2ZHAA 1VOMA 3QIPB 4KAIA 5K9FA 2UVUA 3MM5A 4USIA 1SV5B 3DOKA 3GMGA 3RR7A 1ACMB 1S6QA 2IC3B 5IFMA 3PFEA 3FDSA 1N36J 4FYYB 3TVZA 3ZXWA 2LXUA 2ZFHA 3BV8A 1SUQA 4F4WA 5GADU 2AP6A 4ED8A 1F1BB 3T5JA 5L1KA 1DARA 4IRKA 1RTHB 3UN2A 3NY0A 4C7QA 3H2LA 1RT2B 4Y6IA 1IBKJ 2RF2A 2I2YA 2KXFA 2WVCA 3W1YC 1S4FA 2XMTA 5GAHU 3QLHB 4DSLA 2C3YA 4NLXA 1ZOTA 1XMOJ 2MLYA 3N01A 4C8NA 5A76A 1ZA2B 2CJYB 3I5BA 4IH5A 3LWMA 1SQEA 4O0NA 2ZH8A 3W3SA 4KY3A 1RISA 3FCHA 1JNZB 3MEGA 1XQIA 4NPOA 2P8IA 2CQPA 3EZOA 1S0NA 5CZXA 3DU5A 2D68A 1H73A 1TFYA 1MU2A 1U8WA 2BKNA 3R5DA 4WFBQ 1HR0F 2W9BA 2BANA 3CJTA 3W63A 3LO3A 3TUPA 4HACB 4NRUA 3N6MA 1FRIA 1KR4A 1NK5A 3HHNB 2LA4A 3G86A 4OYZA 1PC5A 2UUAF 4WJBA 2N4DA 5J1PA 1T94A 4N56A 3K5NA 1RTJB 4OZNA 5J1EB 3RAQA 2XTJP 1MMDA 3AX3A 4XDCA 4DL5A 2J8SA 2MKJA 1X4CA 3LPEA 4JOUA 2GQCA 5AE2A 2GZOA 5KT2A 2HPUA 2VONA 1YBAA 1FJ7A 2YXLA 1S6PB 3MAHA 4XPEA 2VU5A 4DS5A 1FX2A 2MZJA 2XULA 3DRPA 1Y5IB 4ZVUB 1S1TA 3TUZC 2ZJRQ 2AYGA 1HBOA 3CDBA 3MM8B 4IDKB 4LFBJ 2OKQA 2VG5B 4LUBA 3PR5B 3GONA 1V9OA 4IOCQ 1FESA 5B0CA 2IY5B 4DQRA 1Y5LB 2BV3A 5GAEI 4QZVB 2HQ3A 3X1LB 4P71A 4I7FB 4WP8A 3V81A 2YH1A 2J0XA 5B0BA 1HHSA 4C8YA 1F5AA 2LA6A 3HJVA 4WP9A 4C6AA 4YQWA 1N5SA 2D3ZA 1D09B 1T9WA 4ITSA 1REVB 2O01C 4HHJA 4F7VA 4C2MA 3LP1A 4ECWA 3P5TL 4QQBA 2UXBJ 1REGX 5E3PA 3Q2SC 3TP2A 3WDOA 4KGVB 3DI6B 3TNVA 3L7OA 4C9DA 4M8LA 3NLCA 3B6BA 3SFGA 1LWEA 2GQQA 2V67A 2AT1B 2IRYA 3EVOA 4KO0B 2MGZB 2JLGA 4DR3J 1JXEA 4CNZA 1KONA 2EFQA 1XC9A 5BR8J 4UQGA 3GE9A 1J5OB 1VQ5S 1SXLA 1TMMA 4G1QA 2EKYA 2GGPB 4W98A 3UN3A 5A8KA 5KFBA 3IS9B 5KFEA 2KHCA 3OFFA 3EDRB 4P2MA 3SCLE 1J5OA 4G1QB 2HVEA 3VAIA 1ZTWA 2B9XA 3G87A 3CJ5A 5E3QA 3ENQA 3TARA 5H9EK 1A6LA 4F3OA 1OY6A 2CQCA 1SIWB 3CJKB 3BSCA 3MUMP 2CFXA 3VV2B 1JJ4A 1MNEA 2UP1A 3CJ4A 5F8MA 2P9CA 5B0DA 2BE7D 1S5ZA 4CLTA 3KJVA 2OAUA 3D6FB 3EXYA 3KHLA 2KG0A 3LAMA 4HT5A 5K8OA 3RAXA 5HLFB 1S79A 2DNYA 2XMAA 1MSWD 4TYAA 4MMOA 1VI7A 1N5TA 1C0TB 1S99A 2AYMA 1TL5A 3IXQA 4QWBA 4CQ1A 2KM8B 2V4QA 5J2PB 2OMOA 2K7KA 3B8HA 5DRKA 1HNWF 2CQ1A 3KLHB 2G1HA 2Z2MA 2B9YA 1SB6A 4B9VA 2E7XA 2MZQA 1ZS6A 1TU0B 2FHKA 2OHDA 2QL9B 3CEDA 5KFTA 4A48A 4EBCA 4EGLA 1DJ0A 4U96A 2KYZA 2IAJA 3HCXA 4LREA 4Q8EA 3T9ZA 1N32J 1TUGB 4U95A 4LBPA 1KLMB 4UUXA 4X66F 1UA1A 3KLFB 5LM7E 1XIQA 1EZZB 5B0GA 2I5JA 3R7BB 4KH0B 3I4HX 5FLXU 1VRUA 4AE5A 1NDLA 3FQLA 5HQMA 4C8OA 2XYHB 4FN5A 4OI4A 1WKLA 1EQ0A 3GFXA 3UVJB 3GU0A 1YJ7A 3J7YI 4ZCMA 1S72S 1M90T 3ETOA 1L3UA 1CEZA 1AUDA 2HFNA 2KG1A 4ED5A 2HVZA 2Z8QA 3IWXA 2QLFB 3ETMA 3LP2A 4GO7X 5I3PA 1HQUA 5HVHA 3HVRA 1OPZA 3GCWP 4WU3A 4QPXA 1X5TA 2QG9B 3PNIA 1YTYA 2W7PA 4DV7J 4RNMA 5K14B 3HZGA 2ZHBA 2ZH2A 2XNRA 3OR2B 2AZ3A 3WX4A 4JI5F 2ZM6J 2CQDA 3DC2A 3OTBA 4MYTA 4C8LA 1TL1B 3JSMB 3S01A 1FEHA 5GADI 2DYAA 3AQPA 2K06A 2JWNA 1RTHA 1D1UA 2UUBF 4IR9A 4F25A 4K4VA 2HHWA 1SC4B 3VWSA 4ETZA 4DWIA 2B6AA 1FVSA 3ET6A 3PRVA 1RLDA 4ZJOA 3P6YC 3N6LA 5CQGA 5GMKa 2BKPA 2DIVA 4RU9A 4EZ9A 1JB0C 4FBTA 4WBFA 4F50A 3EDQB 3UN5A 4L3NA 4KR0B 1SL0A 3KG0A 5L46A 4WFNQ 3CIMA 4E0DA 1HWJA 3SIPB 4XO0A 3BN7A 2VPYB 1DBDA 3WZ0A 3KHGA 3OUYA 2DHAA 2MLZA 4IFYB 1SI9A 1PO6A 3RR8A 2VQEJ 5ETPA 4X4RA 3VAKA 3IG1B 3LH2S 3AOCA 3M6WA 5HVFA 3GV5B 3RB0A 2O5DA 3AA9A 2QLXA 4WK3A 3FQKA 3TYTA 3G71S 3EXCX 2YNGB 4MKVA 4FP9A 4J9VA 1HWLA 1OJ4A 2H5EA 