2FW4A

Carbonic anhydrase activators. the first x-ray crystallographic study of an activator of isoform i, structure with l-histidine.
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
Knots found
sequence length
257
structure length
257
Chain Sequence
DWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Carbonic anhydrase 1
publication title Carbonic anhydrase activators: The first X-ray crystallographic study of an adduct of isoform I.
pubmed doi rcsb
total genus 69
structure length 257
sequence length 257
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2006-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 2fw4A00
3S74B 1DCAA 1XEVA 1YDBA 1I90A 1CAOA 1HEBA 4MDLA 2NXRA 5AMLA 3S73B 3BL1A 4RFDA 3ML5A 3RYYA 3RZ0B 3V5GA 5DSPA 1HCAA 4BF6A 4Q78A 3K34A 3EFIA 4MO8A 4CACA 1ZSBA 5G0BA 3F4XA 4QJXA 2POVA 4MDMA 3OIKA 2HFWA 3F7UA 3HKTA 4Y0JA 4L5UA 4Q6EA 2O4ZA 3NI5A 5C8IA 2QOAA 3S71B 3R16A 1H4NA 4L5VA 3DC3A 1HVAA 4WW6A 1CAZA 4HF3A 4QJWA 4QK1A 2X7SA 3N0NA 3RZ5A 3NB5A 1KOPA 4XZ5A 3K2FA 1Z97A 4COQA 1FQRA 3S75B 1URTA 1BNNA 3M2NA 4K13A 3RGEA 5DSMA 2VVAX 2AX2A 4WW8A 4YHAA 2WD3A 4HBAA 4YGLA 4RIUA 4ZX0A 3MHLA 5FLSA 4BCWA 1G0EA 1CVBA 3V3FA 3P5LA 5CLUA 3DV7A 5EH5A 5E5RA 4M2WA 4ZX1A 1A42A 1ZSCA 2W2JA 3KONA 1CCTA 1CNXA 4Z1NA 3M98A 1CAHA 3Q31A 3RZ7A 1RZBA 2NNGA 4QSIA 4Q81A 1BNVA 1TEQX 1CAIA 2FNNA 3FFPX 1HECA 4YXUA 2CBBA 4E3FA 4QJMA 3MWOA 4FVOA 1YO0A 1UGDA 5EHEA 3D8WA 3TVNX 4K1QA 3FW3A 4QK2A 4ZWZA 4QJPA 1I9MA 4WUPA 3MNUA 4Q99A 5G0CA 4K0SA 4MLXA 4Z1EA 3N4BA 5BRVA 1AM6A 3F7BA 3M5SA 4FL7A 5L6KA 1G54A 5FLOA 4QK3A 1J9WA 2NNVA 5DSJA 4Q9YA 1I9OA 2NWZA 5E2KA 1KWQA 1FLJA 4YWPA 5BRUA 3OKUA 4Q7WA 4MTYA 12CAA 5JG3B 1BZMA 2EU3A 3HKUA 3ZP9A 1CAJA 3MNIA 3CYUA 3U7CA 1TTMA 2EZ7A 3M40A 1CALA 3CZVA 5DSQA 5E5UA 2NNOA 1RJ6A 4FU5A 4PXXA 3MMFA 2X7UA 1RZAA 3DCSA 3M1WA 3PO6A 2CBAA 3F8EA 5E2RA 5LMDA 3MHCA 3RYJB 3V3IB 4JS6A 1H9NA 1CNKA 3MHIA 4ETQC 3W6IA 1AZMA 2FMZA 3HKNA 4QIYA 2HD6A 3DVCA 3KKXA 4Q07A 1G46A 5FDIA 5EHWA 5DSRA 4E3DA 5DRSA 4LHIA 1CNCA 4WR7A 4QY3A 1LG5A 3D9ZA 5BNLA 4RFCA 4RIVA 3M14A 2QP6A 3IBNA 1XPZA 1ZNCA 4FRCA 4K0TA 3JXGA 5G01A 4E9OX 1BNWA 5EOIA 4R5BA 3MDZA 3SBIA 5SZ3A 3S78B 3OY0A 2WEHA 4RUYA 1OKNA 5J8ZA 1YO1A 1BN3A 4KNJA 5EH7A 5JGSB 2CBDA 4QSAA 4G7AA 4PYXA 3DCWA 4WL4A 4ITPA 3M2XA 4LP6A 5JEHB 3TMJA 4HT2A 4YXIA 3V2MA 1CVAA 3NJ9A 1ZE8A 4RN4A 1IF8A 2FOQA 1ZGFA 1ZGEA 3UYNA 2F14A 4QJ0A 4Z1JA 3IAIA 3M1JA 2GD8A 1BV3A 4YX4A 3SAXA 1TEUX 2WEGA 4YGNA 5EIJA 2NNSA 5FL4A 1RZCA 1BICA 1YDAA 4JSZA 1RZEA 2CA2A 4Q08A 4QSBA 2Q38A 3M1QA 4M2UA 1HUHA 2CBEA 1TG9A 4IWZA 3S76A 3MNHA 3DD8A 3T85A 1UGEA 1ZFKA 3P58A 5FL5A 1ZH9A 1FR7A 1LZVA 2H4NA 5SZ4A 3OYSA 4QSJA 3MHMA 1FQMA 3IBIA 5EH8A 1I9PA 1ZSAA 7CA2A 1CINA 5SZ6A 5FLRA 1V9IC 5FNLA 3RYXB 1T9NA 3OKVA 3U45X 1MUAA 4CNXA 2FMGA 2VVBX 3V3GB 1KWRA 1CA2A 1CNYA 3GZ0A 1TB0X 3HFPA 3RYVB 4E5QA 1LGDA 5HPJA 1CAYA 1BNMA 4YVYA 1KOQA 2GEHA 1CNIA 1G52A 1G0FA 1OKMA 3RJ7A 4E3GA 5EKMA 4PYYA 1RAZA 3SAPA 1I9NA 2POUA 2Q1QA 3KLDB 3T5UA 2CABA 4CA2A 5DSOA 4KP8A 4Q09A 4Q7PA 3S77B 2NWOA 1G1DA 1TE3X 1TH9A 4Z0QA 1BN4A 1OQ5A 5EZTX 4E3HA 3RG4A 5FNJA 1LUGA 4FPTA 2FOSA 1IF6A 2POWA 3BL0A 1G6VA 2FOYA 1BNUA 1CZMA 4YGKA 3KOIA 5AMGA 4ZWIA 1EOUA 2CBCA 3PYKA 3ML2A 5JEPB 1I91A 1UGAA 1G53A 3T84A 1CANA 5JGTB 1I8ZA 3P4VA 4ITOA 4MDGA 4TWLA 1I9QA 1JD0A 1Z9YA 1TG3A 5JESB 3M5EA 1CAMA 9CA2A 1YO2A 5E2SA 2NWYA 4Q0LA 1IF4A 1CA3A 3HS4A 2H15A 3D93A 3DD0A 3JXFA 1CCSA 5A6HA 5JQTA 4WUQA 1AVNA 4KUWA 3LXEA 4JSWA 3VBDA 1G45A 1UGFA 1DMXA 2WEOA 2FNMA 3P44A 3SBHA 4Q49A 5FLTA 1MOOA 3U47A 1RAYA 3V2JA 1FQLA 4Q8ZA 4YGFA 3M5TA 1HEDA 2ABEA 4ILXA 1XEGA 4G0CA 4XE1A 1CIMA 1I9LA 3KS3A 4HEZA 5BRWA 1HEAA 3IBUA 3OYQA 1IF9A 5SZ0A 3CAJA 4CNRA 1CVEA 4KUYA 2HOCA 4M2VA 4Z1KA 3ZNCA 1OKLA 2EU2A 3IEOA 1DMYA 4QIZA 3R17B 4CNWA 1V9EA 1CVHA 4YXOA 3KIGA 3MYQA 2NMXA 3M2ZA 4KNIA 3HKQA 4Q7VA 2FOVA 3T5ZA 3S9TA 4RH2A 3KOKA 4ZWXA 1HCBA 4GL1X 4LU3A 5AMDA 3PJJA 4Q6DA 4YGJA 2FW4A 3BETA 5JG5B 3RYZA 3RG3A 4HEYA 3T82A 4CNVA 3RZ1B 1CRAA 5EKJA 5JDVB 3QYKA 3RZ8A 5SZ7A 3OIMA 1G4OA 1RZDA 2NN7A 5DOGA 4KAPA 2ILIA 5FNKA 2X7TA 3TVOX 4Q06A 4L5WA 4HU1A 3UYQA 4BF1A 4X5SA 3N2PA 4Q90A 5EKHA 2NXSA 4ZAOA 5FL6A 3JXHC 3B4FA 3MHOA 1CILA 2QO8A 4PZHA 5DSLA 4KNNA 5BYIA 3D0NA 3DVDA 2IT4A 1HUGA 4KP5A 1FSRA 4UOVA 4HEWA 1YDDA 3V3HB 3DA2A 3M96A 5DSNA 5SZ1A 4N16A 5IPZA 3HLJA 3P55A 4XFWA 5FDCA 1XQ0A 4RUZA 1ZFQA 5DOHA 1Y7WA 1JV0A 4RUXA 4XIWA 3S72B 4KNMA 4KV0A 5E2MA 3U3AX 1UGGA 1RJ5A 3DVBA 1BCDA 1DCBA 4IDRX 4XIXA 1CNHA 4HT0A 2WEJA 5FNHA 5E2NA 2WD2A 5A25A 