1SH0A

Crystal structure of norwalk virus polymerase (triclinic)
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
502
structure length
502
Chain Sequence
b'GTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVNED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA Polymerase
molecule tags Transferase
source organism Norwalk virus
publication title Crystal structure of norwalk virus polymerase reveals the carboxyl terminus in the active site cleft.
pubmed doi rcsb
total genus 162
structure length 502
sequence length 502
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 1sh0A02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1sh0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sh0A03
5J1EB 3C6TB 1C0UA 2JEIA 3KHGA 3M9MB 3DRRA 1DLOA 4ED6A 2IMWP 4IFVA 2J6TA 3C6UB 2HMIB 2C2DA 4PQUB 2W7PA 2E9RX 3BQ1A 1TVRA 1VRTA 4TLRA 2V4QA 3RAQA 4M95A 5DG9A 1HPZA 3V81B 2W8LA 5HLFB 3NBPB 1S0OA 3DRSA 1JLBB 1GX5A 4R0EA 5HBMA 1S9GB 2YNFB 3BR9A 4URGA 1LWFB 3RBEA 3OL7A 1BQNA 3GYNA 4J9RA 3DLGA 3V6DB 3CIZA 2W8KA 5EDWA 4O3SA 1EETA 1XR5A 4RW8B 2UUWA 1T94A 3DRPB 3TQ1A 2C22A 3DRRB 3RB0A 5F8NA 4PUOA 1N56A 4Q8FA 3KJVA 4ZVFA 1RT6B 1S9EB 5KFQA 1IKXA 4ECXA 2FVCA 1J5OB 1S1VB 1RT3B 2BANB 4RZRA 5KT4A 1T3NA 2OPQB 4MIBA 1TV6B 4ECZA 4I2PB 1S9FA 2JC1A 1VRUA 4MFBA 4JV1A 1NNDA 2FJWA 5KFHA 4K4ZA 2B6AA 2WOMB 4KHRA 1SV5B 1IKWB 5I42A 1TP7A 3KLHB 2IC3A 2OPSB 3H4DA 2ASLA 5HP1B 3H40A 1RT6A 1S9EA 2D3ZA 4EO6A 4LSLB 2RKIA 1CSJA 3DYAA 4O3OA 3Q8RB 1XR6A 2DPJA 1BQMB 4B3OA 1RA7A 4ZHRA 1RT1A 3I5BA 2RDJA 3BSOA 4QPXA 4NCGB 3I5AA 1S1XA 2DPIA 3N6NA 5KG3A 4EO8A 4IRCA 1HYSB 3N6LA 3MEEB 1FK9A 1HQEB 5HLFA 4JUZA 3TAMB 5F8HA 1JLBA 1TL3B 3PW2A 2I5JB 3I5CA 5KFJA 3E01A 4G3IA 4ZP8A 1JLAB 2YKNB 5KFTA 2XGPA 3DMJA 4IDKA 4EBDA 2BRLA 1TQLA 2YKMB 1RT2B 3IS9B 2R8KA 4H4MB 3GV5B 5DGAA 4NLDA 3QZ8A 1S97A 5D3GA 2IM1A 1JXLA 5J2QB 1TKXA 1DLOB 1HQUB 4RW6B 3C6UA 4KBIA 3TAMA 2ASJA 4IG3B 1RTIA 1HNIB 3D28A 3KLGB 4GC6A 4PQUA 1T05B 1JLEB 3GQCA 4DL3A 1EP4A 3MF5A 2IAJB 5FDLB 5KG4A 3QLHA 1SH2A 3KK1A 4URSA 2GIRA 3ISNC 3QGIA 3KLHA 3ISND 4ICLB 5L9XA 3IGNA 4U6PA 1S1WA 4KV8A 1TL1B 1NHVA 2CJQA 2VG7B 4EYHB 4O44B 3M8PA 2XCPA 1JIHA 3IRXB 4ED7A 1LWCB 3LP1A 5KT7A 4EEYA 4QWBA 4QWEA 4DG1A 3PVXA 3LANA 4EYIB 5I3UA 4WFZA 1RT4A 4F4XA 2HNYB 2VG6B 3HVTA 5DLGA 5L1LA 3HKWA 1U09A 2ZE2A 4ZMMA 1TV6A 3KK1B 1S49A 4MKBA 2OPSA 4ICLA 2WONA 2VA2A 3H5YA 1S1WB 4IOBA 5F8MA 4KV8B 2WK4A 2W9CA 3NGDA 2IC3B 2HWIA 2YKMA 3BQ2A 3H5XA 2B5JA 1JLGA 3NMAA 3DLKB 3QIDA 2QV6A 3FRZA 2R8HA 4O3PA 2W7OA 1LWEB 1LW0A 3UDLA 4RUAA 4IKAA 3EPIA 3OSPA 2IBKA 2ILYA 1HQUA 2R8JA 3T1AA 3GV8B 1N6QA 1W25A 3I0SB 5C24B 3M9NB 4WFXA 1TKTB 4MIAA 4QW8A 5KT3A 2IM2A 3KHRA 3FDSA 4ECWA 1RTDB 4TN2A 2FLLA 4ZVEA 1TL3A 4TYAA 2C2EA 2AGPA 2AGOA 4F50A 1JLAA 4IFVB 4DL6A 1RA6A 3MR2A 3KOAA 1TL1A 3DI6A 2JLEA 3SFGA 1S6QB 2BE2A 4Q43A 4WYWA 4MH8A 4DG1B 4O3QA 5I3UB 2XI2A 1K1SA 4KKOA 1S48A 1TKXB 3KMQA 3LP0A 4I2QB 5J2MA 2IA6A 2RF2A 4YR3A 1RTIB 3KLGA 1D0EA 3DRPA 3T5HA 2YNGB 3N6MA 3KLEB 3KK3B 3UR0A 5KT2A 1IKXB 3MTKA 4K4SA 5FDLA 3BGRA 3H59A 3M8PB 1I6JA 3DOKA 3QO9A 4ECQA 3LP1B 2HNZA 3D5MA 2E9TA 5KFYA 4FS1A 3IG1A 3DLKA 4I2PA 2VG7A 4NLOA 4TY8B 4ZP9A 3V6JA 5J2NA 3H2LA 4IQXA 1LWFA 3MECA 4IG0B 4MK9A 5DQIA 3MR5A 4J9LA 4Y34A 2GC8A 4RU9A 5KFDA 3GIIA 5KG0A 2V9WA 1S6PA 4LSLA 5L1KA 4J9MA 1R0AA 5KFVA 5KFNA 4KFBB 4YMEA 1BQMA 4B3OB 3KJVB 3H4BA 3DDKA 3CDWA 1JKHA 1MU2A 3QZ7A 3RAXA 2BR0A 2W9CB 2ZD1A 1S1XB 4TY8A 4KAIA 2HMIA 2XWYA 3KLVA 4K4XA 4ECRA 1JLGB 1HMVA 1HPZB 5DGBA 4ECUA 2I5JA 3NAHA 3Q8PB 1TVRB 1VRTB 5KG1A 5KFPA 1REVB 2YKNA 4RW9B 1S0MA 1LW2B 3BJYA 3V81A 4O4RA 1S6PB 4NRUA 2RF2B 4HKQA 3H98A 5KFAA 1JLFA 4I7FA 3IGVA 5HP1A 5C5JA 1C1CB 2F8EX 5KFWA 1RTJB 4KHMA 1RYSA 4IR1A 3GIKA 4K4UA 2V0NA 1RT7A 2FVRA 3DOKB 3QO9B 4IR9A 3OL6A 4K4TA 1QUVA 1QE1B 3CWJA 3NAIA 3KLIA 4ZVGA 3RB6A 4K4VA 3IG1B 1SH3A 2OPQA 1S1VA 2WB4A 3PW4A 2FJVA 3E51A 5KG5A 2FLNA 2IAJA 2UVUA 1RT5B 4I7FB 3UPFA 1MMLA 2VA3A 4J9QA 2J6SA 3GIMA 1HNVA 4R5PA 4KO0B 1HARA 2HNDB 1FKPA 4J9PA 1RT7B 1RT2A 2FVQA 1KLMB 1DTTB 2YNGA 3KLEA 2AU0A 1QAJA 3CJ2A 4WXOA 3NL0A 2VG5B 2D7SA 1C1BA 5CYQA 5KFOA 4RNMA 5J2PA 3OLAA 4Q44A 1C0TA 4ZHRB 4TXSA 3PW5A 4MK7A 2ZD1B 3CJ4A 5J2QA 2BQUA 4WE1B 4NLTA 5KFUA 1TKZA 4ECTA 3OL8A 3ITHA 5KT5A 5DG8A 3V4IB 5KFGA 3MFHA 4XPCA 1HYSA 2ILZA 1NHUA 5L1IA 3MEEA 4TQSA 4URQU 4TY9A 3VQSA 1IKVB 3DLEA 5KFBA 1RAJA 2CKWA 4NYZA 3GIJA 3MECB 1JLQB 4IG0A 4LSNA 1SH0A 4K4YA 4KFBA 5JXSA 4J9KA 2OPPA 3QGHA 5KFXA 4H54A 3V6HA 4ED8A 3T5JA 4NLQA 3G86A 2BQ3A 1XR7A 4Q0BA 3FQLA 5EWFA 5F8JA 1OS5A 4ECVA 1R0AB 1LW0B 2WCXA 3LAKA 2FVSA 3IS9A 4RNNA 1GX6A 4F4YA 2ALZA 2UUTA 2HNYA 3HVTB 3BSNA 1LW2A 2GIQA 4O4GB 4F4ZA 4DL5A 2C2RA 2E9ZA 3SFUA 1RT5A 4ED0A 2XC9A 3RB4A 4NRTA 2WONB 4RW4A 4NLGA 3QIPA 4WXWA 5KG2A 2BRKA 4IH6A 3EPGA 4QWCA 1RTJA 5KFEA 4RNOA 3QLHB 4NLWA 5KFRA 2ATLA 4PWDA 4EBEA 2QE5A 4IH7A 3JSMB 3M9OB 1ZETA 3Q8SB 2UVVA 3CDEA 2D3UA 4R8UA 2R2SA 1LWEA 1FKOB 3JYTB 3OLBA 4J9OA 3OHBA 1ZTWA 4J9SA 3DRSB 4OL8A 5KG6A 1N6QB 3DOLB 3H5SA 1RTHB 2YNFA 1ZTTA 1SUQB 1S4FA 4F4WA 4ECYA 4PUOB 1S1TA 1EETB 4RW8A 2JEFA 4U7CA 2XCAA 