1FF2A 1KQSR 2L3MA 1DQ9A 2B4OA 3KLVA 4B17A 2R2TA 2XM3A 2FJEB 3KKFA 4NOHA 1AT1B 2HHVA 4WE1A 4G1IA 2Q79A 3V6DA 2WOMB 2XCPA 5L9XA 4NLQA 5HSPA 3CD7A 2F63A 2QMWA 1TL7A 1HNVA 1RP5A 3HD2A 4PAAA 2E1CA 1S1XB 2VIHA 1KHVA 1AROP 1M1HA 1RLCL 3QGPA 5KFJA 2NREA 2RUSA 3ITHA 2ROEA 1RT4B 4FPRA 3CCJS 2YBVA 3PYFA 3GB0A 2UUWA 1DLOB 3LP2B 1SH3A 1PAUB 2KYXA 4Y2KA 2F65A 4PG8A 2XCAA 1M0SA 2DJWA 5LT5A 4DX8H 1RDRA 4ZOSA 3I0SB 4ZLNA 3JQJA 2FQQB 2WAQD 4XIUA 1IWGA 3IR5B 2N7CA 4M94A 1UEKA 3KDOA 3FMBA 2NXJA 4H4KA 3H20A 1WC1A 3W5YA 2DO0A 2RB7A 4N77A 3GYGA 4DR5F 3MAAA 1TVRB 4RR5A 3SMZA 4X4NA 3MEKA 4DR6F 1RE1B 2C3PA 3BBBA 3QATA 4PQAA 1SJFA 1U45A 1RBOB 1KOOA 1S9FA 1T9TA 3Q8VA 1YKWA 4K2XA 1BLUA 2H5IB 4UW2A 5J2MB 2EWHA 3GILA 2XY7A 2DHHA 2OPSA 2BJEA 2NLWA 3A13A 3DGPB 2X1BA 5D0HA 2I6WA 2YPZA 4UZBA 1R6VA 3KLIB 1ITPA 1X7VA 2GHVC 3G82B 3HKZD 2J7WA 1KFSA 2IHR1 2JC1A 3PM9A 3UCUP 1LW2A 1Q4RA 1MMLA 2H54B 2C42A 3E3XA 3VAHA 2BJ7A 2MXYA 2DB1A 4PZVA 3KLGA 2ZH9A 4NE9C 2WBMA 1E6VB 1QLNA 1FNMA 1IJEB 2MKCA 1L3SA 2I0XA 1T05B 3KJVB 2XLJA 1YJRA 2QL7B 4DEZA 2NYIA 3BGOP 1CS4A 1R7IA 4DN0A 5HMXA 1MWZA 5DGAA 3SI8A 1RTIB 1XJWB 4X2BA 1YZ6A 2HLTA 2IA0A 2L9WA 4RWWA 5M2PA 2BYCA 2PO4A 1VIOA 1X9SA 1HI0P 2V1SA 2MKYA 2DBBA 5BYQA 3UWTA 4FXWA 1M5PC 2C3UA 3G2XA 3AB4B 2R9LA 1U48A 1R8HA 2WZ1A 1JLCA 5HBMA 3DKDA 2QA4S 2FJXA 2E9ZA 2K1RB 2RKIA 3QT7A 4K4WA 4CCHA 1NJXA 2IVYA 3MECA 5BYRA 3RBDA 5MAOA 3DM2B 1U2FA 2N3LA 1VK3A 4KFBA 3MR6A 3H40A 4RNOA 1AXQA 3LP0A 1KP6A 1XERA 4Z37A 2E66A 3E51A 3C16B 4DU7A 5C24B 3J81U 2B4VA 3C14A 2AEFA 2J9EA 1NUEA 2V8VA 4ZJLA 4NZ0A 4MFBA 4DSJA 2ACYA 3ZFVA 5DLFA 2O67A 3EM1A 3J80U 4DG1A 4PXEA 4EFAC 4ELVA 4TQSA 3DLGA 4UOHA 2FJWA 1HKAA 1M5KC 3EPGA 2MQQA 5AXMA 2MQPA 1WHWA 2KJVA 3F0NA 3HF5A 2ILZA 4DS4A 2V69A 4LR7A 1SJQA 2WB4A 4RKUC 3PHTA 1RU2A 3ILJA 2M8HA 1N8RT 1KDNA 2LCWA 1PILA 3L7PA 1KQKA 3TA2A 4ED1A 1B7FA 2GAGC 2JVOA 2G2OA 3QZ7A 1F9HA 4YOEA 3DLKB 1NAQA 3CCQS 4RW6A 2QGFB 3AA8A 2DIUA 3TR5A 4K8RA 3PXGa 2DITA 4RW9A 2HS4A 5HP1B 3RRHA 4DV1J 1TL3B 3A8IA 2MHNA 2AW0A 3K8WA 1AZSB 4M5IA 4ECXA 3R5AA 5IQ6A 3RB6A 4EWTA 2JEIA 2ZH5A 4CT9A 3ZTSA 4DMZA 4CO0A 1VQNS 3CWJA 1FKOB 2HRTA 2V8PA 2VKRA 1U4BA 3W8PA 2VBWA 1D9DA 2E1MC 3MCNA 1MWYA 3UE2A 1WF2A 4DFJA 2M5YA 4M5HA 3SQGA 2IVMA 4DV0F 4B9LA 2ZZMA 5GAGI 1QAXA 1TL7B 3BYPA 2DGQA 2NSBA 3UD3P 3OVSA 1NKEA 2H48B 1LW0A 3PKMA 1G4CA 3MR2A 4OYMA 1WACA 3DLBA 3L4BC 4PR6A 2HHQA 4YN3B 3T5HA 2GFFA 2CQ2A 2CJKA 4ES3A 1U0HB 1Q1KA 3T1HJ 1IKXA 3UW1A 1M1GA 1W26A 4A8MP 4PWDB 1WNEA 1U24A 2PC6A 3I87A 4CO5A 1I1GA 1U49A 3IMQJ 2FPHX 1TR0A 4Y28C 2BJ9A 1YJNS 3UDEA 4FBUA 2W8LA 1DTTA 1GMWA 2RU9A 1RAFB 4HR2A 1YJ9S 1ICEB 3J81Y 1N56A 1S9EA 2XHCA 3AD9C 2DRAA 3JQMA 1S59A 1URRA 1S0OA 5IC4B 3TAPA 3CT9A 5G0RA 4CM0A 3BM7A 1M5HA 4L72B 1CULA 3OJUA 2J6UA 2GMJA 2JFKA 5DLGA 2FVPA 3BDPA 2VBZA 4GVBB 1BY9A 2CPZA 4MFBB 4ZVQB 3R2CJ 4DR3F 4GKJF 3QZ8A 2UXDJ 2EBEA 2RT3A 4DV2J 1K0TA 3VVUA 3U1LA 2YH0A 3O8WA 2KFYA 3A8KA 3OR2A 4OHYA 4X4QA 4K4TA 2KJWA 3FEXB 4FKYA 3SSQA 3AWRA 2ALYB 2BXJA 2ROPA 4ZCLA 2ZH4A 5DJBA 3M8YA 1TMJA 1YSJA 1RAIB 2YNHB 3DRRA 5DDPC 1G1XA 4CT8A 3CCZA 1X9MA 4IOAQ 4NZ7A 4B3RF 3VVTA 1H74A 2A6MA 3MEEB 1HBMA 2FJDB 2MJUA 2VG6A 5L1IA 4WF9Q 3KUEA 2BRLA 4I0WA 4G3IA 1XN9A 3QGGA 2PSZA 5J2NA 2HK3A 2XEXA 5LSRA 2XMWA 5DG9A 1OY8A 4ZPAA 