3M5TA

Fragment tethered to carbonic anhydrase ii h64c mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
Knots found
sequence length
257
structure length
257
Chain Sequence
HWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGCAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Carbonic anhydrase 2
publication title Fragment screening on Carbonic Anhydrase II via Tethering approach
rcsb
source organism Homo sapiens
total genus 77
structure length 257
sequence length 257
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2010-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 3m5tA00
2Q1QA 5BRWA 4QSIA 3RJ7A 3DCCA 4KNNA 1JD0A 1IF9A 1H9NA 5FLOA 2EU3A 3N0NA 5JDVB 4FPTA 2FOVA 3IBNA 4QK3A 3ZNCA 1HCAA 1BNVA 3TVNX 4E3FA 5CLUA 12CAA 5SZ6A 2HFWA 3CZVA 1H9QA 4ETQC 5FL6A 3HKTA 2NNGA 4MTYA 2NNOA 4WW8A 3T5ZA 4RFDA 3DBUA 4Q07A 4CNXA 3JXGA 3M98A 4HU1A 4Q7VA 2WEOA 4E3HA 5FL5A 2WD3A 1BNQA 4RIUA 5JQ0A 2NMXA 3MHIA 3MMFA 3RZ1B 3P3JA 4WR7A 1G46A 2NXTA 5C8IA 4FL7A 4ITOA 1FQNA 5A6HA 3PYKA 5DSQA 2NWYA 5SZ2A 3MHCA 4Q90A 1T9NA 4L5VA 5A25A 4XFWA 5J8ZA 5DOHA 4QEFA 3DC9A 4PYYA 1I9MA 2AW1A 2NNSA 1UGAA 1CCSA 4PYXA 3K2FA 4ZX1A 1RAZA 4IWZA 4Q6EA 1I9PA 4RUXA 2FNNA 4HBAA 1IF7A 3SBHA 1ZSCA 1KOQA 3D9ZA 4QSJA 5E2NA 4E9OX 5SZ4A 1KEQA 3IBLA 3R17B 4HT2A 3MHLA 4YXIA 4JSAA 4COQA 1BCDA 3U7CA 3S77B 4ZX0A 2HOCA 1CCUA 4YGFA 4GL1X 4LHIA 4Q99A 3P58A 3F7BA 4YGNA 3OYSA 1ZNCA 2QO8A 3RZ5A 2WD2A 4M2WA 4PXXA 3F4XA 4LU3A 2Q1BA 4E4AA 2POWA 2VVAX 5E2KA 4L5WA 4CA2A 3MHOA 3S73B 3S76A 3F8EA 4ZWXA 4KNIA 4K0SA 2POUA 5FLPA 3M96A 3DC3A 4Q7WA 1BICA 1AVNA 2FNMA 3MZCA 4Q7SA 4BF6A 2X7TA 3UYNA 1RJ5A 5JQTA 4YVYA 1XEGA 1LG5A 5AMDA 3B1BA 3FE4A 4N16A 2WEJA 3F7UA 1RAYA 1RZDA 1CAHA 5IPZA 4DZ7A 3S72B 2OSFA 3M40A 4IDRX 5DSLA 1DMXA 1I91A 2QOAA 