1SH0A

Crystal structure of norwalk virus polymerase (triclinic)
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
502
structure length
502
Chain Sequence
GTYCGAPILGPGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPDKWSFAQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKTHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVNED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA Polymerase
publication title Crystal structure of norwalk virus polymerase reveals the carboxyl terminus in the active site cleft.
pubmed doi rcsb
source organism Norwalk virus
molecule tags Transferase
total genus 162
structure length 502
sequence length 502
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 1sh0A02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 1sh0A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1sh0A03
3HKWA 1TKZA 3I0SB 3PW2A 3E51A 1RT3A 3DLEA 1RT5A 2ASLA 3JYTB 3D5MA 4KBIA 2I5JB 2WCXA 5I3UB 2RKIB 2WOMB 5KFDA 1JXLA 2JEGA 5CYMA 4ECTA 1RT1A 3KK2B 3V6JA 1JLEA 4G1QA 5F8LA 4NLTA 1RA6A 1KHWA 2IM1A 3PHEA 5HROA 2F8EX 5I42A 1ZETA 2WHOA 3PVXA 1HPZA 4QWCA 1VRTA 4KKOA 3OSNA 1VRUB 1QE1B 1TKTB 4ID5B 1JKHA 4G3IA 4IFVA 2ASJA 3TAMA 1DTTB 1RTHB 4NLWA 3BSCA 5JXSA 3QO9A 4ZPDA 3SFGA 4ED2A 2IM3A 2HNYB 1HARA 1JLQB 2IC3B 5KFZA 3V81A 3KLIA 3G6YA 1REVA 4O3OA 5J2PA 3G86A 3T1AA 3LP1A 3ISNC 1IKXA 5CYQB 3RB6A 4NLDA 5J2QB 3QZ7A 3FQKA 5F9NA 4NRUA 2YNHB 3LP0B 3I5CA 3QIPB 5C25A 4U6PA 4EYHB 4NLVA 1S1VB 5D3GA 3M8PB 5DGAA 3KLHB 2VG5B 4QWAA 2BQUA 2FVRA 3N6NA 3MEEA 3DOKA 4WYWA 2FVQA 5DQGA 4RNMA 4ECQA 1S1WB 5HLFA 4KAIA 1HYSB 4RW7A 1JIHA 2XC9A 3BGRA 1TQLA 1S10A 5KFVA 4DG1B 3V6DA 1S0MA 3H4BA 3MR2A 1R0AB 2BANA 5FDLA 3QLHB 3GILA 1S1TA 2ZD1A 3DLKB 2OPQB 2XGPA 3JSMA 3SFUA 1JLFA 3MEGA 2C28A 1S9EA 4RW6A 4R5PB 5EUHA 5KFMA 4Y3CA 2W8KA 2B6AB 3CJ0A 2FLLA 1J5OA 4R8UA 2W9BA 4K4UA 2C22A 4WZMA 3KJVA 2BR0A 3FFIA 2BE2B 4KV8A 3KLGB 3GV8B 4K4XA 3CIZA 4O3RA 1UWBA 5EWFA 2HWHA 2YNFA 3UDLA 1LWCB 3Q8PB 1OS5A 1KLMB 3PZPA 3ICLA 1DTQB 2BRLA 3IRXB 2OPSB 4MIAA 4K4YA 2VG7B 1EP4B 3OLAA 5KFJA 3D28A 4IFYB 2HAIA 1N56A 4RNFA 4ED7A 4PQUB 1N48A 4RW4B 2JEJA 2I1RA 5KFGA 5J2MB 1HMVB 4JV2A 2C2EA 4I7FB 3KLEA 4H4MB 3CJ2A 3Q8SB 3OL9A 4ED3A 1JLAB 4MFBA 4LQ9A 1QAIA 3GQCA 1HNVA 4TYAA 4PUOA 3MR6A 4IH5A 1BQMA 5KFXA 1C2PA 1S6PA 1WNEA 2WRMA 2R2RA 3DMJB 2W9CB 2AGOA 1IKYA 5JUMA 3PR5B 1FKOB 2YNGA 3E01A 5F8HA 4IG3A 2GIRA 1SH2A 4J9KA 4NLUA 1RTIB 3DRSA 3HVAA 2UUTA 5KG6A 4IOBA 4Q0BA 1S9GB 4Q8FA 3DDKA 4LSLA 4DL5A 1S6QA 2HMIA 3MEDA 4KFBA 2JLEA 1JLBA 4MK9A 5EWEA 4Y2AA 2RDJA 3DYAB 4O44A 3I0SA 1N6QB 1QAJA 1HQUA 2QV6A 3DLGB 4QW9A 4IR9A 4RW9A 3CDUA 4LSNA 1C1CA 4IQXA 2ALZA 1ZTWA 3M9OB 4NLYA 4NLXA 5I3UA 2WOMA 4H4OB 4B3OB 3V4IA 2FJWA 2R8JA 3NMAA 2V4QA 3GYNA 2R8KA 2OPPB 4U7CA 3KK2A 5KG4A 1XR6A 4J9QA 2AU0A 4DL6A 3GV7B 2OPRB 4TY8B 3HVTA 4WXWA 5HBMB 3DRRA 2YKMA 4RNHA 4TY9A 5KFTA 1VRUA 1IKWA 4I2QB 4R0EA 4ID5A 5J1EA 1LWEA 1DTTA 1TL1B 1JLGB 1RT6B 4ED0A 3LALA 5F8GA 2YNIA 4WYLA 3CO9A 2DPJA 1RA7A 3EPIA 1GX6A 4J9OA 2HNDA 5DLGA 1N5YB 4WFZA 3KK3A 2JC1A 2FVCA 5CYQA 3BREA 4RU9A 3IG1A 2O5DA 4YMEA 2VA3A 5KG3A 3LP0A 4RZRA 4EBCA 1S1XA 3OHAA 3ITHA 1LW2A 4EBEA 4MKAA 3IS9A 1RT2A 3M8PA 4I2PB 3KOAA 2IAJB 2V0NA 4KO0B 2VG5A 3TQ1A 4QWEA 4PWDB 4O4GA 3N6LA 3I5AA 3PJXA 1TVRB 4ICLB 4MK7A 3BQ0A 3BR9A 4J9PA 3G6VA 2FLNA 2R8GA 4NLGA 4M95A 1FKPB 1HNIA 1FK9A 3HHKA 1RTJB 2XGQA 3QLHA 2E9TA 2WONB 4NCGB 4ED6A 5KG0A 2ASDA 3DLKA 4DL7A 1C0UB 1T05A 3OL7A 1TKZB 3UPFA 4IDKB 5EDWA 5KFYA 4IRCA 4DL3A 1BQNB 4RW8A 3DLEB 2B6AA 2IA6A 1RT7B 3H4DA 1LW0A 2R2UA 3OSPA 2ZE2A 5KT7A 2CJQA 2D3UA 2UVUA 3DRPB 4X2BA 1IM4A 4ZHRA 3T5HA 4IH6A 5CYMB 4F4XA 4DL4A 2JC0A 1JLEB 4H54A 4G1QB 2IM0A 5F8MA 4ECZA 3OL6A 3DM2B 5I42B 1DLOA 1KLMA 1RT4A 1XR7A 1HPZB 5DQHA 1JLCA 1VRTB 4JV1A 1TV6A 3UQSA 3I0RA 3DI6A 4KKOB 3ISND 5L1LA 1MMLA 5C24A 4JV0A 1JKHB 5KFEA 2R8IA 2DPIA 5F8NA 1W25A 1MU2A 4IFYA 1RDRA 1K1QA 2YKNA 4RW4A 2HNZA 3T19A 2CKWA 4MK8A 5KFIA 3DOLA 5J2MA 2FVSA 5KFRA 4KSEB 2QE5A 1TP7A 4HKQA 2IMWP 3KLIB 1REVB 1S97A 3NL0A 5J2PB 1S0NA 4ECUA 2UVRA 3OHBA 2VG6A 3LP1B 2B5JB 2AX0A 1S48A 1NNDA 4ZVHA 2R2TA 4K4WA 1S9FA 5C25B 3C6UB 3DMJA 4ZPCA 3NAHA 1FKOA 3EZUA 4EYIB 2IM2A 3QGIA 1RTIA 3MEEB 3DOKB 2IBKA 4ZVEA 3GIMA 1S9GA 1C1BA 3C6TB 3PJWA 5KFNA 3PR4A 5HLFB 5EWGA 2XWYA 3BGRB 2BRKA 2UUWA 1D1UA 4MKBA 3FQLA 1TKXB 3V6DB 4O3PA 4K4ZA 5KFHA 1QUVA 2BANB 5FDLB 5K14B 5F9LA 3KK1A 1N6QA 3KLVA 3DLGA 5KFQA 2RF2A 4IH7A 2IJFA 3H5YA 3JSMB 3KLFA 3PW4A 2FJVA 4Q8EA 1SH3A 1JLFB 3M8QA 3MEGB 2W9AA 1TL3B 1S9EB 3KHLA 4F4YA 1I6JA 4IG0B 1ZTTA 4IRKA 4H4OA 2ILYA 3BSNA 3LP2B 1RYRA 2XCPA 3RBDA 2FLPA 1RYSA 1RAJA 5J2NB 5C42A 3MF5A 3KJVB 3NKYA 1LWFA 1SV5A 3BQ2A 4YQWA 4F4ZA 2OPRA 3MR5A 1C0TA 3HVWA 4ECRA 1UWBB 2YNFB 5KT5A 3GV5B 4Y2CA 1HQEB 3BQ1A 3KHGA 4IR1A 2XI2A 4QPXA 3JYTA 2V9WA 5KFWA 5F8JA 4J9RA 2I5JA 4RNOA 4FBUA 4M94A 2RKIA 4Q45A 4YR2A 4J9SA 5DLFA 4ZP8A 2WTFA 5KG1A 3MFHA 5T14A 2JEIA 2IJNA 2AGQA 1T03B 4URGA 1IKVB 3KLEB 3MR3A 1N4LA 4ECXA 1JX4A 5KG5A 2ATLA 2J6SA 4WFXA 1QE1A 1TKTA 4MFBB 4NYZA 1HNVB 5KT3A 3QZ8A 4PUOB 4NLRA 2R2SA 1RTHA 1BQMB 4WE1B 4GC7A 1RTDB 2IAJA 4K4SA 4TYBA 