1SH0A

Crystal structure of norwalk virus polymerase (triclinic)
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
502
structure length
502
Chain Sequence
GTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVNED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of norwalk virus polymerase reveals the carboxyl terminus in the active site cleft.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase
molecule keywords RNA Polymerase
total genus 162
structure length 502
sequence length 502
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 1sh0A02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1sh0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sh0A03
4IDKA 2FVCA 1T3NA 3CDEA 2V4RA 2VG7A 4TYAA 3MEDB 3V81B 3KLIA 2VG7B 4WZQA 4Q0BA 3MR5A 3IG1A 2W9CB 5HROB 3SFUA 1RT5A 4LSNA 4X2BA 4Q0BB 3DM2A 2XI2A 1R0AB 4KKOB 4ZPBA 2D3UA 1S6PA 2WONA 2FVRA 4RW6A 3MEGB 1S9EB 1TKTA 2VG6A 4RW6B 1XR6A 3H40A 4RW7B 4Q44A 2YNHB 2VG6B 1JLGB 1HMVA 4RW9B 5C24A 1HQEB 3LP1B 3KHLA 2R2UA 5J2QB 1HMVB 4EBCA 3CJ2A 2JEFA 4K50A 3JYTA 5L1KA 4NCGA 3QLHB 3IS9B 3FQLA 3PJWA 3QLHA 3LP2A 2R8IA 3PW5A 1S1UA 4KB7A 4Q8FA 3PZPA 4IFYB 4R0EA 2ZD1A 4IFVB 4KV8A 1ZTWA 2ZKUA 3UDLA 4QWAA 2IBKA 2ZD1B 3FFIB 4KV8B 1S10A 1N4LA 4ZP6A 1S4FA 2AGPA 4O3RA 5F8HA 2B5JB 2BANA 3FFIA 1RTHA 3I5CA 2JEGA 1J5OA 3DOLA 2UVUA 4K4WA 4RUCA 4J9MA 4I2PA 5J2MB 3PW0A 4PWDA 3BGRA 5C5JA 1RT2B 5KFMA 1C0TA 3C6UA 1S1VB 5J2NA 1N56A 1QAJA 2R2RA 3MEEA 4LSLA 4DL5A 1C2PA 2XI3A 3MECA 3PJXA 3M9OB 5KFUA 1RTJB 5KFJA 2ATLA 4WE1A 4WFZA 5CYMA 3DLGB 2XGPA 1XR7A 3CDUA 3QIPB 3Q8RB 4ED2A 3DLGA 4F4WA 4IH7A 4MH8A 3BQ2A 1IKYB 2UVVA 4NLPA 4FBUA 5L1LA 4ECXA 1WNEA 2YNFA 5L1IA 3MTKA 1U09A 1JLFB 3RB0A 1SH0A 2YNFB 1TL3A 1TVRA 3HHKA 3HVWA 3N6LA 1RDRA 4O4RA 3DI6A 2O5DA 3D28A 2VA2A 2R8KA 1GX5A 2OPRB 1EETA 1SV5A 3DRPB 3MR2A 5FDLA 4K4TA 2RDJA 5K14B 4HKQA 1RT6B 5F8LA 1BQMA 4R5PA 3HVTA 3GQCA 2B43A 1RT6A 4NRTA 4NLSA 2HNZA 3T19A 5KFZA 1S0OA 3KK1B 3HVAA 1JIHA 4FS1A 2FVPA 5I3UA 2E9ZA 2IJNA 2HNZB 3I5AA 4NLDA 3G6VA 2C2DA 4PQUA 4K4VA 3C6TA 4O3NA 5F8JA 3MFHA 1KLMA 1TV6A 4QWDA 4ECTA 2W9BB 4M95A 3V6HA 1VRUB 5KG1A 5KFXA 4O44B 3VQSA 1GX6A 1MU2B 1UWBB 2OPPA 1W25A 3KLEB 1FKPB 1MU2A 2V0NA 4H4MA 5DGAA 2JEJA 5EWEA 2IA6A 1FKPA 3OL6A 3LAMA 2C2EA 4O3SA 3CVKA 1JKHA 4DG1A 3PHEA 1EP4B 4R8UB 5DQGA 2R8HA 2ASLA 4R8UA 4EYHB 1T05A 1JLQA 5HROA 3RAXA 4OL8A 4TXSA 5C42B 1LWFB 4ID5A 4ZVGA 4QW9A 3V4IA 2YKMA 1LWFA 3V4IB 4XO0A 4ED6A 1S97A 3I5BA 1KHWA 2ALZA 2YNHA 4Y2CA 2IC3A 2WCXA 4RW9A 5C24B 3LP1A 4I7FA 3KK2B 4WXWA 2W8LA 3LAKA 1IKXA 4ICLA 3RBDA 3NBPB 5JXSA 2IM0A 3NBPA 2FVSA 4YR2A 1TL1A 5CYQA 4WFYA 2WRMA 2XCAA 4DL4A 5KFEA 2YKNA 4ZHRA 5CYQB 2OPSA 4WYWA 4KE5A 3T1AA 2D41A 2YKNB 4ZHRB 5KFWA 1T03B 2DPJA 2JLEA 5T14A 4KFBB 3PR4A 3KMSA 3EPIA 2OPQA 2B6AB 4MKAA 1SH2A 1VRTA 2BANB 3GIMA 2OPQB 2ZE2A 2HNDA 1TKZA 3KK3A 4J9QA 5KG2A 1TKXB 4IH6A 2W7OA 4PUOB 5L1JA 3CJ3A 4H4OA 3QGIA 2IMWP 4K4ZA 1TKZB 3TAMB 5C25A 3KK3B 2WTFA 1RTDB 4KKOA 4Q8EA 3TAMA 5C25B 2FLNA 2QV6A 4GC7A 1S1VA 5J2NB 1LW2A 3MEGA 5DGBA 5EDWA 4YP3A 1NHUA 1REVA 4YR3A 4J9KA 3TQ1A 2BQUA 3MECB 1REVB 1QAIA 3DMJB 2R2TA 3KLGB 1FK9A 2IM2A 3DDKA 2XWYA 1HQEA 4KHRA 1LWEB 4TY8B 4O3OA 1OS5A 5F9NA 5F8MA 4NLUA 1QUVA 2RF2B 3LALA 4XPEA 3T5HA 2I1RA 1FKOA 2XCPA 4RNNA 5HLFA 1RYSA 3N6MA 4Y3CA 3BQ1A 1SUQA 1S9GA 5DG7A 4ZPCA 3LP2B 4DL6A 3GIJA 1S9GB 3CWJA 4RNMA 1N6QA 4J9OA 3QIDA 4H54A 3DLEA 4MK7A 4ZVEA 1LW0B 5KFTA 2UUTA 3OHAA 3KNAA 4ZVFA 5KFNA 3KHRA 1DTQB 4NLQA 3DI6B 3JSMB 4JV2A 5KT7A 4G1QB 2AGOA 2YNGB 3LP0A 4IQXA 1SV5B 2ASDA 3OSNA 1J5OB 1BQNB 5KFDA 4I2PB 1JLCA 2E9TA 1BQNA 3KK1A 3C6UB 5KG6A 4GC6A 3CO9A 5KFKA 1RYRA 3IGNA 2I5JA 4B3OB 3H5SA 3UQSA 3KHGA 4WE1B 3M8PB 4ZPAA 3QO9B 1S0NA 1RA6A 4MK8A 1VRUA 3M8PA 1DLOB 4MIBA 3KLFB 2VG5A 3KLFA 2GIQA 3I0RB 4QPXA 1HQUA 3DOKA 3MEDA 3V81A 5KFGA 1S1WB 4RW8B 1HARA 2IJFA 2IM1A 1CSJA 4O4GA 1S1WA 1DTTB 1QE1A 3UR0A 4RW8A 3M9NB 1TVRB 3ICLA 4O4GB 3DM2B 4K4UA 2WB4A 3PR5B 4ECVA 4Y2AA 3DRPA 1RT7A 2WONB 4NLVA 5KFVA 3RB3A 3OL9A 1BQMB 4R5PB 5J2PA 1I6JA 4ZP9A 3DRRB 4RU9A 4U6PA 1C0UB 5KT3A 2ASJA 1JLAA 4G3IA 4KAIA 1C0UA 3KHHA 1JLAB 4J9PA 3RBEA 5KG3A 5D3GA 3KK2A 4LQ3A 2F8EX 3C6TB 4J9SA 1RAJA 3FRZA 4ED7A 5D3GB 2BQ3A 3MFIA 4NZ0A 5DLGA 1RT3A 5KG7A 4O3QA 2R2SA 4URSA 3QZ7A 4Q43A 4ECSA 3QGHA 5JUMA 3ITHA 3V6KA 4ECZA 3Q8QB 3H2LA 3MR3A 4KFBA 1EP4A 3RB6A 3PW4A 3GV8B 5DQIA 4MKBA 5KFHA 1TKXA 2IAJB 4RW4B 5KFSA 5J2MA 1JLBA 4MIAA 5C42A 3BSNA 4DL7A 1RT2A 3KLHA 1S6PB 2IAJA 4RW4A 5EWFA 4TQSA 4IR9A 2HMIB 1S9EA 3KLHB 3MEEB 4ECUA 4KO0A 1LW2B 3BSOA 1N48A 5EUHA 3RB4A 3H4BA 5J2QA 4TY8A 3NGDA 4I7FB 4KBIA 1S6QB 1XR5A 3HKWA 3DRSA 4NCGB 5L9XA 4EBDA 4DL3A 1S6QA 1S1XA 3IS9A 4QWBA 1YVFA 3CIZA 4QW8A 4F4YA 3G6YA 4F50A 4IKAA 3MF5A 4QWCA 1RT1B 5KT2A 4IFVA 4IFYA 2C22A 1S48A 1IM4A 4TLRA 1N6QB 1RT1A 5DQHA 1S0MA 1S49A 3DLEB 1Z4UA 4RUAA 2UVWA 1S1TA 4KSEB 4Y34A 1VRTB 4MK9A 3JSMA 2J6SA 4ZPDA 5KFYA 1S1TB 3E01B 5KFRA 3UPFA 4NLRA 4H4OB 1RTIB 5KFIA 4XPCA 4F4XA 1C0TB 3QGGA 3Q8SB 1RTDA 3GYNA 1RTIA 2HWHA 5DLFA 2FJVA 3M8QB 1IKVA 1C1CB 5I42A 2AQ4A 1S9FA 5F8NA 3H5YA 4NYZA 2I5JB 4K4YA 4DEZA 3EPGA 