5JEHB 1TBTX 2NN7A 4FIKA 1H4NA 4CNRA 1YDBA 3ML5A 1DCBA 3P5AA 4Q83A 4R5AA 5G0CA 5DSPA 4QY3A 2EZ7A 3MHMA 1I90A 5EKJA 1EOUA 2F14A 1CAJA 1RZAA 2NN1A 4Z1JA 4QJPA 1TEUX 1BZMA 3V3JA 5E5RA 4G0CA 4QK1A 1OKNA 4N0XB 8CA2A 4QSAA 4KAPA 1CILA 1OQ5A 1F2WA 1I9NA 1TEQX 4X5SA 1DMYA 4BCWA 3DVDA 5EOIA 1DCAA 3M5SA 3NJ9A 1TG3A 1HECA 1TH9A 4YWPA 5DSIA 6CA2A 3CYUA 1BNTA 4MDGA 4CNVA 3P5LA 1G0FA 4G7AA 3S78B 1CVCA 1BN3A 3OIKA 5E2MA 5FNJA 2CBCA 1TG9A 1LGDA 3DVBA 4XE1A 4M2UA 1CAYA 5FDCA 2ZNCA 4RN4A 4KNMA 1G0EA 4QJWA 3FW3A 4QJOA 3KOKA 3MYQA 3OY0A 2FNKA 1UGFA 1HEBA 1G4OA 3B4FA 4ZWYA 1Z97A 4Q8ZA 1CNYA 1THKA 4E5QA 3C7PA 5FLRA 5EKMA 1CNHA 4CNWA 3HKNA 1MUAA 5FLQA 3MNUA 3U3AX 3KNEA 3V3FA 4BF1A 1CVEA 3V3GB 3W6HA 4Q49A 1CNIA 4QTLA 4JSWA 2X7UA 3PO6A 4QIZA 2FOUA 2WEHA 3KIGA 3V5GA 4LP6A 5FLTA 1TE3X 3DD0A 3V7XA 5AMGA 3SAPA 2FOYA 4Q78A 4QJ0A 3FFPX 3K7KA 2CA2A 1CNGA 5E5UA 1BN1A 3DA2A 5G01A 5L3OA 3M14A 3KS3A 4FVNA 1YO2A 4XIXA 3S97A 3S71B 4K13A 4ILXA 4YGJA 1CINA 1FQMA 1RJ6A 4XZ5A 4Q9YA 5DSNA 3OYQA 4FU5A 3UYQA 1RZBA 1TB0X 3N3JA 3RLDA 4KP5A 5JESB 1UGBA 3KONA 3T5UA 4RUZA 2HL4A 1IF4A 3KOIA 3OILA 3MNKA 1OKLA 3N2PA 5EKHA 1ZGFA 2CABA 3MWOA 1CNWA 4HEWA 4Q0LA 4R5BA 3M5TA 4KUWA 1Z9YA 4YXOA 4Q81A 1BNMA 3V3HB 1I8ZA 4JSZA 4YGKA 1CNKA 1A42A 1BNWA 4MDMA 3KKXA 4Q7PA 4DZ9A 4KUYA 1JCZA 3M04A 1Z93A 3NB5A 1V9IC 1CVHA 3OKUA 1ZGEA 3N4BA 2H4NA 1HUGA 4Q09A 1G52A 2QP6A 1FR7A 1YDAA 3HLJA 5JGTB 1TTMA 1G54A 4ZWIA 3M1KA 1FSQA 3QYKA 1CAMA 7CA2A 4JS6A 3TVOX 3MNHA 3M3XA 3P4VA 4QSBA 3S9TA 1G4JA 1HCBA 5E2RA 4HT0A 1CVAA 5CACA 1CAOA 4QJXA 1KWRA 3M2NA 1BN4A 4HEZA 4E49A 9CA2A 1I9QA 5JG5B 4PQ7A 3EFTA 2NXSA 2ILIA 3OKVA 3P55A 1CNXA 3M5EA 1LZVA 2FW4A 5EH8A 2WEGA 3M2YA 5BRVA 3RYJB 2NNVA 3M2XA 3MNAA 5EHVA 1FSNA 1RZCA 3IGPA 3P3HA 1YDCA 4QK2A 2CBDA 5SZ1A 1G1DA 3BETA 