2FNKA

Activation of human carbonic anhydrase ii by exogenous proton donors
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
Knots found
sequence length
258
structure length
258
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGWAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Location of binding sites in small molecule rescue of human carbonic anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Carbonic anhydrase 2
total genus 75
structure length 258
sequence length 258
other databases KnotProt 2.0: K +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2006-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 2fnkA00
1IF6A 1CNGA 5BRWA 4FRCA 5A25A 3TVNX 2FNMA 4FPTA 3IBLA 1G0EA 2F14A 4Q09A 1OKNA 4WW6A 1JCZA 1BCDA 4LU3A 3OILA 4Q8YA 1BNVA 2X7UA 4QIYA 2NMXA 5JEPB 5LMDA 1OKMA 5DSKA 4QJPA 1LG5A 1CA2A 1EOUA 2FNKA 1IF4A 2NN1A 3RGEA 1RZDA 4BF1A 4WW8A 4E3DA 2HFWA 3RZ0B 2CBDA 1FQMA 1YO2A 4ZWYA 1OKLA 1DMYA 4Q7SA 9CA2A 5C8IA 4RN4A 4MLXA 3P3JA 4K13A 2NNOA 4Q0LA 4WR7A 3M96A 1HECA 5DOHA 1A42A 3RG3A 4CNVA 1G3ZA 5DSRA 4KUWA 5SZ6A 4X5SA 4Q99A 3KNEA 2O4ZA 1RZAA 4QJXA 2NNVA 4RIVA 1JD0A 3T84A 4E5QA 2HL4A 1YO1A 2EU3A 3DVDA 1KOPA 5EH8A 4ITPA 5FLTA 3D9ZA 4KUYA 1Y7WA 5DRSA 5FL6A 1Z93A 3N2PA 1CNCA 5HPJA 5DOGA 1KWQA 3L14A 3M67A 4PYYA 3MNUA 1G52A 5E2RA 1V9EA 4JSSA 5JDVB 5BNLA 1YO0A 1G46A 3NI5A 3RYZA 1BN4A 4ZX1A 5A6HA 3P4VA 3S9TA 3DBUA 2FOVA 2WD3A 2OSMA 3F8EA 1G6VA 3T82A 3U45X 3EFTA 3PO6A 4Q7VA 4HBAA 1UGBA 1TEQX 4CA2A 4MDGA 2WEGA 3RYXB 1CRMA 3KONA 4QK1A 4K0TA 3UYNA 4KNJA 3M1KA 3C7PA 3V3FA 1LZVA 3HLJA 2NWPA 4CACA 3CAJA 4G7AA 4WUQA 2ILIA 3CZVA 3R17B 3OYSA 3B4FA 4QK2A 4KP8A 3LXEA 5FLQA 1JV0A 1IF8A 2W2JA 3TVOX 3K34A 4RFCA 1UGCA 5E2NA 1HUHA 2NXTA 3S74B 4XZ5A 4KNMA 4CNWA 5FLPA 5JG3B 5JQ0A 4G0CA 4ZWIA 4HT2A 4PYXA 3RZ1B 4YGKA 3MNIA 2QO8A 5E2KA 5AMGA 1T9NA 3DCSA 4Q06A 3DAZA 2FW4A 3MHOA 4RUXA 2H15A 4K0SA 5SZ2A 1TEUX 4QEFA 2NNSA 4RFDA 5EH5A 3RJ7A 1ZSCA 1RAYA 1FQRA 12CAA 3DVBA 3KWAA 3V3JA 1ZSBA 1CNJA 4KAPA 5L3OA 1RZBA 1YDDA 1MUAA 4FVNA 4QJOA 1ZFKA 2Q38A 1URTA 1RAZA 3OIKA 3MNHA 4Q81A 5DSMA 3RZ8A 1CVDA 5FL4A 1RZCA 3SBHA 5BRUA 1CVAA 3V2JA 1ZNCA 4E4AA 6CA2A 4JSAA 1HEAA 4R5BA 4XFWA 3NB5A 5SZ4A 3MNKA 5CA2A 3ZP9A 1CZMA 4ZWZA 5JG5B 1TG3A 3S76A 4K0ZA 1TE3X 1HCBA 4MDLA 2EZ7A 1CNBA 3DVCA 4Z1EA 5EHWA 3SAXA 4RUZA 3V5GA 4WUPA 1HEBA 4M2VA 4FU5A 3V3IB 5G03A 3VBDA 2FMZA 1ZSAA 4Z1KA 1G45A 1YDCA 2POWA 1KEQA 3S77B 5JEGB 1CVFA 5SZ5A 4ZX0A 1CANA 2VVBX 4KP5A 5EKHA 1UGAA 5G0CA 3M5TA 3FE4A 5DSOA 4M2WA 2NWZA 1J9WA 4FVOA 5EKJA 1BNWA 3V3HB 1IF7A 4Y0JA 2FOYA 2VVAX 3MHCA 1CIMA 1BNQA 3F4XA 1LGDA 2CBCA 4CNXA 3HKNA 4HT0A 4TWMA 1XQ0A 3S8XA 5FNLA 1ZGEA 4TWLA 5FDIA 1CVBA 1CAIA 1CAHA 2NN7A 1IF5A 1I8ZA 3DD0A 3JXFA 1FQNA 1CVCA 4GL1X 4MTYA 3V3GB 4Q8ZA 2ABEA 5DVXA 4CQ0A 4HU1A 3BL1A 3KS3A 3RZ5A 1I90A 2CABA 1UGEA 1G53A 1TTMA 4Q6DA 5FL5A 3S72B 4Q7WA 4COQA 3NJ9A 1G1DA 4YGLA 2NNGA 2IT4A 4M2UA 5DSNA 3SBIA 3CA2A 1FSRA 1G48A 4WL4A 4QIZA 4Q7PA 3M3XA 1V9IC 3T85A 3DC3A 2EU2A 3DC9A 2WEOA 1FSNA 3ML5A 3IEOA 3KLDB 3P3HA 5SZ0A 4Q49A 5FNJA 2ZNCA 1ZE8A 1I9NA 3SAPA 3DCWA 1CAYA 2HNCA 1CILA 1I9PA 4YGFA 3UYQA 1XPZA 2NXSA 2AW1A 5SZ7A 4DZ7A 1CAJA 2Q1BA 1CCSA 1TH9A 3OY0A 3IBNA 4YWPA 5E2SA 2WD2A 1I91A 1MOOA 4HF3A 4ETQC 2CBBA 1I9MA 1FSQA 1RJ6A 2CA2A 3D93A 3KKXA 3N3JA 3P5AA 2NWOA 4KNIA 1HUGA 5L6KA 5E2MA 3IBIA 4ZWXA 4LHIA 1CALA 3M2XA 1AM6A 1RZEA 1YDBA 4HEWA 4Q08A 4HEYA 1UGFA 1KOQA 8CA2A 1ZH9A 3RYYA 4RIUA 1BNTA 3QYKA 3S97A 1BICA 3IBUA 5EKMA 4Q07A 5FLRA 5EIJA 3HFPA 4Q6EA 1CNKA 2H4NA 4ITOA 1CNIA 5E5RA 4M2RA 5BRVA 4ILXA 5FDCA 5FLOA 2NWYA 3GZ0A 5EOIA 4JSWA 5DSIA 1CNXA 4BF6A 1IF9A 3OYQA 1THKA 1YDAA 4R59A 4HEZA 2HKKA 4ZAOA 1OQ5A 2FOQA 4QJ0A 4C3TA 1CRAA 4YXIA 1CNWA 1HCAA 3RLDA 5E5UA 3K2FA 3T5ZA 3N4BA 5DSJA 2HD6A 4XIXA 3CYUA 4QSJA 4IDRX 4Z1JA 3M5EA 4MDMA 1LG6A 3F7BA 1G0FA 5EHVA 3RYJB 3OKVA 3KOIA 4LP6A 1KWRA 1DCAA 4YGJA 1CAZA 4YXUA 3MDZA 4L5UA 4QTLA 1CNYA 3HKUA 2QOAA 5EZTX 1BN1A 3U7CA 3RZ7A 3RG4A 4E3HA 3MWOA 4Q87A 4R5AA 4YXOA 1I9QA 1DCBA 2QP6A 3BL0A 3M1JA 3M1WA 1AVNA 3P58A 4QSBA 5EH7A 4PQ7A 3U47A 1HVAA 3M5SA 5AMDA 1UGDA 2GEHA 3P44A 1BNNA 2FNNA 3HS4A 2FMGA 4FL7A 3OKUA 3T5UA 1H4NA 3TMJA 4QSIA 1CNHA 5SZ1A 3S75B 4QJMA 4CNRA 4QY3A 5DSQA 3MZCA 1CA3A 1FR4A 2POUA 1BN3A 3M2NA 1F2WA 4MO8A 3ML2A 2HOCA 5BYIA 1CAMA 1XEVA 4RH2A 3ZNCA 3D92A 3N0NA 5G01A 4RUYA 2X7SA 1BV3A 5E28A 1I9OA 1UGGA 3PYKA 5FNIA 1ZFQA 4FIKA 4Q9YA 3B1BA 3M2YA 4YVYA 4E49A 1CAKA 3V2MA 2FOUA 3IGPA 3M14A 4YYTA 1CVHA 2FOSA 3JXHC 4YX4A 5JGSB 4Z1NA 3M04A 3HKTA 1DMXA 3S73B 