2IM1A

Crystal structure of poliovirus polymerase complexed with ctp and mn2+
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stabilization of Poliovirus Polymerase by NTP Binding and Fingers-Thumb Interactions.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Transferase
molecule keywords poliovirus polymerase
total genus 135
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 2im1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2im1A02
1R0AB 1RTIB 2AGOA 2XCPA 4QPXA 2FJWA 4NZ0A 2VA2A 1C2PA 4FBTA 4RNNA 4G1QB 3GILA 4Q0BA 3DOLB 1S6PA 2V4QA 4RW9B 4ZVHA 5J2MA 1RT5A 4PUOA 1C0TA 2ILYA 1XR6A 1C1CB 4NLYA 3FDSA 4O4GB 1JLEB 3DLKB 4WE1B 3KLGA 5F9LA 4LQ3A 4YR0A 5KFYA 3TAMB 1QAIA 3PHEA 1C1CA 4F4YA 1BQNA 2B43A 4I7FB 1LWCB 2XC9A 3DI6A 3KHGA 3E51A 3GIMA 2XGQA 3GQCA 3KHHA 4EBDA 4PWDB 4J9QA 4NCGB 4IRCA 4G1QA 1S1WB 3KK2B 5EUHA 3VQSA 5KT6A 4RUCA 1J5OB 3JSMA 3HVTB 1S9EA 2WRMA 4WFYA 4ED3A 5KG1A 4ED0A 4Q44A 5KG6A 1C0UA 2IA6A 4J9KA 5CYQA 5J2PB 1LWFA 1JLGA 4KHMA 1S1UB 1W25A 4RU9A 3SI8A 1K1SA 4PQUB 2I5JB 3GIKA 3HHKA 3QIPB 3PW4A 4ZVFA 2IM2A 3MEGB 4RW4A 1ZTTA 3FQKA 4HYKA 4DL2A 2J6SA 1CSJA 5K14B 4O3SA 3KLEB 1HNVA 3GYNA 1S1XB 1JLAB 4TY8B 3MFHA 4ZPCA 4IG3A 1S1TB 5I3UA 3Q8PB 1S9FA 1TQLA 4K4XA 2B5JA 1VRTB 4ED8A 1VRUA 2UVVA 2HWHA 3UDLA 1TP7A 1MU2A 5KFNA 2HNDB 5I42B 5EWGA 3OHAA 2D3ZA 1T03A 1RYSA 4Q43A 3H5SA 4U7CA 2IC3B 2YNHB 1HQUB 3OL9A 2RKIA 2OPQB 4R0EA 3KNAA 2FLLA 1NNDA 3MR2A 2RF2B 1DTTA 3SFGA 1LWEA 1EETB 3EZUA 4TN2A 4Q45A 1N5YA 4WXWA 1TKTB 4KV8A 1DLOB 1TV6A 5D3GA 2B5JB 2W9BB 2JEJA 4JV1A 5C5JA 5DQHA 3C6UA 4O3PA 1S1TA 4RW8A 3G6VA 2ATLA 3GV7B 1QE1B 1REVB 4QW9A 4DL6A 1S1XA 2E9RX 1YVFA 2UUTA 1OS5A 3BSCA 1KHVA 1BQMB 2D41A 2OPSA 1JLCA 4WYWA 2WCXA 4YR2A 3H4BA 4IG0A 2D7SA 2YNGB 2F8EX 5KFJA 4F4ZA 1RAJA 4O3RA 4EO6A 1TKZB 4MK9A 4IFYB 4Y3CA 4NLXA 2I5JA 3EPIA 4PQUA 1TL1B 2XI3A 2ZKUA 3IS9A 5L1LA 4LSLB 3QGIA 4TLRA 4LQ9A 5T14A 4I2QB 4O44B 1TVRB 3H40A 1TVRA 5KFEA 1TKTA 3KJVB 3RBDA 4TXSA 1S49A 4NLRA 1JXLA 2AWZA 1HNIB 3I0SB 3KMQA 1DTQB 3DMJB 2R2TA 4IRKA 2BRLA 4KO0A 4WZQA 2HNZA 1TL1A 4KBIA 3BQ1A 2ZE2A 3NKYA 2ASDA 4IFYA 4WFZA 4GC6A 4MIAA 1RT3A 5DG7A 2R2SA 4EYHB 4JV0A 3RB4A 4YQWA 2FJXA 3FFIB 1RDRA 2ALZA 4NYZA 3LP0A 4TQSA 1JKHB 4TY9A 3KHLA 2VG6A 3QO9B 4EBEA 2E9ZA 3LP2B 1LW2B 5KFIA 3LP0B 4DG1B 2W9CA 3KHRA 2YKNA 4O3OA 4WYLA 2V4RA 1RT4B 3LAKA 5DQIA 4B3OB 1S0NA 3MFIA 2FJVA 1HMVA 4ECXA 4M94A 1I6JA 3V4IA 5J2QA 4Y2AA 4KSEB 1RTJB 4QW8A 3M8PB 5KFDA 3M8PA 3MF5A 4ZPBA 5J2QB 4U6PA 3DM2A 5HBMB 2HAIA 3JYTA 4ECYA 4NRUA 4O3QA 3JSMB 2JEFA 1JX4A 4NLWA 5KFMA 4M95A 3IGNA 5HP1A 1FKPB 4EBCA 3G86A 1RT4A 3ISNC 3MEEB 4MK7A 3KK3A 3T5LA 2QV6A 4DG1A 2AX0A 2FVCA 4LSLA 5KFUA 2BANA 3DRRB 4KFBA 2AGQA 1S0OA 3LAMA 2VG7A 5J2NA 5DGAA 3V6DB 2BQRA 1RTHA 3CJ0A 2YNIA 3UR0A 3DOKB 3V4IB 2ZD1B 1XR7A 3OL7A 2BE2B 1JLFA 5L1KA 2JEGA 1U09A 1JLFB 4TYAA 4URSA 2WOMA 1RT6B 5L9XA 3MTKA 3RB0A 4O4RA 2HMIB 4ZP8A 1BQMA 2OPSB 1ZTWA 2QE5A 3DLGA 3IN5A 4J9PA 2BANB 4KFBB 3FRZA 3PW7A 1RA7A 3PJWA 4RW8B 4ZP6A 3RAQA 1SV5B 5KG4A 5L1IA 5F9NA 2B6AB 2JC0A 2RDIA 1S1VA 3PJXA 4H4OA 3CO9A 3IGVA 3JYTB 4HKQA 3CVKA 2OPQA 3IS9B 4ED1A 4IR9A 2JLEA 3BGRA 5KFQA 1RT7B 2IAJB 3IRXA 3QGHA 4NLVA 1ZETA 2UVRA 4ZPAA 3QIDA 1T94A 3NAHA 2FVRA 1IKXA 3LP1B 4R5PA 2YKMA 3MR5A 2BE2A 1HMVB 5CYMA 3CDUA 1S9GB 4K4VA 1S6PB 4MFBB 2R8IA 2B6AA 4H4OB 3BQ2A 3H5UA 1JLQA 1C1BA 1UWBB 4J9NA 5C24A 3G6YA 3DRPA 3MECB 2C2DA 3LP2A 5F8HA 2GC8A 1C1BB 1UWBA 1JKHA 5C24B 4Y34A 5KFFA 2AU0A 3H5YA 4ED2A 1LW0B 1RT1A 4KV8B 4RNMA 3H4DA 1IKXB 1TL3A 3QGGA 1N56A 4I2PA 4OL8A 4DL3A 1RT2B 4Y2CA 4IG0B 5DGBA 3PZPA 1TKXB 4H4MB 2HNYB 2IC3A 1NHVA 4NRTA 2YNHA 3ISND 1FK9A 3PR4A 1S9EB 1EP4A 4URGA 5DG8A 4ECUA 1N6QB 1JLBA 3MEEA 1DLOA 4NLDA 4QWEA 4J9MA 3DLGB 3FSIA 2DPIA 2UUWA 1HNVB 2IM1A 3H98A 5KFPA 4RNFA 4ECZA 2ASLA 5KT7A 4URQU 2WOMB 1S48A 2XWYA 1RT5B 3LALA 2BR0A 4PUOB 5KFBA 3DOKA 2J6UA 2UVUA 2ZD1A 4XPCA 1VRTA 4KHRA 5KFLA 3IG1B 3QYYA 4RW7B 1S1UA 3KOAA 3UPFA 4WXOA 5J2NB 4DL5A 3I5BA 4NLSA 1C0UB 3DRRA 3N6MA 4XO0A 3T5HA 5KFTA 4GC7A 3CJ5A 2C2EA 5HROA 3GIJA 1JLQB 4F50A 5EWEA 4XPEA 4O44A 4EO8A 1SH2A 4NLUA 3E01B 5CYMB 2CKWA 1EETA 2XI2A 1N5YB 2IBKA 1EP4B 2RF2A 4RUAA 1RTDB 3QIPA 5EWFA 2IM0A 1BQNB 2ZE2B 3KMSA 4R8UA 5C42B 5C42A 2OH2A 3BGRB 3OSPA 1RTDA 1HPZA 4O4GA 1K1QA 1MU2B 3ITHA 1T03B 2R2RA 2YNGA 1SH3A 5KG7A 1JLCB 1S1WA 4IKAA 1KLMB 4IG3B 4PWDA 3QO9A 1IKVB 1SUQA 5EDWA 2W9CB 4NLGA 4F4XA 4KKOA 1JLAA 2IM3A 3CDWA 4K4SA 2OPRA 2VG6B 2FLNA 4NLPA 1HQEA 3Q8QB 5F8GA 3IG1A 4RW7A 4ZVGA 2HWIA 5D3GB 5KFOA 2DPJA 4MFBA 2V0NA 1KHWA 4RNOA 3MEGA 2YKMB 2WONA 4RW4B 4ECRA 3UQSA 4K4UA 1RT3B 4DL7A 1RTHB 4G3IA 4J9OA 1T3NA 3TQ1A 3RB6A 1RA6A 5FDLB 1S97A 4Q8FA 3Q8RB 1HNIA 3I0SA 2W7OA 3N6NA 1FKOA 3C6UB 1VRUB 1J5OA 3HVAA 5F8IA 1TV6B 4IQXA 5HP1B 1N6QA 2WTFA 1RYRA 4QWDA 2YNFA 4H54A 4NLTA 4I7FA 3DI6B 4IR1A 1FK9B 3NBPA 3DYAA 3V81A 4JV2A 3RB3A 2D3UA 4H4MA 4KAIA 1S10A 1RT2A 3MR3A 1HYSB 3BSAA 3QLHB 1RT6A 3MEDA 4WE1A 5KG5A 4YR3A 3OSNA 1C0TB 3EPGA 5DQGA 1LW0A 4RW9A 2XGPA 2YKNB 2R2UA 4MKAA 4Q8EA 3BSOA 4IH6A 4ECVA 3DRSB 3M9OB 1QE1A 1REVA 1IM4A 5KFXA 3PR5B 