2NWZA

Structural and kinetic effects of hydrophobic mutations on the active site of human carbonic anhydrase ii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
Knots found
sequence length
258
structure length
258
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFLVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Speeding Up Proton Transfer in a Fast Enzyme: Kinetic and Crystallographic Studies on the Effect of Hydrophobic Amino Acid Substitutions in the Active Site of Human Carbonic Anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords carbonic anhydrase 2
total genus 76
structure length 258
sequence length 258
other databases KnotProt 2.0: K +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2006-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 2nwzA00
3JXGA 5BRWA 4ZX0A 1JV0A 3RG4A 4RH2A 2FNKA 3M5EA 4HBAA 4HF3A 1FLJA 4YGNA 1I9PA 2FNMA 4QJOA 1DCAA 3P3HA 4LU3A 1CZMA 3T82A 4R5AA 3M2NA 4QK3A 1CNHA 1KEQA 3T5UA 2GD8A 1RZAA 2FMGA 4XIXA 3M1QA 3M40A 3MNHA 1CIMA 4CNXA 5CA2A 1BNQA 2ABEA 2CBBA 3U7CA 4MTYA 1IF6A 2EU3A 3KKXA 2CABA 5FNJA 4LHIA 3DCSA 5FNLA 1KOPA 1BNMA 3OIMA 5FL6A 1IF8A 2QOAA 1BN3A 1G45A 5FLSA 2EU2A 4Z1JA 1BZMA 3T83A 1MOOA 4E9OX 3M1KA 5DRSA 2NN7A 1TBTX 3M14A 3L14A 4CNRA 1I9LA 5AMLA 4QJXA 3OILA 4YX4A 4G7AA 4K1QA 4QJPA 1CVDA 4YXUA 3TVOX 5DSJA 3IGPA 3KNEA 2F14A 1CALA 4KUVA 3MDZA 4WUPA 1CNGA 4CQ0A 1I8ZA 4IWZA 4QSBA 5LMDA 1G48A 3K7KA 1BNTA 1YO2A 4QJMA 3MHLA 3S77B 3U45X 3DAZA 4WW8A 1T9NA 1FQLA 4M2VA 1TH9A 1UGEA 5FLPA 4MLXA 4KUWA 3RJ7A 5FDIA 3S72B 4BCWA 1YDDA 4Z1KA 4YHAA 3B1BA 4YXOA 5CLUA 1CAKA 2NNOA 3R16A 4Q6DA 3V3IB 4QTLA 4FIKA 5FL5A 3S73B 4CACA 1YDAA 5JQ0A 5EHVA 3IBNA 2HL4A 3UYNA 3IBUA 5CACA 1I90A 1HEBA 4Q07A 5CJFA 1ZGFA 4Z1EA 1BNUA 5E28A 1CVCA 5A25A 3M2ZA 4PQ7A 5FNIA 3IAIA 3DD8A 5JEGB 4Q7WA 5EHEA 4TWMA 1CNIA 4K0SA 1BICA 4WL4A 1BN1A 1ZFKA 3D8WA 3HKNA 3RZ7A 1UGBA 4Q8YA 4M2WA 5A6HA 2Q1QA 5E2RA 1BCDA 5G01A 5EHWA 3TMJA 1HUGA 1TTMA 2POVA 4DZ7A 3MMFA 3CZVA 1BN4A 3EFIA 3S9TA 1LUGA 1CNXA 4XE1A 3TVNX 1ZSBA 2POWA 5FNKA 4COQA 3ML2A 1FSRA 2CA2A 1ZSCA 4K0ZA 3BETA 4ZWXA 5FNGA 3D0NA 1CCUA 3BL1A 1Z93A 4Y0JA 1AM6A 1CVAA 1OKMA 4E3DA 1IF5A 1I9OA 4HEYA 5EKHA 4Q8ZA 4E3FA 3P5AA 4QSAA 3RYJB 3P44A 4TWLA 5EIJA 4ETQC 1ZFQA 4KNMA 2FOYA 3R17B 4Q8XA 5JG5B 1G1DA 1OKLA 1V9EA 1XEGA 1CNBA 1FSQA 1LZVA 4E3HA 3M3XA 1XPZA 1ZGEA 5FNMA 5AMGA 3NJ9A 3PYKA 2Q38A 3F7BA 3MWOA 5SZ1A 4YWPA 3P3JA 3P5LA 4IDRX 1YDBA 3RYVB 5EH7A 5SZ7A 2VVBX 4JSAA 1UGFA 5E2KA 3MNUA 3M96A 4FPTA 5DSLA 3BL0A 1H9NA 1CRMA 4PZHA 2FNNA 3M2XA 3HFPA 8CA2A 1KOQA 5L6KA 4M2RA 1RZCA 4WUQA 4JSSA 3S75B 3KLDB 2H4NA 1CILA 2NXSA 1G53A 4RIUA 3UYQA 3T5ZA 4ITOA 3RZ5A 4KUYA 9CA2A 4Q83A 1CAYA 1IF4A 1RAYA 5FL4A 3IBIA 1CCTA 3N3JA 5JEPB 1AZMA 4MDGA 3GZ0A 1MUAA 5E2MA 1CAJA 4Q09A 1HCBA 4L5UA 5DSOA 3IBLA 3MHOA 4CA2A 4WW6A 1OKNA 5FNHA 4QIYA 1LG6A 3F7UA 4RUYA 1BV3A 2HOCA 3MNKA 4MLTA 2CBAA 1F2WA 4Q7SA 3SBIA 1FQRA 3RYXB 3RZ8A 2ILIA 3N4BA 4Q08A 4PYXA 4CNWA 3ZP9A 3RYYA 1UGCA 4ILXA 4C3TA 1XQ0A 5JESB 4Q6EA 3VBDA 3NI5A 4KNNA 3DCCA 2X7TA 4ZX1A 1HUHA 3U3AX 4Q90A 4QSIA 3RLDA 1Z97A 4FU5A 5DOHA 1I9NA 1J9WA 2CBCA 4HU1A 4XZ5A 3SAXA 4XFWA 3ZNCA 4N16A 4Z0QA 1YO0A 3RYZA 4KAPA 3C7PA 3M1WA 1CAHA 2ZNCA 4KP5A 3DVDA 4X5SA 1ZNCA 4R5BA 3D93A 3S8XA 5EH5A 5EH8A 3HKTA 1ZE8A 4YXIA 3V3JA 2NNVA 3S97A 1RZEA 1JCZA 1RZDA 2NWPA 4KV0A 5DSRA 1H4NA 1IF7A 5EOIA 3P4VA 1RJ5A 5DVXA 5FLQA 3HKUA 1HVAA 4N0XB 4YGLA 3PJJA 3MZCA 2Q1BA 4RFDA 2WEJA 1G54A 2NXRA 5FLTA 6CA2A 3RZ1B 3S74B 5BYIA 1TEUX 3B4FA 1URTA 3OYSA 1OQ5A 3D92A 1G0FA 4QJ0A 4QIZA 4ZAOA 4GL1X 4Q9YA 4UOVA 5DSMA 1KWQA 1G46A 2AX2A 4YYTA 5JDVB 4HT0A 3OKVA 2GEHA 4MDLA 3DVBA 5C8IA 1UGDA 1CNJA 3SBHA 3M67A 1V9IC 3V2MA 5BRUA 1JD0A 1Z9YA 1HCAA 5FDCA 3LXEA 2NNGA 1FR7A 1FSNA 4Q06A 5G0CA 3W6HA 4KNIA 3S76A 3K34A 3V3FA 1HEDA 3KS3A 4RIVA 2NWOA 1TB0X 1CVEA 3EFTA 4JSZA 5FLRA 5E5RA 5HPJA 4RUXA 3KOKA 2FOQA 2WD2A 4YGKA 5E2SA 4ZWZA 5JQTA 3RZ0B 3OKUA 4L5WA 4BF6A 1LGDA 1H9QA 1CNYA 2QP6A 1DMXA 2FOSA 1IF9A 2WD3A 1CNKA 3V2JA 3F4XA 1CNCA 3CAJA 3V5GA 5JG3B 2IT4A 1CA3A 1DCBA 1YO1A 5SZ4A 3DA2A 3MNAA 1FQNA 3MHMA 2WEGA 3HKQA 2HKKA 1CNWA 2X7UA 1FR4A 2HNCA 1UGGA 3P55A 1CAOA 1G0EA 3Q31A 3DC3A 4K13A 4HT2A 2FOUA 4QJWA 5JEHB 4Z1NA 4G0CA 1G4JA 1BNNA 3DV7A 3S78B 4YGJA 2NNSA 1EOUA 3KONA 4FRCA 5E5UA 3DCWA 3S71B 2O4ZA 4CNVA 1G52A 4JS6A 3PO6A 4E5QA 5E2NA 2FOVA 3N2PA 5DSIA 3MNIA 5DOGA 1THKA 4Q87A 1CA2A 1BNWA 4L5VA 3M2YA 3V3HB 1ZH9A 3N0NA 1I9MA 3M5TA 1RAZA 1BNVA 3RG3A 3DBUA 2NMXA 4PYYA 5IPZA 1FQMA 1TG9A 1KWRA 3M5SA 3D9ZA 4KNJA 3FFPX 3MNJA 3M1JA 