2IM1A

Crystal structure of poliovirus polymerase complexed with ctp and mn2+
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords poliovirus polymerase
publication title Stabilization of Poliovirus Polymerase by NTP Binding and Fingers-Thumb Interactions.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 135
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 2im1A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2im1A02
3Q8QB 2W7OA 1S1TB 2YNHB 3KLFB 2FJVA 2FVSA 1KHVA 5EDWA 4DG1B 5KFWA 4QWEA 5KFNA 3GYNA 4DL7A 3UQSA 4K4TA 1LWEA 2VG7A 3EZUA 4K4VA 3KJVA 1TKZB 4ICLB 3IGNA 3CDUA 1C1CB 2OPRA 4I2QA 3G6XA 4WFYA 1CSJA 2HWIA 3H59A 1T05B 3H98A 5KG2A 4EO6A 2WHOA 5C42B 3NL0A 1LWCB 4EBCA 2RDJA 4PUOA 4RNFA 5DLGA 5KFCA 1JX4A 1IKVA 5C25A 4TQSA 5DQIA 3BQ2A 4Q0BA 2HNZA 2ZD1A 4J9QA 1RA7A 4LSNB 4I2PB 4MK7A 3NKYA 1UWBA 3DOKB 1N4LA 3BJYA 3IGVA 4QWCA 4PWDB 3NGDA 3CWJA 4R8UA 3KK1B 2R8HA 1IKWB 2WRMA 4IOBA 2HNDA 3BQ1A 3NBPA 1KHWA 2YKNA 2IAJA 2WONB 3UR0A 1RYRA 2IJFA 1JLFA 3T5KA 3HKWA 4WXWA 1SUQA 5I42A 4RW7A 2BRLA 1GX6A 4ED6A 1XR5A 1BQNB 4IG3B 1C0TB 2R8IA 2FLLA 5KFQA 2V4RA 4ID5B 2B5JB 3LP1B 1HNVA 5HROB 4B3OA 1HPZB 4ECZA 1T3NA 1BQMA 1S9GA 3FFIA 4ZPDA 3MF5A 2BRKA 4RNHA 4TQRA 1JLQB 4NCGB 3MEGA 1RT7A 1IKYB 4Y2AA 3BQ0A 4EBEA 4IDKA 5FDLB 4K4UA 1DLOA 3BGRA 1C1BA 2VA2A 2WB4A 4HKQA 1JLEA 4EEYA 1MMLA 1TL1B 1S9EA 3NAIA 1RT3A 3DRPA 4ZHRB 3MECA 3D5MA 3TAMA 1S6PB 1J5OA 3GILA 2E9RX 4MKAA 4I7FB 5J2NB 3SFUA 3KLGB 1EP4B 3LP2B 4NLUA 4IH7A 3HVTB 2WTFA 3I5CA 4ECRA 2GC8A 5F8MA 4H4OB 5KT4A 4NZ0A 4RNNA 1RA6A 2ZKUA 4JUZA 3PJWA 4ZP9A 3GIIA 5D3GA 2B43A 4MKBA 2W9AA 1LW2A 2VG7B 5KFYA 3BSOA 4G1QB 5KFBA 3BSNA 3IRXB 4RU9A 2BE2B 1S0NA 1HNIB 3CJ3A 3KJVB 1N5YA 5KFAA 2I5JA 4O3OA 2AQ4A 2OPRB 5KFVA 4FS1A 2C2EA 4ECQA 5J2PA 1RYSA 3MR6A 3GIJA 4ECWA 4PUOB 1S49A 2YKMA 3H2LA 4O3SA 1TKXA 1TV6A 1VRUA 3MTKA 2IM2A 1OS5A 1N56A 5KFMA 2VA3A 4WZMA 4Q0BB 2JLEA 2HNZB 4RW4A 4ED2A 4NLRA 2HNYA 2C2RA 1U09A 2W7PA 1T03A 1S0OA 1JLBB 2HWHA 3DLGA 2AGPA 4KSEB 3HHKA 1UWBB 3SFGA 1KLMA 4IR9A 3FRZA 4IFYA 3MEEA 2HAIA 1S10A 4DL3A 1N48A 3DMJB 2HNDB 3NBPB 3DM2A 5KG4A 3KLHB 2IAJB 3DOLA 3MEDB 2D3UA 5F8JA 3C6TA 3IS9B 4ECTA 2AGOA 1JLFB 4JV0A 2FLNA 2R8GA 4NLSA 4R5PA 5I42B 1MU2A 4RW7B 2DPJA 2FVPA 5L9XA 4FBTA 3OLAA 4WZQA 1LW0B 3EPGA 3QIDA 5KFZA 3MR5A 2UVUA 3OL8A 4M95A 5KFTA 2YNGA 3KMSA 1K1SA 4DL4A 3QIPB 2ZE2A 1FK9B 1TKTA 1EETA 5F8LA 2R8KA 3ISND 3MEGB 1TVRB 5KFPA 5F8IA 1RT7B 3GV7B 1HQUA 2ILZA 4IDKB 3N6MA 1XR6A 3BGRB 4J9KA 1C1BB 4ZVHA 5KFIA 5CYMA 3I0SA 1RAJA 3T1AA 1S9EB 1LWFA 3DI6A 3QGIA 3DRPB 4IG0A 3MECB 3TAMB 4ED8A 1J5OB 1REVA 4M94A 4K4YA 4KE5A 4WYWA 4ZP7A 3H4DA 4DL5A 4Q45A 3DLEB 1JXLA 1TL3B 4Y3CA 3G86A 3LP0A 3PW0A 4Q44A 3KMQA 1S1UB 1SV5A 4KBIA 5F9NA 2ASLA 1C0UB 2BANA 1S48A 4RW9A 3V6HA 4RW6A 2IM0A 2UVWA 4DEZA 4KO0A 3PHEA 1S9FA 2XC9A 2OPSA 5DQGA 2V9WA 2JEGA 2IC3A 5KT6A 5KT2A 4ED0A 1RT4B 4TY8A 1RT5A 3E01A 1RT1A 2XCAA 2RKIA 3Q8RB 1HQEA 1RTIA 4O3QA 5D3GB 4IKAA 4RUAA 4RW8A 1LW2B 3KOAA 4J9LA 4EO8A 2UUTA 4K4WA 1S6QA 5KT3A 4J9MA 3GIKA 2FVQA 5JUMA 3SI8A 3NAHA 4QWBA 5J2MB 4Q8EA 2IM1A 5J2PB 1JLCA 5C24B 4Q8FA 1HMVA 3JSMA 2R2UA 2DPIA 2YKMB 3FSIA 3OL9A 3QLHB 1TKXB 1TV6B 1VRUB 5I3UA 5KFOA 4X2BA 2OPQA 3H4BA 3T5LA 4RW4B 2BQUA 1JLAB 1T03B 2E9ZA 2GIQA 5DGAA 5EWFA 1Z4UA 3DLGB 4KV8A 4DL6A 4PQUB 5KFJA 1S0MA 2VG5A 1KLMB 4WFXA 3OSNA 4RNOA 4IFYB 3MEEB 1N6QB 5L1JA 4QW9A 4J9PA 4EYHB 4KFBA 4K50A 1S1VA 5KFFA 3C6UB 3DOLB 5F9LA 4O3PA 2E9TA 3M8PA 3BSAA 4Y34A 3QGHA 4R5PB 3NMAA 3KLEB 5HBMA 3RB6A 4YQWA 4XPEA 3MFIA 3V4IA 3QO9B 3FQLA 2ILYA 2WK4A 4NLTA 4YR3A 3JYTA 1HYSB 3I0RB 3CVKA 4ECXA 3PR4A 3DRRA 1RTDA 1QE1A 4O3NA 4O44A 3CDWA 1RT2B 1TKTB 2AX0A 3RB3A 4KKOA 1D1UA 2C22A 4YR0A 1HQUB 1S1XA 4IFVA 4DL2A 3V6DB 4NRUA 1RTJA 3KK2A 5F8NA 1FKPA 3CJ4A 2VG6B 4H4MA 5CYMB 3KHHA 3ITHA 3Q8SB 5J1EB 4LQ9A 3OLBA 1JLGA 1LWFB 2CJQA 2OPPA 3CJ2A 3DLKA 3DRSA 4IG0B 5J2QA 1K1QA 4ZPAA 2D7SA 1SH2A 5KFXA 3RBDA 4YMEA 3OHBA 3KLIA 4IH6A 5KG6A 3LP0B 4NLWA 1LWEB 1RT6A 1SV5B 1I6JA 3QYYA 2BQRA 4RW9B 1S1TA 4TN2A 4I2QB 3BREA 3T19A 1JKHA 4KO0B 1NHVA 3PR5B 4J9SA 4ECSA 2FVRA 4ED3A 3M8QA 2OPSB 2IC3B 3RAXA 4TY8B 3ICLA 4RUCA 1RT1B 3KHLA 4FS2A 4U7CA 1IKVB 5KG1A 4RW8B 1TKZA 5C25B 5CYQA 2ZD1B 5EWGA 1T05A 5C42A 5KT7A 1LWCA 3H40A 1TQLA 3PJXA 4WXOA 3BR9A 4MIBA 3VQSA 4GC7A 3PW4A 5HLFA 4NLGA 2WCXA 3JSMB 4R8UB 2XGQA 4IRDA 2IM3A 4LSNA 4I2PA 4O4GA 3D28A 4ECYA 5L1KA 2OPQB 5KT5A 2FLPA 2YKNB 3DOKA 4GC6A 2CKWA 3Q8PB 4KV8B 1SUQB 4XO0A 3KK1A 2VG5B 2YNFA 3MFHA 5L1IA 4U6PA 3MR3A 2RF2A 3KLVA 4NLXA 4ZPCA 2R2SA 4KFBB 1TP7A 4EBDA 1HNVB 4B3OB 2R8JA 1BQMB 1S9GB 3FFIB 5L1LA 4KHRA 4NYZA 1IM4A 4IG3A 1BQNA 3TQ1A 2FJXA 4G3IA 4H54A 3ISNC 4RNMA 3RB4A 4ID5A 3LP1A 4ZVGA 1DLOB 1HPZA 3QZ7A 1R0AA 3JYTB 1S4FA 2O5DA 3HVWA 4J9RA 2YNIA 2F8EX 4IH5A 4MIAA 3KK3A 2W9CA 2BR0A 1JLEB 1RTDB 3DRRB 1ZETA 1QE1B 1RT3B 1JIHA 2D3ZA 5KG5A 5EWEA 1IKYA 5KFSA 3E51A 4WYLA 4FBUA 1S1XB 4IFVB 4MH8A 3KHRA 3H5UA 2FJWA 1RTJB 5DG9A 1FKPB 4H4MB 4NLVA 3ITHB 1DTTA 4ZVFA 4URGA 4YP3A 5J2QB 5HP1A 5F8GA 3DLKB 4ECVA 4ED1A 1C2PA 5KFDA 2AGQA 1EP4A 1D0EA 2ASDA 2ATLA 