2NN1A

Structure of inhibitor binding to carbonic anhydrase i
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
Knots found
sequence length
258
structure length
258
Chain Sequence
PDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of Charge Discrimination in the Binding of Inhibitors to Human Carbonic Anhydrases I and II
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Carbonic anhydrase 1
total genus 73
structure length 258
sequence length 258
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2006-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 2nn1A00
3FW3A 4HEWA 3QYKA 4K0ZA 3F8EA 5SZ5A 3ML2A 3U3AX 2HD6A 2HKKA 1CAJA 5FNGA 4CACA 4KP8A 2IT4A 1CNGA 4YGKA 5FLRA 4KUVA 5FDIA 4FPTA 1ZGEA 1CRMA 1I9MA 5HPJA 2NN7A 3IEOA 3S72B 3N4BA 4WL4A 1TBTX 1BNWA 4YXIA 3KS3A 5FLTA 3MHMA 4GL1X 3RZ1B 3M1KA 4FIKA 1BNUA 3TVOX 4RN4A 2CBAA 4Z1NA 1V9EA 4CNWA 4Z1KA 1G52A 5FLOA 4ZWZA 3D8WA 3S8XA 4Y0JA 3MWOA 1HEBA 1OKNA 1AM6A 1G6VA 1TH9A 2HNCA 3NB5A 4QK1A 4KNJA 4G0CA 1I9LA 4DZ9A 4WW8A 1THKA 1BV3A 5DSNA 3F4XA 1KEQA 2GEHA 1CAYA 3P3JA 2FOUA 2O4ZA 4E3FA 3V2JA 5FNLA 3R17B 4Q09A 4Z1EA 1ZGFA 3PJJA 3LXEA 1CAIA 3MMFA 4Q7PA 4JSAA 1RZEA 3SAXA 4HEZA 4KAPA 3MHIA 4KNIA 4ITOA 5EKJA 4YGNA 5DSLA 3RYZA 3DCSA 1G4OA 3KIGA 1LGDA 3KKXA 5SZ3A 1RJ6A 1FQMA 3SAPA 1CAZA 5FNKA 2OSFA 3M2YA 3MDZA 4QSAA 3B1BA 4E4AA 4QEFA 1CVFA 1T9NA 1XEGA 1TG3A 3RZ8A 3OIMA 3HLJA 1RZBA 1ZSBA 3OILA 3IGPA 4QJPA 4Q90A 3HKNA 3UYNA 2GD8A 1FSRA 1ZE8A 2H15A 1HUHA 1FQRA 3CZVA 3V3IB 3RGEA 1CNHA 5DRSA 5FL5A 1CANA 1BN4A 5EZTX 2FOYA 3OKVA 5CACA 3JXGA 1UGBA 4ETQC 4YXOA 4QJWA 1YDBA 4ZX0A 2WD2A 4KUYA 3P3HA 3MNIA 4FVOA 1G53A 3RYJB 5J8ZA 4QJMA 3W6IA 1TG9A 3KOKA 4XIXA 5DSQA 2Q38A 2QOAA 4Q7SA 4QSBA 3M5TA 4JSSA 5FL6A 3S76A 3U47A 1AZMA 5AMDA 4K1QA 3ZNCA 4E49A 4ZX1A 3F7UA 1FSNA 3KNEA 4LHIA 4Q8ZA 4QY3A 1IF9A 3D93A 1TB0X 4MLTA 2AW1A 4N16A 4MDMA 5EKHA 3M98A 3K34A 5DSIA 3T83A 3RG4A 2CABA 4RIVA 3KLDB 3DBUA 3U45X 4M2WA 4G7AA 3JXHC 3GZ0A 5E28A 4M2VA 3S9TA 2W2JA 1CNIA 3SBHA 1CVBA 1G48A 4PYYA 1YDCA 4HBAA 5A6HA 3CYUA 4QIZA 1G3ZA 3OY0A 1YO0A 3M3XA 1FR7A 1I91A 5L6KA 3KOIA 3MNAA 3S97A 4TWMA 2WEHA 3RLDA 4HF3A 4PQ7A 2FOQA 4YXUA 3OYSA 4MLXA 1BN1A 3FE4A 4HT2A 1HCAA 1CRAA 5IPZA 4PYXA 1RZCA 5BRVA 4YGLA 3D0NA 1CVHA 3S75B 4Q8XA 4Q8YA 2HOCA 3PO6A 3UYQA 3M40A 5JEPB 3M14A 5G0CA 4YVYA 1JD0A 4E9OX 1BNTA 4XFWA 2NNVA 1EOUA 5JDVB 4QJ0A 3V5GA 1G46A 2CBCA 2QO8A 5EOIA 5C8IA 3M5SA 3N2PA 4Q81A 1JV0A 1YDDA 4ITPA 3T5UA 1FLJA 4CNXA 4Q6DA 1F2WA 1FQLA 1Z93A 1CAOA 1IF7A 3MHOA 3M1QA 6CA2A 4WUQA 5SZ0A 3T84A 1XEVA 4QSJA 3P5LA 2NWOA 1HECA 1CCUA 3RZ5A 3TMJA 1IF5A 4ZWYA 3U7CA 2CBBA 3FFPX 1CVCA 5FL4A 3DVDA 5BRUA 4IDRX 2NXSA 4L5VA 3IAIA 5FLPA 1CIMA 4ZWXA 3DCWA 1G0FA 3NI5A 4QK3A 5CA2A 5DOHA 1CZMA 3MNKA 1TEUX 4N0XB 4YHAA 3BL1A 8CA2A 3S74B 1UGCA 3IBIA 4QJOA 4E3DA 3P55A 1CILA 3L14A 3CA2A 3KONA 1CA3A 1CNBA 5FNHA 3V3FA 3V7XA 1FSQA 1TE3X 2NNOA 1RAYA 3R16A 9CA2A 5FDCA 5SZ1A 4RUYA 3RYVB 5EHWA 1BZMA 2NMXA 4E5QA 1YO2A 4CQ0A 4YX4A 4Q87A 3M2XA 3W6HA 1CAMA 4QTLA 3NJ9A 3TVNX 3ZP9A 1CVDA 4FU5A 4RIUA 1CNYA 3D92A 3CAJA 5DSKA 1CINA 12CAA 1URTA 1CAKA 1CVAA 5G01A 5DSJA 1LUGA 4WW6A 1I8ZA 3MYQA 4FRCA 3MNJA 4MDGA 1YDAA 3N3JA 4R59A 1HVAA 4JSWA 5FNJA 3M2NA 4Z0QA 1RZAA 4R5BA 5CJFA 3HKQA 3Q31A 3OIKA 4QSIA 3DCCA 2X7UA 3RYYA 1CA2A 1RAZA 7CA2A 2WEGA 2NXRA 1H9QA 4K0TA 1Z9YA 5A25A 2NNSA 4IWZA 5EKMA 5BYIA 1FR4A 3D9ZA 5G03A 4C3TA 3C7PA 4Q07A 1JCZA 4JS6A 5JQ0A 2X7TA 3T5ZA 5EHEA 1CNCA 1UGDA 3M1WA 1H9NA 2POWA 5JG3B 2NNGA 2FMGA 2F14A 4Q78A 3DD8A 4MO8A 3OYQA 5BNLA 1ZFQA 1LG6A 3DV7A 1OQ5A 4LU3A 3RYXB 3SBIA 5E2SA 1DMXA 1V9IC 2NWZA 2NWYA 3EFIA 3RG3A 2FW4A 1A42A 5E2NA 4COQA 1BNQA 1I9NA 1ZH9A 3BL0A 4K13A 5L3OA 1XPZA 2ABEA 5E5UA 3RZ7A 5FNIA 5EH5A 4L5WA 2CBEA 1AVNA 4WR7A 3MZCA 4CNRA 4MDLA 4CA2A 1IF4A 1OKMA 2POVA 3B4FA 2AX2A 4Q0LA 3T85A 2FOSA 5JG5B 4QJXA 4XIWA 2OSMA 1UGGA 1OKLA 4DZ7A 1G0EA 1CAHA 1HCBA 4ZAOA 5DSPA 1UGFA 3KWAA 1KWRA 4HT0A 5JQTA 2HFWA 1KOQA 3V3HB 5EHVA 3P44A 1LZVA 5CLUA 4KNMA 1H4NA 2NN1A 4Z1JA 1G54A 5EH8A 5JGSB 3HKUA 1ZSAA 4YWPA 3M5EA 3K2FA 1TTMA 3HFPA 1J9WA 3DC9A 3F7BA 5SZ6A 4YYTA 1TEQX 2Q1QA 2QP6A 3K7KA 4KNNA 1ZFKA 3N0NA 4Q6EA 4YGFA 3VBDA 5FLQA 1BICA 3M1JA 2VVAX 1MUAA 5EIJA 4XZ5A 3HS4A 3DD0A 1RZDA 4RUXA 4BF1A 2EU2A 4Q08A 4L5UA 1BN3A 5E2KA 4FVNA 3RJ7A 1CCSA 4Q06A 5SZ7A 4PXXA 3RZ0B 1DCBA 5JGTB 1Y7WA 4RFDA 3V3JA 2EZ7A 3M2ZA 4FL7A 1CALA 5FNMA 3M04A 1BNNA 5DSMA 2CBDA 4Q99A 5DOGA 3DA2A 1FQNA 3DVCA 4R5AA 3IBUA 4XE1A 1KWQA 1XQ0A 1LG5A 2H4NA 3EFTA 1I9OA 1ZSCA 3DC3A 4Q49A 4QIYA 