3LP2B 2IJFA 4DEZA 4Q45A 5DQGA 3FSIA 2JEJA 5KFIA 2VG5A 4DL2A 5J2PB 5J1EA 3OHAA 1HNVB 4R8UB 1RYRA 2B5JB 1FKOA 3JYTA 1DTQB 4Y2CA 2R2TA 1KLMA 3HVAA 1JX4A 3G6XA 3MEGA 5F9LA 4K50A 1TKZB 3MFIA 2EC0A 2YNHA 3GV7B 5C25B 4NLXA 2R8IA 1RTHA 4WYLA 2R8GA 2AX1A 4FS2A 3LP0B 3FFIB 5HROA 1SV5A 2WTFA 3QYYA 3BSCA 3ICLA 2I1RA 4ZP7A 5KFKA 4IRKA 3PZPA 4QWDA 2C28A 1RT1B 2OPRA 3KK2B 4DL7A 3KHLA 3IN5A 3CJ3A 3MEDB 2W9AA 1KHWA 4WZQA 1C0UB 2HWHA 2IM3A 2AGQA 4ECSA 4ZPDA 2HAIA 3DI6B 5DG7A 1C2PA 5K14B 1VRUB 4NLRA 2FVPA 4O4GA 4KKOB 4ED2A 4QWAA 5J2MB 3CVKA 4MK8A 5F8IA 4ZPBA 3SI8A 3RB3A 3QIPB 1N48A 3LAMA 1S9GA 3T19A 1C1CA 4YQWA 4M94A 1S1TB 3PJWA 4H4MA 3H5UA 4X2BA 2AX0A 3LP2A 4J9NA 2YNIA 3QGGA 3CO9A 1JKHB 3PR5B 2R2UA 4RW7A 1YVFA 4RNFA 4ED1A 2D41A 4IG3A 1DTQA 1T05A 2HNZB 5CYMA 1HMVB 1RT3A 2BANA 5T14A 1EP4B 4QW9A 5C42A 5KT6A 5C25A 3V6KA 4H4OB 1JLEA 1UWBB 2JEGA 3BREA 4NLSA 2JC0A 5EWGA 4O3RA 2W9BA 4XO0A 4R5PB 1Z4UA 1S10A 1S0NA 3RBDA 3DM2B 4G1QA 4IRDA 2FJXA 4MKAA 4TYBA 2UVRA 4YR0A 4LQ9A 4O44A 4IFYA 3PW7A 1N5YA 2B43A 2AWZA 3KLFB 1RT4B 4JV0A 1N4LA 2V4RA 2XI3A 2RKIB 1QE1A 2WHOA 3BSAA 4LQ3A 3EZUA 3KLIB 4KB7A 4RUCA 5JUMA 2OH2A 3V4IA 3FQKA 2ZE2B 5KFZA 3I0RB 4YR2A 4DL4A 4NLPA 4ZPCA 4NLYA 3FFIA 2YNHB 5K14A 1FK9B 1HQEA 3DM2A 4G1QB 1T03B 1JLCB 5DLFA 1REVA 4RW9A 1JLFB 2AQ4A 1FKPB 4ED3A 4IFYB 3G6YA 4Q0BB 4TQRA 3KLFA 4EBCA 3MEDA 4HYKA 3UQSA 5F8GA 4XPEA 1LWCA 3I0RA 2OPRB 3M8QA 4KSEB 3KK2A 1IKYB 2UVWA 2ASDA 4K4WA 2R2RA 5D3GB 3I0SA 4FBUA 3ITHB 1TKTA 3DLGB 5C42B 3V6DA 4RW6A 4FBTA 1S1UA 5C24A 4H4OA 4O3NA 1HNIA 5KG7A 1UWBA 4NLUA 5HBMB 1IKVA 3CJ0A 3DLEB 3CJ5A 3MR3A 2O5DA 4NZ0A 5EUHA 2W9BB 4ID5B 5KFFA 2OPPB 3MR6A 5L1JA 2YNIB 2HNDA 3C6TA 1KHVA 1DTTA 3PJXA 2WRMA 4RW7B 1IKYA 4KO0A 1C1BB 4KE5A 5CYQB 5KFSA 1N5YB 2IM0A 1C0TB 5CYMB 3IRXA 3Q8QB 4ZP6A 4JV2A 3PR4A 3NBPA 3DOLA 5F9NA 1S1UB 3NKYA 2WOMA 1SUQA 3OL9A 4WE1A 1WNEA 5KFCA 4ZPAA 4IH5A 3BQ0A 2VG6A 4ID5A 1T03A 4RW4B 3BGRB 3OSNA 3PHEA 2J6UA 2BQRA 4NLVA 3KK3A 5DQHA 2IJNA 5KFMA 3HHKA 4RNHA 3GILA 1J5OA 4PWDB 2ZKUA 4NCGA 1JLQA 4LSNB 3MEGB 5KFLA 1K1QA 3DYAB 4ZVHA 2XGQA 3JSMA 1S6QA 2BE2B 3LALA 4Q8EA 5F8LA 1RDRA 3CDUA 5J2NB 3M8QB 4GC7A 3TVKA 4MFBB 3KNAA 5HROB 4WZMA 3KHHA 2B6AB 4Y2AA 3DMJB 3HVWA 1IKWA 4I2QA 4IDKB 5I42B 5EWEA 3T5KA 3PW0A 4WFYA 1IM4A 3KMSA 3E01B 3T5LA 4YP3A 1D1UA 4Y3CA 1BQNB 2RDIA 2FLPA 1RTDA 1JLCA 1MU2B 1QAIA 3G6VA
chains in the Genus database with same CATH superfamily
3VVTA 4U7UD 3K5MA 3KG1A 1TK0A 5A8KA 4ED6A 2XHCA 3HHLC 5E2QA 3H2VE 1M0SA 3GYGA 4CLFA 2E9RX 5D6GA 1IJEB 1TVRA 2A2DA 4CLZA 2MGZA 4M95A 4WKRA 1UW9A 2HVDA 4GVBA 5DG9A 1YBTA 4DV7J 3NBPB 1NXIA 2NPFA 1N5TA 4PG8A 3M6VA 1NU4A 3AA9A 5HBMA 1FNXH 1H3DA 2KRBA 5D77A 2DGXA 4YY3F 2DNZA 1S72S 3RJMB 1EX8A 1KN6A 4OV1A 5B0EA 2KN4A 1T94A 3C14A 3ZNJ1 2K2PA 1Q4RA 4B08A 5HO4A 3UD4P 1D9FA 3DRRB 1KS2A 4RU2A 1IJFB 1WHVA 2COLA 1FESA 4WK1A 4PUOA 1XERA 1RT6B 2E66A 4Q8FA 3W63A 3T9ZA 1JB0C 2FVCA 2RQ4A 1U1PA 1J5OB 1U8WA 4C6AA 1RT3B 2BANB 2ZVIA 4MAKA 5KT4A 3TX0A 2VJVA 3PIOQ 2VU5A 1VQ5S 1S9FA 4OIXA 3A4TA 1X4EA 1U6BA 4FNHA 2VJUA 1HLWA 2PT0A 2RAQA 1GXLA 1XK8A 3PYFA 3UDCA 2C1EB 1T11A 1RUSA 2QX0A 2WOMB 4KHRA 3A13A 4L74A 2K1OA 2OPSB 3MGJA 2Y1JA 3PKMA 1MNTA 1OPIA 1RT6A 4PPZA 1OM2A 1TL7B 2MLYA 1YI2S 2K7JA 2RKIA 4UF4A 2AJ2A 2OEMA 3Q8RB 4M1KA 2DPJA 3A3NB 4DR2J 1SKRA 1I94J 1BDTA 1FRKA 1RT1A 2KXHA 3O1LA 3BSOA 4W98A 4PKDB 4QPXA 3NNAA 1JXEA 3I5AA 3H8YA 4B3SJ 5IC4B 2DK2A 3S8SA 1CJTA 4DR1F 1FK9A 4KPCA 4LRAA 5D0RA 1PBAA 4OZ1A 3TAMB 3CSKA 3I32A 3PW2A 2F9DA 1X9WA 4I67A 3RYLA 1HBNA 4X66F 4ZP8A 5A8RB 4WF9Q 2C2NA 2VODA 1V3SA 4I6AA 2XLIA 1EQMA 1M1GA 3BEGB 5HJXA 2KH9A 3DDIA 1RT2B 3IBFB 2AN7A 3D0HE 4NLDA 3QZ8A 4I69A 1JXLA 3TUZC 2EWHA 4R0JA 2FGCA 2F4FA 5J2QB 1UVKA 1S6OA 1HQUB 1WEYA 2LYVA 2ASJA 3TAMA 1M1HA 1NB7A 4IG3B 3KLGB 1K8AT 4GC6A 4PQUA 2XMWA 1JLEB 3MTJA 4LSZB 3GQCA 4DL3A 4ER8A 3MXHP 1PIEA 2HS3A 1EP4A 3W5ZA 1CJUB 4OYWA 3B8HA 2QC3A 1RJJA 3QPIA 1SH2A 1S5ZA 4HACA 4URSA 1KD1T 3QGIA 3VHQA 2HQCA 2ADCA 1U9PA 2NSBA 3OFFA 4F3OA 2R7VA 4ED7A 3IRXB 1REGX 1AFIA 2KT2A 2JJ4D 4DG1A 4KHPF 2HFZA 5E3AA 4CYUA 4EYIB 4ECXA 5I3UA 4WFZA 2BABA 3HJVA 3R1HA 2DGSA 3JXOA 4CM2A 3OVAA 3CMES 3HVTA 3EICA 1Q0NA 3D68A 3HKWA 4CO4A 2EFVA 4ZMMA 3UNYA 3SYZA 3MUTP 1NK6A 1RE1B 2F8HA 2GVDB 2W2NP 4TVAB 5B0CA 1IBKF 1ULRA 2A3JA 1Q86T 3H5YA 5DM6Q 5F8MA 4WFNQ 4DV1F 2MKKA 5IWAJ 1H38A 2XTCA 1GT8A 2UUAJ 1FVQA 3BQ2A 4PQAA 4GKJF 2B9YA 1B3TA 1MLAA 4C8ZA 4O0NA 1D8ZA 2I38A 2R8HA 3FRZA 1ZPVA 4O3PA 2RIJA 4K2XA 3BN4A 4OZJA 1QAXA 3U1MA 3OSPA 2IBKA 1HQUA 3X3UA 2AJFE 3T1AA 2R8JA 4UOFA 3L9ZA 1N6QA 1LOUA 2FC8A 3R2CJ 1JNZB 5C24B 3M9NB 3BKFA 4MIAA 4QW8A 2MQOA 1LK7A 1NM2A 2J8SA 3R6LB 4FP9A 2E5HA 4FDFA 4OX8A 2UUCJ 3C8YA 2AGPA 3FMTA 2E7WA 2ZDOA 4ZPWR 5HMZA 1N8RT 4IFVB 4PPDA 3TP2A 3UCGA 2LVWA 1WI8A 1NK7A 3DI6A 1S6QB 2E1CA 3EUNA 2KM8B 3FZBA 1HBUA 2G0IA 3G87A 2P2CB 2DXEA 4B9MA 4P52A 2CJYB 2Q6CA 2XI2A 4A8XA 1K1SA 4KY3A 3IR7A 1YRXA 5LSOA 3TZZA 1OMSA 3KMQA 4V19X 1GMVA 3OUYB 2IA6A 2FB0A 2RF2A 4YR3A 4AUKA 4QYZK 2NQPA 1QSSA 1SKWA 1IRQA 1S77D 2YNGB 3TZXA 3KLEB 3DLLQ 5IT9U 3KK3B 5T7LB 1G1XA 4BCAA 2JL9A 2IVFB 4P10A 3W64A 1RAEB 