3OL8A 1S1UB 4ECYA 1IKYB 2HNYA 5KFAA 2IC3A 1JLQA 2YNGB 1CSJA 3KHHA 3UR0A 4IG3B 3PW7A 4PWDA 4OL8A 5KFPA 3GIKA 3RB4A 1D0EA 3GIJA 3CJ4A 4LSLB 1S6QB 5J2QA 2FJXA 5HP1B 1EETB 3QGGA 1T94A 2J6UA 2YNHA 1JLBB 3QIPA 2UVWA 2OH2A 3MECB 4QWDA 5KFFA 4O44B 1S1VA 4IDKA 4FBTA 3H5UA 3PW0A 1HQUB 5KFUA 1BQNA 3KLHA 4FS1A 1KHVA 1RT7A 5KG2A 4RNNA 4RW9B 4YP3A 1NHUA 3Q8RB 4LSNB 1C1CB 2W7PA 3RB3A 1S1WA 3DRPA 5DQIA 1HYSA 4NLQA 3T5KA 3T5JA 3V4IB 4K4TA 4WXOA 5L9XA 3NBPB 4DG1A 3QIDA 1R0AA 1SUQB 3DM2A 2AWZA 3HVTB 4HYKA 2V4RA 4FS2A 2OPQA 3LAMA 4ED1A 3DRRB 2YKMB 1IKWB 3CVKA 4R5PA 1RT3B 4YR3A 3TVKA 3FSIA 5J1EB 1LWEB 1RT5B 2ILZA 3N6MA 4RUCA 4RUAA 4QWBA 4XPEA 4J9NA 3PW5A 3IGVA 2B43A 2YNIB 2R8HA 2GIQA 4ZVFA 5KFBA 4O3NA 4NRTA 2BE2A 3KLGA 4TN2A 4K4VA 3H59A 5KFKA 1RT1B 4K50A 2HNDB 3M9MB 4F4WA 4EEYA 2AGPA 2D41A 2C2DA 3H2LA 1LWCA 3KK3B 5L1IA 2B5JA 4DEZA 5DG8A 5HROB 3MTKA 3IG1B 4EO6A 5F8IA 5KFCA 1DTQA 2E9ZA 1S1XB 3C6UA 3V6KA 4IFVB 1NHVA 3ITHB 3IRXA 4WFYA 1LW2B 2OPSA 3TAMB 3IS9B 1RT2B 2VG7A 1EP4A 2XI3A 5KFSA 4Q44A 4PQUA 1S49A 3QO9B 4ZP9A 2EC0A 4KB7A 1K1SA 1HMVA 1YVFA 3V81B 4MIBA 3BSAA 3C6TA 4O4GB 4I7FA 4MH8A 5KFOA 3GIIA 2W7OA 3RAXA 4H4MA 2C2RA 2UVVA 5L1KA 2D7SA 1JLAA 1S4FA 1SH0A 1TKXA 1IKXB 4GC6A 4EBDA 1HNIB 5KT6A 1FK9B 4J9MA 5K14A 3SI8A 4KHRA 5DG9A 4YR0A 1T05B 3Q8QB 3IN5A 5L1JA 3MFIA 2W9CA 5C5JA 3H98A 1Z4UA 5D3GB 1TL3A 4IG0A 2D3ZA 4RW8B 4NLOA 3FRZA 3NGDA 3KNAA 3H5SA 3LP2A 1LW0B 4DL2A 1XR5A 2ZE2B 4URSA 4ZHRB 5J2NA 3KMQA 2BQRA 4RW7B 4ED8A 4TQRA 2AQ4A 1T3NA 4ZMMA 3DYAA 4O4RA 1HQEA 4NZ0A 3CWJA 2HWIA 4ZPBA 1DLOB 1RT4B 1S1TB 4WZQA 2ZD1B 4XO0A 3H40A 1JLCB 4TQSA 1TV6B 3I0RB 3DI6B 5C24B 3KHRA 4RW6B 4JUZA 3IGNA 4KE5A 4B3OA 3BSOA 1J5OB 2GC8A 2ZKUA 4R8UB 2OPPA 2W9BB 1MU2B 3CDWA 2YKNB 1T03A 2HNZB 5KG7A 3FFIB 3DOLB 4KV8B 1IKVA 4TY8A 4ZPAA 1S0OA 3OLBA 5HBMA 3QYYA 4NLPA 4ZP6A 2FVPA 3VQSA 2VG6B 4I2QA 2E9RX 1U09A 1TL1A 1JLGA 1RT6A 4WE1A 1RTDA 3RBEA 3M9NB 3FDSA 1S1UA 3BJYA 3RB0A 4J9LA 2BQ3A 5KT4A 4IKAA 1GX5A 4ZP7A 5KFLA 4F50A 3T5LA 3NAIA 1N5YA 3LANA 4EO8A 3V6HA 4TLRA 2J6TA 1C1BB 3I5BA 2WK4A 2RDIA 4Y34A 3QGHA 4Q43A 4ECVA 3CJ5A 3KMSA 1EETA 5HP1A 4IRDA 4ZVGA 4NLSA 4TXSA 4ECWA 4O3SA 3MECA 3CJ3A 4KHMA 3KK1B 4I2PA 3EPGA 1S6PB 4KO0A 2RF2B 2WB4A 4URQU 2W8LA 3KLFB 2XCAA 4XPCA 4LQ3A 3M8QB 3E01B 5DG7A 1TVRA 4ICLA 4ECSA 3H5XA 3LAKA 3RAQA 3DRSB 4O3QA 3G6XA 1FKPA 4Q0BB 4QW8A 5KT2A 3NBPA 5DGBA 5C42B 2AX1A 1SUQA 1LWFB 1RTJA 2HMIB 1SV5B 3CDEA 2WONA 3MEDB 4NCGA 4KFBB 2VA2A 1C0TB 1C0UA 2JEFA
chains in the Genus database with same CATH superfamily
4MIWA 2IBOA 4B9TA 1RT5A 4C4WA 4DFKA 1XQIA 4B9VA 3GG0A 2Z0GA 2WCXA 2M3DA 3EGWB 2RVJA 2AYBA 5GVQA 1VRTA 4DUYJ 4OX9J 2DGQA 4FXVA 4NLWA 1RHKB 4ED2A 1JLQB 3LP1A 1BAZA 2ZC3A 3M8PB 1UW4A 2RS2A 1L3VA 2JRSA 3D2WA 3J7YU 1JK9B 2J8AA 1KQGB 4C2MA 3MM7A 3GCXP 1N32F 4DG1B 1KLNA 4WFAQ 2IFXA 1FI4A 1P94A 2OPQB 1Q5YA 3TX8A 2Y1LB 2YVSA 4R5PB 3E8OA 2BXJA 2ATCB 1REGX 2UZAA 3HHLD 2X3DA 3Q0AA 3ZZRA 4CH1A 1Q8KA 2V69A 4F2RA 4M5JA 3B78A 4TLQA 2HAIA 5HANA 1N48A 4V19J 2AW0A 1XNRJ 4ED3A 1D9AA 3DMJB 1M5PC 2CQHA 3IBCB 1H72C 3HDSA 4DR5J 4KFBA 1RHRB 5JJBA 4NL5A 4DUTA 4IQXA 2ZFHA 1EKRA 3UFCX 2YWFA 3MMCB 3C19A 3HJFA 1JLGB 2YX7A 2EC2A 2L41A 4MT1A 2DPJA 5D0GA 1AZSB 1JMTA 1N5YB 2FHJD 4LRBA 5K5MA 2FVCA 3GPAA 3LP0A 4X65J 4YFUA 3CCSS 2OJ3A 4PYDA 2VOPA 4HDHA 1TVRB 2DR9A 1S7HA 3EZOA 5DZ6A 2R7OA 1I1GA 2FGCA 5LL6d 2CVIA 3R7SB 3RRKA 1Y7PA 4PG8A 2D3UA 1F6TA 3KFWX 1VC5A 1XNQJ 3EDQB 3DU6A 4OYWA 3GJSB 4EUVA 3ISND 2ZBRA 4KGMA 1Q78A 4RW4A 3CB4A 2K5JA 1URNA 1FD8A 3G96A 2LQ8A 1NNDA 3FZ2A 3T3FA 4P7TA 1FKOA 3ZNJ1 1V3ZA 4XDDA 5HLFB 5KFNA 1RADB 2KXNB 2UXCF 4MKBA 2HFUA 5IV4A 3RAMA 1X9MA 1CJVA 3A4TA 3ET6B 3I87A 1PG5B 3MEGB 2Q6CA 2XNRA 1K0VA 1NJXA 1WKKA 1I94J 3MF5A 4N8NA 3UW1A 2VICA 3TP2A 3BQ1A 1PIEA 3PCOB 5KFWA 2GO8A 4XK8C 2HAFA 1K44A 2V8HA 4IOAQ 4Y28C 1T03B 5A6WA 2YKOA 3D7SB 4ZJLA 2FHJA 2CDQA 5KFAA 3UR0A 1S4EA 2JLGA 2BV3A 1FJEB 2PA8D 2MQNA 5KFFA 3MCNA 4XIUA 4LR7A 1HQUB 5KFUA 2JH3A 1L3KA 1B70B 4DR3F 3V4IB 2MZTA 4ILMA 3CC4S 2VJVA 2J7UA 1F2GA 1R8BA 4YR3A 1KTVA 8RUCA 1WI6A 5E41A 3JQKA 2ZZNA 3DGPB 1V5VA 3GSIA 1NM2A 2Z2YB 1K9MT 1KR4A 3AY0A 1Q86T 2QLFB 2E9ZA 4L72B 2OPSA 2G9OA 3HHLC 4C8YA 2LMIA 5KFOA 3FUYA 3A3OB 5BYSA 1JLAA 2PDAA 4J9MA 4DV7F 5K14A 3R2DJ 2YQ0A 3MOZA 2M2BA 3WQPA 3AOBA 3KNAA 1HIYA 1VHIA 3W9JA 2BJ1A 1J27A 3CCUS 2J0XA 2AQ4A 1T3NA 1D8YA 1PILA 1UMJA 4ZVUB 2PIIA 1XC9A 5CZXA 2W9BB 1MU2B 2CJYB 3M6WA 3DOMA 4GKJJ 4CLWA 1NK0A 4LF6F 3QJPA 3SZ2A 2V50A 3IAS9 1S1UA 1WI8A 1MG7A 2PA3A 3MAAB 2BW7A 3I5BA 3PFOA 3KG0A 4ZVGA 4TXSA 3AJDA 4JI6F 7FDRA 1YDLA 4U7UD 1NDPA 3HMJG 4W90B 4A4JA 5B08A 1HWUA 1YJTA 2DH9A 3HULA 2AX1A 2VA2A 3MEDB 3PW2A 3E51A 4UW2A 3W66A 2VODA 4YDDB 2FY1A 1SJFA 2ZDPA 1RA6A 2KTQA 2I2YA 3Q83A 4X4PA 3QO9A 3U1MA 2N4DA 4ZPDA 4F3QA 3SFGA 2IC3B 5M2RA 3MM8B 3ISNC 5J2QB 4D3GA 3TVYA 4JI3F 3K5MA 2UUCF 4OHYA 4OIXA 1HA1A 3Q8VA 3NGRA 4NA1A 1PKUA 3KJVA 2B9EA 5D15A 4O3RA 2B8QA 5DJBA 3DDIA 2COLA 2VQFJ 3IR5B 5BXIA 3ZFVA 2LQ9A 3NMRA 2GFFA 5F0UA 1WUUA 3MCMA 4H4KA 2GAGC 4PUOA 3M30B 4IG3A 3HVAA 3FEZA 4C8MA 4BLGA 2XHWA 4CO3A 1YJWS 3DHWC 3D1HA 1QAJA 5HSPA 2JFKA 2HHSA 2LP4A 3CIMA 