4Q7PA 1AVNA 3HS4A 3JXFA 2QO8A 4WR7A 4QSJA 1G4OA 1DMYA 4Q7VA 3IEOA 1ZSAA 3JXHC 4ZWIA 3M98A 1I9QA 4K0TA 4RUZA 3DD0A 2HFWA 3HLJA 3OY0A 1I91A 3F8EA 4QY3A 4Q81A 1CINA 4YVYA 4MDMA 4KP8A 3DC9A 5BNLA 5FLOA 5G0BA 1TE3X 5J8ZA 1G3ZA 5DSKA 3DVCA 3CA2A 1HECA 3FE4A 4XIWA 1CAIA 2FW4A 1UGAA 4QEFA 3MHCA 4MO8A 4BF1A 2CBDA 1CRAA 1CVFA 4QK2A 3V3GB 2HD6A 2NN1A 3SAPA 3M04A 3RGEA 2FMZA 4RFCA 4Q0LA 3OIKA 4DZ9A 3ML5A 5EKJA 5SZ0A 4LP6A 2X7SA 2W2JA 5BRVA 1LG5A 5DSNA 4RN4A 4YGFA 3NB5A 1CAZA 4QK1A 5EKMA 3FW3A 1Y7WA 3K2FA 4E49A 5EZTX 1CANA 3W6IA 4E3GA 4HEWA 7CA2A 2WEOA 1CVHA 5SZ5A 2CBEA 2NWZA 4ITPA 2H15A 5G03A 4HEZA 4FVNA 1RJ6A 5SZ6A 2EZ7A 3QYKA 4Q99A 1G6VA 1TEQX 4Q49A 1YDCA 4M2UA 12CAA 2VVAX 4Q78A 4R59A 4PXXA 4FL7A 2NXTA 1A42A 1CCSA 3MHIA 3MYQA 4E4AA 5JGTB 5L3OA 3OYQA 4FVOA 3T84A 3U47A 1XEVA 3V7XA 1TG3A 2POUA 3KIGA 1RZBA 4JSWA 2NWYA 3P58A 5AMDA 5JGSB 2AW1A 4ZWYA 1HEAA 3KWAA 3KOIA 5SZ3A 1CVBA 2OSMA 2OSFA 3CYUA 5DSQA 2WEHA 5DSPA 1CAMA 5SZ2A 3T85A
chains in the Genus database with same CATH superfamily
3JXGA 5BRWA 4ZX0A 1JV0A 3RG4A 4RH2A 2FNKA 3M5EA 4HBAA 4HF3A 1FLJA 4YGNA 1I9PA 2FNMA 4QJOA 1DCAA 3P3HA 4LU3A 1CZMA 3T82A 4R5AA 3M2NA 4QK3A 1CNHA 1KEQA 3T5UA 2GD8A 1RZAA 2FMGA 4XIXA 3M1QA 3M40A 3MNHA 1CIMA 4CNXA 5CA2A 1BNQA 2ABEA 2CBBA 3U7CA 4MTYA 1IF6A 2EU3A 3KKXA 2CABA 5FNJA 4LHIA 3DCSA 5FNLA 1KOPA 1BNMA 3OIMA 5FL6A 1IF8A 2QOAA 1BN3A 1G45A 5FLSA 2EU2A 4Z1JA 1BZMA 3T83A 1MOOA 4E9OX 3M1KA 5DRSA 2NN7A 1TBTX 3M14A 3L14A 4CNRA 1I9LA 5AMLA 4QJXA 3OILA 4YX4A 4G7AA 4K1QA 4QJPA 1CVDA 4YXUA 3TVOX 5DSJA 3IGPA 3KNEA 2F14A 1CALA 4KUVA 3MDZA 4WUPA 1CNGA 4CQ0A 1I8ZA 4IWZA 4QSBA 5LMDA 1G48A 3K7KA 1BNTA 1YO2A 4QJMA 3MHLA 3S77B 3U45X 3DAZA 4WW8A 1T9NA 1FQLA 4M2VA 1TH9A 1UGEA 5FLPA 4MLXA 4KUWA 3RJ7A 5FDIA 3S72B 4BCWA 1YDDA 4Z1KA 4YHAA 3B1BA 4YXOA 5CLUA 1CAKA 2NNOA 3R16A 4Q6DA 3V3IB 4QTLA 4FIKA 5FL5A 3S73B 4CACA 1YDAA 5JQ0A 5EHVA 3IBNA 2HL4A 3UYNA 3IBUA 5CACA 1I90A 1HEBA 4Q07A 5CJFA 1ZGFA 4Z1EA 1BNUA 5E28A 1CVCA 5A25A 3M2ZA 4PQ7A 5FNIA 3IAIA 3DD8A 5JEGB 4Q7WA 5EHEA 4TWMA 1CNIA 4K0SA 1BICA 4WL4A 1BN1A 1ZFKA 3D8WA 3HKNA 3RZ7A 1UGBA 4Q8YA 4M2WA 5A6HA 2Q1QA 5E2RA 1BCDA 5G01A 5EHWA 3TMJA 1HUGA 1TTMA 2POVA 4DZ7A 3MMFA 3CZVA 1BN4A 3EFIA 3S9TA 1LUGA 1CNXA 4XE1A 3TVNX 1ZSBA 2POWA 5FNKA 4COQA 3ML2A 1FSRA 2CA2A 1ZSCA 4K0ZA 3BETA 4ZWXA 5FNGA 3D0NA 1CCUA 3BL1A 1Z93A 4Y0JA 1AM6A 1CVAA 1OKMA 4E3DA 1IF5A 1I9OA 4HEYA 5EKHA 4Q8ZA 4E3FA 3P5AA 4QSAA 3RYJB 3P44A 4TWLA 5EIJA 4ETQC 1ZFQA 4KNMA 2FOYA 3R17B 4Q8XA 5JG5B 1G1DA 1OKLA 1V9EA 1XEGA 1CNBA 1FSQA 1LZVA 4E3HA 3M3XA 1XPZA 1ZGEA 5FNMA 5AMGA 3NJ9A 3PYKA 2Q38A 3F7BA 3MWOA 5SZ1A 4YWPA 3P3JA 3P5LA 4IDRX 1YDBA 3RYVB 5EH7A 5SZ7A 2VVBX 4JSAA 1UGFA 5E2KA 3MNUA 3M96A 4FPTA 5DSLA 3BL0A 1H9NA 1CRMA 4PZHA 2FNNA 3M2XA 3HFPA 8CA2A 1KOQA 5L6KA 4M2RA 1RZCA 4WUQA 4JSSA 3S75B 3KLDB 2H4NA 1CILA 2NXSA 1G53A 4RIUA 3UYQA 3T5ZA 4ITOA 3RZ5A 4KUYA 9CA2A 4Q83A 1CAYA 1IF4A 1RAYA 5FL4A 3IBIA 1CCTA 3N3JA 5JEPB 1AZMA 4MDGA 3GZ0A 1MUAA 5E2MA 1CAJA 4Q09A 1HCBA 4L5UA 5DSOA 3IBLA 3MHOA 4CA2A 4WW6A 1OKNA 5FNHA 4QIYA 1LG6A 3F7UA 4RUYA 1BV3A 2HOCA 3MNKA 4MLTA 2CBAA 1F2WA 4Q7SA 3SBIA 1FQRA 3RYXB 3RZ8A 2ILIA 3N4BA 4Q08A 4PYXA 4CNWA 3ZP9A 3RYYA 1UGCA 4ILXA 4C3TA 1XQ0A 5JESB 4Q6EA 3VBDA 3NI5A 4KNNA 3DCCA 2X7TA 4ZX1A 1HUHA 3U3AX 4Q90A 4QSIA 3RLDA 1Z97A 4FU5A 5DOHA 1I9NA 1J9WA 2CBCA 4HU1A 4XZ5A 3SAXA 4XFWA 3ZNCA 4N16A 4Z0QA 1YO0A 3RYZA 4KAPA 3C7PA 3M1WA 1CAHA 2ZNCA 4KP5A 3DVDA 4X5SA 1ZNCA 4R5BA 3D93A 3S8XA 5EH5A 5EH8A 3HKTA 1ZE8A 4YXIA 3V3JA 2NNVA 3S97A 1RZEA 1JCZA 1RZDA 2NWPA 4KV0A 5DSRA 1H4NA 1IF7A 5EOIA 3P4VA 1RJ5A 5DVXA 5FLQA 3HKUA 1HVAA 4N0XB 4YGLA 3PJJA 3MZCA 2Q1BA 4RFDA 2WEJA 1G54A 2NXRA 5FLTA 6CA2A 3RZ1B 3S74B 5BYIA 1TEUX 3B4FA 1URTA 3OYSA 1OQ5A 3D92A 1G0FA 4QJ0A 4QIZA 4ZAOA 4GL1X 4Q9YA 4UOVA 5DSMA 1KWQA 1G46A 2AX2A 4YYTA 5JDVB 4HT0A 3OKVA 2GEHA 4MDLA 3DVBA 5C8IA 1UGDA 1CNJA 3SBHA 3M67A 1V9IC 3V2MA 5BRUA 1JD0A 1Z9YA 1HCAA 5FDCA 3LXEA 2NNGA 1FR7A 1FSNA 4Q06A 5G0CA 3W6HA 4KNIA 3S76A 3K34A 3V3FA 1HEDA 3KS3A 4RIVA 2NWOA 1TB0X 1CVEA 3EFTA 4JSZA 5FLRA 5E5RA 5HPJA 4RUXA 3KOKA 2FOQA 2WD2A 4YGKA 5E2SA 4ZWZA 5JQTA 3RZ0B 3OKUA 4L5WA 4BF6A 1LGDA 1H9QA 1CNYA 2QP6A 1DMXA 2FOSA 1IF9A 2WD3A 1CNKA 3V2JA 3F4XA 1CNCA 3CAJA 3V5GA 5JG3B 2IT4A 1CA3A 1DCBA 1YO1A 5SZ4A 3DA2A 3MNAA 1FQNA 3MHMA 2WEGA 3HKQA 2HKKA 1CNWA 2X7UA 1FR4A 2HNCA 1UGGA 3P55A 1CAOA 1G0EA 3Q31A 3DC3A 4K13A 4HT2A 2FOUA 4QJWA 5JEHB 4Z1NA 4G0CA 1G4JA 1BNNA 3DV7A 3S78B 4YGJA 2NNSA 1EOUA 3KONA 4FRCA 5E5UA 3DCWA 3S71B 2O4ZA 4CNVA 1G52A 4JS6A 3PO6A 4E5QA 