4B3OA 1TV6B 3OL8A 4WZMA 1KLMB 5CYMB 3QYYA 1TP7A 3G6XA 3BQ0A 4HYKA 4O44A 4JV0A 2HNYB 2RDIA 3V6DB 2E9RX 1LWCA 4TY9A 5KFLA 2RF2A 3I0SB 4DL2A 2HNYA 2AU0A 4ZMMA 1LWCB 4H4MB 5KG5A 1C1BA 4FS2A 3T5JA 2VG5B 2HWIA 1C1BB 3IRXB 3KLIB 2XC9A 3H5XA 3H98A 3IRXA 3OHBA 4ECQA 1ZTTA 4NRUA 2BE2A 4RNHA 1T05B 4URGA 1R0AA 1NHVA 4LQ9A 1DTQA 1MMLA 2J6UA 3OLAA 5FDLB 4NLYA 5K14A 2YKMB 3NL0A 1KHVA 2IM3A 1TKTB 3GV7B 3PVXA 2UVRA 3NAHA 1IKWB 4F4ZA 1JLCB 3DRRA 1N5YA 5I3UB 1IKWA 2EC0A 5KFOA 3GILA 3IN5A 4ED0A 4PQUB 3NKYA 5HP1A 1HYSB 2FLPA 2GC8A 3GIIA 3M9MB 2D3ZA 4FBTA 2OPPB 4TN2A 1S1UB 4YR0A 1RT3B 3KLEA 1SH3A 2W9AA 4NLTA 1JLEB 4IDKB 5DG9A 2JC1A 2D7SA 4RNFA 3BJYA 5F8GA 1T03A 4ED8A 1JLEA 1JKHB 3G86A 3BSCA 3EZUA 3I0RA 3ITHB 4DG1B 4QWEA 2DPIA 3E51A 2CJQA 5KT6A 3IG1B 2W9CA 2UUWA 1RT5B 4LSNB 3DOLB 5KT4A 1HNVB 2HNDB 3ISNC 4ECRA 1JX4A 1JLQB 1DTTA 3BGRB 5KFFA 2FLLA 4K4SA 1HNVA 3QZ8A 3RAQA 4ID5B 1HNIB 3CDWA 4I2QA 2BRKA 4ED1A 1JLBB 4IRDA 4IRCA 1RT7B 1HNIA 4ZP7A 4I2QB 1D1UA 3T5LA 3SFGA 5J2PB 2HMIA 4RW7A 2WK4A 4ECWA 4KO0B 4IG0A 1JLGA 5KG4A 5J1EB 4ZP8A 4YQWA 3DMJA 3BSAA 4IG3B 3KLGA 3FDSA 4IG0B 2IC3B 5J1EA 2AGQA 4IG3A 3JYTB 4TYBA 4WFXA 2FJXA 3H4DA 3GV5B 1IKYA 1FKOB 5HLFB 4K4XA 3KOAA 1TL1B 4ED3A 3OL7A 2BR0A 2FVQA 1S1XB 3NMAA 3CJ4A 4EO6A 3OSPA 4ZVHA 1JLFA 4NLOA 3MR6A 1K1QA 1TL3B 2B5JA 4RZRA 1RA7A 2B6AA 4MFBA 2ILYA 1RTHB 4YMEA 4IRKA 4TQRA 4G1QA 2ZE2B 3CJ0A 4MFBB 2WHOA 3Q8PB 3HVTB 4PUOA 4PWDB 2W8KA 2R8GA 5KFBA 3TVKA 3E01A 3PW2A 3KMQA 4WYLA 4LSLB 4URQU 4ECYA 4JV1A 5KFPA 1RTJA 1IKVB 1C1CA 1TQLA 4JUZA 4U7CA 4NLXA 3N6NA 1FK9B 4O3PA 2W9BA 3D5MA 3QIPA 1LWEA 2J6TA 3QO9A 4EO8A 2C28A 1DLOA 2BRLA 2GIRA 4Q45A 3KJVB 1ZETA 2HAIA 3DRSB 4NLWA 3I0SA 2XGQA 1D0EA 4IR1A 4RNOA 4NLGA 1SUQB 5F9LA 3KJVA 1RT4B 3H5UA 1T94A 3LANA 5KFQA 2W7PA 4EYIB 2CKWA 2R8JA 3OLBA 2ILZA 1HQUB 3DLKA 3DOKB 1RT4A 5KG0A 3KLVA 4EBEA 3DLKB 1LW0A 4KHMA 5F8IA 1QE1B 2BE2B 2WOMB 4J9NA 2JC0A 1EETB 2OPRA 2FJWA 4M94A 3V6JA 1HPZB 2WOMA 2YNGA 3H59A 3LP0B 3NAIA 1HPZA 3T5KA 4IOBA 2AX1A 2JEIA 1JXLA 3CJ5A 2V9WA 5HBMA 4EEYA 5DG8A 3SI8A 1N5YB 3BR9A 4WXOA 3IGVA 5HBMB 4IH5A 5KFCA 2VA3A 3FSIA 3M8QA 1IKXB 4ICLB 5I42B 2RKIB 2YNIA 4J9RA 1NNDA 5EWGA 5HP1B 2AWZA 1HYSA 2RKIA 3GIKA 2YNIB 5KT5A 4J9LA 2C2RA 2OH2A 1K1SA 1UWBA 3DYAB 2V4QA 3V6DA 2AX0A 3FQKA 3PW7A 3DYAA 2OPSB 5KFAA 2QE5A 3ISND 3BREA 2BQRA
chains in the Genus database with same CATH superfamily
2XMJA 2A2DA 3TA2A 3I6PA 3MM6A 5F3TA 4ZIVA 2V4RA 1PC5A 3VGTA 2QA4S 3V81B 1FX2A 3D6TB 3C3LA 4RUHA 4GVLA 2W2NP 4Q0BA 2W9CB 3SFUA 2D9OA 4CLFA 2RBFA 3UD5A 3W3SA 4Q0BB 2XI2A 1KQKA 2ZHBA 3TANA 1WG1A 1R0AB 4ZPBA 4DV0J 3AA9A 2WVBA 2D3UA 2R7QA 2FVRA 1BY9A 3DGVA 2DEJA 4DR7F 4P10A 1XR6A 3MAAB 3UDCA 1MN7A 4PCQA 2QMXA 1M5PC 1HQEB 1XERA 2KXFA 4CO5A 3EM1A 2QLXA 4FYWB 2BSQE 4LFAF 3QJJA 4HHHA 4R25A 4C8NA 3KXDA 1SQFA 4FN5A 1NPKA 2DNYA 3VGVA 4ZJQA 4UZBA 1TTHB 1A9NB 1QTNB 3BGUA 2KXNB 2R8IA 4N77A 4KB7A 3JS9A 2OD6A 1VQ8S 1IQTA 3ZZPA 1FF2A 2HHQA 1SL0A 2N4CA 3SCIE 2ZD1B 3FFIB 5FJ4A 1MMNA 4X64J 4DS4A 3A8KA 3FFIA 1S6OA 2EI5A 3OXFA 4DQQA 1HHQA 3EUNA 3I5CA 1MWQA 3VWSA 2JEGA 2CQPA 4J9MA 5J2MB 2E5LJ 2D74B 2A6OA 2BOAA 2FLOA 1D9AA 1RT2B 1UPPA 3ZNUA 1IN0A 5KFMA 2JDJA 2V4JB 4A8QA 5AE3A 2CJXB 2HRYA 1WELA 4DCPB 1ZAXA 3ZTPA 1C2PA 1Q5YA 2JRSA 3ZZOA 4LIWA 4RJVA 1HWKA 1YG0A 1RTJB 4K2JA 1QUPA 4EU0A 5AE1A 3DHWC 3DHXA 5KFJA 3TAQA 1H6KX 2ATLA 1NKCA 5H9FK 5E0OA 1XR7A 3CDUA 1CBKA 2AW0A 4X62F 2DR7A 4LR8A 2HGLA 4Y6IA 1UJ5A 5HJXA 3NGTA 4CH0S 1LK7A 1YJTA 1F3VA 2GVDB 3EXCX 3W2WB 2UVVA 1S76D 2A10A 2NUHA 4LF2A 1WNEA 1O8BA 2GVDA 5GVQA 1SC1B 3OTBA 2FZKB 4L3KA 4A48A 4CYUA 2R7SA 1JLFB 3VTIA 1SH0A 2OMLA 3H90A 4CYUB 3GSDA 2BJ1A 3HHKA 4WP8A 1IWGA 3N6LA 2XQCA 1RDRA 3X1LB 2VA2A 4N7TA 3MR2A 5K14B 3MUMP 1NM2A 2OO4A 3HVTA 3HSZA 1M1KT 3T19A 2KELA 5KFZA 1SKSA 3OVBA 3KK1B 1T3OA 1RWXB 5I3UA 2UV8G 2DH7A 2HNZB 4NLDA 2HKEA 1EB0A 2DXDA 2YKQA 2WSCC 3T9NA 2ZJPQ 1MNTA 1S57A 3BKUA 3D54A 3C6TA 5BYRA 1VQYA 1X4FA 1SPBP 3HX9A 3QAUA 2VDHA 2BBEA 1MROB 5KG1A 4Y00A 5KFXA 4OX7A 4C0HA 1XMQF 1EX8A 9RUBA 3LA0A 1W25A 2X7IA 3KLEB 4FXDA 1FKPB 2VFUA 1MU2A 2V0NA 3BN7A 2KVIA 3PEJA 1I94J 2AEJA 2JOQA 1B4SA 4LVOP 2FGCA 4M8LA 1R8BA 1S59A 2MY7A 2O01C 3GCWP 4LMZA 3PJ9A 2E5JA 3JAMU 3GE9A 4NZ6A 1T05A 3K5NA 4J90A 4JI7F 1X5OA 2MQ8A 4ZVGA 3POTB 4QW9A 3PEHA 2XYPB 3C15B 2C3UA 4XO0A 5DO2A 1DQAA 4CRJA 3D2WA 4ED6A 2QA2A 2V5HG 1KHWA 1O5JA 4FNHA 4M5KA 3HT0A 4PXDA 4U8YA 4E98A 1GT8A 2ALZA 2ZWOA 4MJWA 3OT9A 1FRMA 4F0HA 2BJDA 5C24B 3LP1A 4I7FA 4ZIWA 2XS5A 1QAYA 1IKXA 2AYEA 1IJEB 1I3OB 2ZC4A 3NBPB 4KPCA 2XTDA 3I55S 3RBDA 3AJ1A 2RSQA 4JBCA 2OFHX 4YY3F 1TL1A 4ZITA 3EICA 2YX4A 2HLUA 2QMWA 2XCAA 4DL4A 4D3HA 1URRA 5L8RC 2YKNA 3E8OA 2VKRA 2DR5A 3D66A 3AT1B 3MMAA 4MYUA 4WKRA 2YVSA 3BPDA 2DPJA 3VW4A 2YKNB 2CAJA 1T03B 2W4DA 2Q66A 4K59A 2AMCB 3MM6B 4UZCA 1WJ9A 3TVYA 1OJ4A 2NXNA 2BANB 2K3KA 2UV8A 4QIWD 3RAMA 2MLZA 2ZE2A 1TKZA 4N56A 3BF4A 3BS9A 1TKXB 1FNOA 1RACB 2DY1A 2W7OA 1RWPB 1X60A 1TKZB 3HLUA 3I96A 2VZ9A 4CCHA 1BHNA 1FXRA 3P4UB 1H72C 2RUSA 2WTFA 2KYXA 3CCRS 3NS7B 3OPKA 4C98A 1BD6A 4QWCA 5DGBA 3MEGA 3DGPA 4J9KA 2HHUA 2CQ2A 4ILMA 3MAAA 4IYQA 