3GG1A 2HNZA 3D5MA 2LXIA 1YX2A 4U7UK 3IG1A 1SXLA 4I2PA 1VQ4S 1HBOB 4FYYB 3M2RA 4JV5J 1FWLA 5LJ3Y 2PMZD 4NLOA 5EGYA 4TY8B 4HHUA 2QLBB 4ZP9A 2HGNA 4KQZA 1CLFA 3V6JA 4I0WA 1AYEA 1TK5A 3MECA 2ZJPQ 1N34F 1IN0A 1MN9A 1WKJA 3K8VA 2D9OA 4N77A 2I0XA 2GIFA 1VJWA 3GCXP 2MY7A 5KG0A 4P2FA 4WIQA 1Y3JA 2DHXA 2P6SA 2X51A 4LSLA 4ZCIA 3CCRS 1KEKA 2EVZA 2QZ8A 5KFVA 1R0AA 2DGOA 4KFBB 4OHVA 5LSLA 1NJIT 4B3OB 3KJVB 3P4UB 2DH8A 4OX9J 3CDWA 3RAXA 3T1YJ 3I4PA 4BC9A 4TY8A 4KAIA 5IV4A 2H51B 2HBYB 4ECRA 1B70B 1T9XA 1RAHB 5AE1A 1HPZB 1RU1A 3IR5B 2I5JA 1U1LA 4EZ9A 2EFNA 3NNCA 4RW9B 2YKNA 1S0MA 1NJYA 3V81A 3M6WA 2GX8A 3EGNA 4ZIVA 3B82A 4O4RA 1GK8A 2XS2A 2F4VJ 4HKQA 2W7AA 4LF2A 3MCOA 3M8ZA 4BWJA 2YPYA 5KFAA 2XYHB 1ZM9A 3IGVA 2RU3A 5HP1A 4NOHA 1Q8BA 1MG7A 1Y5NB 2C2OB 4RJVA 5SUHA 4IR1A 1QUPA 2GO8A 4K4UA 1RT7A 4N8NA 3QO9B 3M05A 2V2QA 5CABA 3OL6A 2LXFA 3CWJA 1QE1B 2MZRA 2AJ1A 4LRFA 3RB6A 1SH3A 2OPQA 1S1VA 1VMBA 3HSDA 5EX3A 4YHHJ 1VFJA 1U2FA 2XY7A 2OSRA 1T02A 3NOCA 2HHPA 3GB0A 4DS5A 3D9BA 5K8NA 1AZSB 1OY8A 2OEKA 4KGVB 2VV5A 2F8MA 2UXDF 3PFEA 3W61A 4CNYA 2J6SA 6AT1B 4J9PA 1U1OA 1RT7B 1R7IA 2BYCA 3Q8VA 1LKZA 1DTTB 1Y5LB 2YNGA 3KLEA 1Q82T 3KTQA 5IWAF 2CQGA 3NL0A 2XS7A 3GTYX 5KFOA 5J2PA 1B28A 2EK1A 4JB8B 2H5IB 2PN6A 3MMBA 4TXSA 2OAUA 3B4MA 1NSKL 5KFUA 1YZ7A 2DNHA 4ECTA 1FF2A 3OL8A 2MZSA 3KDNA 5KT5A 4I6WA 5KFGA 3RZAA 1KQFB 3TRGA 2BE7D 2W1BA 3TWZA 4WK3A 3MFHA 4LF5J 4Z37A 3MEEA 1UW4A 1FEHA 4URQU 2MXYA 1Q81T 3MM7A 4AFFA 2WSFC 5HMWA 1VC0A 3MECB 4J9VA 1BGXT 4KR0B 3ILJA 1ZAVA 4FXDA 1D3WA 2CG4A 1TZ0A 4DPWA 1OS5A 1R0AB 3HHLD 1LW0B 5CZVA 1NEEA 3HMJG 4RNNA 2CWXA 2MEWA 3CC7S 4M5MA 5D0GA 1Q78A 1QLNA 3FT7A 4F26A 2ALZA 1UCNA 2UUTA 3AX3A 4DJBA 2BVZA 1GH8A 3MCNA 2JVOA 2HURA 2FYXA 4PR6A 4DPUA 1GEHA 4DL5A 2R4FA 2E9ZA 3PO4A 2M5YA 4YB5A 3CCES 4ED0A 3RB4A 4RW4A 3VGVA 3OR1A 1Y9OA 4K5RA 4IH6A 3EPGA 1KLNA 2O3DA 1DBDA 1S76D 3QLHB 2VKRA 3NMRA 1FHTA 2FTRA 4I4BA 5ETPA 2QE5A 3UN2A 2KT5A 3MPWA 2PD1A 3Q8SB 3PYEA 3CDEA 3SQOP 1H6KX 2AEFA 2LECA 5L8RC 3OLBA 3US5A 2MJNA 3BH6B 3EGWB 3GONA 2ERRA 2KOEA 2MKYA 1SC1B 4BS2A 4DL0C 2DD8S 1GXTA 1ZTTA 1HW9A 2MKHA 4F4WA 1ZPWX 1S1TA 3ZZPA 4ZITA 2IJFA 1WTFA 2VL1A 3IFEA 3WZ0A 4ELTA 3FSIA 1GQEA 2XO6A 4R25A 2HHHJ 2B5JB 1FWPA 2MKJA 3D2WA 5D15A 4K59A 3HVAA 1JX4A 1MWQA 3MMAB 4GVLA 2ZC3A 3HO1A 4X4SA 2LU2A 2H4WB 3A8IA 4NLXA 3QBCA 2R8IA 1B0VA 1WI6A 4JI5F 3AQPA 1BE4A 3W2WA 1ZZNA 3FRYA 2R8GA 3P6YC 2XNQA 3EVWA 1ARQA 2M8DB 3K2YA 3FFIB 4K5SA 4RUBA 3KXDA 4IO1A 1PILA 2XULA 1KKHA 3IBCB 1UZDA 3UNGC 3R2DJ 2QA4G 1WC5A 1WD6A 3RBZA 4NASA 3AAWB 3IN5A 2JDJA 1VBKA 4DV4F 2HYIB 3PYDA 4U67Q 4N41A 1PKUA 1NPPA 1RSCA 2AZ3A 2FIUA 5KTQA 3KG0A 4ECSA 4X4RA 4L73A 3BBCA 1CJTB 1M1KT 1C2PA 2VPYB 4USVA 4A4JA 4DLGA 1SL2A 1FDBA 1VRUB 3J80Y 1QD1A 4KKOB 2GHPA 2WAQD 4PG6A 4GO5X 2B9XA 4DN9A 4ED2A 2PI4A 1CVJA 1KVJA 1N32F 5F8IA 1NK5A 4ZPBA 2R3VA 1N48A 3DDNA 3LAMA 1FFGB 4F25A 1C1CA 2YBVA 3GFXA 3DLBA 2CNLB 1LQ9A 1K9MT 3H5UA 4X2BA 2QRRA 1SVDA 1B4SA 1VQSA 3G96A 1P1LA 3I82A 1ZA2B 2H1OE 1JKHB 2H48B 3CO9A 1OYEA 3O2IA 2D41A 2DNRA 5GMDA 3W60A 2WZ1A 5DETA 3CPWR 1PJ6A 1JK9B 2ZWOA 3K17A 3M2VB 3RW7A 3QT6A 1T05A 4ME7E 1EP4B 5FLXU 4QW9A 2IRUA 3TR5A 4U8YA 1JLEA 4FXVA 4PABA 1WHXA 3AD7C 4ZCKA 2JEGA 2YKOA 4DFPA 1QY7A 1OPZA 2LP4A 5EWGA 2AYMA 1HWKA 1ZA1B 4DV3J 1N36J 4XO0A 4CO1A 1S0NA 1B01A 3MPDA 3RBDA 2HHSA 4G1QA 3WC0A 3HI9A 3G6ES 1ZS6A 2I9SA 1BLUA 2GPEA 4TYBA 2UVRA 4YR0A 3BF4A 4LT6A 4LQ9A 4O44A 3BPSP 1SBRA 2VKZG 1H2TZ 1T0TV 4HEA9 4U8VA 7FDRA 3FCWA 4JV0A 5IZHA 2OD6A 3KLFB 4J9UE 2XI3A 2RKIB 2WHOA 3EZUA 4KB7A 1PC4A 4DR5J 3TAPA 3NNHA 5JVGQ 1Y00A 1YTYA 2QL5B 5KFZA 3AOCA 3R7NB 4YR2A 2ZH2A 1UJ4A 4DL4A 2CZ9A 3BPDA 3T1HJ 4B3RJ 4NLYA 3JQJA 3S6EA 4X66J 2A6MA 4YB6A 2YNHB 3QSIA 1FK9B 3W8GA 5DLFA 3C19A 2XLJA 2CA9A 2DR5A 1OHNA 1REVA 2K3IA 1JLFB 3LGHA 2HS4A 2MYFA 4UZBA 1FKPB 1X5PA 1OG7A 4WKYA 3G6YA 3L09A 4TQRA 1UAWA 1X4FA 2RBFA 3MEDA 2MKSA 4DFMA 2E7VA 1NUEA 2BKNA 1R0BG 2MLXA 2OELA 2FJEB 2FC9A 2GMJA 4KSEB 1B0TA 5GAGU 3FK4A 2HQIA 4K4WA 1UPPA 1VR6A 5CAAA 3MCSA 3THPA 1TFWA 2RE1A 3GSIA 1YRUA 3EGZA 1H98A 4LBIA 2K8GA 3KKFA 5C24A 4O3NA 2E5LJ 2SXLA 3CCJS 3FJ2A 5HBMB 4GKKF 1HBMB 4EUVA 3MR3A 1BWVA 1TTHB 2IA0A 2M9KA 2GV1A 2W9BB 3A3OB 5RUBA 3JAMU 1UEVA 2NUUG 2OPPB 3LJPA 4Z7CA 5L1JA 2XHWA 1U1NA 2NCKL 3K5PA 4FYDA 2LQJA 3N4WA 5E41A 2QLFB 2DRDA 1XNQJ 2RT3A 4AQYJ 2XMVA 5KFSA 4F0KA 4MKVA 2JXIA 1C0TB 3SCKE 2CQ1A 3PDNA 1RHUB 1VDHA 1VQ9S 4A8YA 1A9NB 2UXCJ 1WNEA 2GAGC 5IOLA 5KFCA 4IH5A 3GWCA 3BO3A 2NZ4A 2R7XA 1U2RA 1TL7A 3VV2B 1O0PA 1O6XA 3JSBA 2BQRA 4NLVA 3EVOA 3KK3A 4DF8A 4C97A 1T7PA 3HT0A 5KFMA 3NGKA 3ENAA 2LKZA 2C3MA 5LMUF 4NCGA 1JLQA 3VAJA 4WIIA 4RUHA 1U47A 4PWDB 3BGOP 5KFLA 3JSMA 2KO1A 4MYTA 2XSJA 1S7HA 3OVSA 5F8LA 2VDHA 3M2RB 2JXGA 1N0UA 2DGWA 3GJTB 2R7TA 1APSA 2CFXA 3AX5A 4DV6F 2BDPA 4ZVUB 1VQYA 3C2PA 4GVBB 3KHHA 1N32J 3DMJB 1SQFA 2Z8QA 1OWXA 1KONA 1KOHA 3DGPA 3E01B 3IMQJ 3MWBA 4P71A 4YP3A 4ZCLA 3EMTA 1RTDA 2AF6A 4BBYA 2M2BA 2BJ3A 1M5VC 2HLTA 1JNRB 1QDUB 3T6JA 5J1EB 1I94F 1RAGB 3MCMA 3DRRA 2IMWP 2FHKA 2J6TA 2W2MP 2A1BA 2HG4A 2F63A 4DV0J 4PQUB 3TJ9A 2WVEA 1VRTA 1FRIA 5HJYA 1RZMA 4FVMA 