2J6TA 3BSNA 1RTIA 2FLPA 4ZP9A 3FFIA 4WFXA 2ILZA 2AX1A 4ED6A 4RZRA 1S4FA 4NCGA 3I0RB 4ZHRB 2C2RA 3V6KA 4QWAA 1GX6A 4EYIB 4NLQA 2C28A 5KT3A 2RKIB 3RAXA 4IH7A 3OHBA 4YMEA 4ECQA 4YP3A 1JLEA 3DLKA 3KLGB 2HNDA 2W7PA 2OPPB 5I42A 5J2MB 3M9MB 3I5AA 4DL4A 1T05A 2GIRA 2V9WA 3M8QB 5C25B 3KK2A 1KLMA 2W8KA 4KE5A 4IDKB 3BQ0A 3SFUA 4DEZA 3GV5B 3CJ4A 1T05B 5KFSA 5JXSA 3OLBA 4TQRA 5KFZA 4TY8A 2JC1A 1NHUA 1S0MA 3TAMA 2WB4A 4K50A 2AGPA 3OL6A 4R8UB 2IJNA 4IOBA 5KT2A 4ED7A 1IKWA 3NBPB 3C6TB 4IFVB 3KK1B 3RBEA 3E01A 2R8HA 4J9SA 1Z4UA 5CYQB 4J9LA 1LWFB 5J2PA 1S6QA 2XCAA 3OLAA 2R8KA 5F8NA 1DTQA 3DMJA 3GIIA 3KLHA 1S6QB 4TYBA 3KJVA 5KFVA 1R0AA 4ICLA 5L1JA 1FKPA 3CWJA 2I1RA 4I2QA 4ZP7A 4LSNA 4F4WA 4QWCA 3T5JA 3NAIA 3N6LA 4JUZA 4ID5A 2W8LA 1HQUA 1RTJA 2FVQA 3GV8B 4ID5B 2OPRB 2ASJA 2R8JA 1TKZA 2O5DA 5DLFA 1N48A 2YNFB 4QWBA 3KLIB 5DLGA 2W9AA 3H59A 2WK4A 3V6JA 4IRDA 2BRKA 4RW6B 3QZ7A 4RW6A 3Q8SB 3KLFB 1LW2A 3PW2A 1HARA 2OPPA 4WZMA 1IKYA 3D28A 2FVSA 4ZMMA 2HNYA 1TKXA 2VG5A 1DTTB 1LWEB 4ECSA 2VG5B 3DLEB 2IJFA 4LSNB 3I0RA 2FVPA 2E9TA 4ZHRA 2HNZB 4MKBA 3BJYA 3V6HA 4KO0B 1MMLA 2GIQA 5HROB 1QUVA 3KLVA 4X2BA 5KT4A 3DRSA 3BREA 3KLFA 3DRPB 3MECA 2BQUA 3HVWA 3PW0A 3CIZA 3D5MA 4NLOA 4O3NA 5KFHA 2VA3A 3DDKA 4K4YA 5KG0A 5KFKA 3QLHA 3MR6A 3MEDB 5HLFB 3M9NB 1HPZB 3HKWA 3G6XA 1XR5A 3T19A 3PVXA 5KFGA 5HLFA 4IH5A 1RT7A 2IAJA 3IRXB 3H2LA 3H5XA 5J1EA 5F8MA 4ZPDA 4MK8A 5JUMA 3DOLA 4FS1A 4K4WA 3CJ3A 4IDKA 4EEYA 5KG3A 4Q0BB 1S1VB 4KB7A 1JIHA 3M8QA 5C25A 1D0EA 5KFRA 1SV5A 2IMWP 3KLHB 1FKOB 2AQ4A 3HVTA 5DG9A 3ICLA 4J9RA 2W9BA 4K4TA 1GX5A 2HMIA 2EC0A 3NL0A 5KFAA 3KK1A 5J1EB 4I2PB 1LWCA 1TL3B 1IKWB 2WONB 3C6TA 4IFVA 2UVWA 2RDJA 1HYSA 5KFWA 2YNIB 3V6DA 4ECWA 2VG7B 3NGDA 4ECTA 1HQEB 3T5KA 3DYAB 3V81B 2JEIA 2C22A 4KKOB 1IKVA 3OL8A 4K4ZA 1SUQB 3CJ2A 4MIBA 3TVKA 1QAJA 3QZ8A 4FBUA 3LANA 1N4LA 3KK3B 3CDEA 5I3UB 4ICLB 1S9GA 3KLIA 1JLBB 3LP1A 4R5PB 5F8JA 3ITHB 4FS2A 3FQLA 3DM2B 1SH0A 5HBMA 4MH8A 3KLEA 5FDLA 2WHOA 5K14A 4ZVEA 4RNHA 2R8GA 3NMAA 5KG2A 3DLEA 5KFCA 3T1AA 3I5CA 1WNEA 3BR9A 3PW5A 2BQ3A 2CJQA 5KT5A 4B3OA 5F8LA 1JLGB 1RT1B 1D1UA 1IKYB
chains in the Genus database with same CATH superfamily
4K5SA 3TP2A 1G3OA 2JWNA 3UN2A 5F3ZA 1NU4A 2J0WA 3B54A 5CABA 1ZM4A 1NSQA 1HFEL 4V1Ak 3TJ9A 1WF2A 5DO2A 4DV1F 4KPCA 1WUUA 4LIRA 4ZIVA 1HIYA 3M4XA 2DRAA 4ZVHA 2UXDJ 2DB1A 3B4MA 3JSYA 3HZEA 2ILYA 2KI2A 3J81U 4PYDA 3HHLC 4B3RJ 2QC3A 4LQ3A 2HLUA 2KU7A 3TAMB 2QMUB 4YR0A 1P9YA 5IC6B 4BWMA 1SQFA 3TWZA 1NK6A 4JP8A 4AUKA 4MMOA 1R31A 1U1QA 3AX2A 3ENVA 3GQCA 3J7Z5 2XGQA 3J80U 2XB2D 3D68A 4DSEA 4NCGB 3T1YF 3M30A 4G1QA 4X66F 4DPXA 3OXGA 1U0HA 3EGWB 3RTVA 3VQSA 2IY5B 4RUCA 1RAEB 1TTHB 1HQ2A 1S9EA 3HHLB 4CLYA 4HR2A 1YJRA 4DR6J 2RUSA 3MMJA 5KG6A 3TEGA 4FVMA 1LWFA 1TUGB 4LF1A 1QJHA 1GMWA 1RSCA 4KHMA 2V8DA 4RU9A 2ZH5A 2UZAA 5CA5A 3GIKA 3HHKA 1NK4A 1EHWA 1DY3A 1YJUA 3B8HA 4ZVFA 4AE5A 1JJCB 1VC5A 1Z1ZA 1ZTTA 3HF5A 3DRYA 3BKUA 2E5GA 1RB0A 2WVBA 3FQKA 4NA2A 4ZDNA 4ETZA 1I3OB 2OEKA 3VGVA 5KOWA 5K14B 4BCAA 1LWXA 4F67A 4O3SA 4I4BA 1OJ4A 3KLEB 1UW9A 4NCAA 4FZVA 2Y8WA 2F4VJ 1PYSB 1GMWD 2HFZA 4TY8B 5HJXA 3MFHA 4O0NA 4IG3A 3DLHA 1JNZB 3Q8PB 1S9FA 2YWGA 1TQLA 2DNHA 3L4BC 1P8GA 2B5JA 2HEKA 3FVYA 5JVGQ 1JWWA 1VRUA 2GFFA 1HR0J 1VQKS 1TP7A 1B70B 2UVVA 2YKAA 2HNDB 1B0VA 4EFAC 5KFNA 3OHAA 1VK8A 1NB7A 3JTNA 1M5KC 5B0CA 2ZHOA 1S7IA 4U7CA 1EAYC 2W25A 1HQUB 1WACA 2I9SA 4OYMA 1UVLA 3JQKA 2ALYB 3M1VA 3NGRA 4ZVQB 4C8NA 4FXVA 1NNDA 3MR2A 4KYZA 2XHWA 4GKKJ 1DTTA 1LWEA 1EETB 1IBCB 3HFZB 1TKTB 1J27A 1DLOB 1IN0A 1RI7A 1RP5A 1TV6A 2ZH1A 4DQIA 4JV1A 5D3GA 5C5JA 3ETOA 2GA7A 2AJ2A 1VR6A 2XSJB 4RW8A 2DIVA 3G6VA 3D6TB 5H9FJ 2E7VA 4OZ3A 2UUTA 4DV3J 3LW5C 4CLKA 1KHVA 1BQMB 3H4BA 4AXJA 2EK1A 4WYWA 4YY3J 2ZH6A 2A6OA 2COLA 3AFGA 2Z2ZA 5E33A 3W7BA 3W5ZA 2ZH9A 1FJCA 1RBAA 4EO6A 4HHJA 5A8RB 3C15B 5AT1B 2RRBA 5D0RA 3R97A 4OLOA 5L39A 4DFPA 1GMVA 2Q66A 3EPIA 1X4HA 1TL1B 2CNOB 3GYGA 3NGSA 3OR2B 1WTBA 2FHJA 4LSLB 2IRUA 3LOUA 5T14A 1QUPA 4O44B 2RDDA 3FC9A 3RBDA 3P49B 1S49A 4NLRA 2ZM6F 1VQYA 4RUHA 3DMJB 4QPTA 4YEAA 2BRLA 4LF2A 2GHWA 4QU7A 2IBOA 2HZVA 1G7CB 2ZE2A 3MM6A 1F60B 3NKYA 2W2PP 3V2UC 3EYZA 1NSPA 1RBLA 4GVBA 4MIAA 3EGVA 5IZHA 2ASDA 1APSA 4LF9J 5DG7A 4DPYA 3NGTA 1RWNB 5T7LA 1VQ6S 3NNHA 2JJ4D 3GPAA 3QT8A 1JKHB 4TY9A 4OZ0A 4EBEA 2E9ZA 3LP2B 5KFIA 2I0XA 3LP0B 4DG1B 2W9CA 3CMAS 1UJ4A 4C2MA 3KHRA 2VOPA 3CJQA 4WYLA 3MPVA 3DRXA 2V67A 5DQIA 2EFNA 3MFIA 1HMVA 2BJ9A 2OO4A 3CCTA 3OFFA 1ROFA 1X8DA 1NJWA 2BJ3A 2VDHA 1I6JA 3KK1B 2GIFA 3EXCX 1LK5A 1RTJB 3PYFA 4QW8A 4C7QA 2C3MA 2FHOB 4OX9J 4UOHA 2FC8A 1YBUA 5J2QB 5CXTA 1HBOB 5HBMB 3FSYA 2A1BA 3NEKA 3J80Y 4B9MA 1Q7LB 2JEFA 2GVDB 4NLWA 2G9OA 3OR1A 4LT6A 5KFMA 1FKPB 4EBCA 1VCTA 2R7RA 1IWGA 3MEEB 4MK7A 1B0PA 4ZLLA 2FVCA 1TELA 2BJEA 4LSLA 4Y2KA 4U95A 4CYUA 2J5AA 2AGQA 3I87A 1S0OA 1HL6A 3KUEA 2LEBA 3V6DB 1X4CA 3CJ0A 2DT9A 3QJLA 1GTEA 3EVWA 2ZD1B 2BE2B 1WSRA 5K5MA 3QSIA 1MSWD 4URSA 1RT6B 4DZDA 2GZOA 3TOQA 2XYGB 4KGMA 1UPMB 2R9LA 4ZP8A 2OPSB 4J9PA 1PYOB 2GVZB 2MKHA 3HI9A 4KFBB 4LSZB 3VZHA 2RSQA 3MPWA 5H1SV 1BLUA 3PW7A 2F9DA 1WORA 