1DMYA 1BNVA 4RUZA 5LMDA 2Q1BA 2FNNA 1MOOA 4LP6A 4Q7VA 5G0BA 2POUA 1G4JA 4HEYA 5E5RA 4KUWA 5AMGA 2WD3A 3DAZA 5JESB 5FLSA 4X5SA 3MHLA 2WEOA 3ML5A 3MNUA 4ZWIA 2EU3A 2NXTA 2FNMA 1CNXA 4M2UA 4E3HA 4ILXA 1I90A 4UOVA 1G1DA 3PYKA 3V2MA 4CNVA 1CNWA 2FNKA 2WEJA 3BETA 3P5AA 4TWLA 4HU1A 5SZ2A 2NWPA 4KP5A 4BCWA 2HL4A 4WUPA 3P58A 1KOPA 4RFCA 5DSOA 5EH7A 1DCAA 5E2MA 4Q9YA 1CCTA 4E3GA 1UGEA 3V3GB 3S73B 5AMLA 1HUGA 2FMZA 1CVEA 2ZNCA 1BCDA 1BNMA 1ZNCA 1CNJA 5SZ4A 4K0SA 3M96A 4Q83A 4YGJA 3IBLA 1Z97A 1HEDA 3S71B 5E2RA 2CA2A 3HKTA 4MTYA 1YO1A 2X7SA 4Q7WA 4QK2A 4RH2A 5JEGB 4M2RA 1I9QA 3MNHA 3OKUA 2VVBX 3DVBA 1HEAA 1I9PA 5DSRA 1G45A 5JEHB 4PZHA 1IF6A 3JXFA 4BF6A 3P4VA 1RJ5A 1IF8A 3M67A 4KV0A 1UGAA 3IBNA 3MHCA 3S78B 5DVXA 2FOVA 4JSZA 3S77B 3T82A 5BRWA 1CNKA 2ILIA
chains in the Genus database with same CATH superfamily
3FW3A 4HEWA 3QYKA 4K0ZA 3F8EA 5SZ5A 3ML2A 3U3AX 2HD6A 2HKKA 1CAJA 5FNGA 4CACA 4KP8A 2IT4A 1CNGA 4YGKA 5FLRA 4KUVA 5FDIA 4FPTA 1ZGEA 1CRMA 1I9MA 5HPJA 2NN7A 3IEOA 3S72B 3N4BA 4WL4A 1TBTX 1BNWA 4YXIA 3KS3A 5FLTA 3MHMA 4GL1X 3RZ1B 3M1KA 4FIKA 1BNUA 3TVOX 4RN4A 2CBAA 4Z1NA 1V9EA 4CNWA 4Z1KA 1G52A 5FLOA 4ZWZA 3D8WA 3S8XA 4Y0JA 3MWOA 1HEBA 1OKNA 1AM6A 1G6VA 1TH9A 2HNCA 3NB5A 4QK1A 4KNJA 4G0CA 1I9LA 4DZ9A 4WW8A 1THKA 1BV3A 5DSNA 3F4XA 1KEQA 2GEHA 1CAYA 3P3JA 2FOUA 2O4ZA 4E3FA 3V2JA 5FNLA 3R17B 4Q09A 4Z1EA 1ZGFA 3PJJA 3LXEA 1CAIA 3MMFA 4Q7PA 4JSAA 1RZEA 3SAXA 4HEZA 4KAPA 3MHIA 4KNIA 4ITOA 5EKJA 4YGNA 5DSLA 3RYZA 3DCSA 1G4OA 3KIGA 1LGDA 3KKXA 5SZ3A 1RJ6A 1FQMA 3SAPA 1CAZA 5FNKA 2OSFA 3M2YA 3MDZA 4QSAA 3B1BA 4E4AA 4QEFA 1CVFA 1T9NA 1XEGA 1TG3A 3RZ8A 3OIMA 3HLJA 1RZBA 1ZSBA 3OILA 3IGPA 4QJPA 4Q90A 3HKNA 3UYNA 2GD8A 1FSRA 1ZE8A 2H15A 1HUHA 1FQRA 3CZVA 3V3IB 3RGEA 1CNHA 5DRSA 5FL5A 1CANA 1BN4A 5EZTX 2FOYA 3OKVA 5CACA 3JXGA 1UGBA 4ETQC 4YXOA 4QJWA 1YDBA 4ZX0A 2WD2A 4KUYA 3P3HA 3MNIA 4FVOA 1G53A 3RYJB 5J8ZA 4QJMA 3W6IA 1TG9A 3KOKA 4XIXA 5DSQA 2Q38A 2QOAA 4Q7SA 4QSBA 3M5TA 4JSSA 5FL6A 3S76A 3U47A 1AZMA 5AMDA 4K1QA 3ZNCA 4E49A 4ZX1A 3F7UA 1FSNA 3KNEA 4LHIA 4Q8ZA 4QY3A 1IF9A 3D93A 1TB0X 4MLTA 2AW1A 4N16A 4MDMA 5EKHA 3M98A 3K34A 5DSIA 3T83A 3RG4A 2CABA 4RIVA 3KLDB 3DBUA 3U45X 4M2WA 4G7AA 3JXHC 3GZ0A 5E28A 4M2VA 3S9TA 2W2JA 1CNIA 3SBHA 1CVBA 1G48A 4PYYA 1YDCA 4HBAA 5A6HA 3CYUA 4QIZA 1G3ZA 3OY0A 1YO0A 3M3XA 1FR7A 1I91A 5L6KA 3KOIA 3MNAA 3S97A 4TWMA 2WEHA 3RLDA 4HF3A 4PQ7A 2FOQA 4YXUA 3OYSA 4MLXA 1BN1A 3FE4A 4HT2A 1HCAA 1CRAA 5IPZA 4PYXA 1RZCA 5BRVA 4YGLA 3D0NA 1CVHA 3S75B 4Q8XA 4Q8YA 2HOCA 3PO6A 3UYQA 3M40A 5JEPB 3M14A 5G0CA 4YVYA 1JD0A 4E9OX 1BNTA 4XFWA 2NNVA 1EOUA 5JDVB 4QJ0A 3V5GA 1G46A 2CBCA 2QO8A 5EOIA 5C8IA 3M5SA 3N2PA 4Q81A 1JV0A 1YDDA 4ITPA 3T5UA 1FLJA 4CNXA 4Q6DA 1F2WA 1FQLA 1Z93A 1CAOA 1IF7A 3MHOA 3M1QA 6CA2A 4WUQA 5SZ0A 3T84A 1XEVA 4QSJA 3P5LA 2NWOA 1HECA 1CCUA 3RZ5A 3TMJA 1IF5A 4ZWYA 3U7CA 2CBBA 3FFPX 1CVCA 5FL4A 3DVDA 5BRUA 4IDRX 2NXSA 4L5VA 3IAIA 5FLPA 1CIMA 4ZWXA 3DCWA 1G0FA 3NI5A 4QK3A 5CA2A 5DOHA 1CZMA 3MNKA 1TEUX 4N0XB 4YHAA 3BL1A 8CA2A 3S74B 1UGCA 3IBIA 4QJOA 4E3DA 3P55A 1CILA 3L14A 3CA2A 3KONA 1CA3A 1CNBA 5FNHA 3V3FA 3V7XA 1FSQA 1TE3X 2NNOA 1RAYA 3R16A 9CA2A 5FDCA 5SZ1A 4RUYA 3RYVB 5EHWA 1BZMA 2NMXA 4E5QA 1YO2A 4CQ0A 4YX4A 4Q87A 3M2XA 3W6HA 1CAMA 4QTLA 3NJ9A 3TVNX 3ZP9A 1CVDA 4FU5A 4RIUA 1CNYA 3D92A 3CAJA 5DSKA 1CINA 12CAA 1URTA 1CAKA 1CVAA 5G01A 5DSJA 1LUGA 4WW6A 1I8ZA 3MYQA 4FRCA 3MNJA 4MDGA 1YDAA 3N3JA 4R59A 1HVAA 4JSWA 5FNJA 3M2NA 4Z0QA 1RZAA 4R5BA 5CJFA 3HKQA 3Q31A 3OIKA 4QSIA 3DCCA 2X7UA 3RYYA 1CA2A 1RAZA 7CA2A 2WEGA 2NXRA 1H9QA 4K0TA 1Z9YA 5A25A 2NNSA 4IWZA 5EKMA 5BYIA 1FR4A 3D9ZA 5G03A 4C3TA 3C7PA 4Q07A 1JCZA 4JS6A 5JQ0A 2X7TA 3T5ZA 5EHEA 1CNCA 1UGDA 3M1WA 1H9NA 2POWA 5JG3B 2NNGA 2FMGA 2F14A 4Q78A 3DD8A 4MO8A 3OYQA 5BNLA 1ZFQA 1LG6A 3DV7A 1OQ5A 4LU3A 3RYXB 3SBIA 5E2SA 1DMXA 1V9IC 2NWZA 2NWYA 3EFIA 3RG3A 2FW4A 1A42A 5E2NA 4COQA 1BNQA 1I9NA 1ZH9A 3BL0A 4K13A 5L3OA 1XPZA 2ABEA 5E5UA 3RZ7A 5FNIA 5EH5A 4L5WA 2CBEA 1AVNA 4WR7A 3MZCA 4CNRA 4MDLA 4CA2A 1IF4A 1OKMA 2POVA 3B4FA 2AX2A 4Q0LA 3T85A 2FOSA 5JG5B 4QJXA 4XIWA 2OSMA 1UGGA 1OKLA 4DZ7A 1G0EA 1CAHA 1HCBA 4ZAOA 5DSPA 1UGFA 3KWAA 1KWRA 4HT0A 5JQTA 2HFWA 1KOQA 3V3HB 5EHVA 3P44A 1LZVA 5CLUA 4KNMA 1H4NA 2NN1A 4Z1JA 1G54A 5EH8A 5JGSB 3HKUA 1ZSAA 4YWPA 3M5EA 3K2FA 1TTMA 3HFPA 1J9WA 3DC9A 3F7BA 5SZ6A 4YYTA 1TEQX 2Q1QA 2QP6A 3K7KA 4KNNA 1ZFKA 3N0NA 4Q6EA 4YGFA 3VBDA 5FLQA 1BICA 3M1JA 2VVAX 1MUAA 5EIJA 4XZ5A 3HS4A 3DD0A 1RZDA 4RUXA 4BF1A 2EU2A 4Q08A 4L5UA 1BN3A 5E2KA 4FVNA 3RJ7A 