2FNKA

Activation of human carbonic anhydrase ii by exogenous proton donors
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
Knots found
sequence length
258
structure length
258
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGWAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Location of binding sites in small molecule rescue of human carbonic anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Carbonic anhydrase 2
total genus 75
structure length 258
sequence length 258
other databases KnotProt 2.0: K +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2006-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 2fnkA00
2Q38A 1CAKA 5DSPA 3MNAA 5CACA 3JXGA 4Q7VA 3U47A 2F14A 4RUYA 4E3HA 4RN4A 4ZWXA 3RZ1B 3P4VA 4CNWA 1CAHA 1BCDA 1KOPA 3RG4A 3DVDA 1OKMA 1BNMA 4CNXA 1RAYA 5EHVA 3OYSA 1CVFA 2ABEA 1H9QA 1Z9YA 4E4AA 1UGDA 3TVOX 1CAMA 3IEOA 3V7XA 1CNBA 5JEHB 1CRMA 2WEJA 4JSSA 5FNIA 1FSQA 4Q8XA 3ML5A 3FFPX 4K0ZA 1CNGA 5DSKA 3M2NA 1CCUA 1DCAA 1XEGA 1CAZA 4RUXA 3RYJB 5DSMA 3MYQA 4PYYA 4TWMA 4WL4A 1TTMA 3M1WA 4G0CA 1H9NA 4KP8A 2QOAA 3F7UA 3T5ZA 2HOCA 3M14A 4HBAA 3DD8A 1BV3A 3KS3A 3M2XA 1UGAA 3MNHA 5A25A 3DAZA 4RFDA 4QIZA 5FNJA 5SZ6A 5DVXA 3NJ9A 1CILA 1BNWA 5LMDA 2EZ7A 5BRVA 3MNIA 2VVAX 5JGTB 1OKNA 5BYIA 4YGFA 5SZ5A 1CAYA 1HUGA 4JSAA 4K1QA 3HFPA 2CBDA 4YXIA 3F4XA 1HCAA 3M5EA 1I91A 4XE1A 4HEWA 4WR7A 5JEPB 3P5AA 4RFCA 5E5UA 4QK3A 1FSRA 4YGKA 4YWPA 3DCSA 4YHAA 3MDZA 3PYKA 4FRCA 3RG3A 4YXUA 4HT2A 4ILXA 4KNMA 2CBEA 1EOUA 2POWA 3N3JA 3HKNA 3R16A 4JS6A 4QJXA 3ML2A 2QP6A 1HEBA 1CVEA 4QSJA 1YO2A 3RGEA 1UGGA 1CNHA 3RYYA 4Q87A 5AMGA 5HPJA 4PQ7A 4ZX1A 3V3FA 1HCBA 2NWZA 3Q31A 1HEDA 4BCWA 2NN1A 2NNGA 2CABA 2FMZA 4E5QA 4QSIA 2NWOA 1CAOA 4UOVA 1BNVA 4E9OX 2NMXA 1UGBA 5SZ1A 3N0NA 3FE4A 4TWLA 2ZNCA 1G0FA 4ITOA 3IGPA 3P3JA 5E2KA 3N4BA 1URTA 1LUGA 3B1BA 4XZ5A 3NB5A 5A6HA 2ILIA 1YDCA 4MLTA 8CA2A 5CJFA 4KNJA 2FOVA 1FLJA 1XEVA 1Z97A 4ZWIA 3V5GA 3TVNX 1OKLA 1CVAA 4CA2A 5FNKA 3S74B 1G4JA 1J9WA 4JSZA 2O4ZA 1CZMA 3HKQA 4Q83A 3SBIA 2CBAA 3DV7A 3P55A 4XFWA 3T5UA 2GEHA 3RZ0B 3S72B 1YDAA 4DZ9A 1G0EA 1TBTX 2FOSA 4C3TA 3M04A 3MWOA 3KNEA 4WUQA 4YGJA 1FSNA 3MZCA 1G53A 3IBUA 3D0NA 5L6KA 1LZVA 1CINA 1FQRA 1ZFQA 3BL0A 3D8WA 12CAA 2W2JA 5DSLA 4CNVA 5E2RA 3NI5A 2WEHA 3OIMA 3MHLA 4MLXA 3SAPA 4WW8A 4L5WA 4Q6EA 3DVCA 3UYQA 1BN3A 3CYUA 3GZ0A 1G45A 1ZSBA 3HKTA 2Q1BA 5E2MA 1TH9A 1BN4A 3KONA 1CAIA 4KNIA 4FL7A 5G0CA 5SZ2A 4E3GA 5DSQA 4M2UA 5JQ0A 2X7UA 4Q8ZA 2AW1A 2EU3A 1OQ5A 4KNNA 3S9TA 5JESB 2FOQA 2HFWA 1RJ5A 4K13A 5EZTX 5SZ3A 3S71B 4Q7SA 1YO1A 1G3ZA 4HF3A 4GL1X 5JQTA 4FVOA 4QEFA 5SZ0A 4KV0A 4Q90A 4ZWZA 5CLUA 1TB0X 2NN7A 2HNCA 3SBHA 2X7TA 1T9NA 1TEQX 1TE3X 4Q7WA 1FR4A 3OIKA 1CVBA 3C7PA 4Q6DA 1F2WA 4LU3A 4FVNA 3DBUA 5FNHA 3P3HA 3T85A 3MNKA 1G4OA 3RJ7A 4HU1A 1RZDA 4RH2A 5JDVB 5BRUA 5C8IA 3JXFA 4XIWA 5AMDA 3KWAA 1XQ0A 3R17B 4YX4A 1YO0A 4PZHA 3M1QA 3F7BA 4Z1JA 1CVDA 2NXSA 2NWPA 2NXTA 1IF8A 1BZMA 1G1DA 1IF6A 1A42A 3CZVA 4ZWYA 3OYQA 3V3JA 3MMFA 1BNQA 3S8XA 3DVBA 5EIJA 1CNJA 5DSNA 5G01A 3KOIA 3V3HB 1IF5A 5FL4A 4G7AA 3P58A 6CA2A 1JD0A 5JG3B 1UGCA 4QJ0A 2AX2A 5FDIA 4QK2A 1FQNA 4MDLA 5FLPA 1I9NA 3M3XA 5G03A 1IF9A 5SZ7A 4R59A 3RZ8A 3JXHC 4QSBA 4YYTA 4Y0JA 3P44A 4BF1A 4XIXA 1MOOA 1HVAA 2HD6A 4LP6A 5E5RA 2WEGA 4FU5A 3M2YA 1CAJA 4YXOA 1AVNA 3ZNCA 5G0BA 1XPZA 2OSFA 1V9EA 1TG3A 1ZFKA 4QJOA 5E2NA 1JV0A 2FNNA 3D9ZA 1CVHA 1KWRA 4PYXA 1ZSAA 1AZMA 3S97A 1JCZA 4Z1KA 1DCBA 1ZE8A 4Q99A 3RZ7A 1ZGEA 3PJJA 1KEQA 3MNJA 4Q81A 1G48A 3KLDB 1ZSCA 2H4NA 1LG6A 5DSOA 2OSMA 5E28A 4MTYA 1CCSA 2NNOA 3RLDA 4R5AA 3T83A 4N16A 2NXRA 2FNMA 3M5TA 1G46A 2HL4A 4HEZA 4QTLA 4Q0LA 5DRSA 5EKMA 3V2MA 3DC3A 2EU2A 3KKXA 4E3FA 5DOGA 3TMJA 3P5LA 5FL5A 2NNSA 5CA2A 1YDBA 2Q1QA 3K2FA 3L14A 4YGLA 3DD0A 2FOYA 5EHWA 1THKA 4YGNA 5EH8A 5EKJA 4QK1A 1LGDA 4FPTA 5FLRA 2X7SA 4KUVA 3M40A 5AMLA 1HECA 1I9LA 1UGFA 1AM6A 1RJ6A 1CANA 4QJPA 3RYXB 4E3DA 3QYKA 5DSRA 5FNGA 3W6IA 4QIYA 3FW3A 3T82A 2WEOA 3MHCA 5DSJA 1IF7A 1KOQA 3BL1A 3RYZA 1KWQA 3MNUA 1FQMA 4Z1EA 2H15A 1H4NA 4KAPA 4KUWA 1MUAA 5FLQA 4KUYA 4ITPA 4N0XB 3EFTA 1CA3A 5JGSB 1RZBA 1TG9A 4YVYA 3V3GB 3B4FA 5EKHA 5FNMA 3CAJA 9CA2A 2POUA 1I9OA 1HUHA 5DSIA 5FLSA 5J8ZA 3F8EA 1CNIA 1BN1A 5JEGB 4R5BA 3MHMA 5BNLA 4E49A 3SAXA 1CA2A 2POVA 4FIKA 4M2VA 3U7CA 1ZH9A 4Q08A 2FOUA 3EFIA 1IF4A 5JG5B 3D92A 3IBNA 3M2ZA 1CNCA 3S75B 1UGEA 1BICA 4QY3A 5L3OA 5SZ4A 4IWZA 1DMXA 2NNVA 5DOHA 3V3IB 3M96A 1ZGFA 4MO8A 3VBDA 4Q8YA 5FL6A 4LHIA 3M98A 1CVCA 3KIGA 3LXEA 1V9IC 4PXXA 3K7KA 3HLJA 4IDRX 4HT0A 3OY0A 1CALA 