3IG1A 1RT6B 4WE1A 4OL8A 1N5YB 4O3RA 4NLPA 2I5JB 4RZRA 5KG0A 1JKHB 3RBEA 3M8QB 5C5JA 4MFBA 5EUHA 5T14A 3V81A 2IMWP 4Q43A 4G1QA 3IRXA 1W25A 2BE2A 1HNIA 3OL7A 4KHMA 3CDEA 4LSLA 1DTQA 5K14A 1SH3A 1XR7A 3PVXA 5CYQB 3RB0A 2HNYB 3HVAA 2J6SA 3LALA 4QWDA 5DGBA 3UPFA 2JEJA 4NLOA 3TVKA 3LANA 4ZMMA 5HLFB 5JXSA 5KFEA 4LQ3A 3OL6A 2J6UA 1VRTA 1T94A 3CIZA 4F4ZA 3KNAA 4O4GB 1JLBA 3DM2B 2AU0A 3FDSA 2JEFA 1RTHA 3C6TB 3H5YA 4F4XA 2B6AA 1MU2B 2EC0A 4JV1A 3I5BA 2YNFB 1RDRA 3DMJA 1S1WA 2R2RA 4ZP6A 2W8LA 2C28A 3KLHA 2RF2B 3PW7A 2WOMA 2UUWA 3IS9A 4R0EA 3MEDA 4IRCA 3UDLA 2HMIA 2IBKA 2YNGB 4ECUA 3FQKA 1FKOA 2ZE2B 1EETB 4TXSA 5F8HA 3PW5A 1QUVA 1LW0A 2I1RA 5KFRA 4NLDA 2XGPA 2QE5A 2W9BA 1R0AB 4YR2A 3OSPA 1S97A 2YNIB 3KK3B 2W9CB 3I5AA 3QIPA 1FK9A 3I0SB 4URQU 3GIMA 3CO9A 3DI6B 4ED7A 1TVRA 1NNDA 1REVB 4MK9A 3M9NB 2BQ3A 5DLFA 2JC0A 4O4RA 3CJ5A 3DYAA 4F4YA 1IKXA 1HARA 4WFZA 2BANB 5KFHA 3H5XA 1ZTWA 2YNHA 4RW6B 3KLFA 4IQXA 4QWAA 1DTTB 2UVRA 1ZTTA 4DG1A 5HP1B 3G6YA 3PZPA 2XWYA 3DLEA 1TL3A 4ZPBA 2R2TA 1RT5B 3E01B 3RAQA 4IR1A 1S1UA 2RKIB 1HQEB 1RTIB 1C0UA 4ICLA 3IG1B 1C1CA 4WE1B 4JV2A 4F50A 1S6QB 3MR2A 3LAKA 2GIRA 1RT4A 2W8KA 4NLYA 4MFBB 4QW8A 3PW2A 1JLCB 2AX1A 3V81B 1HMVB 3N6NA 4TYBA 3G6VA 1QAJA 3GV8B 2JC1A 2FVCA 3T5JA 4K4SA 4LSLB 1DTQB 5K14B 5I3UB 3KHGA 5J2MA 1SH0A 3H5SA 4KAIA 1WNEA 4PWDA 3T5HA 5C24A 4EYIB 2QV6A 3CJ0A 5DG8A 3M9MB 3DDKA 1IKWA 3QLHA 4MK8A 2V4QA 3QZ8A 1VRTB 4TY9A 5KFLA 1GX5A 5KFGA 5DQHA 1JLAA 2WONA 4TLRA 4F4WA 4PQUA 1S1VB 4NRTA 4TYAA 2OH2A 1RTHB 2J6TA 4ZP8A 4Y2CA 2B6AB 3M8PB 4XPCA 3OHAA 3M9OB 1N6QA 1C0TA 3N6LA 5HBMB 5HROA 2B5JA 1S1WB 3V4IB 2ALZA 4J9OA 1QAIA 2RDIA 3C6UA 2WOMB 3QGGA 4QPXA 5KFKA 3GV5B 2V0NA 3LAMA 2HMIB 1JLQA 4NCGA 2XCPA 3KLEA 3EPIA 4HYKA 4O44B 2AWZA 4ZVEA 3BSCA 4NLQA 1FKOB 4KB7A 3QO9A 5FDLA 5DG7A 2C2DA 2ASJA 4KKOB 2JEIA 1NHUA 3I0RA 1HYSA 4K4ZA 2D41A 3IN5A 4J9NA 1TL1A 2W9BB 2IA6A 3KK2B 4ZHRA 1S6PA 1RT2A 2XI3A 4K4XA 3V6KA 1JLGB 5KFUA 4I7FA 1YVFA 2OPPB 3V6JA 3DRSB 5KG3A 5J2NA 2IJNA 3KLGA 3GQCA 3LP2A 3HVTA 4URSA 3V6DA 3KLIB 2XI2A 2VG6A 3DYAB 2UVVA 4IRKA 1IKXB 4H4OA 5J1EA 5KG7A
chains in the Genus database with same CATH superfamily
1S7HA 4Y65A 4J9VA 5D0RA 4K4TA 2MSTA 3M32A 5HANA 2K7JA 3KJVA 3LF0A 4EO6A 4N8OA 1SKRA 2NLWA 8ATCB 4ED5A 2N82B 4KQZA 2AEMA 1Q4RA 1HWJA 4HT7A 3BZQA 2V63A 3UR3C 4DXLA 2CQDA 3CW2C 5KFQA 3LP1B 2DGWA 4ZPWR 2F65A 4FF4A 2M0GB 5FDLB 3JXOA 1LEOA 4Q7AA 4EEYA 2OD4A 5D4NA 3AD8C 4PQAA 4DZDA 1EP4B 2WTFA 3W66A 4P2MA 3WDOA 3WIVA 2RQCA 3FCVA 5E2QA 2W9AA 2O66A 3TUZC 3BSNA 3IRXB 5BJRA 2Z56B 4DI6A 4M5DA 2LA6A 4CLWA 4PUOB 2YKMA 5DZ6A 4A47A 5HI7A 2JLEA 4Q5VA 4ED2A 2M70A 3AY0A 2DR9A 3MMBA 2MQNA 2DRAA 1CULA 1UJ4A 1WG1A 5LM7E 3C6TA 2FLNA 4DU8A 4N47A 3NRBA 1V3SA 4UW2A 4DU7A 4PYAA 5B0FA 4MTPA 4FP9A 1G2EA 4J9KA 4CO3A 4ZP7A 3JSYA 4Q45A 2XSJA 4QR0A 4AT1B 4JV5F 3I9V9 3CULA 5DDOC 3L7OA 5KT6A 2E5IA 2XCAA 2RQ4A 2RKIA 4RUAA 5KT3A 4F4KA 1FTRA 1DJ0A 4NOHA 2GVZA 3SI8A 2F4VF 2KB2A 2H5EA 3HSJA 2CDQA 4I67A 4KV8A 4DL6A 2XZ2A 3RRHA 3OSNA 3G87A 4EYHB 1K44A 1S1VA 2DJWA 1RQ0A 3IC1A 2NXEA 4NLTA 3I0RB 2VBWA 3CDWA 1NLKL 1VC0A 2UUBJ 2PI5A 1R8CA 3WC2A 1C4CA 2HVDA 1FDAA 4JI4F 3RB3A 2OPPA 4DV3J 1SH2A 3CCWA 2DNRA 2KYXA 1BD6A 1KWMA 4KY3A 2OPSB 2HBYB 2AJQA 1QSSA 3MZIA 1FRHA 4RUCA 4C48A 1IKVB 3UFCX 2OD6A 3FBCA 1GAOA 3D28A 3G96A 2QC3A 4QIEA 3KK1A 4U6PA 4JI7J 5A76A 4DR6J 2H54B 3BN7A 5GAGU 2FJXA 1AFIA 3AOAA 2LCWA 2ROEA 4X65F 5IC4B 2YNIA 1OY6A 4PXEA 2WSFC 4HL9A 2E7WA 4IO9Q 5EWEA 5LMUF 4ELVA 3Q89A 3H5UA 3AX5A 3UDCA 2AGQA 2GQ2A 3IG1A 3C66A 1OY8A 4DR2F 2DY1A 2JFDA 3CGIA 4KHMA 3CDEA 5K14A 2HZVA 2E1RA 1U8WA 3NS5A 4C7QA 5CQGA 2XBPA 4A48A 2LQ5A 2E7XA 3M6XA 1BWVA 2VBYA 3IBFB 4B3SJ 3WX8A 4W98A 5SZTA 4OHYA 3R5AA 4LIRA 2YKOA 1GK8A 1EQMA 2HMIA 1RCXB 3OVBA 1U4BA 1CJKB 3HPOA 4PR6A 2V8HA 3I4HX 1T7PA 1HARA 2YNHA 4AXIA 3FBBA 2Q1LA 4AQYF 1RT5B 4UY8T 3C19A 1U02A 4RL1A 1M1KT 2Q6CA 2W8KA 3PW2A 1JLCB 3DDNA 4RJVA 2E5LJ 1VQ8S 3W5XA 1X7VA 3D68A 5F0WA 5J2MA 4PABA 2EKNA 1VJWA 3CXCR 3N01A 4C2MA 2QV6A 3QRQA 2J0XA 1IKWA 4MK8A 3W5YA 4I6WA 5KFLA 5A8KA 2ZITA 1JLAA 3SSSA 4X4RA 3U27A 2LKZA 4DPYA 3VAKA 2G9OA 2DH7A 2BE9B 2VKZG 4ES3A 1G3OA 5FLXY 1TMMA 4NLQA 2ASJA 4DSLA 4LR8A 4DX5A 1VR6A 3W5ZA 3ZZTA 4LBIA 2RILA 3C15B 3FNNA 2OEMA 3JAMU 3V6DA 1U24A 3D1QA 3PR5B 4H4OA 1NB2A 5EDWA 4DMZA 1ZPWX 2VG7A 2IDLA 3G6XA 2HWIA 5KG2A 4RU2A 2MJUA 2VFRA 4OYZA 4P10A 2HNZA 4PG8A 5G4DA 3NP5A 3N79A 3CMES 3K89A 2VOOA 3CMQA 3KDNA 2Q79A 3CCMS 4I68A 1FEEA 2B56A 5LSRA 3A3NB 2RU9A 1BQMA 4DUYF 2DIVA 2RNEA 1ZA1B 9RUBA 2IY5B 2R3VA 4LFAF 1FI4A 3AX2A 1XNRF 3CCZA 4RNNA 2C1EB 2ZKUA 3T1YF 3E3XA 1WSVA 3VVUA 4B02A 1NBEB 1RWUA 2OPRB 2LXUA 3Q8YA 2CPFA 2MQOA 1UEKA 2HFNA 4QIGA 2VKRA 2IM2A 4UUXA 3TYTA 1T03A 2WZ1A 4WK1A 1UWBB 2G2OA 2QRRA 4NLSA 2A3JA 1RBLA 1ZS6A 1UZDA 1LW0B 3M6UA 2HVIA 2MY7A 1D09B 3VZIA 2CAJA 1Q5YA 1KQFB 1EETA 3AX3A 3AD9C 3CNQP 1I3OB 2BXJA 2VOPA 1XR6A 1U47A 3OR2B 5KFIA 4LF7F 1H98A 3T1AA 4KE5A 2J0WA 4Q44A 2XYHB 1XWLA 1ZZFA 2APOA 4TY8A 3Q8RB 1HL6A 1LFPA 4RW8A 2OHDA 3HI9A 4J9MA 1G4CA 5IT9Y 2IM1A 2GAHC 2AYBA 3IR5B 3JSMA 1Q8BA 1UVLA 4X4SA 