1CCSA 4Q06A 5SZ7A 4PXXA 3RZ0B 1DCBA 5JGTB 1Y7WA 4RFDA 3V3JA 2EZ7A 3M2ZA 4FL7A 1CALA 5FNMA 3M04A 1BNNA 5DSMA 2CBDA 4Q99A 5DOGA 3DA2A 1FQNA 3DVCA 4R5AA 3IBUA 4XE1A 1KWQA 1XQ0A 1LG5A 2H4NA 3EFTA 1I9OA 1ZSCA 3DC3A 4Q49A 4QIYA 1DMYA 1BNVA 4RUZA 5LMDA 2Q1BA 2FNNA 1MOOA 4LP6A 4Q7VA 5G0BA 2POUA 1G4JA 4HEYA 5E5RA 4KUWA 5AMGA 2WD3A 3DAZA 5JESB 5FLSA 4X5SA 3MHLA 2WEOA 3ML5A 3MNUA 4ZWIA 2EU3A 2NXTA 2FNMA 1CNXA 4M2UA 4E3HA 4ILXA 1I90A 4UOVA 1G1DA 3PYKA 3V2MA 4CNVA 1CNWA 2FNKA 2WEJA 3BETA 3P5AA 4TWLA 4HU1A 5SZ2A 2NWPA 4KP5A 4BCWA 2HL4A 4WUPA 3P58A 1KOPA 4RFCA 5DSOA 5EH7A 1DCAA 5E2MA 4Q9YA 1CCTA 4E3GA 1UGEA 3V3GB 3S73B 5AMLA 1HUGA 2FMZA 1CVEA 2ZNCA 1BCDA 1BNMA 1ZNCA 1CNJA 5SZ4A 4K0SA 3M96A 4Q83A 4YGJA 3IBLA 1Z97A 1HEDA 3S71B 5E2RA 2CA2A 3HKTA 4MTYA 1YO1A 2X7SA 4Q7WA 4QK2A 4RH2A 5JEGB 4M2RA 1I9QA 3MNHA 3OKUA 2VVBX 3DVBA 1HEAA 1I9PA 5DSRA 1G45A 5JEHB 4PZHA 1IF6A 3JXFA 4BF6A 3P4VA 1RJ5A 1IF8A 3M67A 4KV0A 1UGAA 3IBNA 3MHCA 3S78B 5DVXA 2FOVA 4JSZA 3S77B 3T82A 5BRWA 1CNKA 2ILIA
chains in the Genus database with same CATH topology
3FW3A 4HEWA 3QYKA 4K0ZA 3F8EA 5SZ5A 3ML2A 3U3AX 2HD6A 2HKKA 1CAJA 5FNGA 4CACA 4KP8A 2IT4A 1CNGA 4YGKA 5FLRA 4KUVA 5FDIA 4FPTA 1ZGEA 1CRMA 1I9MA 5HPJA 2NN7A 3IEOA 3S72B 3N4BA 4WL4A 1TBTX 1BNWA 4YXIA 3KS3A 5FLTA 3MHMA 4GL1X 3RZ1B 3M1KA 4FIKA 1BNUA 3TVOX 4RN4A 2CBAA 4Z1NA 1V9EA 4CNWA 4Z1KA 1G52A 5FLOA 4ZWZA 3D8WA 3S8XA 4Y0JA 3MWOA 1HEBA 1OKNA 1AM6A 1G6VA 1TH9A 2HNCA 3NB5A 4QK1A 4KNJA 4G0CA 1I9LA 4DZ9A 4WW8A 1THKA 1BV3A 5DSNA 3F4XA 1KEQA 2GEHA 1CAYA 3P3JA 2FOUA 2O4ZA 4E3FA 3V2JA 5FNLA 3R17B 4Q09A 4Z1EA 1ZGFA 3PJJA 3LXEA 1CAIA 3MMFA 4Q7PA 4JSAA 1RZEA 3SAXA 4HEZA 4KAPA 3MHIA 4KNIA 4ITOA 5EKJA 4YGNA 5DSLA 3RYZA 3DCSA 1G4OA 3KIGA 1LGDA 3KKXA 5SZ3A 1RJ6A 1FQMA 3SAPA 1CAZA 5FNKA 2OSFA 3M2YA 3MDZA 4QSAA 3B1BA 4E4AA 4QEFA 1CVFA 1T9NA 1XEGA 1TG3A 3RZ8A 3OIMA 3HLJA 1RZBA 1ZSBA 3OILA 3IGPA 4QJPA 4Q90A 3HKNA 3UYNA 2GD8A 1FSRA 1ZE8A 2H15A 1HUHA 1FQRA 3CZVA 3V3IB 3RGEA 1CNHA 5DRSA 5FL5A 1CANA 1BN4A 5EZTX 2FOYA 3OKVA 5CACA 3JXGA 1UGBA 4ETQC 4YXOA 4QJWA 1YDBA 4ZX0A 2WD2A 4KUYA 3P3HA 3MNIA 4FVOA 1G53A 3RYJB 5J8ZA 4QJMA 3W6IA 1TG9A 3KOKA 4XIXA 5DSQA 2Q38A 2QOAA 4Q7SA 4QSBA 3M5TA 4JSSA 5FL6A 3S76A 3U47A 1AZMA 5AMDA 4K1QA 3ZNCA 4E49A 4ZX1A 3F7UA 1FSNA 3KNEA 4LHIA 4Q8ZA 4QY3A 1IF9A 3D93A 1TB0X 4MLTA 2AW1A 4N16A 4MDMA 5EKHA 3M98A 3K34A 5DSIA 3T83A 3RG4A 2CABA 4RIVA 3KLDB 3DBUA 3U45X 4M2WA 4G7AA 3JXHC 3GZ0A 5E28A 4M2VA 3S9TA 2W2JA 1CNIA 3SBHA 1CVBA 1G48A 4PYYA 1YDCA 4HBAA 5A6HA 3CYUA 4QIZA 1G3ZA 3OY0A 1YO0A 3M3XA 1FR7A 1I91A 5L6KA 3KOIA 3MNAA 3S97A 4TWMA 2WEHA 3RLDA 4HF3A 4PQ7A 2FOQA 4YXUA 3OYSA 4MLXA 1BN1A 3FE4A 4HT2A 1HCAA 1CRAA 5IPZA 4PYXA 1RZCA 5BRVA 4YGLA 3D0NA 1CVHA 3S75B 4Q8XA 4Q8YA 2HOCA 3PO6A 3UYQA 3M40A 5JEPB 3M14A 5G0CA 4YVYA 1JD0A 4E9OX 1BNTA 4XFWA 2NNVA 1EOUA 5JDVB 4QJ0A 3V5GA 1G46A 2CBCA 2QO8A 5EOIA 5C8IA 3M5SA 3N2PA 4Q81A 1JV0A 1YDDA 4ITPA 3T5UA 1FLJA 4CNXA 4Q6DA 1F2WA 1FQLA 1Z93A 1CAOA 1IF7A 3MHOA 3M1QA 6CA2A 4WUQA 5SZ0A 3T84A 1XEVA 4QSJA 3P5LA 2NWOA 1HECA 1CCUA 3RZ5A 3TMJA 1IF5A 4ZWYA 3U7CA 2CBBA 3FFPX 1CVCA 5FL4A 3DVDA 5BRUA 4IDRX 2NXSA 4L5VA 3IAIA 5FLPA 1CIMA 4ZWXA 3DCWA 1G0FA 3NI5A 4QK3A 5CA2A 5DOHA 1CZMA 3MNKA 1TEUX 4N0XB 4YHAA 3BL1A 8CA2A 3S74B 1UGCA 3IBIA 4QJOA 4E3DA 3P55A 1CILA 3L14A 3CA2A 3KONA 1CA3A 1CNBA 5FNHA 3V3FA 3V7XA 1FSQA 1TE3X 2NNOA 1RAYA 3R16A 9CA2A 5FDCA 5SZ1A 4RUYA 3RYVB 5EHWA 1BZMA 2NMXA 4E5QA 1YO2A 4CQ0A 4YX4A 4Q87A 3M2XA 3W6HA 1CAMA 4QTLA 3NJ9A 3TVNX 3ZP9A 1CVDA 4FU5A 4RIUA 1CNYA 3D92A 3CAJA 5DSKA 1CINA 12CAA 1URTA 1CAKA 1CVAA 5G01A 5DSJA 1LUGA 4WW6A 1I8ZA 3MYQA 4FRCA 3MNJA 4MDGA 1YDAA 3N3JA 4R59A 1HVAA 4JSWA 5FNJA 3M2NA 4Z0QA 1RZAA 4R5BA 5CJFA 3HKQA 3Q31A 3OIKA 4QSIA 3DCCA 2X7UA 3RYYA 1CA2A 1RAZA 7CA2A 2WEGA 2NXRA 1H9QA 4K0TA 1Z9YA 5A25A 2NNSA 4IWZA 5EKMA 5BYIA 1FR4A 3D9ZA 5G03A 4C3TA 3C7PA 4Q07A 1JCZA 4JS6A 5JQ0A 2X7TA 3T5ZA 5EHEA 1CNCA 1UGDA 3M1WA 1H9NA 2POWA 5JG3B 2NNGA 2FMGA 2F14A 4Q78A 3DD8A 4MO8A 3OYQA 5BNLA 1ZFQA 1LG6A 3DV7A 1OQ5A 4LU3A 3RYXB 3SBIA 5E2SA 1DMXA 1V9IC 2NWZA 2NWYA 3EFIA 3RG3A 2FW4A 1A42A 5E2NA 4COQA 1BNQA 1I9NA 1ZH9A 3BL0A 4K13A 5L3OA 1XPZA 2ABEA 5E5UA 3RZ7A 5FNIA 5EH5A 4L5WA 2CBEA 1AVNA 4WR7A 3MZCA 4CNRA 4MDLA 4CA2A 1IF4A 1OKMA 2POVA 3B4FA 2AX2A 4Q0LA 3T85A 2FOSA 5JG5B 4QJXA 4XIWA 2OSMA 1UGGA 1OKLA 4DZ7A 1G0EA 1CAHA 1HCBA 4ZAOA 5DSPA 1UGFA 3KWAA 1KWRA 4HT0A 5JQTA 2HFWA 1KOQA 3V3HB 5EHVA 3P44A 1LZVA 5CLUA 4KNMA 1H4NA 2NN1A 4Z1JA 1G54A 5EH8A 5JGSB 3HKUA 1ZSAA 4YWPA 3M5EA 3K2FA 