1Y7WA 1RAZA 4X5SA 4M2RA 1I9QA 3S78B 1ZNCA 4L5VA 5FDCA 5EH7A 4MDGA 4RUZA 1FQLA 1LG5A 3BETA 3S73B 1CIMA 3S76A 3UYNA 1CNYA 3V2JA 3IAIA 1RZAA 4CQ0A 4HEYA 1CNKA 3M1JA 4Z0QA 5BRWA 7CA2A 1FR7A 3IBIA 4K0TA 2IT4A 3DCCA 1CCTA 5EH5A 4WW6A 3MHOA 3N2PA 2GD8A 3HKUA 4QJMA 3S77B 1I9MA 3U45X 1TEUX 3ZP9A 3IBLA 3OILA 2WD3A 5FLOA 4Q07A 4ZAOA 4COQA 1BNTA 5FLTA 1RZCA 4QSAA 3RZ5A 3MHIA 4L5UA 5EOIA 2CBBA 1G54A 4RIUA 1CNXA 1BNNA 1CNWA 3M1KA 4Q09A 1YDDA 2FW4A 3DC9A 3OKUA 4Q06A 1I9PA 4WUPA 4RIVA 4QJWA 2WD2A 4BF6A 3M5SA 3DA2A 2NWYA 3KOKA 4M2WA 4MDMA 3M67A 2VVBX 1I8ZA 3K34A 4Z1NA 4KP5A 3HS4A 5E2SA 1G6VA 3OKVA 4Q78A 4JSWA 2HKKA 3CA2A 3PO6A 1HEAA 4DZ7A 2FMGA 2FNKA 5EHEA 4Q49A 4ETQC 1Z93A 3W6HA 4CNRA 1RZEA 1I90A 1BNUA 1CRAA 2CBCA 4ZX0A 3U3AX 3DCWA 3T84A 4Q9YA 3D93A 4CACA 1DMYA 5IPZA 2CA2A 4Q7PA 3RYVB 4K0SA 5FNLA 1G52A 2QO8A
chains in the Genus database with same CATH superfamily
2Q38A 1CAKA 5DSPA 3MNAA 5CACA 3JXGA 4Q7VA 3U47A 2F14A 4RUYA 4E3HA 4RN4A 4ZWXA 3RZ1B 3P4VA 4CNWA 1CAHA 1BCDA 1KOPA 3RG4A 3DVDA 1OKMA 1BNMA 4CNXA 1RAYA 5EHVA 3OYSA 1CVFA 2ABEA 1H9QA 1Z9YA 4E4AA 1UGDA 3TVOX 1CAMA 3IEOA 3V7XA 1CNBA 5JEHB 1CRMA 2WEJA 4JSSA 5FNIA 1FSQA 4Q8XA 3ML5A 3FFPX 4K0ZA 1CNGA 5DSKA 3M2NA 1CCUA 1DCAA 1XEGA 1CAZA 4RUXA 3RYJB 5DSMA 3MYQA 4PYYA 4TWMA 4WL4A 1TTMA 3M1WA 4G0CA 1H9NA 4KP8A 2QOAA 3F7UA 3T5ZA 2HOCA 3M14A 4HBAA 3DD8A 1BV3A 3KS3A 3M2XA 1UGAA 3MNHA 5A25A 3DAZA 4RFDA 4QIZA 5FNJA 5SZ6A 5DVXA 3NJ9A 1CILA 1BNWA 5LMDA 2EZ7A 5BRVA 3MNIA 2VVAX 5JGTB 1OKNA 5BYIA 4YGFA 5SZ5A 1CAYA 1HUGA 4JSAA 4K1QA 3HFPA 2CBDA 4YXIA 3F4XA 1HCAA 3M5EA 1I91A 4XE1A 4HEWA 4WR7A 5JEPB 3P5AA 4RFCA 5E5UA 4QK3A 1FSRA 4YGKA 4YWPA 3DCSA 4YHAA 3MDZA 3PYKA 4FRCA 3RG3A 4YXUA 4HT2A 4ILXA 4KNMA 2CBEA 1EOUA 2POWA 3N3JA 3HKNA 3R16A 4JS6A 4QJXA 3ML2A 2QP6A 1HEBA 1CVEA 4QSJA 1YO2A 3RGEA 1UGGA 1CNHA 3RYYA 4Q87A 5AMGA 5HPJA 4PQ7A 4ZX1A 3V3FA 1HCBA 2NWZA 3Q31A 1HEDA 4BCWA 2NN1A 2NNGA 2CABA 2FMZA 4E5QA 4QSIA 2NWOA 1CAOA 4UOVA 1BNVA 4E9OX 2NMXA 1UGBA 5SZ1A 3N0NA 3FE4A 4TWLA 2ZNCA 1G0FA 4ITOA 3IGPA 3P3JA 5E2KA 3N4BA 1URTA 1LUGA 3B1BA 4XZ5A 3NB5A 5A6HA 2ILIA 1YDCA 4MLTA 8CA2A 5CJFA 4KNJA 2FOVA 1FLJA 1XEVA 1Z97A 4ZWIA 3V5GA 3TVNX 1OKLA 1CVAA 4CA2A 5FNKA 3S74B 1G4JA 1J9WA 4JSZA 2O4ZA 1CZMA 3HKQA 4Q83A 3SBIA 2CBAA 3DV7A 3P55A 4XFWA 3T5UA 2GEHA 3RZ0B 3S72B 1YDAA 4DZ9A 1G0EA 1TBTX 2FOSA 4C3TA 3M04A 3MWOA 3KNEA 4WUQA 4YGJA 1FSNA 3MZCA 1G53A 3IBUA 3D0NA 5L6KA 1LZVA 1CINA 1FQRA 1ZFQA 3BL0A 3D8WA 12CAA 2W2JA 5DSLA 4CNVA 5E2RA 3NI5A 2WEHA 3OIMA 3MHLA 4MLXA 3SAPA 4WW8A 4L5WA 4Q6EA 3DVCA 3UYQA 1BN3A 3CYUA 3GZ0A 1G45A 1ZSBA 3HKTA 2Q1BA 5E2MA 1TH9A 1BN4A 3KONA 1CAIA 4KNIA 4FL7A 5G0CA 5SZ2A 4E3GA 5DSQA 4M2UA 5JQ0A 2X7UA 4Q8ZA 2AW1A 2EU3A 1OQ5A 4KNNA 3S9TA 5JESB 2FOQA 2HFWA 1RJ5A 4K13A 5EZTX 5SZ3A 3S71B 4Q7SA 1YO1A 1G3ZA 4HF3A 4GL1X 5JQTA 4FVOA 4QEFA 5SZ0A 4KV0A 4Q90A 4ZWZA 5CLUA 1TB0X 2NN7A 2HNCA 3SBHA 2X7TA 1T9NA 1TEQX 1TE3X 4Q7WA 1FR4A 3OIKA 1CVBA 3C7PA 4Q6DA 1F2WA 4LU3A 4FVNA 3DBUA 5FNHA 3P3HA 3T85A 3MNKA 1G4OA 3RJ7A 4HU1A 1RZDA 4RH2A 5JDVB 5BRUA 5C8IA 3JXFA 4XIWA 5AMDA 3KWAA 1XQ0A 3R17B 4YX4A 1YO0A 4PZHA 3M1QA 3F7BA 4Z1JA 1CVDA 2NXSA 2NWPA 2NXTA 1IF8A 1BZMA 1G1DA 1IF6A 1A42A 3CZVA 4ZWYA 3OYQA 3V3JA 3MMFA 1BNQA 3S8XA 3DVBA 5EIJA 1CNJA 5DSNA 5G01A 3KOIA 3V3HB 1IF5A 5FL4A 4G7AA 3P58A 6CA2A 1JD0A 5JG3B 1UGCA 4QJ0A 2AX2A 5FDIA 4QK2A 1FQNA 4MDLA 5FLPA 1I9NA 3M3XA 5G03A 1IF9A 5SZ7A 4R59A 3RZ8A 3JXHC 4QSBA 4YYTA 4Y0JA 3P44A 4BF1A 4XIXA 1MOOA 1HVAA 2HD6A 4LP6A 5E5RA 2WEGA 4FU5A 3M2YA 1CAJA 4YXOA 1AVNA 3ZNCA 5G0BA 1XPZA 2OSFA 1V9EA 1TG3A 1ZFKA 4QJOA 5E2NA 1JV0A 2FNNA 3D9ZA 1CVHA 1KWRA 4PYXA 1ZSAA 1AZMA 3S97A 1JCZA 4Z1KA 1DCBA 1ZE8A 4Q99A 3RZ7A 1ZGEA 3PJJA 1KEQA 3MNJA 4Q81A 1G48A 3KLDB 1ZSCA 2H4NA 1LG6A 5DSOA 2OSMA 5E28A 4MTYA 1CCSA 2NNOA 3RLDA 4R5AA 3T83A 4N16A 2NXRA 2FNMA 3M5TA 1G46A 2HL4A 4HEZA 4QTLA 4Q0LA 5DRSA 5EKMA 3V2MA 3DC3A 2EU2A 3KKXA 4E3FA 5DOGA 3TMJA 3P5LA 5FL5A 2NNSA 5CA2A 1YDBA 2Q1QA 3K2FA 3L14A 4YGLA 3DD0A 2FOYA 5EHWA 1THKA 4YGNA 5EH8A 5EKJA 4QK1A 1LGDA 4FPTA 5FLRA 2X7SA 4KUVA 3M40A 5AMLA 1HECA 1I9LA 1UGFA 1AM6A 1RJ6A 1CANA 4QJPA 3RYXB 4E3DA 3QYKA 5DSRA 5FNGA 3W6IA 4QIYA 3FW3A 3T82A 2WEOA 3MHCA 5DSJA 1IF7A 1KOQA 3BL1A 3RYZA 1KWQA 3MNUA 1FQMA 4Z1EA 2H15A 1H4NA 4KAPA 4KUWA 1MUAA 5FLQA 4KUYA 4ITPA 4N0XB 3EFTA 1CA3A 5JGSB 1RZBA 1TG9A 4YVYA 3V3GB 3B4FA 5EKHA 5FNMA 3CAJA 9CA2A 2POUA 1I9OA 1HUHA 5DSIA 5FLSA 5J8ZA 3F8EA 1CNIA 1BN1A 5JEGB 4R5BA 3MHMA 5BNLA 4E49A 3SAXA 1CA2A 2POVA 4FIKA 4M2VA 3U7CA 1ZH9A 4Q08A 2FOUA 3EFIA 