3QFWA 2MKHA 1NSPA 1Q0NA 2DYAA 2BE7D 1HQ2A 1W7WA 4O3OA 2XWYA 1HQEA 2F3JA 4EI2A 3MXHP 1K8AT 1RXOB 2RF2B 3LALA 4ZPTR 3C66A 2EEYA 1YJNS 4DN0A 1YLXA 2E1MC 3DDIA 3D68A 2ZBRA 4NWBA 1K47A 1S9GA 2DGWA 3EVWA 4USTA 3BQ1A 4ZPCA 3VAGA 5DG7A 4ZOSA 4C9DA 4PPZA 1AW0A 3J7AN 5D6GA 4GRSA 1H38A 3DC2A 4ZN1A 4OV6A 3DLEA 2HVHA 4ZVEA 3BH6B 2UUTA 2BACA 4U96A 5KFNA 1XNQJ 5A0YA 3P5TL 1UEUA 2L48A 4G1QB 4HACB 3OQ2A 2AGOA 3MPYA 1F5CA 4Y0FA 1YSJA 3OSNA 3MMJA 3UDEA 2VJVA 1Q1KA 3O6QA 4I2PB 2FHMA 3P3DA 5EGYA 1FD8A 4OHYA 4HEA9 1PAEX 4A4JA 5K5MA 4ZCIA 1HFEL 4DF8A 3C6UB 3OTOJ 1RYRA 1SKRA 1SIZA 4KQZA 4YY3J 1APSA 2V2KA 4B3OB 2HBRB 3ILIA 2HWTA 3H5SA 4DU7A 2KZZA 2LU2A 3FNNA 3Q86A 3CIMA 2HBQB 4HH1A 3WX4A 1LXNA 1RA6A 1WSRA 1VRUA 3VVUA 4CQ1A 2DHSA 1XQIA 1EHWA 5F41A 4MIBA 4JI0F 3KLFB 3PKYA 2VG5A 3VCDA 4X4OA 1S77D 3C16A 3KLFA 3MCOA 2L3MA 1HL6A 1FJ7A 2Y9HA 4QPXA 4Z2XA 1FCAA 2MZTA 1DY3A 4RW8B 3V81A 4OJ1A 1S99A 5C2GA 2CPGA 2AJ4A 3WIVA 3BPSP 4RW8A 3M9NB 1QE1A 4DPYA 2ZM6J 1AFJA 2BJEA 5L46A 1FDDA 3GWCA 4O4GB 3B54A 4V19X 4PQUA 4Y2AA 1RT7A 3FEYB 1GXTA 4OI2A 4P72A 5MLCV 1NK6A 4CLTA 3HK2A 2HK3A 2GGPB 2HFSA 1EAYC 3KJNB 1RAOA 3P5BP 3T9ZA 4MJKA 5IS2A 5SZTA 1C0UB 1EJ7L 5GAEU 1I94F 1JJHA 3FBEA 2ASJA 3M4XA 1AYEA 1H7XA 5LJ5Y 2E5LF 1YDLA 1C0UA 2W2OP 2W25A 3KHHA 4JI1J 2MJNA 3TVZA 1XMQJ 3RBEA 2FB0A 4LRAA 1NKEA 2D9PA 2ZUAA 3C6TB 2FTRA 2XLKA 3FRZA 5JVHQ 1RWWB 1U6FA 4C8MA 2OHDA 2QA1A 2M4MA 5CXTA 1RT3A 5KG7A 1UJ4A 3IBCB 4FNIA 2ASYA 1T7PA 1X0PA 5CCLA 3HSDA 4HI1A 2KM8C 4ECSA 5JUMA 4F02A 4UOCA 2XZTB 3ITHA 4ZVPB 4F0MA 1CQMA 2JX2A 1RWKB 3G5OA 1X8DA 1WTFA 2GO8A 4KFBA 2OFGX 1KOOA 4OJGA 5DQIA 1VC5A 4Z7YA 4BHQA 1GMWA 4QIVA 1CJKA 3PZPA 3VALA 2QT7A 5A8WA 1DBDA 1AZSB 4DV3F 1VBZA 1RT2A 2W1BA 5ETRA 5EN1A 3RG6A 1QD1A 4OZJA 1SVDA 5CZXA 3CD5A 4PQAA 3NS6A 1Q8BA 1LW2B 1RAIB 2NYIA 3EZ5A 1N48A 1WSVA 4Q2MA 4DN9A 2V1SA 3AOCA 2KXHA 1FRJA 3R7NB 3HHLB 5IM0A 3LF0A 4TY8A 3NGDA 4F4KA 4I7FB 1PC4A 1S6QB 2L08A 3GJQB 3HKWA 2GPEA 2EKYA 4QWBA 2GFFA 3THTA 2DT9A 2BA3A 4F50A 3AX3A 1P1LA 1ZAWA 1U47A 3HXMA 4IFYA 3CJ8A 1S48A 3LPYA 5B7WA 2HBYB 3MMAB 2KVQE 5F0WA 1N6QB 4DR7J 3CJQA 5CD4A 1S49A 3KNGA 1Z4UA 3CJRA 2CPXA 2DNOA 2B7CB 1S1TA 2J5AA 4C3LA 4KY3A 1FFGB 1U2RA 3TUZC 4Y34A 3VAMA 1DRZA 1LOUA 4OYPA 5KFYA 1HNZJ 3GONA 1FJGF 3Q2SC 4LRFA 4G1IA 3E01B 1OWXA 1UZDA 1N5QA 3HI9A 4H4OB 4TKTA 1RHMB 1FFWB 2FUG9 1NK7A 2R7VA 2OD4A 2JWNA 3VAHA 4M5DA 2KN4A 4NEYA 4QU6A 1IKVA 1QSSA 2N3LA 5LT5A 3DGPB 1YWXA 4GO7X 4M5DB 4WCEQ 3OJUA 3CPWR 3TR5A 3G82B 2JLFA 2AD9A 3D1HA 3TWZA 1BDVA 3OL8A 4WZMA 3EDRB 2H48B 4LRVA 1SB6A 5BXIA 1BQXA 5K8NA 1NSKL 4JV0A 4RPFA 2E9RX 4ZJOA 2W24A 3R2DJ 5KFLA 1FXLA 2RF2A 2J9CA 1JXVA 4H4MB 5D4NA 1IJFB 4ILLA 2W2MP 5FLXY 3IRXB 2DCLA 4HI2A 5LSLA 2XC9A 2KU7A 3H98A 5A8RB 2DGXA 5LSOA 3J7ZT 4ECQA 2F4VF 4RUBA 2ZVIA 4C8OA 6AT1B 1T05B 1R27B 2DNZA 2MEWA 3RUBL 1W26A 4DSFA 1N0VC 5EX0A 1NXIA 4TU8A 2IM3A 3ETOA 5AJ3J 3GG1A 3NAHA 1GMUA 1IKWB 4F3QA 3CMES 2V2VA 3EGNA 3DRRA 4FKYA 4C6AA 1NK8A 1IKWA 4OIXA 2Q6CA 4OI1A 1X4AA 5G4DA 2DXFA 4LF8F 4OZ3A 4CLWA 2E5GA 1Q16B 2AEMA 3N5FA 3LGMA 5LXYA 2E1CA 2Y0SD 3ISZA 1GEHA 1HYSB 2ERRA 4BBYA 1NK9A 3FBFA 2GNKA 4P7VA 2CQGA 3SV4A 4U7UD 1UVKA 2KO1A 4YR0A 1NB2A 1KFSA 1B0PA 1WDDA 4WPAA 2CNLB 3UVJB 3B82A 1RHRB 3N4WA 4NLTA 5RUBA 4IDKB 2W9AA 3GPAA 1T03A 4YB5A 1RB0A 1JKHB 3BSCA 3R7BB 1YZ6A 1ZS6A 3BBBA 3DCAA 3OXGA 4A8KA 1N34J 2B4UA 3ZZYA 4BS2A 5E3AA 2W9CA 1RT5B 3DOLB 1HNVB 2HNDB 2OAUA 1VR6A 3ISNC 4ANEA 3UR3C 1DTTA 4ECRA 4DQRA 2QX0A 4ZLNA 1JX4A 2DRBA 2LDIA 4HLBA 4ID5B 1TKDA 4IRDA 1U48A 1FX4A 4IRCA 5DDOC 1RT7B 2OELA 5DJBA 1HNIA 1G6BA 2CRLA 2J8SA 4DR1J 4YOEA 3PRDA 1WHXA 3IXQA 1P6TA 3R5CA 3GYXB 4KO0B 5DDRC 5KG4A 4LF7F 4DPUA 4ZP8A 3QRPA 3AOBA 3BSAA 5J1EA 2EVZA 1IR0A 2HFNA 2QYGA 3CUNA 1U0SA 2RHQB 2HHTA 3KJQB 3GV5B 1SC4B 2ZBIA 1FKOB 1UJ6A 1KP6A 2C3OA 2V8GA 3PM9A 1LQ9A 5AE2A 2J9EA 1S1XB 4NI2B 1NDLA 2HZAA 3H25A 2GQQA 2MJUA 2CJ9A 2MGZB 3U02A 3ZZRA 4YB6A 1NDCA 3OXLA 1TL3B 1NJYA 1B3TA 4B3RJ 2E7XA 1R89A 4RZRA 2ACMA 1RA7A 2B6AA 1PBAA 3A8EA 4KR0B 4MFBA 5HJYA 2GS8A 5D77A 3DU5A 4UQGA 4B3MF 4F3OA 3U1LA 5HK4A 2M52A 2WW4A 1SI9A 3PNIA 4L72B 4LIRA 4C11B 4BCAA 5HN0A 4WK1A 2M2BA 2MQMA 3R2CJ 1B64A 3OUYA 2VH7A 3PW2A 3KMQA 3E3XA 1AZSA 3C14B 3DLLQ 3OR1A 3DLBA 1RUSA 3CEDA 4C2MA 5IV3A 3C14A 4KJIA 2YPZA 2H65B 3W5YA 2LYVA 1RTJA 2G0JA 4V1Ak 4M5LA 4JI4J 1TQLA 2ADCA 4O3PA 2MPUA 3M8RA 2C3MA 2YWKA 3QIPA 1IBLF 3QO9A 1BE4A 3Q89A 4DXLA 3CCVS 4B17A 2GAHC 3Q0AA 4DUZJ 4M95A 1FERA 3ILOA 4NLGA 1NZ8A 2XGQA 4OI3A 4OJHA 1NJZA 4OL8A 5GMDA 3HCXA 2NPFA 2D69A 2P9EA 3FEZA 3H5UA 1HI0P 5D0EA 3OLBA 5MAOA 2VJUA 2JSXA 2OSQA 1Y7PA 5D8HB 3R8YA 3SCLE 4EBEA 1N5TA 3PX6A 5ADZA 1LW0A 2I9SA 5F8IA 2VBYA 3BYPA 4WU2A 2JC0A 2OPRA 2BDPA 1RU2A 2HGNA 1I5OB 2WOMA 3IO1A 2MTLA 3LP0B 2NREA 4DL0C 3T5KA 4DR4J 4DV4J 3J7A1 2PSZA 3AB2B 3CJ5A 4DFJA 2JJ4D 3R27A 3S6EA 4BWJA 5HBMA 3K5OA 2PMWA 3W65A 1F9HA 2IHR1 1RKIA 2QSWA 5KOWA 1N5YB 1TFWA 1TFYA 4WXOA 1AUSL 1FEHA 5KFCA 2WZ1A 4OYMA 4S0MA 2YNIA 2RH3A 5ETOA 5EWGA 2AWZA 1MROA 4QR0A 2CZ9A 2YNIB 5KT5A 1SIWB 4U95A 4J9LA 2C2RA 2OH2A 3NOGA 3HF5A 4O23A 4LT6A 3FQKA 4DU8A 2OPSB 3MMBA 2V8VA 1OQ3A 2JHEA 