5L1IA 2QEXS 3F73A 5F9NA 5GADI 3PJXA 5HI7A 2J9CA 5F0UA 2GQQA 3CO9A 2HVEA 2WAQD 4KH1B 3BPDA 3O8WA 1RZMA 3CVKA 2CQPA 3IS9B 4ED1A 1N34F 1FDBA 2GQCA 2IAJB 2L9WA 3QGHA 2X1FA 2OTLS 5M2RA 1RKIA 3CDBA 2CFXA 4F3MA 4ZPAA 3MUVP 1T94A 1IUJA 2MSTA 4PG4A 3CSKA 3ZZ0A 1D9DA 3LP1B 3ZZOA 4CCHA 3NS7B 8ATCB 2R8IA 1FRMA 3BPSP 3R7NB 1NSAA 4H4OB 1RHRB 1YJTA 3NCQA 6FD1A 1JLQA 4P71A 3KTQA 2K1RB 4ELTA 1IR1A 4J9NA 1H72C 3CJTA 3G6YA 4A48A 1Y5NB 1FF2A 5F8HA 1FEEA 3Q8VA 3NLCA 1AROP 1UWBA 3IBFB 1JKHA 3MI7X 4Y34A 3IWLA 2Z57B 5C24B 1FWLA 2GGPA 3CCQS 1V9OA 2VBZA 1RJJA 4I1TA 2WVCA 3QGGA 3W9JA 1UCNA 3H20A 2MHNA 3LGMA 3QSYB 1N56A 2BDPA 2ZBIA 3NP5A 4OL8A 4Y2CA 4IG0B 5DGBA 5CYJA 2AEFA 4DV1J 4DSIA 2E1PA 2IC3A 4NRTA 2QFIA 4A8WA 4KH0B 1OWXA 1SQGA 1UTAA 1KVKA 1VDHA 2MQLA 3FKBA 3CXCR 4ECUA 2QGFB 2G0JA 4B3RF 4C98A 5ETVA 3CD6S 1NDCA 1PBUA 3GFZA 2HZCA 5AJ3J 1BWEA 3Q89A 2KKHA 5BXIA 2DPIA 3T1YJ 3BZQA 4QIGA 3TUPA 3DU6A 3QWUA 5KFPA 4RNFA 4DX6A 1F1BB 1C4CA 3QAUA 1JXVA 2WOMB 5CZVA 1RT5B 3VAGA 2BR0A 1DHMA 3W2WA 4DR6F 4JI0F 3K5PA 2ZD1A 3B4DA 1DFDA 2IRXA 1NPKA 2VB6A 3IG1B 3QYYA 4ZN3A 4FF4A 4C8ZA 4LVNP 3AXMA 3I5BA 1C0UB 1P1TA 2GV1A 4NZ7A 3ZTSA 1N32J 4IO1A 4FKXA 4GC7A 3CJ5A 3ZTRA 4ZLJA 5HROA 2J0XA 5IQ6A 1JLQB 4F50A 1F5BA 4DCOB 6FDRA 3E01B 1EETA 2CQDA 1R7IA 2B9EA 1HNZF 4ZVUB 1SIZA 1NO8A 2KM8C 1RTDB 4JV5F 5EWFA 3BDEA 3KMSA 1OM2A 1MMNA 4WK1A 3OSPA 1Z2LA 4AL6A 1DQ9A 2QX0A 3MMAB 2HBQB 2R2RA 2YNGA 2FPHX 1X9SA 4H4KC 3EVOA 1SH3A 2CIMA 1JLCB 2I38A 4IKAA 1RADB 2O1PA 2XMVA 4IG3B 3WIUA 4PWDA 1FE0A 2B0GA 2HHPA 4N7TA 2HLTA 5I4MA 1TFWA 2RQCA 1JLAA 4K4SA 2V4JB 2VG6B 5AXMA 1CC8A 2ACYA 2KB2A 2MZQA 2E1CA 1NCLA 3ET6B 3MM5A 5F8GA 3IG1A 2GHPA 5ETLA 2XY6A 2VKZG 4DUTA 1U25A 1KHWA 3K89A 3MEGA 3AQPA 2CQ2A 3RBXA 3ZTPA 3J7YI 2CNKB 1N52B 1H2UX 3AOBA 1UA0A 2CJ9A 2CQCA 4G3IA 4J9OA 1MLAA 1CS4B 3NXZA 4PWUA 1XMBA 1SJRA 1HNIA 1RWPB 2W2NP 3EMTA 3W8PA 3N6NA 2HFSA 2Y0BB 1TFYA 3OTOJ 3C6UB 5IV4A 2PDAA 1J5OA 3TZYA 3HVAA 3AOAA 3MPUB 3SCJE 5LM7E 5HP1B 1FEHA 3QGPA 2QSWA 3M30B 2BW2A 1CULB 2HBZB 2KO1A 5K8NA 2XG8A 4H54A 4I7FA 4X4PA 3Q22A 2KT5A 1GAOA 2LLZA 3DYAA 1ZZNA 1FX2A 4QR1A 4DS4A 4KAIA 2JH3A 4L6V3 1AFJA 4ANDA 2CQIA 2IYIA 3KDOA 4WTYA 2QA4S 2FLOA 2AZ1A 1SC1B 3QLHB 3CCUS 2D69A 4ER8A 3TZWA 3X1LB 2HBRB 1YTYA 3AT1B 2YKNB 2C3UA 4ECVA 3DRSB 3FUYA 4OIXA 1REVA 4LF9F 1H6KX 5LMNF 2LVWA 2LQBA 2QG9B 3A3OB 1FJ7A 1ZA2B 2F8HA 2ILZA 2AX1A 1XC9A 3HLUA 2HFNA 1WEXA 2H65B 1CJTA 2HPUA 3CCWA 2PMHA 4ZHRB 5CAAA 1RHUB 2DH8A 2KH9A 5B0FA 2P6TA 1KVIA 2JLGA 3JAMY 4AL5A 2PEHA 4DF4A 4DR2J 3L95X 3EXYA 1FVSA 1E6VA 3IWXA 5J2MB 2DXDA 2V9WA 5C25B 4USMA 3SFUA 2MQNA 4DEZA 4OX9F 3CJ4A 4AQYJ 3HM9A 4F2SA 2R7SA 2FGOA 3OLBA 1U2RA 1PSDA 4TY8A 2ZWPA 5KFZA 3K57A 4ZITA 4A8KA 4Z7CA 4N5SA 1L3SA 1WC0A 3PRDA 3B82A 4P2MA 4K50A 3TEHB 4PXBA 3MM9A 4BBYA 3OL6A 4CLFA 3G2XA 5HQLA 2ATCB 3N5FA 2ERRA 2XNQA 1MWYA 1N5QA 3DXSX 3NBPB 4NPOA 3K59A 1KN6A 3MUTP 8RUCA 1UEUA 4X64J 4A8XA 1F2GA 1WI6A 3LUYA 2YWWA 4PG5A 3W65A 2V34A 2QZ8A 4J9SA 1Z4UA 4WPAA 4J9LA 4B3MJ 2XNRA 4FXDA 2XCAA 2UXDF 3QJJA 3DN9A 5F8NA 4PCQA 3S7RA 2AT1B 3KLHA 3FEZA 1R3NA 2Y1IA 1RLDA 3UD4P 2Q3PA 3FBEA 1FFGB 1HA1A 5KFVA 1R0AA 3QMQA 4DV4J 4L72B 2HQCA 2M0GB 3LA0A 4LSNA 4ZS6A 4CM0A 2Z0GA 2HGMA 2MKIA 4DV5F 4TVAB 4XDCA 1H3DA 1WDTA 1JQGA 2KFYA 1RTJA 2IHR1 1IXKA 1KS2A 3SSRA 2CG8A 3TNVA 2XTDA 1S5ZA 4ID5B 4ZVOB 4CI0B 1F5CA 4DDFA 1KKHA 1SQEA 2DR9A 4B9UA 1MN9A 2CZ4A 2YNFB 1FKAF 4QWBA 1PO6A 4M5DB 3HFVA 5ETOA 2WK4A 1DQ8A 1VHIA 2BRKA 4IRDA 3O6QA 1LW2A 2EG2A 4I0WA 5L9NA 1HARA 3OTEA 1S4EA 2OPPA 4LBIA 4N8NA 5MLCV 2YWEA 2RB7A 3DCAA 3FGVA 1U1NA 3D28A 4UT4A 2BM0A 4FF1A 2N4CA 3HSDA 1RU2A 1I51B 1A9NB 2M7SA 1QDUB 2VG5A 3MMBB 1XJWB 1T7PA 2VG5B 3DLEB 1AUSL 3A8EA 5D0HA 2C3PA 3WHIA 5A8KB 1KD1T 4DSLA 1BGXT 3UN3A 1Q8BA 1P27B 4EMDA 1Y00A 4KIAA 3V6HA 2LFVA 1S7HA 3CJKA 1HR0F 2LXUA 4AXIA 1QUVA 4X2BA 3SDEA 5HVGA 5K20B 4DX7A 2CPIA 3BREA 4USJC 3DOMA 2BQUA 2MEWA 2RVJA 3OBIA 4NLOA 2V68A 1U2CA 2KXNB 1X4AA 2DHGA 3IM9A 4K4YA 3NGUA 4FYWB 2KG0A 2EFQA 3FSXA 2MJNA 3EGZA 4JYAF 3UD3P 1OO0B 2V1TA 2Z58B 1ZPWX 3MEDB 5B0EA 2H51B 1FJEB 4OZ2A 2RS8A 1VBXA 4KC5A 1U8WA 2CQHA 2YX4A 3J7ZT 5F8MA 2ABYA 3R2DJ 1LNQA 4MT1A 7FD1A 2OSRA 4OQJA 4DV3F 2YPZA 4FS1A 2ZBPA 2UUAF 1MW7A 3IBCB 1JIHA 2XM3A 3UNYA 4M5JA 5KFRA 2IMWP 3VQTA 2AQ4A 2ZITA 4E8UA 1NH8A 4FF3A 2H5EA 2XO6A 3RW7A 1HW9A 2Z4PA 4LF6J 5DRKA 3HKZD 2HK3A 2NS1B 2QSFA 1KFSA 2UXCF 4WCEQ 4OX6A 2XZ2A 5J1EB 4I2PB 1UZHA 2N7YA 1LWCA 2X3DA 2WONB 2UVWA 3GYXB 1QTNB 4K8RA 5KFWA 2HQ3A 2BV3A 2K7JA 2VG7B 2XYPB 3DYAB 1XBWA 1M5PC 2RUGA 4KKOB 1SUQB 4C6AA 4ZK7M 2LU1A 3CJ2A 2EFOA 3QZ8A 3MD1A 3PDNA 4FXWA 4QU6A 1CJKB 3CDEA 3M8ZA 3KK3B 3GU0A 3DFEA 1HD1A 4ICLB 3KLIA 2Q6CA 3LQVA 2VH7A 2Z30B 4IQMA 4EZ9A 2XS2A 4R5PB 3KUHA 1Q95G 3KLEA 3GFXA 2WHOA 4OZNA 5K14A 1VOMA 3VGUA 2R8GA 2F7VA 3M2RA 4WBFA 5KG2A 1Y9OA 2EBGA 3T1AA 4CRJA 5CD4H 2DHSA 1P9QC 1XNRJ 3BR8A 1HWIA 2GJ2A 3PW5A 1U2FA 3TJAA 1FCAA 4EZ6A 1RT1B 1LW0A 2IBKA 2A2CA 3W9HA 4OI4A 3AJ1A 2AGOA 3RBZA 4YHHJ 3W3SA 1M5VC 4ILLA 2VJUA 4CNZA 3OFGA 4CH0S 2VA2A 1C2PA 2ZUAA 4KY3A 4TU8A 2K1RA 3GILA 3BF4A 2A6MA 4G1QB 1FERA 3A4TA 