1UGBA 2NXTA 3DAZA 2HNCA 1BNQA 4Q83A 3M04A 4JSSA 3B1BA 2ZNCA 3P3JA 5CA2A 4YYTA 2HKKA 1BNTA 2FNKA 1KEQA 4DZ9A 5FLQA 1CVFA 1TBTX 3C7PA 4ZWYA 5JQ0A 4Q87A 4MLTA 4N0XB 5DVXA 3FE4A 1CNJA 1THKA 4R59A 3W6HA 3CA2A 5CACA 5FNMA 3MZCA 4Q7SA 3N3JA 4R5AA 3IGPA 5DSKA 4CQ0A 4KUVA 3L14A 4DZ7A 5L3OA 3KWAA 4TWMA 5FLPA 2HL4A 3OILA 1FQNA 1YDCA 4FVNA 1FSQA 5SZ5A 4FIKA 3D92A 1CCUA 3MNAA 1CVDA 4M2RA 4E4AA 3M3XA 1H9QA 3M2YA 4JSAA 3DBUA 5DSIA 1CVCA 3DC9A 3V3JA 1G3ZA 1LG6A 3MNJA 5G03A 3S8XA 4Q8YA 1FSNA 3M67A 2NWPA 3RLDA 3S97A 4QEFA 4C3TA 3IBLA 1CNGA 5JEGB 6CA2A 5E28A 2FOUA 1Z93A 3DCCA 3MNKA 1F2WA 1FR4A 4QJOA 1JCZA 1CNBA 1UGCA 3EFTA 1CAKA 3P5AA 3P3HA 1CRMA 4K0ZA 3M1KA 4E49A 3T83A 4QTLA 1G4JA 5EHVA 5SZ2A 3V7XA 2OSFA 4PQ7A 5FNGA 2Q1BA 2OSMA 1IF5A 8CA2A 2NN1A 3KNEA 4Q8XA 5FNIA 1BN1A 1IF7A 1G48A 2AW1A 1CNWA 3K7KA 5CJFA
chains in the Genus database with same CATH superfamily
3S74B 1DCAA 1XEVA 1YDBA 1I90A 1CAOA 1HEBA 4MDLA 2NXRA 5AMLA 3S73B 3BL1A 4RFDA 3ML5A 3RYYA 3RZ0B 3V5GA 5DSPA 1HCAA 4BF6A 4Q78A 3K34A 3EFIA 4MO8A 4CACA 1ZSBA 5G0BA 3F4XA 4QJXA 2POVA 4MDMA 3OIKA 2HFWA 3F7UA 3HKTA 4Y0JA 4L5UA 4Q6EA 2O4ZA 3NI5A 5C8IA 2QOAA 3S71B 3R16A 1H4NA 4L5VA 3DC3A 1HVAA 4WW6A 1CAZA 4HF3A 4QJWA 4QK1A 2X7SA 3N0NA 3RZ5A 3NB5A 1KOPA 4XZ5A 3K2FA 1Z97A 4COQA 1FQRA 3S75B 1URTA 1BNNA 3M2NA 4K13A 3RGEA 5DSMA 2VVAX 2AX2A 4WW8A 4YHAA 2WD3A 4HBAA 4YGLA 4RIUA 4ZX0A 3MHLA 5FLSA 4BCWA 1G0EA 1CVBA 3V3FA 3P5LA 5CLUA 3DV7A 5EH5A 5E5RA 4M2WA 4ZX1A 1A42A 1ZSCA 2W2JA 3KONA 1CCTA 1CNXA 4Z1NA 3M98A 1CAHA 3Q31A 3RZ7A 1RZBA 2NNGA 4QSIA 4Q81A 1BNVA 1TEQX 1CAIA 2FNNA 3FFPX 1HECA 4YXUA 2CBBA 4E3FA 4QJMA 3MWOA 4FVOA 1YO0A 1UGDA 5EHEA 3D8WA 3TVNX 4K1QA 3FW3A 4QK2A 4ZWZA 4QJPA 1I9MA 4WUPA 3MNUA 4Q99A 5G0CA 4K0SA 4MLXA 4Z1EA 3N4BA 5BRVA 1AM6A 3F7BA 3M5SA 4FL7A 5L6KA 1G54A 5FLOA 4QK3A 1J9WA 2NNVA 5DSJA 4Q9YA 1I9OA 2NWZA 5E2KA 1KWQA 1FLJA 4YWPA 5BRUA 3OKUA 4Q7WA 4MTYA 12CAA 5JG3B 1BZMA 2EU3A 3HKUA 3ZP9A 1CAJA 3MNIA 3CYUA 3U7CA 1TTMA 2EZ7A 3M40A 1CALA 3CZVA 5DSQA 5E5UA 2NNOA 1RJ6A 4FU5A 4PXXA 3MMFA 2X7UA 1RZAA 3DCSA 3M1WA 3PO6A 2CBAA 3F8EA 5E2RA 5LMDA 3MHCA 3RYJB 3V3IB 4JS6A 1H9NA 1CNKA 3MHIA 4ETQC 3W6IA 1AZMA 2FMZA 3HKNA 4QIYA 2HD6A 3DVCA 3KKXA 4Q07A 1G46A 5FDIA 5EHWA 5DSRA 4E3DA 5DRSA 4LHIA 1CNCA 4WR7A 4QY3A 1LG5A 3D9ZA 5BNLA 4RFCA 4RIVA 3M14A 2QP6A 3IBNA 1XPZA 1ZNCA 4FRCA 4K0TA 3JXGA 5G01A 4E9OX 1BNWA 5EOIA 4R5BA 3MDZA 3SBIA 5SZ3A 3S78B 3OY0A 2WEHA 4RUYA 1OKNA 5J8ZA 1YO1A 1BN3A 4KNJA 5EH7A 5JGSB 2CBDA 4QSAA 4G7AA 4PYXA 3DCWA 4WL4A 4ITPA 3M2XA 4LP6A 5JEHB 3TMJA 4HT2A 4YXIA 3V2MA 1CVAA 3NJ9A 1ZE8A 4RN4A 1IF8A 2FOQA 1ZGFA 1ZGEA 3UYNA 2F14A 4QJ0A 4Z1JA 3IAIA 3M1JA 2GD8A 1BV3A 4YX4A 3SAXA 1TEUX 2WEGA 4YGNA 5EIJA 2NNSA 5FL4A 1RZCA 1BICA 1YDAA 4JSZA 1RZEA 2CA2A 4Q08A 4QSBA 2Q38A 3M1QA 4M2UA 1HUHA 2CBEA 1TG9A 4IWZA 3S76A 3MNHA 3DD8A 3T85A 1UGEA 1ZFKA 3P58A 5FL5A 1ZH9A 1FR7A 1LZVA 2H4NA 5SZ4A 3OYSA 4QSJA 3MHMA 1FQMA 3IBIA 5EH8A 1I9PA 1ZSAA 7CA2A 1CINA 5SZ6A 5FLRA 1V9IC 5FNLA 3RYXB 1T9NA 3OKVA 3U45X 1MUAA 4CNXA 2FMGA 2VVBX 3V3GB 1KWRA 1CA2A 1CNYA 3GZ0A 1TB0X 3HFPA 3RYVB 4E5QA 1LGDA 5HPJA 1CAYA 1BNMA 4YVYA 1KOQA 2GEHA 1CNIA 1G52A 1G0FA 1OKMA 3RJ7A 4E3GA 5EKMA 4PYYA 1RAZA 3SAPA 1I9NA 2POUA 2Q1QA 3KLDB 3T5UA 2CABA 4CA2A 5DSOA 4KP8A 4Q09A 4Q7PA 3S77B 2NWOA 1G1DA 1TE3X 1TH9A 4Z0QA 1BN4A 1OQ5A 5EZTX 4E3HA 3RG4A 5FNJA 1LUGA 4FPTA 2FOSA 1IF6A 2POWA 3BL0A 1G6VA 2FOYA 1BNUA 1CZMA 4YGKA 3KOIA 5AMGA 4ZWIA 1EOUA 2CBCA 3PYKA 3ML2A 5JEPB 1I91A 1UGAA 1G53A 3T84A 1CANA 5JGTB 1I8ZA 3P4VA 4ITOA 4MDGA 4TWLA 1I9QA 1JD0A 1Z9YA 1TG3A 5JESB 3M5EA 1CAMA 9CA2A 1YO2A 5E2SA 2NWYA 4Q0LA 1IF4A 1CA3A 3HS4A 2H15A 3D93A 3DD0A 3JXFA 1CCSA 5A6HA 5JQTA 4WUQA 1AVNA 4KUWA 3LXEA 4JSWA 3VBDA 1G45A 1UGFA 1DMXA 2WEOA 2FNMA 3P44A 3SBHA 4Q49A 5FLTA 1MOOA 3U47A 1RAYA 3V2JA 1FQLA 4Q8ZA 4YGFA 3M5TA 1HEDA 2ABEA 4ILXA 1XEGA 4G0CA 4XE1A 1CIMA 1I9LA 3KS3A 4HEZA 5BRWA 1HEAA 3IBUA 3OYQA 1IF9A 5SZ0A 3CAJA 4CNRA 1CVEA 4KUYA 2HOCA 4M2VA 4Z1KA 3ZNCA 1OKLA 2EU2A 3IEOA 1DMYA 4QIZA 3R17B 4CNWA 1V9EA 1CVHA 4YXOA 3KIGA 3MYQA 2NMXA 3M2ZA 4KNIA 3HKQA 4Q7VA 2FOVA 3T5ZA 3S9TA 4RH2A 3KOKA 4ZWXA 1HCBA 4GL1X 4LU3A 5AMDA 3PJJA 4Q6DA 4YGJA 2FW4A 3BETA 5JG5B 3RYZA 3RG3A 4HEYA 3T82A 4CNVA 3RZ1B 1CRAA 5EKJA 5JDVB 3QYKA 3RZ8A 5SZ7A 3OIMA 1G4OA 1RZDA 2NN7A 5DOGA 4KAPA 2ILIA 5FNKA 2X7TA 3TVOX 4Q06A 4L5WA 4HU1A 3UYQA 4BF1A 4X5SA 3N2PA 4Q90A 5EKHA 2NXSA 4ZAOA 5FL6A 3JXHC 3B4FA 3MHOA 1CILA 2QO8A 4PZHA 5DSLA 4KNNA 5BYIA 3D0NA 3DVDA 2IT4A 1HUGA 4KP5A 1FSRA 4UOVA 4HEWA 1YDDA 3V3HB 3DA2A 