3CZVA

Crystal structure of the human carbonic anhydrase xiii in complex with acetazolamide
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
Knots found
sequence length
258
structure length
258
Chain Sequence
SWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Carbonic anhydrase 13
publication title Crystal structure of human carbonic anhydrase XIII and its complex with the inhibitor acetazolamide.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 258
sequence length 258
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2008-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 3czvA00
4WL4A 1MOOA 1CINA 2IT4A 3F4XA 1G4JA 1FSNA 1HCAA 1RZDA 2O4ZA 4ZWYA 4CQ0A 4PZHA 2WEGA 4WW8A 1FQRA 3RYXB 2NNGA 3V5GA 5G0CA 4QK3A 4HEYA 1ZGEA 2WD3A 1CVHA 5IPZA 5AMLA 1YO2A 2NXRA 4HT0A 4JSZA 2X7UA 1MUAA 1CALA 4CA2A 4Q81A 1CNYA 4Q9YA 3D8WA 5DVXA 1ZFKA 4QJXA 3T5ZA 4ZWZA 1CCUA 4QK2A 5FLRA 5SZ1A 5SZ7A 1ZE8A 1G52A 3M96A 3S97A 4YXUA 1XEVA 1CANA 1LGDA 2Q1QA 4YGLA 3U3AX 1OKNA 1ZGFA 1IF6A 3SAXA 2NXTA 5EIJA 3UYQA 1YDBA 5FDIA 3M67A 3P44A 4MLXA 4XIWA 3V2MA 1IF7A 5JESB 3Q31A 3M14A 2QOAA 1G45A 1CVFA 4QTLA 1I9MA 5FL4A 3OYSA 4E3HA 1I9LA 3FE4A 2NWOA 3L14A 5JDVB 4Q99A 5BRVA 4FVOA 4Q07A 3P5AA 5SZ3A 2X7SA 5E5UA 3SBHA 4HEWA 4ITOA 3T84A 3TVOX 2FW4A 1CNJA 3KLDB 4UOVA 1G54A 1BCDA 2HL4A 4Q08A 1G0FA 3K34A 1CA2A 3W6IA 1XPZA 1CVCA 3T5UA 1RZCA 4QY3A 1CIMA 1BN4A 2POVA 4CNRA 4LU3A 4PYXA 5BNLA 3NJ9A 3IAIA 2NWPA 4K0ZA 1CNHA 4L5WA 3K7KA 4WR7A 4COQA 3JXGA 4E9OX 5EH7A 4Z1KA 5FL5A 3KS3A 4Z1NA 3S8XA 3KOIA 1KEQA 1FSQA 1CZMA 3D92A 3HLJA 1LG6A 2Q38A 1I91A 1CAOA 3EFTA 4E3GA 3DD0A 1KOQA 1RZAA 4BF6A 4CNVA 5FLPA 1G3ZA 2AW1A 5E2RA 4G7AA 5L6KA 2NNSA 4HF3A 1CNKA 1CCSA 4FIKA 3VBDA 3M2YA 3M98A 3JXHC 3EFIA 1JCZA 4KNJA 4WW6A 5LMDA 4CNWA 1I9QA 3BETA 2NWZA 2POWA 4QIYA 3PO6A 2X7TA 1CAKA 5FLSA 4JS6A 1ZNCA 1IF4A 4R59A 1RJ5A 4TWLA 1V9IC 4Q09A 1CRAA 5JG3B 2ZNCA 1YDCA 2H4NA 3HKQA 2ILIA 4YX4A 3RZ7A 3D9ZA 1HUHA 4K13A 5FNKA 3CAJA 2CABA 4Q90A 1OQ5A 1FQMA 2VVBX 4QIZA 5CACA 3DV7A 3OIKA 3F7BA 4KNNA 4Q83A 3N0NA 4KP8A 1TE3X 1TG3A 4KP5A 5FNGA 4JSWA 4YHAA 4MTYA 3OIMA 5AMGA 3U47A 3F8EA 3SBIA 1FQLA 5EH8A 4Q6DA 3M5TA 3MNHA 4MDMA 3IEOA 1TEUX 5E2MA 3N2PA 4C3TA 5CA2A 3HKNA 1BNMA 4K0TA 3RJ7A 4RUXA 4ITPA 2WEHA 3NI5A 3DD8A 1TB0X 3MNJA 5E5RA 1I9PA 5DOHA 9CA2A 5JEPB 2FNMA 1ZSBA 3MWOA 4Q78A 1CNGA 3MHMA 5E2KA 4Q06A 3V3JA 3V2JA 5SZ6A 5FLQA 2QP6A 6CA2A 4FVNA 2FOQA 1UGBA 4QSIA 1CNBA 1DMXA 5HPJA 1OKLA 4QJPA 3DC3A 2OSMA 5BRUA 5C8IA 3KIGA 1XQ0A 5BRWA 2CBEA 3P3JA 4QSJA 3C7PA 3KONA 3MNUA 3RZ5A 5DSLA 5DSJA 1KOPA 4YXIA 1YO0A 5DSKA 1JV0A 1RJ6A 4WUQA 3KOKA 3R17B 5FNJA 3M1JA 3S76A 3MNKA 3S77B 2NXSA 1G6VA 3UYNA 1H4NA 4QJ0A 5L3OA 1HEAA 1LG5A 3MMFA 4E3DA 4ZX1A 4HU1A 5SZ4A 3KWAA 3U45X 3CZVA 1CVAA 2HOCA 1BN3A 1UGFA 4IWZA 4Y0JA 1G0EA 5DOGA 4TWMA 5EHEA 1FQNA 1HEDA 4Z1JA 3DC9A 5G03A 1G53A 1CNXA 4G0CA 3RYYA 5AMDA 4E5QA 1G1DA 5EH5A 3S75B 4KV0A 1LZVA 1BZMA 2FOSA 7CA2A 1LUGA 3B1BA 4IDRX 4Z1EA 4Z0QA 4YGFA 3V7XA 3S72B 1KWRA 5EHVA 5A6HA 4QEFA 3M2NA 1TEQX 3IBLA 3DVBA 1CAIA 1FR7A 4PYYA 3F7UA 4ZWXA 4Q8ZA 3NB5A 4Q49A 4K1QA 4RIVA 1Y7WA 1BN1A 2NNOA 1DCBA 3BL1A 4QJMA 3RZ1B 1OKMA 5DSNA 2EU3A 3P5LA 4Q7PA 1JD0A 4M2WA 4QK1A 5G0BA 1Z97A 4Q7SA 2FOVA 1YDAA 3DCWA 4Q8XA 3M04A 3S9TA 1ZFQA 12CAA 3DCCA 4RFCA 1EOUA 4KNMA 5SZ2A 3RYZA 2NMXA 5FNIA 3M1QA 5JGSB 5FLOA 5A25A 5EHWA 4BCWA 2HNCA 1KWQA 3DVCA 5DSQA 2HD6A 1AVNA 4YYTA 4Q87A 1J9WA 3K2FA 4FPTA 4PQ7A 3ML2A 4CNXA 4ZAOA 4HEZA 5EKJA 3DAZA 3V3GB 1H9NA 3DCSA 2NNVA 4BF1A 4RUYA 5DSIA 3RZ0B 3M1WA 1CRMA 3CA2A 2NN1A 1I9OA 3RZ8A 1FR4A 3HS4A 1V9EA 4DZ9A 5JG5B 1UGDA 5JEGB 3QYKA 4XFWA 3M2XA 3ZNCA 1CAMA 2VVAX 2FNKA 3N3JA 4RUZA 5FNMA 3MHIA 1TTMA 1TBTX 1UGCA 1CNWA 4Q0LA 1BICA 2CA2A 1DMYA 3BL0A 3JXFA 3W6HA 3M3XA 4LHIA 1CA3A 3DBUA 3FFPX 2FOYA 1Z93A 4E3FA 3KKXA 2POUA 4ILXA 2FMGA 4N0XB 3M1KA 3OILA 3MHOA 3P3HA 3P4VA 1A42A 3S73B 1CILA 2Q1BA 1ZSAA 1CAYA 5DSPA 3LXEA 5FNLA 5FL6A 4LP6A 5EOIA 3M40A 3RGEA 4M2RA 2H15A 3CYUA 4YGJA 5E28A 4KNIA 1FLJA 2HKKA 3HKTA 4M2UA 3MHCA 4RN4A 4R5AA 1UGAA 1HVAA 1I9NA 3S74B 1CAZA 3RYVB 3B4FA 3RLDA 4KUWA 3MNAA 4PXXA 1BNWA 1CNCA 4KUVA 1YDDA 1I90A 3IGPA 5JQTA 1BNVA 1T9NA 1BV3A 1HCBA 5EKMA 3ML5A 4QSBA 3R16A 3KNEA 5SZ5A 2WEJA 2WEOA 3OKVA 4GL1X 4XE1A 4Q7WA 1BNUA 3V3IB 3IBNA 3MZCA 4E4AA 3M2ZA 4Q7VA 3GZ0A 4RH2A 1AZMA 5DSOA 3P55A 4FU5A 4Q8YA 1XEGA 1FSRA 4L5VA 3MNIA 1H9QA 4KAPA 3D93A 4WUPA 4K0SA 4N16A 3PJJA 3IBUA 1G46A 3M5EA 4X5SA 1IF9A 4DZ7A 3HKUA 3T82A 3V3FA 2EZ7A 3MHLA 3ZP9A 4CACA 4RFDA 2GD8A 1CNIA 2QO8A 3M5SA 