3CJRA 5ADZA 3HJFA 4CO1A 2V4QA 2MDAA 4GVLA 1C0TA 4NA3A 4OYPA 2W1BA 4O4GB 1JLEB 2YKPA 2P8IA 4ALZA 3KLGA 3SCLE 2BYCA 1PILA 2C2OB 2FJEB 2OEMA 2NPFA 3ZZYA 1HHTP 3KG0A 2GAHC 2FZCB 4F4YA 1QAIA 4NCBA 1F2HA 4I7FB 3KHGA 3QATA 3C14A 3W2VA 1QVFR 3G9CA 4RBUA 3HHNB 1RAGB 4J9QA 4IRCA 2K7KA 3SV3A 4LRAA 4HACA 3KK2B 8AT1B 2R7XA 5KT6A 1NDPA 1RAHB 5F0WA 3JSMA 3HVTB 4ED3A 2OD6A 4ED0A 2ZKTA 4Q44A 1C0UA 3RR8A 2JSXA 3BH6B 1DURA 2FD2A 2MYFA 3Q24A 1PGZA 1S1UB 1BWVA 1U7LA 4CLPA 4C8MA 2CG4A 2I5JB 3SI8A 3X3UA 4PQUB 3QIPB 3CULA 4X4VA 1OSDA 1Q5YA 2VBYA 4M5GA 4ZCIA 2D3OR 3MEGB 4N76A 3AY0A 1EKSA 1VC6A 4JI1F 2R7TA 2F8MA 3VV2B 1KWMA 1U49A 3J7AN 2HGLA 4UW2A 3GYNA 2KJWA 4CLLA 1OY8A 1ZM2A 2MPUA 4OJ1A 3JS9A 4P2SA 3CO0P 2DH9A 1S1TB 5A2QU 3QAEA 4LRCA 4NLGA 2B4PA 2EFGA 3HK2A 5GVQA 1VRTB 2VFSA 3NS5A 2E5HA 3UDLA 5E0OA 4F2RA 4ETXA 1T03A 1IBMF 2BMBA 1GXLA 3AODA 1TK5A 3VWSA 2G2OA 2IC3B 4G1PA 2DY9A 5E5NA 2M88A 4R0EA 3KNAA 2EBEA 3GZ7A 2HHQA 3EZUA 1Z2ZA 4TN2A 1CVJA 1KTVA 1N5YA 1VQ5S 2DRDA 4USWA 4JBCA 2AMCB 2L08A 3BDPA 4XAKA 5DQHA 3VCDA 3I31A 4O3PA 3L09A 3GG0A 2XBPA 3DU5A 4J91A 3DHWC 1REVB 1IR2A 4QW9A 3GV7B 2R7VA 1FRIA 1S1XA 1RWVB 3L7UA 4PWWA 3UW1A 1OS5A 3BSCA 3PYGA 3ZZTA 5AE3A 3ZZPA 4DV6J 2UUCF 2KN4A 1VQPS 2Q43A 1X7VA 2D7SA 1IWAA 2F8EX 5KFJA 1L5UA 4F4ZA 1RAJA 4O3RA 1RAFB 3S01A 1TKZB 4DZ6A 1ZPVA 4IFYB 4MKVA 2CXEA 1GNKA 4NLXA 2PO4A 4ZLNA 2XI3A 5C7PA 1IBKF 4J5OA 3T41A 5EHHA 3IS9A 2W24A 3GB0A 4LQ9A 5H9FK 2RQMA 1TVRA 2CA9A 5LT5A 1CQMA 5KFEA 1WC5A 1NB2A 3OJUA 2AWZA 1HNIB 3PV8A 1NKCA 2KFNA 1DTQB 2R2TA 3MAAA 4CTAA 5LMUJ 2MXYA 1FHTA 3OTCA 4WZQA 2BA9A 2Z2YB 3SYZA 2AJQA 1TL1A 2HVIA 1KOOA 1QAYA 4WJBA 5A2QY 3ISZA 2ACMA 1Y7PA 2EWHA 1EJ7L 4JV0A 1SKUB 2HQIA 2Z56B 4Y0FA 3ZFVA 1RDRA 2ALZA 2FJXA 3IXQA 4PXDA 3TVYA 1SPBP 4TQSA 1VBZA 2VG6A 4F3OA 2DTJA 4L75A 3LGNA 1L3UA 1RHJB 1LW2B 2C42A 3C66A 2VODA 4JV5J 2AYMA 4XTTA 2CDQA 1FXRA 2R7WA 1NJYA 2GO9A 4M5HA 2VBWA 3OTBA 2FYXA 3M6XA 5KAKA 4MYTA 4PPDA 1AZSB 2J76E 4MJKA 1SJ1A 2LU2A 4KQZA 1HHSA 4P75A 5B7WA 3V4IA 5J2QA 4X4UA 1UVMA 2ADCA 5D4PA 4M5MA 5KFDA 3EM1A 3ZTOA 3MM8A 4FDFA 4U6PA 2HAIA 3MGJA 4ZVTB 3JYTA 2H5IB 5CQGA 4O3QA 1SC6A 3JSMB 4ECYA 2HSEB 1E6YB 3IGNA 3P5BP 4BC7A 3T6JA 3G86A 3R2CJ 3ISNC 2QN6B 2H4WB 2IRYA 2LXIA 2ROPA 2PT0A 3OR1B 4I68A 5G4DA 2AX0A 3KJNB 5KFUA 1VQ8S 1K0VA 2RNEA 3DRRB 2H1YA 4KFBA 5AXKA 1LQ9A 1Q81T 4E0DA 3C3LA 5FLXU 1S6OA 4X66J 2E66A 3G96A 1RTHA 2V8GA 2YNIA 2VF3A 3UR0A 1Y11A 2M52A 3DOKB 3MM7B 3V4IB 1FO1A 3OFHA 1JLFA 2BOAA 3QFWA 2AF6A 1U09A 2FTRA 4RO0A 2EFVA 2WOMA 3OTOF 4W90B 5B0BA 1VK3A 4LF6F 2F9JA 2YBVA 4DU8A 3RB0A 2UV8A 2MB0B 2HMIB 1IQTA 1EQMA 3FBFA 1WWHA 2UXCJ 1Q1KA 1HW8A 4RLEA 4EWTA 1K44A 4C9DA 1RA7A 2L3MA 3PJWA 2NYHA 4ZP6A 2V5HG 3P4UB 2HW3A 1Q78A 5EX3A 3M6WA 2B6AB 2JC0A 2YWKA 4LRBA 2XYHB 1DQAA 1VIXA 3GJQB 3IR7B 5T7LB 3IGVA 3SMZA 3SSQA 4DQRA 2NSCA 1PJ6A 4HKQA 1NRKA 4IR9A 2JLEA 1XWLA 1RT7B 3IRXA 3B78A 2FGCA 2GJFA 2VDIA 3IFEA 1ZETA 1NKEA 2UVRA 5B0AA 3TX8A 2RJZA 3NAHA 1XK8A 2YWHA 3MZIA 5J1NA 3THTA 4R5PA 5LMNJ 2CQGA 4WK3A 4V19J 4ZPWR 5CYMA 3CDUA 4K4VA 1S6PB 3BQ2A 4DV2J 5IQQA 1S72S 4M5IA 1UWBB 1IBLJ 5C24A 2C2DA 3MECB 4ITSA 3TZZA 4ELUA 4S0MA 2MHEA 1YI2S 2AYEA 3AD9C 3EDRB 4C3MA 5KFFA 2BJ8A 4N41A 3H5YA 2OMOA 1YJ9S 3HT3A 1N5TA 4RNMA 4DR2F 4YUDA 3MMAA 1W26A 2GQ2A 4JI4F 4QYZK 1TL3A 4YB6A 2E5LF 4I2PA 4QOTA 4GVBB 5U47A 4OHZA 5DDPC 4DL3A 2MTLA 2YWFA 2DNGA 3BKTA 3HJVA 2UU9J 1HNXF 3EWGA 2KRRA 1S99A 1NHVA 1Y3KA 4AQYF 2AP6A 4RKUC 3PR4A 1DJ0A 1PJ5A 4YFUA 3QT7A 3P45B 1SC4B 2ROGA 3R5AA 2X51A 4YDXA 2KDOA 3I96A 4P72A 3TVZA 1DLOA 3H42A 1E6YA 3HULA 2V8VA 3N4WA 5ETTA 3UE2A 4QWEA 4A8YA 1FTRA 4W98A 1HKAA 2ADBA 2UUWA 3G6ES 2Y0SD 2IM1A 3DLJA 1QSYA 1B0TA 1SXLA 1YRUA 1Q8IA 2B9WA 3BBCA 2XS5A 3EJMA 1Q0NA 2U1AA 1R0CB 2HRYA 5THWA 4PUOB 3DOKA 2J6UA 2UVUA 2OHDA 4RUBA 1VRTA 4KHRA 5CZXA 5KFLA 2XMAA 3L3CA 4IOAQ 1S1UA 3UPFA 4FN5A 4WXOA 5F41A 4LF8J 4DL5A 3EX7B 2HVZA 2V4JA 1B7FA 4NLSA 2GO8A 3DRRA 1W2BR 1UW4A 3JTPA 2C2EA 2K06A 3GIJA 4CWBA 3SCKE 2CNLB 2BW7A 3RZAA 5LOQA 2EK6A 2IMOA 1SH2A 4NLUA 2DCLA 2NXNA 1AYEA 1XIQA 2OFHX 2XI2A 4RWXA 3GCXP 5K8OA 5GAHI 3J81j 4E2FB 2DNZA 2KT3A 2RF2A 2XZDB 4X4QA 3ENQA 3ULHA 3CC2S 3PRBA 3QIPA 1S77D 2IYGA 2KL8A 3DGPA 4R8UA 4M63A 3PO4A 3BGRB 1RTDA 1VQLS 2JOQA 4O4GA 3MAAB 4CTAB 1OMSA 1MU2B 1BD6A 2BE7D 1FESA 2W01A 5D4OA 1SL2A 1RWUA 2BOPA 5LSLA 4OJ3A 4NMLA 4LJMA 4M1KA 1IVZA 5KG7A 1FRXA 4PABA 5D6GA 1KLMB 4U96A 1FFWB 3NCRA 3PX4A 4JOUA 1VQ4S 3UI3A 1IKVB 1Q8LA 5EDWA 2W9CB 2FHKA 1PBAA 1W7WA 4KKOA 4NEZA 3CDWA 1QTMA 3R1HA 1X9MA 4K0KJ 3Q8QB 3LWLA 5DDOC 4RW7A 2HWIA 4IUFA 1XEZA 2XMTA 3MOJB 4WFNQ 2GW8A 3EGNA 4C8OA 2BJDA 1RT3B 2DHXA 3BGFA 2BJ1A 3PFEA 3R9LA 1UWAA 5E3PA 1NK8A 4ZCKA 3TQ1A 2KXHA 3C8YA 4DR1F 1S97A 4Q8FA 3Q8RB 2J0SD 3CCJS 4U8VA 2CJYB 2ZJQQ 1CG2A 2NREA 1FD2A 2QLBB 4ZPTR 1CPZA 1N6QA 3MMCA 2C1EB 1RYRA 4NLTA 2QIFA 3C16B 3DI6B 4IR1A 3FK4A 3C46A 2RS2A 1N0UA 3RB3A 3A8KA 2NUHA 4H4MA 1FJGJ 3R3TA 4L73A 4CIOA 1S10A 4LIWA 4WIQA 3MR3A 3Q86A 2VICA 1RT6A 4YR3A 3OSNA 2F40A 3D1OA 1A6LA 2PE8A 4NASA 3W64A 3EPGA 2H48B 1XQIA 2G2ZA 3AAWB 3HD2A 2I8EA 3I4HX 1F0XA 2VPWB 