2QE5A 5AXMA 3Q23A 2ZH5A 5BYQA 2FQQB 3HDSA 1T3NA 3CDEA 3EGWB 4C97A 1XMOJ 3D3BJ 1IBMF 1YX2A 8AT1B 2N7YA 4JI8J 5DS7A 3W9IA 1N32J 1UVIA 4WZQA 4DZDA 3CCES 3CW2C 4LSNA 1GMVA 3DOMB 1F60B 2HW3A 3CE8A 5IXUA 2NSBA 2NPIA 4UF4A 4NOHA 2C2OB 3WHIA 2KRRA 2BUNA 3IR7A 1UL3A 2WONA 4RW6A 3JSRA 1EZZB 3HD1A 4A8FA 4I6AA 1RP5A 4DPWA 1WF0A 4RW6B 2KZMA 4OV1A 4U9RA 2P6SA 4Q44A 2P2CB 1WOSA 2VG6B 5GMKa 1JLGB 1HMVA 5C24A 2BJ3A 1F2HA 1RQ0A 1UW4A 2BYCA 2COLA 3FCHA 3HSGA 3CDBA 3I9V9 3UW1A 5GADI 5J2QB 4JI3J 4JI2J 2Y8YA 3JTNA 2JEFA 1E6YB 4K50A 1REGX 2MZSA 1YIJS 1K44A 2PE8A 3IC1A 3NNAA 2YWEA 2GQ2A 2ZJQQ 4P9SA 3NO7A 4RLEA 4CNZA 2DIUA 3MM8B 4IFYB 4KV8A 2Z56B 2IDEA 2NXCA 2ZKUA 3AJ2A 2IBKA 2JZ5A 4KV8B 3CF5Q 1S10A 2G13A 4AT1B 2MXYA 4QYZK 2Z2ZA 2BANA 2H5JB 1G7CB 3D6FB 1RTHA 1VIOA 1FWPA 2Q79A 5LXRA 5FIIA 2Y1JA 2UVUA 2PT0A 3HD2A 4PWDA 3DRXA 1LXJA 3NCPA 5JVGQ 1CG2A 1U4BA 2VPYB 2NSCA 4IUFA 2A18A 1UUJA 2K1RB 3ZZTA 4F8RA 2BJ8A 4LSLA 4M63A 3AOAA 3PJXA 2VV5A 4F3MA 3W9JA 4G1PA 2UUAF 5LJ3Y 1OMSA 1UP1A 1DFDA 4WFZA 5CYMA 4EUVA 1P9YA 1A7GE 2XMWA 3DLGB 5FD1A 5THWA 1CJUB 1HBNB 2CWXA 3DLGA 4F4WA 2CQDA 4J9QA 4IH7A 4PRFA 4AQYJ 1FKAF 3FCVA 4HVZA 2ZKTA 5I4MA 4I4BA 3JQJA 1F2GA 2QJ3A 2IY5B 2J8AA 4I6WA 1UVNA 8ATCB 2YNFA 5L1IA 3WDOA 1KS2A 2APOA 2P9GA 2EK6A 5A8RA 4B3SF 3K58A 4LF9J 2E44A 2EFQA 2X1AA 2E1AA 1RSCA 1GQEA 1AB8A 1B7YB 1FEEA 1HA1A 1TVRA 3DI6A 3HVWA 2EFGA 5A0YB 3MCNA 2BA9A 3IA0A 1GX5A 1SJRA 3C2PA 1EETA 2AKWB 4YB1P 1SXLA 5FDLA 5GAGI 2AYBA 1U6BA 3G71S 2C3YA 1LNQA 3FZBA 3IFEA 1K0VA 5GAEI 4I68A 5A2QY 3ENQA 1FHTA 4NRTA 2HHPA 4WIIA 2J0QD 1WEZA 4ED5A 2Y0BB 2NR0A 3NLCA 3Q8UA 3G4SS 3I5AA 3OTCA 5J1NA 3M2RB 4A8SA 4A8OA 3RR7A 3MTJA 2ZBCA 4P73A 1AUDA 1IWAA 1ULRA 3QPIA 4O3NA 4DCOB 4WTYA 2KM8B 2DO4A 4FKXA 1VQPS 3CO0P 3V6HA 3ZTSA 4O44B 3LQVA 3PX4A 1VHIA 4W4MA 2KG1A 1RAAB 5H9EJ 3UVJA 4A47A 4GO5X 3K2YA 5DGAA 3QOQA 3IWXA 3W63A 5GAHI 3M8YA 2ATCB 4FYYB 2PMZD 4C3KA 1V5IB 4DV7F 1FRLA 1KBRA 4PG4A 4DUYJ 4OX9J 5LMUF 4UW2A 1EP4B 4LFBJ 1UFLA 1RAEB 5T7LB 3HO1A 1K0TA 2DH8A 1N36F 3BO4A 4LR7A 2ASLA 4R8UA 3H42A 1KTVA 1JLQA 1FVSA 1HI1A 4GMKA 5HROA 5C42B 3RAXA 3BGOP 5B0EA 4ZCKA 3SBMA 1LWFB 4ID5A 3VZHA 4JI7J 2CPHA 2F5GA 2VODA 1LWFA 2GGPA 4DZ6A 4EK2A 3IWLA 1T95A 4ZVOB 3CCLS 2J0WA 4HR2A 2LA4A 5K20B 3ENVA 2OMOA 3LOUA 3VR1A 5KAKA 1NLAA 3MZIA 4LBHA 4M5HA 3W64A 1HBOB 1ZM3A 4WXWA 3KK2B 4ICLA 2VDIA 2H5EA 3MUTP 1PO6A 2DO0A 5CAAA 3IR6B 5CYQA 4OI0A 4WFYA 2DY9A 4L73A 2LFVA 4ZHRA 5CYQB 2OPSA 4KE5A 3T1AA 3A13A 3B78A 2EBGA 3GJTB 2EFOA 5T14A 1PARA 1RGVA 1TL4A 2LA6A 1NMEB 2C2KB 2WVFA 3ZNJ1 1VRTA 2CUYA 2F1FA 4Q7AA 2OPQB 2QA4G 1D8YA 1C4CA 2MZ1A 3KK3A 3WZ0A 5KG2A 4IH6A 3M30B 3R5BA 5L1JA 2V69A 3ENWA 4K4ZA 2XEXA 1TMJA 4P75A 4NCAA 4W90B 1N5SA 4CH1A 3CCSS 1RTDB 1SQEA 4E2FB 4Q8EA 2F9JA 3TAMA 5C25B 4PKDB 2WVEA 1UEVA 2QV6A 5EDWA 4YR3A 2BQUA 1YBUA 3RBXA 5K8PA 2AHOB 2LQBA 4DLGA 3PFEA 4QU7A 3MECB 1REVB 5HI7A 2CQ3A 5E33A 5BYSA 2R2TA 3M8ZA 1FK9A 1VQKS 3CC7S 1MWYA 4FYDA 3DDKA 4TY8B 1LWEB 1U8WA 3AJDA 1OS5A 5F9NA 4NLUA 1D8ZA 1QUVA 2BABA 1GNKA 2V68A 2I1RA 3D0HE 4F0KA 1N88A 1KEKA 4P2SA 4OX8A 3N6MA 3FVYA 2RT3A 3M6UA 3FUYA 4AUKA 4DL6A 2HZVA 3JSYA 2RU9A 4NE9C 6FD1A 4USKA 4J9OA 2L9WA 3QIDA 2CQ4A 4MK7A 2DNPA 4E0DA 3KNAA 4ZVFA 4NYPA 1TUWA 5GAGU 3NWRA 4FYXB 1R3NA 3GR1A 2NXEA 2Z0GA 3WQPA 3JSMB 2VQFF 2V2ZA 4JV2A 3LP0A 1S0VA 2YKAA 3LWLA 1N33J 2ASDA 4JI8F 2C3PA 2DKOB 3W66A 4X66J 1HBUA 2E9TA 3ETMA 4LJMA 3FSYA 3DU6A 1XMOF 1MNEA 1BQNA 1Q8LA 2KRBA 4DV6F 3M8WA 3KK1A 4LF4F 1J5EF 5KG6A 3CO9A 5KFKA 2V8HA 2CYYA 1QDUB 3SSQA 1A6LA 3BO2A 1NK5A 3VAJA 2I5JA 1TL7B 3W62A 2G0IA 1KN6A 2V9WA 4LUBA 4N47A 3UI3A 4X65F 1L3VA 2KI2A 1SIWA 2VU5A 3TW0A 1MSWD 1X31C 3OFHA 1CJUA 1T9YA 1DLOB 3M1VA 3MMBB 3SZ2A 2XTEA 1GTEA 1RI7A 1NZAA 3KWMA 3M1VB 3D6MB 3HZEA 2JFDA 2GJ2A 4DDFA 1D9FA 1CVJA 5KFGA 1S1WB 1HARA 4L3NA 2IM1A 3VVTA 3TUPA 2ZNYA 3TA0A 1CSJA 3IAM9 2KKHA 5I3QA 3EXYA 1TVRB 4AL7A 1FA0A 2IDLA 2VD3A 3ICLA 2U2FA 1WUUA 2WB4A 4I64A 4QIGA 2KHDA 3CJSA 3VQTA 4F25A 2O67A 3DRPA 1WHYA 1Y10A 2DNHA 1DJ0A 2WONB 4NLVA 3BDEA 3IR7B 3RU0A 2BKPA 4PG6A 2H4WB 7AT1B 5J2PA 2CQ0A 4ZP9A 1UWAA 3DRRB 3DXBA 3GFYA 1VDHA 4DV6J 4FF2A 4X66F 1HR0J 3TAPA 5KT3A 2GQCA 4RWWA 1VHFA 4OZLA 4KAIA 2HFOA 1N33F 2IA0A 5K8OA 2VQFJ 4J9PA 1YJ7A 3AXMA 3GR0A 1URNA 4IO1A 4LQ3A 3QT5A 4C8ZA 4J9SA 3BKTA 5D3GB 3MFIA 4NZ0A 4OLOA 4JI4F 4U7UK 1J2VA 3IBWA 4C4WA 4JV5J 1DQ8A 3CMAS 2EXUA 2DGUA 2BXJA 2FY8A 4PXBA 4XIUA 2VL1A 2G4BA 2XWXA 3VEBA 4ECZA 4WF9Q 5LMNF 1XMBA 3H20A 2CPDA 3MR3A 2AV5A 4DV2F 3LGNA 1VQ9S 1LEOA 5HSPA 3RB6A 2MZQA 1G2EA 3PW4A 2UXDJ 2UU9F 3GV8B 3IAS9 2EFVA 3BR8A 3D4JA 2PO4A 4B3MJ 1M5KC 5KFHA 5LM7E 2IAJB 1L3TA 4MIAA 5C42A 2ZH1A 1ZETA 1UAWA 4DL7A 2RUGA 3KLHA 1S6PB 2FPHX 2IAJA 3QATA 1Y3KA 5EWFA 4TU9A 3O1LA 3FBBA 2HMIB 3MEEB 4ECUA 2DD8S 1RHUB 1LFWA 2V6AA 1HD0A 2CDRB 1IBKJ 2AY0A 3A12A 2DGTA 2KYZA 2VFTA 3F41A 4NCBA 3X3UA 2FC9A 3RTVA 1LKZA 5IOLA 4KBIA 2MQOA 3HHLD 4EFAC 1XR5A 3EVMA 1FRIA 4EBDA 3GFXA 3JAMY 4DL3A 3KTQA 2PI4A 2JL9A 2V8PA 1S1XA 2MHEA 3IS9A 5A76A 1YVFA 3CIZA 4PG7A 4Q2LA 5DDPC 5E41A 3G6YA 2ZZMA 3MAQA 2DGSA 1UTAA 1ZPWX 2EKNA 1YBAA 3IM8A 5A8KB 3TX8A 1NB7A 