5JQ0A 2OSFA 1ZSCA 4E49A 5JEHB 1ZH9A 4HBAA 1IF5A 1BNNA 1RZBA 5EZTX 1CCTA 2FNNA 3RG3A 4RIUA 3TMJA 4XZ5A 5DRSA 1Z9YA 3MYQA 4HT2A 3T83A 2AX2A 4L5UA 1UGGA 4KUYA 5J8ZA 1I8ZA 3S78B 1BNQA 1BNTA 8CA2A 3RG4A 5DSRA 2F14A 5DSMA 3D0NA 1HECA 4JSAA 4MO8A 3OYQA 4M2VA 1G4OA 1HEBA 1DCAA 4Q6EA 5FNHA 3PYKA 1YO1A 4YWPA 1F2WA 4QJWA 4ETQC 4YGNA 3T85A 3OKUA 4YVYA 3SAPA 1TH9A 3S71B 1THKA 3TVNX 1TG9A 5BYIA 5EKHA 2CBDA 2GEHA 1CVDA 3DVDA 1CVEA 2NWYA 2ABEA 4MDGA 4XIXA 4YXOA 2CBAA 3N4BA 3HFPA 3IBIA 1RZEA 5E2NA 5FDCA 5JGTB 5CLUA 2CBBA 4MDLA 4ZX0A 2HFWA 1CAHA 4FRCA 5CJFA 1AM6A 1IF8A 3V3HB 4QSAA 4YGKA 4FL7A 5SZ0A 2EU2A 5G01A 1RAYA 4ZWIA 3P58A 3FW3A 1G48A 1HUGA 3OY0A 1CAJA 2WD2A 1CVBA 3RYJB 2W2JA 4JSSA 4QJOA 2CBCA 5E2SA 3U7CA 3DA2A 3MDZA 5FLTA 2NN7A 1RAZA 2FMZA 1URTA 1UGEA 4MLTA 2FOUA 4R5BA
chains in the Genus database with same CATH superfamily
4WL4A 1MOOA 1CINA 2IT4A 3F4XA 1G4JA 1FSNA 1HCAA 1RZDA 2O4ZA 4ZWYA 4CQ0A 4PZHA 2WEGA 4WW8A 1FQRA 3RYXB 2NNGA 3V5GA 5G0CA 4QK3A 4HEYA 1ZGEA 2WD3A 1CVHA 5IPZA 5AMLA 1YO2A 2NXRA 4HT0A 4JSZA 2X7UA 1MUAA 1CALA 4CA2A 4Q81A 1CNYA 4Q9YA 3D8WA 5DVXA 1ZFKA 4QJXA 3T5ZA 4ZWZA 1CCUA 4QK2A 5FLRA 5SZ1A 5SZ7A 1ZE8A 1G52A 3M96A 3S97A 4YXUA 1XEVA 1CANA 1LGDA 2Q1QA 4YGLA 3U3AX 1OKNA 1ZGFA 1IF6A 3SAXA 2NXTA 5EIJA 3UYQA 1YDBA 5FDIA 3M67A 3P44A 4MLXA 4XIWA 3V2MA 1IF7A 5JESB 3Q31A 3M14A 2QOAA 1G45A 1CVFA 4QTLA 1I9MA 5FL4A 3OYSA 4E3HA 1I9LA 3FE4A 2NWOA 3L14A 5JDVB 4Q99A 5BRVA 4FVOA 4Q07A 3P5AA 5SZ3A 2X7SA 5E5UA 3SBHA 4HEWA 4ITOA 3T84A 3TVOX 2FW4A 1CNJA 3KLDB 4UOVA 1G54A 1BCDA 2HL4A 4Q08A 1G0FA 3K34A 1CA2A 3W6IA 1XPZA 1CVCA 3T5UA 1RZCA 4QY3A 1CIMA 1BN4A 2POVA 4CNRA 4LU3A 4PYXA 5BNLA 3NJ9A 3IAIA 2NWPA 4K0ZA 1CNHA 4L5WA 3K7KA 4WR7A 4COQA 3JXGA 4E9OX 5EH7A 4Z1KA 5FL5A 3KS3A 4Z1NA 3S8XA 3KOIA 1KEQA 1FSQA 1CZMA 3D92A 3HLJA 1LG6A 2Q38A 1I91A 1CAOA 3EFTA 4E3GA 3DD0A 1KOQA 1RZAA 4BF6A 4CNVA 5FLPA 1G3ZA 2AW1A 5E2RA 4G7AA 5L6KA 2NNSA 4HF3A 1CNKA 1CCSA 4FIKA 3VBDA 3M2YA 3M98A 3JXHC 3EFIA 1JCZA 4KNJA 4WW6A 5LMDA 4CNWA 1I9QA 3BETA 2NWZA 2POWA 4QIYA 3PO6A 2X7TA 1CAKA 5FLSA 4JS6A 1ZNCA 1IF4A 4R59A 1RJ5A 4TWLA 1V9IC 4Q09A 1CRAA 5JG3B 2ZNCA 1YDCA 2H4NA 3HKQA 2ILIA 4YX4A 3RZ7A 3D9ZA 1HUHA 4K13A 5FNKA 3CAJA 2CABA 4Q90A 1OQ5A 1FQMA 2VVBX 4QIZA 5CACA 3DV7A 3OIKA 3F7BA 4KNNA 4Q83A 3N0NA 4KP8A 1TE3X 1TG3A 4KP5A 5FNGA 4JSWA 4YHAA 4MTYA 3OIMA 5AMGA 3U47A 3F8EA 3SBIA 1FQLA 5EH8A 4Q6DA 3M5TA 3MNHA 4MDMA 3IEOA 1TEUX 5E2MA 3N2PA 4C3TA 5CA2A 3HKNA 1BNMA 4K0TA 3RJ7A 4RUXA 4ITPA 2WEHA 3NI5A 3DD8A 1TB0X 3MNJA 5E5RA 1I9PA 5DOHA 9CA2A 5JEPB 2FNMA 1ZSBA 3MWOA 4Q78A 1CNGA 3MHMA 5E2KA 4Q06A 3V3JA 3V2JA 5SZ6A 5FLQA 2QP6A 6CA2A 4FVNA 2FOQA 1UGBA 4QSIA 1CNBA 1DMXA 5HPJA 1OKLA 4QJPA 3DC3A 2OSMA 5BRUA 5C8IA 3KIGA 1XQ0A 5BRWA 2CBEA 3P3JA 4QSJA 3C7PA 3KONA 3MNUA 3RZ5A 5DSLA 5DSJA 1KOPA 4YXIA 1YO0A 5DSKA 1JV0A 1RJ6A 4WUQA 3KOKA 3R17B 5FNJA 3M1JA 3S76A 3MNKA 3S77B 2NXSA 1G6VA 3UYNA 1H4NA 4QJ0A 5L3OA 1HEAA 1LG5A 3MMFA 4E3DA 4ZX1A 4HU1A 5SZ4A 3KWAA 3U45X 3CZVA 1CVAA 2HOCA 1BN3A 1UGFA 4IWZA 4Y0JA 1G0EA 5DOGA 4TWMA 5EHEA 1FQNA 1HEDA 4Z1JA 3DC9A 5G03A 1G53A 1CNXA 4G0CA 3RYYA 5AMDA 4E5QA 1G1DA 5EH5A 3S75B 4KV0A 1LZVA 1BZMA 2FOSA 7CA2A 1LUGA 3B1BA 4IDRX 4Z1EA 4Z0QA 4YGFA 3V7XA 3S72B 1KWRA 5EHVA 5A6HA 4QEFA 3M2NA 1TEQX 3IBLA 3DVBA 1CAIA 1FR7A 4PYYA 3F7UA 4ZWXA 4Q8ZA 3NB5A 4Q49A 4K1QA 4RIVA 1Y7WA 1BN1A 2NNOA 1DCBA 3BL1A 4QJMA 3RZ1B 1OKMA 5DSNA 2EU3A 3P5LA 4Q7PA 1JD0A 4M2WA 4QK1A 5G0BA 1Z97A 4Q7SA 2FOVA 1YDAA 3DCWA 4Q8XA 3M04A 3S9TA 1ZFQA 12CAA 3DCCA 4RFCA 1EOUA 4KNMA 5SZ2A 3RYZA 2NMXA 5FNIA 3M1QA 5JGSB 5FLOA 5A25A 5EHWA 4BCWA 2HNCA 1KWQA 3DVCA 5DSQA 2HD6A 1AVNA 4YYTA 4Q87A 1J9WA 3K2FA 4FPTA 4PQ7A 3ML2A 4CNXA 4ZAOA 4HEZA 5EKJA 3DAZA 3V3GB 1H9NA 3DCSA 2NNVA 4BF1A 4RUYA 5DSIA 3RZ0B 3M1WA 1CRMA 3CA2A 2NN1A 1I9OA 3RZ8A 1FR4A 3HS4A 1V9EA 4DZ9A 5JG5B 1UGDA 5JEGB 3QYKA 4XFWA 3M2XA 3ZNCA 1CAMA 2VVAX 2FNKA 3N3JA 4RUZA 5FNMA 3MHIA 1TTMA 1TBTX 1UGCA 1CNWA 4Q0LA 1BICA 2CA2A 1DMYA 3BL0A 3JXFA 3W6HA 3M3XA 4LHIA 1CA3A 3DBUA 3FFPX 2FOYA 1Z93A 4E3FA 3KKXA 2POUA 4ILXA 2FMGA 4N0XB 3M1KA 3OILA 3MHOA 3P3HA 3P4VA 1A42A 3S73B 1CILA 2Q1BA 1ZSAA 1CAYA 5DSPA 3LXEA 5FNLA 5FL6A 4LP6A 5EOIA 3M40A 3RGEA 4M2RA 2H15A 3CYUA 4YGJA 5E28A 4KNIA 1FLJA 2HKKA 3HKTA 4M2UA 3MHCA 4RN4A 4R5AA 1UGAA 1HVAA 1I9NA 3S74B 1CAZA 3RYVB 3B4FA 3RLDA 4KUWA 3MNAA 4PXXA 1BNWA 1CNCA 4KUVA 1YDDA 1I90A 3IGPA 5JQTA 1BNVA 1T9NA 1BV3A 1HCBA 5EKMA 3ML5A 4QSBA 3R16A 3KNEA 5SZ5A 2WEJA 2WEOA 3OKVA 4GL1X 4XE1A 4Q7WA 1BNUA 3V3IB 3IBNA 3MZCA 4E4AA 3M2ZA 