3MAHA 1V5IB 3K5MA 4B9NA 3DLGB 3K17A 1SJRA 3M8WA 4B3TF 2E9TA 4RUHA 3NMAA 2NUHA 3PR4A 2LFVA 2HFVA 5SUHA 3VCDA 4KKOA 4CO0A 3G82A 2KHCA 4H4MA 2KZZA 1RAHB 3CCTA 3DU5A 3OHBA 3GIRA 3BDPA 1E6VB 1RT1B 4FS2A 3G8TA 4D3HA 2Q66A 1CJVA 2F3JA 1KKHA 4LFBJ 2R7WA 4IRDA 4HI1A 3HK2A 2YH0A 2PMZD 1HI0P 1QJHA 1H6KX 2FLPA 3PV8A 8RUCA 5L1IA 1WUUA 2V50A 3OFHA 2QA4G 4I6AA 4NYZA 3M8YA 4WFNQ 1Y10A 1VIOA 4ID5A 4N5SA 2O5DA 1T3OA 2W9CA 1VQ9S 1JLEB 3VAIA 2ZKTA 4FBUA 3D6HB 3LPEA 3HM9A 4XDDA 1MMDA 4DV7J 1C2PA 1JMTA 2HHHJ 2AV5A 3FBEA 1U1MA 4RZRA 4G1PA 4N76A 2HVEA 3PVXA 3HVAA 1YZ7A 3GJTB 3R7NB 1VRTA 1EX8A 3D7SB 3I87A 2YNFB 5A8WB 4ZP6A 4R0EA 3GTYX 2G2ZA 5IM0B 3RRKA 2GHPA 4CH1A 5F8HA 3PW5A 4UOFA 3OSPA 4YUDA 1I1GA 2EW9A 1X4CA 1FT8A 4QWAA 4DUZF 1WG5A 1PYSB 2XYGB 1N52B 2BEFA 1RWNB 2W25A 4NLYA 3MM7B 1Q79A 1MROB 2A6OA 1RHQB 1TK0A 5C24A 2VQEJ 4N7TA 4F4WA 1EQ0A 2AJ0A 1D9FA 1S7IA 2MJNA 3V4IB 2IVFB 4J9OA 3TNVA 3RW7A 3K5OA 4DV1F 3BSCA 5FDLA 4JI3F 1KVJA 1NK7A 1B99A 2AEFA 2CQ2A 1YWXA 1BUXA 2FHJA 4JI8F 1NSAA 2VG6A 3CMAS 5LMNJ 4IRKA 4OLPA 1KHVA 4DG1B 5KFNA 5CXTA 2XNRA 4ZCIA 1C1CB 4M5IA 1VHIA 4DOZA 2CFXA 4PUOA 5DLGA 1NU4A 2OGUA 5C25A 4TQSA 3BQ2A 3MM9B 1I94J 5IFMA 1FESA 4DV0F 1IWAA 3CCRS 1S79A 1FKAF 2CPIA 4HACB 1H2VZ 1HLWA 4DCJB 1DY3A 2B5JB 3MCSA 3G4SS 4FPIA 1WKLA 4ZPDA 1RTZA 3BQ0A 4YN3B 3IAM9 1XMOF 1RT3A 1UVNA 1KVKA 2E9RX 3SFUA 3NCRA 2GW8A 1Q0NA 5K5MA 1TUVA 3MUTP 1YGYA 4ZP9A 3L09A 1ZM4A 1HNIB 2C2EA 5ETNA 5F0UA 2JSXA 4DR4F 5GADU 3UD5A 4Q0BB 3D6FB 2W7PA 1IR0A 4YY3J 3EVMA 4NX9A 3J80U 4ALZA 2AJ4A 4PWUA 4P75A 4WIQA 1L5UA 5IC6B 2ERRA 2FVPA 1R8PA 3MR5A 5H9EK 5A6PA 3W9IA 1C1BB 4O0IA 5J1PA 1P1LA 1CQNA 1QSLA 1DHMA 3OV7A 3PYEA 4RW6A 1F3FA 2M4MA 2OPSA 1WC5A 1NH8A 1ZA2B 1VHFA 2QTWA 2YH1A 4ZVSB 1LK5A 3OL9A 1RBOB 2BQUA 3MCNA 3DN9A 2W1BA 2FGCA 1N6QB 3SCIE 2P5VA 1AB8A 3IP0A 3TAQA 5HBMA 4NMXA 4UOGA 3KTQA 2H51B 4PPDA 5U47A 1K47A 4O3NA 2Z2YB 1OYDA 2D1CA 2RD5C 3IO1A 3OTBA 3FCWA 1X5OA 2K2PA 5CCMA 2DK2A 4YMEA 4F67A 1JJHA 4F3QA 3T19A 4KO0B 4RR5A 1IJFB 4U7CA 4LF9F 1VBYA 2HRYA 4HEA9 2B4PA 5MAOA 1TQLA 5IS2A 4ZA1A 4LRFA 3A8IA 5KT5A 5L9NA 4A8OA 2V4JA 4ZLJA 2XSFA 2R8JA 2GQCA 1NCLA 3FMBA 2HIYA 3QZ7A 2ALYB 4F7VA 3JYTB 3QT6A 2DNLA 2I9SA 2YKQA 5KFSA 2OAUA 3EM1A 5EX3A 2CQIA 4WJBA 2K1RB 3NGUA 2XEXA 1D0EA 4DN9A 2YPYA 5T14A 2PA3A 1FXRA 5E3RA 3ADAC 1M5SA 2HNYB 4WU2A 3ENAA 2BV3A 2JEJA 5HLFB 2R4FA 2CWKA 5MLCV 1J2VA 3DM2B 3MHYA 4B9VA 2MEWA 4FF3A 1VDHA 2XS2A 4I6YA 3FQKA 4JP8A 2ZHBA 4LF8F 1KLNA 1LQ9A 2OIHA 5D0HA 1FK9A 2HLTA 4URQU 3SCJE 2EVZA 4CO4A 3C15A 4O4RA 4C6AA 1D9AA 1WHWA 2ZEJA 4QOTA 3LAKA 4C9DA 1IXKA 3EVWA 3D0GE 2R7QA 3OTDA 3H5SA 4LT6A 4F2SA 5M2PA 3OTOF 2IA0A 3KUHA 3SBMA 1G6BA 3TJ9A 1UEUA 5BR8F 2P6TA 4X64F 1QAIA 4EUVA 4P73A 1WI8A 4ZJLA 2V0NA 1VQMS 2G1HA 3T1HJ 2AWZA 2ZDOA 4DFPA 2HLUA 2JLGA 4IYQA 3BM7A 1PSDA 4A8XA 2IJNA 2XMMA 2XI2A 1U25A 5KG7A 2W7OA 3ET6B 1U6FA 2FC8A 1DZ5A 2HFZA 2OPRA 3CCES 2DRBA 1IBLF 2IYGA 4B3MF 1UWBA 3DOKB 3IGVA 4A46A 3R97A 4DCOB 1FJ7A 1FX4A 1O51A 3ZZYA 1SUQA 4GKKF 5EHHA 4LF2A 2DR6A 3Q23A 2KN4A 2CQ4A 4B3OA 3QRRA 1VQ6S 2KXNB 4DV6F 4Q2LA 3O8WA 1HBNA 5ETOA 4K4UA 2YQ0A 4NEYA 1H38A 1R3NA 2UZAA 2FTRA 3DLJA 2EXUA 3KYLA 4DPTA 1GFWB 3TR5A 2DXFA 3D54A 2ZOFA 1N5YA 3CJ3A 2BVZA 3RUBL 3TX8A 1F0XA 4C11B 4NLRA 1XMQJ 3DLGA 3NY0A 3HZGA 2ZNYA 4QR2A 4ZCKA 3O5TB 3TA2A 2WBRA 5F8JA 2DH9A 1SIWB 4FBTA 1K0VA 2H48B 2KJWA 1FXLA 3BGRB 4ZVHA 1J5OB 2EFOA 3GP9A 4DL5A 2EPIA 1AUDA 2DXDA 1E6VA 2QJ3A 1J5EJ 5KT2A 2C3PA 3JTNA 1RT1A 3OUYA 1XBWA 1AT1B 2NSCA 1HMVA 1SJ3P 1HHSA 2FC9A 1NK4A 2JFKA 3NNCA 3QATA 5DDPC 4WFXA 1N36F 2MYFA 1WEYA 4EZ9A 4O3PA 4Y34A 1W2IA 2KH9A 3MFIA 7FD1A 4HLBA 5E0OA 1WSRA 2AX0A 2DRDA 3BBCA 2CG8A 1RGVA 3KHHA 4WFAQ 2KHDA 4M5HA 3OLBA 2HRUA 2LQ9A 1M1GA 5KFXA 3GJQB 2Z2MA 4PYDA 1NDLA 2F63A 4RW9B 3MPUB 2WVBA 1MWZA 5DZ7A 3RAXA 3RGIA 4F02A 1HKAA 1FJCA 5E33A 4OHWA 3AOCA 1NKBA 3BH6B 4USKA 2VFSA 5AXNA 4XO0A 2YNFA 2W2NP 1CC8A 3M8SA 3THTA 3KLVA 2R2SA 3QRPA 1D8YA 3RB4A 3A8EA 3OPKA 4ZVGA 1DLOB 4JI1J 1S4FA 4IH5A 1RB0A 2BR0A 2OTLS 1KQKA 1S12A 2V69A 3ZTQA 2XULA 5DDQC 4L72B 3RR7A 2Z57B 3MM5B 1N0UA 2MHEA 3BH7B 2VHGA 3TEGA 1JKHB 4JV5J 1HHQA 2NREA 3MM7A 3ISZA 1MROA 2BE2A 2CJKA 3RW6A 2DCUB 5B7WA 5DGBA 2XMUA 5JXSA 1ZM9A 1U7LA 1U2FA 4LSZB 1F5BA 2JLFA 4ITSA 2EC0A 3ZZ0A 2R2RA 2DNOA 3P45B 2ZBIA 3EMTA 3UDLA 2G0CA 2XGPA 2PFDA 3HX9A 2ZHAA 1R6VA 4DG1A 3BO4A 5CHCB 1AZSB 2H4YB 1XERA 4JI4J 4UTGA 4EU0A 1HQEB 2PMHA 1C1CA 4WP3A 1YJ7A 1V3RA 4MFBB 1TK5A 4TYBA 1I51B 3T5JA 3K5LA 3T5HA 3QLHA 4FKYA 1UUJA 2VC0A 1XK8A 4PQUA 1KD1T 4HACA 5B09A 2EC2A 3M8PB 2GFFA 2B5JA 2RDIA 3TUJC 3X1LB 2AYEA 2IPOB 1PG5B 1N32J 1FHTA 1FDBA 1O5JA 1VC6A 3KK2B 1AYEA 2XWXA 1WJ9A 5LMUJ 1KOOA 4BHQA 1S1TB 4P72A 2HGLA 2WVDA 2WVCA 3P5BP 2XB2D 1KC8T 4DPXA 3IGNA 5HK4A 1FE4A 4WFYA 1REGX 4PPZA 4DR2J 4PXCA 2XYPB 1KSPA 4DQSA 3NCQA 4Q0BA 2R7UA 3CCUS 2KJVA 4PWDB 2CQCA 4B9LA 2DB1A 2YPZA 2GHWA 3K2YA 4FYDA 3DGPB 3UR0A 4NXMJ 2M8DB 1FDDA 1PYTA 1HNVA 4XAKA 5LL6d 2DIUA 2ZBRA 2HGMA 1NXIA 4TQRA 1JLQB 1C1BA 3D0IE 4ZHRB 2ZNZA 3CJRA 1Y5LB 1QAYA 2ZVSA 2DVIA 1JNRB 3PJWA 2AKWB 2FY8A 3M4XA 3ZFVA 4MKBA 5KFYA 