1IF4A 5JG5B 3D92A 3IBNA 3M2ZA 1CNCA 3S75B 1UGEA 1BICA 4QY3A 5L3OA 5SZ4A 4IWZA 1DMXA 2NNVA 5DOHA 3V3IB 3M96A 1ZGFA 4MO8A 3VBDA 4Q8YA 5FL6A 4LHIA 3M98A 1CVCA 3KIGA 3LXEA 1V9IC 4PXXA 3K7KA 3HLJA 4IDRX 4HT0A 3OY0A 1CALA 1Y7WA 1RAZA 4X5SA 4M2RA 1I9QA 3S78B 1ZNCA 4L5VA 5FDCA 5EH7A 4MDGA 4RUZA 1FQLA 1LG5A 3BETA 3S73B 1CIMA 3S76A 3UYNA 1CNYA 3V2JA 3IAIA 1RZAA 4CQ0A 4HEYA 1CNKA 3M1JA 4Z0QA 5BRWA 7CA2A 1FR7A 3IBIA 4K0TA 2IT4A 3DCCA 1CCTA 5EH5A 4WW6A 3MHOA 3N2PA 2GD8A 3HKUA 4QJMA 3S77B 1I9MA 3U45X 1TEUX 3ZP9A 3IBLA 3OILA 2WD3A 5FLOA 4Q07A 4ZAOA 4COQA 1BNTA 5FLTA 1RZCA 4QSAA 3RZ5A 3MHIA 4L5UA 5EOIA 2CBBA 1G54A 4RIUA 1CNXA 1BNNA 1CNWA 3M1KA 4Q09A 1YDDA 2FW4A 3DC9A 3OKUA 4Q06A 1I9PA 4WUPA 4RIVA 4QJWA 2WD2A 4BF6A 3M5SA 3DA2A 2NWYA 3KOKA 4M2WA 4MDMA 3M67A 2VVBX 1I8ZA 3K34A 4Z1NA 4KP5A 3HS4A 5E2SA 1G6VA 3OKVA 4Q78A 4JSWA 2HKKA 3CA2A 3PO6A 1HEAA 4DZ7A 2FMGA 2FNKA 5EHEA 4Q49A 4ETQC 1Z93A 3W6HA 4CNRA 1RZEA 1I90A 1BNUA 1CRAA 2CBCA 4ZX0A 3U3AX 3DCWA 3T84A 4Q9YA 3D93A 4CACA 1DMYA 5IPZA 2CA2A 4Q7PA 3RYVB 4K0SA 5FNLA 1G52A 2QO8A
chains in the Genus database with same CATH topology
2Q38A 1CAKA 5DSPA 3MNAA 5CACA 3JXGA 4Q7VA 3U47A 2F14A 4RUYA 4E3HA 4RN4A 4ZWXA 3RZ1B 3P4VA 4CNWA 1CAHA 1BCDA 1KOPA 3RG4A 3DVDA 1OKMA 1BNMA 4CNXA 1RAYA 5EHVA 3OYSA 1CVFA 2ABEA 1H9QA 1Z9YA 4E4AA 1UGDA 3TVOX 1CAMA 3IEOA 3V7XA 1CNBA 5JEHB 1CRMA 2WEJA 4JSSA 5FNIA 1FSQA 4Q8XA 3ML5A 3FFPX 4K0ZA 1CNGA 5DSKA 3M2NA 1CCUA 1DCAA 1XEGA 1CAZA 4RUXA 3RYJB 5DSMA 3MYQA 4PYYA 4TWMA 4WL4A 1TTMA 3M1WA 4G0CA 1H9NA 4KP8A 2QOAA 3F7UA 3T5ZA 2HOCA 3M14A 4HBAA 3DD8A 1BV3A 3KS3A 3M2XA 1UGAA 3MNHA 5A25A 3DAZA 4RFDA 4QIZA 5FNJA 5SZ6A 5DVXA 3NJ9A 1CILA 1BNWA 5LMDA 2EZ7A 5BRVA 3MNIA 2VVAX 5JGTB 1OKNA 5BYIA 4YGFA 5SZ5A 1CAYA 1HUGA 4JSAA 4K1QA 3HFPA 2CBDA 4YXIA 3F4XA 1HCAA 3M5EA 1I91A 4XE1A 4HEWA 4WR7A 5JEPB 3P5AA 4RFCA 5E5UA 4QK3A 1FSRA 4YGKA 4YWPA 3DCSA 4YHAA 3MDZA 3PYKA 4FRCA 3RG3A 4YXUA 4HT2A 4ILXA 4KNMA 2CBEA 1EOUA 2POWA 3N3JA 3HKNA 3R16A 4JS6A 4QJXA 3ML2A 2QP6A 1HEBA 1CVEA 4QSJA 1YO2A 3RGEA 1UGGA 1CNHA 3RYYA 4Q87A 5AMGA 5HPJA 4PQ7A 4ZX1A 3V3FA 1HCBA 2NWZA 3Q31A 1HEDA 4BCWA 2NN1A 2NNGA 2CABA 2FMZA 4E5QA 4QSIA 2NWOA 1CAOA 4UOVA 1BNVA 4E9OX 2NMXA 1UGBA 5SZ1A 3N0NA 3FE4A 4TWLA 2ZNCA 1G0FA 4ITOA 3IGPA 3P3JA 5E2KA 3N4BA 1URTA 1LUGA 3B1BA 4XZ5A 3NB5A 5A6HA 2ILIA 1YDCA 4MLTA 8CA2A 5CJFA 4KNJA 2FOVA 1FLJA 1XEVA 1Z97A 4ZWIA 3V5GA 3TVNX 1OKLA 1CVAA 4CA2A 5FNKA 3S74B 1G4JA 1J9WA 4JSZA 2O4ZA 1CZMA 3HKQA 4Q83A 3SBIA 2CBAA 3DV7A 3P55A 4XFWA 3T5UA 2GEHA 3RZ0B 3S72B 1YDAA 4DZ9A 1G0EA 1TBTX 2FOSA 4C3TA 3M04A 3MWOA 3KNEA 4WUQA 4YGJA 1FSNA 3MZCA 1G53A 3IBUA 3D0NA 5L6KA 1LZVA 1CINA 1FQRA 1ZFQA 3BL0A 3D8WA 12CAA 2W2JA 5DSLA 4CNVA 5E2RA 3NI5A 2WEHA 3OIMA 3MHLA 4MLXA 3SAPA 4WW8A 4L5WA 4Q6EA 3DVCA 3UYQA 1BN3A 3CYUA 3GZ0A 1G45A 1ZSBA 3HKTA 2Q1BA 5E2MA 1TH9A 1BN4A 3KONA 1CAIA 4KNIA 4FL7A 5G0CA 5SZ2A 4E3GA 5DSQA 4M2UA 5JQ0A 2X7UA 4Q8ZA 2AW1A 2EU3A 1OQ5A 4KNNA 3S9TA 5JESB 2FOQA 2HFWA 1RJ5A 4K13A 5EZTX 5SZ3A 3S71B 4Q7SA 1YO1A 1G3ZA 4HF3A 4GL1X 5JQTA 4FVOA 4QEFA 5SZ0A 4KV0A 4Q90A 4ZWZA 5CLUA 1TB0X 2NN7A 2HNCA 3SBHA 2X7TA 1T9NA 1TEQX 1TE3X 4Q7WA 1FR4A 3OIKA 1CVBA 3C7PA 4Q6DA 1F2WA 4LU3A 4FVNA 3DBUA 5FNHA 3P3HA 3T85A 3MNKA 1G4OA 3RJ7A 4HU1A 1RZDA 4RH2A 5JDVB 5BRUA 5C8IA 3JXFA 4XIWA 5AMDA 3KWAA 1XQ0A 3R17B 4YX4A 1YO0A 4PZHA 3M1QA 3F7BA 4Z1JA 1CVDA 2NXSA 2NWPA 2NXTA 1IF8A 1BZMA 1G1DA 1IF6A 1A42A 3CZVA 4ZWYA 3OYQA 3V3JA 3MMFA 1BNQA 3S8XA 3DVBA 5EIJA 1CNJA 5DSNA 5G01A 3KOIA 3V3HB 1IF5A 5FL4A 4G7AA 3P58A 6CA2A 1JD0A 5JG3B 1UGCA 4QJ0A 2AX2A 5FDIA 4QK2A 1FQNA 4MDLA 5FLPA 1I9NA 3M3XA 5G03A 1IF9A 5SZ7A 4R59A 3RZ8A 3JXHC 4QSBA 4YYTA 4Y0JA 3P44A 4BF1A 4XIXA 1MOOA 1HVAA 2HD6A 4LP6A 5E5RA 2WEGA 4FU5A 3M2YA 1CAJA 4YXOA 1AVNA 3ZNCA 5G0BA 1XPZA 2OSFA 1V9EA 1TG3A 1ZFKA 4QJOA 5E2NA 1JV0A 2FNNA 3D9ZA 1CVHA 1KWRA 4PYXA 1ZSAA 1AZMA 3S97A 1JCZA 4Z1KA 1DCBA 1ZE8A 4Q99A 3RZ7A 1ZGEA 3PJJA 1KEQA 3MNJA 4Q81A 1G48A 3KLDB 1ZSCA 2H4NA 1LG6A 5DSOA 2OSMA 5E28A 4MTYA 1CCSA 2NNOA 3RLDA 4R5AA 3T83A 4N16A 2NXRA 2FNMA 3M5TA 1G46A 2HL4A 4HEZA 4QTLA 4Q0LA 5DRSA 5EKMA 3V2MA 3DC3A 2EU2A 3KKXA 4E3FA 5DOGA 3TMJA 3P5LA 5FL5A 2NNSA 5CA2A 1YDBA 2Q1QA 3K2FA 3L14A 4YGLA 3DD0A 2FOYA 5EHWA 1THKA 4YGNA 5EH8A 5EKJA 4QK1A 1LGDA 4FPTA 5FLRA 2X7SA 4KUVA 3M40A 5AMLA 1HECA 1I9LA 1UGFA 1AM6A 1RJ6A 1CANA 4QJPA 3RYXB 4E3DA 3QYKA 5DSRA 5FNGA 3W6IA 4QIYA 3FW3A 3T82A 2WEOA 3MHCA 5DSJA 1IF7A 1KOQA 3BL1A 3RYZA 1KWQA 3MNUA 1FQMA 4Z1EA 2H15A 1H4NA 4KAPA 4KUWA 1MUAA 5FLQA 4KUYA 4ITPA 4N0XB 3EFTA 