5E2NA 2FOVA 3N2PA 5DSIA 3MNIA 5DOGA 1THKA 4Q87A 1CA2A 1BNWA 4L5VA 3M2YA 3V3HB 1ZH9A 3N0NA 1I9MA 3M5TA 1RAZA 1BNVA 3RG3A 3DBUA 2NMXA 4PYYA 5IPZA 1FQMA 1TG9A 1KWRA 3M5SA 3D9ZA 4KNJA 3FFPX 3MNJA 3M1JA 4Q7PA 1AVNA 3HS4A 3JXFA 2QO8A 4WR7A 4QSJA 1G4OA 1DMYA 4Q7VA 3IEOA 1ZSAA 3JXHC 4ZWIA 3M98A 1I9QA 4K0TA 4RUZA 3DD0A 2HFWA 3HLJA 3OY0A 1I91A 3F8EA 4QY3A 4Q81A 1CINA 4YVYA 4MDMA 4KP8A 3DC9A 5BNLA 5FLOA 5G0BA 1TE3X 5J8ZA 1G3ZA 5DSKA 3DVCA 3CA2A 1HECA 3FE4A 4XIWA 1CAIA 2FW4A 1UGAA 4QEFA 3MHCA 4MO8A 4BF1A 2CBDA 1CRAA 1CVFA 4QK2A 3V3GB 2HD6A 2NN1A 3SAPA 3M04A 3RGEA 2FMZA 4RFCA 4Q0LA 3OIKA 4DZ9A 3ML5A 5EKJA 5SZ0A 4LP6A 2X7SA 2W2JA 5BRVA 1LG5A 5DSNA 4RN4A 4YGFA 3NB5A 1CAZA 4QK1A 5EKMA 3FW3A 1Y7WA 3K2FA 4E49A 5EZTX 1CANA 3W6IA 4E3GA 4HEWA 7CA2A 2WEOA 1CVHA 5SZ5A 2CBEA 2NWZA 4ITPA 2H15A 5G03A 4HEZA 4FVNA 1RJ6A 5SZ6A 2EZ7A 3QYKA 4Q99A 1G6VA 1TEQX 4Q49A 1YDCA 4M2UA 12CAA 2VVAX 4Q78A 4R59A 4PXXA 4FL7A 2NXTA 1A42A 1CCSA 3MHIA 3MYQA 4E4AA 5JGTB 5L3OA 3OYQA 4FVOA 3T84A 3U47A 1XEVA 3V7XA 1TG3A 2POUA 3KIGA 1RZBA 4JSWA 2NWYA 3P58A 5AMDA 5JGSB 2AW1A 4ZWYA 1HEAA 3KWAA 3KOIA 5SZ3A 1CVBA 2OSMA 2OSFA 3CYUA 5DSQA 2WEHA 5DSPA 1CAMA 5SZ2A 3T85A
chains in the Genus database with same CATH topology
3JXGA 5BRWA 4ZX0A 1JV0A 3RG4A 4RH2A 2FNKA 3M5EA 4HBAA 4HF3A 1FLJA 4YGNA 1I9PA 2FNMA 4QJOA 1DCAA 3P3HA 4LU3A 1CZMA 3T82A 4R5AA 3M2NA 4QK3A 1CNHA 1KEQA 3T5UA 2GD8A 1RZAA 2FMGA 4XIXA 3M1QA 3M40A 3MNHA 1CIMA 4CNXA 5CA2A 1BNQA 2ABEA 2CBBA 3U7CA 4MTYA 1IF6A 2EU3A 3KKXA 2CABA 5FNJA 4LHIA 3DCSA 5FNLA 1KOPA 1BNMA 3OIMA 5FL6A 1IF8A 2QOAA 1BN3A 1G45A 5FLSA 2EU2A 4Z1JA 1BZMA 3T83A 1MOOA 4E9OX 3M1KA 5DRSA 2NN7A 1TBTX 3M14A 3L14A 4CNRA 1I9LA 5AMLA 4QJXA 3OILA 4YX4A 4G7AA 4K1QA 4QJPA 1CVDA 4YXUA 3TVOX 5DSJA 3IGPA 3KNEA 2F14A 1CALA 4KUVA 3MDZA 4WUPA 1CNGA 4CQ0A 1I8ZA 4IWZA 4QSBA 5LMDA 1G48A 3K7KA 1BNTA 1YO2A 4QJMA 3MHLA 3S77B 3U45X 3DAZA 4WW8A 1T9NA 1FQLA 4M2VA 1TH9A 1UGEA 5FLPA 4MLXA 4KUWA 3RJ7A 5FDIA 3S72B 4BCWA 1YDDA 4Z1KA 4YHAA 3B1BA 4YXOA 5CLUA 1CAKA 2NNOA 3R16A 4Q6DA 3V3IB 4QTLA 4FIKA 5FL5A 3S73B 4CACA 1YDAA 5JQ0A 5EHVA 3IBNA 2HL4A 3UYNA 3IBUA 5CACA 1I90A 1HEBA 4Q07A 5CJFA 1ZGFA 4Z1EA 1BNUA 5E28A 1CVCA 5A25A 3M2ZA 4PQ7A 5FNIA 3IAIA 3DD8A 5JEGB 4Q7WA 5EHEA 4TWMA 1CNIA 4K0SA 1BICA 4WL4A 1BN1A 1ZFKA 3D8WA 3HKNA 3RZ7A 1UGBA 4Q8YA 4M2WA 5A6HA 2Q1QA 5E2RA 1BCDA 5G01A 5EHWA 3TMJA 1HUGA 1TTMA 2POVA 4DZ7A 3MMFA 3CZVA 1BN4A 3EFIA 3S9TA 1LUGA 1CNXA 4XE1A 3TVNX 1ZSBA 2POWA 5FNKA 4COQA 3ML2A 1FSRA 2CA2A 1ZSCA 4K0ZA 3BETA 4ZWXA 5FNGA 3D0NA 1CCUA 3BL1A 1Z93A 4Y0JA 1AM6A 1CVAA 1OKMA 4E3DA 1IF5A 1I9OA 4HEYA 5EKHA 4Q8ZA 4E3FA 3P5AA 4QSAA 3RYJB 3P44A 4TWLA 5EIJA 4ETQC 1ZFQA 4KNMA 2FOYA 3R17B 4Q8XA 5JG5B 1G1DA 1OKLA 1V9EA 1XEGA 1CNBA 1FSQA 1LZVA 4E3HA 3M3XA 1XPZA 1ZGEA 5FNMA 5AMGA 3NJ9A 3PYKA 2Q38A 3F7BA 3MWOA 5SZ1A 4YWPA 3P3JA 3P5LA 4IDRX 1YDBA 3RYVB 5EH7A 5SZ7A 2VVBX 4JSAA 1UGFA 5E2KA 3MNUA 3M96A 4FPTA 5DSLA 3BL0A 1H9NA 1CRMA 4PZHA 2FNNA 3M2XA 3HFPA 8CA2A 1KOQA 5L6KA 4M2RA 1RZCA 4WUQA 4JSSA 3S75B 3KLDB 2H4NA 1CILA 2NXSA 1G53A 4RIUA 3UYQA 3T5ZA 4ITOA 3RZ5A 4KUYA 9CA2A 4Q83A 1CAYA 1IF4A 1RAYA 5FL4A 3IBIA 1CCTA 3N3JA 5JEPB 1AZMA 4MDGA 3GZ0A 1MUAA 5E2MA 1CAJA 4Q09A 1HCBA 4L5UA 5DSOA 3IBLA 3MHOA 4CA2A 4WW6A 1OKNA 5FNHA 4QIYA 1LG6A 3F7UA 4RUYA 1BV3A 2HOCA 3MNKA 4MLTA 2CBAA 1F2WA 4Q7SA 3SBIA 1FQRA 3RYXB 3RZ8A 2ILIA 3N4BA 4Q08A 4PYXA 4CNWA 3ZP9A 3RYYA 1UGCA 4ILXA 4C3TA 1XQ0A 5JESB 4Q6EA 3VBDA 3NI5A 4KNNA 3DCCA 2X7TA 4ZX1A 1HUHA 3U3AX 4Q90A 4QSIA 3RLDA 1Z97A 4FU5A 5DOHA 1I9NA 1J9WA 2CBCA 4HU1A 4XZ5A 3SAXA 4XFWA 3ZNCA 4N16A 4Z0QA 1YO0A 3RYZA 4KAPA 3C7PA 3M1WA 1CAHA 2ZNCA 4KP5A 3DVDA 4X5SA 1ZNCA 4R5BA 3D93A 3S8XA 5EH5A 5EH8A 3HKTA 1ZE8A 4YXIA 3V3JA 2NNVA 3S97A 1RZEA 1JCZA 1RZDA 2NWPA 4KV0A 5DSRA 1H4NA 1IF7A 5EOIA 3P4VA 1RJ5A 5DVXA 5FLQA 3HKUA 1HVAA 4N0XB 4YGLA 3PJJA 3MZCA 2Q1BA 4RFDA 2WEJA 1G54A 2NXRA 5FLTA 6CA2A 3RZ1B 3S74B 5BYIA 1TEUX 3B4FA 1URTA 3OYSA 1OQ5A 3D92A 1G0FA 4QJ0A 4QIZA 4ZAOA 4GL1X 4Q9YA 4UOVA 5DSMA 1KWQA 1G46A 2AX2A 4YYTA 5JDVB 4HT0A 3OKVA 2GEHA 4MDLA 3DVBA 5C8IA 1UGDA 1CNJA 3SBHA 3M67A 1V9IC 3V2MA 5BRUA 1JD0A 1Z9YA 1HCAA 5FDCA 3LXEA 2NNGA 1FR7A 1FSNA 4Q06A 5G0CA 3W6HA 4KNIA 3S76A 3K34A 3V3FA 1HEDA 3KS3A 4RIVA 2NWOA 1TB0X 1CVEA 3EFTA 4JSZA 5FLRA 5E5RA 5HPJA 4RUXA 3KOKA 2FOQA 2WD2A 4YGKA 5E2SA 4ZWZA 5JQTA 3RZ0B 3OKUA 4L5WA 4BF6A 1LGDA 1H9QA 1CNYA 2QP6A 1DMXA 2FOSA 1IF9A 2WD3A 1CNKA 3V2JA 3F4XA 1CNCA 3CAJA 3V5GA 5JG3B 2IT4A 1CA3A 1DCBA 1YO1A 5SZ4A 3DA2A 3MNAA 1FQNA 3MHMA 2WEGA 3HKQA 2HKKA 1CNWA 2X7UA 1FR4A 