2V4QA 3RAQA 5A6WA 4LF6F 1KTQA 2XWXA 2W8LA 3D67A 3V81B 1S0OA 4K0KF 5MLCV 3DRSA 1JLBB 1GX5A 3DHXA 4LRBA 1UVMA 3QRQA 2PFFB 1MYKA 2DCLA 2HS0A 2YNFB 3H20A 4ZPTR 3RBEA 1KDNA 4RWWA 1G3OA 2LMIA 3TQEA 4HDHA 2JNJA 3F56A 4TLQA 1SC6A 3CIZA 3QATA 3ZZOA 5EDWA 4NXMJ 1EETA 2UXDJ 2LFVA 3DRPB 1XQIA 4E0DA 1UFKA 3TJ8A 5F8NA 2RD5C 5FD1A 2P9EA 4ZVFA 1S9EB 5KFQA 5ETMA 4KT0C 1CS4B 2N82B 2L41A 4P7TA 2ACYA 1S1VB 2PEBA 3ILOA 4KYZA 5DM7Q 2CAJA 3NO7A 2OPQB 4OI6A 2AP6A 3HD1A 4D3GA 1TV6B 4EU0A 1VQOS 2ZOMA 3AFGA 4I2PB 2JC1A 3QJJA 2JSXA 2I6WA 1X4HA 1X4BA 4LFAF 1NNDA 2ZBIA 1X31C 1AZSA 3FNNA 4JI2J 4ZK7M 4K4ZA 4TU8A 2RHSB 2DR9A 1QAYA 4DPXA 3KLHB 3H4DA 5EN1A 1S9EA 3K7RA 3RR7A 2CPEA 1WSRA 2V8VA 1GAOA 2D3ZA 2R7SA 3P96A 1CSJA 2Z2MA 4O3OA 3J7Z5 3EXYA 4B3OA 1U0HA 3W7BA 3MM6B 2MHEA 2RDJA 4NCGB 3BM7A 1SB6A 3PM9A 4XTTA 2K6LA 4OYXA 1P1TA 5KG3A 4IRCA 4ZA1A 5H9EJ 3N6LA 2VDIA 1NH7A 4FYVB 4WP9A 1JJ2R 1GMWD 4DU8A 3BO4A 3LUYA 1I1GA 4LBHA 5F8HA 2W2PP 1TL3B 2BUNA 4PCQA 3UD5A 5KFJA 3LGMA 2DGTA 4UW2A 1RAOA 2YKNB 5JJBA 3DMJA 4NZ7A 4C8OA 2V63A 1FRJA 2YKPA 3AH6A 4JOUA 3W3SA 1FDNA 2YKMB 2QMXA 4FYXB 2MQQA 3DRXA 3AB4B 3NGUA 2ZWPA 4X84A 4H4MB 3TUIC 2BSQE 3W2VA 5HVHA 3GV5B 1S97A 1F3FA 2RJZA 3T9NA 4EK2A 2OIHA 3SCIE 1RTZA 1Y5IB 1TKXA 3MOZA 2QLJB 4RW6B 4KBIA 3AA8A 4CP5A 1L5UA 1HNIB 4DR5F 4C48A 3CMAS 1SL1A 1FRMA 4B9LA 1X9SA 2RRBA 3MF5A 2IAJB 1VS3A 4ZDNA 1U1RA 4DHVA 5KG4A 4HR2A 2IFXA 3VZHA 2MZ1A 3SQGA 3KLHA 5JVHQ 1R0CB 4OI1A 1URRA 2AW0A 2V1SA 2FHOB 2J9CA 5L9XA 3W5XA 4U6PA 1RAIB 1S1WA 5LMUJ 1TL1B 1NHVA 5GMKa 1HBOA 4DSIA 4NXNF 2XCPA 3M8PA 1JIHA 1MMNA 3R3TA 4OYZA 2ZH9A 1RKJA 4QWBA 4QWEA 2AYGA 4N76A 3T1HF 1CQMA 2LDIA 2ZNYA 1B7YB 3BN7A 2YQ0A 2DHSA 3C16B 2KT3A 4TKTA 2CDQA 3J80U 3MUMP 4F4XA 2UU9J 1NLAA 1B64A 5C42B 4X62J 5DLGA 2LQBA 4N5SA 1ZAXA 3PX4A 2ZE2A 4X64F 2J76E 1TV6A 3KYLA 2RILA 4ID8A 1S49A 2CZVC 3HSGA 1PJ5A 1EQ0A 3GR0A 4ICLA 3SEOA 4DCOB 2WONA 1VJQA 4ITSA 2VA2A 1S1WB 2H4YB 1FNOA 3W66A 3MM8A 1IWGA 4X4QA 2W9CA 4L3KA 3CCQS 3NGDA 3LQVA 4TU7A 2HWIA 1HNXJ 3H5XA 4DV4J 2GJIA 1I51B 3DLKB 1MW7A 2L9WA 3LF0A 3W2WB 5BR8J 2GMHA 4OX6A 4I1TA 1MROB 1LWEB 2KVQE 1LW0A 4M5KA 4RUAA 4IKAA 3EPIA 2E5LF 3MM6A 1HWIA 1BAZA 1ZBTA 1HNZF 3GV8B 5CYJA 1EA4A 1UEUA 3OTDA 1T9UA 5J1NA 3JAMY 4WFXA 3HF5A 3UN5A 1WUUA 1FD2A 2BJ9A 4DQRA 4ECWA 3FDSA 4TN2A 1N33J 5EX0A 5A0YB 4DR7F 1TL3A 3CDBA 3K58A 2C2EA 2J9DE 4OQJA 3EZ5A 1OY6A 3PRDA 2AGOA 5B08A 1RA6A 2DNMA 2ATCB 3SZ2A 1S6UA 3H42A 3EWGA 6FD1A 1GFWB 1T95A 4Q2MA 4QIVA 2HAFA 3WDOA 3L4BC 4MH8A 4P9SA 4DG1B 2BZ2A 4ETZA 1AROP 5I3UB 3X1LB 4PG7A 1TKXB 4I2QB 3LP0A 3NGRA 1UA1A 3S01A 1MMDA 2FHJA 3MMJA 2GZOA 2RU9A 2GGPB 2ZBRA 2XM3A 3C15B 3T5HA 1HWLA 3N6MA 1FJEB 2R7OA 5GAEU 1UJ5A 5AXLA 3UR0A 2V8GA 3MR7A 1IKXB 2POKA 2VFRA 3BBFA 5FDLA 4NCBA 3BGRA 2APOA 2DEIA 4BHQA 3DOKA 4CTAB 4ECQA 1TL4A 3I6PA 2GFFA 4OV6A 1IBMF 4LF8J 3HULA 3DLKA 2VG7A 2PDAA 3RU0A 3HP6A 3KNGA 4RX6A 4ZVPB 2D3O1 4F0MA 2JLGA 3DGVA 4XAKA 2NLWA 2ZZNA 4IQXA 1F2HA 1LWFA 3A8JA 1M5HA 3DOMB 2F65A 5ADZA 3PXGa 1HNWJ 4QYZJ 5KFDA 3GIIA 1T9TA 4FXEA 4ZVOB 2V9WA 2IY5B 3G8SA 4LREA 4J9MA 1B7FA 2CPFA 5KFNA 3I56S 1BQMA 1SQEA 2EFPA 4D8JA 3T1YF 4W90B 3ADAC 2VH7A 2G1DA 2BJ8A 5F0WA 2BR0A 3HZEA 2XSFA 3MM8B 1S1XB 2IVYA 4WFAQ 2W9CB 2HMIA 3K57A 2DNYA 5LMNF 4M5HA 4K4XA 1BXNA 2VBZA 3OXFA 4C0OC 2KG0A 1HMVA 4WPAA 1F1BB 5DGBA 4N47A 1EAYC 2GHVC 4HTIA 3D1QA 4DR6J 2KFZA 5KFPA 2J7KA 3JTPA 4QPTA 3U27A 1UVIA 2QA1A 1FNMA 3ETOA 3BJYA 1N0VC 1WG1A 1ZOTA 4YB7A 3R27A 2MHNA 4NRUA 1HI8A 2RF2B 3FCHA 3WX8A 4C3KA 5KOXA 1JLFA 1NB2A 3AODA 5D0EA 4UOGA 2KXNB 2OP5A 3R9LA 2DNGA 2HHWA 5HATA 1RYSA 3THTA 1KSPA 4L3NA 1TL5A 2DNPA 4RR5A 1NZAA 4P73A 1V3ZA 5E3CA 5IV3A 4K4TA 1QUVA 3KLIA 5K5MA 2LQ5A 4Q7AA 3ET6B 3IG1B 1ZH5A 4ZCMA 3CJRA 2YWGA 4K7QA 3AD8C 4C8YA 1Q79A 1FRXA 5BYQA 1F5AA 2FLNA 2AKWB 2Q79A 1PO6A 2L08A 1RT5B 2IPOB 2QSFA 4OYPA 2R7RA 3D0IE 3Q86A 2FZCB 3FMBA 3FZ2A 1XJWB 4NYOA 3GIMA 1HHSA 2V6AA 4KO0B 2HNDB 4GRSA 4AT1B 1SQGA 1RT2A 4J37A 1KLMB 3IWXA 1VQMS 5HVGA 3UN3A 2DT9A 1BUXA 2D7SA 4CT8A 4UZCA 4RNMA 1HR0F 4PG5A 1C0TA 3W65A 4ZHRB 1VQNS 3CJ4A 3G2XA 4DV0F 5GVQA 3D6TB 1AFJA 2PA3A 2I8EA 4K8RA 4N7TA 4QOTA 1TKZA 3DNCA 1EJ7L 2D68A 1N34J 5CXTA 4C4WA 1FI4A 3G82B 2BX6A 4O23A 2HBZB 4ANEA 2A0FB 3RRKA 1HYSA 4C7QA 2YXLA 3G8QA 4TY9A 5KFBA 3DLEA 2PIIA 1ROFA 4OI3A 4QU7A 3UR3C 1PYOB 2PI5A 1JLQB 5G0RA 2D3OR 4DX6A 3HXMA 5JXSA 1CJKA 4ANCA 2LEPA 3WIUA 4M5DB 3V6HA 1D8YA 2FY1A 2ZHOA 3NG8A 2QMWA 2OSQA 3G86A 1XR7A 4Q0BA 3FQLA 2IJRA 5F8JA 1U0SA 1YJRA 4WTYA 5EWFA 4EZ6A 1NKEA 4CYUB 2FVSA 3IS9A 5ETTA 3CJSA 2FQQB 2KHDA 4ES1A 2CJAA 1X4DA 2GQ2A 3GJSB 2Y1IA 3HVTB 3JQMA 3R5CA 3MOJB 3BSNA 2GIQA 5HMYA 4GO7X 4KTQA 3FUYA 1YBUA 4C11B 2N3LA 4F4ZA 2C2RA 2X7IA 7FD1A 4AXJA 4NRTA 1C4CA 3H2UB 3OXLA 4MTPA 1NSAA 1RAFB 1RWXB 7AT1B 3HM9A 2XMTA 5KG2A 3GJQB 4HTJA 3KWMA 4M8LA 4RNOA 3RW6A 2ATLA 3NLCA 4EBEA 3OTEA 4IH7A 3PHTA 1LFWA 1YBAA 1RBAA 3FKBA 3ETMA 3M9OB 3CJ8A 3CCVS 2UVVA 4B9UA 2R2SA 4JI4J 1U4BA 3EXCX 4ZVTB 1QSLA 2VQEJ 1FXRA 2DYAA 2CVEA 3TJAA 2P9GA 1ZTWA 2HVHA 2FDNA 2BM1A 3G4SS 5KG6A 2XY5A 5IFMA 2RSQA 2W01A 3ELHA 5LJ5Y 2D69A 2J5AA 3H5SA 2YNFA 2ADBA 3VZIA 3OTCA 3RRHA 