3M40A 3D0NA 5FNGA 1LUGA 1AZMA 3P5LA 4E9OX 4Q78A 3MHMA 4JS6A 1FR7A 2CBAA 2CBEA 3MHLA 4IWZA 4UOVA 4YHAA 5EHEA 3V7XA 2GD8A 1TG9A 1G54A 5DSLA 1CINA 5SZ3A 4PZHA 4YGNA 5JQTA 4JSZA 5JGTB 3U3AX 4DZ9A 3KOKA 3DCCA 3FFPX 3MYQA 3FW3A 3DD8A 1XEGA 3T83A 3HKQA 1H9NA 3S78B 1CCUA 5G0BA 1ZGFA 3W6IA 5IPZA 1BZMA 3MNAA 3DV7A 2Q1QA 1RJ5A 3P55A 1Z97A 2OSFA 1HEDA 3MNJA 1Z9YA 3PJJA 1TB0X 4Z0QA 3M1QA 1FQLA 1CCTA 3F7UA 3W6HA 1G4OA 4L5VA 3BETA 4Q8XA 4N16A 1FLJA 5JESB 5FNKA 3RYVB 2WEJA 7CA2A 4Q83A 4MLTA 3DA2A 3M98A 5CLUA 5FNHA 1H9QA 5JEHB 3Q31A 4QK3A 3JXGA 4QJWA 4E3GA 2WEHA 3D8WA 4XIWA 3K7KA 1BNUA 1TBTX 2NXRA 4L5WA 3KIGA 4PXXA 4Q90A 4KV0A 5AMLA 4KNNA 4BCWA 1CAOA 3MHIA 5DSPA 2X7TA 3OIMA 4KUVA 4E3FA 4K1QA 2POVA 1CVEA 2AX2A 5FLSA 3EFIA 1I9LA 3R16A 4QSAA 5FNMA 4XE1A 5J8ZA 3S71B 5CACA 5CJFA 3M2ZA 1G4JA 1BNMA 4N0XB 3MMFA 3IAIA
chains in the Genus database with same CATH superfamily
1IF6A 1CNGA 5BRWA 4FRCA 5A25A 3TVNX 2FNMA 4FPTA 3IBLA 1G0EA 2F14A 4Q09A 1OKNA 4WW6A 1JCZA 1BCDA 4LU3A 3OILA 4Q8YA 1BNVA 2X7UA 4QIYA 2NMXA 5JEPB 5LMDA 1OKMA 5DSKA 4QJPA 1LG5A 1CA2A 1EOUA 2FNKA 1IF4A 2NN1A 3RGEA 1RZDA 4BF1A 4WW8A 4E3DA 2HFWA 3RZ0B 2CBDA 1FQMA 1YO2A 4ZWYA 1OKLA 1DMYA 4Q7SA 9CA2A 5C8IA 4RN4A 4MLXA 3P3JA 4K13A 2NNOA 4Q0LA 4WR7A 3M96A 1HECA 5DOHA 1A42A 3RG3A 4CNVA 1G3ZA 5DSRA 4KUWA 5SZ6A 4X5SA 4Q99A 3KNEA 2O4ZA 1RZAA 4QJXA 2NNVA 4RIVA 1JD0A 3T84A 4E5QA 2HL4A 1YO1A 2EU3A 3DVDA 1KOPA 5EH8A 4ITPA 5FLTA 3D9ZA 4KUYA 1Y7WA 5DRSA 5FL6A 1Z93A 3N2PA 1CNCA 5HPJA 5DOGA 1KWQA 3L14A 3M67A 4PYYA 3MNUA 1G52A 5E2RA 1V9EA 4JSSA 5JDVB 5BNLA 1YO0A 1G46A 3NI5A 3RYZA 1BN4A 4ZX1A 5A6HA 3P4VA 3S9TA 3DBUA 2FOVA 2WD3A 2OSMA 3F8EA 1G6VA 3T82A 3U45X 3EFTA 3PO6A 4Q7VA 4HBAA 1UGBA 1TEQX 4CA2A 4MDGA 2WEGA 3RYXB 1CRMA 3KONA 4QK1A 4K0TA 3UYNA 4KNJA 3M1KA 3C7PA 3V3FA 1LZVA 3HLJA 2NWPA 4CACA 3CAJA 4G7AA 4WUQA 2ILIA 3CZVA 3R17B 3OYSA 3B4FA 4QK2A 4KP8A 3LXEA 5FLQA 1JV0A 1IF8A 2W2JA 3TVOX 3K34A 4RFCA 1UGCA 5E2NA 1HUHA 2NXTA 3S74B 4XZ5A 4KNMA 4CNWA 5FLPA 5JG3B 5JQ0A 4G0CA 4ZWIA 4HT2A 4PYXA 3RZ1B 4YGKA 3MNIA 2QO8A 5E2KA 5AMGA 1T9NA 3DCSA 4Q06A 3DAZA 2FW4A 3MHOA 4RUXA 2H15A 4K0SA 5SZ2A 1TEUX 4QEFA 2NNSA 4RFDA 5EH5A 3RJ7A 1ZSCA 1RAYA 1FQRA 12CAA 3DVBA 3KWAA 3V3JA 1ZSBA 1CNJA 4KAPA 5L3OA 1RZBA 1YDDA 1MUAA 4FVNA 4QJOA 1ZFKA 2Q38A 1URTA 1RAZA 3OIKA 3MNHA 4Q81A 5DSMA 3RZ8A 1CVDA 5FL4A 1RZCA 3SBHA 5BRUA 1CVAA 3V2JA 1ZNCA 4E4AA 6CA2A 4JSAA 1HEAA 4R5BA 4XFWA 3NB5A 5SZ4A 3MNKA 5CA2A 3ZP9A 1CZMA 4ZWZA 5JG5B 1TG3A 3S76A 4K0ZA 1TE3X 1HCBA 4MDLA 2EZ7A 1CNBA 3DVCA 4Z1EA 5EHWA 3SAXA 4RUZA 3V5GA 4WUPA 1HEBA 4M2VA 4FU5A 3V3IB 5G03A 3VBDA 2FMZA 1ZSAA 4Z1KA 1G45A 1YDCA 2POWA 1KEQA 3S77B 5JEGB 1CVFA 5SZ5A 4ZX0A 1CANA 2VVBX 4KP5A 5EKHA 1UGAA 5G0CA 3M5TA 3FE4A 5DSOA 4M2WA 2NWZA 1J9WA 4FVOA 5EKJA 1BNWA 3V3HB 1IF7A 4Y0JA 2FOYA 2VVAX 3MHCA 1CIMA 1BNQA 3F4XA 1LGDA 2CBCA 4CNXA 3HKNA 4HT0A 4TWMA 1XQ0A 3S8XA 5FNLA 1ZGEA 4TWLA 5FDIA 1CVBA 1CAIA 1CAHA 2NN7A 1IF5A 1I8ZA 3DD0A 3JXFA 1FQNA 1CVCA 4GL1X 4MTYA 3V3GB 4Q8ZA 2ABEA 5DVXA 4CQ0A 4HU1A 3BL1A 3KS3A 3RZ5A 1I90A 2CABA 1UGEA 1G53A 1TTMA 4Q6DA 5FL5A 3S72B 4Q7WA 4COQA 3NJ9A 1G1DA 4YGLA 2NNGA 2IT4A 4M2UA 5DSNA 3SBIA 3CA2A 1FSRA 1G48A 4WL4A 4QIZA 4Q7PA 3M3XA 1V9IC 3T85A 3DC3A 2EU2A 3DC9A 2WEOA 1FSNA 3ML5A 3IEOA 3KLDB 3P3HA 5SZ0A 4Q49A 5FNJA 2ZNCA 1ZE8A 1I9NA 3SAPA 3DCWA 1CAYA 2HNCA 1CILA 1I9PA 4YGFA 3UYQA 1XPZA 2NXSA 2AW1A 5SZ7A 4DZ7A 1CAJA 2Q1BA 1CCSA 1TH9A 3OY0A 3IBNA 4YWPA 5E2SA 2WD2A 1I91A 1MOOA 4HF3A 4ETQC 2CBBA 1I9MA 1FSQA 1RJ6A 2CA2A 3D93A 3KKXA 3N3JA 3P5AA 2NWOA 4KNIA 1HUGA 5L6KA 5E2MA 3IBIA 4ZWXA 4LHIA 1CALA 3M2XA 1AM6A 1RZEA 1YDBA 4HEWA 4Q08A 4HEYA 1UGFA 1KOQA 8CA2A 1ZH9A 3RYYA 4RIUA 1BNTA 3QYKA 3S97A 1BICA 3IBUA 5EKMA 4Q07A 5FLRA 5EIJA 3HFPA 4Q6EA 1CNKA 2H4NA 4ITOA 1CNIA 5E5RA 4M2RA 5BRVA 4ILXA 5FDCA 5FLOA 2NWYA 3GZ0A 5EOIA 4JSWA 5DSIA 1CNXA 4BF6A 1IF9A 3OYQA 1THKA 1YDAA 4R59A 4HEZA 2HKKA 4ZAOA 1OQ5A 2FOQA 4QJ0A 4C3TA 1CRAA 4YXIA 1CNWA 1HCAA 3RLDA 5E5UA 3K2FA 3T5ZA 3N4BA 5DSJA 2HD6A 4XIXA 3CYUA 4QSJA 4IDRX 4Z1JA 3M5EA 4MDMA 1LG6A 3F7BA 1G0FA 5EHVA 3RYJB 3OKVA 3KOIA 4LP6A 1KWRA 1DCAA 4YGJA 1CAZA 4YXUA 3MDZA 4L5UA 4QTLA 1CNYA 3HKUA 2QOAA 5EZTX 1BN1A 3U7CA 3RZ7A 3RG4A 4E3HA 3MWOA 4Q87A 4R5AA 4YXOA 1I9QA 1DCBA 2QP6A 3BL0A 3M1JA 3M1WA 1AVNA 3P58A 4QSBA 5EH7A 4PQ7A 3U47A 1HVAA 3M5SA 5AMDA 1UGDA 2GEHA 3P44A 1BNNA 2FNNA 3HS4A 2FMGA 4FL7A 3OKUA 3T5UA 1H4NA 3TMJA 4QSIA 1CNHA 5SZ1A 3S75B 4QJMA 4CNRA 4QY3A 5DSQA 3MZCA 1CA3A 1FR4A 2POUA 1BN3A 3M2NA 1F2WA 4MO8A 3ML2A 2HOCA 5BYIA 1CAMA 1XEVA 