2CPYA 1IBMF 4DBQA 3VHQA 4ERDA 4WKRA 1GXLA 4PPDA 4HT7A 1V3ZA 2FC9A 3NP5A 4RW8B 2NCKL 1IR0A 4L74A 1EX8A 2BABA 1VC0A 4IUFA 4KSEB 4A8SA 4QIGA 1CJUB 2DK2A 3Q83A 3R97A 2CJQA 3CJ8A 2UUTA 3HXMA 1IKVA 2BM0A 2BKOA 4DX6A 4TY8B 4P2FA 2Y8YA 4DSEA 2CWXA 4H4KC 2JNJA 2BE2A 2BR0A 2C22A 2MQ8A 4TY8A 2OEKA 4EYIB 3BN4A 5HMYA 3W9IA 5E3AA 1LWCB 3G6XA 1JX4A 1A7GE 1MROA 1WI8A 2E29A 2GVDA 3L3CA 2GIQA 2GA7A 4MYUA 2ZD1A 5CH7B 3FCWA 2B51A 3K0JA 2XC9A 2VC1A 5C24A 2V2QA 3OVAA 3RRKA 3IGNA 2YPYA 2DXEA 4NLSA 2QO3A 1QAYA 1KHWA 3DFEA 1O5JA 4BS2A 1NZ8A 3WC0A 3T5KA 3R6GB 2CQ0A 4I6AA 3JQKA 3ZTQA 1G6BA 4DXLA 3QJPA 2EC2A 2JSXA 4ID8A 5KFYA 4CLWA 2KO1A 4PABA 1LEOA 3BSOA 1U0SA 2H5JB 2XWXA 3M7VA 1TL3A 2ILYA 3NRBA 4R5PB 2XGPA 3NCRA 5F8NA 2EW9A 3B82A 2M4MA 4K4ZA 1FE0A 2JJ4D 3FC9A 3IM8A 3PHEA 4USVA 4LRCA 1QUVA 2IJFA 4U6PA 2ASLA 4F0KA 4K4XA 2RDDA 3BPSP 3THVA 5DDQC 1O51A 3AH6A 2D3UA 1JLGB 2Y1RI 2XGQA 4BCAA 1E6YB 3N0VA 4M95A 3U1NA 4USWA 5GMEA 3V6HA 4MJKA 4KV8A 1IKYA 2AD9A 1VBZA 3OXFA 4L76A 1X0FA 3LP1B 2GMLA 1SH0A 1L3KA 1S9GB 3CDEA 3H98A 4LFAJ 3THTA 4L6V3 5EWEA 3C66A 5J1NA 2VJVA 2D3O1 4RNFA 1WWHA 5ETKA 1C4AA 4ZIVA 3DYAB 2DD8S 4U7CA 3LWLA 3KFWX 5DDOC 3MMCB 4WU2A 1D8YA 2E7WA 4F4AA 3GFYA 4NLDA 1U1PA 3CF5Q 2ZVSA 4OZJA 1YX2A 1YQHA 1CVJA 1VQLS 1WKKA 4DV3J 1FX4A 3PW5A 3TX0A 4PWDA 3NG8A 3MR3A 3EPIA 2ERRA 1XR7A 3EUNA 1RKJA 3BSNA 1OSDA 2D1CA 1PJ5A 2FZCB 3FCVA 5CABA 2UU9F 5E5NA 4CH0S 1RWXB 1NH7A 4DU8A 3FMWA 2RILA 1OYEA 2V0NA 4A4JA 1ZYQA 3W2WA 4KGZB 1DURA 4WIIA 5DO2A 5HQ8A 1T05A 2G13A 5H9FJ 2RQCA 2LVWA 4RPFA 2JOQA 3B4DA 1HIYA 2BANB 5D4NA 2GVZB 5KFNA 2F9DA 4URQU 5ETTA 2AU0A 2WVBA 2YY3A 2XO6A 2FDNA 4HTJA 4JUZA 1FFWB 4LF9F 4X64F 2AV5A 3AODA 3OHBA 2XZDB 2ZHOA 2WCXA 4F4XA 1AUSL 2QX0A 5A0YA 4CLFA 2CVEA 2HHHF 3QPIA 3U02A 3O1LA 1UVLA 3ITHB 4EZ6A 1JKHA 2NQPA 1UJ6A 2Y3YA 3PCOB 2V34A 2QSFA 4RW7A 3HVTB 1D3WA 3UVJA 3HMJG 2W2OP 3HULA 2RVJA 2H4WB 3UDVA 1VQYA 1DY3A 4AYBD 4ZVGA 1RTDB 4CLLA 1CLFA 4Z7CA 4J5OA 1FRHA 2CNOB 2NXEA 3EVWA 4EBDA 4A8WA 3NGTA 3EZUA 1TKXA 1YJUA 2DGUA 2YKAA 3D3CJ 4KQZA 4K0KF 4RUBA 1RADB 3E01B 4YR0A 1DQ8A 4MAKA 5T41A 4KRWA 3KHHA 1H98A 3OUYB 1MMNA 1DTQA 2ZDOA 2QIFA 1I5OB 2WONA 2Z56B 2XI2A 3M05A 4HH1A 4CYUB 4K2JA 4GKKJ 1B64A 4Y2IA 1RSCA 2XTCA 3UCZP 3QRPA 3R5BA 2B8PA 4CNYA 5KOXA 4LIWA 3M2UB 1RHRB 2R8JA 2XB2D 1NDKA 1T11A 4QU7A 3ET6B 3IP0A 3TI0A 3M1VA 4ZK7M 2BUNA 2UXBF 1Q8LA 3M32A 2Y8WA 1HYSA 5LOQA 5ETRA 3VGVA 4DHVA 3SV4A 3I5CA 4LF7F 3RAMA 2YKOA 1HQEB 2VG6B 2QYGA 3D67A 5GVQA 1UEVA 2Y1IA 3PW4A 3OL9A 1R31A 3H4BA 1QM9A 1JLQB 4NMLA 2DNMA 1VRTA 4WYWA 1RZMA 2J9CA 1NSKL 2WHOA 3BR8A 1D9AA 1U6ZA 3I82A 3TA1A 5KG1A 2QC3A 4ZJQA 5KFFA 2AQ4A 4ZKAA 1I94F 2GVZA 2Z57B 3GJTB 3BO4A 3L7UA 5EX3A 1JLAA 2D41A 1B70B 1RWNB 2LXFA 2C2DA 2CUYA 5B0FA 2CXEA 2HZVA 2PA8D 2XMKA 3D0GE 3N9UC 2UXCJ 1TKTB 3R6LB 3PW2A 2OMLA 5K20B 4MKYA 2ALZA 4ATNA 3NS6A 1HNXJ 1IM4A 2NS1B 1UP1A 3HK2A 4KO0A 1XR5A 1V6HA 1NKBA 3AJDA 3O44A 3TUIC 5DM7Q 2X1AA 1M5OC 2AX1A 1HI8A 3R5CA 1SJ3P 3DLLQ 2MQOA 2QSWA 1RHUB 3HHKA 3HT3A 4YB1P 1Q78A 2DVIA 3EICA 5ETMA 1X4HA 3JAMU 1FTRA 5CYMA 3TJ8A 2YKMB 1D8ZA 1X4BA 2LDYA 2YVSA 2XQCA 3TVYA 1TP7A 2ZC4A 2ASYA 4EO6A 4QBUA 2RUGA 3H5YA 4GC7A 4DSKA 1BWEA 1FHTA 5IV4A 2EFOA 3PIOQ 4DV6F 2ZZNA 1DTQB 1FWPA 1AB8A 2KT3A 2NXNA 3EGVA 3UCGA 3HM9A 3CULA 1UCNA 4DV5F 