4G1QB 1NHKL 4AQYJ 1RLCL 3HF5A 4FS1A 4TU7A 1BXNA 5GMDA 1RHKB 2MTLA 3GIJA 1S49A 2QLFB 1U09A 1JLBB 2ZM6F 2HAIA 5B0CA 4DV2F 3NBPB 2BM0A 3CJSA 2IAJB 5T7LB 3IS9B 1KVIA 2AGOA 3MOZA 3LTOA 5I42B 3QIDA 3OL8A 2Z0GA 4ZIWA 4UZCA 3RR8A 2R8KA 2BKNA 1VQNS 2AJFE 2ILZA 2UUAJ 4YB7A 4IUFA 4DFKA 3OQ2A 1KS2A 1QSYA 3WC0A 1PJ6A 2CZ9A 1REVA 1NB7A 3MPDA 4KO0A 1ZZNA 5ETVA 2W2OP 4DX6A 5CAAA 3MEKA 3VVTA 3SQOP 2RH3A 3ZNUA 4JI5F 4RBVA 2PA8D 2E9ZA 5HATA 5DGAA 2RHSB 3IWNC 5E7OB 2FHOB 3N9UC 3CO0P 4GKJJ 4R5PB 3RB6A 3HVRA 1A0OB 4YQWA 2H9ZA 2MLZA 3JYTA 2WK4A 3TA0A 1TFWA 3EDQB 4O44A 1TKTB 4DUYJ 2HAFA 4NASA 1S99A 2X1FA 2CPZA 2MGZB 2K1RA 4KJIA 4IH6A 1IR2A 1LWEB 3C14B 3GSIA 4I2QB 3PO4A 2J7KA 2B4OA 1XNRJ 4ECSA 2DKOB 3BDEA 1H0HB 7AT1B 3T1YJ 2OP5A 5C42A 4NMLA 3WZ0A 5HLFA 4MIBA 4KR0B 4LSNA 4ECYA 2DHSA 3HHLD 4BLGA 1TK8A 3MFHA 2HVZA 4RBUA 4NLXA 4TKTA 5L1LA 3TX0A 4QYZJ 2QYGA 5T41A 4IG3A 1N5TA 2ZH8A 2BUNA 1W7WA 1RKJA 1V9OA 2C2NA 2J9EA 1FFWB 4URGA 2R7OA 1X60A 4LF7J 2V6AA 1NK0A 1RHJB 1SJ1A 1UETA 3H90A 1S77D 2PC6A 1Q16B 5E41A 2V94A 5H9FK 3OL7A 4OFZA 2P6SA 2D3OR 1NPPA 1K0TA 2CQ0A 3UPFA 4ZMMA 2XTJP 2VB6A 4IO1A 4HTJA 1VYAA 1RDRA 2KT2A 1SL2A 5HJXA 1IQTA 3W2VB 2YNGB 2OLWA 2GJ2A 2B9WA 2ZE2B 4KGKA 2IJRA 1U0SA 2HPUA 3KXDA 1RP5A 1K8AT 2YVSA 3DI6B 3W1YC 3MMAB 2KRRA 3CJ5A 2FUG9 2XWYA 5L39A 3E01B 4GVLA 1S1UA 1EKRA 1FVQA 3T6JA 1D9DA 3IM8A 4JOUA 4ENOA 1P9YA 4LSLB 1DTQB 4EYIB 3I31A 3FRYA 3ENWA 2V4QA 3N5BA 1CJTB 5KFGA 2N7CA 4TLRA 1WORA 3UCGA 3QJLA 2VU5A 1S1WB 1CS4B 4K8RA 4TNOA 3EPIA 5KTQA 3QO9A 2C2DA 1N0VC 1HYSA 4GRSA 4AE5A 2XI3A 1FO1A 4DSKA 3DRSB 3NOGA 4URSA 5ETPA 3RJMB 3KLIB 3RYLA 5J1EA 4P2FA 2HHHF 4J9UE 1X5SA 3IBCB 3MI7X 3AA8A 3S01A 3TQEA 4X4QA 3MMJA 3H98A 2VZ9A 1LWCB 2K8GA 2RS8A 1FWPA 4C11A 2ZD1A 3P5TL 1B7FA 1N4LA 2W4PA 4QWCA 4OYPA 2ZZTA 2F40A 1RWWB 1UJ6A 3GFXA 1F9EB 3BQ1A 1CJUA 2WONB 3M1VB 3TUIC 5D15A 1Q78A 3KDOA 2X51A 3OR1B 4OYBA 1TL7B 3OBIA 3BGRA 3SEOA 4WWSA 3AQPA 1J5OA 3M2RB 2JVOA 3AT1B 4IH7A 3HVTB 2I6WA 4NCAA 1DRZA 2GGPA 2LEBA 3ILJA 4GVBB 4C98A 2OTJS 3I9ZA 4HH1A 1P6TA 2YWWA 1MLAA 3J7ZT 1SC3B 1N56A 2CIMA 5KFMA 3NGKA 3VAJA 2GQQA 1SB6A 3QAUA 4BBYA 3OLAA 3GLJA 1HBMB 2C3MA 3CEDA 2E7VA 3UNYA 5KFZA 1OJ4A 5KFTA 2OMOA 4Z2XA 3HFKA 5KFPA 5IV4A 1RT7B 1WOSA 4DV1J 4JI3J 1RWOB 5GVQA 2V1SA 1R8AA 3H4DA 2XTCA 4LBHA 1C0UB 4RW9A 1NH7A 4JI8J 5LXYA 2JEGA 4TLQA 3JQMA 5HVFA 1JJCB 1WD6A 2GO9A 3GU0A 4CT8A 2KL8A 4FF2A 3MM6A 1N33J 4ZN3A 1FEHA 4IFYB 1NSKL 4DV0J 5BYSA 2K06A 2IRUA 2AD9A 3KLEB 3PIOQ 4DR5F 2ILYA 3MPYA 1ZOTA 4ECXA 2J7UA 2L9WA 5HVHA 2HURA 3P3DA 4ILMA 4AFFA 5LOQA 2DO4A 1XMOJ 4OX7A 3IFEA 2W2PP 1NK8A 2BE7D 1JKHA 1XTZA 2HS4A 5AE1A 4MYUA 4UOHA 1T05A 3QFHA 3JAMY 3IR6B 3PJXA 1Q86T 4C8ZA 2EFVA 4L76A 1WG4A 4I2PA 2OPQB 4GC6A 4M5KA 2V5HG 4K5RA 2VG5B 4DN0A 2JOQA 4NZ7A 1QTNB 1SKWA 3FFIB 2B4UA 4X4VA 1FXDA 2XLJA 4ZVRB 2XS7A 3DRRB 3LGNA 1ZETA 1PO6A 1IKYA 4OI4A 4CRJA 2CQ1A 3KHRA 2BYCA 1RU1A 3F56A 4ZVFA 4C3KA 4YP3A 2YWFA 3NEKA 3TJAA 1PBUA 4OZ0A 1HW8A 2ATLA 4OL8A 2RHQB 4EFAC 2I5JB 2JL9A 2ZOGA 3W62A 1U1PA 4MFBA 4UF4A 1VLOA 5FLXU 1H7XA 3JTPA 3R6LB 1T94A 3A8JA 1FD8A 3IAS9 5FJ4A 2FLOA 4O4GB 3FSYA 5L8RC 1YLXA 4DX8H 5D4PA 2I38A 4JI6J 1WACA 3TW0A 5K8MA 2C28A 1MNEA 4DQPA 2NR0A 3W8PA 4E0DA 1U6ZA 1QY7A 3PFOA 1NK5A 4GO7X 2RE1A 1WC1A 2CPEA 5ITHA 2MKYA 4ZVOB 4F4YA 1Y00A 2BANB 1T0TV 3BEGB 4F3OA 4ETZA 4OV1A 3AFGA 4MMOA 3EYZA 1S6QB 1DBDA 2G2YA 1PILA 3UCUP 2V34A 4CO5A 2FVCA 5I3UB 1MMNA 4PWDA 4J90A 1F60B 4P52A 3HJFA 3DGPA 4V19X 3ILOA 4ZP8A 2JWNA 3OHAA 4D3GA 3MCOA 2KXHA 2B8PA 2XMWA 3QGGA 3G2XA 1JLQA 1NDCA 3CCJS 3NXZA 4J9NA 3IN5A 4ZHRA 1JLGB 1HR0J 4FZVA 4ZK7M 1Q5VA 4PG7A 3D67A 2ASYA 3DYAB 4EK2A 1FJGJ 3MAAB 3Q2SC 4FVCA 2KM8B 3MUMP 3B78A 3UQSA 3CIMA 1UZHA 1CSJA 5CCLA 5IT0A 5HN0A 1JX4A 2W01A 2R9LA 1FWLA 5HMWA 3SCLE 3DLBA 1RA7A 1Y5NB 1SQEA 1EAYC 4PKDB 2QSFA 4HDHA 1NDKA 2R8HA 4IOBA 4KGXB 1T11A 2JHEA 3NBPA 2YKNA 2IAJA 3ENVA 5T7LA 3PX0A 4B3RF 1CG2A 2FZCB 3HKWA 3CCSS 2KFNA 4OYWA 5I42A 1X9SA 1V3ZA 3EICA 1Y4ZB 4USUA 1EIYB 5AE2A 4NCGB 2ZUAA 3QPIA 3NCPA 1U45A 5IT9U 2E1PA 1IBMJ 4LF8J 2QO3A 1QLNA 1S6PB 1WDDA 4I1TA 1CEZA 4UT4A 1NDPA 3SDEA 3KG4A 2V9KA 4PG4A 3HZEA 3IR7B 1RYSA 4FNIA 2QA4S 4J91A 2G1DA 2OSQA 1DQ8A 2CQPA 4JYAF 4P7TA 1U2CA 1S10A 2V2KA 4CO2A 3JTOA 3NNAA 3OTOJ 3IRWP 4ECTA 3Q2TC 2R8GA 4R5PA 3GJRB 2DPJA 1OY9A 5BR8J 3T1HF 4X64J 2RSQA 1K1SA 1TKTA 1TVRB 3L7PA 3QMQA 4USHA 3I0SA 1WF0A 4K4YA 3O3LA 1FRMA 1RWKB 1TL3B 2OFHX 2D9OA 4NPOA 1H72C 4YB6A 1RT4B 4O3QA 5IXUA 2FVQA 3NAHA 4V1Ak 5J2PB 1IBLJ 2QT7A 2G0IA 4U8VA 1MSWD 4CTAB 3Q83A 3RTVA 5HQ8A 4B3MJ 1S0MA 1KLMB 5IOLA 5L1JA 1IJEB 1DQ9A 4L74A 3M7VA 4GKKJ 2RU3A 1RZMA 1PYOB 5AE3A 4WTOB 1RT2B 3QWUA 2N3LA 4DV6J 1BC6A 1UPPA 3VR1A 3J7Z5 3G8SA 3MURP 4DL2A 1PCAA 4LRBA 4LVNP 1LWFB 3CJ2A 4IG0B 3NLCA 4KH1B 1TUGB 1I6JA 3QYYA 2IBKA 2DGUA 3BREA 5DS7A 2ZH2A 4N77A 2W7AA 3BGLA 3CC4S 4MIWA 1XC9A 2BJEA 5EWGA 3KUGA 1NJWA 2DR5A 5FIIA 1F9FA 1HWLA 1Y7PA 2FD2A 3QJPA 1WC4A 4WK3A 5JVGQ 1YQHA 2HRTA 1TP7A 1Z1ZA 2RIJA 3W2VA 1S6UA 2R7RA 3T6BA 3PRVA 2PT0A 1BQNA 2AEJA 2HBRB 4FF1A 1HI8A 3TZZA 1T9UA 4H4KC 2Z4PA 3MMAA 2BOAA 2F4FA 2KZMA 