4Q7VA 3GZ0A 4RH2A 1AZMA 5DSOA 3P55A 4FU5A 4Q8YA 1XEGA 1FSRA 4L5VA 3MNIA 1H9QA 4KAPA 3D93A 4WUPA 4K0SA 4N16A 3PJJA 3IBUA 1G46A 3M5EA 4X5SA 1IF9A 4DZ7A 3HKUA 3T82A 3V3FA 2EZ7A 3MHLA 3ZP9A 4CACA 4RFDA 2GD8A 1CNIA 2QO8A 3M5SA 5JQ0A 2OSFA 1ZSCA 4E49A 5JEHB 1ZH9A 4HBAA 1IF5A 1BNNA 1RZBA 5EZTX 1CCTA 2FNNA 3RG3A 4RIUA 3TMJA 4XZ5A 5DRSA 1Z9YA 3MYQA 4HT2A 3T83A 2AX2A 4L5UA 1UGGA 4KUYA 5J8ZA 1I8ZA 3S78B 1BNQA 1BNTA 8CA2A 3RG4A 5DSRA 2F14A 5DSMA 3D0NA 1HECA 4JSAA 4MO8A 3OYQA 4M2VA 1G4OA 1HEBA 1DCAA 4Q6EA 5FNHA 3PYKA 1YO1A 4YWPA 1F2WA 4QJWA 4ETQC 4YGNA 3T85A 3OKUA 4YVYA 3SAPA 1TH9A 3S71B 1THKA 3TVNX 1TG9A 5BYIA 5EKHA 2CBDA 2GEHA 1CVDA 3DVDA 1CVEA 2NWYA 2ABEA 4MDGA 4XIXA 4YXOA 2CBAA 3N4BA 3HFPA 3IBIA 1RZEA 5E2NA 5FDCA 5JGTB 5CLUA 2CBBA 4MDLA 4ZX0A 2HFWA 1CAHA 4FRCA 5CJFA 1AM6A 1IF8A 3V3HB 4QSAA 4YGKA 4FL7A 5SZ0A 2EU2A 5G01A 1RAYA 4ZWIA 3P58A 3FW3A 1G48A 1HUGA 3OY0A 1CAJA 2WD2A 1CVBA 3RYJB 2W2JA 4JSSA 4QJOA 2CBCA 5E2SA 3U7CA 3DA2A 3MDZA 5FLTA 2NN7A 1RAZA 2FMZA 1URTA 1UGEA 4MLTA 2FOUA 4R5BA
chains in the Genus database with same CATH topology
4WL4A 1MOOA 1CINA 2IT4A 3F4XA 1G4JA 1FSNA 1HCAA 1RZDA 2O4ZA 4ZWYA 4CQ0A 4PZHA 2WEGA 4WW8A 1FQRA 3RYXB 2NNGA 3V5GA 5G0CA 4QK3A 4HEYA 1ZGEA 2WD3A 1CVHA 5IPZA 5AMLA 1YO2A 2NXRA 4HT0A 4JSZA 2X7UA 1MUAA 1CALA 4CA2A 4Q81A 1CNYA 4Q9YA 3D8WA 5DVXA 1ZFKA 4QJXA 3T5ZA 4ZWZA 1CCUA 4QK2A 5FLRA 5SZ1A 5SZ7A 1ZE8A 1G52A 3M96A 3S97A 4YXUA 1XEVA 1CANA 1LGDA 2Q1QA 4YGLA 3U3AX 1OKNA 1ZGFA 1IF6A 3SAXA 2NXTA 5EIJA 3UYQA 1YDBA 5FDIA 3M67A 3P44A 4MLXA 4XIWA 3V2MA 1IF7A 5JESB 3Q31A 3M14A 2QOAA 1G45A 1CVFA 4QTLA 1I9MA 5FL4A 3OYSA 4E3HA 1I9LA 3FE4A 2NWOA 3L14A 5JDVB 4Q99A 5BRVA 4FVOA 4Q07A 3P5AA 5SZ3A 2X7SA 5E5UA 3SBHA 4HEWA 4ITOA 3T84A 3TVOX 2FW4A 1CNJA 3KLDB 4UOVA 1G54A 1BCDA 2HL4A 4Q08A 1G0FA 3K34A 1CA2A 3W6IA 1XPZA 1CVCA 3T5UA 1RZCA 4QY3A 1CIMA 1BN4A 2POVA 4CNRA 4LU3A 4PYXA 5BNLA 3NJ9A 3IAIA 2NWPA 4K0ZA 1CNHA 4L5WA 3K7KA 4WR7A 4COQA 3JXGA 4E9OX 5EH7A 4Z1KA 5FL5A 3KS3A 4Z1NA 3S8XA 3KOIA 1KEQA 1FSQA 1CZMA 3D92A 3HLJA 1LG6A 2Q38A 1I91A 1CAOA 3EFTA 4E3GA 3DD0A 1KOQA 1RZAA 4BF6A 4CNVA 5FLPA 1G3ZA 2AW1A 5E2RA 4G7AA 5L6KA 2NNSA 4HF3A 1CNKA 1CCSA 4FIKA 3VBDA 3M2YA 3M98A 3JXHC 3EFIA 1JCZA 4KNJA 4WW6A 5LMDA 4CNWA 1I9QA 3BETA 2NWZA 2POWA 4QIYA 3PO6A 2X7TA 1CAKA 5FLSA 4JS6A 1ZNCA 1IF4A 4R59A 1RJ5A 4TWLA 1V9IC 4Q09A 1CRAA 5JG3B 2ZNCA 1YDCA 2H4NA 3HKQA 2ILIA 4YX4A 3RZ7A 3D9ZA 1HUHA 4K13A 5FNKA 3CAJA 2CABA 4Q90A 1OQ5A 1FQMA 2VVBX 4QIZA 5CACA 3DV7A 3OIKA 3F7BA 4KNNA 4Q83A 3N0NA 4KP8A 1TE3X 1TG3A 4KP5A 5FNGA 4JSWA 4YHAA 4MTYA 3OIMA 5AMGA 3U47A 3F8EA 3SBIA 1FQLA 5EH8A 4Q6DA 3M5TA 3MNHA 4MDMA 3IEOA 1TEUX 5E2MA 3N2PA 4C3TA 5CA2A 3HKNA 1BNMA 4K0TA 3RJ7A 4RUXA 4ITPA 2WEHA 3NI5A 3DD8A 1TB0X 3MNJA 5E5RA 1I9PA 5DOHA 9CA2A 5JEPB 2FNMA 1ZSBA 3MWOA 4Q78A 1CNGA 3MHMA 5E2KA 4Q06A 3V3JA 3V2JA 5SZ6A 5FLQA 2QP6A 6CA2A 4FVNA 2FOQA 1UGBA 4QSIA 1CNBA 1DMXA 5HPJA 1OKLA 4QJPA 3DC3A 2OSMA 5BRUA 5C8IA 3KIGA 1XQ0A 5BRWA 2CBEA 3P3JA 4QSJA 3C7PA 3KONA 3MNUA 3RZ5A 5DSLA 5DSJA 1KOPA 4YXIA 1YO0A 5DSKA 1JV0A 1RJ6A 4WUQA 3KOKA 3R17B 5FNJA 3M1JA 3S76A 3MNKA 3S77B 2NXSA 1G6VA 3UYNA 1H4NA 4QJ0A 5L3OA 1HEAA 1LG5A 3MMFA 4E3DA 4ZX1A 4HU1A 5SZ4A 3KWAA 3U45X 3CZVA 1CVAA 2HOCA 1BN3A 1UGFA 4IWZA 4Y0JA 1G0EA 5DOGA 4TWMA 5EHEA 1FQNA 1HEDA 4Z1JA 3DC9A 5G03A 1G53A 1CNXA 4G0CA 3RYYA 5AMDA 4E5QA 1G1DA 5EH5A 3S75B 4KV0A 1LZVA 1BZMA 2FOSA 7CA2A 1LUGA 3B1BA 4IDRX 4Z1EA 4Z0QA 4YGFA 3V7XA 3S72B 1KWRA 5EHVA 5A6HA 4QEFA 3M2NA 1TEQX 3IBLA 3DVBA 1CAIA 1FR7A 4PYYA 3F7UA 4ZWXA 4Q8ZA 3NB5A 4Q49A 4K1QA 4RIVA 1Y7WA 1BN1A 2NNOA 1DCBA 3BL1A 4QJMA 3RZ1B 1OKMA 5DSNA 2EU3A 3P5LA 4Q7PA 1JD0A 4M2WA 4QK1A 5G0BA 1Z97A 4Q7SA 2FOVA 1YDAA 3DCWA 4Q8XA 3M04A 3S9TA 1ZFQA 12CAA 3DCCA 4RFCA 1EOUA 4KNMA 5SZ2A 3RYZA 2NMXA 5FNIA 3M1QA 5JGSB 5FLOA 5A25A 5EHWA 4BCWA 2HNCA 1KWQA 3DVCA 5DSQA 2HD6A 1AVNA 4YYTA 4Q87A 1J9WA 3K2FA 4FPTA 4PQ7A 3ML2A 4CNXA 4ZAOA 4HEZA 5EKJA 3DAZA 3V3GB 1H9NA 3DCSA 2NNVA 4BF1A 4RUYA 5DSIA 3RZ0B 3M1WA 1CRMA 3CA2A 2NN1A 1I9OA 3RZ8A 1FR4A 3HS4A 1V9EA 4DZ9A 5JG5B 1UGDA 5JEGB 3QYKA 4XFWA 3M2XA 3ZNCA 1CAMA 2VVAX 2FNKA 3N3JA 4RUZA 5FNMA 3MHIA 1TTMA 1TBTX 1UGCA 1CNWA 4Q0LA 1BICA 2CA2A 1DMYA 3BL0A 3JXFA 3W6HA 3M3XA 4LHIA 1CA3A 3DBUA 3FFPX 2FOYA 1Z93A 4E3FA 3KKXA 2POUA 4ILXA 2FMGA 4N0XB 3M1KA 3OILA 3MHOA 3P3HA 3P4VA 1A42A 3S73B 1CILA 2Q1BA 1ZSAA 1CAYA 5DSPA 3LXEA 5FNLA 5FL6A 4LP6A 5EOIA 3M40A 3RGEA 4M2RA 2H15A 3CYUA 4YGJA 5E28A 4KNIA 1FLJA 2HKKA 3HKTA 4M2UA 3MHCA 4RN4A 4R5AA 1UGAA 1HVAA 1I9NA 3S74B 