1TTMA 3HFPA 1J9WA 3DC9A 3F7BA 5SZ6A 4YYTA 1TEQX 2Q1QA 2QP6A 3K7KA 4KNNA 1ZFKA 3N0NA 4Q6EA 4YGFA 3VBDA 5FLQA 1BICA 3M1JA 2VVAX 1MUAA 5EIJA 4XZ5A 3HS4A 3DD0A 1RZDA 4RUXA 4BF1A 2EU2A 4Q08A 4L5UA 1BN3A 5E2KA 4FVNA 3RJ7A 1CCSA 4Q06A 5SZ7A 4PXXA 3RZ0B 1DCBA 5JGTB 1Y7WA 4RFDA 3V3JA 2EZ7A 3M2ZA 4FL7A 1CALA 5FNMA 3M04A 1BNNA 5DSMA 2CBDA 4Q99A 5DOGA 3DA2A 1FQNA 3DVCA 4R5AA 3IBUA 4XE1A 1KWQA 1XQ0A 1LG5A 2H4NA 3EFTA 1I9OA 1ZSCA 3DC3A 4Q49A 4QIYA 1DMYA 1BNVA 4RUZA 5LMDA 2Q1BA 2FNNA 1MOOA 4LP6A 4Q7VA 5G0BA 2POUA 1G4JA 4HEYA 5E5RA 4KUWA 5AMGA 2WD3A 3DAZA 5JESB 5FLSA 4X5SA 3MHLA 2WEOA 3ML5A 3MNUA 4ZWIA 2EU3A 2NXTA 2FNMA 1CNXA 4M2UA 4E3HA 4ILXA 1I90A 4UOVA 1G1DA 3PYKA 3V2MA 4CNVA 1CNWA 2FNKA 2WEJA 3BETA 3P5AA 4TWLA 4HU1A 5SZ2A 2NWPA 4KP5A 4BCWA 2HL4A 4WUPA 3P58A 1KOPA 4RFCA 5DSOA 5EH7A 1DCAA 5E2MA 4Q9YA 1CCTA 4E3GA 1UGEA 3V3GB 3S73B 5AMLA 1HUGA 2FMZA 1CVEA 2ZNCA 1BCDA 1BNMA 1ZNCA 1CNJA 5SZ4A 4K0SA 3M96A 4Q83A 4YGJA 3IBLA 1Z97A 1HEDA 3S71B 5E2RA 2CA2A 3HKTA 4MTYA 1YO1A 2X7SA 4Q7WA 4QK2A 4RH2A 5JEGB 4M2RA 1I9QA 3MNHA 3OKUA 2VVBX 3DVBA 1HEAA 1I9PA 5DSRA 1G45A 5JEHB 4PZHA 1IF6A 3JXFA 4BF6A 3P4VA 1RJ5A 1IF8A 3M67A 4KV0A 1UGAA 3IBNA 3MHCA 3S78B 5DVXA 2FOVA 4JSZA 3S77B 3T82A 5BRWA 1CNKA 2ILIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FW3 A;  4HEW A;  3QYK A;  4K0Z A;  3F8E A;  5SZ5 A;  3ML2 A;  3U3A X;  2HD6 A;  2HKK A;  1CAJ A;  5FNG A;  4CAC A;  4KP8 A;  2IT4 A;  1CNG A;  4YGK A;  5FLR A;  4KUV A;  5FDI A;  4FPT A;  1ZGE A;  1CRM A;  1I9M A;  5HPJ A;  2NN7 A;  3IEO A;  3S72 B;  3N4B A;  4WL4 A;  1TBT X;  1BNW A;  4YXI A;  3KS3 A;  5FLT A;  3MHM A;  4GL1 X;  3RZ1 B;  3M1K A;  4FIK A;  1BNU A;  3TVO X;  4RN4 A;  2CBA A;  4Z1N A;  1V9E A;  4CNW A;  4Z1K A;  1G52 A;  5FLO A;  4ZWZ A;  3D8W A;  3S8X A;  4Y0J A;  3MWO A;  1HEB A;  1OKN A;  1AM6 A;  1G6V A;  1TH9 A;  2HNC A;  3NB5 A;  4QK1 A;  4KNJ A;  4G0C A;  1I9L A;  4DZ9 A;  4WW8 A;  1THK A;  1BV3 A;  5DSN A;  3F4X A;  1KEQ A;  2GEH A;  1CAY A;  3P3J A;  2FOU A;  2O4Z A;  4E3F A;  3V2J A;  5FNL A;  3R17 B;  4Q09 A;  4Z1E A;  1ZGF A;  3PJJ A;  3LXE A;  1CAI A;  3MMF A;  4Q7P A;  4JSA A;  1RZE A;  3SAX A;  4HEZ A;  4KAP A;  3MHI A;  4KNI A;  4ITO A;  5EKJ A;  4YGN A;  5DSL A;  3RYZ A;  3DCS A;  1G4O A;  3KIG A;  1LGD A;  3KKX A;  5SZ3 A;  1RJ6 A;  1FQM A;  3SAP A;  1CAZ A;  5FNK A;  2OSF A;  3M2Y A;  3MDZ A;  4QSA A;  3B1B A;  4E4A A;  4QEF A;  1CVF A;  1T9N A;  1XEG A;  1TG3 A;  3RZ8 A;  3OIM A;  3HLJ A;  1RZB A;  1ZSB A;  3OIL A;  3IGP A;  4QJP A;  4Q90 A;  3HKN A;  3UYN A;  2GD8 A;  1FSR A;  1ZE8 A;  2H15 A;  1HUH A;  1FQR A;  3CZV A;  3V3I B;  3RGE A;  1CNH A;  5DRS A;  5FL5 A;  1CAN A;  1BN4 A;  5EZT X;  2FOY A;  3OKV A;  5CAC A;  3JXG A;  1UGB A;  4ETQ C;  4YXO A;  4QJW A;  1YDB A;  4ZX0 A;  2WD2 A;  4KUY A;  3P3H A;  3MNI A;  4FVO A;  1G53 A;  3RYJ B;  5J8Z A;  4QJM A;  3W6I A;  1TG9 A;  3KOK A;  4XIX A;  5DSQ A;  2Q38 A;  2QOA A;  4Q7S A;  4QSB A;  3M5T A;  4JSS A;  5FL6 A;  3S76 A;  3U47 A;  1AZM A;  5AMD A;  4K1Q A;  3ZNC A;  4E49 A;  4ZX1 A;  3F7U A;  1FSN A;  3KNE A;  4LHI A;  4Q8Z A;  4QY3 A;  1IF9 A;  3D93 A;  1TB0 X;  4MLT A;  2AW1 A;  4N16 A;  4MDM A;  5EKH A;  3M98 A;  3K34 A;  5DSI A;  3T83 A;  3RG4 A;  2CAB A;  4RIV A;  3KLD B;  3DBU A;  3U45 X;  4M2W A;  4G7A A;  3JXH C;  3GZ0 A;  5E28 A;  4M2V A;  3S9T A;  2W2J A;  1CNI A;  3SBH A;  1CVB A;  1G48 A;  4PYY A;  1YDC A;  4HBA A;  5A6H A;  3CYU A;  4QIZ A;  1G3Z A;  3OY0 A;  1YO0 A;  3M3X A;  1FR7 A;  1I91 A;  5L6K A;  3KOI A;  3MNA A;  3S97 A;  4TWM A;  2WEH A;  3RLD A;  4HF3 A;  4PQ7 A;  2FOQ A;  4YXU A;  3OYS A;  4MLX A;  1BN1 A;  3FE4 A;  4HT2 A;  1HCA A;  1CRA A;  5IPZ A;  4PYX A;  1RZC A;  5BRV A;  4YGL A;  3D0N A;  1CVH A;  3S75 B;  4Q8X A;  4Q8Y A;  2HOC A;  3PO6 A;  3UYQ A;  3M40 A;  5JEP B;  3M14 A;  5G0C A;  4YVY A;  1JD0 A;  4E9O X;  1BNT A;  4XFW A;  2NNV A;  1EOU A;  5JDV B;  4QJ0 A;  3V5G A;  1G46 A;  2CBC A;  2QO8 A;  5EOI A;  5C8I A;  3M5S A;  3N2P A;  4Q81 A;  1JV0 A;  1YDD A;  4ITP A;  3T5U A;  1FLJ A;  4CNX A;  4Q6D A;  1F2W A;  1FQL A;  1Z93 A;  1CAO A;  1IF7 A;  3MHO A;  3M1Q A;  6CA2 A;  4WUQ A;  5SZ0 A;  3T84 A;  1XEV A;  4QSJ A;  3P5L A;  2NWO A;  1HEC A;  1CCU A;  3RZ5 A;  3TMJ A;  1IF5 A;  4ZWY A;  3U7C A;  2CBB A;  3FFP X;  1CVC A;  5FL4 A;  3DVD A;  5BRU A;  4IDR X;  2NXS A;  4L5V A;  3IAI A;  5FLP A;  1CIM A;  4ZWX A;  3DCW A;  1G0F A;  3NI5 A;  4QK3 A;  5CA2 A;  5DOH A;  1CZM A;  3MNK