4PYDA 3QFHA 4KT0C 3Q8PB 2RS2A 2MKIA 1HWIA 1UVKA 3H90A 1RGVA 1RA7A 3F56A 2AKWB 1V5IB 3KDNA 3UNYA 5MLCV 3RB3A 5I3UA 4X64J 1QAIA 2MYFA 1T3NA 1K8AT 3ZZZA 3OTOJ 1WEYA 1WDDA 1U1LA 2YQ0A 3CMES 2HVHA 1R8AA 1RAJA 3C46A 2C3OA 3TOQA 3EVMA 3GP9A 4LR8A 5HN0A 4LF4J 2R7QA 2CNNB 2MHEA 2MQNA 3MM7A 2V2VA 3MR7A 2W24A 1RHQB 2V8HA 2HRYA 3IRXA 1NEEA 4O44B 4TQRA 2J0WA 4A8YA 1OO0B 2A2DA 4P52A 4TYBA 3LGHA 2J5AA 2PEBA 3BF4A 3EGNA 1VMBA 1WOOA 1CJKA 3ULHA 1B0PA 4CTAA 2VG7A 3M2RB 4KTQA 3FFIA 1F5CA 2XI3A 3OT9A 4EBEA 2KFNA 2EFGA 4MK7A 4DI6A 4F26A 4FNHA 3UNGC 3OTEA 5DQHA 1FJGF 1PC4A 2PE8A 3W5XA 1HW8A 1F9EB 1KNZA 2DEIA 4NWBA 1PBAA 2EI5A 3N5BA 4QYZK 2OP5A 2BOPA 1VBYA 2Y1JA 5KFRA 4K59A 5HBMB 1PJ7A 2BQ3A 4NLGA 2HHUA 5D3GA 3CC4S 3M8QA 4Q7AA 4I69A 3GFZA 1NMEB 3R9LA 3KYLA 1HWUA 2F8MA 1Q8KA 2IBOA 2RQ4A 3H5SA 2FGOA 3IG1A 3MCOA 1RTIA 2V5HG 3SCIE 3CC7S 2APOA 3EWGA 3NGUA 2OPQA 2PA3A 1P6TA 1ELOA 4OHZA 5KG7A 5AJ3J 1HLWA 4DUYF 1LNQA 4ZDNA 1KVJA 4ZVRB 1F5BA 3W9HA 2W7OA 4OQJA 5ETQA 3JXOA 3BGLA 2HMIA 1K1QA 3R27A 2IMOA 3GZ7A 3I56S 3GPAA 4N7TA 3BREA 1BE4A 4KHPJ 5HAOA 2X1FA 4U67Q 1RAGB 4LF6J 2ZOMA 4JYAJ 4YR3A 5A2QY 2VG5A 3THPA 4ECYA 2CJ9A 4DL7A 2MZRA 3OXGA 2D74B 2ZOFA 4YP3A 3DLEB 1CSJA 2NXUA 3P3DA 4CO2A 4BDPA 1GH8A 1TKXB 4J9UE 2J9DE 1FJEB 3TQEA 4IG0B 3E01A 1H7XA 3R7SB 4B9TA 5FDLB 4Y2MA 2WVEA 2BBEA 2MZTA 1NHVA 2HSEB 2OUGA 3MPDA 5HJXA 4USMA 4OV1A 1VRTB 2EG2A 3DDNA 4NYOA 4UT4A 3M8WA 3TA0A 1VLYA 2NR0A 1FDNA 4IG3A 3ZNUA 2D9OA 2MKHA 2WVFA 3N5FA 3C3LA 4OLPA 5KTQA 4NZ6A 5ETOA 2KDOA 2VQFF 1SL2A 4EYHB 3P4UB 4CWBA 2R42A 1NDPA 2HIYA 2L9DA 1CQMA 3NWGA 4FPIA 4C98A 4F2SA 1D9FA 4QW9A 1S1WA 2AEMA 1SC3B 2HNZA 3MGJA 3MURP 4ECTA 1JLEA 4MKBA 2KL8A 4QWEA 2F4FA 3KLEA 2R7RA 3DOMA 1S4EA 8ATCB 2RH3A 3MUTP 1UFWA 2BOAA 1ZETA 2XLKA 2R7VA 1GFWB 3LANA 3QFWA 3ZTOA 4LRBA 1YRTA 2E7VA 3DXSX 3QIPA 4YHHF 3HPOA 5LMNJ 1M1KT 4P2SA 4OYAA 3NKYA 5L9NA 5EUHA 2QN6B 1C0TA 5KT5A 2ABYA 4YUDA 4ZLJA 5CYMB 2Z2LA 1OS5A 5ADZA 3R1HA 1WF1A 2DY9A 1KD1T 3ZNJ1 1QY7A 4ZVSB 2YX7A 3C15B 1PIEA 1TK5A 2PI5A 5BXIA 1FK9B 2O66A 2GHWA 4KHRA 2BW2A 2DGTA 3C6UA 5C2GA 4LT6A 4ECRA 5E2QA 5KFAA 1H2UX 2CZ9A 4DG1B 3PZPA 2UV8A 1TV6A 4RW7B 4WXOA 4ZMMA 1IQTA 4F3QA 4H54A 5HROB 3FSYA 4OX8A 3PDNA 2KXHA 3MMJA 1S0VA 4ZVPB 2IPOB 3HLUA 4LIRA 2LQ5A 2RNEA 2HNDA 2ZKTA 2J76E 4LRFA 4ID5A 2HFZA 4DCJB 5IM0B 1M5VC 1EAYC 5A8KB 2V8DA 3DGVA 1HW9A 2G1DA 4ID5B 4LVOP 4X62J 1TL1A 3JSMA 2QA1A 1RT2A 3JB9k 3RJMB 4DL2A 1YVFA 3K5MA 4OI0A 3IBFB 5KFUA 3ISZA 1NK8A 2V8GA 3GIJA 3GYNA 2DR6A 1S6OA 1VYAA 4LFAF 1UVMA 1AFJA 4KKOB 2MGZA 1CJKB 3OLAA 5K5MA 1U1KA 1N52B 1JJ2R 5F41A 5EWFA 3FFIB 3K5PA 1QVFR 2FGCA 2HZAA 4USHA 4OZ1A 3PJ9A 2R3VA 1HBUA 1RT5B 1B99A 2ZVIA 3M1VB 4ZHRB 2I8EA 3KG4A 2FHJD 2HFVA 2XG8A 3OL6A 3MM7B 3MTJA 2UUAJ 4JI3F 3WC2A 1Z4UA 5L1LA 3P49B 4Q44A 3J7ZT 3T6JA 1IUJA 3I31A 2GVDB 2I1RA 2BRKA 3QT8A 1UUJA 3C16A 4IKAA 4NA3A 5BJRA 5C2CA 2DNNA 4FNIA 2UU9J 2WBRA 1RT6B 4K5RA 3PKYA 5HK4A 4O0IA 4ES1A 3MEDB 3HSZA 3IN5A 2ZWPA 4ETXA 4TU8A 1DRZA 4DV1F 1CQNA 4FYDA 3FGVA 2CPHA 1YDLA 1Y4ZB 4LMZA 2CQHA 4DN9A 3RW6A 4I4BA 4F04B 3DLGB 5D77A 2FLPA 2OD6A 3CJ2A 1TL4A 2G2YA 4KGMA 4XTTA 4FF1A 2AF6A 1SBRA 5A8WA 3W64A 2XZWA 3QO9A 2E9RX 1HFEL 2NPIA 3GG1A 2HKEA 4DL6A 4IQXA 1HNIB 5JMNA 3BDEA 4O4GB 1IKWA 1SQFA 1Q7YT 1YBUA 4RW9B 4K50A 1GNKA 