3D0NA

Crystal structure of human carbonic anhydrase xiii
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
Knots found
sequence length
263
structure length
263
Chain Sequence
SMSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Carbonic anhydrase 13
publication title Crystal structure of human carbonic anhydrase XIII and its complex with the inhibitor acetazolamide.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 263
sequence length 263
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2008-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 3d0nA00
3RYVB 3M3XA 3TVOX 3D0NA 2FOSA 1I9NA 1RZEA 1CCUA 1CNWA 2CBAA 4MLTA 3P58A 2HOCA 2CBBA 1I8ZA 1I9MA 4HBAA 5DSQA 3D8WA 1V9IC 2NWPA 3DVDA 1YO0A 1KOPA 5FLPA 4JSAA 4L5VA 4Y0JA 5DSNA 3RYYA 1MUAA 1BV3A 4HT2A 1FQRA 3D93A 3MZCA 1FR4A 4FRCA 4ZX1A 1CCTA 3HKTA 4E3FA 1JCZA 3D92A 3N0NA 3M2XA 1YDCA 6CA2A 1AZMA 3V3JA 2ABEA 5G01A 2ILIA 4RUXA 1ZH9A 4YGFA 3RLDA 5EHEA 4QJ0A 1G46A 3S9TA 4XZ5A 1HUGA 1CAOA 3RYZA 1CIMA 4KUVA 5JESB 3JXGA 3RJ7A 2NXSA 3S71B 1ZE8A 3TMJA 4ZWZA 2POVA 4Q7PA 4HEZA 4R5AA 3S74B 1OKNA 3S97A 3OYSA 3P3JA 4LHIA 4Q8ZA 4WR7A 5BYIA 1G52A 3IBIA 3RZ1B 3M1WA 4Q07A 3MWOA 1CRAA 1CNGA 3S73B 3CYUA 4CNWA 1KWQA 1HCAA 1G0FA 3SAXA 1G4OA 4QY3A 3RG4A 2QO8A 3DAZA 3PO6A 4HU1A 9CA2A 5DRSA 3V7XA 2X7UA 5EH8A 4JSSA 1Z97A 1FQMA 5FL4A 3KLDB 3M2ZA 3M5EA 4Q8XA 3R16A 5SZ1A 1IF8A 2FNKA 4XIWA 4KP5A 1DCBA 2GD8A 3DBUA 4Z0QA 1CNIA 1IF5A 3LXEA 3M04A 3K7KA 1TEQX 1CRMA 2X7TA 1BNNA 4E3GA 3HS4A 4PQ7A 1BZMA 4Q7WA 1I90A 4YXUA 2POWA 5SZ6A 1BN4A 1UGDA 1JD0A 5SZ0A 1THKA 3IBNA 1CA2A 1DCAA 4GL1X 4QJWA 5SZ2A 2EU3A 5SZ5A 2ZNCA 4M2RA 4Q7VA 4MDLA 3MNAA 4X5SA 4WW8A 2FNNA 4N16A 3T5UA 5DSIA 3B1BA 5JEGB 5AMLA 3OIMA 12CAA 5FLQA 4YXOA 4YYTA 4KNIA 5DOHA 5E2NA 1HECA 1H9QA 3TVNX 5E2SA 3DCWA 3T83A 2H15A 4RUYA 4TWLA 5G0BA 2OSFA 1CVCA 4E49A 3OKUA 4CQ0A 3MNIA 1CANA 5FLOA 3S78B 4XIXA 4Q08A 3IEOA 4FU5A 1ZFQA 3DVBA 1FQNA 4KUWA 3KOIA 3W6HA 4BF6A 3UYQA 2NXRA 3MHMA 3OKVA 3P3HA 1LGDA 2Q1QA 3MHOA 3N2PA 2EZ7A 4FPTA 4QJPA 3NI5A 5CACA 1RZDA 1UGEA 1CNJA 1LG6A 3MNKA 4KNJA 2NWYA 3DVCA 1CNYA 3EFTA 4FIKA 1OQ5A 4IWZA 4Q87A 5BNLA 1AM6A 2NMXA 3RYXB 4M2VA 4RIVA 4QEFA 2NN7A 3MNJA 4WL4A 2HKKA 5EHWA 5JG5B 1TG9A 4E5QA 1BNTA 1G45A 5E5RA 4TWMA 4DZ7A 2NNGA 3KWAA 4ITOA 4XE1A 5C8IA 3OY0A 5FNJA 4K0SA 4KV0A 3F7UA 4Q6DA 1A42A 3KIGA 1CAKA 1Z9YA 4L5UA 3F7BA 1BNMA 5FL5A 3MHCA 2WEJA 3M96A 3S76A 4MDMA 2X7SA 1DMYA 4ZWXA 3HKNA 3IGPA 3S77B 3U7CA 5JGSB 4QK3A 1HUHA 5FNGA 1V9EA 2WD2A 1RJ5A 3MYQA 4ZWYA 1T9NA 1TE3X 2CA2A 3K2FA 4YGLA 3HLJA 2CBDA 5DSKA 4JSZA 1BCDA 1TH9A 2GEHA 3IBLA 4WW6A 1G48A 5HPJA 1HEDA 4QSIA 3DD8A 1RZBA 4YVYA 1BNQA 1Z93A 4G0CA 5JGTB 4CACA 4M2WA 3JXFA 1UGFA 1CAHA 4Q8YA 1CALA 4ZWIA 4KNMA 3P55A 3SAPA 4Z1KA 4QTLA 3RZ5A 5EIJA 4ETQC 1CVHA 4K0TA 1YO2A 3M1JA 1XEVA 4QJOA 2W2JA 4FL7A 1FLJA 5E2MA 4MO8A 3MHIA 1ZNCA 3NB5A 1FR7A 4Q09A 1OKMA 2NWOA 4IDRX 5EKHA 3KS3A 1BICA 4QIZA 2O4ZA 5DVXA 3M2YA 5DSLA 4CA2A 1TB0X 3GZ0A 1G4JA 1CAYA 3OILA 4QSJA 4YHAA 1CAZA 4ZAOA 2WEGA 3JXHC 1YDDA 4N0XB 5CJFA 3S8XA 3DD0A 3U45X 3IBUA 1HCBA 8CA2A 1LZVA 5EH5A 5EHVA 1FQLA 1BNUA 3M67A 5DSRA 5FNLA 2FNMA 3DA2A 4Q83A 2QOAA 1KWRA 3U47A 4KAPA 3T82A 5FLTA 3M5SA 1IF4A 3M14A 5E28A 5SZ4A 5L3OA 1F2WA 5L6KA 3EFIA 5FNHA 5JQ0A 1YDAA 3FW3A 1Y7WA 3KONA 3P5LA 5EH7A 1XEGA 5J8ZA 1G3ZA 4RUZA 3B4FA 1CNXA 1G54A 2FOVA 1KOQA 4PZHA 3M5TA 4Q9YA 4RFCA 3BL1A 4RIUA 3M98A 4FVNA 1URTA 3V3FA 2NWZA 5JDVB 1I9OA 5A25A 2NNSA 3MDZA 4MDGA 1CAMA 2AW1A 3HFPA 4PXXA 5JG3B 5EKJA 5JQTA 1UGBA 1CILA 5CLUA 1CNKA 1CNBA 4RFDA 3F8EA 2CABA 1CNHA 1XPZA 3KKXA 5AMGA 3C7PA 4UOVA 1EOUA 4Q49A 5DSMA 5LMDA 4K1QA 1UGAA 5CA2A 4YXIA 3P5AA 5E5UA 5EOIA 3N4BA 3MMFA 1CVDA 2HL4A 4QJXA 4R5BA 4QIYA 3RZ0B 4Q6EA 3V5GA 3IAIA 3V3IB 4RN4A 4KNNA 4Q0LA 1RJ6A 1OKLA 4YGNA 1G6VA 1IF6A 1ZSAA 5A6HA 2QP6A 5FNKA 1CAJA 5BRUA 3ZNCA 4L5WA 3M40A 3U3AX 3OIKA 5G0CA 2Q38A 1CNCA 1UGCA 3P44A 5EKMA 3SBHA 3NJ9A 5FDIA 3ML5A 3PYKA 1JV0A 2HFWA 5E2KA 1LG5A 2FOUA 1BN3A 5BRWA 5G03A 3ML2A 4E9OX 1LUGA 1ZSBA 3CAJA 3S75B 1BN1A 2OSMA 1ZGFA 4QSBA 2F14A 3DCCA 3RYJB 4Q78A 2WD3A 4KP8A 7CA2A 1RZAA 4G7AA 4E3HA 2NNVA 2VVAX 4YX4A 5EZTX 5DSPA 3S72B 3V3HB 5AMDA 1YO1A 2FOYA 3DC3A 1TTMA 5FDCA 4PYXA 1G1DA 3V3GB 3W6IA 1RAZA 3Q31A 3M2NA 4RH2A 3M1QA 4K0ZA 5FLSA 1CVEA 2NN1A 1BNVA 4KUYA 1TEUX 4CNXA 1YDBA 1HVAA 4Z1EA 1UGGA 1FSRA 4Q99A 3CZVA 1CAIA 1H9NA 3T84A 3MNHA 4QJMA 5SZ7A 1RAYA 5DSJA 4HT0A 3BL0A 2POUA 1CVFA 5FLRA 3FFPX 3KOKA 1HEAA 3L14A 5IPZA 4PYYA 4Q06A 4R59A 1BNWA 1ZGEA 4YGKA 2WEHA 3UYNA 3D9ZA 