3QT5A 1WG4A 4RW9A 1T9YA 3CUNA 2LDYA 4Q8EA 3NOCA 2KYXA 3TANA 1KONA 4WTOB 1SC3B 2OAUA 4DU7A 2J6TA 4V19X 3SV4A 1IM6A 1UL3A 1RTIA 1YRXA 2B3TB 3CMQA 4DOZA 3R5GA 3TA1A 5A76A 2K2PA 2FLPA 3FFIA 4HACB 4WFXA 3FBBA 4ED6A 4RZRA 3I0RB 1BMQB 4D3GA 5HMXA 2ZOFA 1YDLA 4Q7AA 3SBMA 4X4TA 3CCLS 1PYTA 1VS3A 1XTZA 1GX6A 1HBOA 2GJIA 1PAUB 5J1PA 2C28A 3M1VB 3R1LA 5JJBA 1YLXA 3OHBA 1FRKA 1VJQA 3I4PA 4ECQA 4YP3A 1JLEA 3KLGB 4DWIA 4RR5A 1NEEA 2CQBA 4I56A 3AD7C 2HNDA 2OPPB 1KQKA 1WOPA 4NL5A 2NLWA 3M9MB 5GAEI 1T05A 3F0NA 4OX7A 2EI5A 1R0BG 1WG1A 2M5YA 2VPYB 4IDKB 3GV5B 3BQ0A 2E1RA 2F63A 2O3DA 1B4SA 3GFYA 1XMQF 4GKKF 1JJHA 3PEJA 3ZZZA 4F7VA 5IWAF 1S0MA 3CJKB 4JI7J 2XQCA 2WB4A 1BUXA 5A6PA 2RRAA 3PNIA 4B9SA 4IOBA 2HHVA 1CEZA 3OW2R 1L3TA 3C6TB 1GXTA 2CJAA 2Q6BA 3RBEA 3K5MA 5DM7Q 3PKYA 2A2DA 2R8HA 4LF7F 2HHXA 2VL1A 1J5EJ 1LWFB 1S6QA 1T3OA 1F3FA 3GP9A 1DTQA 3GIIA 3K5OA 3U1NA 4ELVA 4TYBA 4ICLA 5L1JA 4OJGA 3IRWP 1FKPA 1WOOA 1YJ7A 2OMLA 1EX8A 4CM2A 3CIMA 1YJWS 3FCVA 1SL1A 2HHHF 4U7UD 3W2VB 1SJ4P 2HYIB 3JXOA 2ZDPA 3F41A 3MWBA 5HQ8A 4JUZA 1JJ2R 4ID5A 1K0TA 4PXCA 2MQQA 2F4FA 1O51A 1HD0A 3NG8A 4R0JA 4PEOA 2C2NA 1S6UA 2R8JA 1TKZA 2O5DA 1HNZJ 4M5LA 4ZKAA 1N48A 1NZ8A 3DNCA 3LH2S 3MCMA 2DEIA 4OZLA 5DLGA 2W9AA 3V6JA 2KJVA 3BS9A 4RW6B 4CO0A 1U1OA 1UVIA 3Q8SB 4F4AA 1RHMB 3PW2A 1SJ3P 2DNMA 2H3EB 2P5VA 3RRKA 4ILMA 3MUMP 1U1RA 4QR0A 3PKMA 5A0YA 2HNYA 1WC6A 3D6FB 4RWWA 1TKXA 2DNOA 4YMEA 4QBUA 4ZVPB 5B0DA 2W2QP 1B3TA 2B8PA 4N56A 2QMXA 2OGUA 1MWQA 4LSNB 3I0RA 2CPEA 2ZWOA 3CMES 3TQEA 3JSRA 3TJ8A 4F26A 2WVFA 4AT1B 3BJYA 2R7UA 5HROB 4ES2A 1WTFA 2E1MC 3KLVA 3ONQA 3KLFA 3MECA 4QIEA 3D5MA 1AT1B 4O3NA 1BE4A 2PA3A 4QIWD 3MCOA 5KFHA 2ZH3A 1U1MA 2VA3A 2DNLA 5KG0A 1ZH5A 2G4BA 1NMEB 3R7SB 2B4VA 1FNOA 1HPZB 3MM9B 2FB0A 1KP6A 2W4PA 4Y65A 4LBHA 4PRFA 2MMYA 4YB7A 4WU3A 1RT7A 3IRXB 3PX6A 1FDNA 2JZ5A 3H2LA 3H5XA 4HEA9 4OLPA 5J1EA 4MK8A 5A8WB 2V2QA 3TAPA 4F4KA 3DOLA 3CJ3A 4P10A 2H9ZA 2RQ4A 5HMZA 2BVZA 5C25A 2HQGA 1YQHA 2QLFB 5BR8F 1LEOA 4AD6A 1D0EA 1SV5A 2VASA 3D0IE 4MAKA 2JFDA 3HVTA 3ICLA 2OLWA 3GTYX 4PKDB 4J9RA 1FDDA 2CZ9A 1GTHA 1N5SA 1IBKJ 4FF2A 2QFJA 1FDAA 1H7XA 4K5RA 1N33F 1OPIA 1TL3B 2B51A 1IKWB 4NZ6A 1LK7A 1ELOA 2YXLA 3KXDA 4IFVA 2RDJA 2OSQA 5GAEU 4P6QA 3CCES 2R3VA 1B7YB 2XZWA 2A18A 2MLZA 2YNIB 3MHYA 3MM7A 3Q2SC 4J9VA 1F5AA 5DETA 1V3ZA 1VJWA 3D4JA 2XWXA 2PMWA 3WQPA 3NGDA 4ECTA 2JEIA 1TAQA 1HBUA 4NYOA 4N8OA 4FBUA 1QAJA 2GMHA 3LANA 4UZBA 3V4MA 2O01C 5JMNA 3G87A 4WIIA 3NNCA 4K2XA 1UFLA 4NWBA 4B9VA 3LP1A 4H4KA 5F8JA 2CQ4A 1OPZA 3FQLA 1R6VA 1SH0A 3DM2B 3HHDA 4ZN1A 5FDLA 2B7CB 3ADAC 5D78A 4ZVEA 1CS4A 4LREA 3NMAA 4OZJA 3RYLA 3S6EA 3N0VA 1QSLA 3DLEA 5KFCA 3VZIA 3BR9A 1X5TA 3CGIA 5E3QA 1TL7A 2DRBA 5IC4B 5KT5A 1HI0P 5F8LA 1FRJA 2VPZB 5EUHA 1RWOB 3AB4B 3AA9A 1U6FA 3NY0A 2XCPA 4QPXA 2EW9A 1ZYQA 3CDAA 4B3TF 1AUDA 4FP9A 2FJWA 4NZ0A 3BBFA 4X64F 1D9FA 2YKOA 3LTOA 1U6BA 3D9BA 5HMYA 4FBTA 2NQPA 2MY8A 3DDNA 4Q0BA 5D4NA 3OUYB 1WF1A 2HIQA 1PAEX 4DR1J 1BXNA 4PQAA 4MYUA 4RW9B 5E2QA 5I3QA 3KYLA 3HSJA 4PUOA 1N8RT 3O1LA 1NPRA 4WE1B 4DUZF 1C1CB 4NLYA 2PFDA 3FDSA 4DN9A 2PIIA 4NYPA 5KFYA 1S79A 3CCVS 3D3CJ 5IT9Y 1CQNA 1LWCB 4OHWA 2GMLA 2M2BA 3C16A 3DI6A 3E51A 4EBDA 2VONA 3F56A 4PWDB 2CNNB 2FC9A 4DPUA 3U1MA 1YGYA 1XNRF 1Y10A 1U0SA 1XNQJ 1GK8A 2WRMA 2P6SA 3L9ZA 4UUWA 5KG1A 2QO3A 2ZHAA 3PX0A 1VISA 1FA0A 2AV5A 5CYQA 5LXRA 5J2PB 4J9KA 2C2RA 2UUAJ 1V3SA 2BZ2A 1D09B 5HQMA 2VQFJ 4DR5F 1RGVA 3PW4A 2IM2A 4RW4A 4X62J 3AXKA 2LQ9A 1F9EB 5D0EA 4N47A 1CSJA 4G6VB 4GMKA 1OY9A 2RILA 2PD1A 3ZTQA 5GADU 2J6SA 1Y5IB 4HH0A 4DQSA 3FRYA 2VFUA 2KYZA 1KTQA 2MZ1A 1SKSA 3CC7S 1NXIA 1S1XB 4LFBF 1Y3JA 1UEKA 4ES1A 4JI7F 5IT4A 1HNWF 1CULA 3U1LA 4B9NA 5I3UA 1WF0A 4K4XA 2DD8S 2CWXA 1UJ6A 3AWRA 3K2YA 3PYEA 3A3PB 2HWHA 4Q5VA 2BJ7A 4A8FA 4WFAQ 4WFBQ 5EWGA 1U4BA 2D3ZA 3SIPB 3O2IA 1UZDA 2QTWA 1FXLA 2KFZA 3BN7A 4ATNA 4FYDA 2DVIA 1ZM3A 4FYYB 4F8RA 5DM6Q 3OL9A 2RKIA 2NSBA 2OPQB 2J8SA 1QSSA 2RF2B 3DDIA 3D0GE 3SFGA 3MMBA 2C2MB 4ZVSB 3AD8C 1H73A 4ILRA 4AYBD 4C11B 2YH1A 2FJBB 2OEJA 3MD3A 2RT3A 2R7QA 4HI1A 3C6UA 4JI4J 3MAHA 1DZ5A 2XEXA 2ATLA 1QE1B 2W7AA 4DL6A 1M5OC 3DKDA 3K0JA 3M8WA 2E9RX 2DK2A 4XK8C 2WCXA 4YR2A 3G71S 2NPIA 2WVEA 2ZDOA 4IG0A 2ZC4A 4USUA 2YNGB 4ZOSA 1R6YA 2MLYA 4HTIA 2NR0A 3SQGB 4DPOA 2VC0A 2G0CA 2ZJPQ 2Y8YA 4MK9A 1RUSA 1MWZA 2GX8A 3ILJA 1LKZA 3K17A 2HHHJ 4PQUA 5BYQA 2ZKUA 2JRSA 2V2ZA 4JI3J 1VQ7S 3ZNUA 1BC6A 4WF9Q 2QRRA 5L1LA 1RU1A 3RGIA 2CVIA 3QGIA 4TLRA 3OJSA 3HX9A 4DFKA 1OQ6A 1TK8A 2PI4A 5IT9U 1FWKA 2CPYA 1GXUA 2YQ0A 3R6GB 1G4CA 2ZZTA 3WC2A 4TXSA 3GWCA 1JXLA 3PY8A 2YH0A 3I0SB 3A8JA 3KMQA 3OFEA 4IRKA 3I56S 3I55S 4KO0A 4JB8B 3T6BA 2DGXA 2CJBA 2Z8QA 2HNZA 4C4WA 3UWTA 4KBIA 4ZJLA 1NJXA 4QJVA 4LF8F 1PC4A 1NK5A 5HSPA 2G1HA 2QLXA 3D0HE 4FVCA 4I69A 1AZSA 5HVFA 1OIAA 3WZ0A 2R2SA 2DITA 2HRTA 1FWPA 1TK0A 3QRQA 4YQWA 4F0MA 4NYZA 1N88A 1X4EA 2BUNA 3ET6A 3OT9A 4ANCA 3BO3A 2FDNA 3LGHA 2NZCA 4NEYA 2VQEF 3KHLA 2L9DA 7FDRA 4JI2J 5CCMA 4R25A 2Y3YA 1QVGR 4KGXB 2YPYA 1ZAXA 4TNOA 2CDRB 4F02A 1RT4B 2DO0A 3LAKA 4Q2MA 1S0NA 4U7UK 1N54B 3R6LB 4ECWA 4ECXA 1E6VB 5DDRC 4YHHF 