3FGVA 1N5VA 4LMZA 2E1AA 4ECVA 1GMWA 3KWMA 1YK9A 2GX8A 5HAOA 3M2UB 5KG0A 2BJ1A 5C5JA 5E3AA 3SXLA 3O1LA 1LV5A 4LSLA 1DTQA 3DHXA 2NPIA 4NLOA 2LEPA 3LANA 3VWSA 2FHJD 3POTB 1GQEA 2RVJA 3KNAA 3T41A 5HMYA 3U1MA 3H5YA 1MU2B 2ZVIA 2MZQA 1S1WA 2W8LA 3KLHA 1N36J 5A8RB 1CS4A 3V5RA 2LEAA 1FRXA 2KI2A 3SV3A 2B9XA 2R7VA 2E44A 3UO0A 4MJKA 1FX2A 2ZH9A 2R2TA 2AMCB 4NZ6A 4ZJQA 1RAGB 3MR2A 1R0CB 3EZOA 2A10A 2M7SA 5DETA 5G0RB 1VFJA 4LF6J 4H4KA 2ACMA 2RT3A 4KT0C 4ILRA 4K2XA 4XDCA 2CZ4A 3M9MB 1GX5A 5DQHA 2X7IA 2WONA 3M1VA 4NRTA 2DNQA 4C8YA 1RTHB 5B0BA 3M9OB 4USJC 3NG8A 1X0PA 1TAUA 4LF1A 2SXLA 3OR1A 4HYKA 4JI1F 3GJSB 5DG7A 1TL7A 3ZNJ1 1B0PA 3ZZOA 2D41A 3O44A 2V2VA 4X66F 2PEHA 3M2RA 3V6KA 1YVFA 1PBAA 3HVTA 1YJNS 2V8DA 3D9BA 3Q8QB 2FVSA 2XY7A 1SQGA 1VK3A 4CLUA 1R8HA 3GWCA 2H3EB 2PEBA 1IM6A 4MKVA 1AUSL 2ZOMA 5DQIA 3PTWA 4J9QA 3C2PA 3KG0A 5C7PA 2FGOA 1MN7A 4A4JA 4DSEA 2HK2A 1U1NA 4DF4A 1KHWA 1RAOA 3BPSP 2UV8A 2NYHA 2BRLA 3M6VA 1XR5A 1HBMA 2V4RA 2YQ3A 4FXWA 1S9GA 4JI0J 1RT7A 4CM2A 3W9HA 4DF8A 3CT9A 3VAHA 3DU6A 1WC0A 3D5MA 1R31A 4I7FB 1X4DA 3LP2B 3H20A 2HK3A 3HCXA 1H7WA 2XM3A 1X4AA 2GJIA 4N8NA 3SIPB 2ZHOA 1R27B 4HI2A 3MR6A 2N7YA 4RWXA 1LWXA 3HHKA 1KN6A 4IFYA 1VJQA 4JV0A 1BMQB 2VDIA 4QPTA 3FJ2A 1VQ7S 3OTCA 3D6TB 1N32F 4DUTA 5C2GA 5IQQA 4X4NA 1BHNA 4OLOA 3HHLB 1HNWF 1NAQA 2UVVA 4KPYA 1RTIA 2H1YA 5JUMA 4DSJA 1XEZA 4Q8FA 2DPIA 2R2UA 2MKJA 1VRUB 3HD1A 1S76D 1S6OA 4X2BA 2OPQA 4RW4B 5EWFA 3PDNA 1Q81T 2VG5A 1HNXF 4F26A 3FZ2A 2Y1RI 1UWAA 1UPMB 3D0HE 1GT8A 4NXMF 1VS3A 3MMCB 3C6UB 3FZBA 1EKSA 1E6YB 7FDRA 4YR3A 1PJ5A 3DRRA 4DV4J 1N34F 2BW7A 3OXLA 3SQGB 4ZPTR 2J0QD 3BV8A 1OQ3A 4C8OA 4DDFA 3Q8SB 3EX7B 3C16A 2MLXA 3FEYB 3ENQA 1NHVA 3MGJA 1CC7A 2KT3A 2NXJA 2V8GA 1TKZA 3GYGA 1WHVA 4WXOA 2GNKA 2CNLB 2V8VA 1SC6A 1B4SA 4O4GA 3JB9k 1TUWA 2D74B 1SJ4P 3GONA 1YIJS 5D0EA 2KM8C 3P6YC 3DOMB 5IWAF 1HHTP 2ZM6J 4EBDA 4DV2J 3AHPA 3MPWA 4U96A 1HPZA 2U2FA 5DM6Q 2UUAF 3GG0A 4B9TA 5D0GA 1RJJA 2FJWA 2RQMA 5DG9A 1X4GA 4ID8A 2CXEA 2EK1A 4DQRA 2L9DA 2ASDA 3VF0B 2O67A 4Y0FA 5CYQB 2CPDA 3H42A 4DR7J 1S0VA 3MMBB 5I3PA 2CQBA 4KHPJ 2VFVA 1MG7A 2O3DA 4CH0S 4JI5J 3C6TB 3K57A 1YKWA 3LW5C 3DMJA 2HQCA 2RF2B 2H4WB 4GKJF 3MEDA 1OWXA 2M52A 1X4FA 4TXSA 1H73A 3DXBA 2D3O1 4AD6A 3QIPA 2XS5A 2ZH4A 2YX1A 3EE3A 2AZ3A 2BQ3A 1ROFA 3DYAA 3J7AN 1H2UX 2WVFA 3MAAA 2XSJB 1MW7A 3FMWA 1M0SA 1YX2A 3DLEA 2RKIB 1R6YA 4ZN1A 2GVZB 3EGNA 2ZJQQ 3V81B 2MHNA 2W2MP 2VF3A 2P8IA 4TY9A 1IBCB 1S1VB 2YWEA 2OH2A 3SMZA 3H2VE 4BC9A 3U1NA 4NCGA 2XCPA 3PYGA 1UVIA 1YRTA 4DZ6A 4X4PA 2IA6A 3CDAA 1OM2A 2GV1A 1S6PA 3UVJA 4WP8A 5KFUA 2OPPB 3V6JA 1EB0A 3AB4B 5K9FA 3KLFB 2A2DA 3VAFA 3OD2A 4CZCA 4CQ1A 4K4VA 3AH6A 1CQMA 1RE1B 4UQGA 1SL0A 5A2QU 1URRA 2RDJA 1QVGR 4WBFA 2R7SA 3E8OA 4MK7A 2MQMA 3BJYA 3MWBA 3NGDA 4R8UA 3KK1B 2EFQA 4EMDA 3K5NA 1Q7LB 4KRWA 4FYYB 5JMNA 3ELHA 3ZZUA 4A8SA 3H2UB 4OI3A 1YSJA 5M2RA 2M8HA 5E3QA 1VQKS 1VCTA 1IN0A 2DNZA 1HBUA 1Y0HA 4JUZA 3PX6A 2HFSA 2NQPA 1RAFB 3GIIA 2B43A 3H7HB 4M63A 1IQZA 2VPWB 2E5HA 4ECQA 1OSCA 5J2PA 4ECWA 4USVA 3MTKA 4F0HA 4CTAA 4BS2A 4A8MP 1WWHA 1KLMA 3H25A 2C2ZB 4OHZA 3FKBA 4U7UK 1N48A 1TZ0A 1SBRA 4BCAA 2QGFB 4HH0A 4Y2IA 3NGRA 5D6GA 3EPGA 4M95A 2Y8WA 1YJUA 3CCLS 1R43A 2HW3A 2DGTA 3BKFA 2DCLA 1LWFA 3QGIA 4IG0A 4X4UA 4C8NA 3AJ1A 2DR8A 3WIUA 4OZ2A 3PHEA 3TWZA 4X62F 2E1MC 4ED0A 3KJNB 3W65A 2FJEB 4K59A 4B08A 5J2MB 4C8KA 5B0EA 4NA1A 5A8KB 5KFOA 3H4BA 3T5LA 1JLAB 3OFGA 4I4BA 4CLFA 2CPHA 3QT5A 5KFJA 1UAWA 4OI2A 1RUSA 3MEEB 4ZLPA 3MTJA 3UW1A 1R0BG 1WC3A 2Y1IA 2XLKA 5AXMA 3LQVA 1RXOB 5BYRA 1UP1A 1WC6A 2YX4A 1N8RT 2HIQA 2V2QA 1S57A 2MZTA 1RHMB 2OUGA 1NRKA 2J9DE 2XG8A 1WKJA 2BJ8A 3V6DB 3CDBA 5CYMB 3I55S 1OSDA 1VQYA 4LQ9A 1YITS 4P7VA 1MWYA 2FQQB 3QSYB 1L3VA 4OX6A 1SV5B 2CPYA 3M2UA 4CLPA 1PJ7A 3DHWC 4ZITA 2D68A 2RRNA 3CC7S 3A1YG 2VH7A 2ZUGA 1GTEA 1KQSR 3PFEA 1J27A 4OZLA 1HWKA 2Z2ZA 4U7UD 2CDRB 4OQJA 3PG9A 4J37A 1BQMB 5CABA 3HHEA 3JS9A 4FXDA 2NZ4A 3LP1A 3Q8UA 3FSXA 1PC5A 2F8EX 3NGSA 1RTDB 4M5MA 1S1XB 4IFVB 3AWRA 1RTJB 6AT1B 3QT8A 2Q3PA 1EP4A 4W4MA 3I82A 2MZSA 1VQLS 2ZBPA 4K0KF 3ILLA 3IRXA 2C2OB 1HD0A 3UWTA 3H8YA 3L4BC 3R7SB 3LUYA 1N33F 2F1FA 4KIAA 2AU0A 1RTHA 1FNOA 1UVKA 5D8HB 3OVAA 4OHXA 3X3UA 1EETB 1S5ZA 5F3TA 2GCFA 5ADZA 5KFRA 4YR2A 4DR5J 3KK3B 3EZ5A 4YS2A 3PACA 2CJBA 1ZAWA 4GMKA 3QSIA 2ADBA 1RAEB 3R8YA 2GO8A 3TVYA 3RAMA 3EDRB 4LF4F 4WE1B 2GIRA 4KGZB 1ZAXA 2HZCA 2XY6A 4K4SA 1CLFA 2VQFF 1SH0A 4A8WA 2DD8S 2CJYB 2UV8G 2HBQB 3A4TA 2M2BA 3BBBA 1SI9A 4CWBA 3T3FA 4YB1P 1HNZF 2MY8A 3EXYA 2N4CA 2ALZA 4QPXA 2OEKA 4TVAB 2HS0A 4LVOP 4KKOB 1NHUA 3I0RA 3UI3A 3AJ2A 4I7FA 1LXNA 2AYGA 5AT1B 3LP2A 3CCQS 2L9NA 2QFIA 4QWEA 4DL7A 4YDDB 1NM2A 5ETLA 1YJWS 2P2CB 4DSIA 3NL0A 4RNFA 1IKVA 4P6QA 3TVZA 1MN9A 1F5AA 2PSZA 4A8FA 1Y3JA 1K73T 1JB0C 1FDNA 4JI6F 3I32A 2X3DA 2DEJA 4FKXA 4X84A 3WQPA 1C0TB 4ID5B 4K7QA 3W64A 5HQMA 1ZM2A 2CVIA 1XNQF 1MMLA 3GILA 2PE8A 3Q0AA 3DCAA 4O23A 3QBCA 3O2IA 1EJ7L 3A13A 1FA0A 1SPBP 1GTHA 4PG5A 3A12A 3BO3A 5ETRA 1VRUA 3TI0A 4RW4A 2MPUA 4QU6A 3UN5A 3W63A 3PO5A 5FD1A 2LDYA 5KG4A 3MMCA 2DNKA 3N5FA 1JLFB 1E6YA 5AJ3J 4YB5A 