3F4XA 1CINA 2FMGA 4M2UA 1AVNA 1XQ0A 2IT4A 1CCSA 1I9PA 3DV7A 3RGEA 3R17B 1CZMA 2EU2A 4FVOA 4DZ9A 5E2RA 4YGJA 4E3DA 4Q90A 3MNUA 3RZ7A 4WUQA 3SBIA 3T5ZA 3VBDA 3QYKA 3N3JA 4HEYA 4WUPA 2FMZA 3RZ8A 4CNRA 2WEOA 2AX2A 2CBEA 1H4NA 1FSQA 2FOQA 4Q81A 4XFWA 3OYQA 3V2JA 3M1KA 4COQA 1IF7A 4YWPA 4E4AA 4HEWA 1ZFKA 2Q1BA 4MLXA 2HD6A 4Z1NA 4ITPA 1I9LA 4QK1A 1TG3A 3DC9A 1KEQA 3RG3A 3T85A 4Z1JA 1G0EA 4BF1A 3BETA 5SZ3A 4QK2A 5FL6A 4ILXA 4Q7SA 2VVBX 4JSWA 4K13A 4C3TA 1RZCA 1IF9A 1TBTX 3K34A 4HF3A 3HKQA 3KNEA 4ZX0A 1DMXA 1MOOA 5JEPB 1ZSCA 1FSNA 4LU3A 5FNIA 1I91A 4JS6A 2H4NA 4QSAA 5BRVA 3FE4A 1CVAA 1CVBA 5DOGA 3ZP9A 3PJJA 1HEBA 3MHLA 3P4VA 1I9QA 2NNOA 1G53A 3V2MA 3HKUA 3CA2A 1J9WA 4LP6A 5JEHB 2HNCA 4CNVA 1CA3A 2NXTA 5DSOA 5FNMA 2CBCA 4MTYA 3DCSA 4BCWA 2FW4A
chains in the Genus database with same CATH superfamily
3RYVB 3M3XA 3TVOX 3D0NA 2FOSA 1I9NA 1RZEA 1CCUA 1CNWA 2CBAA 4MLTA 3P58A 2HOCA 2CBBA 1I8ZA 1I9MA 4HBAA 5DSQA 3D8WA 1V9IC 2NWPA 3DVDA 1YO0A 1KOPA 5FLPA 4JSAA 4L5VA 4Y0JA 5DSNA 3RYYA 1MUAA 1BV3A 4HT2A 1FQRA 3D93A 3MZCA 1FR4A 4FRCA 4ZX1A 1CCTA 3HKTA 4E3FA 1JCZA 3D92A 3N0NA 3M2XA 1YDCA 6CA2A 1AZMA 3V3JA 2ABEA 5G01A 2ILIA 4RUXA 1ZH9A 4YGFA 3RLDA 5EHEA 4QJ0A 1G46A 3S9TA 4XZ5A 1HUGA 1CAOA 3RYZA 1CIMA 4KUVA 5JESB 3JXGA 3RJ7A 2NXSA 3S71B 1ZE8A 3TMJA 4ZWZA 2POVA 4Q7PA 4HEZA 4R5AA 3S74B 1OKNA 3S97A 3OYSA 3P3JA 4LHIA 4Q8ZA 4WR7A 5BYIA 1G52A 3IBIA 3RZ1B 3M1WA 4Q07A 3MWOA 1CRAA 1CNGA 3S73B 3CYUA 4CNWA 1KWQA 1HCAA 1G0FA 3SAXA 1G4OA 4QY3A 3RG4A 2QO8A 3DAZA 3PO6A 4HU1A 9CA2A 5DRSA 3V7XA 2X7UA 5EH8A 4JSSA 1Z97A 1FQMA 5FL4A 3KLDB 3M2ZA 3M5EA 4Q8XA 3R16A 5SZ1A 1IF8A 2FNKA 4XIWA 4KP5A 1DCBA 2GD8A 3DBUA 4Z0QA 1CNIA 1IF5A 3LXEA 3M04A 3K7KA 1TEQX 1CRMA 2X7TA 1BNNA 4E3GA 3HS4A 4PQ7A 1BZMA 4Q7WA 1I90A 4YXUA 2POWA 5SZ6A 1BN4A 1UGDA 1JD0A 5SZ0A 1THKA 3IBNA 1CA2A 1DCAA 4GL1X 4QJWA 5SZ2A 2EU3A 5SZ5A 2ZNCA 4M2RA 4Q7VA 4MDLA 3MNAA 4X5SA 4WW8A 2FNNA 4N16A 3T5UA 5DSIA 3B1BA 5JEGB 5AMLA 3OIMA 12CAA 5FLQA 4YXOA 4YYTA 4KNIA 5DOHA 5E2NA 1HECA 1H9QA 3TVNX 5E2SA 3DCWA 3T83A 2H15A 4RUYA 4TWLA 5G0BA 2OSFA 1CVCA 4E49A 3OKUA 4CQ0A 3MNIA 1CANA 5FLOA 3S78B 4XIXA 4Q08A 3IEOA 4FU5A 1ZFQA 3DVBA 1FQNA 4KUWA 3KOIA 3W6HA 4BF6A 3UYQA 2NXRA 3MHMA 3OKVA 3P3HA 1LGDA 2Q1QA 3MHOA 3N2PA 2EZ7A 4FPTA 4QJPA 3NI5A 5CACA 1RZDA 1UGEA 1CNJA 1LG6A 3MNKA 4KNJA 2NWYA 3DVCA 1CNYA 3EFTA 4FIKA 1OQ5A 4IWZA 4Q87A 5BNLA 1AM6A 2NMXA 3RYXB 4M2VA 4RIVA 4QEFA 2NN7A 3MNJA 4WL4A 2HKKA 5EHWA 5JG5B 1TG9A 4E5QA 1BNTA 1G45A 5E5RA 4TWMA 4DZ7A 2NNGA 3KWAA 4ITOA 4XE1A 5C8IA 3OY0A 5FNJA 4K0SA 4KV0A 3F7UA 4Q6DA 1A42A 3KIGA 1CAKA 1Z9YA 4L5UA 3F7BA 1BNMA 5FL5A 3MHCA 2WEJA 3M96A 3S76A 4MDMA 2X7SA 1DMYA 4ZWXA 3HKNA 3IGPA 3S77B 3U7CA 5JGSB 4QK3A 1HUHA 5FNGA 1V9EA 2WD2A 1RJ5A 3MYQA 4ZWYA 1T9NA 1TE3X 2CA2A 3K2FA 4YGLA 3HLJA 2CBDA 5DSKA 4JSZA 1BCDA 1TH9A 2GEHA 3IBLA 4WW6A 1G48A 5HPJA 1HEDA 4QSIA 3DD8A 1RZBA 4YVYA 1BNQA 1Z93A 4G0CA 5JGTB 4CACA 4M2WA 3JXFA 1UGFA 1CAHA 4Q8YA 1CALA 4ZWIA 4KNMA 3P55A 3SAPA 4Z1KA 4QTLA 3RZ5A 5EIJA 4ETQC 1CVHA 4K0TA 1YO2A 3M1JA 1XEVA 4QJOA 2W2JA 4FL7A 1FLJA 5E2MA 4MO8A 3MHIA 1ZNCA 3NB5A 1FR7A 4Q09A 1OKMA 2NWOA 4IDRX 5EKHA 3KS3A 1BICA 4QIZA 2O4ZA 5DVXA 3M2YA 5DSLA 4CA2A 1TB0X 3GZ0A 1G4JA 1CAYA 3OILA 4QSJA 4YHAA 1CAZA 4ZAOA 2WEGA 3JXHC 1YDDA 4N0XB 5CJFA 3S8XA 3DD0A 3U45X 3IBUA 1HCBA 8CA2A 1LZVA 5EH5A 5EHVA 1FQLA 1BNUA 3M67A 5DSRA 5FNLA 2FNMA 3DA2A 4Q83A 2QOAA 1KWRA 3U47A 4KAPA 3T82A 5FLTA 3M5SA 1IF4A 3M14A 5E28A 5SZ4A 5L3OA 1F2WA 5L6KA 3EFIA 5FNHA 5JQ0A 1YDAA 3FW3A 1Y7WA 3KONA 3P5LA 5EH7A 1XEGA 5J8ZA 1G3ZA 4RUZA 3B4FA 1CNXA 1G54A 2FOVA 1KOQA 4PZHA 3M5TA 4Q9YA 4RFCA 3BL1A 4RIUA 3M98A 4FVNA 1URTA 3V3FA 2NWZA 5JDVB 1I9OA 5A25A 2NNSA 3MDZA 4MDGA 1CAMA 2AW1A 3HFPA 4PXXA 5JG3B 5EKJA 5JQTA 1UGBA 1CILA 5CLUA 1CNKA 1CNBA 4RFDA 3F8EA 2CABA 1CNHA 1XPZA 3KKXA 5AMGA 3C7PA 4UOVA 1EOUA 4Q49A 5DSMA 5LMDA 4K1QA 1UGAA 5CA2A 4YXIA 3P5AA 5E5UA 5EOIA 3N4BA 3MMFA 1CVDA 2HL4A 4QJXA 4R5BA 4QIYA 3RZ0B 4Q6EA 3V5GA 3IAIA 3V3IB 4RN4A 4KNNA 4Q0LA 1RJ6A 1OKLA 4YGNA 1G6VA 1IF6A 1ZSAA 5A6HA 2QP6A 5FNKA 1CAJA 5BRUA 3ZNCA 4L5WA 3M40A 3U3AX 3OIKA 5G0CA 2Q38A 1CNCA 1UGCA 3P44A 5EKMA 3SBHA 3NJ9A 5FDIA 3ML5A 3PYKA 1JV0A 2HFWA 5E2KA 1LG5A 2FOUA 1BN3A 5BRWA 5G03A 3ML2A 4E9OX 1LUGA 1ZSBA 3CAJA 3S75B 1BN1A 2OSMA 1ZGFA 4QSBA 2F14A 3DCCA 3RYJB 4Q78A 2WD3A 4KP8A 7CA2A 1RZAA 4G7AA 4E3HA 2NNVA 2VVAX 4YX4A 5EZTX 5DSPA 3S72B 3V3HB 5AMDA 1YO1A 2FOYA 3DC3A 1TTMA 5FDCA 4PYXA 1G1DA 3V3GB 3W6IA 1RAZA 3Q31A 3M2NA 4RH2A 3M1QA 4K0ZA 5FLSA 1CVEA 2NN1A 1BNVA 