4RKUC 2GCFA 1TUVA 5DQHA 1SJ3P 1WF2A 3L09A 3AFGA 1S0MA 4DSLA 1ZYQA 4LF5F 4AYBD 2QRRA 3OBIA 2GVZB 4QJVA 5T41A 4D8JA 4FDFA 1VRTB 2GZOA 3C8YA 3PACA 4DQSA 1S5ZA 3TNVA 4YB7A 1L3UA 2KKEA 1IR1A 3R3TA 5ETQA 2EWHA 2R4FA 8RUCA 4CLSA 1YJWS 2CDQA 2F9DA 2HWHA 2J0XA 2LXUA 3GYNA 1WI8A 3K7RA 1S12A 2IFXA 4GVBA 4ZVTB 4AD6A 3M8QB 1LV5A 2DGOA 5I42A 1VQ5S 1O51A 2C2NA 1F5BA 1X5SA 4OHVA 3GG0A 4DEZA 3MMCA 4OJ3A 1KLMB 1TV6B 3MM5B 4ERDA 4HYKA 4DSKA 1N8RT 1SQGA 4O44A 2HNYB 4J7CA 2MKYA 3I31A 2H9ZA 3NP5A 3KUEA 1VQ4S 2HNYA 4ZMMA 1LWCB 1JXLA 3MEKA 1C1BA 2H3EB 3B8HA 3UNGC 1ZM4A 2DVIA 3TOQA 2HWIA 3AQOA 1C1BB 1ELOA 4ZKAA 4ELVA 3S01A 2QO3A 2XY7A 3H5XA 2IVMA 3BYRA 2HRUA 2CQCA 1FJEB 2AYGA 4NRUA 2BE2A 3FGVA 4RNHA 1WOPA 3FJ2A 4URGA 3CD0A 3K8WA 4ALZA 5L38A 1TAUA 4LQ9A 1MMLA 3OLAA 5K14A 3LPEA 2B9EA 1WG5A 3EDQB 3NL0A 2XMKA 5H1SV 1W2IA 5F0UA 3GV7B 2UVRA 2IJRA 1IUJA 2HQDA 3Q83A 2NQPA 5I3UB 4LRCA 3AH6A 2EC0A 5U47A 1TELA 2MDAA 3NNCA 4YEAA 3G8TA 4B9NA 3GILA 5HP1A 3MM7A 5LOQA 4ANDA 3PHTA 3GIIA 4QR2A 5DZ6A 2A0FB 3L9ZA 1OSDA 4PYDA 3SQOP 1RT3B 2H54B 3KLEA 2GA7A 2BKOA 4FVMA 1YRTA 4ZA1A 1FRKA 2D7SA 2JC1A 3HFZB 5F8GA 1AT1B 2RAQA 4IQMA 4RNFA 4ED8A 4EZ9A 4DG1B 4QOTA 3ITHB 1T9UA 2DPIA 4YS2A 2UUWA 4LSNB 5KT4A 1X9MA 2E7VA 2Z2YB 3MPVA 5EHHA 3D0IE 2CA9A 5E2QA 1S7IA 2ROEA 4K4SA 5KFFA 4DQPA 4UY85 1WDTA 3POTA 4I2QA 3CDWA 3UCUP 5D0HA 4CM0A 2Q3PA 1B28A 5A8WB 4WJBA 2VHGA 2GHWA 4I2QB 3S1TA 1DAXA 4DV5F 2IBOA 3T5LA 3SFGA 4PXEA 5D3GA 3D9BA 4RW7A 2R7WA 1FI4A 2AYMA 4IOAQ 2MHNA 2IIHA 4YDDB 4IG3B 3FDSA 4AXJA 2IC3B 3GIRA 4I6YA 3H7HB 2AGQA 3W2VB 4IG3A 2YWHA 3D0GE 2FJXA 3CSKA 5DM6Q 3H4DA 2ZHAA 2MKCA 1UVJA 9ATCB 4I69A 5B09A 2R7TA 2CPJA 2ZBQA 1TL1B 4ZCLA 1R43A 3J81j 1K73T 1SCJB 2XZDB 4EO6A 3OSPA 3WC0A 1JLFA 2R3VA 2RVJA 1KQFB 4AL5A 4JYAJ 1OO0B 4OZ0A 1FVQA 1H7WA 2GJIA 3SYZA 1X4BA 3GLJA 4DV3J 5F3ZA 4DR6F 1WEYA 2F63A 2MKIA 4YMEA 5A6WA 2QYCA 4TQRA 2R9LA 4PUOA 2MQQA 3Q8PB 2RJZA 1NRKA 3FBCA 3HVTB 4PWDB 2W8KA 1VQSA 3CCWA 5KTQA 5KFBA 2R8GA 2PDAA 4C8YA 3E01A 3K5PA 4DI6A 3FKBA 2D3OR 2WVDA 4XDCA 5E3CA 4W98A 3SCJE 2Z58B 2OP5A 4ECYA 2FIUA 2RU3A 4EGLA 3AB4B 2O1PA 4R0JA 1C1CA 3BKFA 5B0GA 1FT8A 5ETLA 1VRQC 3N01A 4U7CA 2W9BA 3D5MA 1HBNA 4TVAB 2J6TA 3RW6A 3LGHA 4C3MA 4C0OC 1RAHB 3CJKB 2DJWA 1Y0HA 3BGFA 4HL9A 2C28A 2BRLA 2GIRA 3MOZA 2QC3A 2L41A 4DR5F 2HAIA 1IBMJ 4NLWA 4JI1F 2RQ4A 2XY6A 4RNOA 1ROFA 4USWA 2C2MB 5KFQA 3R6GB 2R8JA 4EYIB 3NNHA 3LJPA 4ZLJA 2CQ1A 2ILZA 1YJUA 3DOKB 1NJXA 1U0HB 2MKJA 5CHCB 3I4HX 2I8EA 1EETB 2CNOB 4ELTA 1ZAVA 1Y00A 4YFUA 2Y8WA 2FJAB 1B01A 2GVZA 1NK4A 1HPZA 1NPPA 1PYTA 3HHEA 4KGMA 1D09B 3ZC4A 2AX1A 2JEIA 3K17A 4YUDA 3C46A 4NMLA 4EEYA 4DV4F 1BUXA 3IGVA 4CM2A 1ICEB 3NEKA 3ET6B 4IH5A 1KKHA 2VA3A 5ITHA 2X51A 1WOOA 1HWJA 3SDEA 5I42B 3FSIA 4NXMF 1BGXT 2FJBB 3ET6A 2B3TB 4K5RA 1G4CA 1GFWB 1MW7A 1HYSA 3GIKA 5HMYA 4H4KA 1XWLA 1HD1A 3V5RA 3ZO7A 1QVFR 2ZZTA 2B8PA 3L3CA 4J37A 3UN2A 3UN3A 2EK1A 2HVEA 1ZA1B 3ISND 3BREA 3OTOF 2MLYA 4IDKA 2FVCA 1YITS 1MYKA 2X3DA 2FD2A 4HTJA 1NSQA 2GW8A 2VG7A 1HWUA 4TYAA 1EIYB 3PV8A 2JXIA 2LXIA 3KLIA 3D1QA 3MPWA 2VG7B 1IBLJ 1UETA 3MR5A 3IG1A 2PA8D 1RT5A 3NS5A 5HROB 2B8QA 5GADU 4NPOA 1X0FA 3MOJB 4X2BA 2XZ2A 2G1HA 3DM2A 1XNQF 1DURA 4LR9A 1S6PA 3HSJA 2K1OA 3VV2B 4EZ6A 3MEGB 6FDRA 1S9EB 1L3KA 1TKTA 1YJ9S 1YHQS 2CPYA 2BW2A 2HIYA 2WSFC 1FRXA 1R0BG 3UO0A 2Z30B 4DPXA 3H40A 1QSYA 1U6ZA 3GFHA 2H1YA 2R2UA 1EQ0A 2CNNB 1FDBA 1YQHA 2XLJA 4JI5J 2LVWA 3UE2A 2QTWA 4B3RF 2RQMA 2VQEF 5CABA 2XY5A 3L7UA 3IS9B 4LF6F 5IQQA 2NUUG 3PJWA 4DPTA 2G2OA 2XTJP 3T6JA 4CTAA 4NI2A 2QFJA 3PW5A 3NY0A 1KRPA 4FXEA 4IFVB 1WKKA 2ZD1A 1MN9A 3I4PA 2X1BA 4PPDA 5L9NA 3EE3A 3UDLA 2DHHA 2Q2KA 4QIEA 1NEEA 2OEJA 4ZP6A 1S4FA 2RHSB 2YH1A 5F8HA 2B5JB 1N4LA 4PZVA 2UXDF 5B0CA 3TUIC 2DHGA 1Q79A 2QGFB 3M30A 3J81Y 4K4WA 4RUCA 2VONA 4I2PA 1CJKB 3TEHB 3BGRA 5C5JA 1QVGR 1NUEA 1C0TA 3OUYB 3TARA 3C6UA 1S1VB 2A3JA 3BV8A 5LL6d 1CC8A 1ZA2B 5BR8J 4WFBQ 3P49B 1DARA 2YXLA 1UEKA 4DSIA 1ARQA 1U25A 3A3NB 2M70A 1YBTA 2XI3A 3MECA 4ATNA 3M8SA 3G9CA 3E2EA 5KFUA 3BBCA 3MMCB 5DETA 1W2BR 4PG8A 1FE4A 2N4DA 4JP8A 1OY8A 1CJTA 1T0TV 2M5YA 2RRBA 3QIPB 2CPZA 3O2IA 3W2WA 2KFYA 2DTJA 1T9XA 2F40A 1IQZA 4J5OA 4F04B 3OW2R 4WP9A 4YN3B 1VBXA 2R7UA 2GAGC 1F9EB 5ETVA 3UDVA 4WP3A 5M2RA 3MTKA 1U09A 2BNZA 3RB0A 1DQ9A 2I0XA 1K9MT 2ZHOA 1RWMB 2ZH2A 5EX3A 4NXNJ 3S8SA 2AJQA 2BM0A 2R8KA 3A4TA 3D28A 3I87A 2KOEA 1VJQA 2OPRB 5IQ6A 1SV5A 4HKQA 4K4TA 3HM9A 4I0WA 1HNXJ 4NA2A 1Y5LB 2FHJD 2PI5A 2LU1A 1RE1B 2DNMA 2F7VA 4LVNP 1TK8A 2HNZA 1D9DA 2O3DA 2UUBJ 2HHWA 3HVAA 4FS1A 2ZWPA 4PEOA 2FVPA 1CJVA 2E9ZA 2IJNA 3AA8A 4H4KC 3SIPB 3HT3A 2C2DA 3D7SB 1R0CB 2OEKA 3J80U 1QAXA 1YRUA 4F36A 3TZYA 2KT3A 5F8JA 3CD7A 1VC6A 3H0PA 4ECTA 2YPYA 2DISA 2W9BB 2FY1A 4DSJA 3MR7A 2F4VJ 2RMLA 1PCAA 2RQKA 1GX6A 1MU2B 1RBAA 2OPPA 3AAWB 4YDXA 3BZQA 3VQSA 2C1EB 2UUCF 2V8DA 4H4MA 3NGSA 4N5SA 2HEKA 2YWWA 2IA6A 1FKPA 3LAMA 2Y1RI 2C2EA 3CVKA 4DG1A 1SC6A 3TZZA 3VAIA 3PHEA 4CH7A 3JB9k 1IR2A 1OHNA 2AJ2A 1RWVB 2XSJA 1U0HA 4UT4A 4K5SA 5DQGA 5CD4H 1Q95G 2R8HA 1QSLA 4EYHB 3PYFA 1FNXH 4USIA 4C7QA 2OTLS 2GX8A 2XMMA 1RTZA 4TXSA 2D3O1 4DR2F 3C15A 5HQ8A 