A;  1TEU X;  4N0X B;  4YHA A;  3BL1 A;  8CA2 A;  3S74 B;  1UGC A;  3IBI A;  4QJO A;  4E3D A;  3P55 A;  1CIL A;  3L14 A;  3CA2 A;  3KON A;  1CA3 A;  1CNB A;  5FNH A;  3V3F A;  3V7X A;  1FSQ A;  1TE3 X;  2NNO A;  1RAY A;  3R16 A;  9CA2 A;  5FDC A;  5SZ1 A;  4RUY A;  3RYV B;  5EHW A;  1BZM A;  2NMX A;  4E5Q A;  1YO2 A;  4CQ0 A;  4YX4 A;  4Q87 A;  3M2X A;  3W6H A;  1CAM A;  4QTL A;  3NJ9 A;  3TVN X;  3ZP9 A;  1CVD A;  4FU5 A;  4RIU A;  1CNY A;  3D92 A;  3CAJ A;  5DSK A;  1CIN A;  12CA A;  1URT A;  1CAK A;  1CVA A;  5G01 A;  5DSJ A;  1LUG A;  4WW6 A;  1I8Z A;  3MYQ A;  4FRC A;  3MNJ A;  4MDG A;  1YDA A;  3N3J A;  4R59 A;  1HVA A;  4JSW A;  5FNJ A;  3M2N A;  4Z0Q A;  1RZA A;  4R5B A;  5CJF A;  3HKQ A;  3Q31 A;  3OIK A;  4QSI A;  3DCC A;  2X7U A;  3RYY A;  1CA2 A;  1RAZ A;  7CA2 A;  2WEG A;  2NXR A;  1H9Q A;  4K0T A;  1Z9Y A;  5A25 A;  2NNS A;  4IWZ A;  5EKM A;  5BYI A;  1FR4 A;  3D9Z A;  5G03 A;  4C3T A;  3C7P A;  4Q07 A;  1JCZ A;  4JS6 A;  5JQ0 A;  2X7T A;  3T5Z A;  5EHE A;  1CNC A;  1UGD A;  3M1W A;  1H9N A;  2POW A;  5JG3 B;  2NNG A;  2FMG A;  2F14 A;  4Q78 A;  3DD8 A;  4MO8 A;  3OYQ A;  5BNL A;  1ZFQ A;  1LG6 A;  3DV7 A;  1OQ5 A;  4LU3 A;  3RYX B;  3SBI A;  5E2S A;  1DMX A;  1V9I C;  2NWZ A;  2NWY A;  3EFI A;  3RG3 A;  2FW4 A;  1A42 A;  5E2N A;  4COQ A;  1BNQ A;  1I9N A;  1ZH9 A;  3BL0 A;  4K13 A;  5L3O A;  1XPZ A;  2ABE A;  5E5U A;  3RZ7 A;  5FNI A;  5EH5 A;  4L5W A;  2CBE A;  1AVN A;  4WR7 A;  3MZC A;  4CNR A;  4MDL A;  4CA2 A;  1IF4 A;  1OKM A;  2POV A;  3B4F A;  2AX2 A;  4Q0L A;  3T85 A;  2FOS A;  5JG5 B;  4QJX A;  4XIW A;  2OSM A;  1UGG A;  1OKL A;  4DZ7 A;  1G0E A;  1CAH A;  1HCB A;  4ZAO A;  5DSP A;  1UGF A;  3KWA A;  1KWR A;  4HT0 A;  5JQT A;  2HFW A;  1KOQ A;  3V3H B;  5EHV A;  3P44 A;  1LZV A;  5CLU A;  4KNM A;  1H4N A;  2NN1 A;  4Z1J A;  1G54 A;  5EH8 A;  5JGS B;  3HKU A;  1ZSA A;  4YWP A;  3M5E A;  3K2F A;  1TTM A;  3HFP A;  1J9W A;  3DC9 A;  3F7B A;  5SZ6 A;  4YYT A;  1TEQ X;  2Q1Q A;  2QP6 A;  3K7K A;  4KNN A;  1ZFK A;  3N0N A;  4Q6E A;  4YGF A;  3VBD A;  5FLQ A;  1BIC A;  3M1J A;  2VVA X;  1MUA A;  5EIJ A;  4XZ5 A;  3HS4 A;  3DD0 A;  1RZD A;  4RUX A;  4BF1 A;  2EU2 A;  4Q08 A;  4L5U A;  1BN3 A;  5E2K A;  4FVN A;  3RJ7 A;  1CCS A;  4Q06 A;  5SZ7 A;  4PXX A;  3RZ0 B;  1DCB A;  5JGT B;  1Y7W A;  4RFD A;  3V3J A;  2EZ7 A;  3M2Z A;  4FL7 A;  1CAL A;  5FNM A;  3M04 A;  1BNN A;  5DSM A;  2CBD A;  4Q99 A;  5DOG A;  3DA2 A;  1FQN A;  3DVC A;  4R5A A;  3IBU A;  4XE1 A;  1KWQ A;  1XQ0 A;  1LG5 A;  2H4N A;  3EFT A;  1I9O A;  1ZSC A;  3DC3 A;  4Q49 A;  4QIY A;  1DMY A;  1BNV A;  4RUZ A;  5LMD A;  2Q1B A;  2FNN A;  1MOO A;  4LP6 A;  4Q7V A;  5G0B A;  2POU A;  1G4J A;  4HEY A;  5E5R A;  4KUW A;  5AMG A;  2WD3 A;  3DAZ A;  5JES B;  5FLS A;  4X5S A;  3MHL A;  2WEO A;  3ML5 A;  3MNU A;  4ZWI A;  2EU3 A;  2NXT A;  2FNM A;  1CNX A;  4M2U A;  4E3H A;  4ILX A;  1I90 A;  4UOV A;  1G1D A;  3PYK A;  3V2M A;  4CNV A;  1CNW A;  2FNK A;  2WEJ A;  3BET A;  3P5A A;  4TWL A;  4HU1 A;  5SZ2 A;  2NWP A;  4KP5 A;  4BCW A;  2HL4 A;  4WUP A;  3P58 A;  1KOP A;  4RFC A;  5DSO A;  5EH7 A;  1DCA A;  5E2M A;  4Q9Y A;  1CCT A;  4E3G A;  1UGE A;  3V3G B;  3S73 B;  5AML A;  1HUG A;  2FMZ A;  1CVE A;  2ZNC A;  1BCD A;  1BNM A;  1ZNC A;  1CNJ A;  5SZ4 A;  4K0S A;  3M96 A;  4Q83 A;  4YGJ A;  3IBL A;  1Z97 A;  1HED A;  3S71 B;  5E2R A;  2CA2 A;  3HKT A;  4MTY A;  1YO1 A;  2X7S A;  4Q7W A;  4QK2 A;  4RH2 A;  5JEG B;  4M2R A;  1I9Q A;  3MNH A;  3OKU A;  2VVB X;  3DVB A;  1HEA A;  1I9P A;  5DSR A;  1G45 A;  5JEH B;  4PZH A;  1IF6 A;  3JXF A;  4BF6 A;  3P4V A;  1RJ5 A;  1IF8 A;  3M67 A;  4KV0 A;  1UGA A;  3IBN A;  3MHC A;  3S78 B;  5DVX A;  2FOV A;  4JSZ A;  3S77 B;  3T82 A;  5BRW A;  1CNK A;  2ILI A; 
#chains in the Genus database with same CATH topology