4KUYA 1TEUX 4CNXA 1YDBA 1HVAA 4Z1EA 1UGGA 1FSRA 4Q99A 3CZVA 1CAIA 1H9NA 3T84A 3MNHA 4QJMA 5SZ7A 1RAYA 5DSJA 4HT0A 3BL0A 2POUA 1CVFA 5FLRA 3FFPX 3KOKA 1HEAA 3L14A 5IPZA 4PYYA 4Q06A 4R59A 1BNWA 1ZGEA 4YGKA 2WEHA 3UYNA 3D9ZA 3F4XA 1CINA 2FMGA 4M2UA 1AVNA 1XQ0A 2IT4A 1CCSA 1I9PA 3DV7A 3RGEA 3R17B 1CZMA 2EU2A 4FVOA 4DZ9A 5E2RA 4YGJA 4E3DA 4Q90A 3MNUA 3RZ7A 4WUQA 3SBIA 3T5ZA 3VBDA 3QYKA 3N3JA 4HEYA 4WUPA 2FMZA 3RZ8A 4CNRA 2WEOA 2AX2A 2CBEA 1H4NA 1FSQA 2FOQA 4Q81A 4XFWA 3OYQA 3V2JA 3M1KA 4COQA 1IF7A 4YWPA 4E4AA 4HEWA 1ZFKA 2Q1BA 4MLXA 2HD6A 4Z1NA 4ITPA 1I9LA 4QK1A 1TG3A 3DC9A 1KEQA 3RG3A 3T85A 4Z1JA 1G0EA 4BF1A 3BETA 5SZ3A 4QK2A 5FL6A 4ILXA 4Q7SA 2VVBX 4JSWA 4K13A 4C3TA 1RZCA 1IF9A 1TBTX 3K34A 4HF3A 3HKQA 3KNEA 4ZX0A 1DMXA 1MOOA 5JEPB 1ZSCA 1FSNA 4LU3A 5FNIA 1I91A 4JS6A 2H4NA 4QSAA 5BRVA 3FE4A 1CVAA 1CVBA 5DOGA 3ZP9A 3PJJA 1HEBA 3MHLA 3P4VA 1I9QA 2NNOA 1G53A 3V2MA 3HKUA 3CA2A 1J9WA 4LP6A 5JEHB 2HNCA 4CNVA 1CA3A 2NXTA 5DSOA 5FNMA 2CBCA 4MTYA 3DCSA 4BCWA 2FW4A
chains in the Genus database with same CATH topology
3RYVB 3M3XA 3TVOX 3D0NA 2FOSA 1I9NA 1RZEA 1CCUA 1CNWA 2CBAA 4MLTA 3P58A 2HOCA 2CBBA 1I8ZA 1I9MA 4HBAA 5DSQA 3D8WA 1V9IC 2NWPA 3DVDA 1YO0A 1KOPA 5FLPA 4JSAA 4L5VA 4Y0JA 5DSNA 3RYYA 1MUAA 1BV3A 4HT2A 1FQRA 3D93A 3MZCA 1FR4A 4FRCA 4ZX1A 1CCTA 3HKTA 4E3FA 1JCZA 3D92A 3N0NA 3M2XA 1YDCA 6CA2A 1AZMA 3V3JA 2ABEA 5G01A 2ILIA 4RUXA 1ZH9A 4YGFA 3RLDA 5EHEA 4QJ0A 1G46A 3S9TA 4XZ5A 1HUGA 1CAOA 3RYZA 1CIMA 4KUVA 5JESB 3JXGA 3RJ7A 2NXSA 3S71B 1ZE8A 3TMJA 4ZWZA 2POVA 4Q7PA 4HEZA 4R5AA 3S74B 1OKNA 3S97A 3OYSA 3P3JA 4LHIA 4Q8ZA 4WR7A 5BYIA 1G52A 3IBIA 3RZ1B 3M1WA 4Q07A 3MWOA 1CRAA 1CNGA 3S73B 3CYUA 4CNWA 1KWQA 1HCAA 1G0FA 3SAXA 1G4OA 4QY3A 3RG4A 2QO8A 3DAZA 3PO6A 4HU1A 9CA2A 5DRSA 3V7XA 2X7UA 5EH8A 4JSSA 1Z97A 1FQMA 5FL4A 3KLDB 3M2ZA 3M5EA 4Q8XA 3R16A 5SZ1A 1IF8A 2FNKA 4XIWA 4KP5A 1DCBA 2GD8A 3DBUA 4Z0QA 1CNIA 1IF5A 3LXEA 3M04A 3K7KA 1TEQX 1CRMA 2X7TA 1BNNA 4E3GA 3HS4A 4PQ7A 1BZMA 4Q7WA 1I90A 4YXUA 2POWA 5SZ6A 1BN4A 1UGDA 1JD0A 5SZ0A 1THKA 3IBNA 1CA2A 1DCAA 4GL1X 4QJWA 5SZ2A 2EU3A 5SZ5A 2ZNCA 4M2RA 4Q7VA 4MDLA 3MNAA 4X5SA 4WW8A 2FNNA 4N16A 3T5UA 5DSIA 3B1BA 5JEGB 5AMLA 3OIMA 12CAA 5FLQA 4YXOA 4YYTA 4KNIA 5DOHA 5E2NA 1HECA 1H9QA 3TVNX 5E2SA 3DCWA 3T83A 2H15A 4RUYA 4TWLA 5G0BA 2OSFA 1CVCA 4E49A 3OKUA 4CQ0A 3MNIA 1CANA 5FLOA 3S78B 4XIXA 4Q08A 3IEOA 4FU5A 1ZFQA 3DVBA 1FQNA 4KUWA 3KOIA 3W6HA 4BF6A 3UYQA 2NXRA 3MHMA 3OKVA 3P3HA 1LGDA 2Q1QA 3MHOA 3N2PA 2EZ7A 4FPTA 4QJPA 3NI5A 5CACA 1RZDA 1UGEA 1CNJA 1LG6A 3MNKA 4KNJA 2NWYA 3DVCA 1CNYA 3EFTA 4FIKA 1OQ5A 4IWZA 4Q87A 5BNLA 1AM6A 2NMXA 3RYXB 4M2VA 4RIVA 4QEFA 2NN7A 3MNJA 4WL4A 2HKKA 5EHWA 5JG5B 1TG9A 4E5QA 1BNTA 1G45A 5E5RA 4TWMA 4DZ7A 2NNGA 3KWAA 4ITOA 4XE1A 5C8IA 3OY0A 5FNJA 4K0SA 4KV0A 3F7UA 4Q6DA 1A42A 3KIGA 1CAKA 1Z9YA 4L5UA 3F7BA 1BNMA 5FL5A 3MHCA 2WEJA 3M96A 3S76A 4MDMA 2X7SA 1DMYA 4ZWXA 3HKNA 3IGPA 3S77B 3U7CA 5JGSB 4QK3A 1HUHA 5FNGA 1V9EA 2WD2A 1RJ5A 3MYQA 4ZWYA 1T9NA 1TE3X 2CA2A 3K2FA 4YGLA 3HLJA 2CBDA 5DSKA 4JSZA 1BCDA 1TH9A 2GEHA 3IBLA 4WW6A 1G48A 5HPJA 1HEDA 4QSIA 3DD8A 1RZBA 4YVYA 1BNQA 1Z93A 4G0CA 5JGTB 4CACA 4M2WA 3JXFA 1UGFA 1CAHA 4Q8YA 1CALA 4ZWIA 4KNMA 3P55A 3SAPA 4Z1KA 4QTLA 3RZ5A 5EIJA 4ETQC 1CVHA 4K0TA 1YO2A 3M1JA 1XEVA 4QJOA 2W2JA 4FL7A 1FLJA 5E2MA 4MO8A 3MHIA 1ZNCA 3NB5A 1FR7A 4Q09A 1OKMA 2NWOA 4IDRX 5EKHA 3KS3A 1BICA 4QIZA 2O4ZA 5DVXA 3M2YA 5DSLA 4CA2A 1TB0X 3GZ0A 1G4JA 1CAYA 3OILA 4QSJA 4YHAA 1CAZA 4ZAOA 2WEGA 3JXHC 1YDDA 4N0XB 5CJFA 3S8XA 3DD0A 3U45X 3IBUA 1HCBA 8CA2A 1LZVA 5EH5A 5EHVA 1FQLA 1BNUA 3M67A 5DSRA 5FNLA 2FNMA 3DA2A 4Q83A 2QOAA 1KWRA 3U47A 4KAPA 3T82A 5FLTA 3M5SA 1IF4A 3M14A 5E28A 5SZ4A 5L3OA 1F2WA 5L6KA 3EFIA 5FNHA 5JQ0A 1YDAA 3FW3A 1Y7WA 3KONA 3P5LA 5EH7A 1XEGA 5J8ZA 1G3ZA 4RUZA 3B4FA 1CNXA 1G54A 2FOVA 1KOQA 4PZHA 3M5TA 4Q9YA 4RFCA 3BL1A 4RIUA 3M98A 4FVNA 1URTA 3V3FA 2NWZA 5JDVB 1I9OA 5A25A 2NNSA 3MDZA 4MDGA 1CAMA 2AW1A 3HFPA 4PXXA 5JG3B 5EKJA 5JQTA 1UGBA 1CILA 5CLUA 1CNKA 1CNBA 4RFDA 3F8EA 2CABA 1CNHA 1XPZA 3KKXA 5AMGA 3C7PA 4UOVA 1EOUA 4Q49A 5DSMA 5LMDA 4K1QA 1UGAA 5CA2A 4YXIA 3P5AA 5E5UA 5EOIA 3N4BA 3MMFA 1CVDA 2HL4A 4QJXA 4R5BA 4QIYA 3RZ0B 4Q6EA 3V5GA 3IAIA 3V3IB 4RN4A 4KNNA 4Q0LA 1RJ6A 1OKLA 4YGNA 1G6VA 1IF6A 1ZSAA 5A6HA 2QP6A 5FNKA 1CAJA 5BRUA 3ZNCA 4L5WA 3M40A 3U3AX 3OIKA 5G0CA 2Q38A 1CNCA 1UGCA 3P44A 5EKMA 3SBHA 3NJ9A 5FDIA 3ML5A 3PYKA 1JV0A 2HFWA 5E2KA 1LG5A 2FOUA 1BN3A 5BRWA 5G03A 3ML2A 4E9OX 1LUGA 1ZSBA 3CAJA 3S75B 1BN1A 2OSMA 1ZGFA 4QSBA 2F14A 