1S57A 5HBMB 2AEMA 2DITA 3DRRA 2YKMA 2KHCA 2MKYA 2B4OA 4WYLA 4HT5A 3WHIA 4J9OA 3T1HF 5A8WA 4RU9A 3IG1A 3C46A 1O6XA 4RZRA 3ZZTA 5B0CA 1WORA 4LR9A 2BOPA 2KVIA 2XTDA 5E3RA 4F04B 3OR2B 1B4SA 5E3QA 4X66F 4G6VB 3VGVA 3H4DA 2ZE2A 3F73A 3GIRA 1XIQA 2J9DE 5CYMB 4PABA 4F4XA 1NSKL 4G1QB 4WJBA 3CULA 3DM2B 2YWGA 3C2PA 5DQHA 3MPUB 3W2VA 3AH6A 4XDCA 1B0VA 3C15A 2CADA 1K1QA 3BBBA 1LQ9A 4P72A 3NCQA 5E7OB 1S48A 1XN9A 2F5GA 1LXNA 2CNOB 2LQ5A 5T7LB 1TK5A 3WX4A 2IBKA 3OFHA 3ZTQA 4FXEA 2UXBJ 1WG1A 1SH3A 2C42A 4K7QA 2B7CB 1RI7A 2W2PP 3W2WA 3LPEA 3GV5B 4Y2CA 2B4PA 4IR1A 2H5IB 1U1QA 5FLXU 1FRXA 3BM7A 2N7CA 3HSDA 2IJNA 1JXEA 3MR3A 3AHPA 4NYZA 2KELA 3OL8A 4DQIA 2BZ2A 1Y5LB 3AA8A 2VFRA 3CJ4A 3TOQA 1S6QB 1HWLA 2OH2A 2XHCA 1S1VA 2ERRA 2MZSA 3D0GE 3FBEA 2XMUA 1UFWA 3IR7A 4KHPF 5H1SV 4CLLA 2ALYB 4DCPB 2QSWA 1N5QA 2VF3A 3R3TA 1IM6A 3FSIA 5A2QU 4LBIA 2D9OA 2RU9A 1WTBA 3CF5Q 4LF8J 4NRTA 3O2IA 2AGPA 2D41A 1ITPA 3L9ZA 4DX8H 5HROB 3TAQA 3E3XA 2B7BB 1U2RA 4OJ1A 1W7WA 5LOQA 3NP5A 1WHYA 2RHSB 4DSJA 2CQ2A 3V81B 3RAXA 2UVVA 4H4MA 3DLJA 1WC5A 2Q66A 2HZVA 2O66A 4XTTA 1YJ9S 2DGSA 1A0OB 4KT0C 1TL3A 2CFXA 4DV1F 2EFOA 4ATNA 1YZ6A 3S01A 2UXCJ 1OMSA 3ZZOA 3KDNA 4ZMMA 4JI2F 4O4RA 4NZ0A 2CIMA 4P7VA 4WZQA 1TV6B 3A12A 3NOCA 2ZJQQ 5HMZA 5CABA 1S0OA 2VG6B 4I2QA 2BKOA 1RTDA 3JTNA 2PEBA 1FESA 3RB0A 2P9CA 3R6GB 1VS3A 1C1BB 3AXMA 1HLWA 2HQIA 4YDXA 3MECA 4KHMA 4KO0A 4DV5F 3GJQB 3UVJB 2Z57B 2XY5A 3RAQA 3CD0A 4DPYA 1RTJA 1IJEB 3UR3C 2JEFA 4C3MA 4ZN3A 1TKZA 2D3O1 2J8SA 4CT8A 2IDEA 5SZTA 1JLEA 3G8QA 2POKA 1WELA 3OTDA 2D9PA 1RLCL 3CJSA 1RKJA 5D8HB 4W98A 4DZ6A 1SC6A 2V8DA 1P9YA 3G6YA 4WK1A 3W8GA 4OYBA 4LF9J 4JB8B 1Q5VA 5C25A 4EYHB 2JNJA 3MMBA 4ANDA 2FVRA 1YBUA 3EYZA 3GFHA 4DV7J 3CT9A 2DEJA 3EUNA 1JLFA 1S9EA 4RW6A 2FLLA 3NG8A 3IP0A 1HNWJ 5E3AA 3BKTA 3M2UA 2KFZA 5DETA 5GADI 4DFMA 5C2CA 3NO7A 4CNZA 1FTCA 1EP4B 3A3NB 1Q16B 1FX4A 4JI0J 2KM8C 3CCES 2ROEA 1HNVA 1YBAA 4IH5A 3R27A 4OI4A 2M8HA 2C3OA 1Q79A 4Q7AA 1QSYA 4S0MA 3DDKA 3PIOQ 1RHJB 1T9WA 3ZTOA 5HK4A 3HF5A 1N6QB 2B9XA 4G1IA 2XY7A 1WSRA 5I3UA 5CYJA 4DR1J 4ZDNA 4J9QA 1A6LA 4F0HA 2OPRB 3M6UA 4QIEA 3HVTA 1T7PA 1WSVA 3NS6A 2C2NA 5B0EA 4LFBF 3EDRB 3O1LA 1GX6A 3NRBA 1M5KC 5F0WA 3K7RA 3R5BA 5CYQA 2G0IA 2Q2KA 2O5DA 4YMEA 3JSRA 1HD1A 2IAJB 1GXLA 3N6LA 3VZHA 4J9PA 2MZ1A 1FKPB 1S79A 4ENOA 1OO0B 3BN4A 3FNNA 2WONB 4NCGB 3O5TB 3KXDA 3UPFA 4DL3A 4A8MP 4C11A 2XYGB 4JI8F 4JI3J 1FERA 4KR0B 3DRPB 3HK2A 3CCWA 2PO4A 3QFWA 2CAJA 2CQPA 3A13A 2XS7A 5C24A 3MPYA 3CW2C 2V4JB 3POTA 1R43A 4O0IA 1DY3A 2X1BA 2E1AA 2IMWP 3KLIB 4N7TA 3HHNB 3I82A 2NPIA 4NZ6A 4C8NA 3TX0A 5A8KA 4B3TF 4OZJA 4KJIA 1KONA 3FQLA 4QZVB 2XLIA 4U7UK 3D4JA 2ZOMA 3KHLA 2LEPA 5ETNA 1RAJA 1VFJA 3MMJA 1H73A 2ZH3A 3UWTA 1RUSA 1HI0P 5DLFA 2WTFA 1RK8A 1UW9A 2Y0BB 2KKHA 5J1NA 3FJ2A 4CLKA 4YY3J 2CQCA 2VB6A 1VIOA 4ZLNA 1T9TA 1CJKA 2YNGB 2L3MA 4UZCA 5GAGI 5D6GA 3RB4A 1S6OA 1RTZA 3GIJA 3LO3A 2CAXA 3N9UC 1BQNA 4M5NA 2H54B 2XY6A 1H2TZ 4A8KA 1PC5A 1MROB 2UV8G 2QL9B 1HYSA 4HVZA 4F7VA 2CPFA 2IMOA 1UTAA 3W7BA 2ZHBA 1UWAA 2ZOGA 1U0HB 2NUHA 3N6MA 1MYLA 4JI4F 2XMAA 3D9BA 2BDPA 4EEYA 1ELOA 1LWCA 2XEXA 4DEZA 1I51B 1GFWB 1VLOA 4L76A 4KB7A 2AV5A 1HMVA 4O4GB 1GTHA 3A1YG 1FXLA 2P9EA 1QUPA 1FK9B 4KHRA 2WVEA 1T05B 4N8OA 5L1JA 2JXHA 4DSFA 2XWXA 5J2NA 2BOAA 4RW7B 1KDNA 4DV3F 1O5JA 4PXBA 3RW6A 1RT4B 3LPYA 3BSOA 3BO3A 3DLLQ 5GMDA 1R8CA 4V19X 1U09A 3QATA 3AX5A 2CPDA 3MTJA 4WE1A 3RBEA 1M1HA 2HVIA 1H0HB 4ERDA 4OHZA 2OI2A 2WB4A 2ZNYA 2Y1RI 4PPDA 1RWUA 4Q0BB 1UA0A 2W2OP 1SV5B 4Q2MA 4ZVQB 2NR0A 3L95X 4DV2F 1HR0F 5DZ7A 1IBLJ 3L7OA 2ASLA 4KPCA 2I5JB 2JEGA 3HVRA 3Q8UA 4YOEA 3VVTA 1KHWA 2XZTB 3NGSA 2PN6A 2MGZB 2E1CA 4KKOA 3HPOA 3OSNA 5D78A 4B3MF 3IR6B 2DGWA 1W2BR 2IM3A 4QBUA 3MR7A 4EFAC 3D66A 2PI4A 2AP6A 2VG5B 4ECQA 1JIHA 4WTOB 1X5PA 3KJFB 2GMJA 4N56A 2QA4G 1VK3A 4FYYB 3TA2A 4F36A 4YUDA 4EI2A 3MEKA 2BR0A 2MKSA 2JHEA 2HWHA 1FE0A 3UDLA 1TL7A 7FD1A 1HI1A 1R8HA 1KLMB 3ZC4A 2PSZA 2QTWA 2VG7B 3C3LA 2LKZA 1VRQC 5J2MB 2FJDB 3D6TB 2OLWA 4CM2A 3MR6A 4ZOSA 3C16B 2WRMA 3HXMA 2JWNA 5L39A 2UUTA 2IYIA 4DPUA 2FPHX 4DL5A 1BHNA 3RU0A 1X9SA 1JLBA 1BC6A 3UCGA 4F3MA 1VYAA 3LF0A 2FQQB 2ZBIA 1CLFA 2ALZA 2WOMA 3NMAA 2R8KA 1UCNA 2V2KA 4N77A 1IQTA 1TL1B 1NK7A 4ED0A 2WVFA 4J9VA 3TQEA 2HNDA 1RWOB 3BYPA 4OX7A 3VV2B 5LMUJ 2K1RB 4EBCA 3L7PA 3ITHA 4QOTA 4EBEA 3TQ1A 1PO6A 3LJPA 2OFGX 1YWXA 3SMZA 3DLEB 5B0BA 1BE4A 2JXGA 5HQLA 4X2BA 2ZBPA 4AL5A 2F7VA 2HRYA 2DHGA 1DLOA 3IMQJ 1HPZB 3PHTA 1SVDA 3PX4A 2E5IA 4TU9A 1YKWA 3I96A 2YX4A 4X4SA 1UPPA 4B9LA 4RPFA 4LFCJ 1PYSB 3THTA 3JXOA 2LVWA 2OTJS 4UQGA 5KFHA 1QVFR 1HBMB 2FJVA 3PW4A 2HBQB 9RUBA 3OFFA 4H4OA 2DNGA 1LWFA 3FMBA 4LIRA 5A8RB 2ZH6A 3SQGB 4I6WA 3SDEA 3KHGA 2GA7A 3UNGC 4FVCA 5T14A 3M6XA 3W5XA 1HW8A 2VJUA 1ZPVA 1PYOB 2DKOB 1N8RT 4LFBJ 4G1PA 3FRYA 2X1GA 2RSQA 4DQSA 5CXTA 5KFPA 3KJNB 2K9IA 1KVKA 1EETB 1U6ZA 2DIVA 2YPYA 3R5GA 4C8OA 3PEJA 2RT3A 2CPJA 2KRRA 3SCJE 4QYZJ 3T5JA 3IC1A 2BJEA 1SB6A 1EA4A 1SC1B 1ZZFA 5J1EB 4XPEA 4J9NA 2GIQA 3R9LA 3ETMA 2M0GB 1HNZJ 3DXSX 3SQOP 3NNAA 5ETTA 1NAQA 4PQUA 1S49A 1XMQJ 1V3RA 3W8PA 2QA1A 1QTNB 3D1OA 1Z4UA 5IWAF 1ZPWX 4RW8B 2BEFA 2RBFA 4CYUB 2BQRA 