4RH2A 3ZNCA 3D92A 3N0NA 5G01A 4RUYA 2X7SA 1BV3A 5E28A 1I9OA 1UGGA 3PYKA 5FNIA 1ZFQA 4FIKA 4Q9YA 3B1BA 3M2YA 4YVYA 4E49A 1CAKA 3V2MA 2FOUA 3IGPA 3M14A 4YYTA 1CVHA 2FOSA 3JXHC 4YX4A 5JGSB 4Z1NA 3M04A 3HKTA 1DMXA 3S73B 3M40A 3D0NA 5FNGA 1LUGA 1AZMA 3P5LA 4E9OX 4Q78A 3MHMA 4JS6A 1FR7A 2CBAA 2CBEA 3MHLA 4IWZA 4UOVA 4YHAA 5EHEA 3V7XA 2GD8A 1TG9A 1G54A 5DSLA 1CINA 5SZ3A 4PZHA 4YGNA 5JQTA 4JSZA 5JGTB 3U3AX 4DZ9A 3KOKA 3DCCA 3FFPX 3MYQA 3FW3A 3DD8A 1XEGA 3T83A 3HKQA 1H9NA 3S78B 1CCUA 5G0BA 1ZGFA 3W6IA 5IPZA 1BZMA 3MNAA 3DV7A 2Q1QA 1RJ5A 3P55A 1Z97A 2OSFA 1HEDA 3MNJA 1Z9YA 3PJJA 1TB0X 4Z0QA 3M1QA 1FQLA 1CCTA 3F7UA 3W6HA 1G4OA 4L5VA 3BETA 4Q8XA 4N16A 1FLJA 5JESB 5FNKA 3RYVB 2WEJA 7CA2A 4Q83A 4MLTA 3DA2A 3M98A 5CLUA 5FNHA 1H9QA 5JEHB 3Q31A 4QK3A 3JXGA 4QJWA 4E3GA 2WEHA 3D8WA 4XIWA 3K7KA 1BNUA 1TBTX 2NXRA 4L5WA 3KIGA 4PXXA 4Q90A 4KV0A 5AMLA 4KNNA 4BCWA 1CAOA 3MHIA 5DSPA 2X7TA 3OIMA 4KUVA 4E3FA 4K1QA 2POVA 1CVEA 2AX2A 5FLSA 3EFIA 1I9LA 3R16A 4QSAA 5FNMA 4XE1A 5J8ZA 3S71B 5CACA 5CJFA 3M2ZA 1G4JA 1BNMA 4N0XB 3MMFA 3IAIA
chains in the Genus database with same CATH topology
1IF6A 1CNGA 5BRWA 4FRCA 5A25A 3TVNX 2FNMA 4FPTA 3IBLA 1G0EA 2F14A 4Q09A 1OKNA 4WW6A 1JCZA 1BCDA 4LU3A 3OILA 4Q8YA 1BNVA 2X7UA 4QIYA 2NMXA 5JEPB 5LMDA 1OKMA 5DSKA 4QJPA 1LG5A 1CA2A 1EOUA 2FNKA 1IF4A 2NN1A 3RGEA 1RZDA 4BF1A 4WW8A 4E3DA 2HFWA 3RZ0B 2CBDA 1FQMA 1YO2A 4ZWYA 1OKLA 1DMYA 4Q7SA 9CA2A 5C8IA 4RN4A 4MLXA 3P3JA 4K13A 2NNOA 4Q0LA 4WR7A 3M96A 1HECA 5DOHA 1A42A 3RG3A 4CNVA 1G3ZA 5DSRA 4KUWA 5SZ6A 4X5SA 4Q99A 3KNEA 2O4ZA 1RZAA 4QJXA 2NNVA 4RIVA 1JD0A 3T84A 4E5QA 2HL4A 1YO1A 2EU3A 3DVDA 1KOPA 5EH8A 4ITPA 5FLTA 3D9ZA 4KUYA 1Y7WA 5DRSA 5FL6A 1Z93A 3N2PA 1CNCA 5HPJA 5DOGA 1KWQA 3L14A 3M67A 4PYYA 3MNUA 1G52A 5E2RA 1V9EA 4JSSA 5JDVB 5BNLA 1YO0A 1G46A 3NI5A 3RYZA 1BN4A 4ZX1A 5A6HA 3P4VA 3S9TA 3DBUA 2FOVA 2WD3A 2OSMA 3F8EA 1G6VA 3T82A 3U45X 3EFTA 3PO6A 4Q7VA 4HBAA 1UGBA 1TEQX 4CA2A 4MDGA 2WEGA 3RYXB 1CRMA 3KONA 4QK1A 4K0TA 3UYNA 4KNJA 3M1KA 3C7PA 3V3FA 1LZVA 3HLJA 2NWPA 4CACA 3CAJA 4G7AA 4WUQA 2ILIA 3CZVA 3R17B 3OYSA 3B4FA 4QK2A 4KP8A 3LXEA 5FLQA 1JV0A 1IF8A 2W2JA 3TVOX 3K34A 4RFCA 1UGCA 5E2NA 1HUHA 2NXTA 3S74B 4XZ5A 4KNMA 4CNWA 5FLPA 5JG3B 5JQ0A 4G0CA 4ZWIA 4HT2A 4PYXA 3RZ1B 4YGKA 3MNIA 2QO8A 5E2KA 5AMGA 1T9NA 3DCSA 4Q06A 3DAZA 2FW4A 3MHOA 4RUXA 2H15A 4K0SA 5SZ2A 1TEUX 4QEFA 2NNSA 4RFDA 5EH5A 3RJ7A 1ZSCA 1RAYA 1FQRA 12CAA 3DVBA 3KWAA 3V3JA 1ZSBA 1CNJA 4KAPA 5L3OA 1RZBA 1YDDA 1MUAA 4FVNA 4QJOA 1ZFKA 2Q38A 1URTA 1RAZA 3OIKA 3MNHA 4Q81A 5DSMA 3RZ8A 1CVDA 5FL4A 1RZCA 3SBHA 5BRUA 1CVAA 3V2JA 1ZNCA 4E4AA 6CA2A 4JSAA 1HEAA 4R5BA 4XFWA 3NB5A 5SZ4A 3MNKA 5CA2A 3ZP9A 1CZMA 4ZWZA 5JG5B 1TG3A 3S76A 4K0ZA 1TE3X 1HCBA 4MDLA 2EZ7A 1CNBA 3DVCA 4Z1EA 5EHWA 3SAXA 4RUZA 3V5GA 4WUPA 1HEBA 4M2VA 4FU5A 3V3IB 5G03A 3VBDA 2FMZA 1ZSAA 4Z1KA 1G45A 1YDCA 2POWA 1KEQA 3S77B 5JEGB 1CVFA 5SZ5A 4ZX0A 1CANA 2VVBX 4KP5A 5EKHA 1UGAA 5G0CA 3M5TA 3FE4A 5DSOA 4M2WA 2NWZA 1J9WA 4FVOA 5EKJA 1BNWA 3V3HB 1IF7A 4Y0JA 2FOYA 2VVAX 3MHCA 1CIMA 1BNQA 3F4XA 1LGDA 2CBCA 4CNXA 3HKNA 4HT0A 4TWMA 1XQ0A 3S8XA 5FNLA 1ZGEA 4TWLA 5FDIA 1CVBA 1CAIA 1CAHA 2NN7A 1IF5A 1I8ZA 3DD0A 3JXFA 1FQNA 1CVCA 4GL1X 4MTYA 3V3GB 4Q8ZA 2ABEA 5DVXA 4CQ0A 4HU1A 3BL1A 3KS3A 3RZ5A 1I90A 2CABA 1UGEA 1G53A 1TTMA 4Q6DA 5FL5A 3S72B 4Q7WA 4COQA 3NJ9A 1G1DA 4YGLA 2NNGA 2IT4A 4M2UA 5DSNA 3SBIA 3CA2A 1FSRA 1G48A 4WL4A 4QIZA 4Q7PA 3M3XA 1V9IC 3T85A 3DC3A 2EU2A 3DC9A 2WEOA 1FSNA 3ML5A 3IEOA 3KLDB 3P3HA 5SZ0A 4Q49A 5FNJA 2ZNCA 1ZE8A 1I9NA 3SAPA 3DCWA 1CAYA 2HNCA 1CILA 1I9PA 4YGFA 3UYQA 1XPZA 2NXSA 2AW1A 5SZ7A 4DZ7A 1CAJA 2Q1BA 1CCSA 1TH9A 3OY0A 3IBNA 4YWPA 5E2SA 2WD2A 1I91A 1MOOA 4HF3A 4ETQC 2CBBA 1I9MA 1FSQA 1RJ6A 2CA2A 3D93A 3KKXA 3N3JA 3P5AA 2NWOA 4KNIA 1HUGA 5L6KA 5E2MA 3IBIA 4ZWXA 4LHIA 1CALA 3M2XA 1AM6A 1RZEA 1YDBA 4HEWA 4Q08A 4HEYA 1UGFA 1KOQA 8CA2A 1ZH9A 3RYYA 4RIUA 1BNTA 3QYKA 3S97A 1BICA 3IBUA 5EKMA 4Q07A 5FLRA 5EIJA 3HFPA 4Q6EA 1CNKA 2H4NA 4ITOA 1CNIA 5E5RA 4M2RA 5BRVA 4ILXA 5FDCA 5FLOA 2NWYA 3GZ0A 5EOIA 4JSWA 5DSIA 1CNXA 4BF6A 1IF9A 3OYQA 1THKA 1YDAA 4R59A 4HEZA 2HKKA 4ZAOA 1OQ5A 2FOQA 4QJ0A 4C3TA 1CRAA 4YXIA 1CNWA 1HCAA 3RLDA 5E5UA 3K2FA 3T5ZA 3N4BA 5DSJA 2HD6A 4XIXA 3CYUA 4QSJA 4IDRX 4Z1JA 3M5EA 4MDMA 1LG6A 3F7BA 1G0FA 5EHVA 3RYJB 3OKVA 3KOIA 4LP6A 1KWRA 1DCAA 4YGJA 1CAZA 4YXUA 3MDZA 4L5UA 4QTLA 1CNYA 3HKUA 2QOAA 5EZTX 1BN1A 3U7CA 3RZ7A 3RG4A 4E3HA 3MWOA 4Q87A 4R5AA 4YXOA 1I9QA 1DCBA 2QP6A 3BL0A 3M1JA 3M1WA 1AVNA 3P58A 4QSBA 5EH7A 4PQ7A 3U47A 1HVAA 