3DCCA 3RYJB 4Q78A 2WD3A 4KP8A 7CA2A 1RZAA 4G7AA 4E3HA 2NNVA 2VVAX 4YX4A 5EZTX 5DSPA 3S72B 3V3HB 5AMDA 1YO1A 2FOYA 3DC3A 1TTMA 5FDCA 4PYXA 1G1DA 3V3GB 3W6IA 1RAZA 3Q31A 3M2NA 4RH2A 3M1QA 4K0ZA 5FLSA 1CVEA 2NN1A 1BNVA 4KUYA 1TEUX 4CNXA 1YDBA 1HVAA 4Z1EA 1UGGA 1FSRA 4Q99A 3CZVA 1CAIA 1H9NA 3T84A 3MNHA 4QJMA 5SZ7A 1RAYA 5DSJA 4HT0A 3BL0A 2POUA 1CVFA 5FLRA 3FFPX 3KOKA 1HEAA 3L14A 5IPZA 4PYYA 4Q06A 4R59A 1BNWA 1ZGEA 4YGKA 2WEHA 3UYNA 3D9ZA 3F4XA 1CINA 2FMGA 4M2UA 1AVNA 1XQ0A 2IT4A 1CCSA 1I9PA 3DV7A 3RGEA 3R17B 1CZMA 2EU2A 4FVOA 4DZ9A 5E2RA 4YGJA 4E3DA 4Q90A 3MNUA 3RZ7A 4WUQA 3SBIA 3T5ZA 3VBDA 3QYKA 3N3JA 4HEYA 4WUPA 2FMZA 3RZ8A 4CNRA 2WEOA 2AX2A 2CBEA 1H4NA 1FSQA 2FOQA 4Q81A 4XFWA 3OYQA 3V2JA 3M1KA 4COQA 1IF7A 4YWPA 4E4AA 4HEWA 1ZFKA 2Q1BA 4MLXA 2HD6A 4Z1NA 4ITPA 1I9LA 4QK1A 1TG3A 3DC9A 1KEQA 3RG3A 3T85A 4Z1JA 1G0EA 4BF1A 3BETA 5SZ3A 4QK2A 5FL6A 4ILXA 4Q7SA 2VVBX 4JSWA 4K13A 4C3TA 1RZCA 1IF9A 1TBTX 3K34A 4HF3A 3HKQA 3KNEA 4ZX0A 1DMXA 1MOOA 5JEPB 1ZSCA 1FSNA 4LU3A 5FNIA 1I91A 4JS6A 2H4NA 4QSAA 5BRVA 3FE4A 1CVAA 1CVBA 5DOGA 3ZP9A 3PJJA 1HEBA 3MHLA 3P4VA 1I9QA 2NNOA 1G53A 3V2MA 3HKUA 3CA2A 1J9WA 4LP6A 5JEHB 2HNCA 4CNVA 1CA3A 2NXTA 5DSOA 5FNMA 2CBCA 4MTYA 3DCSA 4BCWA 2FW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RYV B;  3M3X A;  3TVO X;  3D0N A;  2FOS A;  1I9N A;  1RZE A;  1CCU A;  1CNW A;  2CBA A;  4MLT A;  3P58 A;  2HOC A;  2CBB A;  1I8Z A;  1I9M A;  4HBA A;  5DSQ A;  3D8W A;  1V9I C;  2NWP A;  3DVD A;  1YO0 A;  1KOP A;  5FLP A;  4JSA A;  4L5V A;  4Y0J A;  5DSN A;  3RYY A;  1MUA A;  1BV3 A;  4HT2 A;  1FQR A;  3D93 A;  3MZC A;  1FR4 A;  4FRC A;  4ZX1 A;  1CCT A;  3HKT A;  4E3F A;  1JCZ A;  3D92 A;  3N0N A;  3M2X A;  1YDC A;  6CA2 A;  1AZM A;  3V3J A;  2ABE A;  5G01 A;  2ILI A;  4RUX A;  1ZH9 A;  4YGF A;  3RLD A;  5EHE A;  4QJ0 A;  1G46 A;  3S9T A;  4XZ5 A;  1HUG A;  1CAO A;  3RYZ A;  1CIM A;  4KUV A;  5JES B;  3JXG A;  3RJ7 A;  2NXS A;  3S71 B;  1ZE8 A;  3TMJ A;  4ZWZ A;  2POV A;  4Q7P A;  4HEZ A;  4R5A A;  3S74 B;  1OKN A;  3S97 A;  3OYS A;  3P3J A;  4LHI A;  4Q8Z A;  4WR7 A;  5BYI A;  1G52 A;  3IBI A;  3RZ1 B;  3M1W A;  4Q07 A;  3MWO A;  1CRA A;  1CNG A;  3S73 B;  3CYU A;  4CNW A;  1KWQ A;  1HCA A;  1G0F A;  3SAX A;  1G4O A;  4QY3 A;  3RG4 A;  2QO8 A;  3DAZ A;  3PO6 A;  4HU1 A;  9CA2 A;  5DRS A;  3V7X A;  2X7U A;  5EH8 A;  4JSS A;  1Z97 A;  1FQM A;  5FL4 A;  3KLD B;  3M2Z A;  3M5E A;  4Q8X A;  3R16 A;  5SZ1 A;  1IF8 A;  2FNK A;  4XIW A;  4KP5 A;  1DCB A;  2GD8 A;  3DBU A;  4Z0Q A;  1CNI A;  1IF5 A;  3LXE A;  3M04 A;  3K7K A;  1TEQ X;  1CRM A;  2X7T A;  1BNN A;  4E3G A;  3HS4 A;  4PQ7 A;  1BZM A;  4Q7W A;  1I90 A;  4YXU A;  2POW A;  5SZ6 A;  1BN4 A;  1UGD A;  1JD0 A;  5SZ0 A;  1THK A;  3IBN A;  1CA2 A;  1DCA A;  4GL1 X;  4QJW A;  5SZ2 A;  2EU3 A;  5SZ5 A;  2ZNC A;  4M2R A;  4Q7V A;  4MDL A;  3MNA A;  4X5S A;  4WW8 A;  2FNN A;  4N16 A;  3T5U A;  5DSI A;  3B1B A;  5JEG B;  5AML A;  3OIM A;  12CA A;  5FLQ A;  4YXO A;  4YYT A;  4KNI A;  5DOH A;  5E2N A;  1HEC A;  1H9Q A;  3TVN X;  5E2S A;  3DCW A;  3T83 A;  2H15 A;  4RUY A;  4TWL A;  5G0B A;  2OSF A;  1CVC A;  4E49 A;  3OKU A;  4CQ0 A;  3MNI A;  1CAN A;  5FLO A;  3S78 B;  4XIX A;  4Q08 A;  3IEO A;  4FU5 A;  1ZFQ A;  3DVB A;  1FQN A;  4KUW A;  3KOI A;  3W6H A;  4BF6 A;  3UYQ A;  2NXR A;  3MHM A;  3OKV A;  3P3H A;  1LGD A;  2Q1Q A;  3MHO A;  3N2P A;  2EZ7 A;  4FPT A;  4QJP A;  3NI5 A;  5CAC A;  1RZD A;  1UGE A;  1CNJ A;  1LG6 A;  3MNK A;  4KNJ A;  2NWY A;  3DVC A;  1CNY A;  3EFT A;  4FIK A;  1OQ5 A;  4IWZ A;  4Q87 A;  5BNL A;  1AM6 A;  2NMX A;  3RYX B;  4M2V A;  4RIV A;  4QEF A;  2NN7 A;  3MNJ A;  4WL4 A;  2HKK A;  5EHW A;  5JG5 B;  1TG9 A;  4E5Q A;  1BNT A;  1G45 A;  5E5R A;  4TWM A;  4DZ7 A;  2NNG A;  3KWA A;  4ITO A;  4XE1 A;  5C8I A;  3OY0 A;  5FNJ A;  4K0S A;  4KV0 A;  3F7U A;  4Q6D A;  1A42 A;  3KIG A;  1CAK A;  1Z9Y A;  4L5U A;  3F7B A;  1BNM A;  5FL5 A;  3MHC A;  2WEJ A;  3M96 A;  3S76 A;  4MDM A;  2X7S A;  1DMY A;  4ZWX A;  3HKN A;  3IGP A;  3S77 B;  3U7C A;  5JGS B;  4QK3 A;  1HUH A;  5FNG A;  1V9E A;  2WD2 A;  1RJ5 A;  3MYQ A;  4ZWY A;  1T9N A;  1TE3 X;  2CA2 A;  3K2F A;  4YGL A;  3HLJ A;  2CBD A;  5DSK A;  4JSZ A;  1BCD A;  1TH9 A;  2GEH A;  3IBL A;  4WW6 A;  1G48 A;  5HPJ A;  1HED A;  4QSI A;  3DD8 A;  1RZB A;  4YVY A;  1BNQ A;  1Z93 A;  4G0C A;  5JGT B;  4CAC A;  4M2W A;  3JXF A;  1UGF A;  1CAH A;  4Q8Y A;  1CAL A;  4ZWI A;  4KNM A;  3P55 A;  3SAP