3P96A 3CF5Q 1Q82T 4MYTA 1WTBA 4DL4A 3SQGA 1BLUA 3R5DA 1CJKA 4OZNA 5DJBA 2B4VA 1VI7A 1HR0F 5H1SV 4ES2A 1RI7A 1RCOB 5RUBA 1FJGF 4Y3CA 3KMQA 5F9NA 2CQGA 1S48A 3SZ2A 1FRLA 4DPOA 2PGCA 1RT5A 3RBXA 3KOAA 4OJ3A 3T9ZA 1KONA 2VBXA 1F3VA 4LUBA 3ETOA 1JLCA 5C24B 4NA2A 1N88A 2IFXA 1TKXB 1NEEA 2XTDA 5B0GA 3R7BB 3DOMA 2V2ZA 4ERDA 2IVMA 2AIRB 4B3RJ 3QGHA 4KH0B 4XPEA 4B9MA 3Q24A 4FYVB 4MAKA 1IBMF 4FNHA 3TUPA 4NRUA 1F6TA 2VG6B 3PJ9A 2JJ4D 2VFTA 4ZPAA 2B7CB 5C25B 5CYQA 1BY9A 1VGYA 3VAGA 3PW4A 5JVHQ 3V4MA 3JSBA 2A2CA 3Q8PB 3MCMA 5CZVA 4JYAJ 2KFZA 3QT7A 2RF2A 4CLYA 4KGMA 2XHCA 3HFZB 2J7WA 1QVFR 3KJFB 3FC9A 4DQQA 1QE1B 1RT3B 1RK8A 4NI2B 1Q53A 4DHVA 2GJFA 2KDOA 2QLXA 1XIQA 2BA9A 1MWQA 4J7CA 2BBEA 3R5JB 3DLKB 4ILLA 1ELOA 3R5CA 3DXSX 4DR3J 2YKAA 3TZYA 1HW9A 1NSPA 2R42A 1HIYA 3V81A 4LRDA 2IMWP 1AW0A 1SL1A 4NXNF 3RB0A 1CVJA 2MKIA 2KT5A 3UD4P 2J6SA 2EKYA 3ULHA 2UXCF 2AT1B 3OL6A 2B51A 5IZHA 2DHHA 2ATCB 3SCKE 3TO8A 2EWHA 3DLHA 4IRCA 4PEOA 1FNXH 1LW0A 2I2YA 4F36A 1LXJA 4P2SA 1FRKA 3GIMA 4ED7A 3TJ8A 4F3MA 3OR2A 1TAQA 1Q8KA 2OKQA 3H5XA 1ZTWA 3KLFA 4RW6B 4IQXA 1KP6A 4CT9A 3M8RA 5A6WA 6FD1A 5JJBA 4QW8A 3MR7A 2DXEA 2QLWA 2DTJA 1QAJA 2Z30B 2VJVA 2DYAA 3DDKA 1KBRA 3VV2B 4CDIA 3PYDA 3CSKA 2J6TA 1GXLA 4AL6A 2B6AB 8AT1B 3PRBA 1XJWB 5HBMB 2Y1JA 4ANDA 3G6ES 1YJ9S 3AXMA 2JVRA 2DGQA 2GMLA 4LBPA 4CIOA 2JEIA 3CJQA 2AJ1A 3B54A 1HQ2A 2ZJPQ 1WDTA 3A8KA 1D8ZA 4C0HA 2UUCJ 4ATNA 2F8HA 5KFWA 1VLYA 3M6WA 4ZIVA 2WHOA 2CQHA 4RO0A 3FK4A 3J81Y 3UN3A 2V4JB 4GO5X 3QNWB 2PMWA 5F3ZA 4ZOSA 4QYRA 2KO1A 1GX6A 5ETMA 1U1LA 2QX0A 2V67A 4ECZA 1T3NA 1VBZA 3HXMA 3W2WB 2YXLA 2C3UA 3TZXA 4Y2AA 4EBEA 4RWWA 3PHTA 3NGTA 2WB4A 1JLEA 4G6VB 2CWXA 2IYIA 2DGSA 4OX9F 2VJUA 3KKFA 3TOQA 4F04B 4NZ0A 3GSDA 3H0PA 2MZ1A 2DHAA 4WF9Q 4LRCA 5D4OA 5DDRC 4M8LA 3PEJA 4LF6F 1RBAA 2QA2A 3A3OB 4O3SA 2VA3A 3JQJA 3BBFA 2CRLA 1GXTA 3L3CA 4PXDA 3MEEA 3LWLA 5HO4A 2HNDB 1Q1KA 1NPKA 1WHXA 3UDEA 5A8WA 2RB7A 6FDRA 3QWPA 3KFWX 2PN6A 5IM0A 3UE2A 1FCAA 4ZPVR 2BJ3A 1FK9B 1AA1B 3VAMA 5DRKA 2Y8YA 4Y28C 2ZH6A 3ILIA 5CYMA 4DV5J 1P9QC 3CJTA 3DRPB 4WYWA 2GMJA 4X66J 2J76E 1SV5A 2ASLA 1S9FA 2V9WA 3NOCA 2GZOA 5D3GB 3GCXP 4YEAA 4LFCF 1B0VA 4Q8EA 1LNQA 2VC1A 2KRBA 1TV6B 1Z4UA 2KG0A 1EHWA 4RNOA 1TFYA 2VPXB 4DR1J 1WKKA 1KTQA 1YBTA 1RABB 3V4IA 3TRGA 4DPUA 4JI0F 1RTDA 4CCHA 1IVZA 3HO1A 4WU3A 1D1UA 1HQUB 1S1XA 4IFVA 1RTJA 3GFYA 3TEHB 1OMSA 3BR8A 4WFBQ 2CJQA 5EN1A 1HA1A 3I56S 4QIVA 1VK8A 2RS2A 4J9SA 4ED3A 2IC3B 4EZ6A 3ICLA 1SQFA 2EEYA 4P2XA 1TL4A 5KT7A 3H40A 1U48A 3MM9A 5L46A 3U7JA 1BE4A 1GH8A 1WOPA 3LPYA 4AYBD 2VONA 1SUQB 4F8RA 3MR3A 4J5OA 2VPYB 4B3OB 1T9TA 1NJXA 4U9RA 1M5HA 2CNKB 1HBNB 4J9RA 3MPVA 3KK3A 1L3TA 1W2BR 4NWBA 1TMJA 5KG5A 4ZVPB 1JQGA 1UJ5A 1O8BA 4CH7A 1HNWJ 2Y0BB 4WE1A 4AL5A 5LSLA 2FJDB 1N5YB 3VGVA 5H9FJ 2QL7B 3RRGA 1HNIA 1F1BB 3P4UB 2ADCA 1ZYQA 1X4EA 2L48A 2WAQD 4DX7A 2GA7A 4L73A 1FFSB 1HNXJ 1S4EA 2UUWA 2RJZA 1QDUB 1QTMA 1DFDA 3THVA 2OI2A 5KOWA 3J81j 4DV4F 2IMOA 3FUYA 4NL5A 1YHQS 3M9NB 1N34J 5DLFA 2HG4A 3F73A 4XIUA 2LXFA 1ZTTA 5HP1B 3G6YA 3OUYB 3JQKA 5B08A 5ETQA 1DQAA 4Y00A 2AX1A 1HMVB 3OVSA 2MB0B 3SV4A 3ZXWA 2WSEC 4M5JA 3S1TA 1WTFA 3QZ8A 4TU9A 1RKIA 4TYAA 1O6XA 1N6QA 4ZDNA 1C0TA 3K59A 4DJBA 5IWAJ 2LU1A 2LVWA 4XK8C 3T5KA 4HHHA 4ZVEA 1SJFA 3OFEA 1AXQA 3R2CJ 2J9CA 1T9WA 2IVYA 4JI2J 2QMWA 2LA4A 3GYXB 3EGVA 2MZRA 4Y2KA 3EJMA 4USMA 3JSRA 1TELA 4ICLB 4G65A 4OYAA 5K8OA 4DR7F 3B4DA 4FDFA 1FFGB 3NKYA 2VV5A 4KHPF 3GR1A 2WRMA 4B9SA 1ZPVA 5GMEA 1JLFA 1M5PC 4FYXB 1QUPA 3CCVS 1CPZA 2V1TA 2EG2A 3SYZA 2NXNA 4X4TA 5BXIA 5BYQA 3VGTA 1U2RA 3CD0A 1Q95G 1YG0A 2E66A 4LR7A 2HHSA 5AXLA 5J2NB 4NLUA 2ACYA 3I5CA 4ECRA 4DBQA 3IWXA 2XZTB 3W8GA 5KFBA 2BE2B 2LDIA 3GR0A 1TKXA 2F8MA 2HNYA 4U95A 4KSEB 2HQGA 4E98A 4IR9A 5DO2A 2H5IB 3PEHA 1HI1A 4OYMA 3DM2A 1A9NB 5L9XA 4WIIA 1HD1A 4HHJA 4RPFA 2L41A 3QJJA 3BYPA 3M2VB 2DHXA 2GS8A 3ISND 2HEKA 3EGWB 3N6MA 3BGFA 2QIFA 3PY8A 4WKRA 1JXLA 3K5PA 1B0TA 3DGVA 9ATCB 3R1LA 2HSEB 2CJ9A 4C3MA 1LW2B 1FRJA 4YHHF 2DH8A 1NJIT 2VFUA 3ZZZA 1SKSA 3QLHB 1M5OC 1VQ4S 1H2TZ 1IBKJ 1A6LA 1X0FA 3BGUA 4PQUB 3FCHA 2ABYA 4UY85 1GMWD 3EVOA 5KFFA 5D77A 5F9LA 1IR1A 1ZH5A 3D3BJ 1BQXA 3FQLA 4I69A 3F44A 1QE1A 2KVQE 4NI2A 3G71S 2HHVA 4NEZA 2XLIA 4YR0A 1SKUB 5EX0A 4AUKA 1S59A 3DLKA 1L3SA 2OFGX 5K8NA 3HT0A 3NMRA 3LP0B 4TN2A 1Q8LA 3ET6A 4N41A 2B3TB 4RKUC 3OXGA 5HL7Q 1OIAA 2BACA 5CYJA 4Y6IA 2MQQA 5A0YB 1RHUB 2UXDJ 3R3TA 2K3IA 3LA0A 4NE9C 3DOKA 2YX7A 2N4DA 4QJVA 1G1XA 3PNIA 4OJGA 4KFBB 1HNVB 4CLSA 4KYZA 2CJAA 3S6EA 4OZ1A 4B17A 1TKDA 2NYIA 1RWXB 1JIHA 4IQMA 1WOOA 4NYOA 3R1HA 1F2GA 3BKUA 3ITHB 2NXCA 3MM8B 2XNQA 2EBGA 4NA3A 1T95A 3VGSA 1RT6B 2KU7A 2Z8QA 2XMKA 3RBEA 1UEVA 2E5GA 3J7YU 3IBWA 1B70B 4X62J 1GEHA 1KR4A 1HWIA 2UU9J 1YBUA 3LALA 2KYZA 3G9CA 2WW4A 2W4DA 2J6UA 4DWIA 2DNHA 2B6AA 1U1RA 4ECUA 1JJ2R 4PCQA 3GMGA 4A8KA 3ONQA 1REVB 1UKUA 4OZ5A 4WFZA 2YWKA 2B8QA 2UVRA 3HSGA 1OPIA 2J9DA 4A8YA 4ZPBA 1VQPS 2F9JA 5HMZA 2KVIA 2CA9A 3AAWB 1R7IA 3KHGA 4FN5A 4Z7YA 3LWMA 1KNZA 1WNEA 4CLTA 5GMKa 2ZH3A 4OJHA 2HHWA 4QCLA 1OPZA 3IA0A 3WBZA 2OO4A 1WI6A 2WOMB 3W2WA 2UXBF 3LAMA 