2NS1B 1H98A 4TU8A 2KT2A 2AYEA 2OPPA 4FDFA 1F9EB 4UTGA 3GYXB 1U2FA 3RR7A 3BJYA 2AYMA 5A6PA 1SIZA 3PRBA 3T5LA 4LF5J 4L73A 4TVAB 4ECVA 4WK3A 3CJ3A 1DQ9A 1Q0NA 3LAKA 3G6XA 2G0JA 5DGBA 2CPXA 4B3SJ 1C0UA 2ZJRQ 3ISZA 1Y00A 3AQPA 5LMNJ 3PY8A 2GGPB 1TR0A 3KK2B 4D3HA 3V6JA 3ZZPA 1H7XA 3GFXA 2P9GA 3BGOP 5JVHQ 1EKSA 3QBCA 4G3IA 4IFVA 3J7ZT 4LSZB 3BSCA 4YB6A 3MMAB 4LVOP 1REVA 2HIYA 2JBVA 3TJAA 5F3ZA 3QIPB 1QAXA 4U6PA 2CPYA 4WYWA 5DRKA 1Q53A 4RL1A 4Y2IA 1B01A 2W01A 1URRA 3KG4A 2HQDA 5FDLA 5IC4B 2RDDA 3R2CJ 4B17A 1J5OA 4M5KA 1K73T 4KV8A 3ADAC 1OS5A 3PZPA 4CO1A 3BR8A 2FJEB 2GW8A 2GZOA 2I1RA 1R31A 2FZKB 3P4UB 5THWA 2Y3YA 4FF1A 3CJKB 4X4VA 1TUWA 4B3RF 2VFVA 2R7WA 4Q8FA 3MHYA 1JNZB 2I6WA 3UDCA 3BB5A 2EK1A 4IR9A 3TARA 6FD1A 1HR0J 4RNHA 3VAGA 1SI9A 2XZWA 2PGCA 3MM9B 2JZ5A 3EPIA 1DQAA 2XSJA 3W9HA 3UO0A 3QWPA 4B3MJ 1VIXA 1FVQA 5B7WA 2R9LA 3G6VA 1NRKA 1FFWB 3VHQA 2QG9B 2E7WA 4DL0C 5KT7A 3QQCD 5I3PA 2OELA 2WW4A 1XR7A 3M7VA 2K29A 4WCEQ 4DPWA 2HNZA 3C14A 2W4CA 2I8EA 5J2PB 1S0NA 2YKQA 1WJ9A 2RRNA 2H3EB 4M5GA 2KFYA 3EGNA 3AQOA 3M8WA 4ZPCA 1ZAWA 3IBWA 3MEEB 1S9GA 5EWGA 5A0YB 4HH0A 3N4WA 4OYPA 1RBLA 3V6DB 3MI7X 3HI9A 4CLFA 2YWHA 2W9AA 1DQ8A 4DI6A 1TK0A 1RYSA 5C2GA 3HO1A 1UFKA 4ECRA 1B3TA 1H38A 4RR5A 2NCKL 2IRYA 3PNIA 4J9SA 3HLUA 1EX8A 1F5AA 3MFHA 4P6QA 4ZJQA 4URGA 2GO9A 5HAOA 2ATLA 1AFJA 1P8GA 4WFXA 5FLXY 2EBEA 1NBEB 2RS8A 3L7UA 1JLQA 4CIOA 2GJFA 3HZEA 3GCWP 9ATCB 1KBRA 2EBGA 4QYZK 4IDKA 1RT7A 1NHUA 4LSNB 2J0QD 1VQOS 2G2ZA 4NYPA 2MLYA 1J5EF 4DG1A 5IV3A 4F8RA 4JYAF 4K0KF 3RW7A 4HYKA 2V4RA 2OPQA 3PACA 1OYEA 1WWHA 2XZDB 4R5PA 1RT5B 4RUAA 1UVNA 3PW5A 2JLFA 2FJAB 3QRPA 2PEHA 2RRBA 1WEZA 3KK3B 3TZWA 2G2YA 3MTKA 5A2QY 1S1XB 3HSZA 2EC0A 1OJ4A 1VOMA 2AJQA 1TKXA 2E44A 5DG9A 1FNXH 2VQEJ 4DL2A 1NXIA 1XR5A 3Q89A 1FRHA 3MM7B 4M5HA 2OMOA 1U8SA 3OFGA 2GC8A 2ZKUA 3CCLS 3MMCA 3OLBA 8ATCB 2O67A 4FKYA 2NYHA 2MLXA 1JLGA 3F41A 1UVKA 1AZSA 1N5YA 3WX8A 3EXYA 2DD8S 4NLSA 4NXNF 4O3SA 3M6VA 4WKRA 2XCAA 5H9EJ 1TVRA 1KQKA 4KFBB 4DR4F 3J7YI 3TYTA 1F0XA 1G6BA 5DDQC 2IA0A 5J1PA 1TKTB 4A48A 1WF1A 1KOOA 3I4HX 2F8MA 3K2YA 2R7QA 2LDIA 3LP0B 3OTOF 4NLVA 4RWXA 3GLJA 3KLHB 5HLFA 1UPMB 3UN3A 4YB1P 2ADLA 3MEGA 4USWA 2QLBB 2BA9A 4K4XA 4X64J 1A7GE 3JSBA 1FO1A 4OYZA 1RHMB 3Q8PB 1NDCA 2OEMA 3AWRA 4CNYA 1U25A 2B9WA 4RW4B 3N5BA 3K57A 4I7FB 1VQLS 5BYRA 4EMDA 3TANA 1UZHA 3FSYA 3TVZA 5B0FA 2R2RA 3PR5B 5JUMA 1FKOB 3E01A 5F8HA 1RU1A 1VBZA 4AXIA 2HVDA 3I0SA 1HQUA 1M5OC 4KPYA 1U1KA 1Y5IB 1WKJA 4P52A 4RO0A 4NLYA 4PPZA 2HVZA 3V4IA 5IFMA 1HD0A 1Y3KA 1X5SA 4ID5A 3W5YA 4DQRA 4E0DA 1U1RA 3LALA 2NYIA 4KGZB 2DH8A 2MKCA 2ADCA 4C3KA 4TKTA 1WC6A 1SQGA 4KY3A 5KAKA 1JNRB 2B9YA 3VTIA 3TO8A 4B02A 3DLKA 1X5OA 4OX9F 4DFJA 5K8PA 1PCAA 2J9DA 2ZITA 3TZYA 2DRBA 1DZ5A 2F63A 1YJUA 3NNCA 1UEKA 3MD3A 1FEHA 4NI2B 2NXUA 3I55S 3M2VB 1MU2A 3JQJA 3EE3A 2FVSA 3SBMA 3OV7A 4PXDA 4JI1J 3NWRA 2XBPA 1S97A 4UOHA 2BKNA 1UUJA 3HHDA 4ZVHA 5RUBA 1PYTA 4ZKAA 1SKSA 3IWNC 1BDVA 4M5DB 3MAAA 2IM2A 4AL6A 3DOKB 3PJWA 4YB5A 2BW2A 4WBFA 3VF0B 5K14B 1LOUA 4B3RJ 3DLGA 1ZTTA 1GMWA 4BWMA 2XCPA 2Z56B 4ZVSB 4QPXA 3SXLA 3SCKE 3FVYA 1MNEA 1VQ4S 3ETOA 1TAUA 1O8BA 1OY9A 1JJ4A 2ZH7A 5IT4A 1S1UB 2IC3A 1QM9A 2QEXS 3MM8A 1FNMA 2J9EA 5J2QA 4CT9A 2J6UA 3GSDA 2HPUA 2IHR1 4YB7A 1CULB 4O44B 3TA1A 2DGXA 5KG2A 4RNNA 3VVUA 1NK9A 2R7UA 3CTRA 3JAMU 1MSWD 2DR8A 1TUGB 1VJQA 2NXEA 2P2CB 3ULHA 2WBRA 4DCJB 4X65F 2YNIB 1YRTA 1HWKA 4A8QA 2JJ4D 3TWZA 2C2DA 2B5JA 5DG8A 4FPRA 3RJMB 3C6UA 1CBKA 1RSCA 3KUHA 1RT2B 2XI3A 3QO9B 3ILLA 4DX5A 2HVEA 3BSAA 1AFIA 3GIIA 1TUVA 4GMKA 2CZVC 5L1KA 4GC6A 1HNIB 3M30A 1XMBA 2CJ9A 1XNQF 1L5UA 3P6YC 4NASA 2OSQA 4DS5A 4NPOA 3D0HE 2KJVA 2EFGA 4IOCQ 4V1Ak 2BNWA 3QRRA 4HL9A 4UQTA 5EX0A 4PG5A 5HBMA 4NLPA 1NZ8A 2LQBA 3OQ2A 2V8GA 3FEXB 4J9LA 1QTMA 3H90A 3QSIA 1U7LA 2M5YA 3IWXA 1VC0A 2WK4A 2H3AA 2PMWA 3J7AN 3GE9A 1RJJA 1I94F 1WDDA 3KDOA 1LNQA 1FWLA 5KT2A 2FY8A 3G2XA 3P96A 3BKFA 1G4CA 3OR2A 1XBWA 1F5BA 3J7A1 1WOPA 4ID8A 2UUAJ 5CYMA 4ECTA 4K0KJ 1WDTA 3CCZA 4G1QA 1YTYA 2WHOA 1NJIT 2X1AA 2HGNA 4M5LA 4BDPA 2IY5B 3TAMA 2DB1A 1RAGB 5AE3A 4MYUA 3BDPA 1IKXA 5A8WB 2KVQE 1N34J 2PFDA 1RCOB 5DGAA 5IC6B 2F3JA 5AE1A 1TQLA 1S0MA 1N0VC 1KVJA 1U2CA 3CUNA 2OHDA 2DHAA 4OZLA 2CDRB 1W26A 2RJZA 3FFIA 4HR2A 2QLXA 2GHVC 2B4UA 1NJZA 1YBTA 4ZLLA 4MJWA 3IRXB 4MIAA 4P2MA 2JEJA 3Q8SB 2ZZMA 1QAIA 3DRSA 2BJ7A 2Q3PA 1UVJA 4NXNJ 1S6QA 2B8PA 5JVGQ 2JOQA 4GKJF 4QIWD 4OYAA 3M9OB 4KGXB 2GMHA 1FDAA 3IRWP 1OY8A 1JJCB 2CUYA 4TY8B 2BBEA 5K20B 2MQ8A 2ACYA 1BY9A 2EXUA 4UUWA 4KC5A 4CH7A 4C7QA 2VA3A 5AT1B 3LGHA 4C48A 5ITHA 3F56A 4MK7A 1KRPA 1DFDA 2OFHX 1FJ7A 2BMBA 2YKAA 4HHUA 2FHMA 2EKYA 4E98A 2CJQA 4JP8A 4DOZA 4KIAA 1IJFB 4ECZA 3TI0A 1TV6A 1JKHB 4OI6A 3O6QA 3QAEA 2H65B 4PZVA 4HT7A 1VDHA 2VG6A 1M5SA 2G2OA 3EICA 2QLWA 1ACMB 1C1BA 2CPGA 4YS2A 3X1LB 2ZUGA 4K4ZA 5ETOA 2BANB 3TRGA 4AT1B 1NHKL 2MSSA 3JSMB 3RUBL 1TL3B 3UVJA 4IRKA 3B4MA 2VONA 2VQFF 2HFOA 2NREA 3VGSA 4F4ZA 1T95A 1UWBB 1DHMA 2YNFB 4RUHA 1EAYC 3H42A 5GADU 1X93A 1RAHB 4Q45A 1ZOTA 5LSRA 1Q8LA 2ZH9A 5KG5A 2J6SA 2CNLB 5D0EA 1RTDB 1PAEX 2I38A 1T02A 5BYQA 2MY7A 4KRWA 1D0EA 2ZZTA 4QJVA 3EM1A 3LOUA 1V9OA 