A;  4Z1K A;  4QTL A;  3RZ5 A;  5EIJ A;  4ETQ C;  1CVH A;  4K0T A;  1YO2 A;  3M1J A;  1XEV A;  4QJO A;  2W2J A;  4FL7 A;  1FLJ A;  5E2M A;  4MO8 A;  3MHI A;  1ZNC A;  3NB5 A;  1FR7 A;  4Q09 A;  1OKM A;  2NWO A;  4IDR X;  5EKH A;  3KS3 A;  1BIC A;  4QIZ A;  2O4Z A;  5DVX A;  3M2Y A;  5DSL A;  4CA2 A;  1TB0 X;  3GZ0 A;  1G4J A;  1CAY A;  3OIL A;  4QSJ A;  4YHA A;  1CAZ A;  4ZAO A;  2WEG A;  3JXH C;  1YDD A;  4N0X B;  5CJF A;  3S8X A;  3DD0 A;  3U45 X;  3IBU A;  1HCB A;  8CA2 A;  1LZV A;  5EH5 A;  5EHV A;  1FQL A;  1BNU A;  3M67 A;  5DSR A;  5FNL A;  2FNM A;  3DA2 A;  4Q83 A;  2QOA A;  1KWR A;  3U47 A;  4KAP A;  3T82 A;  5FLT A;  3M5S A;  1IF4 A;  3M14 A;  5E28 A;  5SZ4 A;  5L3O A;  1F2W A;  5L6K A;  3EFI A;  5FNH A;  5JQ0 A;  1YDA A;  3FW3 A;  1Y7W A;  3KON A;  3P5L A;  5EH7 A;  1XEG A;  5J8Z A;  1G3Z A;  4RUZ A;  3B4F A;  1CNX A;  1G54 A;  2FOV A;  1KOQ A;  4PZH A;  3M5T A;  4Q9Y A;  4RFC A;  3BL1 A;  4RIU A;  3M98 A;  4FVN A;  1URT A;  3V3F A;  2NWZ A;  5JDV B;  1I9O A;  5A25 A;  2NNS A;  3MDZ A;  4MDG A;  1CAM A;  2AW1 A;  3HFP A;  4PXX A;  5JG3 B;  5EKJ A;  5JQT A;  1UGB A;  1CIL A;  5CLU A;  1CNK A;  1CNB A;  4RFD A;  3F8E A;  2CAB A;  1CNH A;  1XPZ A;  3KKX A;  5AMG A;  3C7P A;  4UOV A;  1EOU A;  4Q49 A;  5DSM A;  5LMD A;  4K1Q A;  1UGA A;  5CA2 A;  4YXI A;  3P5A A;  5E5U A;  5EOI A;  3N4B A;  3MMF A;  1CVD A;  2HL4 A;  4QJX A;  4R5B A;  4QIY A;  3RZ0 B;  4Q6E A;  3V5G A;  3IAI A;  3V3I B;  4RN4 A;  4KNN A;  4Q0L A;  1RJ6 A;  1OKL A;  4YGN A;  1G6V A;  1IF6 A;  1ZSA A;  5A6H A;  2QP6 A;  5FNK A;  1CAJ A;  5BRU A;  3ZNC A;  4L5W A;  3M40 A;  3U3A X;  3OIK A;  5G0C A;  2Q38 A;  1CNC A;  1UGC A;  3P44 A;  5EKM A;  3SBH A;  3NJ9 A;  5FDI A;  3ML5 A;  3PYK A;  1JV0 A;  2HFW A;  5E2K A;  1LG5 A;  2FOU A;  1BN3 A;  5BRW A;  5G03 A;  3ML2 A;  4E9O X;  1LUG A;  1ZSB A;  3CAJ A;  3S75 B;  1BN1 A;  2OSM A;  1ZGF A;  4QSB A;  2F14 A;  3DCC A;  3RYJ B;  4Q78 A;  2WD3 A;  4KP8 A;  7CA2 A;  1RZA A;  4G7A A;  4E3H A;  2NNV A;  2VVA X;  4YX4 A;  5EZT X;  5DSP A;  3S72 B;  3V3H B;  5AMD A;  1YO1 A;  2FOY A;  3DC3 A;  1TTM A;  5FDC A;  4PYX A;  1G1D A;  3V3G B;  3W6I A;  1RAZ A;  3Q31 A;  3M2N A;  4RH2 A;  3M1Q A;  4K0Z A;  5FLS A;  1CVE A;  2NN1 A;  1BNV A;  4KUY A;  1TEU X;  4CNX A;  1YDB A;  1HVA A;  4Z1E A;  1UGG A;  1FSR A;  4Q99 A;  3CZV A;  1CAI A;  1H9N A;  3T84 A;  3MNH A;  4QJM A;  5SZ7 A;  1RAY A;  5DSJ A;  4HT0 A;  3BL0 A;  2POU A;  1CVF A;  5FLR A;  3FFP X;  3KOK A;  1HEA A;  3L14 A;  5IPZ A;  4PYY A;  4Q06 A;  4R59 A;  1BNW A;  1ZGE A;  4YGK A;  2WEH A;  3UYN A;  3D9Z A;  3F4X A;  1CIN A;  2FMG A;  4M2U A;  1AVN A;  1XQ0 A;  2IT4 A;  1CCS A;  1I9P A;  3DV7 A;  3RGE A;  3R17 B;  1CZM A;  2EU2 A;  4FVO A;  4DZ9 A;  5E2R A;  4YGJ A;  4E3D A;  4Q90 A;  3MNU A;  3RZ7 A;  4WUQ A;  3SBI A;  3T5Z A;  3VBD A;  3QYK A;  3N3J A;  4HEY A;  4WUP A;  2FMZ A;  3RZ8 A;  4CNR A;  2WEO A;  2AX2 A;  2CBE A;  1H4N A;  1FSQ A;  2FOQ A;  4Q81 A;  4XFW A;  3OYQ A;  3V2J A;  3M1K A;  4COQ A;  1IF7 A;  4YWP A;  4E4A A;  4HEW A;  1ZFK A;  2Q1B A;  4MLX A;  2HD6 A;  4Z1N A;  4ITP A;  1I9L A;  4QK1 A;  1TG3 A;  3DC9 A;  1KEQ A;  3RG3 A;  3T85 A;  4Z1J A;  1G0E A;  4BF1 A;  3BET A;  5SZ3 A;  4QK2 A;  5FL6 A;  4ILX A;  4Q7S A;  2VVB X;  4JSW A;  4K13 A;  4C3T A;  1RZC A;  1IF9 A;  1TBT X;  3K34 A;  4HF3 A;  3HKQ A;  3KNE A;  4ZX0 A;  1DMX A;  1MOO A;  5JEP B;  1ZSC A;  1FSN A;  4LU3 A;  5FNI A;  1I91 A;  4JS6 A;  2H4N A;  4QSA A;  5BRV A;  3FE4 A;  1CVA A;  1CVB A;  5DOG A;  3ZP9 A;  3PJJ A;  1HEB A;  3MHL A;  3P4V A;  1I9Q A;  2NNO A;  1G53 A;  3V2M A;  3HKU A;  3CA2 A;  1J9W A;  4LP6 A;  5JEH B;  2HNC A;  4CNV A;  1CA3 A;  2NXT A;  5DSO A;  5FNM A;  2CBC A;  4MTY A;  3DCS A;  4BCW A;  2FW4 A; 
#chains in the Genus database with same CATH topology