2HNCA 1UGGA 3P55A 1CAOA 1G0EA 3Q31A 3DC3A 4K13A 4HT2A 2FOUA 4QJWA 5JEHB 4Z1NA 4G0CA 1G4JA 1BNNA 3DV7A 3S78B 4YGJA 2NNSA 1EOUA 3KONA 4FRCA 5E5UA 3DCWA 3S71B 2O4ZA 4CNVA 1G52A 4JS6A 3PO6A 4E5QA 5E2NA 2FOVA 3N2PA 5DSIA 3MNIA 5DOGA 1THKA 4Q87A 1CA2A 1BNWA 4L5VA 3M2YA 3V3HB 1ZH9A 3N0NA 1I9MA 3M5TA 1RAZA 1BNVA 3RG3A 3DBUA 2NMXA 4PYYA 5IPZA 1FQMA 1TG9A 1KWRA 3M5SA 3D9ZA 4KNJA 3FFPX 3MNJA 3M1JA 4Q7PA 1AVNA 3HS4A 3JXFA 2QO8A 4WR7A 4QSJA 1G4OA 1DMYA 4Q7VA 3IEOA 1ZSAA 3JXHC 4ZWIA 3M98A 1I9QA 4K0TA 4RUZA 3DD0A 2HFWA 3HLJA 3OY0A 1I91A 3F8EA 4QY3A 4Q81A 1CINA 4YVYA 4MDMA 4KP8A 3DC9A 5BNLA 5FLOA 5G0BA 1TE3X 5J8ZA 1G3ZA 5DSKA 3DVCA 3CA2A 1HECA 3FE4A 4XIWA 1CAIA 2FW4A 1UGAA 4QEFA 3MHCA 4MO8A 4BF1A 2CBDA 1CRAA 1CVFA 4QK2A 3V3GB 2HD6A 2NN1A 3SAPA 3M04A 3RGEA 2FMZA 4RFCA 4Q0LA 3OIKA 4DZ9A 3ML5A 5EKJA 5SZ0A 4LP6A 2X7SA 2W2JA 5BRVA 1LG5A 5DSNA 4RN4A 4YGFA 3NB5A 1CAZA 4QK1A 5EKMA 3FW3A 1Y7WA 3K2FA 4E49A 5EZTX 1CANA 3W6IA 4E3GA 4HEWA 7CA2A 2WEOA 1CVHA 5SZ5A 2CBEA 2NWZA 4ITPA 2H15A 5G03A 4HEZA 4FVNA 1RJ6A 5SZ6A 2EZ7A 3QYKA 4Q99A 1G6VA 1TEQX 4Q49A 1YDCA 4M2UA 12CAA 2VVAX 4Q78A 4R59A 4PXXA 4FL7A 2NXTA 1A42A 1CCSA 3MHIA 3MYQA 4E4AA 5JGTB 5L3OA 3OYQA 4FVOA 3T84A 3U47A 1XEVA 3V7XA 1TG3A 2POUA 3KIGA 1RZBA 4JSWA 2NWYA 3P58A 5AMDA 5JGSB 2AW1A 4ZWYA 1HEAA 3KWAA 3KOIA 5SZ3A 1CVBA 2OSMA 2OSFA 3CYUA 5DSQA 2WEHA 5DSPA 1CAMA 5SZ2A 3T85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXG A;  5BRW A;  4ZX0 A;  1JV0 A;  3RG4 A;  4RH2 A;  2FNK A;  3M5E A;  4HBA A;  4HF3 A;  1FLJ A;  4YGN A;  1I9P A;  2FNM A;  4QJO A;  1DCA A;  3P3H A;  4LU3 A;  1CZM A;  3T82 A;  4R5A A;  3M2N A;  4QK3 A;  1CNH A;  1KEQ A;  3T5U A;  2GD8 A;  1RZA A;  2FMG A;  4XIX A;  3M1Q A;  3M40 A;  3MNH A;  1CIM A;  4CNX A;  5CA2 A;  1BNQ A;  2ABE A;  2CBB A;  3U7C A;  4MTY A;  1IF6 A;  2EU3 A;  3KKX A;  2CAB A;  5FNJ A;  4LHI A;  3DCS A;  5FNL A;  1KOP A;  1BNM A;  3OIM A;  5FL6 A;  1IF8 A;  2QOA A;  1BN3 A;  1G45 A;  5FLS A;  2EU2 A;  4Z1J A;  1BZM A;  3T83 A;  1MOO A;  4E9O X;  3M1K A;  5DRS A;  2NN7 A;  1TBT X;  3M14 A;  3L14 A;  4CNR A;  1I9L A;  5AML A;  4QJX A;  3OIL A;  4YX4 A;  4G7A A;  4K1Q A;  4QJP A;  1CVD A;  4YXU A;  3TVO X;  5DSJ A;  3IGP A;  3KNE A;  2F14 A;  1CAL A;  4KUV A;  3MDZ A;  4WUP A;  1CNG A;  4CQ0 A;  1I8Z A;  4IWZ A;  4QSB A;  5LMD A;  1G48 A;  3K7K A;  1BNT A;  1YO2 A;  4QJM A;  3MHL A;  3S77 B;  3U45 X;  3DAZ A;  4WW8 A;  1T9N A;  1FQL A;  4M2V A;  1TH9 A;  1UGE A;  5FLP A;  4MLX A;  4KUW A;  3RJ7 A;  5FDI A;  3S72 B;  4BCW A;  1YDD A;  4Z1K A;  4YHA A;  3B1B A;  4YXO A;  5CLU A;  1CAK A;  2NNO A;  3R16 A;  4Q6D A;  3V3I B;  4QTL A;  4FIK A;  5FL5 A;  3S73 B;  4CAC A;  1YDA A;  5JQ0 A;  5EHV A;  3IBN A;  2HL4 A;  3UYN A;  3IBU A;  5CAC A;  1I90 A;  1HEB A;  4Q07 A;  5CJF A;  1ZGF A;  4Z1E A;  1BNU A;  5E28 A;  1CVC A;  5A25 A;  3M2Z A;  4PQ7 A;  5FNI A;  3IAI A;  3DD8 A;  5JEG B;  4Q7W A;  5EHE A;  4TWM A;  1CNI A;  4K0S A;  1BIC A;  4WL4 A;  1BN1 A;  1ZFK A;  3D8W A;  3HKN A;  3RZ7 A;  1UGB A;  4Q8Y A;  4M2W A;  5A6H A;  2Q1Q A;  5E2R A;  1BCD A;  5G01 A;  5EHW A;  3TMJ A;  1HUG A;  1TTM A;  2POV A;  4DZ7 A;  3MMF A;  3CZV A;  1BN4 A;  3EFI A;  3S9T A;  1LUG A;  1CNX A;  4XE1 A;  3TVN X;  1ZSB A;  2POW A;  5FNK A;  4COQ A;  3ML2 A;  1FSR A;  2CA2 A;  1ZSC A;  4K0Z A;  3BET A;  4ZWX A;  5FNG A;  3D0N A;  1CCU A;  3BL1 A;  1Z93 A;  4Y0J A;  1AM6 A;  1CVA A;  1OKM A;  4E3D A;  1IF5 A;  1I9O A;  4HEY A;  5EKH A;  4Q8Z A;  4E3F A;  3P5A A;  4QSA A;  3RYJ B;  3P44 A;  4TWL A;  5EIJ A;  4ETQ C;  1ZFQ A;  4KNM A;  2FOY A;  3R17 B;  4Q8X A;  5JG5 B;  1G1D A;  1OKL A;  1V9E A;  1XEG A;  1CNB A;  1FSQ A;  1LZV A;  4E3H A;  3M3X A;  1XPZ A;  1ZGE A;  5FNM A;  5AMG A;  3NJ9 A;  3PYK A;  2Q38 A;  3F7B A;  3MWO A;  5SZ1 A;  4YWP A;  3P3J A;  3P5L A;  4IDR X;  1YDB A;  3RYV B;  5EH7 A;  5SZ7 A;  2VVB X;  4JSA A;  1UGF A;  5E2K A;  3MNU A;  3M96 A;  4FPT A;  5DSL A;  3BL0 A;  1H9N A;  1CRM A;  4PZH A;  2FNN A;  3M2X A;  3HFP A;  8CA2 A;  1KOQ A;  5L6K A;  4M2R A;  1RZC A;  4WUQ A;  4JSS A;  3S75 B;  3KLD B;  2H4N A;  1CIL A;  2NXS A;  1G53 A;  4RIU A;  3UYQ A;  3T5Z A;  4ITO A;  3RZ5 A;  4KUY A;  9CA2 A;  4Q83 A;  1CAY A;  1IF4 A;  1RAY A;  5FL4 A;  3IBI A;  1CCT A;  3N3J A;  5JEP B;  1AZM A;  4MDG A;  3GZ0 A;  1MUA A;  5E2M A;  1CAJ A;  4Q09 A;  1HCB A;  4L5U A;  5DSO A;  3IBL A;  3MHO A;  4CA2 A;  4WW6 A;  1OKN A;  5FNH A;  4QIY A;  1LG6 A;  3F7U A;  4RUY A;  1BV3 A;  2HOC A;  3MNK A;  4MLT