 3FW3 A;  4HEW A;  3QYK A;  4K0Z A;  3F8E A;  5SZ5 A;  3ML2 A;  3U3A X;  2HD6 A;  2HKK A;  1CAJ A;  5FNG A;  4CAC A;  4KP8 A;  2IT4 A;  1CNG A;  4YGK A;  5FLR A;  4KUV A;  5FDI A;  4FPT A;  1ZGE A;  1CRM A;  1I9M A;  5HPJ A;  2NN7 A;  3IEO A;  3S72 B;  3N4B A;  4WL4 A;  1TBT X;  1BNW A;  4YXI A;  3KS3 A;  5FLT A;  3MHM A;  4GL1 X;  3RZ1 B;  3M1K A;  4FIK A;  1BNU A;  3TVO X;  4RN4 A;  2CBA A;  4Z1N A;  1V9E A;  4CNW A;  4Z1K A;  1G52 A;  5FLO A;  4ZWZ A;  3D8W A;  3S8X A;  4Y0J A;  3MWO A;  1HEB A;  1OKN A;  1AM6 A;  1G6V A;  1TH9 A;  2HNC A;  3NB5 A;  4QK1 A;  4KNJ A;  4G0C A;  1I9L A;  4DZ9 A;  4WW8 A;  1THK A;  1BV3 A;  5DSN A;  3F4X A;  1KEQ A;  2GEH A;  1CAY A;  3P3J A;  2FOU A;  2O4Z A;  4E3F A;  3V2J A;  5FNL A;  3R17 B;  4Q09 A;  4Z1E A;  1ZGF A;  3PJJ A;  3LXE A;  1CAI A;  3MMF A;  4Q7P A;  4JSA A;  1RZE A;  3SAX A;  4HEZ A;  4KAP A;  3MHI A;  4KNI A;  4ITO A;  5EKJ A;  4YGN A;  5DSL A;  3RYZ A;  3DCS A;  1G4O A;  3KIG A;  1LGD A;  3KKX A;  5SZ3 A;  1RJ6 A;  1FQM A;  3SAP A;  1CAZ A;  5FNK A;  2OSF A;  3M2Y A;  3MDZ A;  4QSA A;  3B1B A;  4E4A A;  4QEF A;  1CVF A;  1T9N A;  1XEG A;  1TG3 A;  3RZ8 A;  3OIM A;  3HLJ A;  1RZB A;  1ZSB A;  3OIL A;  3IGP A;  4QJP A;  4Q90 A;  3HKN A;  3UYN A;  2GD8 A;  1FSR A;  1ZE8 A;  2H15 A;  1HUH A;  1FQR A;  3CZV A;  3V3I B;  3RGE A;  1CNH A;  5DRS A;  5FL5 A;  1CAN A;  1BN4 A;  5EZT X;  2FOY A;  3OKV A;  5CAC A;  3JXG A;  1UGB A;  4ETQ C;  4YXO A;  4QJW A;  1YDB A;  4ZX0 A;  2WD2 A;  4KUY A;  3P3H A;  3MNI A;  4FVO A;  1G53 A;  3RYJ B;  5J8Z A;  4QJM A;  3W6I A;  1TG9 A;  3KOK A;  4XIX A;  5DSQ A;  2Q38 A;  2QOA A;  4Q7S A;  4QSB A;  3M5T A;  4JSS A;  5FL6 A;  3S76 A;  3U47 A;  1AZM A;  5AMD A;  4K1Q A;  3ZNC A;  4E49 A;  4ZX1 A;  3F7U A;  1FSN A;  3KNE A;  4LHI A;  4Q8Z A;  4QY3 A;  1IF9 A;  3D93 A;  1TB0 X;  4MLT A;  2AW1 A;  4N16 A;  4MDM A;  5EKH A;  3M98 A;  3K34 A;  5DSI A;  3T83 A;  3RG4 A;  2CAB A;  4RIV A;  3KLD B;  3DBU A;  3U45 X;  4M2W A;  4G7A A;  3JXH C;  3GZ0 A;  5E28 A;  4M2V A;  3S9T A;  2W2J A;  1CNI A;  3SBH A;  1CVB A;  1G48 A;  4PYY A;  1YDC A;  4HBA A;  5A6H A;  3CYU A;  4QIZ A;  1G3Z A;  3OY0 A;  1YO0 A;  3M3X A;  1FR7 A;  1I91 A;  5L6K A;  3KOI A;  3MNA A;  3S97 A;  4TWM A;  2WEH A;  3RLD A;  4HF3 A;  4PQ7 A;  2FOQ A;  4YXU A;  3OYS A;  4MLX A;  1BN1 A;  3FE4 A;  4HT2 A;  1HCA A;  1CRA A;  5IPZ A;  4PYX A;  1RZC A;  5BRV A;  4YGL A;  3D0N A;  1CVH A;  3S75 B;  4Q8X A;  4Q8Y A;  2HOC A;  3PO6 A;  3UYQ A;  3M40 A;  5JEP B;  3M14 A;  5G0C A;  4YVY A;  1JD0 A;  4E9O X;  1BNT A;  4XFW A;  2NNV A;  1EOU A;  5JDV B;  4QJ0 A;  3V5G A;  1G46 A;  2CBC A;  2QO8 A;  5EOI A;  5C8I A;  3M5S A;  3N2P A;  4Q81 A;  1JV0 A;  1YDD A;  4ITP A;  3T5U A;  1FLJ A;  4CNX A;  4Q6D A;  1F2W A;  1FQL A;  1Z93 A;  1CAO A;  1IF7 A;  3MHO A;  3M1Q A;  6CA2 A;  4WUQ A;  5SZ0 A;  3T84 A;  1XEV A;  4QSJ A;  3P5L A;  2NWO A;  1HEC A;  1CCU A;  3RZ5 A;  3TMJ A;  1IF5 A;  4ZWY A;  3U7C A;  2CBB A;  3FFP X;  1CVC A;  5FL4 A;  3DVD A;  5BRU A;  4IDR X;  2NXS A;  4L5V A;  3IAI A;  5FLP A;  1CIM A;  4ZWX A;  3DCW A;  1G0F A;  3NI5 A;  4QK3 A;  5CA2 A;  5DOH A;  1CZM A;  3MNK A;  1TEU X;  4N0X B;  4YHA A;  3BL1 A;  8CA2 A;  3S74 B;  1UGC A;  3IBI A;  4QJO A;  4E3D A;  3P55 A;  1CIL A;  3L14 A;  3CA2 A;  3KON A;  1CA3 A;  1CNB A;  5FNH A;  3V3F A;  3V7X A;  1FSQ A;  1TE3 X;  2NNO A;  1RAY A;  3R16 A;  9CA2 A;  5FDC A;  5SZ1 A;  4RUY A;  3RYV B;  5EHW A;  1BZM A;  2NMX A;  4E5Q A;  1YO2 A;  4CQ0 A;  4YX4 A;  4Q87 A;  3M2X A;  3W6H A;  1CAM A;  4QTL A;  3NJ9 A;  3TVN X;  3ZP9 A;  1CVD A;  4FU5 A;  4RIU A;  1CNY A;  3D92 A;  3CAJ A;  5DSK A;  1CIN A;  12CA A;  1URT A;  1CAK A;  1CVA A;  5G01 A;  5DSJ A;  1LUG A;  4WW6 A;  1I8Z A;  3MYQ A;  4FRC A;  3MNJ A;  4MDG A;  1YDA A;  3N3J A;  4R59 A;  1HVA A;  4JSW A;  5FNJ A;  3M2N A;  4Z0Q A;  1RZA A;  4R5B A;  5CJF A;  3HKQ A;  3Q31 A;  3OIK A;  4QSI A;  3DCC A;  2X7U A;  3RYY A;  1CA2 A;  1RAZ A;  7CA2 A;  2WEG A;  2NXR A;  1H9Q A;  4K0T A;  1Z9Y A;  5A25 A;  2NNS A;  4IWZ A;  5EKM A;  5BYI A;  1FR4 A;  3D9Z A;  5G03 A;  4C3T A;  3C7P A;  4Q07 A;  1JCZ A;  4JS6 A;  5JQ0 A;  2X7T A;  3T5Z A;  5EHE A;  1CNC A;  1UGD A;  3M1W A;  1H9N A;  2POW A;  5JG3 B;  2NNG A;  2FMG A;  2F14 A;  4Q78 A;  3DD8 A;  4MO8 A;  3OYQ A;  5BNL A;  1ZFQ A;  1LG6 A;  3DV7 A;  1OQ5 A;  4LU3 A;  3RYX B;  3SBI A;  5E2S A;  1DMX A;  1V9I C;  2NWZ A;  2NWY A;  3EFI A;  3RG3 A;  2FW4 A;  1A42 A;  5E2N A;  4COQ A;  1BNQ A;  1I9N A;  1ZH9 A;  3BL0 A;  4K13 A;  5L3O A;  1XPZ A;  2ABE A;  5E5U A;  3RZ7 A;  5FNI A;  5EH5 A;  4L5W A;  2CBE A;  1AVN A;  4WR7 A;  3MZC A;  4CNR A;  4MDL A;  4CA2 A;  1IF4 A;  1OKM A;  2POV A;  3B4F A;  2AX2 A;  4Q0L A;  3T85 A;  2FOS A;  5JG5 B;  4QJX A;  4XIW A;  2OSM A;  1UGG A;  1OKL A;  4DZ7 A;  1G0E A;  1CAH A;  1HCB A;  4ZAO A;  5DSP A;  1UGF A;  3KWA A;  1KWR A;  4HT0 A;  5JQT A;  2HFW A;  1KOQ A;  3V3H B;  5EHV A;  3P44 A;  1LZV A;  5CLU A;  4KNM A;  1H4N A;  2NN1 A;  4Z1J A;  1G54 A;  5EH8 A;  5JGS B;  3HKU A;  1ZSA A;  4YWP A;  3M5E A;  