1R8PA 4WWSA 3POTA 2WVBA 1EB0A 1QJHA 4PUOB 1EETB 3IWLA 4A46A 3MM7B 4U7CA 2JEFA 3N28A 2XCAA 1WC0A 2OUGA 2OJ3A 2JEJA 9ATCB 5KFIA 3ZXWA 2VG5A 3TO8A 2XG8A 2R9LA 2R2TA 4DPTA 5IQ6A 1DTQB 1TU0B 1SC3B 2KKEA 1KLMA 1Y4ZB 2IDEA 2MQ8A 1FE0A 3NCQA 4WP3A 1HNZJ 2EC0A 2YNHA 4NE9C 4CO5A 5C25B 5JMNA 1RTHA 4WYLA 4YDXA 2AX1A 4FKXA 2XBPA 4FS2A 3SSRA 2B7BB 3QGPA 4OLPA 4YY3J 1LV5A 1X0PA 2C2MB 4B02A 2Q66A 4ZN3A 3QYYA 2WTFA 3CB4A 3ICLA 2I1RA 2RDDA 5H9FJ 1V3RA 5ETKA 5KFKA 3CCMS 2F1FA 2NR0A 2IYIA 4OZLA 5I4MA 1RT1B 3KK2B 3TA1A 1F9FA 4KIAA 1PSDA 4DI6A 2KU7A 4EFAC 1IBCB 3MEDB 4RWXA 2Y9HA 1KHWA 4QIFA 3SCLE 4WZQA 4JI8F 2HWHA 1SC4B 1VC6A 1NKBA 3I4HX 2HFOA 1ZM4A 3CCZA 5DG7A 2Y1RI 5K8OA 5H1SV 4LIRA 2GAHC 2NXCA 4CDIA 1TR0A 1W2IA 2BA9A 4O4GA 2WSEC 2FVPA 4WU2A 3CVKA 2Z2ZA 1DAXA 3RB3A 4QJVA 3CD0A 2V8DA 3QIPB 4MKYA 1YRTA 2E44A 4M94A 1WC4A 1VLOA 1S1TB 3PJWA 3PV8A 4NLGA 1FJ7A 1KQGB 1WF0A 2QTWA 2ZDPA 3GPAA 2AEMA 3PR5B 2NXUA 4BDPA 2CQ3A 4U96A 3WBZA 4X65F 2CNKB 4IG3A 2VQFJ 2G0CA 2WVDA 5ITHA 4USMA 1RT3A 2BANA 2Q43A 3CJTA 3UWTA 4DXLA 3R7BB 4YHHF 5LMNJ 1HFEL 1H7XA 2VICA 4H4OB 2GNKA 1UWBB 3N79A 1NBEB 3NNEA 4NLSA 1C4AA 2JC0A 3BREA 2KJWA 1GNKA 1DQ9A 5K8PA 5E3PA 3CD6S 5LSRA 3D6FB 2MQNA 4DV5F 1UZHA 2V8PA 3POTB 3CC4S 4LRVA 3JTNA 2J7UA 4IFYA 4ZLPA 1T9WA 2DITA 3BO2A 4OYMA 5AXMA 4LF9F 2HSEB 3ENQA 1DY3A 5ETVA 3W8PA 3V4IA 1JJ4A 2B7CB 2DR6A 4KHPJ 4NLPA 2ZH4A 3GG0A 4ZPCA 3L3CA 2M52A 2PA8D 3DM2A 3TYTA 2GVDA 4CNZA 1JLCB 1T03B 1NH8A 1UVJA 1U6ZA 3ZZRA 1HI0P 4DSJA 4USHA 4NEYA 2AQ4A 1U6FA 1EKRA 4IFYB 2JHEA 2CYYA 1Q5YA 2V4JB 2V8HA 2W24A 4A47A 4DR2F 4NI2A 4LR8A 3OTOJ 3OT9A 5HQMA 2C2KB 3I0RA 1WKLA 3KK2A 5K20B 1K0TA 1W7WA 4B3TF 2R2RA 5BXIA 1F5BA 3R5BA 4PXEA 3ITHB 5FJ4A 2BKOA 2DKOB 3M6XA 2OHDA 2C3YA 4FBTA 3OFEA 2ADLA 1S59A 4S0MA 1HNIA 2PEHA 1LFPA 4NLUA 5KG7A 4LVOP 3CJ0A 2EC2A 3CJ5A 3Q0AA 3HFKA 4NZ0A 3PCOB 1T3OA 2BXJA 1CULA 4DS4A 5LT5A 1P94A 3TEGA 2AJ4A 5KFFA 2YNIB 3KJNB 3C14B 3C6TA 4ILRA 1KHVA 2MMYA 3IAM9 2OD4A 3ILIA 4RW7B 1U8SA 2FZKB 3VGSA 1U1MA 1C1BB 1MYLA 1F6TA 4M5NA 1N5YB 2IM0A 2PC6A 3IRXA 3K5OA 3SDEA 3D3CJ 5A6PA 5IS2A 2CAXA 4PXDA 5F9NA 1WC6A 4DZ6A 1SUQA 3MPUB 1N54B 5B0BA 3IM9A 4DR4J 2DHAA 1Y0HA 4WJBA 2CPHA 2GGPA 5T7LA 1CULB 1PCAA 3C15A 2VC0A 2E7XA 3T6BA 1T03A 3BGRB 2LA4A 3DU5A 3BDPA 1SIWB 4F36A 4M63A 5DQHA 5HI7A 2FD2A 2Q6BA 2YQ3A 4KH0B 2ZVSA 3HHKA 4OJ1A 4P2XA 4RNHA 1WC1A 3Q8YA 3GILA 2ZKUA 4DF4A 1HQ2A 2O66A 3NCPA 1K1QA 2BJ1A 3TZWA 2BE2B 3IAS9 2CG8A 3JQKA 1CJVB 3HHLB 3CDUA 4LF5F 1P6TA 4GC7A 3P3DA 5B0DA 2DNQA 3CC2S 2FJBB 1N5QA 3MM5A 1YLXA 4MFBB 5DZ6A 1FX2A 2CQ0A 2VHGA 4MJKA 1SL0A 4WZMA 3ZC4A 3TANA 1NDKA 2LQ9A 1DFDA 3E8OA 1YJVA 1IKWA 5KOWA 4NA2A 5HANA 3JTOA 4NMLA 3VAMA 1HA1A 4NYPA 3FMWA 4Y3CA 2GW8A 5M2PA 2B9EA 1JLCA 3J7A1 4B3MJ 4N56A 3PFOA 3G6VA 2P5VA 3I9V9 4N8OA 3C6TB 4DUTA 3PKYA 2XLKA 3KHGA 2JEIA 2KZZA 4LFCJ 5DRKA 4IFVA 4FNIA 3C6UB 4A8SA 4FF3A 3J7YU 1W26A 1K0VA 3BQ1A 2I2YA 2O1PA 2BE9B 3ZTSA 1HPZA 4UUXA 2CQPA 3S1TA 3HHNB 1BWEA 1KTVA 5I3QA 1S9GB 2VB6A 3BR9A 4URGA 4CLSA 1OSDA 1R6YA 3OL7A 2LLZA 3CCTA 4HI1A 1T9VA 3VTIA 5D78A 4O3SA 4RW8B 1XR5A 5AE3A 2G2YA 2UUWA 1WG5A 4CH1A 1DARA 2B9WA 2HQGA 5F0UA 2ZH5A 3TQ1A 1KFSA 2XZ2A 1CG2A 3CTRA 4P2MA 2C22A 1HWUA 4M5JA 1PJ7A 1MSWD 2AT1B 1IKXA 4FZVA 2PGCA 3C66A 4TNOA 4EWTA 1GTEA 2HWTA 1FCAA 2CQCA 4F3QA 4CQ1A 4RZRA 2RHQB 1N5VA 2XSJB 4UY8T 2HEKA 4WP8A 1M5OC 4PEOA 2VZ9A 5L46A 4ECZA 2XTJP 3RR8A 1RACB 4MFBA 3MAAB 3FEYB 3VWSA 4JV1A 2FJWA 5KFHA 1YHQS 4JI3J 1SV5B 1IKWB 1TP7A 3QJPA 4RKUC 4YOEA 1R31A 3N0VA 2ASLA 1AW0A 3H40A 2DVIA 1RB0A 4DU7A 2OI2A 3BR8A 1ZM2A 4LSLB 3N5FA 3DYAA 4MJWA 3NWRA 4ZPVR 4C8NA 1BQMB 3MM9A 2YH0A 1RA7A 4LVNP 3CD5A 5L1LA 1LK5A 3PRVA 3RGIA 3DFEA 4ZJLA 4CLWA 4NA3A 4ED4A 1S1XA 2DPIA 3I96A 3P5BP 1FE4A 3W9HA 3DLJA 4EO8A 4F2RA 1HYSB 3GP9A 1HQEB 3MEEB 3G82A 2E29A 2HKEA 4DUZF 4ED5A 1JLBA 1X5TA 2I5JB 2BOAA 2CPDA 5H9FK 5KFTA 2DXFA 1UETA 1X0FA 3OJSA 2N4DA 1HD0A 2UUAF 1VCTA 2ZKTA 4MYUA 2XMJA 3UVJA 1S99A 5ETOA 1TFYA 2KRRA 4ZJOA 1YJUA 3CIMA 1NJWA 4AL5A 1YSJA 3E3XA 2OO4A 3VVUA 2QLWA 4ZJQA 3FCVA 4P6QA 3QOQA 1CS4A 1D09B 4J5OA 4OX9F 1OYDA 5GAEI 4C8MA 2X3GA 4NWBA 1G4CA 2XZTB 4OI4A 3T3FA 4H4KC 4LMZA 3D1HA 3LO3A 3C6UA 5F3TA 3Q89A 1UFWA 1N6QB 4LF4F 2QT7A 3C16A 2CVIA 1DJ0A 4PXBA 1N5YA 4XIUA 2UUCF 2F4VF 3ZTQA 2IHR1 1FT8A 5FDLB 1DQAA 3QLHA 3OR1B 3KK1A 1O5JA 3K5LA 2OEJA 2GIRA 2RS8A 3D7SB 4NPOA 1K73T 3ISND 3W9JA 5GAGI 4ICLB 2X1AA 3IGNA 1Q95G 1XNRF 2RH3A 2DISA 4KV8A 2CJQA 1H72C 4EYHB 2VG7B 2CNOB 2UXCF 3CULA 3Q2SC 1ELOA 3FEZA 1KC8T 1LWCB 4KGXB 5KT7A 4EEYA 2ALYB 5HVFA 1F5CA 2CQ2A 3VQTA 2UU9F 2Y8WA 1LNQA 1RHRB 2YX7A 3QWPA 1RLCL 1RXOB 4DV7F 3WX4A 4A8FA 2GVZB 3H25A 4B3TJ 2HNYB 5L9NA 1UUJA 1B99A 4D3HA 2KG1A 2EBEA 1M5KC 3ISZA 4YFUA 2MY8A 5AXNA 3M2UA 3KK1B 2QEXS 3HSZA 3LWMA 1U49A 2Q2KA 1UFLA 4IOBA 4KV8B 5DDPC 1FXLA 4HT7A 2PFDA 1XEZA 2H9ZA 1TAUA 3TA0A 5B0FA 3HDSA 1U25A 3TOQA 2L9DA 2B4VA 1WEZA 2YKMA 3IXQA 4NCAA 1UVNA 1A6LA 2B5JA 2DBBA 2GS8A 3NMAA 2WW8A 4NA1A 2VPXB 2QV6A 2W7OA 2Z4PA 1NMEB 1JWWA 2E5GA 4OZNA 3UDLA 2XTEA 1WF1A 2VASA 2ILYA 4F2SA 3TEHB 3HFZB 2QFJA 4LF7F 1Q7YT 1W25A 3I0SB 2QIFA 1XIQA 5KT3A 1XC9A 2AJ0A 