1T94A 3MECB 2LU1A 1RZMA 2P5VA 3KNGA 1D8ZA 3M4XA 1C1CB 3RB3A 1WC4A 1U6FA 4QYRA 3R5AA 2MZRA 2AJ0A 3VAKA 3PKYA 4AQYJ 1RBOB 2VBXA 3BBCA 3KG1A 5HQ8A 1U24A 1U45A 1C4CA 4ZVFA 3QT6A 5KFBA 2HFSA 5GAEU 3H59A 4BBYA 2MKJA 1MWZA 4ZPVR 1FFGB 3IBFB 1HI8A 3GYGA 1EP4A 2M88A 1Q16A 5L8RC 4A8SA 4ZK7M 1GXTA 4JI7F 5B09A 2L9DA 1H7WA 4DV4J 3LP2A 3VGTA 3ILJA 1UVMA 4HTIA 4ZA1A 1WF2A 1XTZA 2NXCA 1YG0A 4TQSA 5E0OA 4PYAA 2IJRA 3M05A 2GMLA 4RW6B 1TKDA 5BR8J 5GMEA 3M2UB 1VCTA 3FDSA 3UD5A 2J76E 2UXBF 1IN0A 1HBOA 4FPIA 3R7BB 3V6HA 2RDIA 3NS7B 2HQGA 4E2FB 3KK1B 3EPGA 4WTYA 2HFVA 2RF2B 4URQU 3CDAA 4XPCA 4DLEA 1FKPA 4QW8A 2Z2ZA 1V5IB 2WONA 4NCGA 1C0TB 3QT7A 4USIA 4Z2XA 4UY85 4DU8A 4OYMA 1X4GA 5I3UB 2J0WA 3OBIA 1K0TA 3D67A 3PHEA 2RQKA 3VALA 3VAHA 2ZC4A 1QE1B 4NEYA 2V4JA 4A47A 5JXSA 2AEJA 2WVDA 2HNYB 5KFZA 3MPWA 4L3KA 5GAGU 3KLIA 2FGOA 1VQMS 5CYQB 4NLDA 1FCAA 3DU5A 3CMAS 4RNMA 1ZYQA 1Q4RA 4LF8F 1T9VA 2V34A 5KFVA 3TJ8A 2BE9B 2ZD1A 3CCMS 3HHLA 3Q24A 2VFUA 2C28A 2CQ0A 4C11B 6AT1B 4R8UA 3HZGA 3BEGB 3KLGB 3GV8B 2QMWA 3UNYA 3D6HB 3ZTPA 2ZNZA 5JMNA 3DDNA 4DWIA 3BF4A 1FD2A 1TZ0A 3POTB 4ZITA 2A2BA 1HHQA 1SBRA 3OL9A 4OYIA 3IWLA 2B4VA 1M1KT 3AJ1A 1S6PA 1VQ5S 2YNGA 1SH2A 3J80U 4DR2J 4K59A 1HWJA 1Z2ZA 2Z30B 1RAIB 2CWKA 3MPVA 2JLEA 3VR1A 1Y9OA 4ZVPB 2QC3A 4QW9A 2UU9J 3VCDA 1MROA 3TEHB 1PJ5A 2R8JA 2FJBB 2HQ3A 1WC1A 1LKZA 3W60A 1WF0A 1FDNA 3OFEA 2C2OB 4DL6A 1F3FA 4WXWA 1YRXA 2HHHF 5HVGA 1RT6B 4I1TA 1YI2S 3BO4A 1ZM3A 3AB4B 4F25A 3BO2A 1I3OB 4NXMJ 4P10A 1CG2A 2CQ3A 4KGVB 1W2IA 4J91A 4QWEA 4O4GA 2FLNA 4ICLB 1UEVA 3NCRA 3OPKA 1FK9A 3F44A 3QLHA 3AX3A 4CTAA 1T05A 1N33F 1HL6A 1BQNB 4G65A 2UVUA 1U4BA 3W5ZA 1OSCA 1HHTP 3OL6A 1NKCA 3WC2A 1RT4A 5L1LA 4LF9F 4RJVA 1DARA 4K5SA 4MK8A 1HBUB 1FNOA 3BH6B 2VBZA 2R2TA 4K4WA 3US5A 1FRKA 4LF2A 4EYIB 3Q2SC 2BJ3A 1QAYA 2XWYA 1WD6A 1AXQA 3U02A 2RH3A 1HNWF 2J7KA 1X4EA 3BH7B 1RYRA 5J2NB 3NKYA 1X0FA 1SV5A 3BYRA 4JBCA 1GQEA 4FVMA 2Y8WA 4JI0F 1KSPA 2I5JA 1B99A 3A8IA 2ZM6J 2AGQA 1RBAA 2MGZA 2DGUA 2DO4A 2J9CA 2MZQA 1BQMB 4WE1B 4J37A 5D4OA 3GFZA 4OL8A 1B7YB 3CC7S 4DR1F 3I56S 2V8PA 4QR2A 1Z2LA 5U47A 3R1LA 5DM7Q 3G8TA 3TR5A 4OFZA 2XTJP 2WBMA 4PKDB 1IKWB 1IR1A 4X4NA 1X7VA 4OZ3A 4Z37A 2XMJA 5KTQA 3MM6A 2P6SA 4K50A 2DHHA 1ZZNA 3R97A 5F8IA 4WFYA 2AJ1A 2ZOFA 3IS9B 2VG7A 3TA0A 4F26A 5IQQA 4F3OA 4EGLA 2AJFE 2NUUG 4MIBA 2K6LA 4MH8A 2C2RA 4J7CA 1YJNS 3GZ7A 3B6BA 3Q8QB 4X4OA 4HV0A 3G8SA 3UI3A 2V2ZA 2J7WA 4IG0A 3FRZA 4NX9A 4ZHRB 1K8AT 3QGPA 4ZLPA 3CPWR 4HI2A 5G4DA 1JLCB 1D09B 2KXFA 4CLUA 4JUZA 4DDFA 3MDFA 4KTQA 2HHTA 2AY0A 1Y0HA 3DOLB 2A1BA 3MUTP 2HK3A 2N7YA 1TL1A 2EG1A 1QD1A 2HKEA 3MXHP 2HFZA 4C97A 3OUYB 2FC8A 3KYLA 2M70A 1GX5A 1TAQA 4F50A 3NAIA 2K1RA 2E29A 2RMLA 4USKA 3OR1A 1L3SA 2HYIB 3D68A 2FHOB 1WOSA 3JB9k 5ETRA 1B0TA 5ETLA 4MJKA 3G4SS 5B0DA 2GVDA 3CD6S 3DLEA 4K2XA 1XMOJ 4YN3B 4LVNP 1BWVA 2WOMB 1CJUA 4YY3F 1OQ6A 3MZIA 3TZZA 1SKRA 4NLTA 1RAFB 1ZETA 3RBZA 1HPZA 1N5VA 3CO0P 3PYGA 4CLTA 4AFFA 3VZIA 4KGKA 5F9NA 2MXYA 4NRUA 1VHFA 2HGMA 1N5SA 4JI7J 3UE2A 1R8PA 2KL8A 5DQGA 3T6BA 2A6MA 3HFZB 2M7SA 2ROPA 3H4BA 4DU7A 4RLEA 4QU7A 1HBMA 1S1TA 1SC3B 1R6YA 4OI3A 3I4PA 2SXLA 4Y3CA 1Y3JA 4WZMA 2IVMA 1RAAB 5EWFA 3SQGA 4A8OA 1H3DA 1DTQB 4L6V3 4K4YA 3D28A 2HQCA 4PEOA 4BC9A 2IDLA 2RB7A 2IVFB 5IM0B 2JX2A 1WOOA 1HBNB 2N4CA 3C66A 2HK2A 2GIRA 4CO2A 3L4BC 4NYOA 2HMIA 1Q1KA 2CJAA 1JJ2R 2K7KA 4EZ9A 2FUG9 3MUVP 2VPZB 4H4OB 4DS4A 2CXEA 2V4QA 2Y1JA 2EEYA 3T1YJ 4KYZA 1S7IA 1SCJB 1H2VZ 4I69A 5J1EA 3S7RA 2Y9HA 4FNHA 4K5RA 3FZBA 5IT0A 1RA7A 1CJTA 1XEZA 5DLGA 4DFPA 2YQ3A 2Z4PA 1PSDA 5LM7E 1EZZB 2ZUAA 4IO9Q 1NUEA 2A0FB 4I2PB 3KOAA 1X9WA 1M1GA 3D0IE 2HGLA 1IBLF 2KZZA 4J90A 4UF4A 4ED6A 2FJWA 2WVBA 4DL7A 2DNLA 2F9DA 5G0RA 3OL7A 5EDWA 4OQJA 4RW8A 4NE9C 2B6AA 4UOCA 3HFVA 1LFPA 4CYUA 2DTJA 1MMDA 1NSAA 3SIPB 5A76A 4DBQA 1BDTA 2PC6A 4RUBA 1W25A 1E6VA 1F9FA 5KFRA 1TP7A 4HKQA 3UN5A 3QPIA 4UZBA 3K5NA 4ECUA 1FFSB 4WIQA 1WHXA 3QGIA 3TUZC 3LUYA 2GCFA 3PR4A 1L3TA 4WP8A 4M63A 2UUWA 1JWWA 5F9LA 4IH7A 2IJFA 3H5YA 1RP5A 1CC8A 4P73A 1VBXA 4PXEA 2H5JB 3J81U 4J9RA 2GGPA 4YR2A 1IQZA 4ZP8A 3DFEA 2RNEA 1C4AA 1FA0A 3IM9A 3KLEB 1N4LA 2HHHJ 3I9ZA 3CCVS 4MFBB 1UL3A 3HFKA 3HD1A 4PWDA 3MMAA 3N0VA 1G2EA 1V6HA 2FJXA 4ZCIA 4C98A 3QIPA 3EMTA 1DRZA 4RW9B 3SSQA 1Q82T 1YQHA 2R42A 2YBVA 5IS2A 3GR1A 3WBZA 1N33J 2PFFB 5LMUF 3CVKA 1YK9A 2O3DA 3JAMY 4TN2A 4K4VA 2XO7A 4C8KA 2OP5A 4CO5A 1NSPA 3M2RB 1QVGR 3EVOA 3PFEA 4IFVB 1LW2B 3LA0A 2BX6A 2DHSA 3C6TA 1AT1B 3U1LA 2BA3A 4MKYA 3OD2A 3TW0A 1S12A 3CJKA 1U1OA 2R7VA 4NA3A 2D3ZA 3FGVA 1LW0B 4CI0B 2PT0A 3WDOA 2BSQE 3KUEA 3MPDA 2YWEA 2MY8A 4ZPBA 2E5GA 3O3LA 3DI6B 2OD4A 1J5OB 2UXDJ 2ASYA 2ZDOA 3AD9C 4LFCF 2YKNB 2CJBA 4KV8B 2IRXA 3JQMA 2QYCA 2KRBA 1RAOA 2F9JA 1EARA 4ZP7A 3ZZZA 3I31A 4EO8A 4TLRA 1N52B 4Y34A 2AIRB 4Q43A 2QRRA 2E5LJ 2DCLA 3H2UB 3U27A 5GAHU 4FZVA 5E5NA 4ZIWA 2G1HA 3GJTB 2B3TB 3M8QB 4NEZA 2DRDA 3NBPA 1SUQA 1X4AA 1TMJA 3D3BJ 1WTFA 3JYTB 1NDLA 1FJGF 1N0UA 4QIGA 4ANEA 1OIAA 1RT1A 2F8EX 4OZ0A 3R5JB 1ULRA 2YH0A 1P1LA 1HARA 1FTRA 3QAUA 1AUDA 1MW7A 4O3OA 5J2PA 2HWTA 3G86A 4JV5J 4PG4A 4DN0A 4HH1A 2H4WB 1SL0A 3MEEA 4DSKA 2UUBJ 3V6DA 1R0AB 