1IUJA 1VRQC 4O44B 4KB7A 3GFHA 1T9VA 3OT9A 4WPAA 1NJZA 2LU2A 1C4AA 4K4XA 1NKCA 1JNZB 3CJKB 4RUBA 1LKZA 2FIUA 4DS5A 3PM9A 3I96A 4TU8A 2HBZB 1X5TA 2YKPA 3KG1A 2LYVA 2BZ2A 2XTEA 3OXFA 3D1HA 5C2CA 4QU7A 5C42B 4DL0C 1PAUB 3CUNA 4K0KJ 3IWLA 4LSNB 4EWTA 3CWJA 4ZKAA 1S72S 3ZTOA 2HNDA 2CADA 5K20B 4OYOA 4DCPB 2M88A 3BO2A 3PKMA 2CNOB 4DSFA 2B9EA 4IG3B 2XMTA 4NCBA 2R8IA 2FLLA 5AXKA 4RNHA 3HD2A 3UD3P 5L38A 1DLOA 2BX6A 2D9PA 4E8UA 3R6GB 1WEXA 1TL1B 4HVZA 3DRPA 1F9HA 2HZAA 2KG1A 3KLGB 1RSCA 2LXIA 3MM5A 5F8MA 5KT4A 1PC4A 4KTQA 2ZWOA 4K2JA 1TTHB 2JRSA 5EGYA 5D3GA 2EG1A 1LOUA 3QAEA 4RU9A 1S0NA 4RLEA 4LF5F 4LF4J 3Q86A 1TV6A 3AXKA 1H3DA 2HHQA 1HWUA 1U8SA 2AGPA 4KPCA 1SJQA 4DPWA 2VQFJ 3FRZA 2LQ8A 1KEKA 2E29A 2F5GA 3FEXB 3U02A 2A18A 2D3UA 1U49A 4LRAA 4RW7B 3W7BA 2HHPA 2W24A 3K8WA 4WZQA 1R8BA 3G8QA 4YOEA 1F2HA 1HNZJ 2O1PA 3KMSA 4BWMA 5F8LA 1M90T 3MEGB 4MKYA 1HQUA 5GAHU 1RAJA 1S9EB 3U1LA 3TAMB 2AHOB 3L9ZA 2HQFA 3K8VA 1S1UB 2BABA 2XC9A 4X4OA 5DQGA 1AZSA 2IC3A 2HFOA 1HQEA 4IKAA 2N3OA 5I3QA 4K4WA 5GAEI 1FE0A 2R7XA 4UZBA 2HWTA 1PGZA 2I0XA 1T9YA 4L75A 2XZWA 2P9GA 3B4MA 2FY1A 2GIQA 3HFVA 2XHWA 4QW9A 2KTQA 3GPAA 3VGUA 1XMBA 2Y3YA 2DGVA 3DOLB 3M8PA 2NS1B 3QO9B 4CM0A 1HYSB 3BGOP 4U8YA 1JK9B 2J8AA 2J0SD 1L3KA 3ZTSA 4OHVA 3ZTRA 3KK2A 5J1EB 1XNQJ 1PIEA 2DITA 4NLWA 2BQRA 1S1TA 1ULRA 3S8SA 4QIWD 2G4BA 5CA5A 2B0GA 5KG1A 3BKTA 1RWVB 1TR0A 2ZD1B 4CYUB 3BR9A 2A6MA 1RADB 4OYIA 1CJUB 2FHMA 2L08A 5A2QY 5D4LA 1D3WA 3DRYA 1RWPB 4ZPCA 1NPRA 3B82A 2ROGA 1HFEL 2PDAA 2OJ3A 1N54B 5AJ3F 4ZCLA 1VBKA 2OSRA 1N5SA 1UA0A 2IRXA 4YFUA 4WTYA 3HVWA 4MIAA 1YJVA 1DURA 2O01C 2ZZMA 1R89A 4MH8A 5B0DA 5HP1A 5KFDA 2GGPB 4OI1A 4CLKA 3UN2A 2DY9A 2CQ3A 3TP2A 3J7A1 3K7RA 3QFWA 2KKHA 2ZBCA 3M8QB 1Y9OA 4G1QA 3HHNB 2HQIA 1SH3A 1XR7A 2YTCA 1JLBA 3TARA 1T8EA 2YWGA 4JV1A 3IS9A 2LMIA 4LJMA 2I1RA 4F2RA 1X9WA 3EXCX 3HSZA 2MKSA 1S97A 4C0BA 3I5AA 2XO6A 1FJEB 1WF1A 3R9LA 2HHUA 5ETTA 1BWEA 2RAQA 1KOHA 1DTTB 4L3NA 1ZAVA 4IR1A 3EWGA 4ICLA 2AZ1A 4ANEA 3TZWA 3LGHA 5CZXA 5E3PA 2NXUA 2VD3A 1T9XA 3GV8B 2JC1A 3MM6B 4PG6A 1Z2ZA 3CJ8A 3OFFA 1GNKA 3R2DJ 4I0WA 2NZCA 4C8MA 3C46A 1KTVA 2CPXA 4BWJA 2VASA 3WX4A 2LLZA 2MQ8A 4N56A 2I8EA 3QGPA 1KQGB 5J2NA 3OJUA 4QR1A 1H74A 1IKXB 2CUYA 2CVEA 5D78A 4DR3F 2LP4A 2MGZA 2F7VA 3GYNA 1LWEA 3C14A 2HFUA 4ANCA 1UVMA 4PRFA 4I2QA 1X31C 1T05B 2QN6B 3IXQA 1UFWA 2VUGA 2JH3A 2QSWA 2BJ7A 2F4VJ 1VQOS 2EBEA 3AODA 4I2PB 2FJAB 3AD7C 1YZ6A 4NXNJ 4ZS6A 1UFLA 3B6BA 2BKPA 1KRPA 2UXCJ 2ZH5A 2IJFA 3NWGA 4ED6A 4QIFA 2RUSA 2UUBF 4ZVQB 2HS3A 3M2VA 3MUVP 1TL5A 1IKYB 2E5JA 3UDVA 3HT3A 4OI0A 5LJ5Y 2VA2A 1B7YB 4DV3F 2RRAA 1T02A 2ZJRQ 3CD7A 3ZZRA 2ROPA 2MKKA 1RA6A 3R5GA 1LW2A 2AQ4A 1RU2A 1P8GA 2E1CA 3RBZA 1S0OA 5ETSA 2HWHA 4PAAA 4JI7F 3THPA 4DR6F 3D6MB 1Y11A 2YY3A 2FZGB 4ZVUB 2UVUA 4QZVB 1ZM3A 2YNGA 4X65J 2ZE2A 2ZFHA 2AP6A 5F8IA 4IDKB 1FTCA 1Y3KA 2W2QP 4P74A 1U1QA 3DI6A 3MECB 2UUCF 5HJYA 1W26A 3LP0A 3G86A 4LR9A 3MXHP 1YRUA 2VPZB 3E01A 3DFEA 4J9LA 3SSQA 4EO8A 2UUTA 2IBOA 4QWBA 5A0YA 1FWKA 2BKOA 2QEXS 2B9YA 2K3KA 4OJ1A 4B3SF 1Q7YT 3CB4A 4OMFG 3S7RA 4DFMA 3F0NA 1CJTA 4UUWA 4J9PA 5GAGI 4KGVB 4KFBA 4DFJA 1FF2A 2FZKB 4ZLNA 2KXFA 3TAPA 2VICA 4W90B 2DEIA 3CJ4A 3J80Y 3ITHA 2FHKA 2ZC4A 1V6HA 3MM8A 3DRSA 2OEJA 3RBDA 2D7SA 4Q2MA 4IOAQ 1OO0B 3KLIA 4FYWB 5KG6A 1RT6A 2MDAA 4O0NA 3CTRA 4OX9J 3K0JA 2E5LF 2X1GA 4F4AA 4ZLLA 2W4CA 4ELUA 1X4HA 3OJSA 3OTEA 1LWCA 2GVDB 1B64A 2HKEA 3P8BB 3W60A 1YJRA 3D3CJ 2AF6A 1JWWA 1YRXA 5L1KA 2YKNB 2VDHA 2CKWA 1SC4B 3GZ7A 4HHUA 2MMYA 1GXUA 1UL3A 5HMXA 1IM4A 2QFJA 4HDGA 1EZZB 3BB5A 1M5KC 1VISA 1SCJB 2DNYA 3HULA 4DV5F 5IV3A 1AROP 2PO4A 2VL1A 1FKPB 2UP1A 5HSPA 3F41A 1RWMB 5J2QB 2POKA 3SDEB 1Z2LA 3DC2A 4Z7CA 3A3PB 3DLLQ 4B9UA 4DQIA 1LFWA 4Q43A 4GVBA 2IRYA 3TVKA 1U1KA 2WVEA 4LFCJ 4I56A 3IMQJ 3CIZA 2IHR1 3E2EA 2F9DA 3PKYA 2DNMA 2CNNB 4DR1F 3I5BA 4FPRA 1LK7A 3T9NA 3PW7A 3P49B 2WOMA 4JB8B 2YBVA 2JDJA 4G1IA 3LGMA 2A1BA 1R0AB 1VQ5S 1PAEX 3I0SB 3CJKA 1ITPA 3I4PA 5M2UA 3TA1A 2CJXB 4LFAJ 5HQLA 1NO8A 1QAXA 1CBKA 4K5SA 2YWHA 2Y9HA 1NUEA 5KOXA 3RAQA 1DAXA 1C0UA 2C2MB 2G0JA 1B3TA 1UA1A 3V2UC 4PXBA 4USIA 3ZTPA 3G6VA 4M5LA 5CD4A 4ES1A 3HLUA 3Q22A 3CJ0A 5I4MA 4CLLA 1YTYA 2PI4A 2DR7A 2C3YA 3EGZA 2MSSA 1U0HB 4XPCA 2WBMA 5KFKA 2QMXA 3KLEA 1FKOB 2LQBA 2OMLA 5E3CA 2HHTA 4K4ZA 2VBZA 1TL1A 1WHYA 2W9BB 2HGNA 4CI0B 3DKDA 3KLGA 3GQCA 1P27B 3BPDA 2X3GA 3HSDA 2AYMA 2FJVA 5K8PA 5DM7Q 3VQTA 2NUUG 3EZUA 3FEZA 3CDUA 2Z58B 4KC5A 3M30B 2EFGA 1M1HA 1NZAA 4ZJOA 3BF4A 1RHRB 2CZVC 1UMJA 4WXWA 4RW7A 4B3TJ 1BQNB 3W9JA 1F5CA 4DLGA 2J8SA 5HROB 3FFIA 4ED4A 3MF5A 2DNGA 3MEGA 1HBOB 3PRDA 4LIWA 4USWA 1U6BA 3DNCA 1S9EA 3NAIA 4MT1A 3TAMA 3KJQB 4MKAA 3AOBA 1UW4A 1WF2A 2MQPA 3CPWR 1NJYA 1O0PA 2MQLA 4P71A 2NSBA 1M5VC 2YQ1A 4BDPA 1GMVA 3M32B 3KJVB 2I5JA 5KFVA 1NSQA 4LFBF 5LT5A 3MOJB 3H2LA 2DHGA 1OS5A 4WZMA 2C2RA 3ZC4A 3CE8A 3KLHB 4HTIA 3DOLA 2DBBA 3LO3A 1DARA 3TANA 2HQ3A 1FRIA 4ETXA 3GV7B 4JI2F 3GCWP 2DO0A 4DV7F 1ICEB 3SSRA 2VIHA 4ED8A 2QZ8A 4M94A 3PW0A 1YI2S 4ER8A 2BANA 3V6HA 2IM0A 3UCZP 4DEZA 1NZ8A 2UVWA 5CH7B 3RU0A 1S6QA 4OYXA 4CYUA 4M5DB 3ETMA 2QMUB 