3M5SA 5AMDA 1UGDA 2GEHA 3P44A 1BNNA 2FNNA 3HS4A 2FMGA 4FL7A 3OKUA 3T5UA 1H4NA 3TMJA 4QSIA 1CNHA 5SZ1A 3S75B 4QJMA 4CNRA 4QY3A 5DSQA 3MZCA 1CA3A 1FR4A 2POUA 1BN3A 3M2NA 1F2WA 4MO8A 3ML2A 2HOCA 5BYIA 1CAMA 1XEVA 4RH2A 3ZNCA 3D92A 3N0NA 5G01A 4RUYA 2X7SA 1BV3A 5E28A 1I9OA 1UGGA 3PYKA 5FNIA 1ZFQA 4FIKA 4Q9YA 3B1BA 3M2YA 4YVYA 4E49A 1CAKA 3V2MA 2FOUA 3IGPA 3M14A 4YYTA 1CVHA 2FOSA 3JXHC 4YX4A 5JGSB 4Z1NA 3M04A 3HKTA 1DMXA 3S73B 3M40A 3D0NA 5FNGA 1LUGA 1AZMA 3P5LA 4E9OX 4Q78A 3MHMA 4JS6A 1FR7A 2CBAA 2CBEA 3MHLA 4IWZA 4UOVA 4YHAA 5EHEA 3V7XA 2GD8A 1TG9A 1G54A 5DSLA 1CINA 5SZ3A 4PZHA 4YGNA 5JQTA 4JSZA 5JGTB 3U3AX 4DZ9A 3KOKA 3DCCA 3FFPX 3MYQA 3FW3A 3DD8A 1XEGA 3T83A 3HKQA 1H9NA 3S78B 1CCUA 5G0BA 1ZGFA 3W6IA 5IPZA 1BZMA 3MNAA 3DV7A 2Q1QA 1RJ5A 3P55A 1Z97A 2OSFA 1HEDA 3MNJA 1Z9YA 3PJJA 1TB0X 4Z0QA 3M1QA 1FQLA 1CCTA 3F7UA 3W6HA 1G4OA 4L5VA 3BETA 4Q8XA 4N16A 1FLJA 5JESB 5FNKA 3RYVB 2WEJA 7CA2A 4Q83A 4MLTA 3DA2A 3M98A 5CLUA 5FNHA 1H9QA 5JEHB 3Q31A 4QK3A 3JXGA 4QJWA 4E3GA 2WEHA 3D8WA 4XIWA 3K7KA 1BNUA 1TBTX 2NXRA 4L5WA 3KIGA 4PXXA 4Q90A 4KV0A 5AMLA 4KNNA 4BCWA 1CAOA 3MHIA 5DSPA 2X7TA 3OIMA 4KUVA 4E3FA 4K1QA 2POVA 1CVEA 2AX2A 5FLSA 3EFIA 1I9LA 3R16A 4QSAA 5FNMA 4XE1A 5J8ZA 3S71B 5CACA 5CJFA 3M2ZA 1G4JA 1BNMA 4N0XB 3MMFA 3IAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IF6 A;  1CNG A;  5BRW A;  4FRC A;  5A25 A;  3TVN X;  2FNM A;  4FPT A;  3IBL A;  1G0E A;  2F14 A;  4Q09 A;  1OKN A;  4WW6 A;  1JCZ A;  1BCD A;  4LU3 A;  3OIL A;  4Q8Y A;  1BNV A;  2X7U A;  4QIY A;  2NMX A;  5JEP B;  5LMD A;  1OKM A;  5DSK A;  4QJP A;  1LG5 A;  1CA2 A;  1EOU A;  2FNK A;  1IF4 A;  2NN1 A;  3RGE A;  1RZD A;  4BF1 A;  4WW8 A;  4E3D A;  2HFW A;  3RZ0 B;  2CBD A;  1FQM A;  1YO2 A;  4ZWY A;  1OKL A;  1DMY A;  4Q7S A;  9CA2 A;  5C8I A;  4RN4 A;  4MLX A;  3P3J A;  4K13 A;  2NNO A;  4Q0L A;  4WR7 A;  3M96 A;  1HEC A;  5DOH A;  1A42 A;  3RG3 A;  4CNV A;  1G3Z A;  5DSR A;  4KUW A;  5SZ6 A;  4X5S A;  4Q99 A;  3KNE A;  2O4Z A;  1RZA A;  4QJX A;  2NNV A;  4RIV A;  1JD0 A;  3T84 A;  4E5Q A;  2HL4 A;  1YO1 A;  2EU3 A;  3DVD A;  1KOP A;  5EH8 A;  4ITP A;  5FLT A;  3D9Z A;  4KUY A;  1Y7W A;  5DRS A;  5FL6 A;  1Z93 A;  3N2P A;  1CNC A;  5HPJ A;  5DOG A;  1KWQ A;  3L14 A;  3M67 A;  4PYY A;  3MNU A;  1G52 A;  5E2R A;  1V9E A;  4JSS A;  5JDV B;  5BNL A;  1YO0 A;  1G46 A;  3NI5 A;  3RYZ A;  1BN4 A;  4ZX1 A;  5A6H A;  3P4V A;  3S9T A;  3DBU A;  2FOV A;  2WD3 A;  2OSM A;  3F8E A;  1G6V A;  3T82 A;  3U45 X;  3EFT A;  3PO6 A;  4Q7V A;  4HBA A;  1UGB A;  1TEQ X;  4CA2 A;  4MDG A;  2WEG A;  3RYX B;  1CRM A;  3KON A;  4QK1 A;  4K0T A;  3UYN A;  4KNJ A;  3M1K A;  3C7P A;  3V3F A;  1LZV A;  3HLJ A;  2NWP A;  4CAC A;  3CAJ A;  4G7A A;  4WUQ A;  2ILI A;  3CZV A;  3R17 B;  3OYS A;  3B4F A;  4QK2 A;  4KP8 A;  3LXE A;  5FLQ A;  1JV0 A;  1IF8 A;  2W2J A;  3TVO X;  3K34 A;  4RFC A;  1UGC A;  5E2N A;  1HUH A;  2NXT A;  3S74 B;  4XZ5 A;  4KNM A;  4CNW A;  5FLP A;  5JG3 B;  5JQ0 A;  4G0C A;  4ZWI A;  4HT2 A;  4PYX A;  3RZ1 B;  4YGK A;  3MNI A;  2QO8 A;  5E2K A;  5AMG A;  1T9N A;  3DCS A;  4Q06 A;  3DAZ A;  2FW4 A;  3MHO A;  4RUX A;  2H15 A;  4K0S A;  5SZ2 A;  1TEU X;  4QEF A;  2NNS A;  4RFD A;  5EH5 A;  3RJ7 A;  1ZSC A;  1RAY A;  1FQR A;  12CA A;  3DVB A;  3KWA A;  3V3J A;  1ZSB A;  1CNJ A;  4KAP A;  5L3O A;  1RZB A;  1YDD A;  1MUA A;  4FVN A;  4QJO A;  1ZFK A;  2Q38 A;  1URT A;  1RAZ A;  3OIK A;  3MNH A;  4Q81 A;  5DSM A;  3RZ8 A;  1CVD A;  5FL4 A;  1RZC A;  3SBH A;  5BRU A;  1CVA A;  3V2J A;  1ZNC A;  4E4A A;  6CA2 A;  4JSA A;  1HEA A;  4R5B A;  4XFW A;  3NB5 A;  5SZ4 A;  3MNK A;  5CA2 A;  3ZP9 A;  1CZM A;  4ZWZ A;  5JG5 B;  1TG3 A;  3S76 A;  4K0Z A;  1TE3 X;  1HCB A;  4MDL A;  2EZ7 A;  1CNB A;  3DVC A;  4Z1E A;  5EHW A;  3SAX A;  4RUZ A;  3V5G A;  4WUP A;  1HEB A;  4M2V A;  4FU5 A;  3V3I B;  5G03 A;  3VBD A;  2FMZ A;  1ZSA A;  4Z1K A;  1G45 A;  1YDC A;  2POW A;  1KEQ A;  3S77 B;  5JEG B;  1CVF A;  5SZ5 A;  4ZX0 A;  1CAN A;  2VVB X;  4KP5 A;  5EKH A;  1UGA A;  5G0C A;  3M5T A;  3FE4 A;  5DSO A;  4M2W A;  2NWZ A;  1J9W A;  4FVO A;  5EKJ A;  1BNW A;  3V3H B;  1IF7 A;  4Y0J A;  2FOY A;  2VVA X;  3MHC A;  1CIM A;  1BNQ A;  3F4X A;  1LGD A;  2CBC A;  4CNX A;  3HKN A;  4HT0 A;  4TWM A;  1XQ0 A;  3S8X A;  5FNL A;  1ZGE A;  4TWL A;  5FDI A;  1CVB A;  1CAI A;  1CAH A;  2NN7 A;  1IF5 A;  1I8Z A;  3DD0 A;  3JXF A;  1FQN A;  1CVC A;  4GL1 X;  4MTY A;  3V3G B;  4Q8Z A;  2ABE A;  5DVX A;  4CQ0 A;  4HU1 