1ICEB 3KUGA 3BGUA 3FJ2A 1RCXB 4Y2AA 3UO0A 5E41A 4C3LA 3CCSS 3T1HF 3RW6A 1T0TV 3TUJC 4NE9C 1KEKA 3NOGA 3DM2A 3PM9A 1L3KA 2PSZA 3KDNA 1U45A 3L7PA 1ACMB 1KDNA 1T11A 3OXFA 5E3RA 3RJMB 3HCXA 4OI3A 4Z7YA 4CLSA 2UXBF 1JK9B 1U1KA 1X4BA 2O67A 2VFTA 5JVHQ 3VVTA 2VJVA 1VBYA 4DG1A 1ZOTA 4EGLA 3UVJA 1TMMA 4DCPB 2ZJRQ 4LF5J 1WHWA 5DGAA 1LOUA 2GMJA 3AA8A 2ZHBA 2LECA 3A13A 2BQRA 4K59A 4OYZA 3HSZA 1XR7A 1UMJA 2ZUGA 4UUXA 4CLTA 5L1KA 1FNXH 1RAOA 4TYAA 1SL0A 2XMKA 3I9ZA 2DHAA 2MY7A 4LBPA 3UCZP 3MM6B 3MTKA 4O4RA 2GGPB 2IVFB 5B09A 4WKRA 1ZTWA 2QE5A 1KFDA 1YSJA 3DLGA 3IN5A 2W2MP 4CO5A 2BANB 1N33J 3FRZA 1DAXA 2D1CA 3RAQA 2DNRA 2CADA 1SV5B 4CP5A 1X4DA 4HH1A 4J90A 2ASYA 2RDIA 3R27A 4DSJA 4RL1A 4NXNF 3BH7B 5K8PA 4KPYA 3NS6A 3SQOP 1FRHA 2VD3A 5LXYA 2OPQA 4OI1A 1R8CA 1UVJA 4LUBA 2ZZMA 2BKPA 2HRUA 2XS7A 2I6WA 4I67A 2VBXA 4DR7J 4OZ1A 2FJAB 3H25A 3JQJA 4K7QA 2V2VA 2WB1D 1URNA 1IQZA 1IKXA 1N5VA 2AJFE 4IYQA 3MR5A 1IBMJ 2VV5A 4MFBB 2B6AA 4I6AA 4FPIA 1PIEA 1KRPA 2L48A 3R5BA 3DLBA 1DARA 3DOMB 3LPEA 4DI6A 4UF4A 2WZ1A 3QBCA 3ENWA 2UP1A 1C1BB 4P2XA 1T8EA 1RWKB 2KM8B 3GFHA 2AU0A 4B3SF 1XMOF 2HFVA 4ED2A 3AB2B 2B9YA 3M6VA 2E5JA 3CCZA 4KV8B 4P7VA 3OVAA 3H4DA 3CCRS 4DQPA 4LMZA 4B3TJ 1TL5A 3E8OA 4PG7A 5LJ5Y 3PYDA 1SB6A 1QLNA 4J7CA 4MIWA 4DV6F 1TKXB 3GJSB 3OXLA 2EG1A 2HNYB 2YNHA 2HFOA 3ISND 1X5PA 9ATCB 2BKOA 1NK0A 3N01A 4RBVA 2LKZA 4DR3F 2BKNA 4CDIA 2WBMA 2L41A 4JYAJ 4L74A 2Q79A 1KQFB 1JLBA 3TYTA 2FJDB 1V5IB 4NI2B 2E44A 2CUYA 3FEXB 4DMZA 4F3QA 2HHSA 1AA1B 1I1GA 4LR9A 2RIJA 4KGKA 1U1LA 3TRGA 3M6UA 2KZMA 4N77A 4CO2A 3FSIA 2IPOB 5FLXY 2J7KA 4LF7J 1EZZB 2Z2MA 1H74A 3H98A 3NWGA 3QRRA 2UUBF 1RAAB 4C8YA 5KT7A 3CD5A 4URQU 3IM8A 1S48A 3LALA 4DV0F 2AEJA 2G13A 1VQNS 4XPCA 1FRLA 3M32A 2JVRA 5J2NB 2DGWA 3VAIA 4OYOA 2F3JA 2PMZD 5A6WA 2QYGA 3MPDA 2N7CA 3N6MA 2CWKA 2CPHA 1UKUA 3GR1A 4D3HA 2Y1JA 4J37A 4OYAA 2QLWA 3BM7A 3TO8A 4LFCJ 1KNZA 4KRWA 5BJRA 2ZBCA 1YK9A 2X3GA 5CYMB 1S0VA 4P74A 2CKWA 2B56A 3JB9k 3QQCD 1LXNA 3FZ2A 1U48A 2CVEA 2EEYA 2MZTA 4ZJQA 1HWKA 2VU5A 2IM0A 1BQNB 1LFPA 2CPXA 2DYAA 3CW2C 3KJFB 3M2VB 4NA1A 5C42B 4OX8A 5C42A 3KWMA 1RWXB 1URRA 1WC4A 3GG1A 5HN0A 1HPZA 1A0OB 4HT5A 2PC6A 1RQ0A 1WI8A 1Q86T 3MTJA 2XTCA 1REGX 2OD4A 3OPKA 4ZCMA 1UAWA 4WP8A 3LO3A 2XULA 5ETSA 4C0BA 5CD4A 2VC1A 3QO9A 3TA0A 2D68A 3UDEA 1RK8A 2V94A 2IM3A 2FLNA 2D9PA 2OPRA 4KT0C 3EDQB 4NLPA 4NMXA 3VF0B 2HBYB 4AFFA 4CO4A 2JX2A 3M32B 2VOOA 3EUNA 1RACB 2DR6A 5D3GB 1FI4A 1NUEA 3FCWA 2V0NA 3Q83A 4FPRA 2LA4A 4X65F 3K5NA 3JTOA 3VR1A 4RNOA 4LFAF 2WONA 2A3JA 3UQSA 4K4UA 2RRNA 3BN4A 4KTQA 1BQXA 1P1LA 4OV1A 5CHCB 5ETMA 4DL7A 4DSKA 4B02A 1NJIT 4M5NA 2G2YA 3IR5B 2DNNA 3CD0A 3IC1A 5L8RC 2EPIA 1U8SA 3M7VA 4DL0C 4P52A 3CJSA 1HWJA 4O23A 3U02A 4IQXA 1HI1A 3UD5A 3HT0A 3H7HB 2WTFA 5ITHA 1VQMS 5A8WA 3S8SA 5GMEA 4LR8A 4QWDA 4LF4J 4ERDA 2FHMA 1FK9B 3NBPA 2B4OA 4WP3A 3V81A 2JVOA 2WW4A 3MM8B 1MROA 4PXEA 3HP6A 2ZEJA 5H9EJ 3A12A 3PXGa 5K9FA 1NM2A 3HVRA 1RT2A 2J7WA 1UVKA 2IFXA 4CLWA 4RBTA 3Q0AA 3VAHA 2CYYA 1HBNA 3MEDA 4WE1A 4HT7A 3D54A 1DRZA 1S12A 1D8YA 3QT6A 1HLWA 1OQ3A 2RU9A 4MKAA 1YHQS 3BSOA 4IH6A 2NXJA 1KQSR 4ZLPA 3M9OB 2XSJA 2CAJA 3SDEB 3BSNA 5EX0A 4JI1J 2LYVA 4L76A 2JLFA 2AJ0A 1MG7A 1S4FA 2GVDA 2R7OA 3MR7A 2GCFA 1V3RA 1ZZFA 1YRTA 3PJ9A 4QWAA 1G1XA 2HURA 4EYIB 3R8YA 2BACA 4YB5A 2M8HA 2MGZB 5GMDA 3RAXA 4IH7A 1JNRB 2HZAA 5I42A 2W7PA 2PI5A 4DL4A 3G8TA 2VHGA 2GIRA 4JI6J 1HBMA 3KK2A 4DV7J 1KLMA 2ZVIA 4CH7A 4EUVA 1T05B 1M5SA 2J9DA 5KFSA 2V63A 4TQRA 1VRQC 4F04B 3ZZRA 2JC1A 3RB6A 1TKDA 2EXUA 2CRLA 3RUBL 3TAMA 1PC5A 1X0PA 2SXLA 1TAUA 4R8UB 2IJNA 2ZBQA 1IKWA 1SVDA 4IFVB 3HHEA 2BBEA 3IP0A 2YY3A 2B4UA 3ILLA 3WDOA 4TU9A 1YG0A 3OTDA 1FNMA 3OUYA 5H9EK 2DY1A 3M2RB 4L3KA 1K73T 3Q2TC 2QJ3A 2NXEA 3CE8A 3FEYB 1HI8A 1NAQA 4USIA 4C97A 4EI2A 2E1AA 3HHLA 3DMJA 3GJTB 3VHQA 2ZH2A 1S6QB 3CC4S 3KJVA 2WSFC 3ZO7A 5IFMA 2R42A 4IOCQ 2I2YA 4DR4F 1WJ9A 2QA4G 4GKJJ 3MEKA 3A8IA 3P8BB 3A1YG 4ZP7A 1W2IA 4F4WA 4KHPJ 3RRGA 3NAIA 5D8HB 3WBZA 3N6LA 3K5LA 2VZ9A 2IDLA 2JDJA 3UN5A 4F0KA 4OI6A 5AXLA 1N36F 4DF8A 5T41A 4NXNJ 1KR4A 4X4RA 5GAGU 2FVQA 4ZCLA 1K9MT 2V1SA 1XNQF 1H38A 1XN9A 2BABA 5A8RA 3QFHA 1RWMB 1NLKL 3KLIB 3ENAA 5FIIA 1VQOS 1YBAA 3PIPQ 4U9RA 2DEJA 2FQQB 1U02A 1NK7A 2YX1A 2M70A 4HVZA 1S76D 4USKA 1S57A 5DJBA 5EN1A 1T9UA 1IKYA 2CQ0A 2HVHA 2FVSA 2JEGA 5LSOA 4B17A 1X5SA 1WG5A 3DXBA 2XTJP 3W66A 1DTTB 1LWEB 2HS0A 3D3BJ 5A8KA 3K8VA 2IVYA 2IJFA 1WELA 3KG1A 1CJTB 2DGQA 2V8HA 4ZHRA 1JXEA 3I6PA 2XO7A 4DUYJ 4K0KF 2HNZB 2OFGX 2YQ1A 1Y0HA 4HI2A 4MKBA 2LEPA 3VAMA 4ZIWA 1WOSA 4DLGA 4HHHA 4C0OC 2WSEC 5KT4A 1Q82T 2DHHA 3ELHA 3WX4A 3HVWA 3PW0A 3CIZA 3PG9A 1YJNS 3U27A 1X31C 2EVZA 2D9OA 1UA1A 1AFIA 1AB8A 2C2KB 5KFKA 3HPOA 3QLHA 3MR6A 2VFVA 3O3LA 3G6XA 2QYCA 1XR5A 1SI9A 2RAQA 3G82A 2FY1A 2EKNA 1CLFA 3M2VA 3Q8YA 3T19A 5KFGA 3PVXA 4IH5A 5HLFA 2IAJA 1G6BA 2IJRA 4G1IA 2BE9B 4X4SA 5D4LA 2LEAA 5ETNA 3W60A 1M1HA 2KHCA 2KVQE 1UVNA 4EEYA 1VFJA 5C2GA 1X4GA 1XERA 4Q0BB 4KB7A 3M8QA 3TUIC 3TW0A 3EZ5A 2UUBJ 1RHQB 2DGOA 1TL4A 3GLJA 1FKOB 1O5JA 1OYEA 2GVZA 2PA8D 2W9BA 3MXHP 5KOXA 4GRSA 2HMIA 4DLEA 