A;  2CBA A;  1F2W A;  4Q7S A;  3SBI A;  1FQR A;  3RYX B;  3RZ8 A;  2ILI A;  3N4B A;  4Q08 A;  4PYX A;  4CNW A;  3ZP9 A;  3RYY A;  1UGC A;  4ILX A;  4C3T A;  1XQ0 A;  5JES B;  4Q6E A;  3VBD A;  3NI5 A;  4KNN A;  3DCC A;  2X7T A;  4ZX1 A;  1HUH A;  3U3A X;  4Q90 A;  4QSI A;  3RLD A;  1Z97 A;  4FU5 A;  5DOH A;  1I9N A;  1J9W A;  2CBC A;  4HU1 A;  4XZ5 A;  3SAX A;  4XFW A;  3ZNC A;  4N16 A;  4Z0Q A;  1YO0 A;  3RYZ A;  4KAP A;  3C7P A;  3M1W A;  1CAH A;  2ZNC A;  4KP5 A;  3DVD A;  4X5S A;  1ZNC A;  4R5B A;  3D93 A;  3S8X A;  5EH5 A;  5EH8 A;  3HKT A;  1ZE8 A;  4YXI A;  3V3J A;  2NNV A;  3S97 A;  1RZE A;  1JCZ A;  1RZD A;  2NWP A;  4KV0 A;  5DSR A;  1H4N A;  1IF7 A;  5EOI A;  3P4V A;  1RJ5 A;  5DVX A;  5FLQ A;  3HKU A;  1HVA A;  4N0X B;  4YGL A;  3PJJ A;  3MZC A;  2Q1B A;  4RFD A;  2WEJ A;  1G54 A;  2NXR A;  5FLT A;  6CA2 A;  3RZ1 B;  3S74 B;  5BYI A;  1TEU X;  3B4F A;  1URT A;  3OYS A;  1OQ5 A;  3D92 A;  1G0F A;  4QJ0 A;  4QIZ A;  4ZAO A;  4GL1 X;  4Q9Y A;  4UOV A;  5DSM A;  1KWQ A;  1G46 A;  2AX2 A;  4YYT A;  5JDV B;  4HT0 A;  3OKV A;  2GEH A;  4MDL A;  3DVB A;  5C8I A;  1UGD A;  1CNJ A;  3SBH A;  3M67 A;  1V9I C;  3V2M A;  5BRU A;  1JD0 A;  1Z9Y A;  1HCA A;  5FDC A;  3LXE A;  2NNG A;  1FR7 A;  1FSN A;  4Q06 A;  5G0C A;  3W6H A;  4KNI A;  3S76 A;  3K34 A;  3V3F A;  1HED A;  3KS3 A;  4RIV A;  2NWO A;  1TB0 X;  1CVE A;  3EFT A;  4JSZ A;  5FLR A;  5E5R A;  5HPJ A;  4RUX A;  3KOK A;  2FOQ A;  2WD2 A;  4YGK A;  5E2S A;  4ZWZ A;  5JQT A;  3RZ0 B;  3OKU A;  4L5W A;  4BF6 A;  1LGD A;  1H9Q A;  1CNY A;  2QP6 A;  1DMX A;  2FOS A;  1IF9 A;  2WD3 A;  1CNK A;  3V2J A;  3F4X A;  1CNC A;  3CAJ A;  3V5G A;  5JG3 B;  2IT4 A;  1CA3 A;  1DCB A;  1YO1 A;  5SZ4 A;  3DA2 A;  3MNA A;  1FQN A;  3MHM A;  2WEG A;  3HKQ A;  2HKK A;  1CNW A;  2X7U A;  1FR4 A;  2HNC A;  1UGG A;  3P55 A;  1CAO A;  1G0E A;  3Q31 A;  3DC3 A;  4K13 A;  4HT2 A;  2FOU A;  4QJW A;  5JEH B;  4Z1N A;  4G0C A;  1G4J A;  1BNN A;  3DV7 A;  3S78 B;  4YGJ A;  2NNS A;  1EOU A;  3KON A;  4FRC A;  5E5U A;  3DCW A;  3S71 B;  2O4Z A;  4CNV A;  1G52 A;  4JS6 A;  3PO6 A;  4E5Q A;  5E2N A;  2FOV A;  3N2P A;  5DSI A;  3MNI A;  5DOG A;  1THK A;  4Q87 A;  1CA2 A;  1BNW A;  4L5V A;  3M2Y A;  3V3H B;  1ZH9 A;  3N0N A;  1I9M A;  3M5T A;  1RAZ A;  1BNV A;  3RG3 A;  3DBU A;  2NMX A;  4PYY A;  5IPZ A;  1FQM A;  1TG9 A;  1KWR A;  3M5S A;  3D9Z A;  4KNJ A;  3FFP X;  3MNJ A;  3M1J A;  4Q7P A;  1AVN A;  3HS4 A;  3JXF A;  2QO8 A;  4WR7 A;  4QSJ A;  1G4O A;  1DMY A;  4Q7V A;  3IEO A;  1ZSA A;  3JXH C;  4ZWI A;  3M98 A;  1I9Q A;  4K0T A;  4RUZ A;  3DD0 A;  2HFW A;  3HLJ A;  3OY0 A;  1I91 A;  3F8E A;  4QY3 A;  4Q81 A;  1CIN A;  4YVY A;  4MDM A;  4KP8 A;  3DC9 A;  5BNL A;  5FLO A;  5G0B A;  1TE3 X;  5J8Z A;  1G3Z A;  5DSK A;  3DVC A;  3CA2 A;  1HEC A;  3FE4 A;  4XIW A;  1CAI A;  2FW4 A;  1UGA A;  4QEF A;  3MHC A;  4MO8 A;  4BF1 A;  2CBD A;  1CRA A;  1CVF A;  4QK2 A;  3V3G B;  2HD6 A;  2NN1 A;  3SAP A;  3M04 A;  3RGE A;  2FMZ A;  4RFC A;  4Q0L A;  3OIK A;  4DZ9 A;  3ML5 A;  5EKJ A;  5SZ0 A;  4LP6 A;  2X7S A;  2W2J A;  5BRV A;  1LG5 A;  5DSN A;  4RN4 A;  4YGF A;  3NB5 A;  1CAZ A;  4QK1 A;  5EKM A;  3FW3 A;  1Y7W A;  3K2F A;  4E49 A;  5EZT X;  1CAN A;  3W6I A;  4E3G A;  4HEW A;  7CA2 A;  2WEO A;  1CVH A;  5SZ5 A;  2CBE A;  2NWZ A;  4ITP A;  2H15 A;  5G03 A;  4HEZ A;  4FVN A;  1RJ6 A;  5SZ6 A;  2EZ7 A;  3QYK A;  4Q99 A;  1G6V A;  1TEQ X;  4Q49 A;  1YDC A;  4M2U A;  12CA A;  2VVA X;  4Q78 A;  4R59 A;  4PXX A;  4FL7 A;  2NXT A;  1A42 A;  1CCS A;  3MHI A;  3MYQ A;  4E4A A;  5JGT B;  5L3O A;  3OYQ A;  4FVO A;  3T84 A;  3U47 A;  1XEV A;  3V7X A;  1TG3 A;  2POU A;  3KIG A;  1RZB A;  4JSW A;  2NWY A;  3P58 A;  5AMD A;  5JGS B;  2AW1 A;  4ZWY A;  1HEA A;  3KWA A;  3KOI A;  5SZ3 A;  1CVB A;  2OSM A;  2OSF A;  3CYU A;  5DSQ A;  2WEH A;  5DSP A;  1CAM A;  5SZ2 A;  3T85 A; 
#chains in the Genus database with same CATH topology