A;  3BL1 A;  3KS3 A;  3RZ5 A;  1I90 A;  2CAB A;  1UGE A;  1G53 A;  1TTM A;  4Q6D A;  5FL5 A;  3S72 B;  4Q7W A;  4COQ A;  3NJ9 A;  1G1D A;  4YGL A;  2NNG A;  2IT4 A;  4M2U A;  5DSN A;  3SBI A;  3CA2 A;  1FSR A;  1G48 A;  4WL4 A;  4QIZ A;  4Q7P A;  3M3X A;  1V9I C;  3T85 A;  3DC3 A;  2EU2 A;  3DC9 A;  2WEO A;  1FSN A;  3ML5 A;  3IEO A;  3KLD B;  3P3H A;  5SZ0 A;  4Q49 A;  5FNJ A;  2ZNC A;  1ZE8 A;  1I9N A;  3SAP A;  3DCW A;  1CAY A;  2HNC A;  1CIL A;  1I9P A;  4YGF A;  3UYQ A;  1XPZ A;  2NXS A;  2AW1 A;  5SZ7 A;  4DZ7 A;  1CAJ A;  2Q1B A;  1CCS A;  1TH9 A;  3OY0 A;  3IBN A;  4YWP A;  5E2S A;  2WD2 A;  1I91 A;  1MOO A;  4HF3 A;  4ETQ C;  2CBB A;  1I9M A;  1FSQ A;  1RJ6 A;  2CA2 A;  3D93 A;  3KKX A;  3N3J A;  3P5A A;  2NWO A;  4KNI A;  1HUG A;  5L6K A;  5E2M A;  3IBI A;  4ZWX A;  4LHI A;  1CAL A;  3M2X A;  1AM6 A;  1RZE A;  1YDB A;  4HEW A;  4Q08 A;  4HEY A;  1UGF A;  1KOQ A;  8CA2 A;  1ZH9 A;  3RYY A;  4RIU A;  1BNT A;  3QYK A;  3S97 A;  1BIC A;  3IBU A;  5EKM A;  4Q07 A;  5FLR A;  5EIJ A;  3HFP A;  4Q6E A;  1CNK A;  2H4N A;  4ITO A;  1CNI A;  5E5R A;  4M2R A;  5BRV A;  4ILX A;  5FDC A;  5FLO A;  2NWY A;  3GZ0 A;  5EOI A;  4JSW A;  5DSI A;  1CNX A;  4BF6 A;  1IF9 A;  3OYQ A;  1THK A;  1YDA A;  4R59 A;  4HEZ A;  2HKK A;  4ZAO A;  1OQ5 A;  2FOQ A;  4QJ0 A;  4C3T A;  1CRA A;  4YXI A;  1CNW A;  1HCA A;  3RLD A;  5E5U A;  3K2F A;  3T5Z A;  3N4B A;  5DSJ A;  2HD6 A;  4XIX A;  3CYU A;  4QSJ A;  4IDR X;  4Z1J A;  3M5E A;  4MDM A;  1LG6 A;  3F7B A;  1G0F A;  5EHV A;  3RYJ B;  3OKV A;  3KOI A;  4LP6 A;  1KWR A;  1DCA A;  4YGJ A;  1CAZ A;  4YXU A;  3MDZ A;  4L5U A;  4QTL A;  1CNY A;  3HKU A;  2QOA A;  5EZT X;  1BN1 A;  3U7C A;  3RZ7 A;  3RG4 A;  4E3H A;  3MWO A;  4Q87 A;  4R5A A;  4YXO A;  1I9Q A;  1DCB A;  2QP6 A;  3BL0 A;  3M1J A;  3M1W A;  1AVN A;  3P58 A;  4QSB A;  5EH7 A;  4PQ7 A;  3U47 A;  1HVA A;  3M5S A;  5AMD A;  1UGD A;  2GEH A;  3P44 A;  1BNN A;  2FNN A;  3HS4 A;  2FMG A;  4FL7 A;  3OKU A;  3T5U A;  1H4N A;  3TMJ A;  4QSI A;  1CNH A;  5SZ1 A;  3S75 B;  4QJM A;  4CNR A;  4QY3 A;  5DSQ A;  3MZC A;  1CA3 A;  1FR4 A;  2POU A;  1BN3 A;  3M2N A;  1F2W A;  4MO8 A;  3ML2 A;  2HOC A;  5BYI A;  1CAM A;  1XEV A;  4RH2 A;  3ZNC A;  3D92 A;  3N0N A;  5G01 A;  4RUY A;  2X7S A;  1BV3 A;  5E28 A;  1I9O A;  1UGG A;  3PYK A;  5FNI A;  1ZFQ A;  4FIK A;  4Q9Y A;  3B1B A;  3M2Y A;  4YVY A;  4E49 A;  1CAK A;  3V2M A;  2FOU A;  3IGP A;  3M14 A;  4YYT A;  1CVH A;  2FOS A;  3JXH C;  4YX4 A;  5JGS B;  4Z1N A;  3M04 A;  3HKT A;  1DMX A;  3S73 B;  3M40 A;  3D0N A;  5FNG A;  1LUG A;  1AZM A;  3P5L A;  4E9O X;  4Q78 A;  3MHM A;  4JS6 A;  1FR7 A;  2CBA A;  2CBE A;  3MHL A;  4IWZ A;  4UOV A;  4YHA A;  5EHE A;  3V7X A;  2GD8 A;  1TG9 A;  1G54 A;  5DSL A;  1CIN A;  5SZ3 A;  4PZH A;  4YGN A;  5JQT A;  4JSZ A;  5JGT B;  3U3A X;  4DZ9 A;  3KOK A;  3DCC A;  3FFP X;  3MYQ A;  3FW3 A;  3DD8 A;  1XEG A;  3T83 A;  3HKQ A;  1H9N A;  3S78 B;  1CCU A;  5G0B A;  1ZGF A;  3W6I A;  5IPZ A;  1BZM A;  3MNA A;  3DV7 A;  2Q1Q A;  1RJ5 A;  3P55 A;  1Z97 A;  2OSF A;  1HED A;  3MNJ A;  1Z9Y A;  3PJJ A;  1TB0 X;  4Z0Q A;  3M1Q A;  1FQL A;  1CCT A;  3F7U A;  3W6H A;  1G4O A;  4L5V A;  3BET A;  4Q8X A;  4N16 A;  1FLJ A;  5JES B;  5FNK A;  3RYV B;  2WEJ A;  7CA2 A;  4Q83 A;  4MLT A;  3DA2 A;  3M98 A;  5CLU A;  5FNH A;  1H9Q A;  5JEH B;  3Q31 A;  4QK3 A;  3JXG A;  4QJW A;  4E3G A;  2WEH A;  3D8W A;  4XIW A;  3K7K A;  1BNU A;  1TBT X;  2NXR A;  4L5W A;  3KIG A;  4PXX A;  4Q90 A;  4KV0 A;  5AML A;  4KNN A;  4BCW A;  1CAO A;  3MHI A;  5DSP A;  2X7T A;  3OIM A;  4KUV A;  4E3F A;  4K1Q A;  2POV A;  1CVE A;  2AX2 A;  5FLS A;  3EFI A;  1I9L A;  3R16 A;  4QSA A;  5FNM A;  4XE1 A;  5J8Z A;  3S71 B;  5CAC A;  5CJF A;  3M2Z A;  1G4J A;  1BNM A;  4N0X B;  3MMF A;  3IAI A; 
#chains in the Genus database with same CATH topology