3M96A 5DSNA 5SZ1A 4N16A 5IPZA 3HLJA 3P55A 4XFWA 5FDCA 1XQ0A 4RUZA 1ZFQA 5DOHA 1Y7WA 1JV0A 4RUXA 4XIWA 3S72B 4KNMA 4KV0A 5E2MA 3U3AX 1UGGA 1RJ5A 3DVBA 1BCDA 1DCBA 4IDRX 4XIXA 1CNHA 4HT0A 2WEJA 5FNHA 5E2NA 2WD2A 5A25A 1UGBA 2NXTA 3DAZA 2HNCA 1BNQA 4Q83A 3M04A 4JSSA 3B1BA 2ZNCA 3P3JA 5CA2A 4YYTA 2HKKA 1BNTA 2FNKA 1KEQA 4DZ9A 5FLQA 1CVFA 1TBTX 3C7PA 4ZWYA 5JQ0A 4Q87A 4MLTA 4N0XB 5DVXA 3FE4A 1CNJA 1THKA 4R59A 3W6HA 3CA2A 5CACA 5FNMA 3MZCA 4Q7SA 3N3JA 4R5AA 3IGPA 5DSKA 4CQ0A 4KUVA 3L14A 4DZ7A 5L3OA 3KWAA 4TWMA 5FLPA 2HL4A 3OILA 1FQNA 1YDCA 4FVNA 1FSQA 5SZ5A 4FIKA 3D92A 1CCUA 3MNAA 1CVDA 4M2RA 4E4AA 3M3XA 1H9QA 3M2YA 4JSAA 3DBUA 5DSIA 1CVCA 3DC9A 3V3JA 1G3ZA 1LG6A 3MNJA 5G03A 3S8XA 4Q8YA 1FSNA 3M67A 2NWPA 3RLDA 3S97A 4QEFA 4C3TA 3IBLA 1CNGA 5JEGB 6CA2A 5E28A 2FOUA 1Z93A 3DCCA 3MNKA 1F2WA 1FR4A 4QJOA 1JCZA 1CNBA 1UGCA 3EFTA 1CAKA 3P5AA 3P3HA 1CRMA 4K0ZA 3M1KA 4E49A 3T83A 4QTLA 1G4JA 5EHVA 5SZ2A 3V7XA 2OSFA 4PQ7A 5FNGA 2Q1BA 2OSMA 1IF5A 8CA2A 2NN1A 3KNEA 4Q8XA 5FNIA 1BN1A 1IF7A 1G48A 2AW1A 1CNWA 3K7KA 5CJFA
chains in the Genus database with same CATH topology
3S74B 1DCAA 1XEVA 1YDBA 1I90A 1CAOA 1HEBA 4MDLA 2NXRA 5AMLA 3S73B 3BL1A 4RFDA 3ML5A 3RYYA 3RZ0B 3V5GA 5DSPA 1HCAA 4BF6A 4Q78A 3K34A 3EFIA 4MO8A 4CACA 1ZSBA 5G0BA 3F4XA 4QJXA 2POVA 4MDMA 3OIKA 2HFWA 3F7UA 3HKTA 4Y0JA 4L5UA 4Q6EA 2O4ZA 3NI5A 5C8IA 2QOAA 3S71B 3R16A 1H4NA 4L5VA 3DC3A 1HVAA 4WW6A 1CAZA 4HF3A 4QJWA 4QK1A 2X7SA 3N0NA 3RZ5A 3NB5A 1KOPA 4XZ5A 3K2FA 1Z97A 4COQA 1FQRA 3S75B 1URTA 1BNNA 3M2NA 4K13A 3RGEA 5DSMA 2VVAX 2AX2A 4WW8A 4YHAA 2WD3A 4HBAA 4YGLA 4RIUA 4ZX0A 3MHLA 5FLSA 4BCWA 1G0EA 1CVBA 3V3FA 3P5LA 5CLUA 3DV7A 5EH5A 5E5RA 4M2WA 4ZX1A 1A42A 1ZSCA 2W2JA 3KONA 1CCTA 1CNXA 4Z1NA 3M98A 1CAHA 3Q31A 3RZ7A 1RZBA 2NNGA 4QSIA 4Q81A 1BNVA 1TEQX 1CAIA 2FNNA 3FFPX 1HECA 4YXUA 2CBBA 4E3FA 4QJMA 3MWOA 4FVOA 1YO0A 1UGDA 5EHEA 3D8WA 3TVNX 4K1QA 3FW3A 4QK2A 4ZWZA 4QJPA 1I9MA 4WUPA 3MNUA 4Q99A 5G0CA 4K0SA 4MLXA 4Z1EA 3N4BA 5BRVA 1AM6A 3F7BA 3M5SA 4FL7A 5L6KA 1G54A 5FLOA 4QK3A 1J9WA 2NNVA 5DSJA 4Q9YA 1I9OA 2NWZA 5E2KA 1KWQA 1FLJA 4YWPA 5BRUA 3OKUA 4Q7WA 4MTYA 12CAA 5JG3B 1BZMA 2EU3A 3HKUA 3ZP9A 1CAJA 3MNIA 3CYUA 3U7CA 1TTMA 2EZ7A 3M40A 1CALA 3CZVA 5DSQA 5E5UA 2NNOA 1RJ6A 4FU5A 4PXXA 3MMFA 2X7UA 1RZAA 3DCSA 3M1WA 3PO6A 2CBAA 3F8EA 5E2RA 5LMDA 3MHCA 3RYJB 3V3IB 4JS6A 1H9NA 1CNKA 3MHIA 4ETQC 3W6IA 1AZMA 2FMZA 3HKNA 4QIYA 2HD6A 3DVCA 3KKXA 4Q07A 1G46A 5FDIA 5EHWA 5DSRA 4E3DA 5DRSA 4LHIA 1CNCA 4WR7A 4QY3A 1LG5A 3D9ZA 5BNLA 4RFCA 4RIVA 3M14A 2QP6A 3IBNA 1XPZA 1ZNCA 4FRCA 4K0TA 3JXGA 5G01A 4E9OX 1BNWA 5EOIA 4R5BA 3MDZA 3SBIA 5SZ3A 3S78B 3OY0A 2WEHA 4RUYA 1OKNA 5J8ZA 1YO1A 1BN3A 4KNJA 5EH7A 5JGSB 2CBDA 4QSAA 4G7AA 4PYXA 3DCWA 4WL4A 4ITPA 3M2XA 4LP6A 5JEHB 3TMJA 4HT2A 4YXIA 3V2MA 1CVAA 3NJ9A 1ZE8A 4RN4A 1IF8A 2FOQA 1ZGFA 1ZGEA 3UYNA 2F14A 4QJ0A 4Z1JA 3IAIA 3M1JA 2GD8A 1BV3A 4YX4A 3SAXA 1TEUX 2WEGA 4YGNA 5EIJA 2NNSA 5FL4A 1RZCA 1BICA 1YDAA 4JSZA 1RZEA 2CA2A 4Q08A 4QSBA 2Q38A 3M1QA 4M2UA 1HUHA 2CBEA 1TG9A 4IWZA 3S76A 3MNHA 3DD8A 3T85A 1UGEA 1ZFKA 3P58A 5FL5A 1ZH9A 1FR7A 1LZVA 2H4NA 5SZ4A 3OYSA 4QSJA 3MHMA 1FQMA 3IBIA 5EH8A 1I9PA 1ZSAA 7CA2A 1CINA 5SZ6A 5FLRA 1V9IC 5FNLA 3RYXB 1T9NA 3OKVA 3U45X 1MUAA 4CNXA 2FMGA 2VVBX 3V3GB 1KWRA 1CA2A 1CNYA 3GZ0A 1TB0X 3HFPA 3RYVB 4E5QA 1LGDA 5HPJA 1CAYA 1BNMA 4YVYA 1KOQA 2GEHA 1CNIA 1G52A 1G0FA 1OKMA 3RJ7A 4E3GA 5EKMA 4PYYA 1RAZA 3SAPA 1I9NA 2POUA 2Q1QA 3KLDB 3T5UA 2CABA 4CA2A 5DSOA 4KP8A 4Q09A 4Q7PA 3S77B 2NWOA 1G1DA 1TE3X 1TH9A 4Z0QA 1BN4A 1OQ5A 5EZTX 4E3HA 3RG4A 5FNJA 1LUGA 4FPTA 2FOSA 1IF6A 2POWA 3BL0A 1G6VA 2FOYA 1BNUA 1CZMA 4YGKA 3KOIA 5AMGA 4ZWIA 1EOUA 2CBCA 3PYKA 3ML2A 5JEPB 1I91A 1UGAA 1G53A 3T84A 1CANA 5JGTB 1I8ZA 3P4VA 4ITOA 4MDGA 4TWLA 1I9QA 1JD0A 1Z9YA 1TG3A 5JESB 3M5EA 1CAMA 9CA2A 1YO2A 5E2SA 2NWYA 4Q0LA 1IF4A 1CA3A 3HS4A 2H15A 3D93A 3DD0A 3JXFA 1CCSA 5A6HA 5JQTA 4WUQA 1AVNA 4KUWA 3LXEA 4JSWA 3VBDA 1G45A 1UGFA 1DMXA 2WEOA 2FNMA 3P44A 3SBHA 4Q49A 5FLTA 1MOOA 3U47A 1RAYA 3V2JA 1FQLA 4Q8ZA 4YGFA 3M5TA 1HEDA 2ABEA 4ILXA 1XEGA 4G0CA 4XE1A 1CIMA 1I9LA 3KS3A 4HEZA 5BRWA 1HEAA 3IBUA 3OYQA 1IF9A 5SZ0A 3CAJA 4CNRA 1CVEA 4KUYA 2HOCA 4M2VA 4Z1KA 3ZNCA 1OKLA 2EU2A 3IEOA 1DMYA 4QIZA 3R17B 4CNWA 1V9EA 1CVHA 4YXOA 3KIGA 3MYQA 2NMXA 3M2ZA 4KNIA 3HKQA 4Q7VA 2FOVA 3T5ZA 3S9TA 4RH2A 3KOKA 4ZWXA 1HCBA 4GL1X 4LU3A 5AMDA 3PJJA 4Q6DA 4YGJA 2FW4A 3BETA 5JG5B 3RYZA 3RG3A 4HEYA 3T82A 4CNVA 3RZ1B 1CRAA 5EKJA 5JDVB 3QYKA 3RZ8A 5SZ7A 3OIMA 1G4OA 1RZDA 2NN7A 5DOGA 4KAPA 2ILIA 