1CAZA 3RYVB 3B4FA 3RLDA 4KUWA 3MNAA 4PXXA 1BNWA 1CNCA 4KUVA 1YDDA 1I90A 3IGPA 5JQTA 1BNVA 1T9NA 1BV3A 1HCBA 5EKMA 3ML5A 4QSBA 3R16A 3KNEA 5SZ5A 2WEJA 2WEOA 3OKVA 4GL1X 4XE1A 4Q7WA 1BNUA 3V3IB 3IBNA 3MZCA 4E4AA 3M2ZA 4Q7VA 3GZ0A 4RH2A 1AZMA 5DSOA 3P55A 4FU5A 4Q8YA 1XEGA 1FSRA 4L5VA 3MNIA 1H9QA 4KAPA 3D93A 4WUPA 4K0SA 4N16A 3PJJA 3IBUA 1G46A 3M5EA 4X5SA 1IF9A 4DZ7A 3HKUA 3T82A 3V3FA 2EZ7A 3MHLA 3ZP9A 4CACA 4RFDA 2GD8A 1CNIA 2QO8A 3M5SA 5JQ0A 2OSFA 1ZSCA 4E49A 5JEHB 1ZH9A 4HBAA 1IF5A 1BNNA 1RZBA 5EZTX 1CCTA 2FNNA 3RG3A 4RIUA 3TMJA 4XZ5A 5DRSA 1Z9YA 3MYQA 4HT2A 3T83A 2AX2A 4L5UA 1UGGA 4KUYA 5J8ZA 1I8ZA 3S78B 1BNQA 1BNTA 8CA2A 3RG4A 5DSRA 2F14A 5DSMA 3D0NA 1HECA 4JSAA 4MO8A 3OYQA 4M2VA 1G4OA 1HEBA 1DCAA 4Q6EA 5FNHA 3PYKA 1YO1A 4YWPA 1F2WA 4QJWA 4ETQC 4YGNA 3T85A 3OKUA 4YVYA 3SAPA 1TH9A 3S71B 1THKA 3TVNX 1TG9A 5BYIA 5EKHA 2CBDA 2GEHA 1CVDA 3DVDA 1CVEA 2NWYA 2ABEA 4MDGA 4XIXA 4YXOA 2CBAA 3N4BA 3HFPA 3IBIA 1RZEA 5E2NA 5FDCA 5JGTB 5CLUA 2CBBA 4MDLA 4ZX0A 2HFWA 1CAHA 4FRCA 5CJFA 1AM6A 1IF8A 3V3HB 4QSAA 4YGKA 4FL7A 5SZ0A 2EU2A 5G01A 1RAYA 4ZWIA 3P58A 3FW3A 1G48A 1HUGA 3OY0A 1CAJA 2WD2A 1CVBA 3RYJB 2W2JA 4JSSA 4QJOA 2CBCA 5E2SA 3U7CA 3DA2A 3MDZA 5FLTA 2NN7A 1RAZA 2FMZA 1URTA 1UGEA 4MLTA 2FOUA 4R5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WL4 A;  1MOO A;  1CIN A;  2IT4 A;  3F4X A;  1G4J A;  1FSN A;  1HCA A;  1RZD A;  2O4Z A;  4ZWY A;  4CQ0 A;  4PZH A;  2WEG A;  4WW8 A;  1FQR A;  3RYX B;  2NNG A;  3V5G A;  5G0C A;  4QK3 A;  4HEY A;  1ZGE A;  2WD3 A;  1CVH A;  5IPZ A;  5AML A;  1YO2 A;  2NXR A;  4HT0 A;  4JSZ A;  2X7U A;  1MUA A;  1CAL A;  4CA2 A;  4Q81 A;  1CNY A;  4Q9Y A;  3D8W A;  5DVX A;  1ZFK A;  4QJX A;  3T5Z A;  4ZWZ A;  1CCU A;  4QK2 A;  5FLR A;  5SZ1 A;  5SZ7 A;  1ZE8 A;  1G52 A;  3M96 A;  3S97 A;  4YXU A;  1XEV A;  1CAN A;  1LGD A;  2Q1Q A;  4YGL A;  3U3A X;  1OKN A;  1ZGF A;  1IF6 A;  3SAX A;  2NXT A;  5EIJ A;  3UYQ A;  1YDB A;  5FDI A;  3M67 A;  3P44 A;  4MLX A;  4XIW A;  3V2M A;  1IF7 A;  5JES B;  3Q31 A;  3M14 A;  2QOA A;  1G45 A;  1CVF A;  4QTL A;  1I9M A;  5FL4 A;  3OYS A;  4E3H A;  1I9L A;  3FE4 A;  2NWO A;  3L14 A;  5JDV B;  4Q99 A;  5BRV A;  4FVO A;  4Q07 A;  3P5A A;  5SZ3 A;  2X7S A;  5E5U A;  3SBH A;  4HEW A;  4ITO A;  3T84 A;  3TVO X;  2FW4 A;  1CNJ A;  3KLD B;  4UOV A;  1G54 A;  1BCD A;  2HL4 A;  4Q08 A;  1G0F A;  3K34 A;  1CA2 A;  3W6I A;  1XPZ A;  1CVC A;  3T5U A;  1RZC A;  4QY3 A;  1CIM A;  1BN4 A;  2POV A;  4CNR A;  4LU3 A;  4PYX A;  5BNL A;  3NJ9 A;  3IAI A;  2NWP A;  4K0Z A;  1CNH A;  4L5W A;  3K7K A;  4WR7 A;  4COQ A;  3JXG A;  4E9O X;  5EH7 A;  4Z1K A;  5FL5 A;  3KS3 A;  4Z1N A;  3S8X A;  3KOI A;  1KEQ A;  1FSQ A;  1CZM A;  3D92 A;  3HLJ A;  1LG6 A;  2Q38 A;  1I91 A;  1CAO A;  3EFT A;  4E3G A;  3DD0 A;  1KOQ A;  1RZA A;  4BF6 A;  4CNV A;  5FLP A;  1G3Z A;  2AW1 A;  5E2R A;  4G7A A;  5L6K A;  2NNS A;  4HF3 A;  1CNK A;  1CCS A;  4FIK A;  3VBD A;  3M2Y A;  3M98 A;  3JXH C;  3EFI A;  1JCZ A;  4KNJ A;  4WW6 A;  5LMD A;  4CNW A;  1I9Q A;  3BET A;  2NWZ A;  2POW A;  4QIY A;  3PO6 A;  2X7T A;  1CAK A;  5FLS A;  4JS6 A;  1ZNC A;  1IF4 A;  4R59 A;  1RJ5 A;  4TWL A;  1V9I C;  4Q09 A;  1CRA A;  5JG3 B;  2ZNC A;  1YDC A;  2H4N A;  3HKQ A;  2ILI A;  4YX4 A;  3RZ7 A;  3D9Z A;  1HUH A;  4K13 A;  5FNK A;  3CAJ A;  2CAB A;  4Q90 A;  1OQ5 A;  1FQM A;  2VVB X;  4QIZ A;  5CAC A;  3DV7 A;  3OIK A;  3F7B A;  4KNN A;  4Q83 A;  3N0N A;  4KP8 A;  1TE3 X;  1TG3 A;  4KP5 A;  5FNG A;  4JSW A;  4YHA A;  4MTY A;  3OIM A;  5AMG A;  3U47 A;  3F8E A;  3SBI A;  1FQL A;  5EH8 A;  4Q6D A;  3M5T A;  3MNH A;  4MDM A;  3IEO A;  1TEU X;  5E2M A;  3N2P A;  4C3T A;  5CA2 A;  3HKN A;  1BNM A;  4K0T A;  3RJ7 A;  4RUX A;  4ITP A;  2WEH A;  3NI5 A;  3DD8 A;  1TB0 X;  3MNJ A;  5E5R A;  1I9P A;  5DOH A;  9CA2 A;  5JEP B;  2FNM A;  1ZSB A;  3MWO A;  4Q78 A;  1CNG A;  3MHM A;  5E2K A;  4Q06 A;  3V3J A;  3V2J A;  5SZ6 A;  5FLQ A;  2QP6 A;  6CA2 A;  4FVN A;  2FOQ A;  1UGB A;  4QSI A;  1CNB A;  1DMX A;  5HPJ A;  1OKL A;  4QJP A;  3DC3 A;  2OSM A;  5BRU A;  5C8I A;  3KIG A;  1XQ0 A;  5BRW A;  2CBE A;  3P3J A;  4QSJ A;  3C7P A;  3KON A;  3MNU A;  3RZ5 A;  5DSL A;  5DSJ A;  1KOP A;  4YXI A;  1YO0 A;  5DSK A;  1JV0 A;  1RJ6 A;  4WUQ A;  3KOK A;  3R17 B;  5FNJ A;  3M1J A;  3S76 A;  3MNK A;  3S77 B;  2NXS A;  1G6V A;  3UYN A;  1H4N A;  4QJ0 A;  5L3O A;  1HEA A;  1LG5 A;  3MMF A;  4E3D A;  4ZX1 A;  4HU1 A;  5SZ4 A;  3KWA A;  3U45 X;  3CZV A;  1CVA A;  