 3JXG A;  5BRW A;  4ZX0 A;  1JV0 A;  3RG4 A;  4RH2 A;  2FNK A;  3M5E A;  4HBA A;  4HF3 A;  1FLJ A;  4YGN A;  1I9P A;  2FNM A;  4QJO A;  1DCA A;  3P3H A;  4LU3 A;  1CZM A;  3T82 A;  4R5A A;  3M2N A;  4QK3 A;  1CNH A;  1KEQ A;  3T5U A;  2GD8 A;  1RZA A;  2FMG A;  4XIX A;  3M1Q A;  3M40 A;  3MNH A;  1CIM A;  4CNX A;  5CA2 A;  1BNQ A;  2ABE A;  2CBB A;  3U7C A;  4MTY A;  1IF6 A;  2EU3 A;  3KKX A;  2CAB A;  5FNJ A;  4LHI A;  3DCS A;  5FNL A;  1KOP A;  1BNM A;  3OIM A;  5FL6 A;  1IF8 A;  2QOA A;  1BN3 A;  1G45 A;  5FLS A;  2EU2 A;  4Z1J A;  1BZM A;  3T83 A;  1MOO A;  4E9O X;  3M1K A;  5DRS A;  2NN7 A;  1TBT X;  3M14 A;  3L14 A;  4CNR A;  1I9L A;  5AML A;  4QJX A;  3OIL A;  4YX4 A;  4G7A A;  4K1Q A;  4QJP A;  1CVD A;  4YXU A;  3TVO X;  5DSJ A;  3IGP A;  3KNE A;  2F14 A;  1CAL A;  4KUV A;  3MDZ A;  4WUP A;  1CNG A;  4CQ0 A;  1I8Z A;  4IWZ A;  4QSB A;  5LMD A;  1G48 A;  3K7K A;  1BNT A;  1YO2 A;  4QJM A;  3MHL A;  3S77 B;  3U45 X;  3DAZ A;  4WW8 A;  1T9N A;  1FQL A;  4M2V A;  1TH9 A;  1UGE A;  5FLP A;  4MLX A;  4KUW A;  3RJ7 A;  5FDI A;  3S72 B;  4BCW A;  1YDD A;  4Z1K A;  4YHA A;  3B1B A;  4YXO A;  5CLU A;  1CAK A;  2NNO A;  3R16 A;  4Q6D A;  3V3I B;  4QTL A;  4FIK A;  5FL5 A;  3S73 B;  4CAC A;  1YDA A;  5JQ0 A;  5EHV A;  3IBN A;  2HL4 A;  3UYN A;  3IBU A;  5CAC A;  1I90 A;  1HEB A;  4Q07 A;  5CJF A;  1ZGF A;  4Z1E A;  1BNU A;  5E28 A;  1CVC A;  5A25 A;  3M2Z A;  4PQ7 A;  5FNI A;  3IAI A;  3DD8 A;  5JEG B;  4Q7W A;  5EHE A;  4TWM A;  1CNI A;  4K0S A;  1BIC A;  4WL4 A;  1BN1 A;  1ZFK A;  3D8W A;  3HKN A;  3RZ7 A;  1UGB A;  4Q8Y A;  4M2W A;  5A6H A;  2Q1Q A;  5E2R A;  1BCD A;  5G01 A;  5EHW A;  3TMJ A;  1HUG A;  1TTM A;  2POV A;  4DZ7 A;  3MMF A;  3CZV A;  1BN4 A;  3EFI A;  3S9T A;  1LUG A;  1CNX A;  4XE1 A;  3TVN X;  1ZSB A;  2POW A;  5FNK A;  4COQ A;  3ML2 A;  1FSR A;  2CA2 A;  1ZSC A;  4K0Z A;  3BET A;  4ZWX A;  5FNG A;  3D0N A;  1CCU A;  3BL1 A;  1Z93 A;  4Y0J A;  1AM6 A;  1CVA A;  1OKM A;  4E3D A;  1IF5 A;  1I9O A;  4HEY A;  5EKH A;  4Q8Z A;  4E3F A;  3P5A A;  4QSA A;  3RYJ B;  3P44 A;  4TWL A;  5EIJ A;  4ETQ C;  1ZFQ A;  4KNM A;  2FOY A;  3R17 B;  4Q8X A;  5JG5 B;  1G1D A;  1OKL A;  1V9E A;  1XEG A;  1CNB A;  1FSQ A;  1LZV A;  4E3H A;  3M3X A;  1XPZ A;  1ZGE A;  5FNM A;  5AMG A;  3NJ9 A;  3PYK A;  2Q38 A;  3F7B A;  3MWO A;  5SZ1 A;  4YWP A;  3P3J A;  3P5L A;  4IDR X;  1YDB A;  3RYV B;  5EH7 A;  5SZ7 A;  2VVB X;  4JSA A;  1UGF A;  5E2K A;  3MNU A;  3M96 A;  4FPT A;  5DSL A;  3BL0 A;  1H9N A;  1CRM A;  4PZH A;  2FNN A;  3M2X A;  3HFP A;  8CA2 A;  1KOQ A;  5L6K A;  4M2R A;  1RZC A;  4WUQ A;  4JSS A;  3S75 B;  3KLD B;  2H4N A;  1CIL A;  2NXS A;  1G53 A;  4RIU A;  3UYQ A;  3T5Z A;  4ITO A;  3RZ5 A;  4KUY A;  9CA2 A;  4Q83 A;  1CAY A;  1IF4 A;  1RAY A;  5FL4 A;  3IBI A;  1CCT A;  3N3J A;  5JEP B;  1AZM A;  4MDG A;  3GZ0 A;  1MUA A;  5E2M A;  1CAJ A;  4Q09 A;  1HCB A;  4L5U A;  5DSO A;  3IBL A;  3MHO A;  4CA2 A;  4WW6 A;  1OKN A;  5FNH A;  4QIY A;  1LG6 A;  3F7U A;  4RUY A;  1BV3 A;  2HOC A;  3MNK A;  4MLT A;  2CBA A;  1F2W A;  4Q7S A;  3SBI A;  1FQR A;  3RYX B;  3RZ8 A;  2ILI A;  3N4B A;  4Q08 A;  4PYX A;  4CNW A;  3ZP9 A;  3RYY A;  1UGC A;  4ILX A;  4C3T A;  1XQ0 A;  5JES B;  4Q6E A;  3VBD A;  3NI5 A;  4KNN A;  3DCC A;  2X7T A;  4ZX1 A;  1HUH A;  3U3A X;  4Q90 A;  4QSI A;  3RLD A;  1Z97 A;  4FU5 A;  5DOH A;  1I9N A;  1J9W A;  2CBC A;  4HU1 A;  4XZ5 A;  3SAX A;  4XFW A;  3ZNC A;  4N16 A;  4Z0Q A;  1YO0 A;  3RYZ A;  4KAP A;  3C7P A;  3M1W A;  1CAH A;  2ZNC A;  4KP5 A;  3DVD A;  4X5S A;  1ZNC A;  4R5B A;  3D93 A;  3S8X A;  5EH5 A;  5EH8 A;  3HKT A;  1ZE8 A;  4YXI A;  3V3J A;  2NNV A;  3S97 A;  1RZE A;  1JCZ A;  1RZD A;  2NWP A;  4KV0 A;  5DSR A;  1H4N A;  1IF7 A;  5EOI A;  3P4V A;  1RJ5 A;  5DVX A;  5FLQ A;  3HKU A;  1HVA A;  4N0X B;  4YGL A;  3PJJ A;  3MZC A;  2Q1B A;  4RFD A;  2WEJ A;  1G54 A;  2NXR A;  5FLT A;  6CA2 A;  3RZ1 B;  3S74 B;  5BYI A;  1TEU X;  3B4F A;  1URT A;  3OYS A;  1OQ5 A;  3D92 A;  1G0F A;  4QJ0 A;  4QIZ A;  4ZAO A;  4GL1 X;  4Q9Y A;  4UOV A;  5DSM A;  1KWQ A;  1G46 A;  2AX2 A;  4YYT A;  5JDV B;  4HT0 A;  3OKV A;  2GEH A;  4MDL A;  3DVB A;  5C8I A;  1UGD A;  1CNJ A;  3SBH A;  3M67 A;  1V9I C;  3V2M A;  5BRU A;  1JD0 A;  1Z9Y A;  1HCA A;  5FDC A;  3LXE A;  2NNG A;  1FR7 A;  1FSN A;  4Q06 A;  5G0C A;  3W6H A;  4KNI A;  3S76 A;  3K34 A;  3V3F A;  1HED A;  3KS3 A;  4RIV A;  2NWO A;  1TB0 X;  1CVE A;  3EFT A;  4JSZ A;  5FLR A;  5E5R A;  5HPJ A;  4RUX A;  3KOK A;  2FOQ A;  2WD2 A;  4YGK A;  5E2S A;  4ZWZ A;  5JQT A;  3RZ0 B;  3OKU A;  4L5W A;  4BF6 A;  1LGD A;  1H9Q A;  1CNY A;  2QP6 A;  1DMX A;  2FOS A;  1IF9 A;  2WD3 A;  1CNK A;  3V2J A;  3F4X A;  1CNC A;  3CAJ A;  3V5G A;  5JG3 B;  2IT4 A;  1CA3 A;  1DCB A;  1YO1 A;  5SZ4 A;  3DA2 A;  3MNA A;  1FQN A;  3MHM A;  2WEG A;  3HKQ A;  2HKK A;  1CNW A;  2X7U A;  1FR4 A;  2HNC A;  1UGG A;  3P55 A;  1CAO A;  1G0E A;  3Q31 A;  3DC3 A;  4K13 A;  4HT2 A;  2FOU A;  4QJW A;  5JEH B;  4Z1N A;  4G0C A;  1G4J A;  