2HKKA 1CRMA 3MNJA 4MDLA 5FNHA 3RYZA 1ZSAA 3S75B 3JXFA 3MDZA 1YO1A 1FSRA 3LXEA 4QJMA 5DSMA 5JG3B 3V3IB 4Z0QA 5L6KA 2Q38A 1CAZA 3ZP9A 3M2ZA 4YX4A 4KP8A 2FMZA 3RYXB 3RYVB 1HUHA 4Q06A 5DSJA 3VBDA 4CACA 4Z1EA 1ZH9A 3S8XA 1CALA 3ML2A 1CNBA 4HF3A 1CA3A 3HKQA 5JGSB 2FMGA 5FNKA 3BL1A 4JSSA 1CCTA 2NWPA 4ITPA 5E28A 1UGCA 5JEGB 3DCWA 1CVBA 5LMDA 3JXHC 1AM6A 3PJJA 4KUVA 2HNCA 5FLSA 4K0TA 1CZMA 1Y7WA 3D92A 3NI5A 5AMLA 4YXUA 3RG3A 1G3ZA 2FOQA 4KNJA 3CA2A 1CVFA 1UGEA 2POVA 2GD8A 5DVXA 1JV0A 3MNIA 4K0ZA 5FNIA 1YO0A 3GZ0A 3SAXA 5SZ5A 4K1QA 4E3DA 3D93A 4ZWZA 2O4ZA 1KWQA 5SZ3A 3DAZA 2EU2A 5DRSA 4Q6DA 5BNLA 3P44A 5G03A 3TMJA 5DSRA 4WUQA 1URTA 4ZAOA 4XIWA 3T82A 4RH2A 1CNCA 4WL4A 4Z1KA 2CBBA 3V2JA 4C3TA 5FNMA 5EH5A 3T84A 3CAJA 4Q87A 1CRAA 4UOVA 1ZE8A 4Y0JA 3RYYA 3DCSA 4FRCA 1J9WA 4RIVA 1UGGA 1V9EA 4Q8YA 5DSKA 3IAIA 3HS4A 5FNLA 1BNNA 4M2RA 1ZSBA 1FQLA 4YHAA 5G0BA 1KOPA 2CBAA 4KV0A 2AX2A 1ZFQA 1XPZA 5SZ7A 3T83A 5HPJA 3R16A 4RFCA 2ABEA 1HEAA 4YGLA 4L5UA 5FNGA 3RGEA 3RG4A 1CAKA 1CIMA 3M1WA 1UGDA 1HEDA 4TWLA 1IF5A 3M1QA 4Q8XA 2NWOA 5EHEA 5DSOA 4Z1NA 4MLXA 4FVOA 3D8WA 2X7SA 5EIJA 3DD8A 3RZ0B 3S74B 1I9OA 2OSMA 1CAIA 3V2MA 1G6VA 4MLTA 1XQ0A 1IF8A 4PZHA 3RZ8A 5E2SA 4RUYA 4WUPA 3OIMA 2VVBX 3DV7A 3HFPA 3M67A 3U47A 4WW6A 3BL0A 1LUGA 1XEVA 1LG6A 3SBIA 5FL4A 2HD6A 4M2VA 4QIYA 1BV3A 5BRUA 1MOOA 2GEHA 1AZMA 1HVAA 3HKUA 5SZ0A 1ZFKA 3IBIA 1G48A 4MO8A 4CQ0A 1BNUA 5JEPB 1G53A 3T85A 1YDDA 5CJFA 5DOGA 4R59A 2IT4A 1FR4A 1CA2A 3IBUA 4TWMA 5BYIA 3EFIA 1I9LA 2NXRA 3KWAA 3D0NA 2W2JA 1IF6A 3M1JA 1CVDA 4HEYA 4Q08A 2CBEA 5EZTX 3U45X 1CANA 3K34A 5EHWA 1FLJA 3L14A 3Q31A 3W6IA 3IEOA 5EH7A 2NWZA 5CA2A 1CNJA 4E3GA 1G45A 5FDIA 3DVCA 3KLDB 2FOSA 1RZEA 3RZ7A 1OKMA 2H15A 1FQRA 4YYTA
chains in the Genus database with same CATH superfamily