5FNKA 2X7TA 3TVOX 4Q06A 4L5WA 4HU1A 3UYQA 4BF1A 4X5SA 3N2PA 4Q90A 5EKHA 2NXSA 4ZAOA 5FL6A 3JXHC 3B4FA 3MHOA 1CILA 2QO8A 4PZHA 5DSLA 4KNNA 5BYIA 3D0NA 3DVDA 2IT4A 1HUGA 4KP5A 1FSRA 4UOVA 4HEWA 1YDDA 3V3HB 3DA2A 3M96A 5DSNA 5SZ1A 4N16A 5IPZA 3HLJA 3P55A 4XFWA 5FDCA 1XQ0A 4RUZA 1ZFQA 5DOHA 1Y7WA 1JV0A 4RUXA 4XIWA 3S72B 4KNMA 4KV0A 5E2MA 3U3AX 1UGGA 1RJ5A 3DVBA 1BCDA 1DCBA 4IDRX 4XIXA 1CNHA 4HT0A 2WEJA 5FNHA 5E2NA 2WD2A 5A25A 1UGBA 2NXTA 3DAZA 2HNCA 1BNQA 4Q83A 3M04A 4JSSA 3B1BA 2ZNCA 3P3JA 5CA2A 4YYTA 2HKKA 1BNTA 2FNKA 1KEQA 4DZ9A 5FLQA 1CVFA 1TBTX 3C7PA 4ZWYA 5JQ0A 4Q87A 4MLTA 4N0XB 5DVXA 3FE4A 1CNJA 1THKA 4R59A 3W6HA 3CA2A 5CACA 5FNMA 3MZCA 4Q7SA 3N3JA 4R5AA 3IGPA 5DSKA 4CQ0A 4KUVA 3L14A 4DZ7A 5L3OA 3KWAA 4TWMA 5FLPA 2HL4A 3OILA 1FQNA 1YDCA 4FVNA 1FSQA 5SZ5A 4FIKA 3D92A 1CCUA 3MNAA 1CVDA 4M2RA 4E4AA 3M3XA 1H9QA 3M2YA 4JSAA 3DBUA 5DSIA 1CVCA 3DC9A 3V3JA 1G3ZA 1LG6A 3MNJA 5G03A 3S8XA 4Q8YA 1FSNA 3M67A 2NWPA 3RLDA 3S97A 4QEFA 4C3TA 3IBLA 1CNGA 5JEGB 6CA2A 5E28A 2FOUA 1Z93A 3DCCA 3MNKA 1F2WA 1FR4A 4QJOA 1JCZA 1CNBA 1UGCA 3EFTA 1CAKA 3P5AA 3P3HA 1CRMA 4K0ZA 3M1KA 4E49A 3T83A 4QTLA 1G4JA 5EHVA 5SZ2A 3V7XA 2OSFA 4PQ7A 5FNGA 2Q1BA 2OSMA 1IF5A 8CA2A 2NN1A 3KNEA 4Q8XA 5FNIA 1BN1A 1IF7A 1G48A 2AW1A 1CNWA 3K7KA 5CJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S74 B;  1DCA A;  1XEV A;  1YDB A;  1I90 A;  1CAO A;  1HEB A;  4MDL A;  2NXR A;  5AML A;  3S73 B;  3BL1 A;  4RFD A;  3ML5 A;  3RYY A;  3RZ0 B;  3V5G A;  5DSP A;  1HCA A;  4BF6 A;  4Q78 A;  3K34 A;  3EFI A;  4MO8 A;  4CAC A;  1ZSB A;  5G0B A;  3F4X A;  4QJX A;  2POV A;  4MDM A;  3OIK A;  2HFW A;  3F7U A;  3HKT A;  4Y0J A;  4L5U A;  4Q6E A;  2O4Z A;  3NI5 A;  5C8I A;  2QOA A;  3S71 B;  3R16 A;  1H4N A;  4L5V A;  3DC3 A;  1HVA A;  4WW6 A;  1CAZ A;  4HF3 A;  4QJW A;  4QK1 A;  2X7S A;  3N0N A;  3RZ5 A;  3NB5 A;  1KOP A;  4XZ5 A;  3K2F A;  1Z97 A;  4COQ A;  1FQR A;  3S75 B;  1URT A;  1BNN A;  3M2N A;  4K13 A;  3RGE A;  5DSM A;  2VVA X;  2AX2 A;  4WW8 A;  4YHA A;  2WD3 A;  4HBA A;  4YGL A;  4RIU A;  4ZX0 A;  3MHL A;  5FLS A;  4BCW A;  1G0E A;  1CVB A;  3V3F A;  3P5L A;  5CLU A;  3DV7 A;  5EH5 A;  5E5R A;  4M2W A;  4ZX1 A;  1A42 A;  1ZSC A;  2W2J A;  3KON A;  1CCT A;  1CNX A;  4Z1N A;  3M98 A;  1CAH A;  3Q31 A;  3RZ7 A;  1RZB A;  2NNG A;  4QSI A;  4Q81 A;  1BNV A;  1TEQ X;  1CAI A;  2FNN A;  3FFP X;  1HEC A;  4YXU A;  2CBB A;  4E3F A;  4QJM A;  3MWO A;  4FVO A;  1YO0 A;  1UGD A;  5EHE A;  3D8W A;  3TVN X;  4K1Q A;  3FW3 A;  4QK2 A;  4ZWZ A;  4QJP A;  1I9M A;  4WUP A;  3MNU A;  4Q99 A;  5G0C A;  4K0S A;  4MLX A;  4Z1E A;  3N4B A;  5BRV A;  1AM6 A;  3F7B A;  3M5S A;  4FL7 A;  5L6K A;  1G54 A;  5FLO A;  4QK3 A;  1J9W A;  2NNV A;  5DSJ A;  4Q9Y A;  1I9O A;  2NWZ A;  5E2K A;  1KWQ A;  1FLJ A;  4YWP A;  5BRU A;  3OKU A;  4Q7W A;  4MTY A;  12CA A;  5JG3 B;  1BZM A;  2EU3 A;  3HKU A;  3ZP9 A;  1CAJ A;  3MNI A;  3CYU A;  3U7C A;  1TTM A;  2EZ7 A;  3M40 A;  1CAL A;  3CZV A;  5DSQ A;  5E5U A;  2NNO A;  1RJ6 A;  4FU5 A;  4PXX A;  3MMF A;  2X7U A;  1RZA A;  3DCS A;  3M1W A;  3PO6 A;  2CBA A;  3F8E A;  5E2R A;  5LMD A;  3MHC A;  3RYJ B;  3V3I B;  4JS6 A;  1H9N A;  1CNK A;  3MHI A;  4ETQ C;  3W6I A;  1AZM A;  2FMZ A;  3HKN A;  4QIY A;  2HD6 A;  3DVC A;  3KKX A;  4Q07 A;  1G46 A;  5FDI A;  5EHW A;  5DSR A;  4E3D A;  5DRS A;  4LHI A;  1CNC A;  4WR7 A;  4QY3 A;  1LG5 A;  3D9Z A;  5BNL A;  4RFC A;  4RIV A;  3M14 A;  2QP6 A;  3IBN A;  1XPZ A;  1ZNC A;  4FRC A;  4K0T A;  3JXG A;  5G01 A;  4E9O X;  1BNW A;  5EOI A;  4R5B A;  3MDZ A;  3SBI A;  5SZ3 A;  3S78 B;  3OY0 A;  2WEH A;  4RUY A;  1OKN A;  5J8Z A;  1YO1 A;  1BN3 A;  4KNJ A;  5EH7 A;  5JGS B;  2CBD A;  4QSA A;  4G7A A;  4PYX A;  3DCW A;  4WL4 A;  4ITP A;  3M2X A;  4LP6 A;  5JEH B;  3TMJ A;  4HT2 A;  4YXI A;  3V2M A;  1CVA A;  3NJ9 A;  1ZE8 A;  4RN4 A;  1IF8 A;  2FOQ A;  1ZGF A;  1ZGE A;  3UYN A;  2F14 A;  4QJ0 A;  4Z1J A;  3IAI A;  3M1J A;  2GD8 A;  1BV3 A;  4YX4 A;  3SAX A;  1TEU X;  2WEG A;  4YGN A;  5EIJ A;  2NNS A;  5FL4 A;  1RZC A;  1BIC A;  1YDA A;  4JSZ A;  1RZE A;  2CA2 A;  4Q08 A;  4QSB A;  2Q38 A;  3M1Q A;  4M2U A;  1HUH A;  2CBE A;  1TG9 A;  4IWZ A;  3S76 A;  3MNH A;  3DD8 A;  3T85 A;  1UGE A;  1ZFK A;  3P58 A;  5FL5 A;  1ZH9 A;  1FR7 A;  1LZV A;  2H4N A;  5SZ4 A;  3OYS A;  4QSJ A;  3MHM A;  1FQM A;  3IBI A;  5EH8 A;  1I9P A;  1ZSA A;  7CA2 A;  1CIN A;  5SZ6 A;  5FLR A;  1V9I C;  5FNL A;  3RYX B;  1T9N A;  3OKV A;  3U45 X;  1MUA A;  