1CA3A 5JGSB 1RZBA 1TG9A 4YVYA 3V3GB 3B4FA 5EKHA 5FNMA 3CAJA 9CA2A 2POUA 1I9OA 1HUHA 5DSIA 5FLSA 5J8ZA 3F8EA 1CNIA 1BN1A 5JEGB 4R5BA 3MHMA 5BNLA 4E49A 3SAXA 1CA2A 2POVA 4FIKA 4M2VA 3U7CA 1ZH9A 4Q08A 2FOUA 3EFIA 1IF4A 5JG5B 3D92A 3IBNA 3M2ZA 1CNCA 3S75B 1UGEA 1BICA 4QY3A 5L3OA 5SZ4A 4IWZA 1DMXA 2NNVA 5DOHA 3V3IB 3M96A 1ZGFA 4MO8A 3VBDA 4Q8YA 5FL6A 4LHIA 3M98A 1CVCA 3KIGA 3LXEA 1V9IC 4PXXA 3K7KA 3HLJA 4IDRX 4HT0A 3OY0A 1CALA 1Y7WA 1RAZA 4X5SA 4M2RA 1I9QA 3S78B 1ZNCA 4L5VA 5FDCA 5EH7A 4MDGA 4RUZA 1FQLA 1LG5A 3BETA 3S73B 1CIMA 3S76A 3UYNA 1CNYA 3V2JA 3IAIA 1RZAA 4CQ0A 4HEYA 1CNKA 3M1JA 4Z0QA 5BRWA 7CA2A 1FR7A 3IBIA 4K0TA 2IT4A 3DCCA 1CCTA 5EH5A 4WW6A 3MHOA 3N2PA 2GD8A 3HKUA 4QJMA 3S77B 1I9MA 3U45X 1TEUX 3ZP9A 3IBLA 3OILA 2WD3A 5FLOA 4Q07A 4ZAOA 4COQA 1BNTA 5FLTA 1RZCA 4QSAA 3RZ5A 3MHIA 4L5UA 5EOIA 2CBBA 1G54A 4RIUA 1CNXA 1BNNA 1CNWA 3M1KA 4Q09A 1YDDA 2FW4A 3DC9A 3OKUA 4Q06A 1I9PA 4WUPA 4RIVA 4QJWA 2WD2A 4BF6A 3M5SA 3DA2A 2NWYA 3KOKA 4M2WA 4MDMA 3M67A 2VVBX 1I8ZA 3K34A 4Z1NA 4KP5A 3HS4A 5E2SA 1G6VA 3OKVA 4Q78A 4JSWA 2HKKA 3CA2A 3PO6A 1HEAA 4DZ7A 2FMGA 2FNKA 5EHEA 4Q49A 4ETQC 1Z93A 3W6HA 4CNRA 1RZEA 1I90A 1BNUA 1CRAA 2CBCA 4ZX0A 3U3AX 3DCWA 3T84A 4Q9YA 3D93A 4CACA 1DMYA 5IPZA 2CA2A 4Q7PA 3RYVB 4K0SA 5FNLA 1G52A 2QO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q38 A;  1CAK A;  5DSP A;  3MNA A;  5CAC A;  3JXG A;  4Q7V A;  3U47 A;  2F14 A;  4RUY A;  4E3H A;  4RN4 A;  4ZWX A;  3RZ1 B;  3P4V A;  4CNW A;  1CAH A;  1BCD A;  1KOP A;  3RG4 A;  3DVD A;  1OKM A;  1BNM A;  4CNX A;  1RAY A;  5EHV A;  3OYS A;  1CVF A;  2ABE A;  1H9Q A;  1Z9Y A;  4E4A A;  1UGD A;  3TVO X;  1CAM A;  3IEO A;  3V7X A;  1CNB A;  5JEH B;  1CRM A;  2WEJ A;  4JSS A;  5FNI A;  1FSQ A;  4Q8X A;  3ML5 A;  3FFP X;  4K0Z A;  1CNG A;  5DSK A;  3M2N A;  1CCU A;  1DCA A;  1XEG A;  1CAZ A;  4RUX A;  3RYJ B;  5DSM A;  3MYQ A;  4PYY A;  4TWM A;  4WL4 A;  1TTM A;  3M1W A;  4G0C A;  1H9N A;  4KP8 A;  2QOA A;  3F7U A;  3T5Z A;  2HOC A;  3M14 A;  4HBA A;  3DD8 A;  1BV3 A;  3KS3 A;  3M2X A;  1UGA A;  3MNH A;  5A25 A;  3DAZ A;  4RFD A;  4QIZ A;  5FNJ A;  5SZ6 A;  5DVX A;  3NJ9 A;  1CIL A;  1BNW A;  5LMD A;  2EZ7 A;  5BRV A;  3MNI A;  2VVA X;  5JGT B;  1OKN A;  5BYI A;  4YGF A;  5SZ5 A;  1CAY A;  1HUG A;  4JSA A;  4K1Q A;  3HFP A;  2CBD A;  4YXI A;  3F4X A;  1HCA A;  3M5E A;  1I91 A;  4XE1 A;  4HEW A;  4WR7 A;  5JEP B;  3P5A A;  4RFC A;  5E5U A;  4QK3 A;  1FSR A;  4YGK A;  4YWP A;  3DCS A;  4YHA A;  3MDZ A;  3PYK A;  4FRC A;  3RG3 A;  4YXU A;  4HT2 A;  4ILX A;  4KNM A;  2CBE A;  1EOU A;  2POW A;  3N3J A;  3HKN A;  3R16 A;  4JS6 A;  4QJX A;  3ML2 A;  2QP6 A;  1HEB A;  1CVE A;  4QSJ A;  1YO2 A;  3RGE A;  1UGG A;  1CNH A;  3RYY A;  4Q87 A;  5AMG A;  5HPJ A;  4PQ7 A;  4ZX1 A;  3V3F A;  1HCB A;  2NWZ A;  3Q31 A;  1HED A;  4BCW A;  2NN1 A;  2NNG A;  2CAB A;  2FMZ A;  4E5Q A;  4QSI A;  2NWO A;  1CAO A;  4UOV A;  1BNV A;  4E9O X;  2NMX A;  1UGB A;  5SZ1 A;  3N0N A;  3FE4 A;  4TWL A;  2ZNC A;  1G0F A;  4ITO A;  3IGP A;  3P3J A;  5E2K A;  3N4B A;  1URT A;  1LUG A;  3B1B A;  4XZ5 A;  3NB5 A;  5A6H A;  2ILI A;  1YDC A;  4MLT A;  8CA2 A;  5CJF A;  4KNJ A;  2FOV A;  1FLJ A;  1XEV A;  1Z97 A;  4ZWI A;  3V5G A;  3TVN X;  1OKL A;  1CVA A;  4CA2 A;  5FNK A;  3S74 B;  1G4J A;  1J9W A;  4JSZ A;  2O4Z A;  1CZM A;  3HKQ A;  4Q83 A;  3SBI A;  2CBA A;  3DV7 A;  3P55 A;  4XFW A;  3T5U A;  2GEH A;  3RZ0 B;  3S72 B;  1YDA A;  4DZ9 A;  1G0E A;  1TBT X;  2FOS A;  4C3T A;  3M04 A;  3MWO A;  3KNE A;  4WUQ A;  4YGJ A;  1FSN A;  3MZC A;  1G53 A;  3IBU A;  3D0N A;  5L6K A;  1LZV A;  1CIN A;  1FQR A;  1ZFQ A;  3BL0 A;  3D8W A;  12CA A;  2W2J A;  5DSL A;  4CNV A;  5E2R A;  3NI5 A;  2WEH A;  3OIM A;  3MHL A;  4MLX A;  3SAP A;  4WW8 A;  4L5W A;  4Q6E A;  3DVC A;  3UYQ A;  1BN3 A;  3CYU A;  3GZ0 A;  1G45 A;  1ZSB A;  3HKT A;  2Q1B A;  5E2M A;  1TH9 A;  1BN4 A;  3KON A;  1CAI A;  4KNI A;  4FL7 A;  5G0C A;  5SZ2 A;  4E3G A;  5DSQ A;  4M2U A;  5JQ0 A;  2X7U A;  4Q8Z A;  2AW1 A;  2EU3 A;  1OQ5 A;  4KNN A;  3S9T A;  5JES B;  2FOQ A;  2HFW A;  1RJ5 A;  4K13 A;  5EZT X;  5SZ3 A;  3S71 B;  4Q7S A;  1YO1 A;  1G3Z A;  4HF3 A;  4GL1 X;  5JQT A;  4FVO A;  4QEF A;  5SZ0 A;  4KV0 A;  4Q90 A;  4ZWZ A;  5CLU A;  1TB0 X;  2NN7 A;  2HNC A;  3SBH A;  2X7T A;  1T9N A;  1TEQ X;  1TE3 X;  4Q7W A;  1FR4 A;  3OIK A;  1CVB A;  3C7P A;  4Q6D A;  1F2W A;  4LU3 A;  4FVN A;  3DBU A;  5FNH A;  3P3H A;  3T85 A;  3MNK A;  1G4O A;  3RJ7 A;  4HU1 