2JX2A 4V1Ak 4ANCA 2JFDA 3L9ZA 2VPXB 5DS7A 3OBIA 4JI8F 5FDLA 3EMTA 1SH2A 2DRDA 4HHHA 2YWFA 1WJ9A 3B54A 1S7HA 1WG1A 2DCUB 1YG0A 2B7BB 1T3OA 2X1GA 2ZBQA 2ZEJA 1BQXA 3OFHA 4WCEQ 4FXDA 1FD2A 2OD4A 4DR4F 3N28A 4DV4F 2FZKB 4H4MB 2C28A 1GAOA 1SV5A 5KFDA 3MTKA 2KHDA 8AT1B 5KFOA 1HQ2A 3OFEA 3KLHA 3LOUA 5KG2A 5KT7A 2DEJA 1WC6A 2C2MB 1EKSA 4NEYA 3CCUS 4F4ZA 4F0MA 2HWTA 3NOGA 2WVDA 1RUSA 3GCXP 3UI3A 3ZZ0A 2NPFA 4BHQA 3G96A 5DG7A 3ZTPA 2BVZA 1FWLA 1IJFB 4N8OA 3M2UA 1F6TA 1MLAA 4U9RA 1NPKA 3NNAA 4GKJJ 2CQ3A 2KU7A 2EG1A 1HYSB 4F3MA 1S77D 1OIAA 5EWGA 3G6YA 5KFMA 3SEOA 1TKTA 4DX7A 2CQBA 3B78A 4FYVB 3TEGA 2G4BA 5I4MA 1HPZA 3W60A 1J5EF 1UKUA 1UETA 5IQQA 1RI7A 4B9UA 3LF0A 2YNIB 2ZH7A 3M2VB 2B5JB 1XK8A 5D78A 4OX9F 1LW0B 1N34J 1APSA 3HP6A 1U7LA 1VISA 4RWXA 1JLEB 1PBUA 2VF3A 1RABB 1FERA 4JI7J 1VJQA 2B5JA 3DOMB 2LEBA 5KFHA 1X31C 4B3RJ 1S1VB 3PX4A 2IMWP 1JLFB 2C2KB 1LK5A 2F4VF 1C1CA 3Q8UA 5KG0A 2C1EB 3W62A 1HNXF 4N47A 5HROA 4PRFA 1WHXA 4IO1A 3FRYA 3H4DA 1Q8IA 2FYXA 4CLUA 4FS2A 2I38A 5JJBA 3RU0A 4CH1A 3PX0A 2LFVA 1ROFA 3I55S 3ZTRA 3CVKA 3Q24A 4ECZA 2HBZB 2HS3A 3T1YF 1L3TA 2VDIA 3AXKA 3Q86A 3C15A 5GAGU 3HSDA 4URSA 3P96A 2JC0A 2RMLA 2QL5B 2CA9A 2E9TA 2W25A 3CSKA 3SDEA 5KFVA 4QWAA 3C6UB 1FXDA 4UOCA 4IDKA 1G2EA 1FNOA 5LL6d 4DFMA 2GAHC 1NNDA 1AZSA 1T02A 3RYLA 4ZPCA 2FUG9 3G9CA 5CAAA 1ZAXA 2A10A 8RUCA 2OJ3A 2UUBJ 2UUCF 4I56A 4UY85 3NNHA 2CYYA 2BACA 1WC0A 4DL3A 4ICLB 3T19A 1V3SA 2YX4A 4AQYJ 4O3NA 2L41A 4IH6A 3RBEA 2HHTA 5D8HB 2ZNZA 4ICLA 3OTOF 3O2IA 2HMIB 3BPDA 4J9LA 1NXIA 3VQTA 1ZM3A 1ZA1B 3OXLA 4OHVA 2DPJA 4NMXA 3FBCA 4F8RA 3CC2S 2QA4G 2W9BB 5HLFA 2AYBA 1IXKA 1XMQF 2FIUA 1RBAA 2CQIA 3LALA 1FKOA 3CMQA 4WKYA 1YK9A 1UPPA 2FB0A 2HNYB 3EYZA 1TKDA 1N36F 3KMSA 1QAJA 3UO0A 1AW0A 1P8GA 3NNCA 1ZM9A 3W66A 2CDQA 3HFZB 4IOBA 2D3OR 2ZBPA 4M5KA 4NASA 1FCAA 1KRPA 1N5QA 1Z2ZA 4DPTA 2ZBIA 4M5MA 1YZ7A 2IIHA 4DFKA 2PN6A 1GT8A 3M8QB 3KMQA 1AFIA 3FNNA 2MSSA 4CLZA 2YWKA 2BX6A 2G0IA 2VFVA 1VQPS 1N48A 3HHLD 4TVAB 3KTQA 3MECB 4QIWD 5E3RA 3Q8YA 1WF0A 2F1FA 3BS9A 1CBKA 2ZE2B 5IZHA 2R8GA 2HFUA 4ECSA 5DZ6A 4I67A 3NGSA 1NJZA 3MFIA 1GX5A 3H0PA 3Q8SB 2W9CA 3WBZA 4ZVEA 5F8LA 1WG4A 4O4GA 4GMKA 3M2VA 3IAS9 5RUBA 1BUXA 4FYWB 2HQIA 1HARA 1X60A 3DXBA 4KHMA 5KFSA 2JZ5A 1XNRF 2HQGA 4LF1A 1GMVA 1KQGB 1EARA 1SPBP 2RD5C 3FZBA 4WFYA 3HHLB 4AXIA 4TN2A 2B8QA 3N4WA 3NGKA 2CIMA 4PUOB 4NLTA 5G0RB 4ZPVR 1ZM2A 4NCBA 2VFTA 5I3QA 2EBGA 1FDDA 2Q6CA 3M6UA 3CDWA 4LSNA 4NLUA 1U0HA 4OV6A 3ZZOA 3PVXA 4JI0J 4JBCA 7AT1B 4EU0A 5CHCB 4I6YA 2HQFA 4DPOA 2XSJB 2R7TA 3PW7A 2R7XA 2GV1A 2EVZA 3AB2B 4B3SF 3IO1A 2IA6A 2JDJA 3PJWA 4DR1F 3MWBA 4NLWA 1Q8BA 1GTEA 4RBUA 5HQLA 6AT1B 1B3TA 3EGWB 2K2PA 4YMEA 4DPUA 1X4GA 2DGVA 4HI2A 3DCAA 5ETVA 2FHJA 3KOAA 2NUHA 1Q0NA 1WHYA 3M2RA 5KG4A 3UDCA 2FHOB 1CJUA 2EEYA 5B7WA 2DHXA 3W5ZA 3DN9A 1P9YA 4LF8J 2M52A 3C19A 1FO1A 4RBVA 2LXIA 1AYEA 2CNLB 3HSGA 3BO2A 3J7AN 3E2EA 4H4OA 3M6XA 4OZLA 1N33J 3BH6B 4L3KA 4FDFA 1M5SA 5DDRC 1OM2A 4BLGA 5BR8F 2QA2A 3QAEA 3IRXB 1ZM4A 2WW8A 2CZ4A 3LGNA 4H4OB 4O44A 1UTAA 5HO4A 5D6GA 1IR2A 1XNQF 2B3TB 1Q16B 1RAOA 3U7JA 5LSLA 2DHGA 3PTWA 3KK3B 3SYZA 2ZD1B 1S6UA 3QNWB 4DDFA 5HI7A 2VASA 4EMDA 1RHKB 5AXKA 5KFKA 4ED3A 3H25A 4HH0A 3RUBL 5A6WA 5LSOA 5F9NA 2J9DA 4YY3J 1S97A 1N0VC 1XWLA 4LQ9A 3PFOA 3EJMA 2ZDPA 