2Q1QA 5BRWA 4QSIA 3RJ7A 3DCCA 4KNNA 1JD0A 1IF9A 1H9NA 5FLOA 2EU3A 3N0NA 5JDVB 4FPTA 2FOVA 3IBNA 4QK3A 3ZNCA 1HCAA 1BNVA 3TVNX 4E3FA 5CLUA 12CAA 5SZ6A 2HFWA 3CZVA 1H9QA 4ETQC 5FL6A 3HKTA 2NNGA 4MTYA 2NNOA 4WW8A 3T5ZA 4RFDA 3DBUA 4Q07A 4CNXA 3JXGA 3M98A 4HU1A 4Q7VA 2WEOA 4E3HA 5FL5A 2WD3A 1BNQA 4RIUA 5JQ0A 2NMXA 3MHIA 3MMFA 3RZ1B 3P3JA 4WR7A 1G46A 2NXTA 5C8IA 4FL7A 4ITOA 1FQNA 5A6HA 3PYKA 5DSQA 2NWYA 5SZ2A 3MHCA 4Q90A 1T9NA 4L5VA 5A25A 4XFWA 5J8ZA 5DOHA 4QEFA 3DC9A 4PYYA 1I9MA 2AW1A 2NNSA 1UGAA 1CCSA 4PYXA 3K2FA 4ZX1A 1RAZA 4IWZA 4Q6EA 1I9PA 4RUXA 2FNNA 4HBAA 1IF7A 3SBHA 1ZSCA 1KOQA 3D9ZA 4QSJA 5E2NA 4E9OX 5SZ4A 1KEQA 3IBLA 3R17B 4HT2A 3MHLA 4YXIA 4JSAA 4COQA 1BCDA 3U7CA 3S77B 4ZX0A 2HOCA 1CCUA 4YGFA 4GL1X 4LHIA 4Q99A 3P58A 3F7BA 4YGNA 3OYSA 1ZNCA 2QO8A 3RZ5A 2WD2A 4M2WA 4PXXA 3F4XA 4LU3A 2Q1BA 4E4AA 2POWA 2VVAX 5E2KA 4L5WA 4CA2A 3MHOA 3S73B 3S76A 3F8EA 4ZWXA 4KNIA 4K0SA 2POUA 5FLPA 3M96A 3DC3A 4Q7WA 1BICA 1AVNA 2FNMA 3MZCA 4Q7SA 4BF6A 2X7TA 3UYNA 1RJ5A 5JQTA 4YVYA 1XEGA 1LG5A 5AMDA 3B1BA 3FE4A 4N16A 2WEJA 3F7UA 1RAYA 1RZDA 1CAHA 5IPZA 4DZ7A 3S72B 2OSFA 3M40A 4IDRX 5DSLA 1DMXA 1I91A 2QOAA 5JEHB 1TBTX 2NN7A 4FIKA 1H4NA 4CNRA 1YDBA 3ML5A 1DCBA 3P5AA 4Q83A 4R5AA 5G0CA 5DSPA 4QY3A 2EZ7A 3MHMA 1I90A 5EKJA 1EOUA 2F14A 1CAJA 1RZAA 2NN1A 4Z1JA 4QJPA 1TEUX 1BZMA 3V3JA 5E5RA 4G0CA 4QK1A 1OKNA 4N0XB 8CA2A 4QSAA 4KAPA 1CILA 1OQ5A 1F2WA 1I9NA 1TEQX 4X5SA 1DMYA 4BCWA 3DVDA 5EOIA 1DCAA 3M5SA 3NJ9A 1TG3A 1HECA 1TH9A 4YWPA 5DSIA 6CA2A 3CYUA 1BNTA 4MDGA 4CNVA 3P5LA 1G0FA 4G7AA 3S78B 1CVCA 1BN3A 3OIKA 5E2MA 5FNJA 2CBCA 1TG9A 1LGDA 3DVBA 4XE1A 4M2UA 1CAYA 5FDCA 2ZNCA 4RN4A 4KNMA 1G0EA 4QJWA 3FW3A 4QJOA 3KOKA 3MYQA 3OY0A 2FNKA 1UGFA 1HEBA 1G4OA 3B4FA 4ZWYA 1Z97A 4Q8ZA 1CNYA 1THKA 4E5QA 3C7PA 5FLRA 5EKMA 