4CNX A;  2FMG A;  2VVB X;  3V3G B;  1KWR A;  1CA2 A;  1CNY A;  3GZ0 A;  1TB0 X;  3HFP A;  3RYV B;  4E5Q A;  1LGD A;  5HPJ A;  1CAY A;  1BNM A;  4YVY A;  1KOQ A;  2GEH A;  1CNI A;  1G52 A;  1G0F A;  1OKM A;  3RJ7 A;  4E3G A;  5EKM A;  4PYY A;  1RAZ A;  3SAP A;  1I9N A;  2POU A;  2Q1Q A;  3KLD B;  3T5U A;  2CAB A;  4CA2 A;  5DSO A;  4KP8 A;  4Q09 A;  4Q7P A;  3S77 B;  2NWO A;  1G1D A;  1TE3 X;  1TH9 A;  4Z0Q A;  1BN4 A;  1OQ5 A;  5EZT X;  4E3H A;  3RG4 A;  5FNJ A;  1LUG A;  4FPT A;  2FOS A;  1IF6 A;  2POW A;  3BL0 A;  1G6V A;  2FOY A;  1BNU A;  1CZM A;  4YGK A;  3KOI A;  5AMG A;  4ZWI A;  1EOU A;  2CBC A;  3PYK A;  3ML2 A;  5JEP B;  1I91 A;  1UGA A;  1G53 A;  3T84 A;  1CAN A;  5JGT B;  1I8Z A;  3P4V A;  4ITO A;  4MDG A;  4TWL A;  1I9Q A;  1JD0 A;  1Z9Y A;  1TG3 A;  5JES B;  3M5E A;  1CAM A;  9CA2 A;  1YO2 A;  5E2S A;  2NWY A;  4Q0L A;  1IF4 A;  1CA3 A;  3HS4 A;  2H15 A;  3D93 A;  3DD0 A;  3JXF A;  1CCS A;  5A6H A;  5JQT A;  4WUQ A;  1AVN A;  4KUW A;  3LXE A;  4JSW A;  3VBD A;  1G45 A;  1UGF A;  1DMX A;  2WEO A;  2FNM A;  3P44 A;  3SBH A;  4Q49 A;  5FLT A;  1MOO A;  3U47 A;  1RAY A;  3V2J A;  1FQL A;  4Q8Z A;  4YGF A;  3M5T A;  1HED A;  2ABE A;  4ILX A;  1XEG A;  4G0C A;  4XE1 A;  1CIM A;  1I9L A;  3KS3 A;  4HEZ A;  5BRW A;  1HEA A;  3IBU A;  3OYQ A;  1IF9 A;  5SZ0 A;  3CAJ A;  4CNR A;  1CVE A;  4KUY A;  2HOC A;  4M2V A;  4Z1K A;  3ZNC A;  1OKL A;  2EU2 A;  3IEO A;  1DMY A;  4QIZ A;  3R17 B;  4CNW A;  1V9E A;  1CVH A;  4YXO A;  3KIG A;  3MYQ A;  2NMX A;  3M2Z A;  4KNI A;  3HKQ A;  4Q7V A;  2FOV A;  3T5Z A;  3S9T A;  4RH2 A;  3KOK A;  4ZWX A;  1HCB A;  4GL1 X;  4LU3 A;  5AMD A;  3PJJ A;  4Q6D A;  4YGJ A;  2FW4 A;  3BET A;  5JG5 B;  3RYZ A;  3RG3 A;  4HEY A;  3T82 A;  4CNV A;  3RZ1 B;  1CRA A;  5EKJ A;  5JDV B;  3QYK A;  3RZ8 A;  5SZ7 A;  3OIM A;  1G4O A;  1RZD A;  2NN7 A;  5DOG A;  4KAP A;  2ILI A;  5FNK A;  2X7T A;  3TVO X;  4Q06 A;  4L5W A;  4HU1 A;  3UYQ A;  4BF1 A;  4X5S A;  3N2P A;  4Q90 A;  5EKH A;  2NXS A;  4ZAO A;  5FL6 A;  3JXH C;  3B4F A;  3MHO A;  1CIL A;  2QO8 A;  4PZH A;  5DSL A;  4KNN A;  5BYI A;  3D0N A;  3DVD A;  2IT4 A;  1HUG A;  4KP5 A;  1FSR A;  4UOV A;  4HEW A;  1YDD A;  3V3H B;  3DA2 A;  3M96 A;  5DSN A;  5SZ1 A;  4N16 A;  5IPZ A;  3HLJ A;  3P55 A;  4XFW A;  5FDC A;  1XQ0 A;  4RUZ A;  1ZFQ A;  5DOH A;  1Y7W A;  1JV0 A;  4RUX A;  4XIW A;  3S72 B;  4KNM A;  4KV0 A;  5E2M A;  3U3A X;  1UGG A;  1RJ5 A;  3DVB A;  1BCD A;  1DCB A;  4IDR X;  4XIX A;  1CNH A;  4HT0 A;  2WEJ A;  5FNH A;  5E2N A;  2WD2 A;  5A25 A;  1UGB A;  2NXT A;  3DAZ A;  2HNC A;  1BNQ A;  4Q83 A;  3M04 A;  4JSS A;  3B1B A;  2ZNC A;  3P3J A;  5CA2 A;  4YYT A;  2HKK A;  1BNT A;  2FNK A;  1KEQ A;  4DZ9 A;  5FLQ A;  1CVF A;  1TBT X;  3C7P A;  4ZWY A;  5JQ0 A;  4Q87 A;  4MLT A;  4N0X B;  5DVX A;  3FE4 A;  1CNJ A;  1THK A;  4R59 A;  3W6H A;  3CA2 A;  5CAC A;  5FNM A;  3MZC A;  4Q7S A;  3N3J A;  4R5A A;  3IGP A;  5DSK A;  4CQ0 A;  4KUV A;  3L14 A;  4DZ7 A;  5L3O A;  3KWA A;  4TWM A;  5FLP A;  2HL4 A;  3OIL A;  1FQN A;  1YDC A;  4FVN A;  1FSQ A;  5SZ5 A;  4FIK A;  3D92 A;  1CCU A;  3MNA A;  1CVD A;  4M2R A;  4E4A A;  3M3X A;  1H9Q A;  3M2Y A;  4JSA A;  3DBU A;  5DSI A;  1CVC A;  3DC9 A;  3V3J A;  1G3Z A;  1LG6 A;  3MNJ A;  5G03 A;  3S8X A;  4Q8Y A;  1FSN A;  3M67 A;  2NWP A;  3RLD A;  3S97 A;  4QEF A;  4C3T A;  3IBL A;  1CNG A;  5JEG B;  6CA2 A;  5E28 A;  2FOU A;  1Z93 A;  3DCC A;  3MNK A;  1F2W A;  1FR4 A;  4QJO A;  1JCZ A;  1CNB A;  1UGC A;  3EFT A;  1CAK A;  3P5A A;  3P3H A;  1CRM A;  4K0Z A;  3M1K A;  4E49 A;  3T83 A;  4QTL A;  1G4J A;  5EHV A;  5SZ2 A;  3V7X A;  2OSF A;  4PQ7 A;  5FNG A;  2Q1B A;  2OSM A;  1IF5 A;  8CA2 A;  2NN1 A;  3KNE A;  4Q8X A;  5FNI A;  1BN1 A;  1IF7 A;  1G48 A;  2AW1 A;  1CNW A;  3K7K A;  5CJF A; 
#chains in the Genus database with same CATH topology