 1IF6 A;  1CNG A;  5BRW A;  4FRC A;  5A25 A;  3TVN X;  2FNM A;  4FPT A;  3IBL A;  1G0E A;  2F14 A;  4Q09 A;  1OKN A;  4WW6 A;  1JCZ A;  1BCD A;  4LU3 A;  3OIL A;  4Q8Y A;  1BNV A;  2X7U A;  4QIY A;  2NMX A;  5JEP B;  5LMD A;  1OKM A;  5DSK A;  4QJP A;  1LG5 A;  1CA2 A;  1EOU A;  2FNK A;  1IF4 A;  2NN1 A;  3RGE A;  1RZD A;  4BF1 A;  4WW8 A;  4E3D A;  2HFW A;  3RZ0 B;  2CBD A;  1FQM A;  1YO2 A;  4ZWY A;  1OKL A;  1DMY A;  4Q7S A;  9CA2 A;  5C8I A;  4RN4 A;  4MLX A;  3P3J A;  4K13 A;  2NNO A;  4Q0L A;  4WR7 A;  3M96 A;  1HEC A;  5DOH A;  1A42 A;  3RG3 A;  4CNV A;  1G3Z A;  5DSR A;  4KUW A;  5SZ6 A;  4X5S A;  4Q99 A;  3KNE A;  2O4Z A;  1RZA A;  4QJX A;  2NNV A;  4RIV A;  1JD0 A;  3T84 A;  4E5Q A;  2HL4 A;  1YO1 A;  2EU3 A;  3DVD A;  1KOP A;  5EH8 A;  4ITP A;  5FLT A;  3D9Z A;  4KUY A;  1Y7W A;  5DRS A;  5FL6 A;  1Z93 A;  3N2P A;  1CNC A;  5HPJ A;  5DOG A;  1KWQ A;  3L14 A;  3M67 A;  4PYY A;  3MNU A;  1G52 A;  5E2R A;  1V9E A;  4JSS A;  5JDV B;  5BNL A;  1YO0 A;  1G46 A;  3NI5 A;  3RYZ A;  1BN4 A;  4ZX1 A;  5A6H A;  3P4V A;  3S9T A;  3DBU A;  2FOV A;  2WD3 A;  2OSM A;  3F8E A;  1G6V A;  3T82 A;  3U45 X;  3EFT A;  3PO6 A;  4Q7V A;  4HBA A;  1UGB A;  1TEQ X;  4CA2 A;  4MDG A;  2WEG A;  3RYX B;  1CRM A;  3KON A;  4QK1 A;  4K0T A;  3UYN A;  4KNJ A;  3M1K A;  3C7P A;  3V3F A;  1LZV A;  3HLJ A;  2NWP A;  4CAC A;  3CAJ A;  4G7A A;  4WUQ A;  2ILI A;  3CZV A;  3R17 B;  3OYS A;  3B4F A;  4QK2 A;  4KP8 A;  3LXE A;  5FLQ A;  1JV0 A;  1IF8 A;  2W2J A;  3TVO X;  3K34 A;  4RFC A;  1UGC A;  5E2N A;  1HUH A;  2NXT A;  3S74 B;  4XZ5 A;  4KNM A;  4CNW A;  5FLP A;  5JG3 B;  5JQ0 A;  4G0C A;  4ZWI A;  4HT2 A;  4PYX A;  3RZ1 B;  4YGK A;  3MNI A;  2QO8 A;  5E2K A;  5AMG A;  1T9N A;  3DCS A;  4Q06 A;  3DAZ A;  2FW4 A;  3MHO A;  4RUX A;  2H15 A;  4K0S A;  5SZ2 A;  1TEU X;  4QEF A;  2NNS A;  4RFD A;  5EH5 A;  3RJ7 A;  1ZSC A;  1RAY A;  1FQR A;  12CA A;  3DVB A;  3KWA A;  3V3J A;  1ZSB A;  1CNJ A;  4KAP A;  5L3O A;  1RZB A;  1YDD A;  1MUA A;  4FVN A;  4QJO A;  1ZFK A;  2Q38 A;  1URT A;  1RAZ A;  3OIK A;  3MNH A;  4Q81 A;  5DSM A;  3RZ8 A;  1CVD A;  5FL4 A;  1RZC A;  3SBH A;  5BRU A;  1CVA A;  3V2J A;  1ZNC A;  4E4A A;  6CA2 A;  4JSA A;  1HEA A;  4R5B A;  4XFW A;  3NB5 A;  5SZ4 A;  3MNK A;  5CA2 A;  3ZP9 A;  1CZM A;  4ZWZ A;  5JG5 B;  1TG3 A;  3S76 A;  4K0Z A;  1TE3 X;  1HCB A;  4MDL A;  2EZ7 A;  1CNB A;  3DVC A;  4Z1E A;  5EHW A;  3SAX A;  4RUZ A;  3V5G A;  4WUP A;  1HEB A;  4M2V A;  4FU5 A;  3V3I B;  5G03 A;  3VBD A;  2FMZ A;  1ZSA A;  4Z1K A;  1G45 A;  1YDC A;  2POW A;  1KEQ A;  3S77 B;  5JEG B;  1CVF A;  5SZ5 A;  4ZX0 A;  1CAN A;  2VVB X;  4KP5 A;  5EKH A;  1UGA A;  5G0C A;  3M5T A;  3FE4 A;  5DSO A;  4M2W A;  2NWZ A;  1J9W A;  4FVO A;  5EKJ A;  1BNW A;  3V3H B;  1IF7 A;  4Y0J A;  2FOY A;  2VVA X;  3MHC A;  1CIM A;  1BNQ A;  3F4X A;  1LGD A;  2CBC A;  4CNX A;  3HKN A;  4HT0 A;  4TWM A;  1XQ0 A;  3S8X A;  5FNL A;  1ZGE A;  4TWL A;  5FDI A;  1CVB A;  1CAI A;  1CAH A;  2NN7 A;  1IF5 A;  1I8Z A;  3DD0 A;  3JXF A;  1FQN A;  1CVC A;  4GL1 X;  4MTY A;  3V3G B;  4Q8Z A;  2ABE A;  5DVX A;  4CQ0 A;  4HU1 A;  3BL1 A;  3KS3 A;  3RZ5 A;  1I90 A;  2CAB A;  1UGE A;  1G53 A;  1TTM A;  4Q6D A;  5FL5 A;  3S72 B;  4Q7W A;  4COQ A;  3NJ9 A;  1G1D A;  4YGL A;  2NNG A;  2IT4 A;  4M2U A;  5DSN A;  3SBI A;  3CA2 A;  1FSR A;  1G48 A;  4WL4 A;  4QIZ A;  4Q7P A;  3M3X A;  1V9I C;  3T85 A;  3DC3 A;  2EU2 A;  3DC9 A;  2WEO A;  1FSN A;  3ML5 A;  3IEO A;  3KLD B;  3P3H A;  5SZ0 A;  4Q49 A;  5FNJ A;  2ZNC A;  1ZE8 A;  1I9N A;  3SAP A;  3DCW A;  1CAY A;  2HNC A;  1CIL A;  1I9P A;  4YGF A;  3UYQ A;  1XPZ A;  2NXS A;  2AW1 A;  5SZ7 A;  4DZ7 A;  1CAJ A;  2Q1B A;  1CCS A;  1TH9 A;  3OY0 A;  3IBN A;  4YWP A;  5E2S A;  2WD2 A;  1I91 A;  1MOO A;  4HF3 A;  4ETQ C;  2CBB A;  1I9M A;  1FSQ A;  1RJ6 A;  2CA2 A;  3D93 A;  3KKX A;  3N3J A;  3P5A A;  2NWO A;  4KNI A;  1HUG A;  5L6K A;  5E2M A;  3IBI A;  4ZWX A;  4LHI A;  1CAL A;  3M2X A;  1AM6 A;  1RZE A;  1YDB A;  4HEW A;  4Q08 A;  4HEY A;  1UGF A;  1KOQ A;  8CA2 A;  1ZH9 A;  3RYY A;  4RIU A;  1BNT A;  3QYK A;  3S97 A;  1BIC A;  3IBU A;  5EKM A;  4Q07 A;  5FLR A;  5EIJ A;  3HFP A;  4Q6E A;  1CNK A;  2H4N A;  4ITO A;  1CNI A;  5E5R A;  4M2R A;  5BRV A;  4ILX A;  5FDC A;  5FLO A;  2NWY A;  3GZ0 A;  5EOI A;  4JSW A;  5DSI A;  1CNX A;  4BF6 A;  1IF9 A;  3OYQ A;  1THK A;  1YDA A;  4R59 A;  4HEZ A;  2HKK A;  4ZAO A;  1OQ5 A;  2FOQ A;  4QJ0 A;  4C3T A;  1CRA A;  4YXI A;  1CNW A;  1HCA A;  3RLD A;  5E5U A;  3K2F A;  3T5Z A;  3N4B A;  5DSJ A;  2HD6 A;  4XIX A;  3CYU A;  4QSJ A;  4IDR X;  4Z1J A;  3M5E A;  4MDM A;  1LG6 A;  3F7B A;  1G0F A;  5EHV A;  3RYJ B;  3OKV A;  3KOI A;  4LP6 A;  1KWR A;  1DCA A;  4YGJ A;  1CAZ A;  4YXU A;  3MDZ A;  4L5U A;  4QTL A;  1CNY A;  3HKU A;  2QOA A;  5EZT X;  1BN1 A;  3U7C A;  3RZ7 A;  3RG4 A;  4E3H A;  3MWO A;  4Q87 A;  4R5A A;  4YXO A;  1I9Q A;  1DCB A;  2QP6 A;  3BL0 A;  3M1J A;  3M1W A;  1AVN A;  3P58 A;  4QSB A;  5EH7 A;  4PQ7 A;  3U47 A;  1HVA A;  3M5S A;  5AMD A;  1UGD A;  2GEH A;  