2HOC A;  1BN3 A;  1UGF A;  4IWZ A;  4Y0J A;  1G0E A;  5DOG A;  4TWM A;  5EHE A;  1FQN A;  1HED A;  4Z1J A;  3DC9 A;  5G03 A;  1G53 A;  1CNX A;  4G0C A;  3RYY A;  5AMD A;  4E5Q A;  1G1D A;  5EH5 A;  3S75 B;  4KV0 A;  1LZV A;  1BZM A;  2FOS A;  7CA2 A;  1LUG A;  3B1B A;  4IDR X;  4Z1E A;  4Z0Q A;  4YGF A;  3V7X A;  3S72 B;  1KWR A;  5EHV A;  5A6H A;  4QEF A;  3M2N A;  1TEQ X;  3IBL A;  3DVB A;  1CAI A;  1FR7 A;  4PYY A;  3F7U A;  4ZWX A;  4Q8Z A;  3NB5 A;  4Q49 A;  4K1Q A;  4RIV A;  1Y7W A;  1BN1 A;  2NNO A;  1DCB A;  3BL1 A;  4QJM A;  3RZ1 B;  1OKM A;  5DSN A;  2EU3 A;  3P5L A;  4Q7P A;  1JD0 A;  4M2W A;  4QK1 A;  5G0B A;  1Z97 A;  4Q7S A;  2FOV A;  1YDA A;  3DCW A;  4Q8X A;  3M04 A;  3S9T A;  1ZFQ A;  12CA A;  3DCC A;  4RFC A;  1EOU A;  4KNM A;  5SZ2 A;  3RYZ A;  2NMX A;  5FNI A;  3M1Q A;  5JGS B;  5FLO A;  5A25 A;  5EHW A;  4BCW A;  2HNC A;  1KWQ A;  3DVC A;  5DSQ A;  2HD6 A;  1AVN A;  4YYT A;  4Q87 A;  1J9W A;  3K2F A;  4FPT A;  4PQ7 A;  3ML2 A;  4CNX A;  4ZAO A;  4HEZ A;  5EKJ A;  3DAZ A;  3V3G B;  1H9N A;  3DCS A;  2NNV A;  4BF1 A;  4RUY A;  5DSI A;  3RZ0 B;  3M1W A;  1CRM A;  3CA2 A;  2NN1 A;  1I9O A;  3RZ8 A;  1FR4 A;  3HS4 A;  1V9E A;  4DZ9 A;  5JG5 B;  1UGD A;  5JEG B;  3QYK A;  4XFW A;  3M2X A;  3ZNC A;  1CAM A;  2VVA X;  2FNK A;  3N3J A;  4RUZ A;  5FNM A;  3MHI A;  1TTM A;  1TBT X;  1UGC A;  1CNW A;  4Q0L A;  1BIC A;  2CA2 A;  1DMY A;  3BL0 A;  3JXF A;  3W6H A;  3M3X A;  4LHI A;  1CA3 A;  3DBU A;  3FFP X;  2FOY A;  1Z93 A;  4E3F A;  3KKX A;  2POU A;  4ILX A;  2FMG A;  4N0X B;  3M1K A;  3OIL A;  3MHO A;  3P3H A;  3P4V A;  1A42 A;  3S73 B;  1CIL A;  2Q1B A;  1ZSA A;  1CAY A;  5DSP A;  3LXE A;  5FNL A;  5FL6 A;  4LP6 A;  5EOI A;  3M40 A;  3RGE A;  4M2R A;  2H15 A;  3CYU A;  4YGJ A;  5E28 A;  4KNI A;  1FLJ A;  2HKK A;  3HKT A;  4M2U A;  3MHC A;  4RN4 A;  4R5A A;  1UGA A;  1HVA A;  1I9N A;  3S74 B;  1CAZ A;  3RYV B;  3B4F A;  3RLD A;  4KUW A;  3MNA A;  4PXX A;  1BNW A;  1CNC A;  4KUV A;  1YDD A;  1I90 A;  3IGP A;  5JQT A;  1BNV A;  1T9N A;  1BV3 A;  1HCB A;  5EKM A;  3ML5 A;  4QSB A;  3R16 A;  3KNE A;  5SZ5 A;  2WEJ A;  2WEO A;  3OKV A;  4GL1 X;  4XE1 A;  4Q7W A;  1BNU A;  3V3I B;  3IBN A;  3MZC A;  4E4A A;  3M2Z A;  4Q7V A;  3GZ0 A;  4RH2 A;  1AZM A;  5DSO A;  3P55 A;  4FU5 A;  4Q8Y A;  1XEG A;  1FSR A;  4L5V A;  3MNI A;  1H9Q A;  4KAP A;  3D93 A;  4WUP A;  4K0S A;  4N16 A;  3PJJ A;  3IBU A;  1G46 A;  3M5E A;  4X5S A;  1IF9 A;  4DZ7 A;  3HKU A;  3T82 A;  3V3F A;  2EZ7 A;  3MHL A;  3ZP9 A;  4CAC A;  4RFD A;  2GD8 A;  1CNI A;  2QO8 A;  3M5S A;  5JQ0 A;  2OSF A;  1ZSC A;  4E49 A;  5JEH B;  1ZH9 A;  4HBA A;  1IF5 A;  1BNN A;  1RZB A;  5EZT X;  1CCT A;  2FNN A;  3RG3 A;  4RIU A;  3TMJ A;  4XZ5 A;  5DRS A;  1Z9Y A;  3MYQ A;  4HT2 A;  3T83 A;  2AX2 A;  4L5U A;  1UGG A;  4KUY A;  5J8Z A;  1I8Z A;  3S78 B;  1BNQ A;  1BNT A;  8CA2 A;  3RG4 A;  5DSR A;  2F14 A;  5DSM A;  3D0N A;  1HEC A;  4JSA A;  4MO8 A;  3OYQ A;  4M2V A;  1G4O A;  1HEB A;  1DCA A;  4Q6E A;  5FNH A;  3PYK A;  1YO1 A;  4YWP A;  1F2W A;  4QJW A;  4ETQ C;  4YGN A;  3T85 A;  3OKU A;  4YVY A;  3SAP A;  1TH9 A;  3S71 B;  1THK A;  3TVN X;  1TG9 A;  5BYI A;  5EKH A;  2CBD A;  2GEH A;  1CVD A;  3DVD A;  1CVE A;  2NWY A;  2ABE A;  4MDG A;  4XIX A;  4YXO A;  2CBA A;  3N4B A;  3HFP A;  3IBI A;  1RZE A;  5E2N A;  5FDC A;  5JGT B;  5CLU A;  2CBB A;  4MDL A;  4ZX0 A;  2HFW A;  1CAH A;  4FRC A;  5CJF A;  1AM6 A;  1IF8 A;  3V3H B;  4QSA A;  4YGK A;  4FL7 A;  5SZ0 A;  2EU2 A;  5G01 A;  1RAY A;  4ZWI A;  3P58 A;  3FW3 A;  1G48 A;  1HUG A;  3OY0 A;  1CAJ A;  2WD2 A;  1CVB A;  3RYJ B;  2W2J A;  4JSS A;  4QJO A;  2CBC A;  5E2S A;  3U7C A;  3DA2 A;  3MDZ A;  5FLT A;  2NN7 A;  1RAZ A;  2FMZ A;  1URT A;  1UGE A;  4MLT A;  2FOU A;  4R5B A; 
#chains in the Genus database with same CATH topology