 3RYV B;  3M3X A;  3TVO X;  3D0N A;  2FOS A;  1I9N A;  1RZE A;  1CCU A;  1CNW A;  2CBA A;  4MLT A;  3P58 A;  2HOC A;  2CBB A;  1I8Z A;  1I9M A;  4HBA A;  5DSQ A;  3D8W A;  1V9I C;  2NWP A;  3DVD A;  1YO0 A;  1KOP A;  5FLP A;  4JSA A;  4L5V A;  4Y0J A;  5DSN A;  3RYY A;  1MUA A;  1BV3 A;  4HT2 A;  1FQR A;  3D93 A;  3MZC A;  1FR4 A;  4FRC A;  4ZX1 A;  1CCT A;  3HKT A;  4E3F A;  1JCZ A;  3D92 A;  3N0N A;  3M2X A;  1YDC A;  6CA2 A;  1AZM A;  3V3J A;  2ABE A;  5G01 A;  2ILI A;  4RUX A;  1ZH9 A;  4YGF A;  3RLD A;  5EHE A;  4QJ0 A;  1G46 A;  3S9T A;  4XZ5 A;  1HUG A;  1CAO A;  3RYZ A;  1CIM A;  4KUV A;  5JES B;  3JXG A;  3RJ7 A;  2NXS A;  3S71 B;  1ZE8 A;  3TMJ A;  4ZWZ A;  2POV A;  4Q7P A;  4HEZ A;  4R5A A;  3S74 B;  1OKN A;  3S97 A;  3OYS A;  3P3J A;  4LHI A;  4Q8Z A;  4WR7 A;  5BYI A;  1G52 A;  3IBI A;  3RZ1 B;  3M1W A;  4Q07 A;  3MWO A;  1CRA A;  1CNG A;  3S73 B;  3CYU A;  4CNW A;  1KWQ A;  1HCA A;  1G0F A;  3SAX A;  1G4O A;  4QY3 A;  3RG4 A;  2QO8 A;  3DAZ A;  3PO6 A;  4HU1 A;  9CA2 A;  5DRS A;  3V7X A;  2X7U A;  5EH8 A;  4JSS A;  1Z97 A;  1FQM A;  5FL4 A;  3KLD B;  3M2Z A;  3M5E A;  4Q8X A;  3R16 A;  5SZ1 A;  1IF8 A;  2FNK A;  4XIW A;  4KP5 A;  1DCB A;  2GD8 A;  3DBU A;  4Z0Q A;  1CNI A;  1IF5 A;  3LXE A;  3M04 A;  3K7K A;  1TEQ X;  1CRM A;  2X7T A;  1BNN A;  4E3G A;  3HS4 A;  4PQ7 A;  1BZM A;  4Q7W A;  1I90 A;  4YXU A;  2POW A;  5SZ6 A;  1BN4 A;  1UGD A;  1JD0 A;  5SZ0 A;  1THK A;  3IBN A;  1CA2 A;  1DCA A;  4GL1 X;  4QJW A;  5SZ2 A;  2EU3 A;  5SZ5 A;  2ZNC A;  4M2R A;  4Q7V A;  4MDL A;  3MNA A;  4X5S A;  4WW8 A;  2FNN A;  4N16 A;  3T5U A;  5DSI A;  3B1B A;  5JEG B;  5AML A;  3OIM A;  12CA A;  5FLQ A;  4YXO A;  4YYT A;  4KNI A;  5DOH A;  5E2N A;  1HEC A;  1H9Q A;  3TVN X;  5E2S A;  3DCW A;  3T83 A;  2H15 A;  4RUY A;  4TWL A;  5G0B A;  2OSF A;  1CVC A;  4E49 A;  3OKU A;  4CQ0 A;  3MNI A;  1CAN A;  5FLO A;  3S78 B;  4XIX A;  4Q08 A;  3IEO A;  4FU5 A;  1ZFQ A;  3DVB A;  1FQN A;  4KUW A;  3KOI A;  3W6H A;  4BF6 A;  3UYQ A;  2NXR A;  3MHM A;  3OKV A;  3P3H A;  1LGD A;  2Q1Q A;  3MHO A;  3N2P A;  2EZ7 A;  4FPT A;  4QJP A;  3NI5 A;  5CAC A;  1RZD A;  1UGE A;  1CNJ A;  1LG6 A;  3MNK A;  4KNJ A;  2NWY A;  3DVC A;  1CNY A;  3EFT A;  4FIK A;  1OQ5 A;  4IWZ A;  4Q87 A;  5BNL A;  1AM6 A;  2NMX A;  3RYX B;  4M2V A;  4RIV A;  4QEF A;  2NN7 A;  3MNJ A;  4WL4 A;  2HKK A;  5EHW A;  5JG5 B;  1TG9 A;  4E5Q A;  1BNT A;  1G45 A;  5E5R A;  4TWM A;  4DZ7 A;  2NNG A;  3KWA A;  4ITO A;  4XE1 A;  5C8I A;  3OY0 A;  5FNJ A;  4K0S A;  4KV0 A;  3F7U A;  4Q6D A;  1A42 A;  3KIG A;  1CAK A;  1Z9Y A;  4L5U A;  3F7B A;  1BNM A;  5FL5 A;  3MHC A;  2WEJ A;  3M96 A;  3S76 A;  4MDM A;  2X7S A;  1DMY A;  4ZWX A;  3HKN A;  3IGP A;  3S77 B;  3U7C A;  5JGS B;  4QK3 A;  1HUH A;  5FNG A;  1V9E A;  2WD2 A;  1RJ5 A;  3MYQ A;  4ZWY A;  1T9N A;  1TE3 X;  2CA2 A;  3K2F A;  4YGL A;  3HLJ A;  2CBD A;  5DSK A;  4JSZ A;  1BCD A;  1TH9 A;  2GEH A;  3IBL A;  4WW6 A;  1G48 A;  5HPJ A;  1HED A;  4QSI A;  3DD8 A;  1RZB A;  4YVY A;  1BNQ A;  1Z93 A;  4G0C A;  5JGT B;  4CAC A;  4M2W A;  3JXF A;  1UGF A;  1CAH A;  4Q8Y A;  1CAL A;  4ZWI A;  4KNM A;  3P55 A;  3SAP A;  4Z1K A;  4QTL A;  3RZ5 A;  5EIJ A;  4ETQ C;  1CVH A;  4K0T A;  1YO2 A;  3M1J A;  1XEV A;  4QJO A;  2W2J A;  4FL7 A;  1FLJ A;  5E2M A;  4MO8 A;  3MHI A;  1ZNC A;  3NB5 A;  1FR7 A;  4Q09 A;  1OKM A;  2NWO A;  4IDR X;  5EKH A;  3KS3 A;  1BIC A;  4QIZ A;  2O4Z A;  5DVX A;  3M2Y A;  5DSL A;  4CA2 A;  1TB0 X;  3GZ0 A;  1G4J A;  1CAY A;  3OIL A;  4QSJ A;  4YHA A;  1CAZ A;  4ZAO A;  2WEG A;  3JXH C;  1YDD A;  4N0X B;  5CJF A;  3S8X A;  3DD0 A;  3U45 X;  3IBU A;  1HCB A;  8CA2 A;  1LZV A;  5EH5 A;  5EHV A;  1FQL A;  1BNU A;  3M67 A;  5DSR A;  5FNL A;  2FNM A;  3DA2 A;  4Q83 A;  2QOA A;  1KWR A;  3U47 A;  4KAP A;  3T82 A;  5FLT A;  3M5S A;  1IF4 A;  3M14 A;  5E28 A;  5SZ4 A;  5L3O A;  1F2W A;  5L6K A;  3EFI A;  5FNH A;  5JQ0 A;  1YDA A;  3FW3 A;  1Y7W A;  3KON A;  3P5L A;  5EH7 A;  1XEG A;  5J8Z A;  1G3Z A;  4RUZ A;  3B4F A;  1CNX A;  1G54 A;  2FOV A;  1KOQ A;  4PZH A;  3M5T A;  4Q9Y A;  4RFC A;  3BL1 A;  4RIU A;  3M98 A;  4FVN A;  1URT A;  3V3F A;  2NWZ A;  5JDV B;  1I9O A;  5A25 A;  2NNS A;  3MDZ A;  4MDG A;  1CAM A;  2AW1 A;  3HFP A;  4PXX A;  5JG3 B;  5EKJ A;  5JQT A;  1UGB A;  1CIL A;  5CLU A;  1CNK A;  1CNB A;  4RFD A;  3F8E A;  2CAB A;  1CNH A;  1XPZ A;  3KKX A;  5AMG A;  3C7P A;  4UOV A;  1EOU A;  4Q49 A;  5DSM A;  5LMD A;  4K1Q A;  1UGA A;  5CA2 A;  4YXI A;  3P5A A;  5E5U A;  5EOI A;  3N4B A;  3MMF A;  1CVD A;  2HL4 A;  4QJX A;  4R5B A;  4QIY A;  3RZ0 B;  4Q6E A;  3V5G A;  3IAI A;  3V3I B;  4RN4 A;  4KNN A;  4Q0L A;  1RJ6 A;  1OKL A;  4YGN A;  1G6V A;  1IF6 A;  1ZSA A;  5A6H A;  2QP6 A;  5FNK A;  1CAJ A;  5BRU A;  3ZNC A;  4L5W A;  3M40 A;  3U3A X;  3OIK A;  5G0C A;  2Q38 A;  1CNC A;  1UGC A;  3P44 A;  5EKM A;  3SBH A;  3NJ9 A;  5FDI A;  3ML5 A;  3PYK A;  1JV0 A;  2HFW A;  5E2K A;  1LG5 A;  2FOU A;  1BN3 A;  5BRW A;  5G03 A;  3ML2 A;  4E9O X;  1LUG A;  1ZSB A;  3CAJ A;  3S75 B;  1BN1 A;  2OSM A;  1ZGF A;  