5IT9Y 4ZVQB 1FJCA 1RABB 2QEXS 1HNWJ 2IVFB 1MYLA 3WBZA 4A8MP 2DGQA 5HO4A 4N76A 4UQTA 2NYHA 3KDOA 3D1OA 3SQGA 1S97A 3I5BA 1NBEB 3VZIA 4FF4A 4QIFA 2H4YB 1QJHA 4ED4A 2JLGA 3EWGA 2VPWB 3AQPA 2YNHA 3NCRA 4L76A 2MKSA 1TUGB 3R7SB 4Y2CA 2IC3A 2XMUA 4RW9A 2POKA 4RL1A 2BE9B 3H8YA 3LAKA 1X7VA 4DHVA 2WSEC 1X4DA 2DNGA 3FEXB 2N7CA 2BEFA 3KKFA 4A8XA 2HG4A 1E6YA 5ETSA 2IM0A 3F44A 3NBPA 4LBIA 3HVRA 4LRBA 1PJ7A 2GO9A 4J9UE 2WRMA 2P9CA 2P8IA 2QL7B 4OX9F 4LFCJ 1CLFA 5E5NA 4UTGA 4WYWA 1ACMB 3SSSA 2OTJS 1JWWA 1ARRA 2D41A 1V3SA 2MSSA 2QLFB 1F6TA 2J76E 2JLEA 3GFZA 5AXLA 1Q81T 3EPIA 1ITPA 2YY3A 3GB0A 1LFPA 2XYGB 1SH2A 2ZC3A 4NASA 3QGPA 1PYOB 1IXKA 4QR1A 4X4TA 2HNDA 4XK8C 4PUOB 3P6YC 4DFKA 3THPA 1NKBA 1EKSA 1WKJA 3CJ3A 3QGIA 4H4OA 4FF1A 4X64F 4HDHA 4XTTA 1XN9A 3KUHA 2B9YA 2XNQA 2FLNA 2XO7A 4GC7A 5J2NB 1RLDA 4KGKA 4YP3A 3BO3A 1NHUA 1RHJB 3KFWX 1U1MA 4B9LA 4QBUA 2EPIA 4NX9A 4B9MA 3ZFVA 3TP2A 1QAIA 2KH9A 3DMJB 4DF4A 1YTYA 1Q82T 2ZDPA 3US5A 4DWIA 1DHMA 2IM2A 2IRUA 4P7TA 2BZ2A 4NMXA 5G0RA 4LFAJ 2XZWA 2FDNA 5F8MA 3D67A 4USUA 2ROPA 4UY8T 2OIHA 3PYGA 3T5HA 1FKOA 4EWTA 4RNNA 4DMZA 5HLFA 4DQIA 1XBWA 3CCUS 4X4NA 1RYSA 4LBPA 4K7QA 1JB0C 1JXEA 1IBCB 4CTAB 1S9GB 3UFCX 4RNMA 2MKKA 2CIMA 4P74A 4DFPA 4H54A 2K7KA 2FHJA 2H1OE 5KFTA 3OHAA 2H5IB 4DV0F 1NO8A 2W2PP 4NLQA 3DI6B 5ETKA 2I6WA 1M0SA 1KR4A 5KT7A 2PN6A 3FK4A 3T3FA 1UA1A 2ZH4A 1WORA 2R7OA 4FXWA 1JLCA 3UWTA 4O0IA 2UUBF 1WC3A 3A3OB 2V4JA 2X3GA 3OTDA 4GC6A 5CZVA 1H98A 1D3WA 3J7Z5 2IYGA 2CZ4A 3IGNA 5HMWA 1EARA 3LO3A 3K59A 2ZM6F 3BH7B 4HHUA 3UQSA 2LQ9A 1UPMB 1Z1ZA 2HK2A 4QQBA 3QO9B 1OPZA 1S0NA 4MK8A 2BVZA 4NZ7A 2J9DA 2RNEA 4NXNF 2DXEA 2DNKA 1HBMA 3KG0A 1TMMA 2FJDB 3C16B 1JMTA 2LQ8A 2WVCA 4MIWA 1NJWA 3CC4S 1QTGA 2GIQA 2NLWA 3GSIA 2V34A 4WFAQ 4JI0J 2BJ7A 1HQUA 2BJ9A 4ZDNA 1HNWF 4PG5A 3MHYA 2YX1A 3MM9A 4DR2J 4O4GA 1X5PA 1ZBTA 1DTTB 3TI0A 3UR0A 2F65A 3CNQP 3OFEA 3MM9B 2M9KA 4DR4F 3AD8C 4K4UA 1O0PA 3DM2B 2JBVA 2J7KA 3VHQA 2VPXB 4EMDA 4JV5F 2DIVA 4NA3A 2XB2D 1BC6A 5KFVA 3OL9A 1OIAA 1UW9A 3QT8A 1RBLA 3M2UA 3LWMA 1WF1A 5BR8F 1R6YA 1Y5IB 3HFVA 1JLAA 2UUCJ 4HTIA 4XDDA 1JLAB 3MM7B 1U1QA 5KG3A 3N5BA 2L9DA 1X4GA 3KK2A 2F8EX 1U7LA 4CLLA 4ED7A 2BQ3A 1O6XA 1RU1A 2P5VA 2VASA 1KFDA 3A8IA 2VIHA 3BN4A 1WHWA 2R2SA 2MGZA 3CTRA 4LSZB 4URSA 3QZ7A 4CDIA 5B0BA 3KYLA 2JNJA 5SUHA 4Q43A 1RBOB 3QGHA 2EW9A 4X4RA 3G8SA 5CCMA 1HKAA 2ZNZA 3V6KA 3MPUB 2IYIA 2BM1A 5E3QA 2VQEJ 3H2LA 3W60A 5B08A 1N5VA 1XC9A 1SC3B 2G2ZA 1HNXF 2KFZA 2LKZA 2JFKA 4NYOA 4C11A 2N3OA 2E5HA 1YJRA 2GHVC 4C48A 4MKBA 4ZVUB 2LLZA 2V50A 3QT7A 5KFSA 5J2MA 2C42A 3M7VA 3ZTRA 3SEOA 1YKWA 4FYVB 3NNEA 2ZH7A 2HFVA 2PC6A 5GMEA 3EYZA 2HS3A 2HRTA 2M88A 4CNYA 3BSOA 1S7HA 1M5OC 2B51A 2CPEA 3MPDA 2AJ0A 3Q2TC 2K8GA 2QG9B 4OMFG 3W2VA 5J2QA 3KJFB 4QCLA 2E1PA 4HDGA 4X4SA 4ZK7M 3T1HJ 1CEZA 4NCGB 4M5GA 1HHTP 1OG7A 1YK9A 1S6QA 1P1TA 2Z8QA 4RR5A 5D0RA 4F4YA 4QW8A 4USMA 4IKAA 1AFIA 1RAFB 3FC9A 1RT1B 4WU3A 5KT2A 1HW8A 4OI6A 3CGIA 3L95X 2ZH8A 2C22A 1IM6A 3GZ7A 4WWSA 1RT1A 1L3SA 1VK8A 1Q4RA 1WI6A 4PABA 2UVWA 5HVFA 3DFEA 4KSEB 1VK3A 4X4PA 1RADB 2HFUA 4MK9A 4BLGA 3JSMA 2J6SA 1S1TB 4NXMJ 1CPZA 3ILJA 3UPFA 4NLRA 5KFIA 1RTIB 4F4XA 5IC4B 4P2XA 1VQ7S 2ZJRQ 4OYAA 5BJRA 3HPOA 1RTIA 2DRDA 3BGLA 5DLFA 1L5UA 4CLKA 1C1CB 1LWXA 4WIQA 1PBUA 1S9FA 5HANA 1PGZA 4LF6J 2CZVC 4DPOA 4G3IA 4K2XA 2I5JB 2DBBA 3EPGA 4OYOA 1TR0A 5CYMB 1NK0A 4JI5F 3QYYA 1TP7A 3BQ0A 4V19J 2DB1A 1T9WA 4TY9A 2LCWA 2VBWA 3I0SB 4M1KA 4M5NA 3OVSA 5C7PA 3T5JA 5ETPA 4FS2A 4ZLPA 5L39A 2HFZA 3EX7B 2YQ1A 2Z2MA 3PCOB 2DNRA 4DR5J 4QPTA 1MLAA 2XSJB 3IRXA 2BOPA 2V63A 2ZOFA 3DOMA 1T9VA 2F8MA 4DSEA 2DGVA 4ANCA 2XMVA 2J6UA 1WC0A 2MY8A 2XSFA 5CH7B 5FDLB 5B0DA 5IT4A 3LUYA 4FP9A 1GAOA 1UCNA 1FD2A 1XK8A 1KHVA 3IM9A 4KRWA 3RZAA 3TA1A 3PVXA 1M5VC 1Z2ZA 4N8OA 4ECVA 4ER8A 1N52B 1SJ4P 1JLCB 1PJ5A 1WKLA 1OY9A 4OQJA 2ZVSA 3NRBA 2ZEJA 4C8KA 2CQIA 2PFDA 3M6WA 2HAFA 5D4OA 4PQUB 2HIQA 2VBXA 2J7WA 1NLKL 3EVOA 3GU0A 3F0NA 2MQLA 4DR6J 2V9KA 2D3ZA 4CT8A 4FBTA 2W7AA 4TN2A 1S1UB 7FDRA 4BC7A 4B9SA 1OQ6A 2HQGA 1VQNS 1JLEB 5DG9A 1P8GA 2CJAA 3DKDA 1JLEA 3EZOA 4LRDA 3EZUA 5IWAJ 2K3IA 3EMTA 4X62J 4QWEA 1JNZB 3E51A 5T7LA 3IG1B 4G65A 3T1YJ 2I38A 2J9DE 1M1GA 1JLQB 1V9OA 2LP4A 4KIAA 3TUJC 2CFXA 4A46A 1HNVA 3ZZ0A 3M05A 4ZN3A 1HNIB 4ED1A 2QL9B 2BRKA 5C2CA 1JLBB 3B6BA 3L7OA 3QWPA 1U1RA 3MGJA 2YQ3A 1D1UA 3TJAA 4DV5J 1JQGA 1X4CA 3HHLC 2CJBA 3NGKA 2HMIA 4DJBA 3PYDA 1B7FA 4ECWA 2WAQD 4JOUA 4UOGA 5J1EB 1VC0A 3PO5A 2CADA 3ULHA 3TZXA 2CQHA 3DMJA 4YQWA 1NCLA 2XG8A 3B4MA 5ETMA 1KC8T 4TYBA 2WBMA 4NA1A 4OYXA 2FZCB 4Y2IA 3OVAA 4UOHA 1IKYA 2WBRA 5HLFB 2HHVA 4K4XA 3W5XA 3G87A 1XJWB 2EG2A 3LW5C 2CXEA 1H2UX 3CJ4A 2RE1A 4RBUA 3PR5B 3CB4A 1LK5A 3MR6A 2DRAA 4HV0A 4DX6A 1R6VA 1RHKB 2B5JA 2VICA 1NU4A 4MKVA 3H87C 2ILYA 4IRKA 1I1GA 3CCZA 4G1QA 1XTZA 4MFBB 2ROGA 1H0HB 1YI2S 3WIUA 4USVA 1R7IA 3OR1B 1RLCL 2ABYA 4KGXB 3TVKA 3HJVA 3ZZZA 3SV3A 3W8PA 1TK5A 2PIIA 1B0VA 4D3GA 1UMJA 1VQ6S 3NGUA 4JYAF 3ONQA 1SL2A 3AODA 4URQU 5E7OB 1VMBA 4W92B 3QSYB 1CQNA 3VF0B 2MB0B 3HMJG 1EKRA 5D78A 3QRRA 4NLXA 2KDOA 3LH2S 1FK9B 4ELUA 1V3ZA 2JH3A 4CO3A 1LWEA 2VFSA 3T41A 4CO2A 