2K1RB 2Z30B 1DQ8A 3IP0A 1HW8A 4TYAA 2NS1B 3QWUA 1RWUA 4ZVEA 1KQKA 3D1OA 3QFWA 4DX8H 5A8KB 4WCEQ 1JLAA 2E1MC 1TUGB 4PXCA 2OTJS 2BJ7A 3NP5A 4LRDA 4DL6A 1VC5A 3W1YC 3ET6A 4XK8C 3B4DA 3CUNA 1TL1A 3BDEA 3SFGA 2RQKA 3W5YA 1Y3KA 3BYPA 1Q1KA 2B3TB 1PAEX 2BBEA 4O3QA 1Q5VA 4ZOSA 4X4TA 1CEZA 4KKOA 4QU6A 4ZS6A 1YIJS 2GHWA 4ELVA 2BW2A 4OYAA 1RTIB 1D0EA 1H74A 3J7ZT 1QTGA 2N7YA 2UXBJ 1VISA 2H3AA 2G2OA 3D4JA 1PBUA 4X4OA 3OFGA 4FYWB 2CJBA 4K4SA 2EFOA 2ZNZA 1I6JA 3MPVA 3LP1B 1V6HA 2E9TA 5FIIA 2V2KA 1P9QC 5B0AA 5KFYA 3BZQA 4GKJJ 3ENWA 3QAEA 4J90A 3QQCD 1RHMB 1KOOA 1BQXA 3QAUA 3ZFVA 2QYCA 1QVFR 2Q1LA 4B3SF 2HRTA 5GMEA 5J2NA 1RP5A 2V1TA 4IG0B 1URNA 5DQIA 3MR5A 4J9LA 4Y34A 2GC8A 2ZBCA 2CPJA 4JP8A 2WW4A 1H2UX 2CUYA 4LRCA 2K1RA 4JI2F 4DX5A 5L1KA 1KBRA 3LPEA 4YMEA 4WBFA 1LXNA 1SJQA 2Y0SD 3M1VB 3BGFA 3H4BA 3DDKA 1RQ0A 1JKHA 1MU2A 3M8YA 5THWA 1KNZA 2ZD1A 3BGUA 1RHQB 2XWYA 3CD7A 2MB0B 2IDLA 3ONQA 2HVIA 2GQCA 5ETQA 5K9FA 2HK3A 4ECUA 1QSYA 3KJFB 1IQTA 1TVRB 3K59A 2MSSA 1KRPA 1REVB 1N33F 3AB2B 1N5SA 3AOBA 2JWNA 1U26A 1S6PB 2NXNA 2QN6B 3H98A 1AUDA 4X4UA 2DH7A 4I7FA 5AXKA 4DOZA 4V19J 1WOOA 1C1CB 2DY1A 2F8EX 2CIMA 4MIWA 5KFWA 1FJGJ 3Q83A 1GTHA 4LUBA 3GIKA 4C8KA 2V0NA 1RWWB 2B4OA 2VBXA 2W2OP 3DOKB 2HZCA 1U0HB 2QG9B 4AYBD 2XQCA 2FVRA 4ZVGA 1IUJA 1U2CA 2HIYA 3NAIA 3U1LA 1ZM3A 1D9DA 4K4VA 2K06A 3P8BB 3PW4A 2FJVA 3Q22A 1SJ4P 3PO5A 1AXQA 2RUSA 2HHTA 1WC3A 2AMCB 2UVUA 1TMJA 2H1YA 2PO4A 2BNWA 4I7FB 1Q8KA 1ICEB 2F9JA 3ENVA 5L38A 4Q5VA 1T8EA 1MMLA 2JH3A 2VA3A 3R5JB 4GKKJ 2W4CA 2AV5A 1XMOJ 2EBGA 1HARA 2FPHX 4KH1B 3SMZA 2ZUGA 1EKSA 2XYGB 3ZTPA 2FVQA 4JI3F 3PYGA 2E1AA 3CJ2A 4ZIWA 3G9CA 3SDEB 1C1BA 4P7VA 2CQDA 2QSWA 1KQSR 3NOGA 4Q44A 1UL3A 3NEKA 3PW5A 1FJGF 4MK7A 2ZD1B 1R43A 2YTCA 5J2QA 2DY9A 3D54A 2MQMA 3NCRA 4F4AA 1VI7A 3I87A 3V4IB 4LIWA 1NK4A 2KDOA 4PG4A 3UO0A 5IT4A 2IYGA 2MJUA 4XPCA 3R1LA 3TARA 1NHUA 1CJUA 2BOPA 5L1IA 4TQSA 4LF7J 1IKVB 4UUWA 2VBWA 2CKWA 4NYZA 2J7WA 5A8RA 3U02A 4I6YA 4IG0A 4PWUA 3VALA 3EM1A 1SH0A 5EHHA 1TK8A 2VOPA 4J9KA 4G1IA 2X1GA 5KFXA 2Y1LB 3PRBA 2HHXA 4QZVB 3D3BJ 2VONA 1R6VA 1ACMB 1XNRJ 2WCXA 3E2EA 3LAKA 2C3PA 2QLXA 3HKZD 2MSTA 3M6UA 3UDEA 2BA3A 5C7PA 2ZOFA 1Q8IA 6FDRA 2EG2A 4F4YA 3IC1A 2VQFF 1FTRA 2ROGA 1LW2A 1SPBP 1VIXA 2LU1A 2U1AA 2Z2LA 3DCAA 3VAIA 4O4GB 3QFHA 4CLTA 1AB8A 1WDTA 5D4LA 1RT5A 1PC5A 5B7WA 3GE9A 4CLPA 2ZH1A 2WONB 2UUBF 4LFBF 4RL1A 2HZAA 4WXWA 4ZLJA 5AJ3J 2JOQA 1YG0A 1RTJA 4QWCA 2RRNA 2YWFA 2Z58B 4DSKA 3HHDA 2V2ZA 3JSMB 3RBXA 3J81U 3QT7A 1SKSA 1QAIA 3CMQA 2D3UA 2QJ3A 1X5OA 2BACA 1LWEA 1FKOB 2WBRA 4U9RA 4X65J 3JYTB 4J9OA 1G7CB 4X4NA 3OUYA 3DRSB 4OL8A 2UV8A 3AWRA 3FBBA 3PJ9A 1RTHB 1NRKA 1SUQB 1YJ9S 1VLYA 2F7VA 1YJNS 3C46A 2FGOA 4ECYA 1RWOB 2GCFA 4FKYA 4RW8A 1S7IA 5A2QY 4LR9A 1RISA 4A8QA 4DFJA 1Y11A 2HHUA 4DEZA 4Q45A 1RWMB 2X1FA 4C9DA 3PEHA 3MAQA 1VIOA 5J2PB 4BC7A 1HNVB 3HT3A 2UP1A 4F0HA 1FKOA 1F9EB 3JYTA 4Y2CA 1L3VA 4P74A 4LF6J 4JYAF 5F9LA 3D66A 3MFIA 1U24A 2CXEA 2DNOA 3DXBA 1ITPA 2WVCA 1WELA 2A2BA 2MLZA 2H5EA 1QTNB 2VBYA 4U95A 1O8BA 2QL9B 3M32B 4OI2A 5CA5A 3LP0B 1U45A 4DUZJ 2CJXB 3J81j 2NREA 3WHIA 3IRWP 5SZTA 5BJRA 2PSZA 1VGYA 3BSCA 3IBWA 3ZNUA 2FY8A 1VQ7S 2A18A 1WTBA 3WC2A 4I64A 4TU9A 3PZPA 3BB5A 4IRKA 2HK2A 4OJ3A 2UXBF 4P2SA 1P27B 4A8MP 1KVKA 4A8OA 5DDOC 1CQNA 5C2CA 4JI6F 4ATNA 3U1NA 2K9IA 3KHLA 4DDFA 3SV3A 3OPKA 4W92B 3MUVP 2CDRB 1S0VA 2IM3A 1RLDA 3MZIA 2WVFA 4ZPDA 1Q53A 2HAIA 3DI6B 3M32A 5A2QU 2O67A 3CXCR 4QCLA 1FEEA 5L39A 1FRLA 5DZ7A 5K14B 1XMBA 4DR3J 2CJKA 1VQPS 2HLUA 3RTVA 2V69A 5J2MB 5GAHI 4MK8A 4DLEA 3TX8A 2K7KA 4NL5A 4YQWA 1T9YA 2ZHBA 3UDVA 4H4MA 3W2VB 1HIYA 1HNXF 2AYBA 2DRAA 5B0GA 4HT5A 2XMAA 1RCXB 3MD3A 5DS7A 1XMOF 4RPFA 3CDAA 2IVMA 3AXKA 1WJ9A 2RVJA 3N9UC 4RW7A 1VQ8S 4AAIA 4Z7YA 4JI1F 3C3LA 2HHVA 2L3MA 1RWPB 3U7JA 2BM0A 1DTQA 3NS7B 2F40A 2ROEA 5LXRA 2N3OA 4J7CA 1L3TA 1R27B 5T14A 2IIHA 2CQHA 5C42A 1RAAB 5C25A 2Y8YA 2QO3A 1FKAF 2YKQA 1L3KA 2EKYA 1A0OB 1IWAA 4DQQA 2YWKA 1YKWA 2PMHA 4R5PB 1NJZA 2XS5A 3DM2B 4DV5J 8ATCB 4IRDA 2YWWA 1S79A 4MKAA 4J91A 2EW9A 2VF3A 2Q3PA 2N4CA 3A8KA 3CCUS 1NDPA 2DNLA 5HSPA 1OO0B 2VFVA 2B43A 1NSPA 2AWZA 2V4JA 2XZWA 3AQOA 1SI9A 2KYXA 3MM5B 1N4LA 1F0XA 1QE1A 1RHJB 4LQ3A 3KJQB 2OH2A 4RUCA 2ZE2B 4DR1J 3I0RB 2HBQB 2ZC4A 2LA6A 1W2BR 4QR2A 1UP1A 3M2UB 5F3ZA 2FJAB 2RQCA 4OHZA 3VAHA 3FFIA 3EE3A 3F73A 4NZ6A 2B0GA 1HQEA 1FERA 5CCMA 2Y3YA 1LWXA 1YZ6A 2ZZMA 4OYIA 4RW9A 2E5IA 2DXDA 1YQHA 3UI3A 3GZ7A 1JJCB 4CLYA 5CCLA 2MTLA 2HGMA 4NX9A 4AQYF 1UVLA 3AOAA 2VPZB 2OMOA 4FVCA 3ZZYA 4DSFA 5M2UA 2MPUA 2EXUA 1MROA 1RBLA 3OTOF 2XTDA 1X7VA 4OJGA 4XPEA 3J7YI 4QIEA 3SSQA 3HSJA 1B0PA 3CGIA 1RI7A 1CBKA 4X62F 9RUBA 3LWLA 4FBUA 3H0PA 1M5PC 2YY3A 2L9NA 2V94A 4HV0A 1WORA 4RW6A 3BV8A 3FVYA 3RAMA 4DMZA 2B8PA 4H4OA 4UTGA 5DDQC 5LXYA 1XN9A 1UWBA 2HQDA 1DHMA 1U02A 1RKIA 1U7LA 3DLEB 4I68A 4OZ3A 2QA4S 2DH9A 5A0YA 2J0QD 1VK3A 3BYRA 4DV3F 1NK9A 4IOCQ 1CJKB 1SIWA 2IBOA 3UE2A 2ASYA 4YDDB 1DTTA 1HKAA 5HMXA 4ILMA 2DCUB 1DZ5A 3FSYA 2B51A 4H4KA 4KE5A 4Y28C 1Z2ZA 5CYQB 4CLKA 3CJKA 5FLXY 2AYEA 2MGZB 1VBYA 2DTJA 5CYMB 3Q8QB 3FBEA 4ZP6A 4JV2A 3PR4A 1RGVA 2DJWA 4CRJA 1E6VB 