1BNN A;  3DV7 A;  3S78 B;  4YGJ A;  2NNS A;  1EOU A;  3KON A;  4FRC A;  5E5U A;  3DCW A;  3S71 B;  2O4Z A;  4CNV A;  1G52 A;  4JS6 A;  3PO6 A;  4E5Q A;  5E2N A;  2FOV A;  3N2P A;  5DSI A;  3MNI A;  5DOG A;  1THK A;  4Q87 A;  1CA2 A;  1BNW A;  4L5V A;  3M2Y A;  3V3H B;  1ZH9 A;  3N0N A;  1I9M A;  3M5T A;  1RAZ A;  1BNV A;  3RG3 A;  3DBU A;  2NMX A;  4PYY A;  5IPZ A;  1FQM A;  1TG9 A;  1KWR A;  3M5S A;  3D9Z A;  4KNJ A;  3FFP X;  3MNJ A;  3M1J A;  4Q7P A;  1AVN A;  3HS4 A;  3JXF A;  2QO8 A;  4WR7 A;  4QSJ A;  1G4O A;  1DMY A;  4Q7V A;  3IEO A;  1ZSA A;  3JXH C;  4ZWI A;  3M98 A;  1I9Q A;  4K0T A;  4RUZ A;  3DD0 A;  2HFW A;  3HLJ A;  3OY0 A;  1I91 A;  3F8E A;  4QY3 A;  4Q81 A;  1CIN A;  4YVY A;  4MDM A;  4KP8 A;  3DC9 A;  5BNL A;  5FLO A;  5G0B A;  1TE3 X;  5J8Z A;  1G3Z A;  5DSK A;  3DVC A;  3CA2 A;  1HEC A;  3FE4 A;  4XIW A;  1CAI A;  2FW4 A;  1UGA A;  4QEF A;  3MHC A;  4MO8 A;  4BF1 A;  2CBD A;  1CRA A;  1CVF A;  4QK2 A;  3V3G B;  2HD6 A;  2NN1 A;  3SAP A;  3M04 A;  3RGE A;  2FMZ A;  4RFC A;  4Q0L A;  3OIK A;  4DZ9 A;  3ML5 A;  5EKJ A;  5SZ0 A;  4LP6 A;  2X7S A;  2W2J A;  5BRV A;  1LG5 A;  5DSN A;  4RN4 A;  4YGF A;  3NB5 A;  1CAZ A;  4QK1 A;  5EKM A;  3FW3 A;  1Y7W A;  3K2F A;  4E49 A;  5EZT X;  1CAN A;  3W6I A;  4E3G A;  4HEW A;  7CA2 A;  2WEO A;  1CVH A;  5SZ5 A;  2CBE A;  2NWZ A;  4ITP A;  2H15 A;  5G03 A;  4HEZ A;  4FVN A;  1RJ6 A;  5SZ6 A;  2EZ7 A;  3QYK A;  4Q99 A;  1G6V A;  1TEQ X;  4Q49 A;  1YDC A;  4M2U A;  12CA A;  2VVA X;  4Q78 A;  4R59 A;  4PXX A;  4FL7 A;  2NXT A;  1A42 A;  1CCS A;  3MHI A;  3MYQ A;  4E4A A;  5JGT B;  5L3O A;  3OYQ A;  4FVO A;  3T84 A;  3U47 A;  1XEV A;  3V7X A;  1TG3 A;  2POU A;  3KIG A;  1RZB A;  4JSW A;  2NWY A;  3P58 A;  5AMD A;  5JGS B;  2AW1 A;  4ZWY A;  1HEA A;  3KWA A;  3KOI A;  5SZ3 A;  1CVB A;  2OSM A;  2OSF A;  3CYU A;  5DSQ A;  2WEH A;  5DSP A;  1CAM A;  5SZ2 A;  3T85 A; 
#chains in the Genus database with same CATH homology
 3JXG A;  5BRW A;  4ZX0 A;  1JV0 A;  3RG4 A;  4RH2 A;  2FNK A;  3M5E A;  4HBA A;  4HF3 A;  1FLJ A;  4YGN A;  1I9P A;  2FNM A;  4QJO A;  1DCA A;  3P3H A;  4LU3 A;  1CZM A;  3T82 A;  4R5A A;  3M2N A;  4QK3 A;  1CNH A;  1KEQ A;  3T5U A;  2GD8 A;  1RZA A;  2FMG A;  4XIX A;  3M1Q A;  3M40 A;  3MNH A;  1CIM A;  4CNX A;  5CA2 A;  1BNQ A;  2ABE A;  2CBB A;  3U7C A;  4MTY A;  1IF6 A;  2EU3 A;  3KKX A;  2CAB A;  5FNJ A;  4LHI A;  3DCS A;  5FNL A;  1KOP A;  1BNM A;  3OIM A;  5FL6 A;  1IF8 A;  2QOA A;  1BN3 A;  1G45 A;  5FLS A;  2EU2 A;  4Z1J A;  1BZM A;  3T83 A;  1MOO A;  4E9O X;  3M1K A;  5DRS A;  2NN7 A;  1TBT X;  3M14 A;  3L14 A;  4CNR A;  1I9L A;  5AML A;  4QJX A;  3OIL A;  4YX4 A;  4G7A A;  4K1Q A;  4QJP A;  1CVD A;  4YXU A;  3TVO X;  5DSJ A;  3IGP A;  3KNE A;  2F14 A;  1CAL A;  4KUV A;  3MDZ A;  4WUP A;  1CNG A;  4CQ0 A;  1I8Z A;  4IWZ A;  4QSB A;  5LMD A;  1G48 A;  3K7K A;  1BNT A;  1YO2 A;  4QJM A;  3MHL A;  3S77 B;  3U45 X;  3DAZ A;  4WW8 A;  1T9N A;  1FQL A;  4M2V A;  1TH9 A;  1UGE A;  5FLP A;  4MLX A;  4KUW A;  3RJ7 A;  5FDI A;  3S72 B;  4BCW A;  1YDD A;  4Z1K A;  4YHA A;  3B1B A;  4YXO A;  5CLU A;  1CAK A;  2NNO A;  3R16 A;  4Q6D A;  3V3I B;  4QTL A;  4FIK A;  5FL5 A;  3S73 B;  4CAC A;  1YDA A;  5JQ0 A;  5EHV A;  3IBN A;  2HL4 A;  3UYN A;  3IBU A;  5CAC A;  1I90 A;  1HEB A;  4Q07 A;  5CJF A;  1ZGF A;  4Z1E A;  1BNU A;  5E28 A;  1CVC A;  5A25 A;  3M2Z A;  4PQ7 A;  5FNI A;  3IAI A;  3DD8 A;  5JEG B;  4Q7W A;  5EHE A;  4TWM A;  1CNI A;  4K0S A;  1BIC A;  4WL4 A;  1BN1 A;  1ZFK A;  3D8W A;  3HKN A;  3RZ7 A;  1UGB A;  4Q8Y A;  4M2W A;  5A6H A;  2Q1Q A;  5E2R A;  1BCD A;  5G01 A;  5EHW A;  3TMJ A;  1HUG A;  1TTM A;  2POV A;  4DZ7 A;  3MMF A;  3CZV A;  1BN4 A;  3EFI A;  3S9T A;  1LUG A;  1CNX A;  4XE1 A;  3TVN X;  1ZSB A;  2POW A;  5FNK A;  4COQ A;  3ML2 A;  1FSR A;  2CA2 A;  1ZSC A;  4K0Z A;  3BET A;  4ZWX A;  5FNG A;  3D0N A;  1CCU A;  3BL1 A;  1Z93 A;  4Y0J A;  1AM6 A;  1CVA A;  1OKM A;  4E3D A;  1IF5 A;  1I9O A;  4HEY A;  5EKH A;  4Q8Z A;  4E3F A;  3P5A A;  4QSA A;  3RYJ B;  3P44 A;  4TWL A;  5EIJ A;  4ETQ C;  1ZFQ A;  4KNM A;  2FOY A;  3R17 B;  4Q8X A;  5JG5 B;  1G1D A;  1OKL A;  1V9E A;  1XEG A;  1CNB A;  1FSQ A;  1LZV A;  4E3H A;  3M3X A;  1XPZ A;  1ZGE A;  5FNM A;  5AMG A;  3NJ9 A;  3PYK A;  2Q38 A;  3F7B A;  3MWO A;  5SZ1 A;  4YWP A;  3P3J A;  3P5L A;  4IDR X;  1YDB A;  3RYV B;  5EH7 A;  5SZ7 A;  2VVB X;  4JSA A;  1UGF A;  5E2K A;  3MNU A;  3M96 A;  4FPT A;  5DSL A;  3BL0 A;  