3K2F A;  1TTM A;  3HFP A;  1J9W A;  3DC9 A;  3F7B A;  5SZ6 A;  4YYT A;  1TEQ X;  2Q1Q A;  2QP6 A;  3K7K A;  4KNN A;  1ZFK A;  3N0N A;  4Q6E A;  4YGF A;  3VBD A;  5FLQ A;  1BIC A;  3M1J A;  2VVA X;  1MUA A;  5EIJ A;  4XZ5 A;  3HS4 A;  3DD0 A;  1RZD A;  4RUX A;  4BF1 A;  2EU2 A;  4Q08 A;  4L5U A;  1BN3 A;  5E2K A;  4FVN A;  3RJ7 A;  1CCS A;  4Q06 A;  5SZ7 A;  4PXX A;  3RZ0 B;  1DCB A;  5JGT B;  1Y7W A;  4RFD A;  3V3J A;  2EZ7 A;  3M2Z A;  4FL7 A;  1CAL A;  5FNM A;  3M04 A;  1BNN A;  5DSM A;  2CBD A;  4Q99 A;  5DOG A;  3DA2 A;  1FQN A;  3DVC A;  4R5A A;  3IBU A;  4XE1 A;  1KWQ A;  1XQ0 A;  1LG5 A;  2H4N A;  3EFT A;  1I9O A;  1ZSC A;  3DC3 A;  4Q49 A;  4QIY A;  1DMY A;  1BNV A;  4RUZ A;  5LMD A;  2Q1B A;  2FNN A;  1MOO A;  4LP6 A;  4Q7V A;  5G0B A;  2POU A;  1G4J A;  4HEY A;  5E5R A;  4KUW A;  5AMG A;  2WD3 A;  3DAZ A;  5JES B;  5FLS A;  4X5S A;  3MHL A;  2WEO A;  3ML5 A;  3MNU A;  4ZWI A;  2EU3 A;  2NXT A;  2FNM A;  1CNX A;  4M2U A;  4E3H A;  4ILX A;  1I90 A;  4UOV A;  1G1D A;  3PYK A;  3V2M A;  4CNV A;  1CNW A;  2FNK A;  2WEJ A;  3BET A;  3P5A A;  4TWL A;  4HU1 A;  5SZ2 A;  2NWP A;  4KP5 A;  4BCW A;  2HL4 A;  4WUP A;  3P58 A;  1KOP A;  4RFC A;  5DSO A;  5EH7 A;  1DCA A;  5E2M A;  4Q9Y A;  1CCT A;  4E3G A;  1UGE A;  3V3G B;  3S73 B;  5AML A;  1HUG A;  2FMZ A;  1CVE A;  2ZNC A;  1BCD A;  1BNM A;  1ZNC A;  1CNJ A;  5SZ4 A;  4K0S A;  3M96 A;  4Q83 A;  4YGJ A;  3IBL A;  1Z97 A;  1HED A;  3S71 B;  5E2R A;  2CA2 A;  3HKT A;  4MTY A;  1YO1 A;  2X7S A;  4Q7W A;  4QK2 A;  4RH2 A;  5JEG B;  4M2R A;  1I9Q A;  3MNH A;  3OKU A;  2VVB X;  3DVB A;  1HEA A;  1I9P A;  5DSR A;  1G45 A;  5JEH B;  4PZH A;  1IF6 A;  3JXF A;  4BF6 A;  3P4V A;  1RJ5 A;  1IF8 A;  3M67 A;  4KV0 A;  1UGA A;  3IBN A;  3MHC A;  3S78 B;  5DVX A;  2FOV A;  4JSZ A;  3S77 B;  3T82 A;  5BRW A;  1CNK A;  2ILI A; 
#chains in the Genus database with same CATH homology
 3FW3 A;  4HEW A;  3QYK A;  4K0Z A;  3F8E A;  5SZ5 A;  3ML2 A;  3U3A X;  2HD6 A;  2HKK A;  1CAJ A;  5FNG A;  4CAC A;  4KP8 A;  2IT4 A;  1CNG A;  4YGK A;  5FLR A;  4KUV A;  5FDI A;  4FPT A;  1ZGE A;  1CRM A;  1I9M A;  5HPJ A;  2NN7 A;  3IEO A;  3S72 B;  3N4B A;  4WL4 A;  1TBT X;  1BNW A;  4YXI A;  3KS3 A;  5FLT A;  3MHM A;  4GL1 X;  3RZ1 B;  3M1K A;  4FIK A;  1BNU A;  3TVO X;  4RN4 A;  2CBA A;  4Z1N A;  1V9E A;  4CNW A;  4Z1K A;  1G52 A;  5FLO A;  4ZWZ A;  3D8W A;  3S8X A;  4Y0J A;  3MWO A;  1HEB A;  1OKN A;  1AM6 A;  1G6V A;  1TH9 A;  2HNC A;  3NB5 A;  4QK1 A;  4KNJ A;  4G0C A;  1I9L A;  4DZ9 A;  4WW8 A;  1THK A;  1BV3 A;  5DSN A;  3F4X A;  1KEQ A;  2GEH A;  1CAY A;  3P3J A;  2FOU A;  2O4Z A;  4E3F A;  3V2J A;  5FNL A;  3R17 B;  4Q09 A;  4Z1E A;  1ZGF A;  3PJJ A;  3LXE A;  1CAI A;  3MMF A;  4Q7P A;  4JSA A;  1RZE A;  3SAX A;  4HEZ A;  4KAP A;  3MHI A;  4KNI A;  4ITO A;  5EKJ A;  4YGN A;  5DSL A;  3RYZ A;  3DCS A;  1G4O A;  3KIG A;  1LGD A;  3KKX A;  5SZ3 A;  1RJ6 A;  1FQM A;  3SAP A;  1CAZ A;  5FNK A;  2OSF A;  3M2Y A;  3MDZ A;  4QSA A;  3B1B A;  4E4A A;  4QEF A;  1CVF A;  1T9N A;  1XEG A;  1TG3 A;  3RZ8 A;  3OIM A;  3HLJ A;  1RZB A;  1ZSB A;  3OIL A;  3IGP A;  4QJP A;  4Q90 A;  3HKN A;  3UYN A;  2GD8 A;  1FSR A;  1ZE8 A;  2H15 A;  1HUH A;  1FQR A;  3CZV A;  3V3I B;  3RGE A;  1CNH A;  5DRS A;  5FL5 A;  1CAN A;  1BN4 A;  5EZT X;  2FOY A;  3OKV A;  5CAC A;  3JXG A;  1UGB A;  4ETQ C;  4YXO A;  4QJW A;  1YDB A;  4ZX0 A;  2WD2 A;  4KUY A;  3P3H A;  3MNI A;  4FVO A;  1G53 A;  3RYJ B;  5J8Z A;  4QJM A;  3W6I A;  1TG9 A;  3KOK A;  4XIX A;  5DSQ A;  2Q38 A;  2QOA A;  4Q7S A;  4QSB A;  3M5T A;  4JSS A;  5FL6 A;  3S76 A;  3U47 A;  1AZM A;  5AMD A;  4K1Q A;  3ZNC A;  4E49 A;  4ZX1 A;  3F7U A;  1FSN A;  3KNE A;  4LHI A;  4Q8Z A;  4QY3 A;  1IF9 A;  3D93 A;  1TB0 X;  4MLT A;  2AW1 A;  4N16 A;  4MDM A;  5EKH A;  3M98 A;  3K34 A;  5DSI A;  3T83 A;  3RG4 A;  2CAB A;  4RIV A;  3KLD B;  3DBU A;  3U45 X;  4M2W A;  4G7A A;  3JXH C;  3GZ0 A;  5E28 A;  4M2V A;  3S9T A;  2W2J A;  1CNI A;  3SBH A;  1CVB A;  1G48 A;  4PYY A;  1YDC A;  4HBA A;  5A6H A;  3CYU A;  4QIZ A;  1G3Z A;  3OY0 A;  1YO0 A;  3M3X A;  1FR7 A;  1I91 A;  5L6K A;  3KOI A;  3MNA A;  3S97 A;  4TWM A;  2WEH A;  3RLD A;  4HF3 A;  4PQ7 A;  2FOQ A;  4YXU A;  3OYS A;  4MLX A;  1BN1 A;  3FE4 A;  4HT2 A;  1HCA A;  1CRA A;  5IPZ A;  4PYX A;  1RZC A;  5BRV A;  4YGL A;  3D0N A;  1CVH A;  3S75 B;  4Q8X A;  4Q8Y A;  2HOC A;  3PO6 A;  3UYQ A;  3M40 A;  5JEP B;  3M14 A;  5G0C