3P44 A;  1BNN A;  2FNN A;  3HS4 A;  2FMG A;  4FL7 A;  3OKU A;  3T5U A;  1H4N A;  3TMJ A;  4QSI A;  1CNH A;  5SZ1 A;  3S75 B;  4QJM A;  4CNR A;  4QY3 A;  5DSQ A;  3MZC A;  1CA3 A;  1FR4 A;  2POU A;  1BN3 A;  3M2N A;  1F2W A;  4MO8 A;  3ML2 A;  2HOC A;  5BYI A;  1CAM A;  1XEV A;  4RH2 A;  3ZNC A;  3D92 A;  3N0N A;  5G01 A;  4RUY A;  2X7S A;  1BV3 A;  5E28 A;  1I9O A;  1UGG A;  3PYK A;  5FNI A;  1ZFQ A;  4FIK A;  4Q9Y A;  3B1B A;  3M2Y A;  4YVY A;  4E49 A;  1CAK A;  3V2M A;  2FOU A;  3IGP A;  3M14 A;  4YYT A;  1CVH A;  2FOS A;  3JXH C;  4YX4 A;  5JGS B;  4Z1N A;  3M04 A;  3HKT A;  1DMX A;  3S73 B;  3M40 A;  3D0N A;  5FNG A;  1LUG A;  1AZM A;  3P5L A;  4E9O X;  4Q78 A;  3MHM A;  4JS6 A;  1FR7 A;  2CBA A;  2CBE A;  3MHL A;  4IWZ A;  4UOV A;  4YHA A;  5EHE A;  3V7X A;  2GD8 A;  1TG9 A;  1G54 A;  5DSL A;  1CIN A;  5SZ3 A;  4PZH A;  4YGN A;  5JQT A;  4JSZ A;  5JGT B;  3U3A X;  4DZ9 A;  3KOK A;  3DCC A;  3FFP X;  3MYQ A;  3FW3 A;  3DD8 A;  1XEG A;  3T83 A;  3HKQ A;  1H9N A;  3S78 B;  1CCU A;  5G0B A;  1ZGF A;  3W6I A;  5IPZ A;  1BZM A;  3MNA A;  3DV7 A;  2Q1Q A;  1RJ5 A;  3P55 A;  1Z97 A;  2OSF A;  1HED A;  3MNJ A;  1Z9Y A;  3PJJ A;  1TB0 X;  4Z0Q A;  3M1Q A;  1FQL A;  1CCT A;  3F7U A;  3W6H A;  1G4O A;  4L5V A;  3BET A;  4Q8X A;  4N16 A;  1FLJ A;  5JES B;  5FNK A;  3RYV B;  2WEJ A;  7CA2 A;  4Q83 A;  4MLT A;  3DA2 A;  3M98 A;  5CLU A;  5FNH A;  1H9Q A;  5JEH B;  3Q31 A;  4QK3 A;  3JXG A;  4QJW A;  4E3G A;  2WEH A;  3D8W A;  4XIW A;  3K7K A;  1BNU A;  1TBT X;  2NXR A;  4L5W A;  3KIG A;  4PXX A;  4Q90 A;  4KV0 A;  5AML A;  4KNN A;  4BCW A;  1CAO A;  3MHI A;  5DSP A;  2X7T A;  3OIM A;  4KUV A;  4E3F A;  4K1Q A;  2POV A;  1CVE A;  2AX2 A;  5FLS A;  3EFI A;  1I9L A;  3R16 A;  4QSA A;  5FNM A;  4XE1 A;  5J8Z A;  3S71 B;  5CAC A;  5CJF A;  3M2Z A;  1G4J A;  1BNM A;  4N0X B;  3MMF A;  3IAI A; 
#chains in the Genus database with same CATH homology
 1IF6 A;  1CNG A;  5BRW A;  4FRC A;  5A25 A;  3TVN X;  2FNM A;  4FPT A;  3IBL A;  1G0E A;  2F14 A;  4Q09 A;  1OKN A;  4WW6 A;  1JCZ A;  1BCD A;  4LU3 A;  3OIL A;  4Q8Y A;  1BNV A;  2X7U A;  4QIY A;  2NMX A;  5JEP B;  5LMD A;  1OKM A;  5DSK A;  4QJP A;  1LG5 A;  1CA2 A;  1EOU A;  2FNK A;  1IF4 A;  2NN1 A;  3RGE A;  1RZD A;  4BF1 A;  4WW8 A;  4E3D A;  2HFW A;  3RZ0 B;  2CBD A;  1FQM A;  1YO2 A;  4ZWY A;  1OKL A;  1DMY A;  4Q7S A;  9CA2 A;  5C8I A;  4RN4 A;  4MLX A;  3P3J A;  4K13 A;  2NNO A;  4Q0L A;  4WR7 A;  3M96 A;  1HEC A;  5DOH A;  1A42 A;  3RG3 A;  4CNV A;  1G3Z A;  5DSR A;  4KUW A;  5SZ6 A;  4X5S A;  4Q99 A;  3KNE A;  2O4Z A;  1RZA A;  4QJX A;  2NNV A;  4RIV A;  1JD0 A;  3T84 A;  4E5Q A;  2HL4 A;  1YO1 A;  2EU3 A;  3DVD A;  1KOP A;  5EH8 A;  4ITP A;  5FLT A;  3D9Z A;  4KUY A;  1Y7W A;  5DRS A;  5FL6 A;  1Z93 A;  3N2P A;  1CNC A;  5HPJ A;  5DOG A;  1KWQ A;  3L14 A;  3M67 A;  4PYY A;  3MNU A;  1G52 A;  5E2R A;  1V9E A;  4JSS A;  5JDV B;  5BNL A;  1YO0 A;  1G46 A;  3NI5 A;  3RYZ A;  1BN4 A;  4ZX1 A;  5A6H A;  3P4V A;  3S9T A;  3DBU A;  2FOV A;  2WD3 A;  2OSM A;  3F8E A;  1G6V A;  3T82 A;  3U45 X;  3EFT A;  3PO6 A;  4Q7V A;  4HBA A;  1UGB A;  1TEQ X;  4CA2 A;  4MDG A;  2WEG A;  3RYX B;  1CRM A;  3KON A;  4QK1 A;  4K0T A;  3UYN A;  4KNJ A;  3M1K A;  3C7P A;  3V3F A;  1LZV A;  3HLJ A;  2NWP A;  4CAC A;  3CAJ A;  4G7A A;  4WUQ A;  2ILI A;  3CZV A;  3R17 B;  3OYS A;  3B4F A;  4QK2 A;  4KP8 A;  3LXE A;  5FLQ A;  1JV0 A;  1IF8 A;  2W2J A;  3TVO X;  3K34 A;  4RFC A;  1UGC A;  5E2N A;  1HUH A;  2NXT A;  3S74 B;  4XZ5 A;  4KNM A;  4CNW A;  5FLP A;  5JG3 B;  5JQ0 A;  4G0C A;  4ZWI A;  4HT2 A;  4PYX A;  3RZ1 B;  4YGK A;  3MNI A;  2QO8 A;  5E2K A;  5AMG A;  1T9N A;  3DCS A;  4Q06 A;  3DAZ A;  2FW4 A;  3MHO A;  4RUX A;  2H15 A;  4K0S A;  5SZ2 A;  1TEU X;  4QEF A;  2NNS A;  4RFD A;  5EH5 A;  3RJ7 A;  1ZSC A;  1RAY A;  1FQR A;  12CA A;  3DVB A;  3KWA A;  3V3J A;  1ZSB A;  1CNJ A;  4KAP A;  5L3O A;  1RZB A;  1YDD A;  1MUA A;  4FVN A;  4QJO A;  1ZFK A;  2Q38 A;  1URT A;  1RAZ A;  3OIK A;  3MNH A;  4Q81 A;  5DSM A;  3RZ8 A;  1CVD A;  5FL4 A;  1RZC A;  3SBH A;  5BRU A;  1CVA A;  3V2J A;  1ZNC A;  4E4A A;  6CA2 A;  4JSA A;  1HEA A;  4R5B A;  4XFW A;  3NB5 A;  5SZ4 A;  3MNK A;  5CA2 A;  3ZP9 A;  1CZM A;  4ZWZ A;  5JG5 B;  1TG3 A;  3S76 A;  4K0Z A;  1TE3 X;  1HCB A;  4MDL A;  2EZ7 A;  1CNB A;  3DVC A;  4Z1E A;  5EHW A;  3SAX A;  4RUZ A;  3V5G A;  4WUP A;  1HEB A;  4M2V A;  4FU5 A;  3V3I B;  5G03 A;  3VBD A;  2FMZ A;  