3NL0A 2EFPA 5KFAA 2ZH8A 4JI3F 1JJ4A 1ITPA 3KK1A 1EKRA 1IJFB 5RUBA 1O8BA 2PGCA 3C6TA 1R89A 1ULRA 1FVQA 1HYSA 2AHOB 2P9EA 1YWXA 3V6DA 1T9TA 2CZVC 4PYAA 5FD1A 4ANEA 4IO9Q 2ZM6J 1P6TA 3V81B 4Y2IA 4RX6A 2C22A 2RD5C 1IKVA 4K4ZA 4MIBA 3TVKA 3RU0A 1R43A 5I3UB 3KG4A 3BYRA 3IO1A 2ZC3A 2N4DA 1JLBB 5HANA 3UDCA 1UFWA 1VGYA 2CQ1A 1SBRA 3N79A 5I3PA 1T95A 4HTJA 3J81Y 4DQQA 3ZC4A 1VMBA 2HAFA 2MZJA 3GSIA 3IAS9 4YB1P 4ED5A 3POTB 2LCWA 4RNHA 4OZ5A 4FYVB 1U1PA 3E2EA 4ENOA 1IBLF 4CH1A 1J2VA 4JI2F 2VQEJ 3K8WA 4P9SA 2NZ4A 1S59A 4BS2A 5EGYA 4C8KA 2PN6A 4DFJA 5IM0A 2BQ3A 1JLGB 3IBWA 5A0YB 3WX8A 2XY7A 4I6YA 1RTIB 1R0AB 3ILIA 5CCLA 4LFAJ 3MURP 2E5LJ 2VFRA 1SKWA 4CNYA 2UU9F 4RNNA 1WKKA 1HNXJ 3ILOA 3UDVA 4O0IA 3DOLB 4NOHA 1S6PA 4A47A 2VPXB 5J2MA 1RT5A 5BYRA 2DBBA 2QL5B 4OMFG 4EYHB 1XR6A 3DLKB 4P7TA 3OD2A 2AKWB 3GE9A 1RBOB 5LL6d 5F9LA 2OTJS 3PHEA 1C1CA 3CF5Q 1QAXA 1BQNA 2B8QA 2F1FA 2B43A 2J9EA 2XC9A 3MCSA 3KHHA 4LVOP 2QL7B 3GIMA 1VYAA 2XLJA 3MMCB 1S1WB 2ZOGA 2APOA 2DIUA 2KG1A 3BGOP 1TUWA 5DZ6A 5D15A 1J5OB 2CJKA 4X84A 4UQTA 4WFYA 4I64A 4WU2A 3W62A 2G1DA 3F44A 1T02A 2IA6A 1KQGB 4KGZB 1M1GA 2W2OP 3H2VE 1JLGA 1W25A 1K1SA 4OYIA 4QZVB 4I6WA 1SJFA 4DBQA 2NCKL 1IR0A 2V6AA 2K3KA 4HYKA 4DL2A 1SKRA 5HMWA 1EB0A 2OKQA 4PG8A 4GO5X 1HNVA 4NXMJ 2AW0A 3G4SS 1JLAB 3K7RA 2XSFA 2LP4A 2HQFA 4ZPCA 3PCOB 1SJQA 3ETMA 4DR7F 3CD7A 3Q23A 4OYXA 4CZCA 3H8YA 4ED8A 1I5OB 1N0VC 1MU2A 4TKTA 3FBCA 5I42B 1KSPA 1T9XA 3TX0A 4JI6F 1H2TZ 3H5SA 4Q43A 1RYSA 2YNHB 2VKRA 2V9KA 1Q5VA 2MGZA 3A3NB 3QNWB 1YITS 1RXOB 2FLLA 2LA6A 4OYBA 1RE1B 2WW8A 2FIUA 4Q45A 3P6YC 2FHJD 4WXWA 4KV8A 1XMOJ 5E3CA 5D77A 2B5JB 1WC3A 2W9BB 2JEJA 4Y00A 2AYGA 2CPZA 2EKYA 1S1TA 3G8QA 4DPTA 2CQ3A 1VHFA 2X7IA 3NWRA 3BGLA 1YVFA 3FZBA 2OPSA 1U6ZA 2D41A 1JLCA 3T9NA 2HG4A 5SUHA 5IT0A 4JI8J 2H5JB 4E98A 4B3MF 3QJPA 2Y1RI 2XMUA 3EZOA 3W2WB 2OJ3A 4J9UE 1I94J 5K8MA 1TMJA 3BO4A 2KVIA 1WEYA 2MKSA 3W5XA 4Y3CA 2I5JA 4CT9A 1KVJA 5IV3A 1GFWB 1MROB 4PR6A 4DV4F 3DC2A 4GKJF 4KHPF 1F9HA 2ZBRA 4RU2A 1GQEA 2P9GA 2HWTA 4DV5J 3MDFA 4CYUB 3FMWA 2D3O1 2AZ3A 1UP1A 4I2QB 5ETKA 1N36J 1EIYB 1U0HB 1TVRB 5B0GA 4QQBA 3H40A 3TARA 1FJGF 1TKTA 3KJVB 2MZRA 2K8GA 1GEHA 4RUAA 1GT8A 3CNQP 2XY5A 1L3VA 2MKYA 2RMLA 3PHTA 5L46A 2KHDA 3P3DA 3BQ1A 2KRBA 3M2UB 4WKYA 4IFYA 4WFZA 3BBBA 4GC6A 3SZ2A 1RT3A 3UCUP 3DLLQ 1N32F 1UPPA 1UFKA 5MAOA 4A8MP 3RR7A 2RQKA 3RB4A 4A8OA 3FFIB 1U26A 2M9KA 1EARA 5AE2A 3MPYA 3PIOQ 3AHPA 3LP0A 2DISA 2AJ4A 2MKCA 3AH6A 2MKJA 1LV5A 1X5OA 2IDEA 3QO9B 4F0HA 2YKNA 4O3OA 3HO1A 2V4RA 3HZGA 3WIVA 2JNJA 4C11A 2LQ5A 2FJVA 4B3OB 1NDKA 3C2PA 4JI5F 3HDSA 1K47A 2MLXA 4KSEB 4M8LA 3M8PB 3M8PA 3MF5A 5CH7B 4MKYA 4UY85 4ZPBA 3IA0A 3GCWP 2XHCA 2J7UA 3U7JA 1XMQJ 2XTEA 4NRUA 1CC7A 2XZTB 1TR0A 5IWAJ 2DNKA 1JX4A 2M3DA 4M95A 5HP1A 3PFOA 1RT4A 3SCIE 1RKJA 3AJ2A 1CJKA 3KK3A 3T5LA 2QV6A 3V5RA 3QPIA 2ZFHA 2U2FA 3DGVA 3CB4A 4A8QA 2BANA 1NK9A 5GAHU 2XLKA 4UOCA 3E3XA 3OR2A 3AJDA 2VG7A 3LAMA 5J2NA 3V6KA 4TLQA 3VGTA 2QA2A 2P2CB 2CJXB 1J5EF 1RISA 2NUUG 3OL7A 2AIRB 1JLFB 1U24A 2JFKA 2MQMA 1TZ0A 1HBNB 2MSSA 1MNEA 3IR6B 4B9LA 3HFKA 2J8AA 3GJRB 5L9XA 3UR3C 3W5YA 4C0HA 5HL7Q 3R5DA 3P5TL 1BQMA 3BKFA 2Q1LA 2VQFF 3UVJB 4DHVA 4DR5J 2QMWA 4LF4F 4X62F 1FT8A 1FXDA 4RW8B 4ED4A 2DXFA 4X4NA 1WD6A 2DGVA 5KG4A 2DCUB 3OQ2A 4H4OA 1S1VA 1GMUA 1B64A 4L3NA 3BYPA 1PG5B 5G0RB 2K3IA 3JYTB 1D3WA 1RHKB 3BGRA 3W63A 4LRFA 5KFQA 1PJ7A 4BLGA 4NLVA 3AQOA 4BDPA 2KTQA 3QIDA 1R8HA 2POKA 1O6XA 3VALA 4DX8H 3LPYA 2FVRA 2A10A 2YKMA 2QLJB 2BE2A 2CPJA 1HMVB 2E7WA 2N82B 1S9GB 1ZAVA 2YX7A 3H5UA 1WKJA 1ZS6A 2E7XA 1A7GE 1C1BA 2OELA 2QA1A 1T9VA 6AT1B 2XMMA 1H7WA 1Y5LB 2C3YA 3DRPA 3LP2A 4M5KA 5IOLA 5FJ4A 5SZTA 2GC8A 4CLZA 2QT7A 4UY8T 2VIHA 2LMIA 3CPWR 3W9IA 1LW0B 1RT1A 2Y9HA 3NNAA 2E29A 3VTIA 3KNGA 3N28A 2V8PA 5GAGI 1NZAA 1TL7B 1IKXB 1KOHA 2F65A 2MQ8A 3BO2A 4P2FA 3TR5A 3UFCX 4PZVA 3OV7A 3AX3A 1RT2B 2A0FB 4YDDB 4AL7A 3PZPA 3TI0A 3SSSA 4H4MB 4YY3F 4QIVA 3UCGA 3J7YU 1FK9A 2DR5A 1R27B 2DXEA 3M8YA 1S9EB 1EP4A 1F3VA 1VBKA 2ZNZA 4USHA 4URGA 5DG8A 1NHKL 3OVSA 4DJBA 3VAFA 1N6QB 5DS7A 4C8LA 3MEEA 2DKOB 2Y1LB 2YKQA 2V50A 4Z2XA 3ZZUA 2LXFA 4NLDA 4U67Q 4TU7A 1U47A 4XIUA 1QY7A 4DS5A 3I32A 1RWWB 4J9MA 3DLGB 3QRPA 2WSCC 1SIWB 2W4CA 1HNVB 3LWMA 2HIYA 2J9DE 2W4DA 2XLIA 1B99A 7AT1B 4ES3A 1ZAWA 5BR8J 3FCHA 4UZCA 4ECZA 1AW0A 1SCJB 3MCNA 2ASLA 4HDGA 4CO3A 1M90T 3C15A 2XWYA 3SQGA 5KFBA 1QD1A 2J0QD 3M2UA 1RCOB 2WVDA 5C2CA 4RW7B 3THVA 4DR4J 3KOAA 1VQSA 1WEZA 1PCAA 1ZA1B 1LXJA 2YTCA 1TUVA 2HKEA 4K2JA 4Y28C 4XO0A 1CJUA 4ZVRB 2BM1A 3VGSA 4DX5A 4FYXB 3VAKA 3T5HA 5KFTA 2N3LA 1YZ7A 4CT8A 4W92B 2IA0A 1AXQA 5EWEA 4Q2LA 4XPEA 4USVA 3AOCA 2HS4A 4O44A 3SXLA 4EO8A 5KTQA 4NI2A 4DSFA 3GSDA 2ZH7A 1N5YB 2ZOMA 1EP4B 3GR0A 1RAIB 1O0PA 2ZE2B 3DGPB 2OH2A 3NGKA 1X60A 3POTA 4DCJB 4YS2A 1K1QA 1V5VA 2WBRA 1NPPA 4DN0A 3ITHA 2FUG9 1T03B 2NYIA 3KKFA 5DDQC 1V6HA 3T1HJ 3CTRA 4Y6IA 1S1WA 1WHYA 1HHQA 2D74B 2X1GA 3R7BB 4OI2A 4QYRA 1SUQA 3TAQA 4A4JA 4F4XA 1VLOA 2HFUA 4WP9A 1HQEA 4C48A 4DUYF 1X0FA 2IVMA 4OJHA 4ZVGA 3BB5A 5E3AA 5HK4A 5KFOA 2DGSA 4MFBA 4A8SA 3HD1A 2OI2A 2DNPA 2DPJA 3J7A1 