1HNZF 2QIFA 1RISA 3MCSA 3CJ0A 2GIFA 4LRFA 1XMQF 4UOGA 3NGTA 2WVCA 3I6PA 5EHHA 1G1XA 2QLJB 3OW2R 2L9NA 2LXFA 1FRLA 4CCHA 1BXNA 5KFGA 5ETQA 3K8VA 3W9IA 3M32B 3DGVA 2KKEA 3H20A 2EFQA 2V2VA 4ZVOB 4OLPA 2H4YB 1ZBTA 2MZJA 1WEYA 2HHWA 4GO5X 2RILA 1LXJA 4ES3A 2AZ1A 1S9GB 3UCZP 2RDJA 3DYAB 2XS5A 2HIQA 4AUKA 4LSNA 2DO0A 2L08A 4DSIA 4B3OB 2ZHAA 2UV8A 5D0RA 2W7AA 3GV7B 4LF5F 4AL7A 1B28A 4FN5A 1VRUA 2ZBCA 2P8IA 4DR6J 2AF6A 1KVIA 4U8VA 3KK3A 2NSCA 3AODA 2H51B 1S1XA 3OHAA 2DHXA 3M1VA 4B3SF 2MB0B 4UY8T 2EWHA 1RAEB 3PJXA 5LMNF 4CQ1A 2BM0A 3M8ZA 1TFWA 4NCAA 2ASDA 1F1BB 4IDKB 3S8SA 1N36J 1GNKA 1RT7B 4I0WA 1UJ4A 3BPDA 2VASA 1U49A 1HNXJ 4JV1A 3PX6A 1QY7A 1MMLA 4JV0A 3T9NA 2CKWA 3O8WA 2V1SA 4DR7J 4K2JA 2VBWA 1SQEA 2Q1LA 1GH8A 2RIJA 3PX0A 2W4DA 1RHQB 3NAHA 3N01A 1RTIA 4PRFA 2HLUA 4CLPA 2HHQA 5CA5A 3HP6A 3BGRB 2BRKA 2ZH2A 1TKXB 2KJWA 1QUVA 3PJ9A 1GK8A 2WZ1A 2YXLA 2DXFA 2HG4A 1T3OA 2EFVA 2C1EB 3RBDA 2FLPA 4OJ3A 2EFNA 4ILRA 3T6JA 3QFHA 1RQ0A 4RNOA 4FBUA 1CS4B 2LEBA 4U9RA 4ANCA 2GHPA 3NOGA 1Y5NB 2V94A 3PYDA 1TKTA 2WB1D 4ETZA 4NLRA 2LCWA 4X62J 4K4SA 4RBVA 3EZ5A 2IVYA 1D9FA 2LECA 2XO6A 3PRVA 1VBYA 1S59A 3N28A 3KLHA 3R8YA 3Q8RB 3FSXA 3AX2A 2NLWA 4F2SA 1S76D 1MNTA 4WXOA 2KH9A 4IYQA 2A18A 3Q23A 3OXLA 1LWEB 4RUCA 2ILZA 1U48A 3OVBA 4M5IA 3M9MB 2V9WA 1G3OA 2VPXB 4Q44A 2CVEA 2ZEJA 4R25A 2LFVA 4I7FA 2W7OA 3UDEA 2CJXB 2MKKA 4EBDA 4C8ZA 3MFIA 3ILIA 2RE1A 4IO1A 5HN0A 4L74A 1HQEA 2DJWA 1NH7A 3GG1A 3R5DA 2HLTA 4LRAA 3ENWA 4WPAA 5DDOC 5FJ4A 4U67Q 1JJHA 2FVPA 2EFPA 3WC0A 1U8WA 4IUFA 2EG2A 2LXIA 5KT4A 1PC4A 3HX9A 5HP1A 1B0PA 2D68A 2EVZA 4OHVA 1F5CA 4GKKJ 3PG9A 1FRMA 3SV3A 3E01B 4ECSA 3HCXA 4O3QA 4R0JA 2YWKA 4W4MA 2YQ1A 5C42B 1NDKA 4IQMA 3I0SB 2NPFA 1RWVB 1FWKA 2CQ4A 4PAAA 4JI5J 2RKIB 3S1TA 3IFEA 4CP5A 3R5CA 4U95A 5D77A 2KB2A 1NMEB 4ID5B 4NI2A 3K5LA 1RTHB 3ENAA 4HI1A 4PWUA 3M2VA 1ARRA 4M5MA 4ZVTB 3VAMA 3A8KA 3T1AA 3QZ7A 4O0NA 2YNHB 3UCUP 3HJVA 5D3GA 2ZVIA 2ZH8A 4M5DA 3N6NA 4YHHJ 3DOKA 3CCTA 4OHXA 2G13A 3DLKB 3HT3A 2CJKA 1OG7A 5KFMA 1R27B 4K4UA 2BE2B 4DHVA 4OV1A 2OAUA 5HQMA 3QNWB 4BWJA 2CG4A 1V3SA 3ZZYA 2DR7A 2PI5A 1N56A 2VQEF 3GWCA 1BQXA 1S5ZA 1T8EA 2D74B 4LQ9A 1N88A 2BKPA 2HHPA 2W9CB 3H0PA 3SCLE 5K8NA 2FDNA 5EWEA 1CULA 1RWXB 1Y4ZB 3AFGA 4O44A 2XQCA 2QV6A 3DLGB 4KQZA 3J80Y 2BM1A 4F02A 1SJ3P 1ZA2B 3VAIA 5HO4A 4U7CA 2AU0A 2LLZA 5L9NA 2ROGA 4R0EA 1FJGJ 1FDDA 1DTTA 5AJ3J 5HL7Q 2YNIA 3H8YA 2KU7A 4MMOA 1J2VA 2XSFA 2OUGA 3GJRB 1KS2A 3VEAA 4HLBA 1RT2A 5CQGA 3TUIC 2V0NA 1RWNB 1WC3A 3CNQP 4Y00A 2F4VJ 3K89A 1HNIA 2GS8A 2AD9A 2K1OA 2XMKA 4GVBB 3MUMP 1XERA 4WFBQ 3OSPA 1SIWB 1IM4A 5FD1A 3T5HA 2BJ8A 2QA2A 3B8HA 5E3CA 4LIWA 2JXIA 4USTA 5I42B 4OI1A 2HS3A 2G1DA 4LFAJ 3WIUA 2WAQD 2V5HG 3FCWA 4IFYA 1G7CB 1RDRA 2F8HA 1ZAVA 1FJCA 2KFNA 3DRYA 1AROP 4FF3A 2B5JB 2AX0A 1O0PA 4NMXA 1CEZA 4DV6J 3UN2A 1S9FA 4CO0A 4QR1A 4RX6A 3C6UB 3EZUA 1NLAA 5IXUA 5E2QA 3LTOA 2DGVA 4ZVEA 1K47A 1IBMJ 3W3SA 1ZM2A 1VI7A 4X64F 4W92B 3OJUA 3THVA 3HSJA 3BQ2A 4YQWA 3HVWA 2XZ2A 4M8LA 3OJSA 3H2VE 4M94A 2KZMA 2B51A 2OTLS 2JDJA 2MPUA 3I9V9 2R2SA 4GC7A 2DNQA 4KH1B 1KWMA 4ECYA 1IKYB 3PW7A 2G4BA 1UEUA 3RYLA 3RR8A 2GVZB 4DV0F 4LSLB 1PJ6A 4QWDA 2FIUA 2R7RA 3UD4P 1A9NB 2FYXA 2LA6A 4ALZA 2GPEA 4ZS6A 3JTOA 5L9XA 3ZXWA 1HKAA 1QTGA 4Z7YA 1KNZA 1N32J 5D4LA 4ME7E 1P6TA 2A2DA 3H2LA 3V6KA 1NHVA 3IRXA 3TAMB 2R3VA 4FF4A 4L3NA 4DLGA 2CWXA 1IKXB 1FVSA 4CH0S 4J5OA 4YR0A 1U1LA 1VJWA 1RKIA 4NLOA 3K17A 4URSA 4AAIA 1FE4A 4USVA 4JI1F 3CDBA 3ZO7A 2YH1A 4F4KA 3CD7A 3H40A 3I0RB 3TJ9A 4H4KC 3BBFA 3ENQA 3FFIB 2AJ4A 1IKVA 3PDNA 4GVLA 4TY8A 1XK8A 1U9PA 4ZP6A 3VQSA 6FDRA 2ZWPA 1DURA 3M9NB 1EJ7L 3R6LB 5ADZA 1FKAF 3Q86A 2E5JA 2GQQA 2APOA 2K2PA 2MQQA 3AXKA 1MN9A 3PTWA 1TMMA 3KLFB 2BABA 4HACA 4OHWA 3DRSB 4QU6A 4I67A 4B9SA 3J7Z5 1R6VA 1RT3A 4PR6A 2XMTA 4UT4A 4KBIA 4OZ1A 1GMUA 1S72S 5D4PA 1UP1A 2KHDA 2NQPA 2CA9A 2OSRA 3PVXA 4DPTA 3N79A 2CQDA 1JKHA 1RWPB 3N5FA 1KN6A 1VQPS 1E6YB 2V2QA 4PQAA 5DDPC 3MAQA 3I5CA 1ZA1B 2DNNA 4N47A 3P8BB 1S1WB 2XYPB 2C3PA 2AKWB 3GTYX 2BANA 3G71S 5L46A 1DAXA 3JSMA 3SFUA 5H9FJ 2W2QP 3IO1A 5EUHA 2W8KA 4WU2A 1UWBA 1X0PA 2YNFA 4OX8A 3ICLA 3QOQA 5BJRA 5KFJA 3QRQA 3MM5B 5MLCV 4I56A 5DS7A 4AE5A 2BUNA 3PIPQ 1D3WA 2DNYA 1VLYA 2XULA 3R1HA 3CMQA 3G82A 3D54A 2A2CA 1WEXA 2QN6B 1LEOA 1IBCB 1NK8A 2KXHA 1QSLA 2XNQA 1C1CA 4NLXA 1NO8A 1PAUB 1WHVA 1LFWA 4A8WA 2D3OR 2MQPA 2PE8A 4DR3J 3H87C 4JOUA 2JC1A 3FCVA 3BREA 4MKAA 3M8PA 2VHGA 1P1TA 3ENVA 3BR9A 2R8GA 2MQLA 2J0SD 2UUAF 1BGXT 1NJYA 2UP1A 2XGQA 2E9TA 2QL7B 1YLXA 2HHXA 5KFYA 3GONA 5ETMA 5AXNA 5GMKa 5D0HA 1B7FA 2NXNA 4H54A 4P2SA 2M9KA 2MLZA 1VRTB 1Q7YT 3UQSA 2OEJA 3BGUA 1N34F 2R8IA 1GTEA 1VQYA 2JVRA 4GRSA 4KSEB 4RKUC 2UVRA 3LP1B 1I5OB 5M2UA 2C3UA 3DMJA 1S0VA 3U7JA 2KI2A 1ARQA 2RD5C 1FWPA 1AUSL 5ETPA 2C3YA 1D1UA 3LGMA 4LF6J 2QO3A 3S6EA 2DNRA 2OO4A 2XB2D 3KK1A 1RWMB 5HATA 2NZCA 2RF2A 2DR6A 1I6JA 3ZTSA 2W25A 3LP2B 4I68A 3EVWA 4JI6J 1C0TA 3MURP 2VKZG 1S77D 1EQ0A 5KG1A 4C0BA 3JTPA 3J81Y 2U1AA 1QE1A 4OJHA 4BCAA 2HNYA 5GAEI 1CSJA 1HBOB 4BS2A 3GIKA 3LH2S 5EX3A 2QJ3A 5DO2A 2UVWA 4DF8A 3SV4A 3DCAA 4YP3A 4C3LA 5DQIA 2F4FA 4Y6IA 1VISA 4K4TA 4ED1A 4FS2A 5ETVA 