2X3DA 3DOLA 5ETLA 2EPIA 3B54A 2YX1A 3ZO7A 4CZCA 2HVEA 1S4EA 2FJDB 3OL9A 3DRYA 4QIWD 4WE1A 4XDCA 4DCPB 4Y0FA 1O51A 4JI0J 3OQ2A 2CWKA 3HVRA 2GVZA 3BQ0A 3QJLA 2DNKA 1HI1A 1OQ6A 4RW4B 2J0WA 3MEKA 1WWHA 3BBBA 3PHEA 4MMOA 2N7CA 2J6UA 2OKQA 4XDDA 3CNQP 1XMQF 2IJNA 3MM9B 1R8AA 4USKA 4DCJB 1M90T 3P45B 1N52B 4LSNB 3DC2A 5HQLA 3MEGB 2XGQA 4ZVHA 1FRHA 1S6QA 4Q8EA 1V9OA 5J1PA 1RDRA 1X9MA 1WHWA 4LJMA 4IYQA 2BMBA 2ROPA 4DSLA 2IMOA 3TVKA 4DQIA 3KNAA 5HROB 3QRRA 2K5JA 3L7PA 1LEOA 4PZVA 5C2GA 2B6AB 4IDKB 4I2QA 5I42B 5E3RA 1U1KA 3PW0A 3CCWA 3EX7B 1E6YB 3KMSA 3BGLA 1NK8A 3AX2A 3R8YA 3M1VA 1D1UA 3VGTA 2R42A 2RDIA 2VFSA 2KKHA 1MU2B 3GFZA 4CM0A 1G2EA 3TVYA 2H3EB 1TAQA 3HD2A 4WU3A 4B3MF 2F3JA 1HD1A 1C0UA 1P8GA 3NGTA 3M9MB 1DLOA 3B78A 1FX4A 4BWMA 4ZN1A 3H87C 2HMIB 2C2DA 2W7PA 4KJIA 3FGVA 3SIPB 4FF1A 2HBRB 4TLRA 4B3RF 5HLFB 3QSYB 3PACA 2HHQA 3HHEA 1HL6A 4DV6J 4R0EA 1RADB 3GMGA 4RLEA 4CO0A 4OHYA 3OW2R 1LWFB 3DOMA 1BD6A 1BQNA 3GYNA 4J9RA 3CE8A 4LF1A 3DLGA 3V6DB 2W8KA 4KPYA 2MKCA 1IVZA 4Y2MA 1IXKA 2WBMA 3J81Y 1BY9A 5AT1B 2B56A 3RB0A 2HRYA 2ZHAA 4L72B 4PAAA 1N56A 3H90A 3KJVA 4W4MA 2BEFA 3LTOA 3OV7A 2G13A 2RRAA 2KFNA 2GO9A 2HRUA 1FD8A 4QR0A 3VCDA 2OFGX 1FWKA 2B4PA 3ZZZA 4ZLLA 1T3NA 2V68A 4JI7J 4HLBA 2XMMA 4MIBA 2LEAA 5A8WA 2MZTA 2FZGB 2AD9A 1VRUA 4YUDA 3AJDA 5E0OA 3BH7B 3VR1A 3O6QA 4NXMF 2B6AA 5LL6d 5IXUA 4DR3F 5I42A 1RBOB 3FC9A 1IR1A 2IC3A 2K3KA 2EK6A 1IR2A 5HP1B 3T41A 1OY9A 2HVZA 3L95X 3NWGA 1Q16B 4ZVSB 4EI2A 5GAHU 2E1RA 4EO6A 4B9SA 4FF4A 5D8HB 1XR6A 3TZYA 3DKDA 4ZHRA 4B17A 3I5BA 4EGLA 4USWA 4Y6IA 1KP6A 3N6NA 4M5LA 3I9ZA 3BS9A 2DEJA 2YKAA 1NPKA 2D74B 4JUZA 3W9IA 5HLFA 3I5CA 4Q2LA 3DGPB 3E01A 4G3IA 1NDCA 2XMKA 5CD4A 4O0IA 1JLAB 3CF5Q 4LF9J 2J9DA 2XGPA 2NSCA 4IDKA 4UY85 1Y10A 4AL6A 2A10A 4EBDA 4ILLA 2BRLA 1TQLA 1HR0J 3N01A 4QYRA 2AIRB 3IS9B 4UOCA 2PMWA 4UOHA 2R8KA 2XMUA 2NXEA 1CC7A 5DGAA 2M8HA 5D3GA 5A76A 1YJ7A 2IM1A 2HQ3A 4ENOA 1BDVA 2FUG9 1ZYQA 1PG5B 3WIVA 1VHFA 4ERDA 1DLOB 4HL9A 1RTIA 2DIVA 1X5SA 3D28A 4C3LA 4DSEA 4JI7F 1T05B 2BNZA 2HZVA 1VQKS 3KFWX 1OSCA 4G6VB 4ZVRB 3ULHA 2FHJD 4B9TA 2ZM6J 3MHYA 1R3NA 4PRFA 1BC6A 2JRSA 3NRBA 5E5NA 4NEZA 2DIUA 4OZ0A 2ZJRQ 3V5RA 5HAOA 3ISNC 2JXHA 3DU6A 2HIQA 4A8KA 4FF2A 2VC1A 1GXUA 1AT1B 3JB9k 2CQIA 3NS5A 1IQZA 3F0NA 4O44B 1UKUA 4AE5A 4CLLA 3AJ1A 2GJ2A 2OFHX 3GLJA 1OJ4A 3LP1A 2KM8C 3Q24A 3MD1A 3PVXA 1SJ1A 2V5HG 3TW0A 3M8RA 3LOUA 3QNWB 3LANA 3VAGA 3L7OA 4CT9A 2V9KA 1RT4A 4ES3A 2EG1A 2W25A 1PARA 2CPYA 1FVSA 5IC6B 1N88A 2G4BA 4OZ2A 1UJ6A 2VG6B 3GYXB 1UWAA 3M4XA 3CO0P 1U09A 4V1Ak 5T41A 5A8WB 3SBMA 1I3OB 1IBKJ 1NLKL 1EIYB 4ZLNA 4MKBA 2OPSA 4C8LA 4DR7J 4OHXA 2JLFA 1I5OB 1FDAA 4YS2A 2DHHA 2WK4A 3IR6B 1UTAA 2CADA 1R8BA 2IC3B 2LXUA 3M8SA 4A8WA 3HZGA 1NKCA 4AXIA 2EI5A 1JLGA 3QIDA 2FLOA 3HCXA 3OBIA 2NYIA 2RNEA 1FXDA 5G4DA 2RQMA 4OLOA 3V4MA 1LXJA 2DGVA 2UV8G 4IQMA 5DO2A 4LFBJ 2JZ5A 5IT0A 2CPZA 2JVRA 3PX6A 4FPIA 1TKTB 1AA1B 2IM2A 3G5OA 3KHRA 1TUWA 2HGLA 4Y2KA 1X60A 1RTDB 2FLLA 1VYAA 2A2CA 2VFTA 4CIOA 3HPOA 2HW3A 5M2RA 3VAKA 4F50A 3G8TA 4LF8F 3N5BA 3NS6A 3J7AN 2BJEA 1UA0A 4ZKAA 2HFVA 3KOAA 5E7OB 3MR2A 1NPRA 3LH2S 3NGSA 2JLEA 2BE2A 3LPYA 1MWYA 2MQLA 4Q43A 1CJVA 2CZ4A 4YB1P 3HK2A 4WYWA 4JI0F 4JI8J 3GFHA 4P72A 2Z56B 4EMDA 5BR8F 2FHMA 1S48A 5BYSA 2RB7A 5J2MA 1HNWF 3F44A 2KZMA 3JSRA 3KLGA 4HACB 3DRPA 3UW1A 3IWNC 4DR4F 4F02A 3AY0A 3A12A 4M5IA 2VFUA 5KT2A 5CQGA 3WQPA 1GMWA 3MTKA 2QYGA 2OMLA 3H59A 2JFDA 3M8PB 2R7QA 3QO9A 4M5GA 4ALZA 3R5GA 4QBUA 3UCZP 1JMTA 2ZEJA 5K8MA 4FS1A 3VEAA 4CCHA 2DGQA 1NZ8A 3GIRA 1BMQB 2KVIA 2VPWB 3ZTRA 3H2LA 2J8AA 2XEXA 3NY0A 2LDYA 3VW4A 4OI0A 2GA7A 4MK9A 4X4PA 1R89A 4RU9A 2IRXA 4WTOB 4E8UA 1S6PA 4OX7A 4F8RA 2V50A 4DFKA 1D9AA 2KTQA 3SXLA 1WHYA 1KFDA 2F5GA 4M5DA 1GMUA 3QZ7A 3PX0A 3UFCX 4OMFG 4YN3B 1CPZA 3EGVA 4P75A 4UQTA 1RCOB 2XB2D 3KLVA 3M2VA 2KHCA 1JLGB 2B8QA 4C3MA 1PAUB 3FSXA 3B6BA 3NAHA 2Z57B 1G6BA 3Q8PB 2AY0A 1HBNB 1VRTB 5KG1A 4FPRA 4X64J 3S7RA 1FA0A 1HHTP 1LW2B 3R7SB 3K8WA 3G71S 4IO9Q 4DV1J 4B9VA 1VOMA 2CPIA 1HHQA 4QQBA 2W2QP 2ZM6F 4DV2F 1SJFA 1PYTA 4USTA 5LOQA 3O8WA 2R7WA 3PEJA 2UUBJ 2D9PA 5C5JA 5ETSA 3DXSX 1FFSB 1RTJB 4KHMA 2E1PA 1Q8LA 3PG9A 4NXNJ 3H7HB 1P9YA 3O44A 1KR4A 3UD3P 1NAQA 1HBUB 4IR9A 1YJWS 2GMLA 3ZZ0A 4IUFA 2ZUAA 2WB4A 3TA2A 2BJDA 2OLWA 2ZITA 3E51A 2DB1A 3MI7X 5KG5A 2IAJA 2X1BA 1QTMA 2B4UA 4HI2A 4HH1A 1NSQA 2DNNA 3R5DA 3LA0A 3GFYA 3HX9A 1R8HA 4F7VA 1AUSL 5DDRC 3UPFA 4AL7A 4Z2XA 4LF4J 1SIZA 3FBCA 3CCSS 4J9QA 5HQ8A 4C0BA 1HNVA 1SJRA 4R5PA 1FKPA 2MQPA 2LCWA 3OJUA 2HPUA 4ZVQB 3TUJC 2AU0A 3IO1A 2J0SD 1QAJA 4WXOA 5AE2A 1SKUB 1WOSA 2VG5B 1WSVA 5CYQA 3M7VA 2DO4A 4G1PA 3OLAA 2ZH8A 2HFNA 2BQUA 4FN5A 4WE1B 4CO2A 2KELA 2YPZA 4NLTA 4GMKA 3CEDA 3K0JA 2Y0BB 4JYAJ 3ITHA 5DG8A 4E98A 3BKTA 4ELUA 1H73A 2ILZA 1X8DA 3CT9A 4QIGA 1ZZFA 2Z2YB 2KJVA 3MURP 2XY6A 1SJ3P 2W4DA 1ARRA 1HBMA 3O5TB 1RAJA 5D4OA 3VQSA 2ZOGA 8AT1B 3GIJA 1QVGR 4LSNA 1KWMA 4CWBA 4K4YA 4KFBA 3VF0B 2YX4A 2OPPA 2YQ1A 3QGHA 4H54A 1OQ3A 4ED8A 2ZH3A 5IT9Y 2U2FA 3T5JA 4NLQA 2BQ3A 5D0HA 3MMBB 3ZZTA 4ECVA 3GXQA 2CQ4A 3D0GE 2NPIA 3HHLA 3OXGA 1K44A 2NXJA 2YH1A 2QA2A 1YITS 1RABB 2M3DA 4WFBQ 