3AX5A 3EVMA 3RAMA 4RW4B 2YKMB 3K58A 2M4MA 2G0IA 4ECRA 1X9WA 2FZKB 2H4YB 3HXMA 1K8AT 1HWUA 1RTHB 3NCPA 1T3NA 2UUCJ 4QCLA 3MOZA 2GAGC 4JI8F 3DHXA 1RA6A 3Q8UA 5FDLB 4EK2A 5AE1A 1D9AA 2DGTA 5IXUA 3RRHA 3WC0A 3I0SA 4ID8A 2W7OA 3R5CA 3VVUA 4DUZJ 5G0RA 1FKOA 1I94F 1VRUB 3T9ZA 2UV8G 5F8IA 2OIHA 1TV6B 2CPDA 1UUJA 1R8AA 2EC2A 3NRBA 1X4FA 1Y4ZB 2YNFA 4DXLA 4B9TA 2MKKA 4UQGA 4JV2A 2D3UA 2DR8A 1MN7A 4QYZJ 2B7BB 4LFCF 1G2EA 1HYSB 1UEVA 4OHXA 4DPWA 3BSAA 2HS3A 3H0PA 5L38A 5KG5A 1FD8A 1C0TB 4YN3B 1ZBTA 5DQGA 1Q16B 1CBKA 5HVHA 2JHEA 2XGPA 5LMUF 3M8RA 1NKBA 3PTWA 2AD9A 2R2UA 3TUZC 4F25A 3FNNA 3JAMU 3NMRA 3EICA 4HLBA 2MQOA 1QE1A 1IM4A 5KFXA 3PR5B 2ZH4A 2MJUA 2F5GA 1FX4A 2PFFB 1RABB 2AEMA 4UTGA 3D1QA 1TU0B 4ZP9A 3D67A 3HHLD 3SEOA 4LFBJ 4NCGA 3H2UB 1F9FA 4M94A 1JB0C 3BEGB 2AYBA 1WSVA 2KXFA 3HSGA 4NLQA 4UOGA 1WKLA 5KT3A 3JSBA 2RKIB 1DBDA 1HNWJ 1NJZA 4B3SJ 5AXNA 2BXJA 2E5IA 2Z2LA 2HGNA 3DLKA 3MM5B 3I9V9 4QR2A 5ETPA 1PKUA 4BC9A 5BYSA 1YBTA 3EE3A 4JI5J 1CJVA 1WC1A 3I5AA 3IAM9 5F3TA 4CLUA 1YIJS 2ZVSA 3M8QB 1OY6A 2W8KA 3H90A 4KE5A 2LQJA 3PEHA 5JXSA 4DR3J 4HL9A 1NHUA 1WHXA 3VAJA 1OSCA 2AGPA 2YQ3A 3G82B 4LRDA 5GMKa 4G65A 5KT2A 4ED7A 4MTPA 2VUGA 1YKWA 2R4FA 2X1BA 5AJ3F 1EQ0A 4OV6A 4PG6A 3E01A 1R8BA 5CYQB 5J2PA 2RHSB 4ZPVR 3OLAA 4KGVB 3N9UC 3TA2A 3W1YC 2FZGB 2R8KA 2MQPA 1RLCL 2HK2A 3BV8A 4DV0J 5B08A 4JI0J 5HO4A 1ZM9A 5IS2A 3D7SB 3HMJG 2RH3A 1OYDA 1JMTA 3CWJA 2I1RA 3KJQB 4PPZA 4I2QA 1BY9A 4ZJOA 2RE1A 3GMGA 3P96A 4EU0A 5IM0B 4QWCA 3T5JA 4OHYA 4OI0A 2C2ZB 3IMQJ 2DO4A 2O66A 4HDHA 4OHVA 3W61A 4NXMF 1VQ9S 2W8LA 3D6MB 1HQUA 4XDDA 1R8PA 1WDDA 2DNYA 2V69A 3D66A 4NX9A 3US5A 5LSRA 3GV8B 2OPRB 2ASJA 2M8DB 5DLFA 2L9NA 1F6TA 5LJ3Y 3GIRA 2DJWA 3H59A 4KJIA 3QZ7A 2MZSA 3D1HA 4RW6A 3LF0A 3KLFB 2P9CA 5HATA 2ZNYA 1CJVB 2XMJA 3PACA 2C3OA 1Q53A 1UETA 2XMWA 3IWNC 4WZMA 3CJ8A 4DV2F 4ZMMA 1M1KT 2HHTA 4USTA 5D0GA 2PEBA 3ZXWA 3W8GA 4UOFA 2OUGA 3O44A 3R5JB 3S1TA 3GONA 4ECSA 4DFMA 3C19A 2FVPA 2E9TA 4QIFA 2BX6A 1NSKL 2GNKA 4KO0B 1MMLA 2ZZNA 2GIQA 2B9XA 4X65J 3D6HB 4FNHA 3JQMA 1CJUB 3DRSA 3I82A 3THPA 1FE4A 3DRPB 4X4OA 1VI7A 2KT2A 1NDLA 3RG6A 4M5DA 2NXUA 3DDKA 3C14B 1VC0A 4WWSA 2BEFA 3L7OA 4OYWA 5ETRA 1HBUB 1KC8T 2KZZA 1M5HA 1C4AA 5DZ7A 3O5TB 3T3FA 5HLFB 3M9NB 4YOEA 3HKWA 4KR0B 4Z37A 2GHVC 1UJ5A 3MAQA 3OVBA 2UXBJ 3FMBA 3CEDA 1Q79A 4P73A 4LR7A 1Q4RA 1QM9A 3M8SA 2JL9A 4RJVA 1Q8KA 5ETQA 2F4VF 4ZPDA 5JUMA 3D2WA 1RTZA 1T9WA 1WHVA 1H2VZ 4K4WA 1HWLA 4HHUA 4IDKA 4BWJA 5KG3A 4LF5F 1S1VB 2HHWA 3N5BA 1NBEB 1HBMB 4RPFA 9RUBA 2RU3A 3G8SA 3B6BA 4FKYA 1M0SA 1Q7YT 1KLNA 2CPFA 4B08A 3KLHB 1VIOA 5M2PA 3TZXA 4U8YA 4CQ1A 2AJ1A 5DG9A 1KBRA 2RHQB 3KFWX 4K4TA 1MMDA 1GX5A 2DNQA 2EC0A 2NXCA 5M2UA 2N3OA 2DGUA 2IIHA 3UNGC 1YX2A 4GO7X 1HQEB 2YVSA 3T5KA 4ZA1A 3PO5A 1BHNA 2V2KA 5HJYA 2OP5A 5E7OB 3OL8A 3CCMS 1N34J 1IJEB 5HAOA 2GS8A 1N4LA 4FNIA 3M05A 3CT9A 2DH7A 2LDIA 4A46A 1S9GA 2HHUA 4OFZA 3ITHB 4FS2A 1FTCA 5HBMA 1GH8A 1NH7A 4MH8A 2X1AA 1YZ6A 1D8ZA 2HVDA 2FY8A 2QL9B 1VLYA 1H0HB 1LFWA 1FFSB 2ROEA 3QWPA 4W4MA 4DV7F 2DR7A 2HQDA 4PAAA 4BHQA 4F36A 3I5CA 2LQ8A 1WNEA 4Y2MA 3PRVA 1YJVA 1H98A 2CJQA 4C3KA 4B3OA 2H54B 1D1UA 1IKYB 3ZNJ1
chains in the Genus database with same CATH topology
4K5SA 3TP2A 1G3OA 2JWNA 5F3ZA 1NU4A 2J0WA 1ZM4A 1HFEL 1WF2A 5DO2A 4DV1F 4LIRA 2DRAA 3M4XA 4ZVHA 2DB1A 3B4MA 3JSYA 3HZEA 2ILYA 2KI2A 3HHLC 4LQ3A 2HLUA 2KU7A 3TAMB 4YR0A 4BWMA 1NK6A 4AUKA 1U1QA 4MMOA 1R31A 3ENVA 3GQCA 3J7Z5 2XGQA 2XB2D 4DSEA 4NCGB 3T1YF 3M30A 4G1QA 4X66F 3OXGA 3EGWB 3RTVA 3VQSA 4RUCA 1S9EA 3HHLB 1YJRA 3MMJA 5KG6A 4FVMA 1LWFA 1QJHA 4KHMA 4RU9A 2ZH5A 2V8DA 2UZAA 5CA5A 3GIKA 3HHKA 1YJUA 3B8HA 4ZVFA 4AE5A 1VC5A 1Z1ZA 1ZTTA 3HF5A 3DRYA 4ZDNA 2E5GA 3FQKA 4ETZA 4NA2A 5K8MA 5KOWA 5M2UA 5K14B 4BCAA 4F67A 4O3SA 4I4BA 3KLEB 4NCAA 4FZVA 2HFZA 4TY8B 3MFHA 4IG3A 3DLHA 1JNZB 3Q8PB 1S9FA 2YWGA 1TQLA 2DNHA 1P8GA 2B5JA 3FVYA 5JVGQ 1JWWA 1VRUA 2GFFA 1VQKS 2UVVA 1TP7A 2YKAA 2HNDB 1B0VA 4EFAC 5KFNA 3OHAA 1VK8A 1NB7A 3JTNA 1M5KC 5B0CA 2ZHOA 4U7CA 2W25A 1HQUB 1WACA 2I9SA 1UVLA 3M1VA 4C8NA 4FXVA 1NNDA 3MR2A 2XHWA 1DTTA 1LWEA 1EETB 1TKTB 1DLOB 1RI7A 1IN0A 1RP5A 1TV6A 2ZH1A 4DQIA 5D3GA 4JV1A 5C5JA 3ETOA 2GA7A 4RW8A 2XSJB 3G6VA 2DIVA 5H9FJ 2UUTA 3LW5C 3H4BA 1KHVA 1BQMB 2ZH6A 4AXJA 2EK1A 4WYWA 2COLA 5E33A 3W7BA 2ZH9A 1FJCA 4EO6A 4HHJA 5A8RB 2RRBA 4OLOA 5L39A 4DFPA 2Q66A 3EPIA 1X4HA 1TL1B 3OR2B 1WTBA 2FHJA 4LSLB 2IRUA 3LOUA 5T14A 1QUPA 4O44B 3RBDA 3P49B 1S49A 4NLRA 2ZM6F 1VQYA 4RUHA 3DMJB 4QPTA 4YEAA 2BRLA 2GHWA 4QU7A 2IBOA 1G7CB 2ZE2A 3MM6A 1F60B 3NKYA 3V2UC 2ASDA 3EYZA 4MIAA 5IZHA 1APSA 5DG7A 5T7LA 1VQ6S 3NNHA 2JJ4D 1JKHB 4TY9A 4OZ0A 4EBEA 2E9ZA 3LP2B 5KFIA 2I0XA 3LP0B 4DG1B 2W9CA 3CMAS 1UJ4A 4C2MA 3KHRA 2VOPA 4WYLA 3MPVA 3DRXA 5DQIA 2EFNA 3MFIA 1HMVA 2OO4A 3CCTA 3OFFA 1ROFA 1X8DA 1NJWA 1I6JA 3EXCX 1LK5A 1RTJB 4QW8A 4C7QA 2C3MA 2FHOB 2FC8A 5J2QB 5CXTA 1HBOB 5HBMB 3FSYA 2A1BA 3J80Y 4B9MA 1Q7LB 2JEFA 4NLWA 2G9OA 3OR1A 4LT6A 5KFMA 1FKPB 4EBCA 2R7RA 3MEEB 4MK7A 1B0PA 2FVCA 4LSLA 2BJEA 4Y2KA 2J5AA 2AGQA 3I87A 1S0OA 1HL6A 2LEBA 3V6DB 1X4CA 3CJ0A 2DT9A 3QJLA