1JJ2R 3DRYA 4J9VA 1WHVA 3JXOA 2Q43A 3QMQA 3QJLA 1X5TA 2K5JA 2XMTA 2SXLA 3KJVB 2B9XA 4IR1A 4ZCMA 2PFFB 1SUQB 3KJVA 1G1XA 1RT4B 3LANA 3K5MA 4GKJF 2MYFA 2CKWA 4DX7A 1HQUB 3DLKA 3TYTA 1RHQB 1RT4A 5KG0A 3CC2S 3U27A 3HP6A 2DNLA 1RCOB 3DLKB 4KHMA 1QE1B 2BE2B 2WOMB 5LSRA 4USJC 2HHHJ 4L6V3 2A1BA 1F0XA 2QSFA 3V6JA 4M94A 2YNGA 2G1DA 3H59A 2QIFA 2NCKL 3CCTA 1CS4B 4QYZJ 4HT7A 4IOBA 3O8WA 3GP9A 2AZ3A 4K8RA 2V1TA 1BLUA 1ZOTA 2HURA 3O3LA 3SI8A 2F8HA 2MZJA 3BR9A 4MAKA 5HBMB 1F5AA 1Q8IA 4ICLB 4K0KJ 4GKKJ 1NNDA 2QN6B 4DV1J 2PGCA 5HP1B 2HHSA 1VLOA 3UD4P 1K1SA 2PA3A 3DYAB 2XULA 2V4QA 3FMBA 1KWMA 3IWNC 3P45B 1G3OA 3G8QA 3DYAA 2IVYA 2NS1B 4CP5A 3TX0A 4CZCA 4CIOA 5D4PA 1KOHA 2XHWA 2BQRA 3BB5A 2CWKA 5AXKA 3PXGa 4FZVA 2UXCF 3MEDB 1P9QC 2RDDA 1H2VZ 1S79A 4N41A 1VJWA 4CO0A 3IR5B 2ZBPA 3DXSX 3M6XA 4P2FA 2M8HA 3I82A 5CQGA 4KHPF 3H2VE 4KKOB 1FWKA 1SJFA 3CMQA 1U1NA 1FTCA 1KQSR 2CG8A 3GXQA 2OKQA 1J5OB 3W7BA 2VG6A 1TL5A 2CG4A 4ES1A 1R8PA 3ADAC 3LTOA 3MCMA 5CA5A 4RW7B 2KFNA 1H74A 2YNHB 4C0BA 4YHHF 3KHLA 4RW9B 3CULA 3LP1B 4U67Q 1VCTA 2DHAA 2RIJA 3FSXA 3BBFA 1HMVB 2KT2A 4N8NA 4EBCA 3CJ2A 1Q16A 3OR2A 5DRKA 1SKUB 3JYTA 2KJVA 5L1KA 3DNCA 1NHKL 4NCGA 3QLHB 2YTCA 3SCKE 3F56A 5LMNJ 3D6HB 3EGZA 3FQLA 3MM8A 1JK9B 1Y11A 3LP2A 3QLHA 4RO0A 1WACA 4ZS6A 1S1UA 2ALYB 3G2XA 4F7VA 5HL7Q 1WC1A 3UD3P 4Q8FA 4R0EA 1SL1A 2K06A 1ZTWA 1VBYA 1F1BB 2HQCA 4QWAA 4UUWA 5M2UA 4OZNA 1AXQA 1XNRJ 2AGPA 4O3RA 3N79A 2MZRA 3W5ZA 4P6QA 3PX0A 2M3DA 1J5OA 2K7JA 3DOLA 3QNWB 5IT0A 1FESA 1VBKA 4ZLLA 3PW0A 4LF5J 2XO6A 3V4MA 1HR0F 3PY8A 5J2NA 1SJ1A 1N56A 1QAJA 1NAQA 2R2RA 3MEEA 1Q7YT 4B3TJ 3NCQA 2PEHA 4DL5A 3M9OB 1Y4ZB 1GXLA 2E1RA 3G82A 2DEIA 2D68A 1WD6A 2L9NA 4WE1A 5IC6B 4CWBA 3FMWA 2YH0A 4OZ5A 3VGSA 3N9UC 1VLYA 4CI0B 2XGPA 3CCJS 4AL6A 1C4AA 1NDPA 3W1YC 3O44A 3Q8RB 4ED2A 4C8LA 4TLQA 5AT1B 1IBKF 3CJKA 1U9PA 3GCXP 2OGUA 3P8BB 4MH8A 1IKYB 2DHXA 3BQ2A 1HWLA 4A8WA 1U2FA 4NLPA 1UFWA 3MAHA 3I32A 3SXLA 5L1LA 5I3PA 4UOFA 1JNRB 1HW9A 4Q5VA 2H3AA 4ECXA 4FBUA 2J0SD 3V2UC 3QT6A 2VC0A 4Y65A 2ZOMA 2YNFB 1TL3A 2NZCA 3O5TB 3WC2A 4O4RA 1H73A 2O5DA 3DLJA 3RW7A 5H9FJ 4DX8H 3AXKA 3HKZD 4ITSA 5AXNA 3DRPB 2UU9J 2RDJA 1VI7A 1RT6B 3W9HA 5F8LA 1BQMA 4R5PA 2MQNA 1NSAA 2IRYA 3HULA 3GQCA 2VB6A 2B43A 3K57A 1RT6A 1S0OA 4NLSA 1J5EJ 4OYIA 1U1KA 1JIHA 2KHCA 2HS4A 4M5JA 3AX2A 1AA1B 1MG7A 1Q86T 1QM9A 4ZVSB 1OM2A 3HHDA 4ZPWR 2VUGA 4DOZA 4FPIA 2ZITA 2CVIA 4ILRA 3G6VA 2UXBJ 2B4VA 2FZGB 3EGVA 2AZ1A 2VF3A 4K4VA 3I9ZA 2LECA 3UCZP 1SKWA 3RR8A 2LQJA 4MKYA 4JI6J 1WC5A 3JQMA 3MFHA 1OYDA 1KLMA 1TV6A 3MM5A 4CLYA 4QWDA 1VRUB 4JI6F 1VGYA 2ADBA 4RBTA 1UWBB 3QQCD 3CCQS 1AROP 1KVKA 2HQIA 3T6BA 2UXBF 2JEJA 5IZHA 2ADLA 4E8UA 5A6PA 3DLHA 5EWEA 4IOCQ 3OL6A 2RB7A 4NEZA 4O3SA 1M1HA 1JKHA 4I67A 2IMOA 3NXZA 3J7YI 4R8UB 2DNNA 3R1LA 1RWOB 3QWUA 3OFGA 2RRAA 4F2SA 4DS5A 1KQGB 4OI4A 1KD1T 2OSRA 1E6VB 2EFPA 3V4IA 3PDNA 2YKMA 2XNRA 3V4IB 2Z4PA 3M2UB 2KG0A 2VFRA 1VS3A 2HYIB 3HHNB 2UXCJ 2RS8A 4J91A 1RWUA 3PIPQ 2K29A 1P94A 2LXFA 2YWFA 2FGOA 2FHOB 4OYBA 3KG1A 5H9EK 1HHSA 2GMLA 4LF1A 3GTYX 4HHJA 3MDFA 2WCXA 4DR3F 2W8LA 2BV3A 2HLTA 4X65J 3OFFA 1FRHA 1HIYA 1R8HA 3PRVA 4AXIA 5JXSA 2HQ3A 3KG4A 4AFFA 4CO1A 2AEFA 2YQ0A 4YR2A 2MMYA 3BEGB 2FVSA 4P52A 3CJTA 3N28A 2HS0A 5KFEA 1UVLA 2XS2A 2G9OA 2EFNA 2GMJA 3TQEA 3RRHA 5KFWA 4ZHRB 4TU7A 3AD7C 4LF4J 2W2QP 1CC7A 4LREA 2XS7A 4KFBB 3PR4A 3KMSA 2AT1B 2B6AB 2OPQA 3IMQJ 4MKAA 5DM7Q 2EC2A 1M5SA 3GIMA 2QZ8A 3C19A 2WW8A 1RCXB 2R42A 5HATA 1V3RA 2IMWP 2VPZB 2NZ4A 4DCJB 3TAMB 5C25A 3KK3B 3PKMA 4WTOB 4KKOA 4F2RA 1KTQA 1S4EA 1S1VA 1RKJA 1LW2A 3PRBA 1WG4A 1REVA 3PO4A 1R31A 3TQ1A 2CJKA 1JJ4A 2CPIA 4BDPA 2K2PA 2QLJB 4MYTA 1KDNA 3KLGB 1A0OB 1ZPVA 4KHRA 3PG9A 3TEGA 1PG5B 1X9SA 4B08A 3PTWA 4XPEA 3A3PB 1F3FA 5HMZA 4LFBF 2ZOGA 2XCPA 3D3CJ 2Y1LB 4YHHJ 4USHA 5LMUJ 1KVIA 4WBFA 1Q78A 4Y3CA 3QBCA 4DV7J 1SUQA 3Q22A 2B0GA 3LP2B 3GIJA 4X84A 4ES2A 5HVHA 3CWJA 1N6QA 2GHPA 4XAKA 4OHZA 3KHRA 1LW0B 2XHCA 1YGYA 4PWWA 5ETTA 4DX5A 1DTQB 1V5VA 2XBPA 4HT5A 2E7WA 2OLWA 2YNGB 4IQXA 1CULB 1SV5B 3HFKA 2ZH9A 3WX8A 4FPRA 3UN5A 2AJ1A 1BQNB 3IBFB 3NWGA 5KFDA 2Y1IA 3NOCA 5DDQC 1T02A 1KONA 4L75A 2X1GA 3TJ8A 1YRXA 4ETXA 1IRQA 3JSBA 1U1OA 4QYRA 4RWXA 4I1TA 2K1RA 1QTMA 3MUVP 1V6HA 2VFVA 4L74A 1ZM9A 1RJJA 3OD2A 1TZ0A 5J1PA 2B4OA 2U1AA 2K6LA 3U1MA 3KHGA 4OFZA 3M8PB 4ZPAA 4WE1B 2AN7A 1SJQA 1UFKA 2YKPA 5B0AA 4OHWA 4DV1F 4K0KF 1GH8A 3M8PA 4B3SJ 1ZM2A 3GJRB 4LF9F 2BKNA 4KT0C 1B0TA 4OZ1A 1S6UA 3B4DA 4M5MA 1EQMA 1BXNA 1VISA 1UZHA 3I0RB 1PYSB 3VGUA 3DOKA 1X93A 3MEDA 3N0VA 2LQ5A 1X9WA 4F67A 1OYEA 1VQLS 4RX6A 2IJFA 2GJFA 1MWZA 1S1WA 2D1CA 2LEPA 1JJCB 3CDAA 4KYZA 2HHHF 3QRQA 2FJEB 2BMBA 2UUAJ 1N36J 3IP0A 3EJMA 5KOXA 4X4QA 3R1HA 3RB3A 1BQMB 3R6LB 4O0NA 4R5PB 4DUYF 1BWVA 1I6JA 2AP6A 2DR9A 4HH0A 4RU9A 4Z7CA 3SQGB 3W8GA 4U6PA 1FO1A 3MD3A 4GKJJ 3RBZA 2LEAA 2MQPA 1UKUA 1H2TZ 3M2RA 1GXUA 3P96A 4NL5A 3SDEB 3TJ9A 1U49A 1F9FA 2BNWA 3QSIA 1KLNA 1TAQA 2DK2A 3ZZUA 4CLZA 2ACYA 1RAJA 2E66A 4U8VA 2HQFA 4ENOA 2F4FA 3NGRA 5DLGA 4A8YA 4O3QA 4ZPVR 2W4PA 2YBVA 3DDNA 2B4PA 4F4AA 1I51B 5E3RA 2KJWA 1BAZA 1IVZA 2LMIA 2QL5B 3R5DA 4B9VA 4DFMA 