A;  1RZD A;  4RH2 A;  5JDV B;  5BRU A;  5C8I A;  3JXF A;  4XIW A;  5AMD A;  3KWA A;  1XQ0 A;  3R17 B;  4YX4 A;  1YO0 A;  4PZH A;  3M1Q A;  3F7B A;  4Z1J A;  1CVD A;  2NXS A;  2NWP A;  2NXT A;  1IF8 A;  1BZM A;  1G1D A;  1IF6 A;  1A42 A;  3CZV A;  4ZWY A;  3OYQ A;  3V3J A;  3MMF A;  1BNQ A;  3S8X A;  3DVB A;  5EIJ A;  1CNJ A;  5DSN A;  5G01 A;  3KOI A;  3V3H B;  1IF5 A;  5FL4 A;  4G7A A;  3P58 A;  6CA2 A;  1JD0 A;  5JG3 B;  1UGC A;  4QJ0 A;  2AX2 A;  5FDI A;  4QK2 A;  1FQN A;  4MDL A;  5FLP A;  1I9N A;  3M3X A;  5G03 A;  1IF9 A;  5SZ7 A;  4R59 A;  3RZ8 A;  3JXH C;  4QSB A;  4YYT A;  4Y0J A;  3P44 A;  4BF1 A;  4XIX A;  1MOO A;  1HVA A;  2HD6 A;  4LP6 A;  5E5R A;  2WEG A;  4FU5 A;  3M2Y A;  1CAJ A;  4YXO A;  1AVN A;  3ZNC A;  5G0B A;  1XPZ A;  2OSF A;  1V9E A;  1TG3 A;  1ZFK A;  4QJO A;  5E2N A;  1JV0 A;  2FNN A;  3D9Z A;  1CVH A;  1KWR A;  4PYX A;  1ZSA A;  1AZM A;  3S97 A;  1JCZ A;  4Z1K A;  1DCB A;  1ZE8 A;  4Q99 A;  3RZ7 A;  1ZGE A;  3PJJ A;  1KEQ A;  3MNJ A;  4Q81 A;  1G48 A;  3KLD B;  1ZSC A;  2H4N A;  1LG6 A;  5DSO A;  2OSM A;  5E28 A;  4MTY A;  1CCS A;  2NNO A;  3RLD A;  4R5A A;  3T83 A;  4N16 A;  2NXR A;  2FNM A;  3M5T A;  1G46 A;  2HL4 A;  4HEZ A;  4QTL A;  4Q0L A;  5DRS A;  5EKM A;  3V2M A;  3DC3 A;  2EU2 A;  3KKX A;  4E3F A;  5DOG A;  3TMJ A;  3P5L A;  5FL5 A;  2NNS A;  5CA2 A;  1YDB A;  2Q1Q A;  3K2F A;  3L14 A;  4YGL A;  3DD0 A;  2FOY A;  5EHW A;  1THK A;  4YGN A;  5EH8 A;  5EKJ A;  4QK1 A;  1LGD A;  4FPT A;  5FLR A;  2X7S A;  4KUV A;  3M40 A;  5AML A;  1HEC A;  1I9L A;  1UGF A;  1AM6 A;  1RJ6 A;  1CAN A;  4QJP A;  3RYX B;  4E3D A;  3QYK A;  5DSR A;  5FNG A;  3W6I A;  4QIY A;  3FW3 A;  3T82 A;  2WEO A;  3MHC A;  5DSJ A;  1IF7 A;  1KOQ A;  3BL1 A;  3RYZ A;  1KWQ A;  3MNU A;  1FQM A;  4Z1E A;  2H15 A;  1H4N A;  4KAP A;  4KUW A;  1MUA A;  5FLQ A;  4KUY A;  4ITP A;  4N0X B;  3EFT A;  1CA3 A;  5JGS B;  1RZB A;  1TG9 A;  4YVY A;  3V3G B;  3B4F A;  5EKH A;  5FNM A;  3CAJ A;  9CA2 A;  2POU A;  1I9O A;  1HUH A;  5DSI A;  5FLS A;  5J8Z A;  3F8E A;  1CNI A;  1BN1 A;  5JEG B;  4R5B A;  3MHM A;  5BNL A;  4E49 A;  3SAX A;  1CA2 A;  2POV A;  4FIK A;  4M2V A;  3U7C A;  1ZH9 A;  4Q08 A;  2FOU A;  3EFI A;  1IF4 A;  5JG5 B;  3D92 A;  3IBN A;  3M2Z A;  1CNC A;  3S75 B;  1UGE A;  1BIC A;  4QY3 A;  5L3O A;  5SZ4 A;  4IWZ A;  1DMX A;  2NNV A;  5DOH A;  3V3I B;  3M96 A;  1ZGF A;  4MO8 A;  3VBD A;  4Q8Y A;  5FL6 A;  4LHI A;  3M98 A;  1CVC A;  3KIG A;  3LXE A;  1V9I C;  4PXX A;  3K7K A;  3HLJ A;  4IDR X;  4HT0 A;  3OY0 A;  1CAL A;  1Y7W A;  1RAZ A;  4X5S A;  4M2R A;  1I9Q A;  3S78 B;  1ZNC A;  4L5V A;  5FDC A;  5EH7 A;  4MDG A;  4RUZ A;  1FQL A;  1LG5 A;  3BET A;  3S73 B;  1CIM A;  3S76 A;  3UYN A;  1CNY A;  3V2J A;  3IAI A;  1RZA A;  4CQ0 A;  4HEY A;  1CNK A;  3M1J A;  4Z0Q A;  5BRW A;  7CA2 A;  1FR7 A;  3IBI A;  4K0T A;  2IT4 A;  3DCC A;  1CCT A;  5EH5 A;  4WW6 A;  3MHO A;  3N2P A;  2GD8 A;  3HKU A;  4QJM A;  3S77 B;  1I9M A;  3U45 X;  1TEU X;  3ZP9 A;  3IBL A;  3OIL A;  2WD3 A;  5FLO A;  4Q07 A;  4ZAO A;  4COQ A;  1BNT A;  5FLT A;  1RZC A;  4QSA A;  3RZ5 A;  3MHI A;  4L5U A;  5EOI A;  2CBB A;  1G54 A;  4RIU A;  1CNX A;  1BNN A;  1CNW A;  3M1K A;  4Q09 A;  1YDD A;  2FW4 A;  3DC9 A;  3OKU A;  4Q06 A;  1I9P A;  4WUP A;  4RIV A;  4QJW A;  2WD2 A;  4BF6 A;  3M5S A;  3DA2 A;  2NWY A;  3KOK A;  4M2W A;  4MDM A;  3M67 A;  2VVB X;  1I8Z A;  3K34 A;  4Z1N A;  4KP5 A;  3HS4 A;  5E2S A;  1G6V A;  3OKV A;  4Q78 A;  4JSW A;  2HKK A;  3CA2 A;  3PO6 A;  1HEA A;  4DZ7 A;  2FMG A;  2FNK A;  5EHE A;  4Q49 A;  4ETQ C;  1Z93 A;  3W6H A;  4CNR A;  1RZE A;  1I90 A;  1BNU A;  1CRA A;  2CBC A;  4ZX0 A;  3U3A X;  3DCW A;  3T84 A;  4Q9Y A;  3D93 A;  4CAC A;  1DMY A;  5IPZ A;  2CA2 A;  4Q7P A;  3RYV B;  4K0S A;  5FNL A;  1G52 A;  2QO8 A; 
#chains in the Genus database with same CATH topology