 4WL4 A;  1MOO A;  1CIN A;  2IT4 A;  3F4X A;  1G4J A;  1FSN A;  1HCA A;  1RZD A;  2O4Z A;  4ZWY A;  4CQ0 A;  4PZH A;  2WEG A;  4WW8 A;  1FQR A;  3RYX B;  2NNG A;  3V5G A;  5G0C A;  4QK3 A;  4HEY A;  1ZGE A;  2WD3 A;  1CVH A;  5IPZ A;  5AML A;  1YO2 A;  2NXR A;  4HT0 A;  4JSZ A;  2X7U A;  1MUA A;  1CAL A;  4CA2 A;  4Q81 A;  1CNY A;  4Q9Y A;  3D8W A;  5DVX A;  1ZFK A;  4QJX A;  3T5Z A;  4ZWZ A;  1CCU A;  4QK2 A;  5FLR A;  5SZ1 A;  5SZ7 A;  1ZE8 A;  1G52 A;  3M96 A;  3S97 A;  4YXU A;  1XEV A;  1CAN A;  1LGD A;  2Q1Q A;  4YGL A;  3U3A X;  1OKN A;  1ZGF A;  1IF6 A;  3SAX A;  2NXT A;  5EIJ A;  3UYQ A;  1YDB A;  5FDI A;  3M67 A;  3P44 A;  4MLX A;  4XIW A;  3V2M A;  1IF7 A;  5JES B;  3Q31 A;  3M14 A;  2QOA A;  1G45 A;  1CVF A;  4QTL A;  1I9M A;  5FL4 A;  3OYS A;  4E3H A;  1I9L A;  3FE4 A;  2NWO A;  3L14 A;  5JDV B;  4Q99 A;  5BRV A;  4FVO A;  4Q07 A;  3P5A A;  5SZ3 A;  2X7S A;  5E5U A;  3SBH A;  4HEW A;  4ITO A;  3T84 A;  3TVO X;  2FW4 A;  1CNJ A;  3KLD B;  4UOV A;  1G54 A;  1BCD A;  2HL4 A;  4Q08 A;  1G0F A;  3K34 A;  1CA2 A;  3W6I A;  1XPZ A;  1CVC A;  3T5U A;  1RZC A;  4QY3 A;  1CIM A;  1BN4 A;  2POV A;  4CNR A;  4LU3 A;  4PYX A;  5BNL A;  3NJ9 A;  3IAI A;  2NWP A;  4K0Z A;  1CNH A;  4L5W A;  3K7K A;  4WR7 A;  4COQ A;  3JXG A;  4E9O X;  5EH7 A;  4Z1K A;  5FL5 A;  3KS3 A;  4Z1N A;  3S8X A;  3KOI A;  1KEQ A;  1FSQ A;  1CZM A;  3D92 A;  3HLJ A;  1LG6 A;  2Q38 A;  1I91 A;  1CAO A;  3EFT A;  4E3G A;  3DD0 A;  1KOQ A;  1RZA A;  4BF6 A;  4CNV A;  5FLP A;  1G3Z A;  2AW1 A;  5E2R A;  4G7A A;  5L6K A;  2NNS A;  4HF3 A;  1CNK A;  1CCS A;  4FIK A;  3VBD A;  3M2Y A;  3M98 A;  3JXH C;  3EFI A;  1JCZ A;  4KNJ A;  4WW6 A;  5LMD A;  4CNW A;  1I9Q A;  3BET A;  2NWZ A;  2POW A;  4QIY A;  3PO6 A;  2X7T A;  1CAK A;  5FLS A;  4JS6 A;  1ZNC A;  1IF4 A;  4R59 A;  1RJ5 A;  4TWL A;  1V9I C;  4Q09 A;  1CRA A;  5JG3 B;  2ZNC A;  1YDC A;  2H4N A;  3HKQ A;  2ILI A;  4YX4 A;  3RZ7 A;  3D9Z A;  1HUH A;  4K13 A;  5FNK A;  3CAJ A;  2CAB A;  4Q90 A;  1OQ5 A;  1FQM A;  2VVB X;  4QIZ A;  5CAC A;  3DV7 A;  3OIK A;  3F7B A;  4KNN A;  4Q83 A;  3N0N A;  4KP8 A;  1TE3 X;  1TG3 A;  4KP5 A;  5FNG A;  4JSW A;  4YHA A;  4MTY A;  3OIM A;  5AMG A;  3U47 A;  3F8E A;  3SBI A;  1FQL A;  5EH8 A;  4Q6D A;  3M5T A;  3MNH A;  4MDM A;  3IEO A;  1TEU X;  5E2M A;  3N2P A;  4C3T A;  5CA2 A;  3HKN A;  1BNM A;  4K0T A;  3RJ7 A;  4RUX A;  4ITP A;  2WEH A;  3NI5 A;  3DD8 A;  1TB0 X;  3MNJ A;  5E5R A;  1I9P A;  5DOH A;  9CA2 A;  5JEP B;  2FNM A;  1ZSB A;  3MWO A;  4Q78 A;  1CNG A;  3MHM A;  5E2K A;  4Q06 A;  3V3J A;  3V2J A;  5SZ6 A;  5FLQ A;  2QP6 A;  6CA2 A;  4FVN A;  2FOQ A;  1UGB A;  4QSI A;  1CNB A;  1DMX A;  5HPJ A;  1OKL A;  4QJP A;  3DC3 A;  2OSM A;  5BRU A;  5C8I A;  3KIG A;  1XQ0 A;  5BRW A;  2CBE A;  3P3J A;  4QSJ A;  3C7P A;  3KON A;  3MNU A;  3RZ5 A;  5DSL A;  5DSJ A;  1KOP A;  4YXI A;  1YO0 A;  5DSK A;  1JV0 A;  1RJ6 A;  4WUQ A;  3KOK A;  3R17 B;  5FNJ A;  3M1J A;  3S76 A;  3MNK A;  3S77 B;  2NXS A;  1G6V A;  3UYN A;  1H4N A;  4QJ0 A;  5L3O A;  1HEA A;  1LG5 A;  3MMF A;  4E3D A;  4ZX1 A;  4HU1 A;  5SZ4 A;  3KWA A;  3U45 X;  3CZV A;  1CVA A;  2HOC A;  1BN3 A;  1UGF A;  4IWZ A;  4Y0J A;  1G0E A;  5DOG A;  4TWM A;  5EHE A;  1FQN A;  1HED A;  4Z1J A;  3DC9 A;  5G03 A;  1G53 A;  1CNX A;  4G0C A;  3RYY A;  5AMD A;  4E5Q A;  1G1D A;  5EH5 A;  3S75 B;  4KV0 A;  1LZV A;  1BZM A;  2FOS A;  7CA2 A;  1LUG A;  3B1B A;  4IDR X;  4Z1E A;  4Z0Q A;  4YGF A;  3V7X A;  3S72 B;  1KWR A;  5EHV A;  5A6H A;  4QEF A;  3M2N A;  1TEQ X;  3IBL A;  3DVB A;  1CAI A;  1FR7 A;  4PYY A;  3F7U A;  4ZWX A;  4Q8Z A;  3NB5 A;  4Q49 A;  4K1Q A;  4RIV A;  1Y7W A;  1BN1 A;  2NNO A;  1DCB A;  3BL1 A;  4QJM A;  3RZ1 B;  1OKM A;  5DSN A;  2EU3 A;  3P5L A;  4Q7P A;  1JD0 A;  4M2W A;  4QK1 A;  5G0B A;  1Z97 A;  4Q7S A;  2FOV A;  1YDA A;  3DCW A;  4Q8X A;  3M04 A;  3S9T A;  1ZFQ A;  12CA A;  3DCC A;  4RFC A;  1EOU A;  4KNM A;  5SZ2 A;  3RYZ A;  2NMX A;  5FNI A;  3M1Q A;  5JGS B;  5FLO A;  5A25 A;  5EHW A;  4BCW A;  2HNC A;  1KWQ A;  3DVC A;  5DSQ A;  2HD6 A;  1AVN A;  4YYT A;  4Q87 A;  1J9W A;  3K2F A;  4FPT A;  4PQ7 A;  3ML2 A;  4CNX A;  4ZAO A;  4HEZ A;  5EKJ A;  3DAZ A;  3V3G B;  1H9N A;  3DCS A;  2NNV A;  4BF1 A;  4RUY A;  5DSI A;  3RZ0 B;  3M1W A;  1CRM A;  3CA2 A;  2NN1 A;  1I9O A;  3RZ8 A;  1FR4 A;  3HS4 A;  1V9E A;  4DZ9 A;  5JG5 B;  1UGD A;  5JEG B;  3QYK A;  4XFW A;  3M2X A;  3ZNC A;  1CAM A;  2VVA X;  2FNK A;  3N3J A;  4RUZ A;  5FNM A;  3MHI A;  1TTM A;  1TBT X;  1UGC A;  1CNW A;  4Q0L A;  1BIC A;  2CA2 A;  1DMY A;  3BL0 A;  3JXF A;  3W6H A;  3M3X A;  4LHI A;  1CA3 A;  3DBU A;  3FFP X;  2FOY A;  1Z93 A;  4E3F A;  3KKX A;  2POU A;  4ILX A;  2FMG A;  4N0X B;  3M1K A;  3OIL A;  3MHO A;  3P3H A;  3P4V A;  1A42 A;  3S73 B;  1CIL A;  2Q1B A;  1ZSA A;  1CAY A;  5DSP A;  3LXE A;  5FNL A;  5FL6 A;  4LP6 A;  5EOI A;  3M40 A;  3RGE A;  4M2R A;  2H15 A;  3CYU A;  4YGJ A;  5E28 A;  4KNI A;  1FLJ A;  2HKK A;  3HKT A;  4M2U A;  3MHC A;  4RN4 A;  4R5A A;  1UGA A;  1HVA A;  1I9N A;  3S74 B;  1CAZ A;  