4QSB A;  2F14 A;  3DCC A;  3RYJ B;  4Q78 A;  2WD3 A;  4KP8 A;  7CA2 A;  1RZA A;  4G7A A;  4E3H A;  2NNV A;  2VVA X;  4YX4 A;  5EZT X;  5DSP A;  3S72 B;  3V3H B;  5AMD A;  1YO1 A;  2FOY A;  3DC3 A;  1TTM A;  5FDC A;  4PYX A;  1G1D A;  3V3G B;  3W6I A;  1RAZ A;  3Q31 A;  3M2N A;  4RH2 A;  3M1Q A;  4K0Z A;  5FLS A;  1CVE A;  2NN1 A;  1BNV A;  4KUY A;  1TEU X;  4CNX A;  1YDB A;  1HVA A;  4Z1E A;  1UGG A;  1FSR A;  4Q99 A;  3CZV A;  1CAI A;  1H9N A;  3T84 A;  3MNH A;  4QJM A;  5SZ7 A;  1RAY A;  5DSJ A;  4HT0 A;  3BL0 A;  2POU A;  1CVF A;  5FLR A;  3FFP X;  3KOK A;  1HEA A;  3L14 A;  5IPZ A;  4PYY A;  4Q06 A;  4R59 A;  1BNW A;  1ZGE A;  4YGK A;  2WEH A;  3UYN A;  3D9Z A;  3F4X A;  1CIN A;  2FMG A;  4M2U A;  1AVN A;  1XQ0 A;  2IT4 A;  1CCS A;  1I9P A;  3DV7 A;  3RGE A;  3R17 B;  1CZM A;  2EU2 A;  4FVO A;  4DZ9 A;  5E2R A;  4YGJ A;  4E3D A;  4Q90 A;  3MNU A;  3RZ7 A;  4WUQ A;  3SBI A;  3T5Z A;  3VBD A;  3QYK A;  3N3J A;  4HEY A;  4WUP A;  2FMZ A;  3RZ8 A;  4CNR A;  2WEO A;  2AX2 A;  2CBE A;  1H4N A;  1FSQ A;  2FOQ A;  4Q81 A;  4XFW A;  3OYQ A;  3V2J A;  3M1K A;  4COQ A;  1IF7 A;  4YWP A;  4E4A A;  4HEW A;  1ZFK A;  2Q1B A;  4MLX A;  2HD6 A;  4Z1N A;  4ITP A;  1I9L A;  4QK1 A;  1TG3 A;  3DC9 A;  1KEQ A;  3RG3 A;  3T85 A;  4Z1J A;  1G0E A;  4BF1 A;  3BET A;  5SZ3 A;  4QK2 A;  5FL6 A;  4ILX A;  4Q7S A;  2VVB X;  4JSW A;  4K13 A;  4C3T A;  1RZC A;  1IF9 A;  1TBT X;  3K34 A;  4HF3 A;  3HKQ A;  3KNE A;  4ZX0 A;  1DMX A;  1MOO A;  5JEP B;  1ZSC A;  1FSN A;  4LU3 A;  5FNI A;  1I91 A;  4JS6 A;  2H4N A;  4QSA A;  5BRV A;  3FE4 A;  1CVA A;  1CVB A;  5DOG A;  3ZP9 A;  3PJJ A;  1HEB A;  3MHL A;  3P4V A;  1I9Q A;  2NNO A;  1G53 A;  3V2M A;  3HKU A;  3CA2 A;  1J9W A;  4LP6 A;  5JEH B;  2HNC A;  4CNV A;  1CA3 A;  2NXT A;  5DSO A;  5FNM A;  2CBC A;  4MTY A;  3DCS A;  4BCW A;  2FW4 A; 
#chains in the Genus database with same CATH homology
 3RYV B;  3M3X A;  3TVO X;  3D0N A;  2FOS A;  1I9N A;  1RZE A;  1CCU A;  1CNW A;  2CBA A;  4MLT A;  3P58 A;  2HOC A;  2CBB A;  1I8Z A;  1I9M A;  4HBA A;  5DSQ A;  3D8W A;  1V9I C;  2NWP A;  3DVD A;  1YO0 A;  1KOP A;  5FLP A;  4JSA A;  4L5V A;  4Y0J A;  5DSN A;  3RYY A;  1MUA A;  1BV3 A;  4HT2 A;  1FQR A;  3D93 A;  3MZC A;  1FR4 A;  4FRC A;  4ZX1 A;  1CCT A;  3HKT A;  4E3F A;  1JCZ A;  3D92 A;  3N0N A;  3M2X A;  1YDC A;  6CA2 A;  1AZM A;  3V3J A;  2ABE A;  5G01 A;  2ILI A;  4RUX A;  1ZH9 A;  4YGF A;  3RLD A;  5EHE A;  4QJ0 A;  1G46 A;  3S9T A;  4XZ5 A;  1HUG A;  1CAO A;  3RYZ A;  1CIM A;  4KUV A;  5JES B;  3JXG A;  3RJ7 A;  2NXS A;  3S71 B;  1ZE8 A;  3TMJ A;  4ZWZ A;  2POV A;  4Q7P A;  4HEZ A;  4R5A A;  3S74 B;  1OKN A;  3S97 A;  3OYS A;  3P3J A;  4LHI A;  4Q8Z A;  4WR7 A;  5BYI A;  1G52 A;  3IBI A;  3RZ1 B;  3M1W A;  4Q07 A;  3MWO A;  1CRA A;  1CNG A;  3S73 B;  3CYU A;  4CNW A;  1KWQ A;  1HCA A;  1G0F A;  3SAX A;  1G4O A;  4QY3 A;  3RG4 A;  2QO8 A;  3DAZ A;  3PO6 A;  4HU1 A;  9CA2 A;  5DRS A;  3V7X A;  2X7U A;  5EH8 A;  4JSS A;  1Z97 A;  1FQM A;  5FL4 A;  3KLD B;  3M2Z A;  3M5E A;  4Q8X A;  3R16 A;  5SZ1 A;  1IF8 A;  2FNK A;  4XIW A;  4KP5 A;  1DCB A;  2GD8 A;  3DBU A;  4Z0Q A;  1CNI A;  1IF5 A;  3LXE A;  3M04 A;  3K7K A;  1TEQ X;  1CRM A;  2X7T A;  1BNN A;  4E3G A;  3HS4 A;  4PQ7 A;  1BZM A;  4Q7W A;  1I90 A;  4YXU A;  2POW A;  5SZ6 A;  1BN4 A;  1UGD A;  1JD0 A;  5SZ0 A;  1THK A;  3IBN A;  1CA2 A;  1DCA A;  4GL1 X;  4QJW A;  5SZ2 A;  2EU3 A;  5SZ5 A;  2ZNC A;  4M2R A;  4Q7V A;  4MDL A;  3MNA A;  4X5S A;  4WW8 A;  2FNN A;  4N16 A;  3T5U A;  5DSI A;  3B1B A;  5JEG B;  5AML A;  3OIM A;  12CA A;  5FLQ A;  4YXO A;  4YYT A;  4KNI A;  5DOH A;  5E2N A;  1HEC A;  1H9Q A;  3TVN X;  5E2S A;  3DCW A;  3T83 A;  2H15 A;  4RUY A;  4TWL A;  5G0B A;  2OSF A;  1CVC A;  4E49 A;  3OKU A;  4CQ0 A;  3MNI A;  1CAN A;  5FLO A;  3S78 B;  4XIX A;  4Q08 A;  3IEO A;  4FU5 A;  1ZFQ A;  3DVB A;  1FQN A;  4KUW A;  3KOI A;  3W6H A;  4BF6 A;  3UYQ A;  2NXR A;  3MHM A;  3OKV A;  3P3H A;  1LGD A;  2Q1Q A;  3MHO A;  3N2P A;  2EZ7 A;  4FPT A;  4QJP A;  3NI5 A;  5CAC A;  1RZD A;  1UGE A;  1CNJ A;  1LG6 A;  3MNK A;  4KNJ A;  2NWY A;  3DVC A;  1CNY A;  3EFT A;  4FIK A;  1OQ5 A;  4IWZ A;  4Q87 A;  5BNL A;  1AM6 A;  2NMX A;  3RYX B;  4M2V A;  4RIV A;  4QEF A;  2NN7 A;  3MNJ A;  4WL4 A;  2HKK A;  5EHW A;  5JG5 B;  1TG9 A;  4E5Q A;  1BNT A;  1G45 A;  5E5R A;  4TWM A;  4DZ7 A;  2NNG A;  3KWA A;  4ITO A;  4XE1 A;  5C8I A;  3OY0 A;  5FNJ A;  4K0S A;  