1SC4B 1NPKA 3KLGA 2UUCJ 4LRDA 2LQJA 4WKYA 1YHQS 5LXRA 1UZDA 5T41A 2C2KB 2D7SA 2DGOA 1S4FA 3PXGa 2QX0A 4USHA 2MEWA 5KT6A 3ET6A 2OD6A 2VC1A 2PD1A 1WACA 4ELVA 3THPA 1KEKA 2ZD1B 1VC6A 3HHLB 4FP9A 2R7SA 2DNOA 1OYDA 4KE5A 3SEOA 4R8UB 1T03A 2GJIA 3QYYA 5E33A 4RU2A 1RT6A 1BMQB 2XG8A 2JFDA 4Q2LA 4IKAA 1KFDA 3LANA 3MD1A 3FCHA 1CJVB 4DUZF 2DY9A 1S6PB 2JVOA 3T1HJ 4OJGA 4ICLA 4DV0J 5LJ3Y 3FK4A 3TZXA 2RRAA 3HKZD 5KFDA 2ZH5A 2F1FA 3DGPA 4X66J 1VQKS 2YTCA 2OEKA 2EI5A 2E1MC 3DRXA 2CPIA 3BV8A 1CC7A 2LDYA 4GO7X 2CPEA 1HBUA 1ZM9A 3P5TL 2VBYA 4LF7F 3ONQA 2PMHA 2MTLA 1VQSA 3DHXA 3NGKA 4HEA9 2NXJA 4AQYF 1OQ3A 4QWAA 1KP6A 3FC9A 4DQQA 2GHWA 4EK2A 1YGYA 5H9FK 4EWTA 3PKMA 3QLHB 4CTAB 1UVLA 2ZBQA 4X4TA 2XLJA 2N82B 2W9BA 4PXCA 2VDIA 4U96A 5HMYA 3VEBA 2CQIA 2DIUA 4EU0A 2OPSB 4RNFA 2VUGA 4DJBA 4JV2A 4DV4F 2C2EA 4OZ2A 1JLAB 2PMZD 1HHSA 1IVZA 1BQMA 2MSTA 4NLUA 2DT9A 3ZZUA 3MEDA 1KD1T 2DNKA 1JQGA 5BR8F 3A8EA 3Q8YA 1RCXB 4LR8A 3NNHA 2FTRA 5LXYA 1MN7A 4ED4A 1AB8A 3SSSA 3GYNA 1XR6A 4Y0FA 2XMMA 2HRTA 2MHEA 3DOMB 4TY9A 1IKWA 1YJRA 4DSLA 4LRVA 5F8GA 2E1PA 2KOEA 3CO9A 2MKHA 3GFYA 4NCBA 3W65A 2A10A 4KHPJ 5M2PA 3NWGA 4Q5VA 5E3PA 5IT9U 4ES1A 2L9WA 5KG3A 5IQ6A 4LF1A 3IS9A 2I0XA 3D6MB 2X3GA 4WU3A 3PO5A 1RHUB 1R89A 3BDEA 4ZPTR 2R2UA 4ZHRA 3KUGA 5DM6Q 4DL4A 3PRDA 3CSKA 1JLCA 4DV1J 5KFEA 5D4NA 2DPIA 1Z1ZA 5F8NA 2OMLA 1SL1A 3MM6B 3DOLA 3SSRA 4JI2J 1M5VC 3NL0A 1WHWA 4DX7A 2ZVSA 3OUYA 4X84A 3IM8A 4YEAA 3CC2S 5K8OA 2E7XA 5KFQA 3PYFA 4LRCA 3GU0A 1Q81T 4IG0B 2V63A 4WP3A 2K3KA 4P9SA 1T9XA 2VL1A 3KJVB 5KT5A 4DV5J 2R7XA 3PV8A 2W2NP 2FD2A 4DCOB 2V6AA 1NPRA 2V9KA 1LK5A 2AJ2A 4DR2F 5CZVA 3DLBA 1VMBA 2O01C 5H9EK 1VBKA 2YKPA 5KT3A 4PUOB 2EW9A 3KHHA 4IG3B 4I64A 2UU9F 3JS9A 2D1CA 1R0BG 2AN7A 3JSYA 1RE1B 3K59A 4CWBA 3OR1B 4FBTA 1R0CB 3G5OA 4NLQA 3V2UC 4DF4A 1F60B 4RBUA 4A46A 2GVDB 3DM2A 3LAMA 1X8DA 2N3LA 2VPYB 2YKMB 3DRRB 4NXMF 1KOHA 2AZ3A 1QDUB 4O3NA 1CJUB 3MCOA 2LU2A 4ZLJA 3RTVA 4C0HA 4CRJA 4F0KA 3IG1B 2Q79A 1DTQA 4Y2MA 4I6YA 3QT5A 5T7LA 2QL5B 1CQNA 2M52A 1VR6A 2W4PA 4ZP9A 2RHQB 3LWLA 2K7JA 1YSJA 3FKBA 5IM0A 4ZCKA 3EGZA 1HBNA 2RUGA 1LWXA 1VQ6S 2BJDA 5HVHA 3H98A 1Q8BA 1U1PA 4WIIA 2ZE2B 4N41A 2XLKA 4ZPWR 5HMWA 5HI7A 3CWJA 2KYZA 4Z7CA 1S1TB 1T0TV 3W2VB 1KTQA 2FC9A 1LV5A 4LREA 3MGJA 2OIHA 3C15B 4DMZA 1VQ8S 1SJRA 4K8RA 3ILOA 4CDIA 5B0AA 2KT3A 3TEGA 1P27B 3A3PB 1N54B 3RG6A 1NB7A 3BPSP 1APSA 2F65A 1MWQA 1D9DA 2DYAA 1L3UA 3CJ5A 4AXJA 4P74A 4I2PA 4LQ3A 3SYZA 5DG7A 4ZJOA 1NEEA 3CGIA 2ZM6F 1OY6A 3W2WB 2HMIB 3CDEA 1KC8T 2QT7A 2QZ8A 1NKEA 1TTHB 3D5MA 2QFIA 1X4FA 3TUPA 5HROA 2EK6A 2AHOB 2KN4A 2V67A 5K9FA 2C3MA 4JI8J 2ZH4A 1CJTB 3V81A 2QA4S 3P5BP 2DEIA 2NZ4A 5AXLA 2H9ZA 1R8AA 4O23A 3X3UA 3D1QA 1S1VB 1UVIA 2XMVA 3BZQA 2FVQA 4TU7A 2RQMA 5CCLA 1H2UX 2XC9A 3FMTA 3IR7B 4CLZA 2VU5A 4NWBA 3GILA 4DQPA 5G0RB 2B6AB 4B3TJ 2HVHA 3V5RA 2C22A 3M8SA 3P3DA 4DSEA 4B08A 3IA0A 1OPIA 2OKQA 1E6VB 5L38A 1FRIA 4ED7A 4ED5A 3BS9A 3P45B 3KLEA 3OXFA 4H4MB 2MQOA 2H48B 4OZ5A 4MFBA 2U2FA 1C2PA 3FT7A 1WNEA 1R3NA 1R7IA 2IRUA 4IOBA 4MYTA 4DUZJ 1NH8A 5ETSA 3H7HB 1QJHA 1JXVA 2DR5A 2GQCA 4RW9A 3CDUA 1ZH5A 5HMXA 1ZTWA 1CQMA 3G9CA 2KM8B 2C2MB 4HHHA 4OV6A 3FBFA 3TAPA 4NMLA 1SJQA 2DNMA 2QFJA 5KFTA 1FF2A 3WIVA 2C2ZB 4I2QB 4OI2A 3DNCA 3PM9A 1OSDA 1YJVA 4FF2A 2KG1A 2H5EA 2ABYA 4OYOA 2BE7D 4WFZA 2V8VA 4ZIVA 4AD6A 3M2RA 3K5PA 3HT0A 1UFLA 3CE8A 1LW2A 4JI4J 4KO0B 2LXUA 1KQSR 4PWDB 1XMOF 3EXCX 2P6TA 2RQCA 4LF7J 5LT5A 4B9MA 1RTJB 2CZ9A 2HURA 2Z2LA 5FIIA 1TKZB 2HRUA 1SKUB 1LW0A 4DX6A 1UAWA 5I4MA 4IH6A 1ZAXA 4PG6A 1JLEB 2IM0A 4FYVB 2I9SA 3DI6A 2X7IA 4FXWA 3NEKA 1TK8A 2YKNA 2BYCA 4DV3J 4BC7A 1GEHA 1ROFA 4RBTA 4LF4F 1AA1B 3G87A 5KOXA 1CPZA 5C25B 1Q8IA 2M4MA 4B9UA 1RU2A 3MMBB 4C6AA 4TNOA 4PG7A 2LEAA 3GIMA 3C6TB 2K3IA 2J5AA 2BJ9A 1N6QA 3KLVA 1VQ9S 4Q8EA 4F4YA 1JLFB 3M8QA 1S9EB 3BSNA 2DBBA 1ZM4A 2OPRA 1OWXA 4RWWA 2XM3A 1EB0A 2HBZB 1F9HA 2XI2A 2HZCA 3JYTA 2VZ9A 3NGUA 1YITS 1FEEA 3NXZA 4DV2J 1HNVB 2HFNA 2IAJA 5MAOA 1IWAA 4WWSA 3W64A 1NK5A 3QWUA 1OPZA 3T1YF 5F41A 4OI0A 3H5UA 3PW0A 5IZHA 2W7PA 3DRPA 1QSSA 3K58A 3A8JA 3NBPB 2KDOA 2G0CA 1R0AA 1SUQB 2E7VA 3L3CA 3HVTB 5AXKA 4QWBA 3IGVA 2HEKA 3C8YA 2LYVA 1NSQA 2DXEA 5KFKA 1RT1B 4X4UA 1PBUA 5L1IA 4EO6A 5KFCA 4CM0A 1NKBA 4TQRA 5CAAA 1DBDA 4CZCA 3M32A 1WC0A 4ELTA 1UJ6A 2RUSA 3SI8A 2QMUB 3IN5A 3NGDA 4N76A 4QPTA 4ED8A 1IWGA 4Y65A 3DYAA 5GAHI 4XO0A 2ADBA 4X4RA 2DRAA 3K0JA 2XTCA 5C24B 3IGNA 4B3OA 2ZH1A 3CDWA 5KG7A 4QR0A 1Y11A 3AD7C 1KQFB 1M0SA 4ZPAA 1TELA 2MJNA 2DISA 1NCLA 1NK4A 5A8KB 5KFLA 1M5HA 2VPWB 3KMSA 4ECWA 4C0OC 2W8LA 1RWWB 3E2EA 3EJMA 2HSEB 2F40A 4IRCA 4ITSA 4MTPA 1U0HA 1GAOA 3M8YA 3VQTA 5CCMA 1HWIA 3RGIA 3TNVA 4DZDA 3VAJA 3T41A 3OVAA 3T9ZA 2YWWA 1T9UA 2CZ4A 4LT6A 4QWCA 1VRUB 5LSLA 3ZTRA 3CCRS 2B0GA 1CJKB 1MWYA 3EVMA 4OX6A 3LWMA 4WP9A 3RB6A 1UETA 3J81j 2HHVA 3M1VB 4I4BA 1TL5A 2BQUA 1IRQA 1BD6A 1HYSB 4RW7A 1UA1A 3BGRA 1S10A 3LGNA 2MQMA 4ZN1A 2XGPA 4NOHA 1IR2A 1IBKF 2HHUA 1VQNS 1YRUA 3BN7A 2NSBA 2H1YA 4FYDA 1LWCB 2XTEA 1Y10A 1U1MA 5EN1A 4D8JA 2BRLA 1CS4A 4QQBA 3DKDA 3RRGA 1U1NA 1DJ0A 1HMVB 2Y8YA 4USJC 3CJ2A 4A8XA 4LUBA 3GQCA 3CJTA 3R7NB 2AGOA 1FT8A 1RTIB 