3RYV B;  3B4F A;  3RLD A;  4KUW A;  3MNA A;  4PXX A;  1BNW A;  1CNC A;  4KUV A;  1YDD A;  1I90 A;  3IGP A;  5JQT A;  1BNV A;  1T9N A;  1BV3 A;  1HCB A;  5EKM A;  3ML5 A;  4QSB A;  3R16 A;  3KNE A;  5SZ5 A;  2WEJ A;  2WEO A;  3OKV A;  4GL1 X;  4XE1 A;  4Q7W A;  1BNU A;  3V3I B;  3IBN A;  3MZC A;  4E4A A;  3M2Z A;  4Q7V A;  3GZ0 A;  4RH2 A;  1AZM A;  5DSO A;  3P55 A;  4FU5 A;  4Q8Y A;  1XEG A;  1FSR A;  4L5V A;  3MNI A;  1H9Q A;  4KAP A;  3D93 A;  4WUP A;  4K0S A;  4N16 A;  3PJJ A;  3IBU A;  1G46 A;  3M5E A;  4X5S A;  1IF9 A;  4DZ7 A;  3HKU A;  3T82 A;  3V3F A;  2EZ7 A;  3MHL A;  3ZP9 A;  4CAC A;  4RFD A;  2GD8 A;  1CNI A;  2QO8 A;  3M5S A;  5JQ0 A;  2OSF A;  1ZSC A;  4E49 A;  5JEH B;  1ZH9 A;  4HBA A;  1IF5 A;  1BNN A;  1RZB A;  5EZT X;  1CCT A;  2FNN A;  3RG3 A;  4RIU A;  3TMJ A;  4XZ5 A;  5DRS A;  1Z9Y A;  3MYQ A;  4HT2 A;  3T83 A;  2AX2 A;  4L5U A;  1UGG A;  4KUY A;  5J8Z A;  1I8Z A;  3S78 B;  1BNQ A;  1BNT A;  8CA2 A;  3RG4 A;  5DSR A;  2F14 A;  5DSM A;  3D0N A;  1HEC A;  4JSA A;  4MO8 A;  3OYQ A;  4M2V A;  1G4O A;  1HEB A;  1DCA A;  4Q6E A;  5FNH A;  3PYK A;  1YO1 A;  4YWP A;  1F2W A;  4QJW A;  4ETQ C;  4YGN A;  3T85 A;  3OKU A;  4YVY A;  3SAP A;  1TH9 A;  3S71 B;  1THK A;  3TVN X;  1TG9 A;  5BYI A;  5EKH A;  2CBD A;  2GEH A;  1CVD A;  3DVD A;  1CVE A;  2NWY A;  2ABE A;  4MDG A;  4XIX A;  4YXO A;  2CBA A;  3N4B A;  3HFP A;  3IBI A;  1RZE A;  5E2N A;  5FDC A;  5JGT B;  5CLU A;  2CBB A;  4MDL A;  4ZX0 A;  2HFW A;  1CAH A;  4FRC A;  5CJF A;  1AM6 A;  1IF8 A;  3V3H B;  4QSA A;  4YGK A;  4FL7 A;  5SZ0 A;  2EU2 A;  5G01 A;  1RAY A;  4ZWI A;  3P58 A;  3FW3 A;  1G48 A;  1HUG A;  3OY0 A;  1CAJ A;  2WD2 A;  1CVB A;  3RYJ B;  2W2J A;  4JSS A;  4QJO A;  2CBC A;  5E2S A;  3U7C A;  3DA2 A;  3MDZ A;  5FLT A;  2NN7 A;  1RAZ A;  2FMZ A;  1URT A;  1UGE A;  4MLT A;  2FOU A;  4R5B A; 
#chains in the Genus database with same CATH homology
 4WL4 A;  1MOO A;  1CIN A;  2IT4 A;  3F4X A;  1G4J A;  1FSN A;  1HCA A;  1RZD A;  2O4Z A;  4ZWY A;  4CQ0 A;  4PZH A;  2WEG A;  4WW8 A;  1FQR A;  3RYX B;  2NNG A;  3V5G A;  5G0C A;  4QK3 A;  4HEY A;  1ZGE A;  2WD3 A;  1CVH A;  5IPZ A;  5AML A;  1YO2 A;  2NXR A;  4HT0 A;  4JSZ A;  2X7U A;  1MUA A;  1CAL A;  4CA2 A;  4Q81 A;  1CNY A;  4Q9Y A;  3D8W A;  5DVX A;  1ZFK A;  4QJX A;  3T5Z A;  4ZWZ A;  1CCU A;  4QK2 A;  5FLR A;  5SZ1 A;  5SZ7 A;  1ZE8 A;  1G52 A;  3M96 A;  3S97 A;  4YXU A;  1XEV A;  1CAN A;  1LGD A;  2Q1Q A;  4YGL A;  3U3A X;  1OKN A;  1ZGF A;  1IF6 A;  3SAX A;  2NXT A;  5EIJ A;  3UYQ A;  1YDB A;  5FDI A;  3M67 A;  3P44 A;  4MLX A;  4XIW A;  3V2M A;  1IF7 A;  5JES B;  3Q31 A;  3M14 A;  2QOA A;  1G45 A;  1CVF A;  4QTL A;  1I9M A;  5FL4 A;  3OYS A;  4E3H A;  1I9L A;  3FE4 A;  2NWO A;  3L14 A;  5JDV B;  4Q99 A;  5BRV A;  4FVO A;  4Q07 A;  3P5A A;  5SZ3 A;  2X7S A;  5E5U A;  3SBH A;  4HEW A;  4ITO A;  3T84 A;  3TVO X;  2FW4 A;  1CNJ A;  3KLD B;  4UOV A;  1G54 A;  1BCD A;  2HL4 A;  4Q08 A;  1G0F A;  3K34 A;  1CA2 A;  3W6I A;  1XPZ A;  1CVC A;  3T5U A;  1RZC A;  4QY3 A;  1CIM A;  1BN4 A;  2POV A;  4CNR A;  4LU3 A;  4PYX A;  5BNL A;  3NJ9 A;  3IAI A;  2NWP A;  4K0Z A;  1CNH A;  4L5W A;  3K7K A;  4WR7 A;  4COQ A;  3JXG A;  4E9O X;  5EH7 A;  4Z1K A;  5FL5 A;  3KS3 A;  4Z1N A;  3S8X A;  3KOI A;  1KEQ A;  1FSQ A;  1CZM A;  3D92 A;  3HLJ A;  1LG6 A;  2Q38 A;  1I91 A;  1CAO A;  3EFT A;  4E3G A;  3DD0 A;  1KOQ A;  1RZA A;  4BF6 A;  4CNV A;  5FLP A;  1G3Z A;  2AW1 A;  5E2R A;  4G7A A;  5L6K A;  2NNS A;  4HF3 A;  1CNK A;  1CCS A;  4FIK A;  3VBD A;  3M2Y A;  3M98 A;  3JXH C;  3EFI A;  1JCZ A;  4KNJ A;  4WW6 A;  5LMD A;  4CNW A;  1I9Q A;  3BET A;  2NWZ A;  2POW A;  4QIY A;  3PO6 A;  2X7T A;  1CAK A;  5FLS A;  4JS6 A;  1ZNC A;  1IF4 A;  4R59 A;  1RJ5 A;  4TWL A;  1V9I C;  4Q09 A;  1CRA A;  5JG3 B;  2ZNC A;  1YDC A;  2H4N A;  3HKQ A;  2ILI A;  4YX4 A;  3RZ7 A;  3D9Z A;  1HUH A;  4K13 A;  5FNK A;  3CAJ A;  2CAB A;  4Q90 A;  1OQ5 A;  1FQM A;  2VVB X;  4QIZ A;  5CAC A;  3DV7 A;  3OIK A;  3F7B A;  4KNN A;  4Q83 A;  3N0N A;  4KP8 A;  1TE3 X;  1TG3 A;  4KP5 A;  5FNG A;  4JSW A;  4YHA A;  4MTY A;  3OIM A;  5AMG A;  3U47 A;  3F8E A;  3SBI A;  1FQL A;  5EH8 A;  4Q6D A;  3M5T A;  3MNH A;  4MDM A;  3IEO A;  1TEU X;  5E2M A;  3N2P A;  4C3T A;  5CA2 A;  3HKN A;  1BNM A;  4K0T A;  3RJ7 A;  4RUX A;  4ITP A;  2WEH A;  3NI5 A;  3DD8 A;  1TB0 X;  3MNJ A;  5E5R A;  1I9P A;  5DOH A;  9CA2 A;  5JEP B;  2FNM A;  1ZSB A;  3MWO A;  4Q78 