1VQMS 1UA0A 3Q8QB 2JVOA 2O66A 1ZH5A 4CO4A 1YZ7A 1EP4A 3JTPA 1N54B 3R5JB 2HBZB 3UCGA 3OTEA 3R97A 4JI3F 2BX6A 2RD5C 4B9UA 1TKXA 4RW4B 1JLBA 4M5IA 3ENAA 3BSNA 1E6VA 3CD6S 2VOPA 2VBZA 4RW4A 2R7XA 1FDAA 4TQSA 4AAIA 2HVDA 1H3DA 1S9EA 3KLHB 3MURP 3THVA 4IR9A 4KPYA 1FDNA 2DITA 4KO0A 2V2QA 2FJWA 4AQYF 5EUHA 3DN9A 1SBRA 4Y28C 1VOMA 3RB4A 4GKKF 3MCSA 3H4BA 4ME7E 2RS2A 3AWRA 1HBOA 3IRWP 4I56A 4PAAA 1NPRA 1HWIA 5L9XA 7FD1A 3DRSA 2VOOA 2GMHA 1ZZNA 3FRYA 3VAFA 4WFNQ 2CVEA 1FE0A 3A8JA 2HSEB 3ILLA 2CAXA 3M6VA 3FT7A 3MF5A 3QFHA 4TNOA 2XM3A 5IFMA 4IFVA 4FF3A 2P6TA 5K8MA 1IM4A 4TLRA 3CXCR 2QFIA 2KTQA 2G0CA 3DLEB 2JXGA 4JB8B 4RUAA 1S72S 5D4LA 3BDPA 3HZGA 4G6VB 1WTBA 4DR3J 3T1YF 1FFSB 4ZPDA 3U1NA 4BC9A 1OSCA 2HVIA 3M2VB 1KVJA 2B7BB 1PILA 2W4CA 4FVCA 4KGVB 4KH1B 4BWMA 5KFRA 4XPCA 2OEMA 4GVBB 3W61A 3M2VA 2HGMA 4P2MA 5JMNA 5IWAF 1C0TB 1U26A 3QGGA 3Q8SB 1RTDA 5A2QU 2CQBA 3RGIA 2IPOB 2Y3YA 1VIXA 1U24A 3R5GA 5HQLA 2J7UA 1RK8A 2M8DB 1Q5VA 3Q8YA 4OLPA 2AQ4A 2ZZNA 5F8NA 2CPFA 2R7RA 1J27A 2AF6A 4OZ2A 3H5YA 4NYZA 4Z37A 3CCMS 4B3OA 4K4YA 2RQCA 1FXDA 5DZ7A 5E3PA 1PAUB 1WEXA 4Y2KA 4JI2F 2AIRB 2CNKB 3G6XA 3V6DB 2W01A 2RDIA 2LDYA 1LWCA 3FZ2A 5HMXA 4DL2A 1NJIT 2AU0A 1P27B 3TO8A 2Z2LA 5KG5A 3CT9A 2VG5B 3MD1A 2LEBA 2RILA 2Q1LA 5D15A 3KLIB 1YJVA 3MI7X 2ZH6A 4DUZF 3RRKA 5M2PA 3OHBA 1ZTTA 2QMUB 1KSPA 5IT9U 4KC5A 1R0AA 1NHVA 1DTQA 3ZXWA 1R8AA 1CS4A 1N32F 4NLYA 2YKMB 2GIFA 1CULA 1TKTB 3K0JA 1RWNB 4F4ZA 2ZFHA 1HBUB 1N5YA 1CJVB 3Q24A 2IRXA 1PKUA 5JJBA 4QZVB 5KFOA 1NDKA 2NXJA 3PFOA 3QAEA 2XLIA 3IN5A 4ED0A 3NKYA 4ID8A 1GMWD 2DNQA 2FLPA 2GC8A 3R5AA 1FNMA 4KTQA 3M9MB 3TRGA 1EA4A 1PJ6A 1X4HA 4ZJLA 1U1PA 2OPPB 4MT1A 1OY6A 4PWUA 3J80Y 2YX7A 1SH3A 1WC6A 2YKOA 4ES3A 2CJYB 2NXUA 4ZVRB 3BJYA 5FLXU 2BW7A 3RRGA 3G86A 2UZAA 2OUGA 3I0RA 2WB1D 2XYHB 4WKYA 3AX5A 2CJQA 5KT6A 2FHKA 2M7SA 2G2YA 1RISA 1N0UA 1Q53A 4B02A 3JTOA 5HAOA 2V94A 3BGRB 5HVGA 2FLLA 1BWEA 4F26A 2DR8A 3QZ8A 3RAQA 2HHXA 4B3TF 4KGZB 2E5IA 2Q6BA 1U8SA 2YWGA 3JQKA 4ZP7A 1Y9OA 3UNYA 3VEAA 2MLXA 2KL8A 2JXHA 1Z2LA 5K9FA 5J2PB 2N82B 1T11A 4OYWA 2WK4A 3TZWA 4IG0A 1JLGA 3PYEA 4DBQA 1XEZA 3SMZA 3U7JA 3KLGA 4IG0B 2QLBB 4WK3A 2XTCA 1CJTB 3T1HF 1M90T 3HHLA 5IM0B 3OR2B 3AHPA 4ETZA 3JYTB 3VAKA 4WFXA 2FC8A 1QLNA 2V67A 1XNRF 3FMTA 3K89A 2PMHA 2VC1A 3KOAA 2H51B 1TU0B 3OL7A 4FXVA 4ED3A 2BR0A 3NMAA 1TK0A 2FVQA 1OPIA 4CLPA 2OJ3A 3HJFA 3R9LA 1RZMA 4ZVHA 1FWLA 1U2CA 3KDNA 2I2YA 4NLOA 2B9WA 5B0FA 3KUGA 1K1QA 1R8CA 3Q8VA 3S7RA 1PIEA 1RAGB 1Q8KA 1U02A 3GYGA 1B70B 4LFCF 1RTHB 5CYJA 1FTRA 1BMQB 2Z57B 2ZH3A 3RJMB 2X1FA 2ZE2B 3CJ0A 1U45A 2WHOA 3OJSA 1X4EA 4OYZA 2M0GB 3H2UB 3BM7A 4X4VA 1GK8A 5D0GA 1KNZA 4X4UA 4RBVA 4WYLA 1HI8A 1WWHA 1ZZFA 3M32A 4LSLB 1B99A 2EG1A 5AJ3F 1VFJA 3M32B 5GAHU 2UP1A 4JV1A 1GTHA 3L7PA 5KFPA 3A1YG 1IKVB 1T8EA 4KHPJ 3J81U 2HVZA 1TL7A 3NG8A 4UUXA 4JUZA 3N6NA 2HPUA 4OX6A 2RRNA 3L4BC 1Q7LB 2A2BA 5G0RB 4OHXA 1XIQA 3RYLA 3AD9C 4EO8A 3K8VA 1DLOA 4Q45A 3MWBA 1D0EA 1VYAA 3FCWA 4CT9A 3DRSB 2QLWA 3GJSB 3I0SA 4MTPA 4PXCA 4P71A 3ZTOA 2A2CA 5F9LA 4IO9Q 4LF7J 1T94A 2ZUGA 2A6MA 2XMAA 2W7PA 1WC4A 1NH8A 4DR1F 3AY0A 4CLUA 3KLVA 2MSTA 5A8KA 3G6ES 1BDTA 4B9TA 4J9NA 1U1LA 3OV7A 4PYAA 2DCUB 4KH0B 2E29A 4Y2MA 3SSRA 1HPZB 4HACA 1DZ5A 2KT5A 2FJVA 3F73A 2HZCA 2K9IA 3NAIA 1NH7A 2DR6A 3GMGA 4PR6A 1N34F 2PD1A 1VQOS 3PIOQ 5ETNA 1T9TA 4DUTA 1Y5NB 5IV4A 3G96A 1M5HA 5DG8A 1HLWA 3I56S 2DH9A 4MMOA 3NMRA 2KB2A 1IKXB 3M8QA 1HNZF 2RKIB 3ELHA 1FJGJ 4J9RA 4RU2A 2GV1A 4AE5A 4DV2J 2OI2A 1Y3JA 2RKIA 3QJPA 2EBEA 2JVRA 1QY7A 1UWBA 2AJFE 4LF8J 3V6DA 2AX0A 2FYXA 1PSDA 3PW7A 1HBMB 2VKZG 5HQMA 3J7YU 1MMDA 2ZDOA 5KFAA 2PEBA 3K5LA 1UVMA 2C2ZB 2B56A 4DLEA 3ZTQA
chains in the Genus database with same CATH topology
2XMJA 2A2DA 3TA2A 3I6PA 3MM6A 5F3TA 2V4RA 1PC5A 2QA4S 3V81B 3C3LA 4RUHA 4Q0BA 2W9CB 3SFUA 2D9OA 3W3SA 4Q0BB 2XI2A 1KQKA 2ZHBA 3TANA 1WG1A 1R0AB 4ZPBA 3AA9A 2D3UA 2FVRA 2R7QA 1BY9A 1XR6A 3UDCA 4PCQA 2QMXA 1M5PC 1HQEB 1XERA 2KXFA 4CO5A 2QLXA 4LFAF 3QJJA 4R25A 4C8NA 4FN5A 2DNYA 1A9NB 3BGUA 2KXNB 2R8IA 4N77A 4KB7A 1VQ8S 2OD6A 1IQTA 3ZZPA 1FF2A 2HHQA 1SL0A 2N4CA 3SCIE 2ZD1B 3FFIB 5FJ4A 1MMNA 4DS4A 3FFIA 1S6OA 2EI5A 3OXFA 4DQQA 3EUNA 3I5CA 3VWSA 2JEGA 2CQPA 4J9MA 5J2MB 2D74B 4DR7F 2FLOA 1D9AA 1RT2B 5KFMA 1IN0A 2JDJA 2V4JB 4A8QA 5AE3A 2HRYA 1WELA 1ZAXA 5JVGQ 1C2PA 3ZZOA 2JRSA 4LFCF 4LIWA 3HK2A 1HWKA 1YG0A 1RTJB 4EU0A 1QUPA 5KFJA 5AE1A 3DHWC 3DHXA 3TAQA 2ATLA 1H6KX 1U1PA 1NKCA 5E0OA 1XR7A 3CDUA 2AW0A 4X62F 2DR7A 2HGLA 4Y6IA 1UJ5A 4CH0S 1LK7A 1YJTA 3EXCX 3W2WB 2UVVA 1S76D 2A10A 2NUHA 1WNEA 1O8BA 5GVQA 3OTBA 4A48A 2R7SA 1JLFB 3VTIA 1SH0A 2OMLA 3GSDA 3HHKA 3X1LB 3N6LA 1RDRA 2VA2A 3MR2A 5K14B 3MUMP 2OO4A 3HVTA 1M1KT 3T19A 5KFZA 1SKSA 3OVBA 3KK1B 1T3OA 5I3UA 2UV8G 2DH7A 2HNZB 4NLDA 2YKQA 2WSCC 3T9NA 2ZJPQ 3D54A 3C6TA 5BYRA 1VQYA 1X4FA 3HX9A 3QAUA 2BBEA 1MROB 5KG1A 4Y00A 5KFXA 4OX7A 4C0HA 1XMQF 1W25A 4FXDA 3KLEB 1FKPB 2VFUA 1MU2A 2V0NA 3BN7A 2KVIA 3PEJA 2JOQA 4LVOP 2FGCA 4M8LA 1R8BA 2MY7A 2O01C 4LMZA 2E5JA 3GE9A 4NZ6A 1T05A 3K5NA 1X5OA 4ZVGA 3POTB 4QW9A 3PEHA 2C3UA 4XO0A 5DO2A 1DQAA 3D2WA 4ED6A 2QA2A 2V5HG