A;  4YVY A;  1JD0 A;  4E9O X;  1BNT A;  4XFW A;  2NNV A;  1EOU A;  5JDV B;  4QJ0 A;  3V5G A;  1G46 A;  2CBC A;  2QO8 A;  5EOI A;  5C8I A;  3M5S A;  3N2P A;  4Q81 A;  1JV0 A;  1YDD A;  4ITP A;  3T5U A;  1FLJ A;  4CNX A;  4Q6D A;  1F2W A;  1FQL A;  1Z93 A;  1CAO A;  1IF7 A;  3MHO A;  3M1Q A;  6CA2 A;  4WUQ A;  5SZ0 A;  3T84 A;  1XEV A;  4QSJ A;  3P5L A;  2NWO A;  1HEC A;  1CCU A;  3RZ5 A;  3TMJ A;  1IF5 A;  4ZWY A;  3U7C A;  2CBB A;  3FFP X;  1CVC A;  5FL4 A;  3DVD A;  5BRU A;  4IDR X;  2NXS A;  4L5V A;  3IAI A;  5FLP A;  1CIM A;  4ZWX A;  3DCW A;  1G0F A;  3NI5 A;  4QK3 A;  5CA2 A;  5DOH A;  1CZM A;  3MNK A;  1TEU X;  4N0X B;  4YHA A;  3BL1 A;  8CA2 A;  3S74 B;  1UGC A;  3IBI A;  4QJO A;  4E3D A;  3P55 A;  1CIL A;  3L14 A;  3CA2 A;  3KON A;  1CA3 A;  1CNB A;  5FNH A;  3V3F A;  3V7X A;  1FSQ A;  1TE3 X;  2NNO A;  1RAY A;  3R16 A;  9CA2 A;  5FDC A;  5SZ1 A;  4RUY A;  3RYV B;  5EHW A;  1BZM A;  2NMX A;  4E5Q A;  1YO2 A;  4CQ0 A;  4YX4 A;  4Q87 A;  3M2X A;  3W6H A;  1CAM A;  4QTL A;  3NJ9 A;  3TVN X;  3ZP9 A;  1CVD A;  4FU5 A;  4RIU A;  1CNY A;  3D92 A;  3CAJ A;  5DSK A;  1CIN A;  12CA A;  1URT A;  1CAK A;  1CVA A;  5G01 A;  5DSJ A;  1LUG A;  4WW6 A;  1I8Z A;  3MYQ A;  4FRC A;  3MNJ A;  4MDG A;  1YDA A;  3N3J A;  4R59 A;  1HVA A;  4JSW A;  5FNJ A;  3M2N A;  4Z0Q A;  1RZA A;  4R5B A;  5CJF A;  3HKQ A;  3Q31 A;  3OIK A;  4QSI A;  3DCC A;  2X7U A;  3RYY A;  1CA2 A;  1RAZ A;  7CA2 A;  2WEG A;  2NXR A;  1H9Q A;  4K0T A;  1Z9Y A;  5A25 A;  2NNS A;  4IWZ A;  5EKM A;  5BYI A;  1FR4 A;  3D9Z A;  5G03 A;  4C3T A;  3C7P A;  4Q07 A;  1JCZ A;  4JS6 A;  5JQ0 A;  2X7T A;  3T5Z A;  5EHE A;  1CNC A;  1UGD A;  3M1W A;  1H9N A;  2POW A;  5JG3 B;  2NNG A;  2FMG A;  2F14 A;  4Q78 A;  3DD8 A;  4MO8 A;  3OYQ A;  5BNL A;  1ZFQ A;  1LG6 A;  3DV7 A;  1OQ5 A;  4LU3 A;  3RYX B;  3SBI A;  5E2S A;  1DMX A;  1V9I C;  2NWZ A;  2NWY A;  3EFI A;  3RG3 A;  2FW4 A;  1A42 A;  5E2N A;  4COQ A;  1BNQ A;  1I9N A;  1ZH9 A;  3BL0 A;  4K13 A;  5L3O A;  1XPZ A;  2ABE A;  5E5U A;  3RZ7 A;  5FNI A;  5EH5 A;  4L5W A;  2CBE A;  1AVN A;  4WR7 A;  3MZC A;  4CNR A;  4MDL A;  4CA2 A;  1IF4 A;  1OKM A;  2POV A;  3B4F A;  2AX2 A;  4Q0L A;  3T85 A;  2FOS A;  5JG5 B;  4QJX A;  4XIW A;  2OSM A;  1UGG A;  1OKL A;  4DZ7 A;  1G0E A;  1CAH A;  1HCB A;  4ZAO A;  5DSP A;  1UGF A;  3KWA A;  1KWR A;  4HT0 A;  5JQT A;  2HFW A;  1KOQ A;  3V3H B;  5EHV A;  3P44 A;  1LZV A;  5CLU A;  4KNM A;  1H4N A;  2NN1 A;  4Z1J A;  1G54 A;  5EH8 A;  5JGS B;  3HKU A;  1ZSA A;  4YWP A;  3M5E A;  3K2F A;  1TTM A;  3HFP A;  1J9W A;  3DC9 A;  3F7B A;  5SZ6 A;  4YYT A;  1TEQ X;  2Q1Q A;  2QP6 A;  3K7K A;  4KNN A;  1ZFK A;  3N0N A;  4Q6E A;  4YGF A;  3VBD A;  5FLQ A;  1BIC A;  3M1J A;  2VVA X;  1MUA A;  5EIJ A;  4XZ5 A;  3HS4 A;  3DD0 A;  1RZD A;  4RUX A;  4BF1 A;  2EU2 A;  4Q08 A;  4L5U A;  1BN3 A;  5E2K A;  4FVN A;  3RJ7 A;  1CCS A;  4Q06 A;  5SZ7 A;  4PXX A;  3RZ0 B;  1DCB A;  5JGT B;  1Y7W A;  4RFD A;  3V3J A;  2EZ7 A;  3M2Z A;  4FL7 A;  1CAL A;  5FNM A;  3M04 A;  1BNN A;  5DSM A;  2CBD A;  4Q99 A;  5DOG A;  3DA2 A;  1FQN A;  3DVC A;  4R5A A;  3IBU A;  4XE1 A;  1KWQ A;  1XQ0 A;  1LG5 A;  2H4N A;  3EFT A;  1I9O A;  1ZSC A;  3DC3 A;  4Q49 A;  4QIY A;  1DMY A;  1BNV A;  4RUZ A;  5LMD A;  2Q1B A;  2FNN A;  1MOO A;  4LP6 A;  4Q7V A;  5G0B A;  2POU A;  1G4J A;  4HEY A;  5E5R A;  4KUW A;  5AMG A;  2WD3 A;  3DAZ A;  5JES B;  5FLS A;  4X5S A;  3MHL A;  2WEO A;  3ML5 A;  3MNU A;  4ZWI A;  2EU3 A;  2NXT A;  2FNM A;  1CNX A;  4M2U A;  4E3H A;  4ILX A;  1I90 A;  4UOV A;  1G1D A;  3PYK A;  3V2M A;  4CNV A;  1CNW A;  2FNK A;  2WEJ A;  3BET A;  3P5A A;  4TWL A;  4HU1 A;  5SZ2 A;  2NWP A;  4KP5 A;  4BCW A;  2HL4 A;  4WUP A;  3P58 A;  1KOP A;  4RFC A;  5DSO A;  5EH7 A;  1DCA A;  5E2M A;  4Q9Y A;  1CCT A;  4E3G A;  1UGE A;  3V3G B;  3S73 B;  5AML A;  1HUG A;  2FMZ A;  1CVE A;  2ZNC A;  1BCD A;  1BNM A;  1ZNC A;  1CNJ A;  5SZ4 A;  4K0S A;  3M96 A;  4Q83 A;  4YGJ A;  3IBL A;  1Z97 A;  1HED A;  3S71 B;  5E2R A;  2CA2 A;  3HKT A;  4MTY A;  1YO1 A;  2X7S A;  4Q7W A;  4QK2 A;  4RH2 A;  5JEG B;  4M2R A;  1I9Q A;  3MNH A;  3OKU A;  2VVB X;  3DVB A;  1HEA A;  1I9P A;  5DSR A;  1G45 A;  5JEH B;  4PZH A;  1IF6 A;  3JXF A;  4BF6 A;  3P4V A;  1RJ5 A;  1IF8 A;  3M67 A;  4KV0 A;  1UGA A;  3IBN A;  3MHC A;  3S78 B;  5DVX A;  2FOV A;  4JSZ A;  3S77 B;  3T82 A;  5BRW A;  1CNK A;  2ILI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...