 3S74 B;  1DCA A;  1XEV A;  1YDB A;  1I90 A;  1CAO A;  1HEB A;  4MDL A;  2NXR A;  5AML A;  3S73 B;  3BL1 A;  4RFD A;  3ML5 A;  3RYY A;  3RZ0 B;  3V5G A;  5DSP A;  1HCA A;  4BF6 A;  4Q78 A;  3K34 A;  3EFI A;  4MO8 A;  4CAC A;  1ZSB A;  5G0B A;  3F4X A;  4QJX A;  2POV A;  4MDM A;  3OIK A;  2HFW A;  3F7U A;  3HKT A;  4Y0J A;  4L5U A;  4Q6E A;  2O4Z A;  3NI5 A;  5C8I A;  2QOA A;  3S71 B;  3R16 A;  1H4N A;  4L5V A;  3DC3 A;  1HVA A;  4WW6 A;  1CAZ A;  4HF3 A;  4QJW A;  4QK1 A;  2X7S A;  3N0N A;  3RZ5 A;  3NB5 A;  1KOP A;  4XZ5 A;  3K2F A;  1Z97 A;  4COQ A;  1FQR A;  3S75 B;  1URT A;  1BNN A;  3M2N A;  4K13 A;  3RGE A;  5DSM A;  2VVA X;  2AX2 A;  4WW8 A;  4YHA A;  2WD3 A;  4HBA A;  4YGL A;  4RIU A;  4ZX0 A;  3MHL A;  5FLS A;  4BCW A;  1G0E A;  1CVB A;  3V3F A;  3P5L A;  5CLU A;  3DV7 A;  5EH5 A;  5E5R A;  4M2W A;  4ZX1 A;  1A42 A;  1ZSC A;  2W2J A;  3KON A;  1CCT A;  1CNX A;  4Z1N A;  3M98 A;  1CAH A;  3Q31 A;  3RZ7 A;  1RZB A;  2NNG A;  4QSI A;  4Q81 A;  1BNV A;  1TEQ X;  1CAI A;  2FNN A;  3FFP X;  1HEC A;  4YXU A;  2CBB A;  4E3F A;  4QJM A;  3MWO A;  4FVO A;  1YO0 A;  1UGD A;  5EHE A;  3D8W A;  3TVN X;  4K1Q A;  3FW3 A;  4QK2 A;  4ZWZ A;  4QJP A;  1I9M A;  4WUP A;  3MNU A;  4Q99 A;  5G0C A;  4K0S A;  4MLX A;  4Z1E A;  3N4B A;  5BRV A;  1AM6 A;  3F7B A;  3M5S A;  4FL7 A;  5L6K A;  1G54 A;  5FLO A;  4QK3 A;  1J9W A;  2NNV A;  5DSJ A;  4Q9Y A;  1I9O A;  2NWZ A;  5E2K A;  1KWQ A;  1FLJ A;  4YWP A;  5BRU A;  3OKU A;  4Q7W A;  4MTY A;  12CA A;  5JG3 B;  1BZM A;  2EU3 A;  3HKU A;  3ZP9 A;  1CAJ A;  3MNI A;  3CYU A;  3U7C A;  1TTM A;  2EZ7 A;  3M40 A;  1CAL A;  3CZV A;  5DSQ A;  5E5U A;  2NNO A;  1RJ6 A;  4FU5 A;  4PXX A;  3MMF A;  2X7U A;  1RZA A;  3DCS A;  3M1W A;  3PO6 A;  2CBA A;  3F8E A;  5E2R A;  5LMD A;  3MHC A;  3RYJ B;  3V3I B;  4JS6 A;  1H9N A;  1CNK A;  3MHI A;  4ETQ C;  3W6I A;  1AZM A;  2FMZ A;  3HKN A;  4QIY A;  2HD6 A;  3DVC A;  3KKX A;  4Q07 A;  1G46 A;  5FDI A;  5EHW A;  5DSR A;  4E3D A;  5DRS A;  4LHI A;  1CNC A;  4WR7 A;  4QY3 A;  1LG5 A;  3D9Z A;  5BNL A;  4RFC A;  4RIV A;  3M14 A;  2QP6 A;  3IBN A;  1XPZ A;  1ZNC A;  4FRC A;  4K0T A;  3JXG A;  5G01 A;  4E9O X;  1BNW A;  5EOI A;  4R5B A;  3MDZ A;  3SBI A;  5SZ3 A;  3S78 B;  3OY0 A;  2WEH A;  4RUY A;  1OKN A;  5J8Z A;  1YO1 A;  1BN3 A;  4KNJ A;  5EH7 A;  5JGS B;  2CBD A;  4QSA A;  4G7A A;  4PYX A;  3DCW A;  4WL4 A;  4ITP A;  3M2X A;  4LP6 A;  5JEH B;  3TMJ A;  4HT2 A;  4YXI A;  3V2M A;  1CVA A;  3NJ9 A;  1ZE8 A;  4RN4 A;  1IF8 A;  2FOQ A;  1ZGF A;  1ZGE A;  3UYN A;  2F14 A;  4QJ0 A;  4Z1J A;  3IAI A;  3M1J A;  2GD8 A;  1BV3 A;  4YX4 A;  3SAX A;  1TEU X;  2WEG A;  4YGN A;  5EIJ A;  2NNS A;  5FL4 A;  1RZC A;  1BIC A;  1YDA A;  4JSZ A;  1RZE A;  2CA2 A;  4Q08 A;  4QSB A;  2Q38 A;  3M1Q A;  4M2U A;  1HUH A;  2CBE A;  1TG9 A;  4IWZ A;  3S76 A;  3MNH A;  3DD8 A;  3T85 A;  1UGE A;  1ZFK A;  3P58 A;  5FL5 A;  1ZH9 A;  1FR7 A;  1LZV A;  2H4N A;  5SZ4 A;  3OYS A;  4QSJ A;  3MHM A;  1FQM A;  3IBI A;  5EH8 A;  1I9P A;  1ZSA A;  7CA2 A;  1CIN A;  5SZ6 A;  5FLR A;  1V9I C;  5FNL A;  3RYX B;  1T9N A;  3OKV A;  3U45 X;  1MUA A;  4CNX A;  2FMG A;  2VVB X;  3V3G B;  1KWR A;  1CA2 A;  1CNY A;  3GZ0 A;  1TB0 X;  3HFP A;  3RYV B;  4E5Q A;  1LGD A;  5HPJ A;  1CAY A;  1BNM A;  4YVY A;  1KOQ A;  2GEH A;  1CNI A;  1G52 A;  1G0F A;  1OKM A;  3RJ7 A;  4E3G A;  5EKM A;  4PYY A;  1RAZ A;  3SAP A;  1I9N A;  2POU A;  2Q1Q A;  3KLD B;  3T5U A;  2CAB A;  4CA2 A;  5DSO A;  4KP8 A;  4Q09 A;  4Q7P A;  3S77 B;  2NWO A;  1G1D A;  1TE3 X;  1TH9 A;  4Z0Q A;  1BN4 A;  1OQ5 A;  5EZT X;  4E3H A;  3RG4 A;  5FNJ A;  1LUG A;  4FPT A;  2FOS A;  1IF6 A;  2POW A;  3BL0 A;  1G6V A;  2FOY A;  1BNU A;  1CZM A;  4YGK A;  3KOI A;  5AMG A;  4ZWI A;  1EOU A;  2CBC A;  3PYK A;  3ML2 A;  5JEP B;  1I91 A;  1UGA A;  1G53 A;  3T84 A;  1CAN A;  5JGT B;  1I8Z A;  3P4V A;  4ITO A;  4MDG A;  4TWL A;  1I9Q A;  1JD0 A;  1Z9Y A;  1TG3 A;  5JES B;  3M5E A;  1CAM A;  9CA2 A;  1YO2 A;  5E2S A;  2NWY A;  4Q0L A;  1IF4 A;  1CA3 A;  3HS4 A;  2H15 A;  3D93 A;  3DD0 A;  3JXF A;  1CCS A;  5A6H A;  5JQT A;  4WUQ A;  1AVN A;  4KUW A;  3LXE A;  4JSW A;  3VBD A;  1G45 A;  1UGF A;  1DMX A;  2WEO A;  2FNM A;  3P44 A;  3SBH A;  4Q49 A;  5FLT A;  1MOO A;  3U47 A;  1RAY A;  3V2J A;  1FQL A;  4Q8Z A;  4YGF A;  3M5T A;  1HED A;  2ABE A;  4ILX A;  1XEG A;  4G0C A;  4XE1 A;  1CIM A;  1I9L A;  3KS3 A;  4HEZ A;  5BRW A;  1HEA A;  3IBU A;  3OYQ A;  1IF9 A;  5SZ0 A;  3CAJ A;  4CNR A;  1CVE A;  4KUY A;  2HOC A;  4M2V A;  4Z1K A;  3ZNC A;  1OKL A;  2EU2 A;  3IEO A;  1DMY A;  4QIZ A;  3R17 B;  4CNW A;  1V9E A;  1CVH A;  4YXO A;  3KIG A;  3MYQ A;  2NMX A;  3M2Z A;  4KNI A;  3HKQ A;  4Q7V A;  2FOV A;  3T5Z A;  3S9T A;  4RH2 A;  3KOK A;  4ZWX A;  1HCB A;  4GL1 X;  4LU3 A;  5AMD A;  3PJJ A;  4Q6D A;  4YGJ A;  2FW4 A;  3BET A;  5JG5 B;  3RYZ A;  3RG3 A;  4HEY A;  3T82 A;  4CNV A;  3RZ1 B;  1CRA A;  5EKJ A;  5JDV B;  3QYK A;  3RZ8 A;  5SZ7 A;  3OIM A;  1G4O A;  1RZD A;  2NN7 A;  5DOG A;  4KAP A;  2ILI A;  5FNK A;  2X7T A;  3TVO X;  4Q06 