4KV0 A;  3F7U A;  4Q6D A;  1A42 A;  3KIG A;  1CAK A;  1Z9Y A;  4L5U A;  3F7B A;  1BNM A;  5FL5 A;  3MHC A;  2WEJ A;  3M96 A;  3S76 A;  4MDM A;  2X7S A;  1DMY A;  4ZWX A;  3HKN A;  3IGP A;  3S77 B;  3U7C A;  5JGS B;  4QK3 A;  1HUH A;  5FNG A;  1V9E A;  2WD2 A;  1RJ5 A;  3MYQ A;  4ZWY A;  1T9N A;  1TE3 X;  2CA2 A;  3K2F A;  4YGL A;  3HLJ A;  2CBD A;  5DSK A;  4JSZ A;  1BCD A;  1TH9 A;  2GEH A;  3IBL A;  4WW6 A;  1G48 A;  5HPJ A;  1HED A;  4QSI A;  3DD8 A;  1RZB A;  4YVY A;  1BNQ A;  1Z93 A;  4G0C A;  5JGT B;  4CAC A;  4M2W A;  3JXF A;  1UGF A;  1CAH A;  4Q8Y A;  1CAL A;  4ZWI A;  4KNM A;  3P55 A;  3SAP A;  4Z1K A;  4QTL A;  3RZ5 A;  5EIJ A;  4ETQ C;  1CVH A;  4K0T A;  1YO2 A;  3M1J A;  1XEV A;  4QJO A;  2W2J A;  4FL7 A;  1FLJ A;  5E2M A;  4MO8 A;  3MHI A;  1ZNC A;  3NB5 A;  1FR7 A;  4Q09 A;  1OKM A;  2NWO A;  4IDR X;  5EKH A;  3KS3 A;  1BIC A;  4QIZ A;  2O4Z A;  5DVX A;  3M2Y A;  5DSL A;  4CA2 A;  1TB0 X;  3GZ0 A;  1G4J A;  1CAY A;  3OIL A;  4QSJ A;  4YHA A;  1CAZ A;  4ZAO A;  2WEG A;  3JXH C;  1YDD A;  4N0X B;  5CJF A;  3S8X A;  3DD0 A;  3U45 X;  3IBU A;  1HCB A;  8CA2 A;  1LZV A;  5EH5 A;  5EHV A;  1FQL A;  1BNU A;  3M67 A;  5DSR A;  5FNL A;  2FNM A;  3DA2 A;  4Q83 A;  2QOA A;  1KWR A;  3U47 A;  4KAP A;  3T82 A;  5FLT A;  3M5S A;  1IF4 A;  3M14 A;  5E28 A;  5SZ4 A;  5L3O A;  1F2W A;  5L6K A;  3EFI A;  5FNH A;  5JQ0 A;  1YDA A;  3FW3 A;  1Y7W A;  3KON A;  3P5L A;  5EH7 A;  1XEG A;  5J8Z A;  1G3Z A;  4RUZ A;  3B4F A;  1CNX A;  1G54 A;  2FOV A;  1KOQ A;  4PZH A;  3M5T A;  4Q9Y A;  4RFC A;  3BL1 A;  4RIU A;  3M98 A;  4FVN A;  1URT A;  3V3F A;  2NWZ A;  5JDV B;  1I9O A;  5A25 A;  2NNS A;  3MDZ A;  4MDG A;  1CAM A;  2AW1 A;  3HFP A;  4PXX A;  5JG3 B;  5EKJ A;  5JQT A;  1UGB A;  1CIL A;  5CLU A;  1CNK A;  1CNB A;  4RFD A;  3F8E A;  2CAB A;  1CNH A;  1XPZ A;  3KKX A;  5AMG A;  3C7P A;  4UOV A;  1EOU A;  4Q49 A;  5DSM A;  5LMD A;  4K1Q A;  1UGA A;  5CA2 A;  4YXI A;  3P5A A;  5E5U A;  5EOI A;  3N4B A;  3MMF A;  1CVD A;  2HL4 A;  4QJX A;  4R5B A;  4QIY A;  3RZ0 B;  4Q6E A;  3V5G A;  3IAI A;  3V3I B;  4RN4 A;  4KNN A;  4Q0L A;  1RJ6 A;  1OKL A;  4YGN A;  1G6V A;  1IF6 A;  1ZSA A;  5A6H A;  2QP6 A;  5FNK A;  1CAJ A;  5BRU A;  3ZNC A;  4L5W A;  3M40 A;  3U3A X;  3OIK A;  5G0C A;  2Q38 A;  1CNC A;  1UGC A;  3P44 A;  5EKM A;  3SBH A;  3NJ9 A;  5FDI A;  3ML5 A;  3PYK A;  1JV0 A;  2HFW A;  5E2K A;  1LG5 A;  2FOU A;  1BN3 A;  5BRW A;  5G03 A;  3ML2 A;  4E9O X;  1LUG A;  1ZSB A;  3CAJ A;  3S75 B;  1BN1 A;  2OSM A;  1ZGF A;  4QSB A;  2F14 A;  3DCC A;  3RYJ B;  4Q78 A;  2WD3 A;  4KP8 A;  7CA2 A;  1RZA A;  4G7A A;  4E3H A;  2NNV A;  2VVA X;  4YX4 A;  5EZT X;  5DSP A;  3S72 B;  3V3H B;  5AMD A;  1YO1 A;  2FOY A;  3DC3 A;  1TTM A;  5FDC A;  4PYX A;  1G1D A;  3V3G B;  3W6I A;  1RAZ A;  3Q31 A;  3M2N A;  4RH2 A;  3M1Q A;  4K0Z A;  5FLS A;  1CVE A;  2NN1 A;  1BNV A;  4KUY A;  1TEU X;  4CNX A;  1YDB A;  1HVA A;  4Z1E A;  1UGG A;  1FSR A;  4Q99 A;  3CZV A;  1CAI A;  1H9N A;  3T84 A;  3MNH A;  4QJM A;  5SZ7 A;  1RAY A;  5DSJ A;  4HT0 A;  3BL0 A;  2POU A;  1CVF A;  5FLR A;  3FFP X;  3KOK A;  1HEA A;  3L14 A;  5IPZ A;  4PYY A;  4Q06 A;  4R59 A;  1BNW A;  1ZGE A;  4YGK A;  2WEH A;  3UYN A;  3D9Z A;  3F4X A;  1CIN A;  2FMG A;  4M2U A;  1AVN A;  1XQ0 A;  2IT4 A;  1CCS A;  1I9P A;  3DV7 A;  3RGE A;  3R17 B;  1CZM A;  2EU2 A;  4FVO A;  4DZ9 A;  5E2R A;  4YGJ A;  4E3D A;  4Q90 A;  3MNU A;  3RZ7 A;  4WUQ A;  3SBI A;  3T5Z A;  3VBD A;  3QYK A;  3N3J A;  4HEY A;  4WUP A;  2FMZ A;  3RZ8 A;  4CNR A;  2WEO A;  2AX2 A;  2CBE A;  1H4N A;  1FSQ A;  2FOQ A;  4Q81 A;  4XFW A;  3OYQ A;  3V2J A;  3M1K A;  4COQ A;  1IF7 A;  4YWP A;  4E4A A;  4HEW A;  1ZFK A;  2Q1B A;  4MLX A;  2HD6 A;  4Z1N A;  4ITP A;  1I9L A;  4QK1 A;  1TG3 A;  3DC9 A;  1KEQ A;  3RG3 A;  3T85 A;  4Z1J A;  1G0E A;  4BF1 A;  3BET A;  5SZ3 A;  4QK2 A;  5FL6 A;  4ILX A;  4Q7S A;  2VVB X;  4JSW A;  4K13 A;  4C3T A;  1RZC A;  1IF9 A;  1TBT X;  3K34 A;  4HF3 A;  3HKQ A;  3KNE A;  4ZX0 A;  1DMX A;  1MOO A;  5JEP B;  1ZSC A;  1FSN A;  4LU3 A;  5FNI A;  1I91 A;  4JS6 A;  2H4N A;  4QSA A;  5BRV A;  3FE4 A;  1CVA A;  1CVB A;  5DOG A;  3ZP9 A;  3PJJ A;  1HEB A;  3MHL A;  3P4V A;  1I9Q A;  2NNO A;  1G53 A;  3V2M A;  3HKU A;  3CA2 A;  1J9W A;  4LP6 A;  5JEH B;  2HNC A;  4CNV A;  1CA3 A;  2NXT A;  5DSO A;  5FNM A;  2CBC A;  4MTY A;  3DCS A;  4BCW A;  2FW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...