A;  1CNG A;  3MHM A;  5E2K A;  4Q06 A;  3V3J A;  3V2J A;  5SZ6 A;  5FLQ A;  2QP6 A;  6CA2 A;  4FVN A;  2FOQ A;  1UGB A;  4QSI A;  1CNB A;  1DMX A;  5HPJ A;  1OKL A;  4QJP A;  3DC3 A;  2OSM A;  5BRU A;  5C8I A;  3KIG A;  1XQ0 A;  5BRW A;  2CBE A;  3P3J A;  4QSJ A;  3C7P A;  3KON A;  3MNU A;  3RZ5 A;  5DSL A;  5DSJ A;  1KOP A;  4YXI A;  1YO0 A;  5DSK A;  1JV0 A;  1RJ6 A;  4WUQ A;  3KOK A;  3R17 B;  5FNJ A;  3M1J A;  3S76 A;  3MNK A;  3S77 B;  2NXS A;  1G6V A;  3UYN A;  1H4N A;  4QJ0 A;  5L3O A;  1HEA A;  1LG5 A;  3MMF A;  4E3D A;  4ZX1 A;  4HU1 A;  5SZ4 A;  3KWA A;  3U45 X;  3CZV A;  1CVA A;  2HOC A;  1BN3 A;  1UGF A;  4IWZ A;  4Y0J A;  1G0E A;  5DOG A;  4TWM A;  5EHE A;  1FQN A;  1HED A;  4Z1J A;  3DC9 A;  5G03 A;  1G53 A;  1CNX A;  4G0C A;  3RYY A;  5AMD A;  4E5Q A;  1G1D A;  5EH5 A;  3S75 B;  4KV0 A;  1LZV A;  1BZM A;  2FOS A;  7CA2 A;  1LUG A;  3B1B A;  4IDR X;  4Z1E A;  4Z0Q A;  4YGF A;  3V7X A;  3S72 B;  1KWR A;  5EHV A;  5A6H A;  4QEF A;  3M2N A;  1TEQ X;  3IBL A;  3DVB A;  1CAI A;  1FR7 A;  4PYY A;  3F7U A;  4ZWX A;  4Q8Z A;  3NB5 A;  4Q49 A;  4K1Q A;  4RIV A;  1Y7W A;  1BN1 A;  2NNO A;  1DCB A;  3BL1 A;  4QJM A;  3RZ1 B;  1OKM A;  5DSN A;  2EU3 A;  3P5L A;  4Q7P A;  1JD0 A;  4M2W A;  4QK1 A;  5G0B A;  1Z97 A;  4Q7S A;  2FOV A;  1YDA A;  3DCW A;  4Q8X A;  3M04 A;  3S9T A;  1ZFQ A;  12CA A;  3DCC A;  4RFC A;  1EOU A;  4KNM A;  5SZ2 A;  3RYZ A;  2NMX A;  5FNI A;  3M1Q A;  5JGS B;  5FLO A;  5A25 A;  5EHW A;  4BCW A;  2HNC A;  1KWQ A;  3DVC A;  5DSQ A;  2HD6 A;  1AVN A;  4YYT A;  4Q87 A;  1J9W A;  3K2F A;  4FPT A;  4PQ7 A;  3ML2 A;  4CNX A;  4ZAO A;  4HEZ A;  5EKJ A;  3DAZ A;  3V3G B;  1H9N A;  3DCS A;  2NNV A;  4BF1 A;  4RUY A;  5DSI A;  3RZ0 B;  3M1W A;  1CRM A;  3CA2 A;  2NN1 A;  1I9O A;  3RZ8 A;  1FR4 A;  3HS4 A;  1V9E A;  4DZ9 A;  5JG5 B;  1UGD A;  5JEG B;  3QYK A;  4XFW A;  3M2X A;  3ZNC A;  1CAM A;  2VVA X;  2FNK A;  3N3J A;  4RUZ A;  5FNM A;  3MHI A;  1TTM A;  1TBT X;  1UGC A;  1CNW A;  4Q0L A;  1BIC A;  2CA2 A;  1DMY A;  3BL0 A;  3JXF A;  3W6H A;  3M3X A;  4LHI A;  1CA3 A;  3DBU A;  3FFP X;  2FOY A;  1Z93 A;  4E3F A;  3KKX A;  2POU A;  4ILX A;  2FMG A;  4N0X B;  3M1K A;  3OIL A;  3MHO A;  3P3H A;  3P4V A;  1A42 A;  3S73 B;  1CIL A;  2Q1B A;  1ZSA A;  1CAY A;  5DSP A;  3LXE A;  5FNL A;  5FL6 A;  4LP6 A;  5EOI A;  3M40 A;  3RGE A;  4M2R A;  2H15 A;  3CYU A;  4YGJ A;  5E28 A;  4KNI A;  1FLJ A;  2HKK A;  3HKT A;  4M2U A;  3MHC A;  4RN4 A;  4R5A A;  1UGA A;  1HVA A;  1I9N A;  3S74 B;  1CAZ A;  3RYV B;  3B4F A;  3RLD A;  4KUW A;  3MNA A;  4PXX A;  1BNW A;  1CNC A;  4KUV A;  1YDD A;  1I90 A;  3IGP A;  5JQT A;  1BNV A;  1T9N A;  1BV3 A;  1HCB A;  5EKM A;  3ML5 A;  4QSB A;  3R16 A;  3KNE A;  5SZ5 A;  2WEJ A;  2WEO A;  3OKV A;  4GL1 X;  4XE1 A;  4Q7W A;  1BNU A;  3V3I B;  3IBN A;  3MZC A;  4E4A A;  3M2Z A;  4Q7V A;  3GZ0 A;  4RH2 A;  1AZM A;  5DSO A;  3P55 A;  4FU5 A;  4Q8Y A;  1XEG A;  1FSR A;  4L5V A;  3MNI A;  1H9Q A;  4KAP A;  3D93 A;  4WUP A;  4K0S A;  4N16 A;  3PJJ A;  3IBU A;  1G46 A;  3M5E A;  4X5S A;  1IF9 A;  4DZ7 A;  3HKU A;  3T82 A;  3V3F A;  2EZ7 A;  3MHL A;  3ZP9 A;  4CAC A;  4RFD A;  2GD8 A;  1CNI A;  2QO8 A;  3M5S A;  5JQ0 A;  2OSF A;  1ZSC A;  4E49 A;  5JEH B;  1ZH9 A;  4HBA A;  1IF5 A;  1BNN A;  1RZB A;  5EZT X;  1CCT A;  2FNN A;  3RG3 A;  4RIU A;  3TMJ A;  4XZ5 A;  5DRS A;  1Z9Y A;  3MYQ A;  4HT2 A;  3T83 A;  2AX2 A;  4L5U A;  1UGG A;  4KUY A;  5J8Z A;  1I8Z A;  3S78 B;  1BNQ A;  1BNT A;  8CA2 A;  3RG4 A;  5DSR A;  2F14 A;  5DSM A;  3D0N A;  1HEC A;  4JSA A;  4MO8 A;  3OYQ A;  4M2V A;  1G4O A;  1HEB A;  1DCA A;  4Q6E A;  5FNH A;  3PYK A;  1YO1 A;  4YWP A;  1F2W A;  4QJW A;  4ETQ C;  4YGN A;  3T85 A;  3OKU A;  4YVY A;  3SAP A;  1TH9 A;  3S71 B;  1THK A;  3TVN X;  1TG9 A;  5BYI A;  5EKH A;  2CBD A;  2GEH A;  1CVD A;  3DVD A;  1CVE A;  2NWY A;  2ABE A;  4MDG A;  4XIX A;  4YXO A;  2CBA A;  3N4B A;  3HFP A;  3IBI A;  1RZE A;  5E2N A;  5FDC A;  5JGT B;  5CLU A;  2CBB A;  4MDL A;  4ZX0 A;  2HFW A;  1CAH A;  4FRC A;  5CJF A;  1AM6 A;  1IF8 A;  3V3H B;  4QSA A;  4YGK A;  4FL7 A;  5SZ0 A;  2EU2 A;  5G01 A;  1RAY A;  4ZWI A;  3P58 A;  3FW3 A;  1G48 A;  1HUG A;  3OY0 A;  1CAJ A;  2WD2 A;  1CVB A;  3RYJ B;  2W2J A;  4JSS A;  4QJO A;  2CBC A;  5E2S A;  3U7C A;  3DA2 A;  3MDZ A;  5FLT A;  2NN7 A;  1RAZ A;  2FMZ A;  1URT A;  1UGE A;  4MLT A;  2FOU A;  4R5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...