A;  4L5W A;  4HU1 A;  3UYQ A;  4BF1 A;  4X5S A;  3N2P A;  4Q90 A;  5EKH A;  2NXS A;  4ZAO A;  5FL6 A;  3JXH C;  3B4F A;  3MHO A;  1CIL A;  2QO8 A;  4PZH A;  5DSL A;  4KNN A;  5BYI A;  3D0N A;  3DVD A;  2IT4 A;  1HUG A;  4KP5 A;  1FSR A;  4UOV A;  4HEW A;  1YDD A;  3V3H B;  3DA2 A;  3M96 A;  5DSN A;  5SZ1 A;  4N16 A;  5IPZ A;  3HLJ A;  3P55 A;  4XFW A;  5FDC A;  1XQ0 A;  4RUZ A;  1ZFQ A;  5DOH A;  1Y7W A;  1JV0 A;  4RUX A;  4XIW A;  3S72 B;  4KNM A;  4KV0 A;  5E2M A;  3U3A X;  1UGG A;  1RJ5 A;  3DVB A;  1BCD A;  1DCB A;  4IDR X;  4XIX A;  1CNH A;  4HT0 A;  2WEJ A;  5FNH A;  5E2N A;  2WD2 A;  5A25 A;  1UGB A;  2NXT A;  3DAZ A;  2HNC A;  1BNQ A;  4Q83 A;  3M04 A;  4JSS A;  3B1B A;  2ZNC A;  3P3J A;  5CA2 A;  4YYT A;  2HKK A;  1BNT A;  2FNK A;  1KEQ A;  4DZ9 A;  5FLQ A;  1CVF A;  1TBT X;  3C7P A;  4ZWY A;  5JQ0 A;  4Q87 A;  4MLT A;  4N0X B;  5DVX A;  3FE4 A;  1CNJ A;  1THK A;  4R59 A;  3W6H A;  3CA2 A;  5CAC A;  5FNM A;  3MZC A;  4Q7S A;  3N3J A;  4R5A A;  3IGP A;  5DSK A;  4CQ0 A;  4KUV A;  3L14 A;  4DZ7 A;  5L3O A;  3KWA A;  4TWM A;  5FLP A;  2HL4 A;  3OIL A;  1FQN A;  1YDC A;  4FVN A;  1FSQ A;  5SZ5 A;  4FIK A;  3D92 A;  1CCU A;  3MNA A;  1CVD A;  4M2R A;  4E4A A;  3M3X A;  1H9Q A;  3M2Y A;  4JSA A;  3DBU A;  5DSI A;  1CVC A;  3DC9 A;  3V3J A;  1G3Z A;  1LG6 A;  3MNJ A;  5G03 A;  3S8X A;  4Q8Y A;  1FSN A;  3M67 A;  2NWP A;  3RLD A;  3S97 A;  4QEF A;  4C3T A;  3IBL A;  1CNG A;  5JEG B;  6CA2 A;  5E28 A;  2FOU A;  1Z93 A;  3DCC A;  3MNK A;  1F2W A;  1FR4 A;  4QJO A;  1JCZ A;  1CNB A;  1UGC A;  3EFT A;  1CAK A;  3P5A A;  3P3H A;  1CRM A;  4K0Z A;  3M1K A;  4E49 A;  3T83 A;  4QTL A;  1G4J A;  5EHV A;  5SZ2 A;  3V7X A;  2OSF A;  4PQ7 A;  5FNG A;  2Q1B A;  2OSM A;  1IF5 A;  8CA2 A;  2NN1 A;  3KNE A;  4Q8X A;  5FNI A;  1BN1 A;  1IF7 A;  1G48 A;  2AW1 A;  1CNW A;  3K7K A;  5CJF A; 
#chains in the Genus database with same CATH homology
 3S74 B;  1DCA A;  1XEV A;  1YDB A;  1I90 A;  1CAO A;  1HEB A;  4MDL A;  2NXR A;  5AML A;  3S73 B;  3BL1 A;  4RFD A;  3ML5 A;  3RYY A;  3RZ0 B;  3V5G A;  5DSP A;  1HCA A;  4BF6 A;  4Q78 A;  3K34 A;  3EFI A;  4MO8 A;  4CAC A;  1ZSB A;  5G0B A;  3F4X A;  4QJX A;  2POV A;  4MDM A;  3OIK A;  2HFW A;  3F7U A;  3HKT A;  4Y0J A;  4L5U A;  4Q6E A;  2O4Z A;  3NI5 A;  5C8I A;  2QOA A;  3S71 B;  3R16 A;  1H4N A;  4L5V A;  3DC3 A;  1HVA A;  4WW6 A;  1CAZ A;  4HF3 A;  4QJW A;  4QK1 A;  2X7S A;  3N0N A;  3RZ5 A;  3NB5 A;  1KOP A;  4XZ5 A;  3K2F A;  1Z97 A;  4COQ A;  1FQR A;  3S75 B;  1URT A;  1BNN A;  3M2N A;  4K13 A;  3RGE A;  5DSM A;  2VVA X;  2AX2 A;  4WW8 A;  4YHA A;  2WD3 A;  4HBA A;  4YGL A;  4RIU A;  4ZX0 A;  3MHL A;  5FLS A;  4BCW A;  1G0E A;  1CVB A;  3V3F A;  3P5L A;  5CLU A;  3DV7 A;  5EH5 A;  5E5R A;  4M2W A;  4ZX1 A;  1A42 A;  1ZSC A;  2W2J A;  3KON A;  1CCT A;  1CNX A;  4Z1N A;  3M98 A;  1CAH A;  3Q31 A;  3RZ7 A;  1RZB A;  2NNG A;  4QSI A;  4Q81 A;  1BNV A;  1TEQ X;  1CAI A;  2FNN A;  3FFP X;  1HEC A;  4YXU A;  2CBB A;  4E3F A;  4QJM A;  3MWO A;  4FVO A;  1YO0 A;  1UGD A;  5EHE A;  3D8W A;  3TVN X;  4K1Q A;  3FW3 A;  4QK2 A;  4ZWZ A;  4QJP A;  1I9M A;  4WUP A;  3MNU A;  4Q99 A;  5G0C A;  4K0S A;  4MLX A;  4Z1E A;  3N4B A;  5BRV A;  1AM6 A;  3F7B A;  3M5S A;  4FL7 A;  5L6K A;  1G54 A;  5FLO A;  4QK3 A;  1J9W A;  2NNV A;  5DSJ A;  4Q9Y A;  1I9O A;  2NWZ A;  5E2K A;  1KWQ A;  1FLJ A;  4YWP A;  5BRU A;  3OKU A;  4Q7W A;  4MTY A;  12CA A;  5JG3 B;  1BZM A;  2EU3 A;  3HKU A;  3ZP9 A;  1CAJ A;  3MNI A;  3CYU A;  3U7C A;  1TTM A;  2EZ7 A;  3M40 A;  1CAL A;  3CZV A;  5DSQ A;  5E5U A;  2NNO A;  1RJ6 A;  4FU5 A;  4PXX A;  3MMF A;  2X7U A;  1RZA A;  3DCS A;  3M1W A;  3PO6 A;  2CBA A;  3F8E A;  5E2R A;  5LMD A;  3MHC A;  3RYJ B;  3V3I B;  4JS6 A;  1H9N A;  1CNK A;  3MHI A;  4ETQ C;  3W6I A;  1AZM A;  2FMZ A;  3HKN A;  4QIY A;  2HD6 A;  3DVC A;  3KKX A;  4Q07 A;  1G46 A;  5FDI A;  5EHW A;  5DSR A;  4E3D A;  5DRS A;  4LHI A;  1CNC A;  4WR7 A;  4QY3 A;  1LG5 A;  3D9Z A;  5BNL A;  4RFC A;  4RIV A;  3M14 A;  2QP6 A;  3IBN A;  1XPZ A;  1ZNC A;  4FRC A;  4K0T A;  3JXG A;  5G01 A;  4E9O X;  1BNW A;  5EOI A;  4R5B A;  3MDZ A;  3SBI A;  5SZ3 A;  3S78 B;  3OY0 A;  2WEH A;  4RUY A;  1OKN A;  5J8Z A;  1YO1 A;  1BN3 A;  4KNJ A;  5EH7 A;  5JGS B;  2CBD A;  4QSA A;  4G7A A;  4PYX A;  3DCW A;  4WL4 A;  4ITP A;  3M2X A;  4LP6 A;  5JEH B;  3TMJ A;  4HT2 A;  4YXI A;  3V2M A;  1CVA A;  3NJ9 A;  1ZE8 A;  4RN4 A;  1IF8 A;  2FOQ A;  