 2Q38 A;  1CAK A;  5DSP A;  3MNA A;  5CAC A;  3JXG A;  4Q7V A;  3U47 A;  2F14 A;  4RUY A;  4E3H A;  4RN4 A;  4ZWX A;  3RZ1 B;  3P4V A;  4CNW A;  1CAH A;  1BCD A;  1KOP A;  3RG4 A;  3DVD A;  1OKM A;  1BNM A;  4CNX A;  1RAY A;  5EHV A;  3OYS A;  1CVF A;  2ABE A;  1H9Q A;  1Z9Y A;  4E4A A;  1UGD A;  3TVO X;  1CAM A;  3IEO A;  3V7X A;  1CNB A;  5JEH B;  1CRM A;  2WEJ A;  4JSS A;  5FNI A;  1FSQ A;  4Q8X A;  3ML5 A;  3FFP X;  4K0Z A;  1CNG A;  5DSK A;  3M2N A;  1CCU A;  1DCA A;  1XEG A;  1CAZ A;  4RUX A;  3RYJ B;  5DSM A;  3MYQ A;  4PYY A;  4TWM A;  4WL4 A;  1TTM A;  3M1W A;  4G0C A;  1H9N A;  4KP8 A;  2QOA A;  3F7U A;  3T5Z A;  2HOC A;  3M14 A;  4HBA A;  3DD8 A;  1BV3 A;  3KS3 A;  3M2X A;  1UGA A;  3MNH A;  5A25 A;  3DAZ A;  4RFD A;  4QIZ A;  5FNJ A;  5SZ6 A;  5DVX A;  3NJ9 A;  1CIL A;  1BNW A;  5LMD A;  2EZ7 A;  5BRV A;  3MNI A;  2VVA X;  5JGT B;  1OKN A;  5BYI A;  4YGF A;  5SZ5 A;  1CAY A;  1HUG A;  4JSA A;  4K1Q A;  3HFP A;  2CBD A;  4YXI A;  3F4X A;  1HCA A;  3M5E A;  1I91 A;  4XE1 A;  4HEW A;  4WR7 A;  5JEP B;  3P5A A;  4RFC A;  5E5U A;  4QK3 A;  1FSR A;  4YGK A;  4YWP A;  3DCS A;  4YHA A;  3MDZ A;  3PYK A;  4FRC A;  3RG3 A;  4YXU A;  4HT2 A;  4ILX A;  4KNM A;  2CBE A;  1EOU A;  2POW A;  3N3J A;  3HKN A;  3R16 A;  4JS6 A;  4QJX A;  3ML2 A;  2QP6 A;  1HEB A;  1CVE A;  4QSJ A;  1YO2 A;  3RGE A;  1UGG A;  1CNH A;  3RYY A;  4Q87 A;  5AMG A;  5HPJ A;  4PQ7 A;  4ZX1 A;  3V3F A;  1HCB A;  2NWZ A;  3Q31 A;  1HED A;  4BCW A;  2NN1 A;  2NNG A;  2CAB A;  2FMZ A;  4E5Q A;  4QSI A;  2NWO A;  1CAO A;  4UOV A;  1BNV A;  4E9O X;  2NMX A;  1UGB A;  5SZ1 A;  3N0N A;  3FE4 A;  4TWL A;  2ZNC A;  1G0F A;  4ITO A;  3IGP A;  3P3J A;  5E2K A;  3N4B A;  1URT A;  1LUG A;  3B1B A;  4XZ5 A;  3NB5 A;  5A6H A;  2ILI A;  1YDC A;  4MLT A;  8CA2 A;  5CJF A;  4KNJ A;  2FOV A;  1FLJ A;  1XEV A;  1Z97 A;  4ZWI A;  3V5G A;  3TVN X;  1OKL A;  1CVA A;  4CA2 A;  5FNK A;  3S74 B;  1G4J A;  1J9W A;  4JSZ A;  2O4Z A;  1CZM A;  3HKQ A;  4Q83 A;  3SBI A;  2CBA A;  3DV7 A;  3P55 A;  4XFW A;  3T5U A;  2GEH A;  3RZ0 B;  3S72 B;  1YDA A;  4DZ9 A;  1G0E A;  1TBT X;  2FOS A;  4C3T A;  3M04 A;  3MWO A;  3KNE A;  4WUQ A;  4YGJ A;  1FSN A;  3MZC A;  1G53 A;  3IBU A;  3D0N A;  5L6K A;  1LZV A;  1CIN A;  1FQR A;  1ZFQ A;  3BL0 A;  3D8W A;  12CA A;  2W2J A;  5DSL A;  4CNV A;  5E2R A;  3NI5 A;  2WEH A;  3OIM A;  3MHL A;  4MLX A;  3SAP A;  4WW8 A;  4L5W A;  4Q6E A;  3DVC A;  3UYQ A;  1BN3 A;  3CYU A;  3GZ0 A;  1G45 A;  1ZSB A;  3HKT A;  2Q1B A;  5E2M A;  1TH9 A;  1BN4 A;  3KON A;  1CAI A;  4KNI A;  4FL7 A;  5G0C A;  5SZ2 A;  4E3G A;  5DSQ A;  4M2U A;  5JQ0 A;  2X7U A;  4Q8Z A;  2AW1 A;  2EU3 A;  1OQ5 A;  4KNN A;  3S9T A;  5JES B;  2FOQ A;  2HFW A;  1RJ5 A;  4K13 A;  5EZT X;  5SZ3 A;  3S71 B;  4Q7S A;  1YO1 A;  1G3Z A;  4HF3 A;  4GL1 X;  5JQT A;  4FVO A;  4QEF A;  5SZ0 A;  4KV0 A;  4Q90 A;  4ZWZ A;  5CLU A;  1TB0 X;  2NN7 A;  2HNC A;  3SBH A;  2X7T A;  1T9N A;  1TEQ X;  1TE3 X;  4Q7W A;  1FR4 A;  3OIK A;  1CVB A;  3C7P A;  4Q6D A;  1F2W A;  4LU3 A;  4FVN A;  3DBU A;  5FNH A;  3P3H A;  3T85 A;  3MNK A;  1G4O A;  3RJ7 A;  4HU1 A;  1RZD A;  4RH2 A;  5JDV B;  5BRU A;  5C8I A;  3JXF A;  4XIW A;  5AMD A;  3KWA A;  1XQ0 A;  3R17 B;  4YX4 A;  1YO0 A;  4PZH A;  3M1Q A;  3F7B A;  4Z1J A;  1CVD A;  2NXS A;  2NWP A;  2NXT A;  1IF8 A;  1BZM A;  1G1D A;  1IF6 A;  1A42 A;  3CZV A;  4ZWY A;  3OYQ A;  3V3J A;  3MMF A;  1BNQ A;  3S8X A;  3DVB A;  5EIJ A;  1CNJ A;  5DSN A;  5G01 A;  3KOI A;  3V3H B;  1IF5 A;  5FL4 A;  4G7A A;  3P58 A;  6CA2 A;  1JD0 A;  5JG3 B;  1UGC A;  4QJ0 A;  2AX2 A;  5FDI A;  4QK2 A;  1FQN A;  4MDL A;  5FLP A;  1I9N A;  3M3X A;  5G03 A;  1IF9 A;  5SZ7 A;  4R59 A;  3RZ8 A;  3JXH C;  4QSB A;  4YYT A;  4Y0J A;  3P44 A;  4BF1 A;  4XIX A;  1MOO A;  1HVA A;  2HD6 A;  4LP6 A;  5E5R A;  2WEG A;  4FU5 A;  3M2Y A;  1CAJ A;  4YXO A;  1AVN A;  3ZNC A;  5G0B A;  1XPZ A;  2OSF A;  1V9E A;  1TG3 A;  1ZFK A;  4QJO A;  5E2N A;  1JV0 A;  2FNN A;  3D9Z A;  1CVH A;  1KWR A;  4PYX A;  1ZSA A;  1AZM A;  3S97 A;  1JCZ A;  4Z1K A;  1DCB A;  1ZE8 A;  4Q99 A;  3RZ7 A;  1ZGE A;  3PJJ A;  1KEQ A;  3MNJ A;  4Q81 A;  1G48 A;  3KLD B;  1ZSC A;  2H4N A;  1LG6 A;  5DSO A;  2OSM A;  5E28 A;  4MTY A;  1CCS A;  2NNO A;  3RLD A;  4R5A A;  3T83 A;  4N16 A;  2NXR A;  2FNM A;  3M5T A;  1G46 A;  2HL4 A;  4HEZ A;  4QTL A;  4Q0L A;  5DRS A;  5EKM A;  3V2M A;  3DC3 A;  2EU2 A;  3KKX A;  4E3F A;  5DOG A;  3TMJ A;  3P5L A;  5FL5 A;  2NNS A;  5CA2 A;  1YDB A;  2Q1Q A;  3K2F A;  3L14 A;  4YGL A;  3DD0 A;  2FOY A;  5EHW A;  1THK A;  4YGN A;  5EH8 A;  5EKJ A;  4QK1 A;  1LGD A;  4FPT A;  5FLR A;  2X7S A;  4KUV A;  3M40 A;  5AML A;  1HEC A;  1I9L A;  1UGF A;  1AM6 A;  1RJ6 A;  1CAN A;  4QJP A;  3RYX B;  4E3D A;  3QYK A;  5DSR A;  5FNG A;  3W6I A;  4QIY A;  3FW3 A;  3T82 A;  2WEO A;  3MHC A;  5DSJ A;  1IF7 A;  1KOQ A;  3BL1 A;  3RYZ A;  1KWQ A;  3MNU A;  1FQM A;  4Z1E A;  2H15 A;  1H4N A;  4KAP A;  4KUW A;  1MUA A;  5FLQ A;  4KUY A;  4ITP A;  4N0X B;  3EFT A;  1CA3 A;  5JGS B;  1RZB A;  1TG9 A;  