4JI1J 2BE2B 1HNVB 1Z2LA 2XWYA 1B4SA 3ELHA 5AE3A 9RUBA 3A12A 2MZ1A 3AOAA 3MMAB 3GJQB 2RHQB 1MW7A 3KJNB 2DXDA 2GNKA 2EFPA 3NOCA 4B3OA 3NMAA 1R0BG 3LAKA 4YR2A 1U1OA 4Q8FA 1VFJA 4USJC 2L9NA 2V2KA 5D4LA 1YGYA 1U1NA 4AL7A 1I6JA 5G4DA 5B08A 4B3MJ 4CM2A 2WRMA 4P72A 5EX0A 3RGIA 4O3RA 3K5LA 4ZVFA 2IYGA 3DHXA 4LVNP 2OPQB 4QW8A 2HQCA 3AQOA 5AXLA 5DETA 3J7A1 1KVIA 5C42B 2KRRA 3VALA 4DF4A 3QRQA 1JKHB 2HHXA 4A8KA 1TKZA 3MD1A 1DAXA 2FJVA 3GG0A 3GR1A 2MY8A 2HWIA 4MIAA 4C97A 2LYVA 4ZPTR 4Q2LA 4X66J 5J2QB 2CPIA 3T5LA 3CJRA 3G8TA 1ZPVA 2WB1D 4HDGA 1TAQA 5HP1A 3PW0A 1S12A 2YNHA 4DR2J 2K8GA 1PYOB 3A3PB 1YBTA 2O3DA 4J9QA 4A8QA 2PMWA 3PV8A 1NO8A 1K73T 1QTMA 1TTHB 4TKTA 3NMRA 3M8SA 1SC1B 1R27B 3MOZA 1WD6A 3W7BA 1D0EA 3IFEA 4ER8A 2UVWA 4QJVA 3JS9A 1JLQA 2E5JA 2JVRA 2WW4A 4P7TA 3R7NB 2IRUA 3JSRA 3T41A 7FDRA 2GO9A 2KRBA 3A4TA 4O3OA 4K7QA 3OFGA 4OYXA 3I0RA 3V4IB 1E6VA 2RDIA 3QGIA 2SXLA 5IV3A 2ZNYA 1VC6A 4C11B 2HWHA 2M8DB 1QDUB 5T7LA 4JI5J 4JI3J 2ZM6F 2AZ1A 2G0JA 2E1AA 3D28A 2AYEA 2OPSB 4UOFA 5EN1A 3CO9A 1TUVA 2G2ZA 3MZIA 4HTIA 4P73A 3IWNC 3CDAA 2Z2ZA 1W7WA 4ZP8A 2FVQA 1QVGR 3D2WA 4TY9A 4LF5F 1RWOB 1N6QA 1S9GA 3KWMA 2W4PA 4IFVA 4DR7J 4JI2F 4OYOA 1N6QB 1BC6A 4N41A 4IH7A 2CPXA 3CDUA 4K4SA 4PKDB 2KZMA 4WFAQ 4BC9A 2VV5A 2DH8A 5THWA 1YRUA 1QUPA 1V3RA 4RLEA 4ZP6A 2KTQA 1FXRA 1VJWA 2OELA 3CO0P 3AJ2A 1IKWB 3V4MA 3MHYA 4OHWA 1I51B 2DR8A 1Q82T 1NSAA 2DHSA 4FKXA 3EZ5A 1N5YB 2LMIA 3CIZA 3NBPB 1JIHA 7FD1A 4U8YA 3C2PA 4XAKA 3BSAA 1LWFB 2R7UA 4KBIA 3H5XA 3FKBA 1VQ8S 1S1XA 1WHVA 4DV2F 3O3LA 3AHPA 3BBCA 3GSIA 1KOHA 5SUHA 4LQ3A 1N0UA 3T9NA 2FTRA 3TZYA 5D3GB 4ZN1A 2HBYB 2HYIB 1S1VA 2EK1A 2Y1LB 1RKIA 2PDAA 1NBEB 5DQIA 2VFUA 1BGXT 1GMWD 3OTCA 1FJCA 2B7CB 5IM0A 2LECA 2G9OA 1SJ1A 3T1AA 2OEJA 2PI4A 2R7SA 1UAWA 4OZ0A 1ZAVA 5ITHA 3M30A 1JWWA 5LXYA 2VICA 4CTAB 1MN7A 1LWXA 2GJIA 3VZIA 1Y5NB 2DO4A 4OYBA 1FKPA 1Y3KA 4CDIA 4F4YA 3PJXA 4GO5X 5B09A 5DQGA 2PMHA 3E8OA 3CE8A 2W1BA 1HNWJ 4ED6A 1RYRA 1U6BA 4NCGB 3ZZTA 1JLBA 4WXWA 1F3VA 4X4SA 1FDAA 3DRYA 2W9AA 3PX6A 3FSIA 1R89A 3LQVA 3HVAA 2DNZA 3MAQA 1JXVA 4JI6J 1JQGA 4PWUA 2E5LF 4LF6F 1E6YA 4KIAA 5KFIA 1N32F 3F44A 4JYAF 2GJ2A 1VBKA 1Y11A 5KFQA 3T3FA 1LW2B 2YWHA 3AX5A 3OTDA 6FD1A 4I2PA 3IR6B 4Y2CA 1J5EJ 3QSYB 3JSBA 4ELUA 4QYZJ 2GQ2A 1RJJA 3K2YA 2GIRA 4RZRA 4OX9J 1FRLA 4B3OB 4PG6A 1HBOB 2CKWA 3G6ES 2LQ9A 1XR6A 4MT1A 4ED4A 2JLFA 3IGVA 3ZZYA 5HJYA 1UFLA 1IKXB 4KYZA 3ZZUA 3MUVP 3QRRA 2LLZA 3G8QA 2QT7A 3JSYA 2DNQA 3MM9B 4DQSA 3QYYA 3NAHA 3H42A 4OYIA 3SDEB 4J9PA 1W2BR 1KVKA 5CZVA 4DUZF 3NEKA 4P75A 1SKUB 4CP5A 2AEJA 2VFRA 1FFGB 1O8BA 2Z4PA 1RK8A 3A8EA 4W4MA 1U1QA 1L5UA 1KLNA 4QCLA 4CO4A 1YHQS 4O3PA 1SQGA 2IJRA 3OL8A 2J0QD 2IRXA 3K57A 2J7UA 1DLOA 3FEYB 3AX2A 1FEEA 3QO9B 5DGBA 3R3TA 4CZCA 3L95X 4X4TA 2A3JA 1BQNA 3ILIA 1HMVB 2M9KA 3F73A 2HAFA 2R4FA 1VDHA 2HZCA 2DXFA 5A8RA 2COLA 2OI2A 4ZPBA 3BH7B 4WK1A 3D4JA 1NZAA 4RW6B 4DLGA 2ROGA 1ZTTA 2V9WA 1X4FA 5K8PA 2MJNA 2V4JB 1P9QC 2FJBB 3ZO7A 4C3MA 1MN9A 1K47A 1Q5VA 4B08A 4TLRA 4MH8A 4DX5A 2WK4A 3V6JA 4QOTA 5GAHI 5HMZA 4KE5A 2ATLA 4JI4F 2OH2A 4G65A 3PO5A 3R5JB 4JB8B 1FE4A 4HI1A 4X4VA 1FTCA 4KJIA 2WSEC 2MZSA 2AGOA 1N33F 4IFYA 5J2NB 1SKRA 1IBKF 3RBXA 2GX8A 5C5JA 1H2TZ 4U7UD 2ADCA 1WC4A 2RRBA 1BHNA 5D0RA 3MMCA 2OIHA 2PT0A 3TX8A 1WG5A 4C11A 