2ZKTA 5KG6A 4Q0BA 2BNZA 3NY0A 1YIJS 3B82A 2UXDF 2VH7A 2CPZA 1X4DA 2K8GA 2VV5A 2W24A 1XWLA 2GX8A 2HS0A 5KG4A 2DK2A 3FEYB 2ZJPQ 3VAFA 1LWEA 2E5LF 5ETKA 4ELUA 3L09A 1RWKB 3D6FB 2BACA 5C7PA 1RB0A 3GR0A 4F67A 1BLUA 5AE2A 2N3OA 1FHTA 2VG5A 2QSFA 3I5AA 1FXRA 3BQ0A 4NA2A 4M95A 3NS5A 4DN9A 1MMNA 2D69A 1BWEA 4EZ6A 5KG0A 3SCIE 2ZWOA 2MKIA 1U0SA 1AYEA 2R4FA 1B64A 1FX2A 2K06A 2QMXA 5F8MA 3HD2A 5AXMA 1KLMA 5IWAJ 4KKOB 3CEDA 4JV5F 4ES2A 2DCUB 3HHEA 3VW4A 5J2MA 1VK8A 2CNKB 2QE5A 2UUBF 2V1TA 1NJWA 3W61A 3KKFA 3OHBA 2Q43A 2KG0A 3FBBA 2CPHA 3C16A 3DC2A 4HTJA 4ETXA 1IUJA 3OT9A 3I32A 3HM9A 2GV1A 1XJWB 2E5HA 4O3PA 2FHKA 3DLHA 1Q95G 4FKXA 2ILYA 4MKVA 5C42A 5K8MA 3MR5A 1YZ7A 1TL7B 1HQEB 2CRLA 8AT1B 1UKUA 1GMWD 3UDVA 1EIYB 2RKIA 4WF9Q 4M1KA 3RBXA 2VDHA 4ECXA 1JX4A 4XAKA 3OTEA 2HQFA 4LBPA 2OGUA 3VWSA 1RTHA 4CLYA 1SKWA 5HP1B 1RGVA 2YNHA 1JLBB 4AYBD 2VD3A 2Z8QA 2W1BA 3M8RA 3GB0A 4N5SA 2MMYA 3T5KA 2JL9A 2V68A 4DR6F 2X1FA 4E8UA 3LW5C 3CD5A 2M8DB 3TVKA 4DUYF 2Z2MA 2Q6BA 4OMFG 4A8FA 3GXQA 2DVIA 2B43A 3GMGA 2BE2A 1FRJA 2HNDB 1MLAA 3OXGA 3HSGA 4OLOA 1VQ7S 3NLCA 4B9NA 3ITHB 3ELHA 5KFSA 2CNNB 1K1SA 5SUHA 1N36F 4LF4J 1X5TA 3AOAA 5LSOA 3UD3P 2QYGA 2W9CA 5C5JA 5D3GB 4OYXA 1HNXF 3H5SA 2EKNA 4WFNQ 5HJYA 3KMQA 5A8RA 3H25A 4C9DA 1NZAA 4MAKA 4DR7F 1DLOB 2LA4A 3KWMA 3CJ8A 3KHRA 2DGTA 1GMVA 4HHJA 1U47A 3DN9A 2GQ2A 3CJQA 1H6KX 1X4HA 4BHQA 5HJXA 1XNRF 2AYGA 1SJ1A 2E9RX 3FMWA 1H74A 1HQ2A 1NPPA 1U6BA 3WZ0A 4C8LA 2GAHC 1P9QC 2BQ3A 3QMQA 2A6OA 2E1RA 3AT1B 3QGHA 1EETA 1PJ7A 4CLSA 1PARA 2YPZA 4DR5F 1NK6A 3B54A 4LJMA 5CD4A 4A8YA 1ICEB 3QSYB 3H5XA 1RACB 2VFSA 3ZZ0A 1GXUA 1LWFB 4GVBA 3HKWA 3SDEB 4QIFA 3CCJS 5CHCB 2IPOB 1SIWA 4DPOA 1KKHA 4X62F 2A3JA 1JXLA 5F8LA 2IM1A 1WG4A 5I42A 5I3QA 1S6UA 3AAWB 3D3CJ 1BUXA 4KH0B 2Y0SD 2ASJA 1DTTB 3AOCA 2VOOA 2CYYA 1U02A 4LBHA 3FQKA 4USMA 4FYWB 4QCLA 4P2XA 3MWBA 1EHWA 2VKRA 4KAIA 1RABB 3MR2A 1IXKA 1PGZA 3V4MA 2HZAA 3B4DA 7AT1B 1OM2A 1SQFA 1AW0A 3BGLA 4UUXA 2MHNA 2FLOA 3CIZA 2YX1A 4P2FA 1NLKL 1OHNA 2CQGA 2X51A 2ZHOA 3LQVA 4DPXA 3OLAA 2GJ2A 4IFYB 4PQUB 5DDRC 1YJ7A 3AA9A 4NZ7A 5LJ5Y 4TYAA 5KFXA 3AB2B 4Y2KA 3Q2TC 1IKYA 4J9KA 4USUA 2GVZA 1X60A 1IR0A 4LSLA 2RAQA 4ZCLA 4MK9A 4Y2AA 3NCPA 2DXDA 1Q7LB 3FBCA 3Q22A 4ZVRB 2VFTA 5CD4H 2XS2A 3AD8C 1RXOB 4FNIA 2CQ1A 4CO4A 4ER8A 2OPPB 3KK2A 3PYEA 3QJJA 1PBAA 3TUJC 1LK7A 2BVZA 4GKKF 1J5EJ 3RZAA 4JYAJ 2HS4A 3P49B 3PO4A 1S99A 3IXQA 1HW9A 2VC0A 1QLNA 5IT9Y 2IA6A 4NLGA 4JI5F 1YX2A 2GNKA 3HHKA 1C0UB 4J9UE 1EQMA 2DNZA 3W1YC 1MYKA 5CH7B 5EGYA 3MAHA 2JC0A 1ZS6A 2WSFC 2IIHA 1O51A 4FYXB 3O44A 3I0RA 3BKUA 1IBKJ 4OZNA 2B56A 4ZCMA 2CQBA 5KFIA 3KTQA 3VGUA 4YHHF 1REVB 3NNEA 1U26A 3K5OA 3CMES 1SL2A 2KT5A 3EWGA 5IOLA 1NB2A 1SXLA 3PEHA 1TL4A 3EGVA 3W62A 1T11A 2DNPA 3OVSA 3ZNUA 3W63A 2L48A 1N5TA 2YY3A 1X4BA 5FDLB 3KLFA 4PCQA 2O1PA 1TU0B 4X4QA 1SJ4P 3CCQS 3KJQB 4F0MA 3QT8A 3OTBA 3MM9A 5F8JA 2Z58B 3OTCA 4L75A 2WSEC 4U8YA 2VIHA 2E66A 2JEIA 2KO1A 4DR4J 3BGFA 1IKVB 3QZ8A 4P71A 2AMCB 2XYHB 1E6YA 2AT1B 1T9YA 4TYBA 1M90T 1RLDA 3QGGA 4UOFA 1F2HA 1X31C 1UJ5A 1HFEL 2JSXA 4FS1A 2XMWA 1KHVA 1S1WA 5AJ3F 4HACB 1JB0C 5HVFA 1X4CA 3QIDA 4LMZA 2MDAA 3OTOJ 2AWZA 1CVJA 3G6ES 4FXDA 1RT3B 2DNHA 4QIVA 4PWWA 2R8HA 3K8WA 1NU4A 2IYGA 4F4WA 3DXBA 2QGFB 2F4VF 1GT8A 2XSJB 4F4AA 2MJUA 1KFSA 2MYFA 2WSCC 4DXLA 4P75A 3MM5A 1YVFA 3RRHA 3GP9A 5A0YA 2FZCB 1SH0A 3QJLA 2AEFA 3F0NA 4LFAF 4ILLA 1F3VA 4I6AA 3U1NA 2HWIA 2EPIA 5F3TA 1SPBP 3CXCR 2WW8A 2RU3A 5B0GA 4DV6F 2HBYB 3MOJB 2H1OE 2ACMA 2DY1A 1TFYA 2HW3A 2CG8A 2HNZB 3C14B 2RQ4A 1FDBA 3AJ2A 2W2MP 1IBMF 2FZGB 1WG5A 1WKLA 3EX7B 3IAM9 2J6TA 1FXDA 4IRDA 2FB0A 1VGYA 2KYXA 2R7TA 2HBRB 3CJRA 2DH7A 3G82B 5KOWA 2Y1IA 4HDGA 3T19A
chains in the Genus database with same CATH topology
2ZJRQ 4MIWA 3ISZA 2IBOA 1Y00A 4B9TA 3CD6S 3DLEA 3AQPA 1RT5A 4K2XA 4C4WA 4DFKA 3PY8A 3GG0A 4B9VA 2Z0GA 4LVNP 2WCXA 2RRAA 2GGPB 3HKZD 2WOMB 5KFDA 2ZH5A 2F1FA 4YY3F 1OQ6A 3MZIA 2M3DA 3EGWB 1TR0A 3KK2B 4D3HA 3V6JA 3ZZPA 3DGPA 1H7XA 1SKRA 3GFXA 4NLTA 2P9GA 2RVJA 1VQKS 5JVHQ 1ZETA 2YTCA 2AYBA 5GVQA 1HPZA 1VRTA 2EI5A 4G3IA 2DGQA 1N5VA 2E1MC 2CPIA 3DRXA 4IFVA 3J7ZT 4FXVA 4NLWA 3BSCA 1CC7A 2LDYA 4GO7X 2CPEA 4ED2A 4YB6A 1JLQB 4AFFA 3MMAB 4LVOP 3VZIA 4KGKA 1REVA 1HBUA 1ZM9A 2JBVA 3LP1A 3P5TL 2VBYA 4LF7F 3ONQA 5F9NA 2ZC3A 2PMHA 2MXYA 5F3ZA 4NRUA 1VHFA 1VQSA 3DHXA 3QIPB 1QAXA 2HGMA 3NGKA 4HEA9 4U6PA 2CPYA 1N5SA 3M8PB 1UW4A 4AQYF 2RS2A 1OQ3A 4QWAA 1L3VA 2JRSA 3UE2A 4WYWA 5DRKA 1R8PA 5DQGA 4DQQA 3D2WA 3J7YU 2GHWA 1JK9B 1Q53A 2J8AA 4Y2IA 3T6BA 1KQGB 1YGYA 4C2MA 3MM7A 2M7SA 1N32F 4DG1B 4EWTA 1KLNA 1URRA 2ROPA 3H4BA 4RLEA 3KG4A 3PKMA 5FDLA 4WFAQ 2IFXA 3QLHB 4CTAB 4QU7A 1HBMA 1S1TA 2OPQB 3TX8A 1UVLA 1R6YA 2YVSA 4R5PB 4OI3A 4X4TA 3I4PA 3E8OA 2SXLA 4Y3CA 2BXJA 4B17A 2XLJA 2N82B 1Y3JA 1J5OA 2UZAA 2W9BA 4WZMA 4PXCA 1K73T 2IVMA 4KV8A 3HHLD 5HMYA 5EWFA 3Q0AA 3SQGA 4A8OA 2CQIA 1OS5A 3ZZRA 3PZPA 2DIUA 4CH1A 4CO1A 1H3DA 1DTQB 3BR8A 2FJEB 4F2RA 4L6V3 4EU0A 2GW8A 2OPSB 1J5OB 4K4YA 3B78A 4TLQA 3D28A 2HAIA 4RNFA 2VUGA 1N48A 4DJBA 2I1RA 4V19J 2AW0A 4BC9A 4JV2A 4DV4F 2C2EA 1R31A 2RB7A 4ED3A 2IVFB 1JLAB 2PMZD 5IM0B 1HHSA 2JX2A