4YVY A;  3V3G B;  3B4F A;  5EKH A;  5FNM A;  3CAJ A;  9CA2 A;  2POU A;  1I9O A;  1HUH A;  5DSI A;  5FLS A;  5J8Z A;  3F8E A;  1CNI A;  1BN1 A;  5JEG B;  4R5B A;  3MHM A;  5BNL A;  4E49 A;  3SAX A;  1CA2 A;  2POV A;  4FIK A;  4M2V A;  3U7C A;  1ZH9 A;  4Q08 A;  2FOU A;  3EFI A;  1IF4 A;  5JG5 B;  3D92 A;  3IBN A;  3M2Z A;  1CNC A;  3S75 B;  1UGE A;  1BIC A;  4QY3 A;  5L3O A;  5SZ4 A;  4IWZ A;  1DMX A;  2NNV A;  5DOH A;  3V3I B;  3M96 A;  1ZGF A;  4MO8 A;  3VBD A;  4Q8Y A;  5FL6 A;  4LHI A;  3M98 A;  1CVC A;  3KIG A;  3LXE A;  1V9I C;  4PXX A;  3K7K A;  3HLJ A;  4IDR X;  4HT0 A;  3OY0 A;  1CAL A;  1Y7W A;  1RAZ A;  4X5S A;  4M2R A;  1I9Q A;  3S78 B;  1ZNC A;  4L5V A;  5FDC A;  5EH7 A;  4MDG A;  4RUZ A;  1FQL A;  1LG5 A;  3BET A;  3S73 B;  1CIM A;  3S76 A;  3UYN A;  1CNY A;  3V2J A;  3IAI A;  1RZA A;  4CQ0 A;  4HEY A;  1CNK A;  3M1J A;  4Z0Q A;  5BRW A;  7CA2 A;  1FR7 A;  3IBI A;  4K0T A;  2IT4 A;  3DCC A;  1CCT A;  5EH5 A;  4WW6 A;  3MHO A;  3N2P A;  2GD8 A;  3HKU A;  4QJM A;  3S77 B;  1I9M A;  3U45 X;  1TEU X;  3ZP9 A;  3IBL A;  3OIL A;  2WD3 A;  5FLO A;  4Q07 A;  4ZAO A;  4COQ A;  1BNT A;  5FLT A;  1RZC A;  4QSA A;  3RZ5 A;  3MHI A;  4L5U A;  5EOI A;  2CBB A;  1G54 A;  4RIU A;  1CNX A;  1BNN A;  1CNW A;  3M1K A;  4Q09 A;  1YDD A;  2FW4 A;  3DC9 A;  3OKU A;  4Q06 A;  1I9P A;  4WUP A;  4RIV A;  4QJW A;  2WD2 A;  4BF6 A;  3M5S A;  3DA2 A;  2NWY A;  3KOK A;  4M2W A;  4MDM A;  3M67 A;  2VVB X;  1I8Z A;  3K34 A;  4Z1N A;  4KP5 A;  3HS4 A;  5E2S A;  1G6V A;  3OKV A;  4Q78 A;  4JSW A;  2HKK A;  3CA2 A;  3PO6 A;  1HEA A;  4DZ7 A;  2FMG A;  2FNK A;  5EHE A;  4Q49 A;  4ETQ C;  1Z93 A;  3W6H A;  4CNR A;  1RZE A;  1I90 A;  1BNU A;  1CRA A;  2CBC A;  4ZX0 A;  3U3A X;  3DCW A;  3T84 A;  4Q9Y A;  3D93 A;  4CAC A;  1DMY A;  5IPZ A;  2CA2 A;  4Q7P A;  3RYV B;  4K0S A;  5FNL A;  1G52 A;  2QO8 A; 
#chains in the Genus database with same CATH homology
 2Q38 A;  1CAK A;  5DSP A;  3MNA A;  5CAC A;  3JXG A;  4Q7V A;  3U47 A;  2F14 A;  4RUY A;  4E3H A;  4RN4 A;  4ZWX A;  3RZ1 B;  3P4V A;  4CNW A;  1CAH A;  1BCD A;  1KOP A;  3RG4 A;  3DVD A;  1OKM A;  1BNM A;  4CNX A;  1RAY A;  5EHV A;  3OYS A;  1CVF A;  2ABE A;  1H9Q A;  1Z9Y A;  4E4A A;  1UGD A;  3TVO X;  1CAM A;  3IEO A;  3V7X A;  1CNB A;  5JEH B;  1CRM A;  2WEJ A;  4JSS A;  5FNI A;  1FSQ A;  4Q8X A;  3ML5 A;  3FFP X;  4K0Z A;  1CNG A;  5DSK A;  3M2N A;  1CCU A;  1DCA A;  1XEG A;  1CAZ A;  4RUX A;  3RYJ B;  5DSM A;  3MYQ A;  4PYY A;  4TWM A;  4WL4 A;  1TTM A;  3M1W A;  4G0C A;  1H9N A;  4KP8 A;  2QOA A;  3F7U A;  3T5Z A;  2HOC A;  3M14 A;  4HBA A;  3DD8 A;  1BV3 A;  3KS3 A;  3M2X A;  1UGA A;  3MNH A;  5A25 A;  3DAZ A;  4RFD A;  4QIZ A;  5FNJ A;  5SZ6 A;  5DVX A;  3NJ9 A;  1CIL A;  1BNW A;  5LMD A;  2EZ7 A;  5BRV A;  3MNI A;  2VVA X;  5JGT B;  1OKN A;  5BYI A;  4YGF A;  5SZ5 A;  1CAY A;  1HUG A;  4JSA A;  4K1Q A;  3HFP A;  2CBD A;  4YXI A;  3F4X A;  1HCA A;  3M5E A;  1I91 A;  4XE1 A;  4HEW A;  4WR7 A;  5JEP B;  3P5A A;  4RFC A;  5E5U A;  4QK3 A;  1FSR A;  4YGK A;  4YWP A;  3DCS A;  4YHA A;  3MDZ A;  3PYK A;  4FRC A;  3RG3 A;  4YXU A;  4HT2 A;  4ILX A;  4KNM A;  2CBE A;  1EOU A;  2POW A;  3N3J A;  3HKN A;  3R16 A;  4JS6 A;  4QJX A;  3ML2 A;  2QP6 A;  1HEB A;  1CVE A;  4QSJ A;  1YO2 A;  3RGE A;  1UGG A;  1CNH A;  3RYY A;  4Q87 A;  5AMG A;  5HPJ A;  4PQ7 A;  4ZX1 A;  3V3F A;  1HCB A;  2NWZ A;  3Q31 A;  1HED A;  4BCW A;  2NN1 A;  2NNG A;  2CAB A;  2FMZ A;  4E5Q A;  4QSI A;  2NWO A;  1CAO A;  4UOV A;  1BNV A;  4E9O X;  2NMX A;  1UGB A;  5SZ1 A;  3N0N A;  3FE4 A;  4TWL A;  2ZNC A;  1G0F A;  4ITO A;  3IGP A;  3P3J A;  5E2K A;  3N4B A;  1URT A;  1LUG A;  3B1B A;  4XZ5 A;  3NB5 A;  5A6H A;  2ILI A;  1YDC A;  4MLT A;  8CA2 A;  5CJF A;  4KNJ A;  2FOV A;  1FLJ A;  1XEV A;  1Z97 A;  4ZWI A;  3V5G A;  3TVN X;  1OKL A;  1CVA A;  4CA2 A;  5FNK A;  3S74 B;  1G4J A;  1J9W A;  4JSZ A;  2O4Z A;  1CZM A;  3HKQ A;  4Q83 A;  3SBI A;  2CBA A;  3DV7 A;  3P55 A;  4XFW A;  3T5U A;  2GEH A;  3RZ0 B;  3S72 B;  1YDA A;  4DZ9 A;  1G0E A;  1TBT X;  2FOS A;  4C3T A;  3M04 A;  3MWO A;  3KNE A;  4WUQ A;  4YGJ A;  1FSN A;  3MZC A;  1G53 A;  3IBU A;  3D0N A;  5L6K A;  1LZV A;  1CIN A;  1FQR A;  1ZFQ A;  3BL0 A;  3D8W A;  12CA A;  2W2J A;  5DSL A;  4CNV A;  5E2R A;  3NI5 A;  2WEH A;  3OIM A;  3MHL A;  4MLX A;  3SAP A;  4WW8 A;  4L5W A;  4Q6E A;  3DVC A;  3UYQ A;  1BN3 A;  3CYU A;  3GZ0 A;  1G45 A;  1ZSB A;  3HKT A;  2Q1B A;  5E2M A;  