1ZSA A;  4Z1K A;  1G45 A;  1YDC A;  2POW A;  1KEQ A;  3S77 B;  5JEG B;  1CVF A;  5SZ5 A;  4ZX0 A;  1CAN A;  2VVB X;  4KP5 A;  5EKH A;  1UGA A;  5G0C A;  3M5T A;  3FE4 A;  5DSO A;  4M2W A;  2NWZ A;  1J9W A;  4FVO A;  5EKJ A;  1BNW A;  3V3H B;  1IF7 A;  4Y0J A;  2FOY A;  2VVA X;  3MHC A;  1CIM A;  1BNQ A;  3F4X A;  1LGD A;  2CBC A;  4CNX A;  3HKN A;  4HT0 A;  4TWM A;  1XQ0 A;  3S8X A;  5FNL A;  1ZGE A;  4TWL A;  5FDI A;  1CVB A;  1CAI A;  1CAH A;  2NN7 A;  1IF5 A;  1I8Z A;  3DD0 A;  3JXF A;  1FQN A;  1CVC A;  4GL1 X;  4MTY A;  3V3G B;  4Q8Z A;  2ABE A;  5DVX A;  4CQ0 A;  4HU1 A;  3BL1 A;  3KS3 A;  3RZ5 A;  1I90 A;  2CAB A;  1UGE A;  1G53 A;  1TTM A;  4Q6D A;  5FL5 A;  3S72 B;  4Q7W A;  4COQ A;  3NJ9 A;  1G1D A;  4YGL A;  2NNG A;  2IT4 A;  4M2U A;  5DSN A;  3SBI A;  3CA2 A;  1FSR A;  1G48 A;  4WL4 A;  4QIZ A;  4Q7P A;  3M3X A;  1V9I C;  3T85 A;  3DC3 A;  2EU2 A;  3DC9 A;  2WEO A;  1FSN A;  3ML5 A;  3IEO A;  3KLD B;  3P3H A;  5SZ0 A;  4Q49 A;  5FNJ A;  2ZNC A;  1ZE8 A;  1I9N A;  3SAP A;  3DCW A;  1CAY A;  2HNC A;  1CIL A;  1I9P A;  4YGF A;  3UYQ A;  1XPZ A;  2NXS A;  2AW1 A;  5SZ7 A;  4DZ7 A;  1CAJ A;  2Q1B A;  1CCS A;  1TH9 A;  3OY0 A;  3IBN A;  4YWP A;  5E2S A;  2WD2 A;  1I91 A;  1MOO A;  4HF3 A;  4ETQ C;  2CBB A;  1I9M A;  1FSQ A;  1RJ6 A;  2CA2 A;  3D93 A;  3KKX A;  3N3J A;  3P5A A;  2NWO A;  4KNI A;  1HUG A;  5L6K A;  5E2M A;  3IBI A;  4ZWX A;  4LHI A;  1CAL A;  3M2X A;  1AM6 A;  1RZE A;  1YDB A;  4HEW A;  4Q08 A;  4HEY A;  1UGF A;  1KOQ A;  8CA2 A;  1ZH9 A;  3RYY A;  4RIU A;  1BNT A;  3QYK A;  3S97 A;  1BIC A;  3IBU A;  5EKM A;  4Q07 A;  5FLR A;  5EIJ A;  3HFP A;  4Q6E A;  1CNK A;  2H4N A;  4ITO A;  1CNI A;  5E5R A;  4M2R A;  5BRV A;  4ILX A;  5FDC A;  5FLO A;  2NWY A;  3GZ0 A;  5EOI A;  4JSW A;  5DSI A;  1CNX A;  4BF6 A;  1IF9 A;  3OYQ A;  1THK A;  1YDA A;  4R59 A;  4HEZ A;  2HKK A;  4ZAO A;  1OQ5 A;  2FOQ A;  4QJ0 A;  4C3T A;  1CRA A;  4YXI A;  1CNW A;  1HCA A;  3RLD A;  5E5U A;  3K2F A;  3T5Z A;  3N4B A;  5DSJ A;  2HD6 A;  4XIX A;  3CYU A;  4QSJ A;  4IDR X;  4Z1J A;  3M5E A;  4MDM A;  1LG6 A;  3F7B A;  1G0F A;  5EHV A;  3RYJ B;  3OKV A;  3KOI A;  4LP6 A;  1KWR A;  1DCA A;  4YGJ A;  1CAZ A;  4YXU A;  3MDZ A;  4L5U A;  4QTL A;  1CNY A;  3HKU A;  2QOA A;  5EZT X;  1BN1 A;  3U7C A;  3RZ7 A;  3RG4 A;  4E3H A;  3MWO A;  4Q87 A;  4R5A A;  4YXO A;  1I9Q A;  1DCB A;  2QP6 A;  3BL0 A;  3M1J A;  3M1W A;  1AVN A;  3P58 A;  4QSB A;  5EH7 A;  4PQ7 A;  3U47 A;  1HVA A;  3M5S A;  5AMD A;  1UGD A;  2GEH A;  3P44 A;  1BNN A;  2FNN A;  3HS4 A;  2FMG A;  4FL7 A;  3OKU A;  3T5U A;  1H4N A;  3TMJ A;  4QSI A;  1CNH A;  5SZ1 A;  3S75 B;  4QJM A;  4CNR A;  4QY3 A;  5DSQ A;  3MZC A;  1CA3 A;  1FR4 A;  2POU A;  1BN3 A;  3M2N A;  1F2W A;  4MO8 A;  3ML2 A;  2HOC A;  5BYI A;  1CAM A;  1XEV A;  4RH2 A;  3ZNC A;  3D92 A;  3N0N A;  5G01 A;  4RUY A;  2X7S A;  1BV3 A;  5E28 A;  1I9O A;  1UGG A;  3PYK A;  5FNI A;  1ZFQ A;  4FIK A;  4Q9Y A;  3B1B A;  3M2Y A;  4YVY A;  4E49 A;  1CAK A;  3V2M A;  2FOU A;  3IGP A;  3M14 A;  4YYT A;  1CVH A;  2FOS A;  3JXH C;  4YX4 A;  5JGS B;  4Z1N A;  3M04 A;  3HKT A;  1DMX A;  3S73 B;  3M40 A;  3D0N A;  5FNG A;  1LUG A;  1AZM A;  3P5L A;  4E9O X;  4Q78 A;  3MHM A;  4JS6 A;  1FR7 A;  2CBA A;  2CBE A;  3MHL A;  4IWZ A;  4UOV A;  4YHA A;  5EHE A;  3V7X A;  2GD8 A;  1TG9 A;  1G54 A;  5DSL A;  1CIN A;  5SZ3 A;  4PZH A;  4YGN A;  5JQT A;  4JSZ A;  5JGT B;  3U3A X;  4DZ9 A;  3KOK A;  3DCC A;  3FFP X;  3MYQ A;  3FW3 A;  3DD8 A;  1XEG A;  3T83 A;  3HKQ A;  1H9N A;  3S78 B;  1CCU A;  5G0B A;  1ZGF A;  3W6I A;  5IPZ A;  1BZM A;  3MNA A;  3DV7 A;  2Q1Q A;  1RJ5 A;  3P55 A;  1Z97 A;  2OSF A;  1HED A;  3MNJ A;  1Z9Y A;  3PJJ A;  1TB0 X;  4Z0Q A;  3M1Q A;  1FQL A;  1CCT A;  3F7U A;  3W6H A;  1G4O A;  4L5V A;  3BET A;  4Q8X A;  4N16 A;  1FLJ A;  5JES B;  5FNK A;  3RYV B;  2WEJ A;  7CA2 A;  4Q83 A;  4MLT A;  3DA2 A;  3M98 A;  5CLU A;  5FNH A;  1H9Q A;  5JEH B;  3Q31 A;  4QK3 A;  3JXG A;  4QJW A;  4E3G A;  2WEH A;  3D8W A;  4XIW A;  3K7K A;  1BNU A;  1TBT X;  2NXR A;  4L5W A;  3KIG A;  4PXX A;  4Q90 A;  4KV0 A;  5AML A;  4KNN A;  4BCW A;  1CAO A;  3MHI A;  5DSP A;  2X7T A;  3OIM A;  4KUV A;  4E3F A;  4K1Q A;  2POV A;  1CVE A;  2AX2 A;  5FLS A;  3EFI A;  1I9L A;  3R16 A;  4QSA A;  5FNM A;  4XE1 A;  5J8Z A;  3S71 B;  5CAC A;  5CJF A;  3M2Z A;  1G4J A;  1BNM A;  4N0X B;  3MMF A;  3IAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...