2B6AB 2E5GA 3CW2C 2R2UA 1RWPB 2AJ2A 4G6VB 4QU6A 2W01A 1NPRA 2H3EB 1TK8A 2QMUB 2B56A 2Z30B 3GLJA 4QYRA 5DZ7A 3UD5A 4ES2A 2ACMA 2W9CB 4KKOA 3I4PA 2CRLA 1NSPA 2R7OA 3K17A 4PPZA 4R25A 4ECQA 2PFDA 2BM1A 3CCSS 3SCKE 2J0SD 2AX0A 4G1PA 4Y00A 2P2CB 3CCWA 5D0GA 3V5RA 4DZDA 5F3ZA 5IT4A 2RRNA 4YFUA 3JYTA 5H9EJ 4RU2A 5A6PA 3TZXA 4ZVTB 3R1LA 2LU1A 1QD1A 1GQEA 2VOOA 1RB0A 1RHJB 4J7CA 4RX6A 4XPCA 2AJ0A 2VG7B 1AA1B 3AD8C 3TAQA 2BMBA 4QIFA 9ATCB 3MPUB 4DV0J 1HQUB 1VQMS 3J80Y 3Q2TC 2C2EA 3GJSB 1LK7A 1NHUA 1Y7PA 2GIFA 2PGCA 3HHEA 1CG2A 1FK9A 3D1QA 2MEWA 1UA0A 1QSYA 3QT5A 4LSLA 4OI1A 4M5DB 4DR4J 4JI0F 2WONB 2CNKB 4S0MA 4YS2A 3KK1B 3QGHA 3J7YU 1LWCA 4B3TF 1GXTA 3IRWP 3BGFA 3W9JA 4USUA 4W92B 4P9SA 1QE1A 3BJYA 2HGNA 2QFIA 4V19J 3DRPB 3VGUA 1IBLF 3HO1A 1YRXA 1T9UA 2QRRA 1RWWB 3FK4A 2X51A 3BGRA 4KB7A 4ZLPA 5F8GA 1EQMA 2HW3A 4ZPDA 4H4MA 4NLPA 3FRZA 4FZVA 4AXJA 3ADAC 3A3OB 5A8RB 1S1WB 2GW8A 2HNZB 3D6HB 4P2XA 5ETLA 4DZ6A 3Q22A 1LXJA 4FS1A 1Q7LB 1K9MT 2ZC3A 1BXNA 2P6SA 1ULRA 2ZBRA 3KK2B 1OY9A 1FFSB 2RU3A 4V19X 1XMBA 1WEXA 2N82B 1RWVB 4NLYA 3LA0A 5CA5A 5KT6A 1LOUA 1WOPA 2F3JA 4KGXB 2UXDF 2Q3PA 2Y0BB 3ENAA 3PRBA 1Y3JA 2GJFA 1H6KX 3GFHA 1F2HA 4OYWA 1WTBA 2DGSA 2YWGA 4X84A 1NJWA 4LBIA 3U1MA 2KVIA 4JP8A 4OJGA 4KGKA 4JI8J 2DH7A 5I3UB 2DKOB 2DNPA 2DY1A 2CVIA 2HFOA 4DPYA 2ZH6A 4B9NA 2IM2A 3QJLA 2HHSA 5IWAF 4YY3F 1SKSA 1RAAB 3QWPA 2YNIA 2LKZA 3CD0A 4DV4J 1HNZF 1GEHA 5D15A 4J9SA 3RTVA 4KHPF 2VOPA 4K5SA 2FC8A 3LW5C 3JTNA 2NSCA 2FY8A 2NZCA 4JV1A 2YWWA 2OTLS 2MTLA 4R8UB 1HWKA 2HLUA 1OWXA 1UL3A 2XNQA 2EKNA 1KS2A 4J90A 1RHMB 4PXCA 4WTOB 1WDTA 2IDEA 4B3MF 1CJVB 3V6KA 1CC8A 1T9VA 1Y0HA 2XSJA 2VA2A 3UQSA 1S7IA 3TJ9A 3K7RA 3FSXA 4Y34A 4F02A 1CJTB 2QTWA 2VD3A 4Q0BB 1VCTA 4PQUA 5FLXY 3MPWA 1DTTB 1C2PA 2DGXA 4PUOA 2CQGA 3BKUA 3TO8A 2XLIA 5U47A 3DMJB 4Y65A 1UFKA 1MWQA 3PEJA 3J7Z5 2DRBA 2XTEA 3MCSA 1TZ0A 4WTYA 3R8YA 2HGLA 1SL1A 4R0EA 1S57A 2KM8C 3MFHA 1BQMB 1R0CB 4EK2A 1OSCA 4I68A 4HYKA 1YI2S 3CNQP 3D6MB 3DOLB 3H2VE 4OI2A 4QR0A 4WFXA 5HMWA 1VRQC 2NXCA 2OO4A 1KBRA 5M2RA 5AE1A 2M70A 4J91A 2DNRA 4KV8B 1FWKA 1VLOA 5ETSA 5K14A 5KT3A 2A18A 2X3GA 3RW7A 4Q43A 3D5MA 4LBHA 2AGQA 3I32A 1FRKA 2PEHA 2MLXA 1S1UA 2OGUA 4M5GA 2AGPA 4LF4F 3SSSA 4C8ZA 1RTDA 4DV7F 1KN6A 2F9JA 5IS2A 3NL0A 1NB7A 3G8SA 2IM3A 2EC0A 3HX9A 5I42A 3PYEA 4F0HA 4AUKA 3NS5A 5GAEU 4B3SJ 3SQGB 3ILOA 2O1PA 1RAHB 2VC0A 4OZ5A 3TANA 3MEEA 4ED7A 1H3DA 2CJXB 1VBXA 3BR9A 4LR9A 2D9PA 4D3HA 4CYUA 4FXVA 2UUCJ 4LF5J 1RCOB 2Q1LA 4X65F 2HQDA 2VPZB 2P9EA 4NA1A 4IYQA 4LF2A 5H9FK 4FVCA 2OSQA 4TU7A 4C48A 1NM2A 1RT6A 5CCMA 5JVGQ 3TVKA 2YNGA 1R6YA 3OV7A 3BEGB 2NZ4A 2LDIA 2E44A 5DM6Q 5JVHQ 3VGSA 3CMAS 1RTJA 1IKVB 2KKHA 4C3LA 5J1EA 3PY8A 4F2RA 5AJ3F 2EK6A 1UMJA 1R43A 1PG5B 2B0GA 2RAQA 3QMQA 4ILRA 1T9YA 4M63A 4WP3A 4OX7A 1XMQJ 2AJQA 4PYAA 3GIRA 1LQ9A 1CC7A 3KLEB 1IBCB 2LQBA 2JHEA 3PYDA 3Q89A 3SQOP 3MDFA 2XS7A 4FF3A 3IR7B 5IT9Y 3TQ1A 5KFLA 5C25A 1VGYA 3PRDA 3PG9A 4GC6A 3I9V9 1TQLA 1U02A 3AD7C 3C14B 1JJCB 4RNNA 4DQIA 1B7YB 2V4RA 3I0SA 4YDDB 3D1OA 3IAM9 4DQQA 4M5DA 3AOBA 3ZZRA 4O23A 2R7WA 1UW9A 2A1BA 2F5GA 2V68A 2Y0SD 1S1UB 3H5UA 4HVZA 1KQFB 3CJKA 1UWAA 4Z2XA 4CO3A 2J6SA 4QIVA 2CPDA 2ZH3A 1SUQB 1U2RA 3D54A 4LF9J 2GHPA 3JTOA 2IDLA 3DLJA 3DLHA 4IRDA 2VJUA 4R5PA 4GVBA 2U2FA 3LUYA 2HURA 