1CNHA 4CNWA 3HKNA 1MUAA 5FLQA 3MNUA 3U3AX 3KNEA 3V3FA 4BF1A 1CVEA 3V3GB 3W6HA 4Q49A 1CNIA 4QTLA 4JSWA 2X7UA 3PO6A 4QIZA 2FOUA 2WEHA 3KIGA 3V5GA 4LP6A 5FLTA 1TE3X 3DD0A 3V7XA 5AMGA 3SAPA 2FOYA 4Q78A 4QJ0A 3FFPX 3K7KA 2CA2A 1CNGA 5E5UA 1BN1A 3DA2A 5G01A 5L3OA 3M14A 3KS3A 4FVNA 1YO2A 4XIXA 3S97A 3S71B 4K13A 4ILXA 4YGJA 1CINA 1FQMA 1RJ6A 4XZ5A 4Q9YA 5DSNA 3OYQA 4FU5A 3UYQA 1RZBA 1TB0X 3N3JA 3RLDA 4KP5A 5JESB 1UGBA 3KONA 3T5UA 4RUZA 2HL4A 1IF4A 3KOIA 3OILA 3MNKA 1OKLA 3N2PA 5EKHA 1ZGFA 2CABA 3MWOA 1CNWA 4HEWA 4Q0LA 4R5BA 3M5TA 4KUWA 1Z9YA 4YXOA 4Q81A 1BNMA 3V3HB 1I8ZA 4JSZA 4YGKA 1CNKA 1A42A 1BNWA 4MDMA 3KKXA 4Q7PA 4DZ9A 4KUYA 1JCZA 3M04A 1Z93A 3NB5A 1V9IC 1CVHA 3OKUA 1ZGEA 3N4BA 2H4NA 1HUGA 4Q09A 1G52A 2QP6A 1FR7A 1YDAA 3HLJA 5JGTB 1TTMA 1G54A 4ZWIA 3M1KA 1FSQA 3QYKA 1CAMA 7CA2A 4JS6A 3TVOX 3MNHA 3M3XA 3P4VA 4QSBA 3S9TA 1G4JA 1HCBA 5E2RA 4HT0A 1CVAA 5CACA 1CAOA 4QJXA 1KWRA 3M2NA 1BN4A 4HEZA 4E49A 9CA2A 1I9QA 5JG5B 4PQ7A 3EFTA 2NXSA 2ILIA 3OKVA 3P55A 1CNXA 3M5EA 1LZVA 2FW4A 5EH8A 2WEGA 3M2YA 5BRVA 3RYJB 2NNVA 3M2XA 3MNAA 5EHVA 1FSNA 1RZCA 3IGPA 3P3HA 1YDCA 4QK2A 2CBDA 5SZ1A 1G1DA 3BETA 2HKKA 1CRMA 3MNJA 4MDLA 5FNHA 3RYZA 1ZSAA 3S75B 3JXFA 3MDZA 1YO1A 1FSRA 3LXEA 4QJMA 5DSMA 5JG3B 3V3IB 4Z0QA 5L6KA 2Q38A 1CAZA 3ZP9A 3M2ZA 4YX4A 4KP8A 2FMZA 3RYXB 3RYVB 1HUHA 4Q06A 5DSJA 3VBDA 4CACA 4Z1EA 1ZH9A 3S8XA 1CALA 3ML2A 1CNBA 4HF3A 1CA3A 3HKQA 5JGSB 2FMGA 5FNKA 3BL1A 4JSSA 1CCTA 2NWPA 4ITPA 5E28A 1UGCA 5JEGB 3DCWA 1CVBA 5LMDA 3JXHC 1AM6A 3PJJA 4KUVA 2HNCA 5FLSA 4K0TA 1CZMA 1Y7WA 3D92A 3NI5A 5AMLA 4YXUA 3RG3A 1G3ZA 2FOQA 4KNJA 3CA2A 1CVFA 1UGEA 2POVA 2GD8A 5DVXA 1JV0A 3MNIA 4K0ZA 5FNIA 1YO0A 3GZ0A 3SAXA 5SZ5A 4K1QA 4E3DA 3D93A 4ZWZA 2O4ZA 1KWQA 5SZ3A 3DAZA 2EU2A 5DRSA 4Q6DA 5BNLA 3P44A 5G03A 