1H9N A;  1CRM A;  4PZH A;  2FNN A;  3M2X A;  3HFP A;  8CA2 A;  1KOQ A;  5L6K A;  4M2R A;  1RZC A;  4WUQ A;  4JSS A;  3S75 B;  3KLD B;  2H4N A;  1CIL A;  2NXS A;  1G53 A;  4RIU A;  3UYQ A;  3T5Z A;  4ITO A;  3RZ5 A;  4KUY A;  9CA2 A;  4Q83 A;  1CAY A;  1IF4 A;  1RAY A;  5FL4 A;  3IBI A;  1CCT A;  3N3J A;  5JEP B;  1AZM A;  4MDG A;  3GZ0 A;  1MUA A;  5E2M A;  1CAJ A;  4Q09 A;  1HCB A;  4L5U A;  5DSO A;  3IBL A;  3MHO A;  4CA2 A;  4WW6 A;  1OKN A;  5FNH A;  4QIY A;  1LG6 A;  3F7U A;  4RUY A;  1BV3 A;  2HOC A;  3MNK A;  4MLT A;  2CBA A;  1F2W A;  4Q7S A;  3SBI A;  1FQR A;  3RYX B;  3RZ8 A;  2ILI A;  3N4B A;  4Q08 A;  4PYX A;  4CNW A;  3ZP9 A;  3RYY A;  1UGC A;  4ILX A;  4C3T A;  1XQ0 A;  5JES B;  4Q6E A;  3VBD A;  3NI5 A;  4KNN A;  3DCC A;  2X7T A;  4ZX1 A;  1HUH A;  3U3A X;  4Q90 A;  4QSI A;  3RLD A;  1Z97 A;  4FU5 A;  5DOH A;  1I9N A;  1J9W A;  2CBC A;  4HU1 A;  4XZ5 A;  3SAX A;  4XFW A;  3ZNC A;  4N16 A;  4Z0Q A;  1YO0 A;  3RYZ A;  4KAP A;  3C7P A;  3M1W A;  1CAH A;  2ZNC A;  4KP5 A;  3DVD A;  4X5S A;  1ZNC A;  4R5B A;  3D93 A;  3S8X A;  5EH5 A;  5EH8 A;  3HKT A;  1ZE8 A;  4YXI A;  3V3J A;  2NNV A;  3S97 A;  1RZE A;  1JCZ A;  1RZD A;  2NWP A;  4KV0 A;  5DSR A;  1H4N A;  1IF7 A;  5EOI A;  3P4V A;  1RJ5 A;  5DVX A;  5FLQ A;  3HKU A;  1HVA A;  4N0X B;  4YGL A;  3PJJ A;  3MZC A;  2Q1B A;  4RFD A;  2WEJ A;  1G54 A;  2NXR A;  5FLT A;  6CA2 A;  3RZ1 B;  3S74 B;  5BYI A;  1TEU X;  3B4F A;  1URT A;  3OYS A;  1OQ5 A;  3D92 A;  1G0F A;  4QJ0 A;  4QIZ A;  4ZAO A;  4GL1 X;  4Q9Y A;  4UOV A;  5DSM A;  1KWQ A;  1G46 A;  2AX2 A;  4YYT A;  5JDV B;  4HT0 A;  3OKV A;  2GEH A;  4MDL A;  3DVB A;  5C8I A;  1UGD A;  1CNJ A;  3SBH A;  3M67 A;  1V9I C;  3V2M A;  5BRU A;  1JD0 A;  1Z9Y A;  1HCA A;  5FDC A;  3LXE A;  2NNG A;  1FR7 A;  1FSN A;  4Q06 A;  5G0C A;  3W6H A;  4KNI A;  3S76 A;  3K34 A;  3V3F A;  1HED A;  3KS3 A;  4RIV A;  2NWO A;  1TB0 X;  1CVE A;  3EFT A;  4JSZ A;  5FLR A;  5E5R A;  5HPJ A;  4RUX A;  3KOK A;  2FOQ A;  2WD2 A;  4YGK A;  5E2S A;  4ZWZ A;  5JQT A;  3RZ0 B;  3OKU A;  4L5W A;  4BF6 A;  1LGD A;  1H9Q A;  1CNY A;  2QP6 A;  1DMX A;  2FOS A;  1IF9 A;  2WD3 A;  1CNK A;  3V2J A;  3F4X A;  1CNC A;  3CAJ A;  3V5G A;  5JG3 B;  2IT4 A;  1CA3 A;  1DCB A;  1YO1 A;  5SZ4 A;  3DA2 A;  3MNA A;  1FQN A;  3MHM A;  2WEG A;  3HKQ A;  2HKK A;  1CNW A;  2X7U A;  1FR4 A;  2HNC A;  1UGG A;  3P55 A;  1CAO A;  1G0E A;  3Q31 A;  3DC3 A;  4K13 A;  4HT2 A;  2FOU A;  4QJW A;  5JEH B;  4Z1N A;  4G0C A;  1G4J A;  1BNN A;  3DV7 A;  3S78 B;  4YGJ A;  2NNS A;  1EOU A;  3KON A;  4FRC A;  5E5U A;  3DCW A;  3S71 B;  2O4Z A;  4CNV A;  1G52 A;  4JS6 A;  3PO6 A;  4E5Q A;  5E2N A;  2FOV A;  3N2P A;  5DSI A;  3MNI A;  5DOG A;  1THK A;  4Q87 A;  1CA2 A;  1BNW A;  4L5V A;  3M2Y A;  3V3H B;  1ZH9 A;  3N0N A;  1I9M A;  3M5T A;  1RAZ A;  1BNV A;  3RG3 A;  3DBU A;  2NMX A;  4PYY A;  5IPZ A;  1FQM A;  1TG9 A;  1KWR A;  3M5S A;  3D9Z A;  4KNJ A;  3FFP X;  3MNJ A;  3M1J A;  4Q7P A;  1AVN A;  3HS4 A;  3JXF A;  2QO8 A;  4WR7 A;  4QSJ A;  1G4O A;  1DMY A;  4Q7V A;  3IEO A;  1ZSA A;  3JXH C;  4ZWI A;  3M98 A;  1I9Q A;  4K0T A;  4RUZ A;  3DD0 A;  2HFW A;  3HLJ A;  3OY0 A;  1I91 A;  3F8E A;  4QY3 A;  4Q81 A;  1CIN A;  4YVY A;  4MDM A;  4KP8 A;  3DC9 A;  5BNL A;  5FLO A;  5G0B A;  1TE3 X;  5J8Z A;  1G3Z A;  5DSK A;  3DVC A;  3CA2 A;  1HEC A;  3FE4 A;  4XIW A;  1CAI A;  2FW4 A;  1UGA A;  4QEF A;  3MHC A;  4MO8 A;  4BF1 A;  2CBD A;  1CRA A;  1CVF A;  4QK2 A;  3V3G B;  2HD6 A;  2NN1 A;  3SAP A;  3M04 A;  3RGE A;  2FMZ A;  4RFC A;  4Q0L A;  3OIK A;  4DZ9 A;  3ML5 A;  5EKJ A;  5SZ0 A;  4LP6 A;  2X7S A;  2W2J A;  5BRV A;  1LG5 A;  5DSN A;  4RN4 A;  4YGF A;  3NB5 A;  1CAZ A;  4QK1 A;  5EKM A;  3FW3 A;  1Y7W A;  3K2F A;  4E49 A;  5EZT X;  1CAN A;  3W6I A;  4E3G A;  4HEW A;  7CA2 A;  2WEO A;  1CVH A;  5SZ5 A;  2CBE A;  2NWZ A;  4ITP A;  2H15 A;  5G03 A;  4HEZ A;  4FVN A;  1RJ6 A;  5SZ6 A;  2EZ7 A;  3QYK A;  4Q99 A;  1G6V A;  1TEQ X;  4Q49 A;  1YDC A;  4M2U A;  12CA A;  2VVA X;  4Q78 A;  4R59 A;  4PXX A;  4FL7 A;  2NXT A;  1A42 A;  1CCS A;  3MHI A;  3MYQ A;  4E4A A;  5JGT B;  5L3O A;  3OYQ A;  4FVO A;  3T84 A;  3U47 A;  1XEV A;  3V7X A;  1TG3 A;  2POU A;  3KIG A;  1RZB A;  4JSW A;  2NWY A;  3P58 A;  5AMD A;  5JGS B;  2AW1 A;  4ZWY A;  1HEA A;  3KWA A;  3KOI A;  5SZ3 A;  1CVB A;  2OSM A;  2OSF A;  3CYU A;  5DSQ A;  2WEH A;  5DSP A;  1CAM A;  5SZ2 A;  3T85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...