2YKMB 5I3UA 4P9SA 5KAKA 4CP5A 3W61A 3GB0A 1OYEA 2DNNA 1CULB 5E5NA 4QQBA 5IQ6A 1NK9A 1PKUA 3N4WA 2HYIB 2COLA 1NMEB 4QBUA 2A0FB 1TU0B 1EARA 3VALA 5F8NA 2DGOA 1VMBA 3CD5A 1APSA 1JLGA 1K1QA 1KFSA 2WB1D 4L6V3 4DUZJ 2ZDPA 4UOCA 2QL9B 2FVRA 2HVHA 3M8QA 4U67Q 3KHLA 1WEZA 1URNA 2IIHA 2BM1A 2VQEF 4F0KA 3VQSA 4GC7A 4Z37A 3L95X 4OZJA 1JXEA 2GHVC 4KV8B 1BGXT 2XQCA 2MLYA 2V8PA 1S9GB 4CLZA 5LSOA 5LJ3Y 3TQ1A 1ACMB 3AB2B 4CO1A 4BC7A 3LOUA 4QYZK 4R25A 2X1AA 2BDPA 5LMNF 1VIXA 1VOMA 3D1OA 4WYLA 3E51A 2RDDA 4NLVA 1DTTA 1RISA 3VHQA 1X8DA 3KNGA 2GAGC 4E2FB 2V68A 4W92B 4NLPA 4ZVTB 3HMJG 4IOCQ 2BJ9A 2QL5B 1W25A 1I94F 2XY5A 1U26A 1YBAA 4WKYA 1WELA 4QWDA 4YHHJ 3PCOB 1IBKF 1QM9A 3QQCD 1JJ4A 1V5VA 1ZBTA 4F4ZA 4RBTA 3FDSA 2BMBA 2XMJA 3KUEA 2B7BB 4FVMA 2ZWPA 3CD6S 2MKCA 1QUVA 2QE5A 2YNIB 3B8HA 3CO9A 5CD4H 1TVRA 4ELTA 4MK9A 3NS6A 3J81U 2JC0A 1IKXA 2VODA 4C3LA 1G7CB 4C4WA 2AW0A 4PZVA 1TL3A 3US5A 1RTIB 3IG1B 4F50A 1FNMA 3C3LA 1RT4A 3N6NA 1Q8IA 4YY3F 2PIIA 5K14B 4DR4J 4KAIA 2UXDF 2QA1A 4AL7A 4C0OC 2D69A 2FDNA 4V19J 2FB0A 2Y1LB 4PWWA 3M8ZA 2JNJA 2PFFB 3NWRA 3C8YA 1GMUA 1OQ6A 3GV5B 2HMIB 2QYCA 5H9EJ 2WW8A 4WP9A 1SIZA 2EK6A 2P9CA 3LH2S 1RT2A 5LXRA 2RMLA 4FXVA 3C16B 3N28A 2EFNA 1A7GE 2YNHB 1I5OB 1U1OA 2C3OA 2GIFA 1TKZB 1SVDA 4C97A 3H59A 2Q43A 5GADI 4EBCA 2QLBB 5KFCA 3R5BA 2PD1A 2UU9F 2FJBB 3MD1A 1RAIB 4CNYA 3FBFA 2Y0SD 2KFYA 1IKWB 2IDEA 2P9EA 1RYRA 4L3KA 2G13A 1HPZB 3OW2R 2AJ2A 1FD2A 2BRKA 1AFJA 4IDKA 4I64A 2DGXA 3I6PA 1Y5IB 4HKQA 3O6QA 3MECA 2K7KA 2GC8A 3PXGa 2LECA 4H4OB 2FYXA 4JBCA 2BOPA 2VG7B 2MZJA 3BSOA 3R27A 3W3SA 2HHXA 5KFAA 4O3OA 3J7YI 1SC1B 5ETKA 4LF9J 2NPFA 1K9MT 2RQKA 4M5GA 4S0MA 4DS4A 3BN4A 2QG9B 2HNZB 1X5PA 1XQIA 5HVGA 3N0VA 3SFGA 2XMVA 2XO7A 2CPJA 4DL3A 1IWGA 3POTA 3D2WA 3DMJB 2GMHA 3MEDB 2EI5A 1MU2A 1KDNA 5A8RA 3QIPB 2EFPA 2UXBJ 2RUGA 3PIPQ 2ZZNA 1X9MA 3HHDA 3BS9A 2CG4A 2BJDA 4F0MA 1YDLA 2JX2A 3DLEB 5THWA 1QD1A 4KBIA 3ZZPA 2DISA 4C8LA 3IM9A 3GE9A 2M3DA 5IT4A 3GIKA 2GVDA 5G0RA 3FSIA 4WCEQ 1T03B 1JXVA 3AJDA 2MKHA 4RX6A 4K50A 1UFKA 3WHIA 3VZHA 3BSAA 4OIXA 2LQJA 3CVKA 1VC5A 2U1AA 1FERA 3UVJB 2H5JB 4M1KA 1FVSA 2C22A 2RRBA 3EUNA 2MXYA 1FKPA 3MDFA 4Y2MA 5J2QA 3VTIA 4OV6A 3DRXA 4CNZA 2Q6BA 3Q8VA 4TY8B 3HJVA 4RW8B 3NS7B 1N5QA 4LF5J 5GAEU 4NLGA 1VQSA 2WCXA 3JSMB 4R8UB 2XGQA 1X4BA 2IM3A 3PYFA 3HHLC 2ZBQA 3DDIA 2CYYA 1UW9A 3GFZA 4KHRA 2ZH1A 4G3IA 4H54A 3ISNC 4RNMA 1RLDA 1R0AA 2J5AA 1NK6A 2OELA 2D3ZA 1YJTA 4OZ3A 3GG1A 2L3MA 3G82B 4H4MB 2BW2A 3FVYA 1HBUB 5F8GA 4ED1A 2FPHX 4AXJA 4YDXA 3BYRA 4O3RA 3ZO7A 1RACB 3RG6A 3D4JA 2XMAA 2C2KB 5EUHA 3K58A 3CC2S 4NYPA 2M5YA 4M5NA 1CJVB 1L3UA 4UQTA 5KFEA 4LQ3A 1KFDA 2QLJB 2JEFA 1U0HA 4EI2A 4F4XA 4XTTA 1RAAB 1UCNA 2DNPA 2X1BA 3PX4A 2R7TA 1FKOA 3MD3A 4NLDA 1XN9A 1UVJA 4OI6A 2W9BA 2W9CB 4HT5A 4ZCMA 5GAHI 2XZDB 4A8QA 1SXLA 3UNGC 2ZH7A 1NNDA 4OX8A 1VBXA 2Z2LA 3HKZD 3RZAA 4DLEA 2DT9A 5KFHA 3HHLA 3AA9A 5B0AA 3PZPA 3HP6A 4JV2A 1P1TA 3M30A 2HQDA 2ZC3A 3AQOA 5F41A 1XMQF 4F25A 4HR2A 5DG8A 2WSCC 3L7UA 1VRTB 3HDSA 3NNHA 4R0JA 4Y2CA 2M9KA 3N6LA 5HROA 4LREA 3C6UA 2JZ5A 4EGLA 4USTA 1HBOA 2NCKL 3MAQA 1NKEA 5KG3A 3M05A 5J1NA 2C42A 1J5EF 3D66A 2H65B 1UTAA
chains in the Genus database with same CATH topology
4BHQA 1S1TB 3KLFB 2A2DA 1S7HA 3VAFA 4Y65A 4CZCA 2HGLA 3I96A 4TU8A 4K4TA 2YKPA 1X5TA 4K4VA 3AH6A 2MSTA 3M32A 4CQ1A 1KC8T 2K7JA 3KG1A 3KJVA 1CQMA 4UQGA 3IGNA 3LF0A 1SL0A 1FE4A 4WFYA 2BZ2A 2LYVA 2XTEA 3OXFA 3D1HA 4QU7A 1URRA 4EO6A 5C42B 4PPZA 2RDJA 4DL0C 1QVGR 4PXCA 3CUNA 1KSPA 4N8OA 1SKRA 4DQSA 3NCQA 4Q0BA 2NLWA 2R7UA 3CCUS 3IWLA 4LSNB 2R7SA 3E8OA 2KJVA 4MK7A 2MQMA 4ED5A 4EWTA 2N82B 3BJYA 4PWDB 2CQCA 3MWBA 3NGDA 4B9LA 2DB1A 3CWJA 4KQZA 4R8UA 4ZKAA 1Q4RA 3KK1B 2GHWA 1S72S 1HWJA 2EFQA 3K5NA 2HNDA 3K2YA 4HT7A 4FYDA 3UR0A 3BZQA 2M88A 3BO2A 3PKMA 1Q7LB 3UR3C 4DSFA 4KRWA 2M8DB 1FDDA 4IG3B 2CQDA 2XMTA 4NCBA 2R8IA 2FLLA 5KFQA 3LP1B 1HNVA 3ZZUA 4A8SA 3H2UB 2DGWA 4XAKA 5LL6d 2DIUA 4OI3A 5AXKA 2HGMA 1YSJA 4ZPWR 4RNHA 4TQRA 1JLQB 4FF4A 3UD3P 2M0GB 5L38A 5FDLB 5M2RA 1DLOA 2D9PA 1C1BA 2M8HA 4E8UA 4Q7AA 3D0IE 1WEXA 4EEYA 1TL1B 4HVZA 5E3QA 1VQKS 3DRPA 2OD4A 4ZHRB 5D4NA 2ZNZA 2KG1A 1Y5LB 4PQAA 1QAYA 3KLGB 1EP4B 2ZVSA 2WTFA 1IN0A 2LXIA 3MM5A 5F8MA 2DVIA 5KT4A 1PC4A 4KTQA 2DNZA 1HBUA 1Y0HA 4JUZA 3PX6A 1JNRB 3PJWA 3WDOA 2NQPA 2JRSA 3M4XA 3ZFVA 2RQCA 5EGYA 3GIIA 5D3GA 5E2QA 2B43A 4MKBA 2W9AA 2O66A 2EG1A 4M63A 1IQZA 4G1QB 1LOUA 2VPWB 3BSNA 3IRXB 3QAEA 4RLEA 2E5HA 3TUZC 4RU9A 3HF5A 5BJRA 1S0NA 4LF5F 4FS1A 4TU7A 4ECQA 1OSCA 4M5DA 5J2PA 2LA6A 3GIJA 4ECWA 4PUOB 1S49A 2YKMA 1TV6A 3MTKA 4A47A 1H3DA 2HHQA 5HI7A 2JLEA 1HWUA 4Q5VA 4CTAA 1U8SA 4ED2A 1U09A 4BS2A 1JLBB 2M70A 2AGPA 3AY0A 4A8MP 2DR9A 1SJQA 1KLMA 1WWHA 2MQNA 3MMBA 3FRZA 3H25A 2ZM6F 2HAIA 5B0CA 1KEKA 2DRAA 4OHZA 2E29A 3FEXB 4U7UK 4DV2F 1TZ0A 1SBRA 4BCAA 1N48A 1UJ4A 1WG1A 3NBPB 3U02A 2BM0A 2IAJB 4HH0A 5T7LB 2A18A 2D3UA 3C6TA 3IS9B 1U49A 2AGOA 3MOZA 2FLNA 1KVIA 4Y2IA 5I42B 4RW7B 3W7BA 4N47A 2HHPA 2W24A 3K8WA 4WZQA 1R8BA 3G8QA 3NRBA 5D6GA 4YOEA 1V3SA 3EPGA 3QIDA 2O1PA 3OL8A 2Z0GA 4M95A 4UW2A 3KMSA 4BWMA 3RR8A