1TH9 A;  1BN4 A;  3KON A;  1CAI A;  4KNI A;  4FL7 A;  5G0C A;  5SZ2 A;  4E3G A;  5DSQ A;  4M2U A;  5JQ0 A;  2X7U A;  4Q8Z A;  2AW1 A;  2EU3 A;  1OQ5 A;  4KNN A;  3S9T A;  5JES B;  2FOQ A;  2HFW A;  1RJ5 A;  4K13 A;  5EZT X;  5SZ3 A;  3S71 B;  4Q7S A;  1YO1 A;  1G3Z A;  4HF3 A;  4GL1 X;  5JQT A;  4FVO A;  4QEF A;  5SZ0 A;  4KV0 A;  4Q90 A;  4ZWZ A;  5CLU A;  1TB0 X;  2NN7 A;  2HNC A;  3SBH A;  2X7T A;  1T9N A;  1TEQ X;  1TE3 X;  4Q7W A;  1FR4 A;  3OIK A;  1CVB A;  3C7P A;  4Q6D A;  1F2W A;  4LU3 A;  4FVN A;  3DBU A;  5FNH A;  3P3H A;  3T85 A;  3MNK A;  1G4O A;  3RJ7 A;  4HU1 A;  1RZD A;  4RH2 A;  5JDV B;  5BRU A;  5C8I A;  3JXF A;  4XIW A;  5AMD A;  3KWA A;  1XQ0 A;  3R17 B;  4YX4 A;  1YO0 A;  4PZH A;  3M1Q A;  3F7B A;  4Z1J A;  1CVD A;  2NXS A;  2NWP A;  2NXT A;  1IF8 A;  1BZM A;  1G1D A;  1IF6 A;  1A42 A;  3CZV A;  4ZWY A;  3OYQ A;  3V3J A;  3MMF A;  1BNQ A;  3S8X A;  3DVB A;  5EIJ A;  1CNJ A;  5DSN A;  5G01 A;  3KOI A;  3V3H B;  1IF5 A;  5FL4 A;  4G7A A;  3P58 A;  6CA2 A;  1JD0 A;  5JG3 B;  1UGC A;  4QJ0 A;  2AX2 A;  5FDI A;  4QK2 A;  1FQN A;  4MDL A;  5FLP A;  1I9N A;  3M3X A;  5G03 A;  1IF9 A;  5SZ7 A;  4R59 A;  3RZ8 A;  3JXH C;  4QSB A;  4YYT A;  4Y0J A;  3P44 A;  4BF1 A;  4XIX A;  1MOO A;  1HVA A;  2HD6 A;  4LP6 A;  5E5R A;  2WEG A;  4FU5 A;  3M2Y A;  1CAJ A;  4YXO A;  1AVN A;  3ZNC A;  5G0B A;  1XPZ A;  2OSF A;  1V9E A;  1TG3 A;  1ZFK A;  4QJO A;  5E2N A;  1JV0 A;  2FNN A;  3D9Z A;  1CVH A;  1KWR A;  4PYX A;  1ZSA A;  1AZM A;  3S97 A;  1JCZ A;  4Z1K A;  1DCB A;  1ZE8 A;  4Q99 A;  3RZ7 A;  1ZGE A;  3PJJ A;  1KEQ A;  3MNJ A;  4Q81 A;  1G48 A;  3KLD B;  1ZSC A;  2H4N A;  1LG6 A;  5DSO A;  2OSM A;  5E28 A;  4MTY A;  1CCS A;  2NNO A;  3RLD A;  4R5A A;  3T83 A;  4N16 A;  2NXR A;  2FNM A;  3M5T A;  1G46 A;  2HL4 A;  4HEZ A;  4QTL A;  4Q0L A;  5DRS A;  5EKM A;  3V2M A;  3DC3 A;  2EU2 A;  3KKX A;  4E3F A;  5DOG A;  3TMJ A;  3P5L A;  5FL5 A;  2NNS A;  5CA2 A;  1YDB A;  2Q1Q A;  3K2F A;  3L14 A;  4YGL A;  3DD0 A;  2FOY A;  5EHW A;  1THK A;  4YGN A;  5EH8 A;  5EKJ A;  4QK1 A;  1LGD A;  4FPT A;  5FLR A;  2X7S A;  4KUV A;  3M40 A;  5AML A;  1HEC A;  1I9L A;  1UGF A;  1AM6 A;  1RJ6 A;  1CAN A;  4QJP A;  3RYX B;  4E3D A;  3QYK A;  5DSR A;  5FNG A;  3W6I A;  4QIY A;  3FW3 A;  3T82 A;  2WEO A;  3MHC A;  5DSJ A;  1IF7 A;  1KOQ A;  3BL1 A;  3RYZ A;  1KWQ A;  3MNU A;  1FQM A;  4Z1E A;  2H15 A;  1H4N A;  4KAP A;  4KUW A;  1MUA A;  5FLQ A;  4KUY A;  4ITP A;  4N0X B;  3EFT A;  1CA3 A;  5JGS B;  1RZB A;  1TG9 A;  4YVY A;  3V3G B;  3B4F A;  5EKH A;  5FNM A;  3CAJ A;  9CA2 A;  2POU A;  1I9O A;  1HUH A;  5DSI A;  5FLS A;  5J8Z A;  3F8E A;  1CNI A;  1BN1 A;  5JEG B;  4R5B A;  3MHM A;  5BNL A;  4E49 A;  3SAX A;  1CA2 A;  2POV A;  4FIK A;  4M2V A;  3U7C A;  1ZH9 A;  4Q08 A;  2FOU A;  3EFI A;  1IF4 A;  5JG5 B;  3D92 A;  3IBN A;  3M2Z A;  1CNC A;  3S75 B;  1UGE A;  1BIC A;  4QY3 A;  5L3O A;  5SZ4 A;  4IWZ A;  1DMX A;  2NNV A;  5DOH A;  3V3I B;  3M96 A;  1ZGF A;  4MO8 A;  3VBD A;  4Q8Y A;  5FL6 A;  4LHI A;  3M98 A;  1CVC A;  3KIG A;  3LXE A;  1V9I C;  4PXX A;  3K7K A;  3HLJ A;  4IDR X;  4HT0 A;  3OY0 A;  1CAL A;  1Y7W A;  1RAZ A;  4X5S A;  4M2R A;  1I9Q A;  3S78 B;  1ZNC A;  4L5V A;  5FDC A;  5EH7 A;  4MDG A;  4RUZ A;  1FQL A;  1LG5 A;  3BET A;  3S73 B;  1CIM A;  3S76 A;  3UYN A;  1CNY A;  3V2J A;  3IAI A;  1RZA A;  4CQ0 A;  4HEY A;  1CNK A;  3M1J A;  4Z0Q A;  5BRW A;  7CA2 A;  1FR7 A;  3IBI A;  4K0T A;  2IT4 A;  3DCC A;  1CCT A;  5EH5 A;  4WW6 A;  3MHO A;  3N2P A;  2GD8 A;  3HKU A;  4QJM A;  3S77 B;  1I9M A;  3U45 X;  1TEU X;  3ZP9 A;  3IBL A;  3OIL A;  2WD3 A;  5FLO A;  4Q07 A;  4ZAO A;  4COQ A;  1BNT A;  5FLT A;  1RZC A;  4QSA A;  3RZ5 A;  3MHI A;  4L5U A;  5EOI A;  2CBB A;  1G54 A;  4RIU A;  1CNX A;  1BNN A;  1CNW A;  3M1K A;  4Q09 A;  1YDD A;  2FW4 A;  3DC9 A;  3OKU A;  4Q06 A;  1I9P A;  4WUP A;  4RIV A;  4QJW A;  2WD2 A;  4BF6 A;  3M5S A;  3DA2 A;  2NWY A;  3KOK A;  4M2W A;  4MDM A;  3M67 A;  2VVB X;  1I8Z A;  3K34 A;  4Z1N A;  4KP5 A;  3HS4 A;  5E2S A;  1G6V A;  3OKV A;  4Q78 A;  4JSW A;  2HKK A;  3CA2 A;  3PO6 A;  1HEA A;  4DZ7 A;  2FMG A;  2FNK A;  5EHE A;  4Q49 A;  4ETQ C;  1Z93 A;  3W6H A;  4CNR A;  1RZE A;  1I90 A;  1BNU A;  1CRA A;  2CBC A;  4ZX0 A;  3U3A X;  3DCW A;  3T84 A;  4Q9Y A;  3D93 A;  4CAC A;  1DMY A;  5IPZ A;  2CA2 A;  4Q7P A;  3RYV B;  4K0S A;  5FNL A;  1G52 A;  2QO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...