3TMJA 5DSRA 4WUQA 1URTA 4ZAOA 4XIWA 3T82A 4RH2A 1CNCA 4WL4A 4Z1KA 2CBBA 3V2JA 4C3TA 5FNMA 5EH5A 3T84A 3CAJA 4Q87A 1CRAA 4UOVA 1ZE8A 4Y0JA 3RYYA 3DCSA 4FRCA 1J9WA 4RIVA 1UGGA 1V9EA 4Q8YA 5DSKA 3IAIA 3HS4A 5FNLA 1BNNA 4M2RA 1ZSBA 1FQLA 4YHAA 5G0BA 1KOPA 2CBAA 4KV0A 2AX2A 1ZFQA 1XPZA 5SZ7A 3T83A 5HPJA 3R16A 4RFCA 2ABEA 1HEAA 4YGLA 4L5UA 5FNGA 3RGEA 3RG4A 1CAKA 1CIMA 3M1WA 1UGDA 1HEDA 4TWLA 1IF5A 3M1QA 4Q8XA 2NWOA 5EHEA 5DSOA 4Z1NA 4MLXA 4FVOA 3D8WA 2X7SA 5EIJA 3DD8A 3RZ0B 3S74B 1I9OA 2OSMA 1CAIA 3V2MA 1G6VA 4MLTA 1XQ0A 1IF8A 4PZHA 3RZ8A 5E2SA 4RUYA 4WUPA 3OIMA 2VVBX 3DV7A 3HFPA 3M67A 3U47A 4WW6A 3BL0A 1LUGA 1XEVA 1LG6A 3SBIA 5FL4A 2HD6A 4M2VA 4QIYA 1BV3A 5BRUA 1MOOA 2GEHA 1AZMA 1HVAA 3HKUA 5SZ0A 1ZFKA 3IBIA 1G48A 4MO8A 4CQ0A 1BNUA 5JEPB 1G53A 3T85A 1YDDA 5CJFA 5DOGA 4R59A 2IT4A 1FR4A 1CA2A 3IBUA 4TWMA 5BYIA 3EFIA 1I9LA 2NXRA 3KWAA 3D0NA 2W2JA 1IF6A 3M1JA 1CVDA 4HEYA 4Q08A 2CBEA 5EZTX 3U45X 1CANA 3K34A 5EHWA 1FLJA 3L14A 3Q31A 3W6IA 3IEOA 5EH7A 2NWZA 5CA2A 1CNJA 4E3GA 1G45A 5FDIA 3DVCA 3KLDB 2FOSA 1RZEA 3RZ7A 1OKMA 2H15A 1FQRA 4YYTA
chains in the Genus database with same CATH topology
2Q1QA 5BRWA 4QSIA 3RJ7A 3DCCA 4KNNA 1JD0A 1IF9A 1H9NA 5FLOA 2EU3A 3N0NA 5JDVB 4FPTA 2FOVA 3IBNA 4QK3A 3ZNCA 1HCAA 1BNVA 3TVNX 4E3FA 5CLUA 12CAA 5SZ6A 2HFWA 3CZVA 1H9QA 4ETQC 5FL6A 3HKTA 2NNGA 4MTYA 2NNOA 4WW8A 3T5ZA 4RFDA 3DBUA 4Q07A 4CNXA 3JXGA 3M98A 4HU1A 4Q7VA 2WEOA 4E3HA 5FL5A 2WD3A 1BNQA 4RIUA 5JQ0A 2NMXA 3MHIA 3MMFA 3RZ1B 3P3JA 4WR7A 1G46A 2NXTA 5C8IA 4FL7A 4ITOA 1FQNA 5A6HA 3PYKA 5DSQA 2NWYA 5SZ2A 3MHCA 4Q90A 1T9NA 4L5VA 5A25A 4XFWA 5J8ZA 5DOHA 4QEFA 3DC9A 4PYYA 1I9MA 2AW1A 2NNSA 1UGAA 1CCSA 4PYXA 3K2FA 4ZX1A 1RAZA 4IWZA 4Q6EA 1I9PA 4RUXA 2FNNA 4HBAA 1IF7A 3SBHA 1ZSCA 1KOQA 3D9ZA 4QSJA 5E2NA 4E9OX 