1GX6A 3EJMA 3CCLS 3ILLA 1J2VA 1YDLA 3DLHA 2HNYA 2J9EA 4A48A 3D6MB 2UZAA 2CPGA 4L76A 3JSYA 4LFAJ 1EZZB 1YJTA 2DHGA 3SFUA 3D6HB 3OR2A 3FBFA 3KG4A 1R8CA 3A3PB 4LR7A 2P9CA 2ZZTA 2XC9A 2ZJQQ 1IR0A 3DHWC 3QIPA 4UQGA 3R6GB 2BRKA 2K29A 3DN9A 5KFEA 4NLWA 3JS9A 1TMMA 2CNNB 4HHHA 3MDFA 5E3QA 5KFRA 1IBMJ 4PWDA 1H7WA 2M0GB 1M5SA 2P8IA 3EVMA 5KAKA 1ZETA 1J5EF 4R8UA 2MZJA 4L75A 5BYRA 1Y7PA 5IM0A 3IR7B 3QT8A 2GQQA 3OHBA 3EYZA 1K47A 4J9SA 2V2VA 3SSSA 1JQGA 1E6VA 1S12A 3DOLB 3EZOA 3I31A 2NUHA 3ZTOA 1S4FA 4CO3A 3Q8UA 4DQPA 3V2UC 1RU2A 2VUGA 3HLUA 4KC5A 2M88A 4RO0A 2M7SA 4CTAA 4USUA 3LP2B 5IQQA 3R97A 5DQGA 2G2ZA 2AHOB 2EFQA 1XBWA 4DL2A 1V5IB 2ACMA 5J1EA 3OHAA 2WB1D 1EARA 2G9OA 4R8UB 1UMJA 1RYRA 3HJFA 5B09A 2QMUB 3GSDA 4KGMA 2A6OA 4CH0S 3P49B 2O01C 1V5VA 1DURA 3G6XA 3MEGA 1F3VA 4YEAA 4K50A 1TKZB 2CQBA 4QR1A 3GV7B 2RUGA 4BLGA 2KB2A 3PTWA 1KVIA 5H9EK 1FTCA 3VGUA 3VAFA 4OZ5A 2JX2A 2HFUA 1JJHA 3GJRB 5HROA 1SV5A 2E5JA 2D1CA 3AXMA 4DBQA 1BHNA 3CW2C 1QM9A 2XZDB 4ZP7A 3OR2B 3TUPA 1TUVA 2V67A 1Z2LA 1E6YA 2QFIA 3SCJE 3O3LA 4QWDA 1X4GA 3MPYA 2C28A 2DR7A 4JI6J 2W4PA 4Y2IA 2OPRA 4PYDA 4DL7A 3CJ3A 5HN0A 3QRPA 2W9AA 2IRYA 4AD6A 4NI2B 1C0UB 1JXVA 2J0XA 2KFYA 3TI0A 2AGQA 5CZXA 1XNQF 5CD4H 2EEYA 1DRZA 4JI4F 1U1QA 5GADU 2ZH7A 4NLRA 3IM8A 3LGNA 2JBVA 3VEBA 4F3MA 4QWAA 3SI8A 1S9GA 3T19A 4L6V3 4IOAQ 1YGYA 1UPMB 2G1HA 1TELA 1A7GE 2QL7B 2YVSA 5E33A 2AX0A 5ETNA 4DPYA 1X93A 3SV4A 2L48A 2WSCC 3LP2A 1F60B 4J9NA 2YNIA 4KGZB 5D4NA 3QGGA 3OTBA 4KRWA 5LM7E 2R2UA 3V6DA 4G65A 3A1YG 4RNFA 1YVFA 4ED1A 4OYOA 1NO8A 2Z0GA 1RK8A 1EHWA 3CJKB 3TVZA 2HNZB 4JI1J 4X4VA 3NXZA 1HMVB 3A8EA 3HFVA 3AJ2A 5CYMA 1VBZA 4B9NA 3V6KA 1WKKA 3M30B 5KT6A 2H54B 1WOPA 2NZCA 4PYAA 2ZH6A 4FXWA 2DRBA 1HWJA 1WF2A 1WEXA 2CPXA 3PNIA 4KGKA 2V34A 5IM0B 1MWZA 2HQFA 4DQSA 3KUHA 4PWWA 4O3RA 2W9BA 1IBLF 1S10A 1Z4UA 3TAQA 4C98A 1TKDA 1NJXA 2VOOA 1FDDA 3GCWP 5D4PA 2FJXA 2BV3A 2EKNA 3UVJB 1H0HB 8RUCA 2VD3A 4DN0A 1XWLA 3PW7A 2YWHA 3CJQA 3OFHA 3AD9C 1RT4B 1VK8A 4OYBA 3P5TL 2V4RA 3K5NA 3BSAA 3KLIB 3RUBL 3THVA 2C2ZB 4OJHA 5JUMA 4DZDA 1PYSB 2ZBPA 3AT1B 3FQKA 1RHKB 4HVZA 1VQLS 4DR6F 5HK4A 3L7UA 3MMCB 4RBUA 1VHIA 4I56A 1X4AA 1WG4A 1MN7A 5K14A 4G1QB 1VBXA 1FJCA 5U47A 2JFKA 2VIHA 2ZBQA 1IBLJ 4USIA 2R7UA 5MAOA 4ES2A 4ETXA 5I3PA 3SQGB 4HDGA 4ED3A 2ZFHA 4Q0BB 2CRLA 1SCJB 3EDRB 3KLFA 4HYKA 4EBCA 3UCUP 4ANDA 4F67A 3RRGA 2C3UA 2AJQA 1F9HA 4DPOA 4CLUA 3UQSA 5F8GA 1FFWB 1UEKA 1J5EJ 1LWCA 1PGZA 3PY8A 4F4KA 4JI5J 2OPRB 3M8QA 4HHJA 4MT1A 1IKYB 2UVWA 2YWEA 2ASDA 3TNVA 5F41A 5HL7Q 1IM6A 3I0SA 4RBTA 3QMQA 3I55S 4C0HA 5D3GB 1TKTA 4C11A 2VQEF 1X4CA 2AEJA 2ABYA 1RWKB 3DLGB 3M30A 3FEXB 4HH0A 1WACA 3EDQB 1S1UA 3GR1A 3RG6A 4CH7A 4K2JA 2RS2A 4K0KJ 3OD2A 3W62A 1XTZA 3KUEA 1IKVA 2H5JB 4RBVA 2O5DA 4UT4A 3LW5C 1VRQC 3R5AA 5EUHA 5G0RB 4JBCA 1MNEA 4ID5B 3BKUA 3MR6A 4F04B 5AJ3F 3KUGA 4DUYF 2HNDA 1L3SA 4LFCF 2M70A 3PJXA 2WRMA 1IKYA 2HFSA 4KO0A 2GJFA 1H2VZ 2MZQA 4NMXA 4DX7A 5CH7B 4Y65A 2KL8A 3Q2TC 2PE8A 4OFZA 5GADI 1NHKL 3NBPA 4OHWA 1YWXA 2LEBA 1S1UB 1NK0A 2RMLA 3NKYA 2WOMA 2H65B 1L3UA 2G0JA 1N36F 2BKPA 1S57A 2OTLS 4ZPAA 2BW7A 3MAAA 4Y00A 1YK9A 2KYZA 1RWVB 2LQ8A 2QGFB 2VG6A 3KDOA 4ID5A 5DJBA 1Z1ZA 1U48A 1Q16A 3OSNA 4DV2J 3OVBA 2DGUA 2C3OA 4DUYJ 2EFGA 1J5OA 1J27A 1OIAA 2NYHA 2MDAA 1NDLA 3QT5A 4LBPA 3MMAA 4C2MA 2OGUA 3DYAB 3F41A 4CI0B 2XO7A 3LALA 1Q7LB 5J2NB 2C42A 2AZ1A 2XYPB 3M8QB 2XNRA 2HHHF 1F2GA 3IA0A 2P6TA 2KI2A 3AHPA 2M4MA 1ZAWA 4USJC 3MAHA 3Q23A 2DR8A 1VQ6S 2DO0A 4JV5F 1WDDA 2CJ9A 5CHCB 3PIPQ 3M8WA 4Y2AA 3HVWA 3T5KA 5ETRA 5EWEA 4E2FB 1CC8A 4WFYA 1IM4A 3K89A 3MMCA 4DWIA 3T5LA 3ZZUA 2MKIA 3GU0A 1NCLA 1RWNB 1BQNB 2FLPA 1FO1A 2KXFA 1XMQJ
chains in the Genus database with same CATH topology
3K5MA 3KG1A 1TK0A 5A8KA 4ED6A 3HHLC 5E2QA 3H2VE 1M0SA 5D6GA 2MGZA 2E9RX 1IJEB 1TVRA 2A2DA 4M95A 5DG9A 3NBPB 2NPFA 1N5TA 4PG8A 3M6VA 1NU4A 3AA9A 5HBMA 1FNXH 1H3DA 2KRBA 5D77A 2DGXA 4YY3F 2DNZA 1S72S 1KN6A 4OV1A 5B0EA 2KN4A 1T94A 2K2PA 1Q4RA 4B08A 5HO4A 3UD4P 1D9FA 3DRRB 1KS2A 4RU2A 1IJFB 1WHVA 2COLA 1FESA 4WK1A 4PUOA 1XERA 1RT6B 2E66A 4Q8FA 3T9ZA 1JB0C 2FVCA 2RQ4A 1U1PA 1J5OB 1RT3B 2BANB 4MAKA 5KT4A 3PIOQ 1VQ5S 1S9FA 4OIXA 1X4EA 1U6BA 4FNHA 2PT0A 3UDCA 1GXLA 1XK8A 2WOMB 4KHRA 2OPSB 3MGJA 2Y1JA 3PKMA 1OPIA 1RT6A 4PPZA 1YI2S 2K7JA 2RKIA 3Q8RB 2DPJA 4M1KA 1SKRA 1FRKA 1RT1A 2KXHA 3O1LA 4PKDB 3BSOA 3NNAA 4QPXA 1JXEA 3I5AA 3H8YA 2DK2A 3S8SA 4DR1F 1FK9A 4OZ1A 3TAMB 3PW2A 3CSKA 3I32A 1X9WA 2F9DA 4I67A 3RYLA 1HBNA 4X66F 4ZP8A 5A8RB 4WF9Q 2VODA 1V3SA 4I6AA 2XLIA 3BEGB 2KH9A 1RT2B 2AN7A 3D0HE 4NLDA 3QZ8A 4I69A 1JXLA 3TUZC 2EWHA 4R0JA 2FGCA 5J2QB 1UVKA 1S6OA 1HQUB 1WEYA 2LYVA 2ASJA 3TAMA 1K8AT 4IG3B 3KLGB 4GC6A 4PQUA 2XMWA 1JLEB 3MTJA 3GQCA 4DL3A 3MXHP 2HS3A 1EP4A 3B8HA 1RJJA 3QPIA 1SH2A 1KD1T 4URSA 3QGIA 2ADCA 2NSBA 3OFFA 4F3OA 2R7VA 4ED7A 3IRXB 2KT2A 2JJ4D 4DG1A 4KHPF 2HFZA 5E3AA 4EYIB 4ECXA 5I3UA 4WFZA 2BABA 3R1HA 2DGSA 3OVAA 3CMES 3HVTA 3SYZA 3HKWA 4CO4A 4ZMMA 2EFVA 1NK6A 3MUTP 2F8HA 5B0CA 1IBKF 1ULRA 2A3JA 1Q86T 3H5YA 5DM6Q 5F8MA 4WFNQ 4DV1F 2MKKA 1H38A 2XTCA 1GT8A 1FVQA 3BQ2A 4PQAA 4GKJF 2B9YA 4C8ZA