1IBMJ 2HHHJ 1NU4A 1U25A 3IS9A 1PJ6A 3WX8A 2GGPA 2E1RA 1HHTP 4BWMA 1IQZA 3GTYX 1Q79A 3H59A 2VQFJ 3MM5B 3RG6A 4NYPA 1SJ4P 2BJ1A 4I2PB 3WIUA 1C0UA 2V6AA 4O3QA 3QQCD 2E5IA 2W2PP 2I9SA 1NDCA 2QV6A 3C6TA 4AL6A 1H2VZ 3WIVA 3R5GA 2BEFA 1B0VA 3HHLC 1S76D 2LU2A 2OPRB 2XMMA 1W25A 1YJTA 2NYHA 2KN4A 4PG4A 4M5JA 3KXDA 5KG6A 3GV7B 3WHIA 4JV5F 2E5HA 2CPJA 4USTA 2ZJQQ 1GK8A 1HA1A 1BWVA 3FZ2A 4BBYA 4DR1J 3LTOA 4D3GA 3K5OA 3BYRA 3M6VA 4ZPWR 5E41A 3VR1A 5J2MA 2RHSB 3GIMA 4DR2F 3DGPA 3RBZA 1Y9OA 2JLEA 4QWDA 4C8KA 2KI2A 4NI2B 3DRSA 2Y9HA 1HD1A 1G3OA 1O0PA 2XS5A 2CG4A 2C2OB 4IRCA 1HD0A 2AJ4A 3G6VA 4X4PA 1VS3A 3GSDA 3DDIA 3S8SA 3OLBA 1IN0A 4UUWA 5E0OA 4LF7J 3NAIA 1TELA 4DUZJ 2ZUGA 1BQNB 4PXDA 1MG7A 3D0HE 4HACA 2HEKA 1QSSA 1NH8A 3OPKA 1FI4A 1CS4B 2LEPA 4ZVOB 5KFWA 1UVNA 1VRUB 4QIEA 2XZ2A 1FD8A 1HNIA 3HVTA 4UZCA 4J37A 2QLJB 3OJSA 3JAMY 4AT1B 2HAIA 2WSCC 5K8MA 1RT4A 3FVYA 3GYXB 4C0HA 3K58A 4DSFA 3X3UA 2FVRA 2VZ9A 2QEXS 4IO9Q 1OQ6A 1WUUA 4C0OC 1WORA 4X62F 1RWUA 4E98A 5CCLA 3OW2R 3SBMA 1FKAF 1EJ7L 1PYSB 1HR0J 2NUUG 3DHWC 3HSJA 4KC5A 3DLEA 3UR3C 1NK4A 5F8HA 1FRJA 1PYTA 1S6QB 1NSQA 3T1HF 1DZ5A 4E2FB 5F3TA 3D7SB 3S6EA 4Y3CA 2RIJA 1YLXA 4NYZA 1N54B 4UF4A 5L1JA 5E7OB 1DQAA 1PGZA 2HK2A 4Y2AA 3MM6B 3OR1A 5A2QU 1REVA 2ZITA 1U26A 1X5OA 2VHGA 1RA6A 4C4WA 3I5AA 2CPEA 5HANA 3VAGA 4J9NA 3PR4A 4HKQA 1RBLA 4NCGA
chains in the Genus database with same CATH topology
4MK8A 1LFPA 1Q81T 3CUNA 3BQ1A 2B43A 4NXMF 1HBMB 3MI7X 3CJ0A 4I6WA 4U7UK 3CCES 4LFBF 4DJBA 3OHAA 3VAJA 4NLOA 3HDSA 2ERRA 4DR2F 2RJZA 4ZP9A 4BWJA 2DGOA 2QYCA 3SSRA 2MQMA 5KT4A 3GV8B 4J9OA 4DF8A 4F8RA 2D7SA 3MPYA 2JL9A 2OPPB 4F4KA 4ZA1A 3H2UB 4O4RA 1ZBTA 1ZAWA 2ZE2A 3MD3A 1FNXH 1C1CB 4OLOA 2ASJA 4ILLA 4R8UA 3EGZA 2YKNB 3OQ2A 2LEAA 1KFDA 2ZBCA 5B0AA 2YKQA 2R8IA 2V94A 2DNGA 1JLCB 2FJAB 3GR0A 3DRSB 3NCQA 2F7VA 1KSPA 2IC3A 4ED2A 2L48A 5EHHA 4C8MA 3CCRS 5FJ4A 3AAWB 3FEZA 4MTPA 2B4UA 1XEZA 4RUHA 5A8WB 1LWFA 1WEZA 1T03A 1TV6B 3EX7B 3MXHP 3ICLA 2XSFA 3POTB 4TLQA 1VQ9S 2DR5A 2J7KA 4PQUB 4DQPA 2UVVA 1VQ6S 3OL7A 3QLHA 3DRXA 4F67A 4NA2A 2UVRA 4X4UA 4DR7F 5C42A 4GKKF 2B4PA 1T95A 3ONQA 4C3KA 2FLLA 2V9KA 1SC6A 3KG1A 3V6DB 3D1HA 3KLIA 3GIIA 5F0WA 4DL0C 1HI1A 4HL9A 1RT7A 2LQJA 4OJHA 2N7YA 3CJ3A 3ISNC 4EEYA 2V4JA 2EFNA 2VH7A 1S0MA 3M30B 3M9OB 4FVMA 1UVJA 4OJ3A 5J2PA 5LJ5Y 2JEFA 1HMVA 4ZHRA 3SXLA 3Q8RB 5EDWA 2MSTA 2FHMA 3MEGB 1J2VA 5D4PA 4I2QB 1G7CB 5E3CA 5CYJA 3V2UC 5DGAA 1S48A 1QSLA 3C8YA 4Y0FA 3UR0A 3AY0A 4I2QA 3UFCX 4J9MA 3OVBA 4HLBA 3MMBB 2P6TA 5AXNA 4RBTA 3TUJC 3TW0A 3CPWR 2FLNA 2F8EX 3KLFA 3DRRB 2YKNA 4E8UA 1C1BA 1RT1A 2VL1A 4Q2MA 5CYQA 1VQKS 2JEGA 5IT0A 3MOJB 2VPWB 1RT1B 2DH9A 1EP4B 5CYQB 4CO1A 2WOMA 3OSPA 3DDKA 4QR2A 1Q86T 1X4AA 1S49A 1UJ5A 3W2WB 3DI6A 5JUMA 1SKWA 1KEKA 2DGWA 3MPVA 1LWEB 1T7PA 2PD1A 3DNCA 4XK8C 3DU6A 1QE1B 4JI6F 4CH7A 2OSRA 3V81B 2CZVC 5M2UA 4LSNB 2QLWA 5FIIA 2HGMA 3IBWA 2ZOGA 1TKZB 3VF0B 3US5A 2F40A 2BQRA 2IM0A 1T03B 2CJBA 1FKPB 3MR5A 5HL7Q 2YKPA 3I0RB 3V4IA 1SJRA 2FY1A 1HBNB 4ED0A 1VHFA 2XBPA 3LGMA 2KXNB 2FLOA 5KOWA 1X5PA 3CCMS 4A8FA 5KFPA 3CCLS 2DCLA 2YWEA 2ZJPQ 2VBYA 3HHDA 2CQ4A 3CD5A 3VCDA 1NRKA 1F2GA 5CD4H 1FRMA 2R2RA 4IQMA 2ADBA 4P6QA 1LKZA 2ZKUA 5KG5A 2HIQA 5H1SV 2XMVA 2WTFA 2MPUA 3MMBA 4K4YA 4IG3B 5J2QA 1KC8T 5F8JA 2P5VA 1XMOF