1ZGF A;  1ZGE A;  3UYN A;  2F14 A;  4QJ0 A;  4Z1J A;  3IAI A;  3M1J A;  2GD8 A;  1BV3 A;  4YX4 A;  3SAX A;  1TEU X;  2WEG A;  4YGN A;  5EIJ A;  2NNS A;  5FL4 A;  1RZC A;  1BIC A;  1YDA A;  4JSZ A;  1RZE A;  2CA2 A;  4Q08 A;  4QSB A;  2Q38 A;  3M1Q A;  4M2U A;  1HUH A;  2CBE A;  1TG9 A;  4IWZ A;  3S76 A;  3MNH A;  3DD8 A;  3T85 A;  1UGE A;  1ZFK A;  3P58 A;  5FL5 A;  1ZH9 A;  1FR7 A;  1LZV A;  2H4N A;  5SZ4 A;  3OYS A;  4QSJ A;  3MHM A;  1FQM A;  3IBI A;  5EH8 A;  1I9P A;  1ZSA A;  7CA2 A;  1CIN A;  5SZ6 A;  5FLR A;  1V9I C;  5FNL A;  3RYX B;  1T9N A;  3OKV A;  3U45 X;  1MUA A;  4CNX A;  2FMG A;  2VVB X;  3V3G B;  1KWR A;  1CA2 A;  1CNY A;  3GZ0 A;  1TB0 X;  3HFP A;  3RYV B;  4E5Q A;  1LGD A;  5HPJ A;  1CAY A;  1BNM A;  4YVY A;  1KOQ A;  2GEH A;  1CNI A;  1G52 A;  1G0F A;  1OKM A;  3RJ7 A;  4E3G A;  5EKM A;  4PYY A;  1RAZ A;  3SAP A;  1I9N A;  2POU A;  2Q1Q A;  3KLD B;  3T5U A;  2CAB A;  4CA2 A;  5DSO A;  4KP8 A;  4Q09 A;  4Q7P A;  3S77 B;  2NWO A;  1G1D A;  1TE3 X;  1TH9 A;  4Z0Q A;  1BN4 A;  1OQ5 A;  5EZT X;  4E3H A;  3RG4 A;  5FNJ A;  1LUG A;  4FPT A;  2FOS A;  1IF6 A;  2POW A;  3BL0 A;  1G6V A;  2FOY A;  1BNU A;  1CZM A;  4YGK A;  3KOI A;  5AMG A;  4ZWI A;  1EOU A;  2CBC A;  3PYK A;  3ML2 A;  5JEP B;  1I91 A;  1UGA A;  1G53 A;  3T84 A;  1CAN A;  5JGT B;  1I8Z A;  3P4V A;  4ITO A;  4MDG A;  4TWL A;  1I9Q A;  1JD0 A;  1Z9Y A;  1TG3 A;  5JES B;  3M5E A;  1CAM A;  9CA2 A;  1YO2 A;  5E2S A;  2NWY A;  4Q0L A;  1IF4 A;  1CA3 A;  3HS4 A;  2H15 A;  3D93 A;  3DD0 A;  3JXF A;  1CCS A;  5A6H A;  5JQT A;  4WUQ A;  1AVN A;  4KUW A;  3LXE A;  4JSW A;  3VBD A;  1G45 A;  1UGF A;  1DMX A;  2WEO A;  2FNM A;  3P44 A;  3SBH A;  4Q49 A;  5FLT A;  1MOO A;  3U47 A;  1RAY A;  3V2J A;  1FQL A;  4Q8Z A;  4YGF A;  3M5T A;  1HED A;  2ABE A;  4ILX A;  1XEG A;  4G0C A;  4XE1 A;  1CIM A;  1I9L A;  3KS3 A;  4HEZ A;  5BRW A;  1HEA A;  3IBU A;  3OYQ A;  1IF9 A;  5SZ0 A;  3CAJ A;  4CNR A;  1CVE A;  4KUY A;  2HOC A;  4M2V A;  4Z1K A;  3ZNC A;  1OKL A;  2EU2 A;  3IEO A;  1DMY A;  4QIZ A;  3R17 B;  4CNW A;  1V9E A;  1CVH A;  4YXO A;  3KIG A;  3MYQ A;  2NMX A;  3M2Z A;  4KNI A;  3HKQ A;  4Q7V A;  2FOV A;  3T5Z A;  3S9T A;  4RH2 A;  3KOK A;  4ZWX A;  1HCB A;  4GL1 X;  4LU3 A;  5AMD A;  3PJJ A;  4Q6D A;  4YGJ A;  2FW4 A;  3BET A;  5JG5 B;  3RYZ A;  3RG3 A;  4HEY A;  3T82 A;  4CNV A;  3RZ1 B;  1CRA A;  5EKJ A;  5JDV B;  3QYK A;  3RZ8 A;  5SZ7 A;  3OIM A;  1G4O A;  1RZD A;  2NN7 A;  5DOG A;  4KAP A;  2ILI A;  5FNK A;  2X7T A;  3TVO X;  4Q06 A;  4L5W A;  4HU1 A;  3UYQ A;  4BF1 A;  4X5S A;  3N2P A;  4Q90 A;  5EKH A;  2NXS A;  4ZAO A;  5FL6 A;  3JXH C;  3B4F A;  3MHO A;  1CIL A;  2QO8 A;  4PZH A;  5DSL A;  4KNN A;  5BYI A;  3D0N A;  3DVD A;  2IT4 A;  1HUG A;  4KP5 A;  1FSR A;  4UOV A;  4HEW A;  1YDD A;  3V3H B;  3DA2 A;  3M96 A;  5DSN A;  5SZ1 A;  4N16 A;  5IPZ A;  3HLJ A;  3P55 A;  4XFW A;  5FDC A;  1XQ0 A;  4RUZ A;  1ZFQ A;  5DOH A;  1Y7W A;  1JV0 A;  4RUX A;  4XIW A;  3S72 B;  4KNM A;  4KV0 A;  5E2M A;  3U3A X;  1UGG A;  1RJ5 A;  3DVB A;  1BCD A;  1DCB A;  4IDR X;  4XIX A;  1CNH A;  4HT0 A;  2WEJ A;  5FNH A;  5E2N A;  2WD2 A;  5A25 A;  1UGB A;  2NXT A;  3DAZ A;  2HNC A;  1BNQ A;  4Q83 A;  3M04 A;  4JSS A;  3B1B A;  2ZNC A;  3P3J A;  5CA2 A;  4YYT A;  2HKK A;  1BNT A;  2FNK A;  1KEQ A;  4DZ9 A;  5FLQ A;  1CVF A;  1TBT X;  3C7P A;  4ZWY A;  5JQ0 A;  4Q87 A;  4MLT A;  4N0X B;  5DVX A;  3FE4 A;  1CNJ A;  1THK A;  4R59 A;  3W6H A;  3CA2 A;  5CAC A;  5FNM A;  3MZC A;  4Q7S A;  3N3J A;  4R5A A;  3IGP A;  5DSK A;  4CQ0 A;  4KUV A;  3L14 A;  4DZ7 A;  5L3O A;  3KWA A;  4TWM A;  5FLP A;  2HL4 A;  3OIL A;  1FQN A;  1YDC A;  4FVN A;  1FSQ A;  5SZ5 A;  4FIK A;  3D92 A;  1CCU A;  3MNA A;  1CVD A;  4M2R A;  4E4A A;  3M3X A;  1H9Q A;  3M2Y A;  4JSA A;  3DBU A;  5DSI A;  1CVC A;  3DC9 A;  3V3J A;  1G3Z A;  1LG6 A;  3MNJ A;  5G03 A;  3S8X A;  4Q8Y A;  1FSN A;  3M67 A;  2NWP A;  3RLD A;  3S97 A;  4QEF A;  4C3T A;  3IBL A;  1CNG A;  5JEG B;  6CA2 A;  5E28 A;  2FOU A;  1Z93 A;  3DCC A;  3MNK A;  1F2W A;  1FR4 A;  4QJO A;  1JCZ A;  1CNB A;  1UGC A;  3EFT A;  1CAK A;  3P5A A;  3P3H A;  1CRM A;  4K0Z A;  3M1K A;  4E49 A;  3T83 A;  4QTL A;  1G4J A;  5EHV A;  5SZ2 A;  3V7X A;  2OSF A;  4PQ7 A;  5FNG A;  2Q1B A;  2OSM A;  1IF5 A;  8CA2 A;  2NN1 A;  3KNE A;  4Q8X A;  5FNI A;  1BN1 A;  1IF7 A;  1G48 A;  2AW1 A;  1CNW A;  3K7K A;  5CJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...