5SZ4A 1KEQA 3IBLA 3R17B 4HT2A 3MHLA 4YXIA 4JSAA 4COQA 1BCDA 3U7CA 3S77B 4ZX0A 2HOCA 1CCUA 4YGFA 4GL1X 4LHIA 4Q99A 3P58A 3F7BA 4YGNA 3OYSA 1ZNCA 2QO8A 3RZ5A 2WD2A 4M2WA 4PXXA 3F4XA 4LU3A 2Q1BA 4E4AA 2POWA 2VVAX 5E2KA 4L5WA 4CA2A 3MHOA 3S73B 3S76A 3F8EA 4ZWXA 4KNIA 4K0SA 2POUA 5FLPA 3M96A 3DC3A 4Q7WA 1BICA 1AVNA 2FNMA 3MZCA 4Q7SA 4BF6A 2X7TA 3UYNA 1RJ5A 5JQTA 4YVYA 1XEGA 1LG5A 5AMDA 3B1BA 3FE4A 4N16A 2WEJA 3F7UA 1RAYA 1RZDA 1CAHA 5IPZA 4DZ7A 3S72B 2OSFA 3M40A 4IDRX 5DSLA 1DMXA 1I91A 2QOAA 5JEHB 1TBTX 2NN7A 4FIKA 1H4NA 4CNRA 1YDBA 3ML5A 1DCBA 3P5AA 4Q83A 4R5AA 5G0CA 5DSPA 4QY3A 2EZ7A 3MHMA 1I90A 5EKJA 1EOUA 2F14A 1CAJA 1RZAA 2NN1A 4Z1JA 4QJPA 1TEUX 1BZMA 3V3JA 5E5RA 4G0CA 4QK1A 1OKNA 4N0XB 8CA2A 4QSAA 4KAPA 1CILA 1OQ5A 1F2WA 1I9NA 1TEQX 4X5SA 1DMYA 4BCWA 3DVDA 5EOIA 1DCAA 3M5SA 3NJ9A 1TG3A 1HECA 1TH9A 4YWPA 5DSIA 6CA2A 3CYUA 1BNTA 4MDGA 4CNVA 3P5LA 1G0FA 4G7AA 3S78B 1CVCA 1BN3A 3OIKA 5E2MA 5FNJA 2CBCA 1TG9A 1LGDA 3DVBA 4XE1A 4M2UA 1CAYA 5FDCA 2ZNCA 4RN4A 4KNMA 1G0EA 4QJWA 3FW3A 4QJOA 3KOKA 3MYQA 3OY0A 2FNKA 1UGFA 1HEBA 1G4OA 3B4FA 4ZWYA 1Z97A 4Q8ZA 1CNYA 1THKA 4E5QA 3C7PA 5FLRA 5EKMA 1CNHA 4CNWA 3HKNA 1MUAA 5FLQA 3MNUA 3U3AX 3KNEA 3V3FA 4BF1A 1CVEA 3V3GB 3W6HA 4Q49A 1CNIA 4QTLA 4JSWA 2X7UA 3PO6A 4QIZA 2FOUA 2WEHA 3KIGA 3V5GA 4LP6A 5FLTA 1TE3X 3DD0A 3V7XA 5AMGA 3SAPA 2FOYA 4Q78A 4QJ0A 3FFPX 3K7KA 2CA2A 1CNGA 5E5UA 1BN1A 3DA2A 5G01A 5L3OA 3M14A 3KS3A 4FVNA 1YO2A 4XIXA 3S97A 3S71B 4K13A 4ILXA 4YGJA 1CINA 1FQMA 1RJ6A 4XZ5A 4Q9YA 5DSNA 3OYQA 4FU5A 3UYQA 1RZBA 1TB0X 3N3JA 3RLDA 4KP5A 5JESB 1UGBA 3KONA 3T5UA 4RUZA 2HL4A 1IF4A 3KOIA 3OILA 3MNKA 1OKLA 3N2PA 5EKHA 1ZGFA 2CABA 3MWOA 1CNWA 4HEWA 4Q0LA 4R5BA 3M5TA 4KUWA 1Z9YA 4YXOA 4Q81A 1BNMA 3V3HB 1I8ZA 4JSZA 4YGKA 1CNKA 1A42A 1BNWA 4MDMA 3KKXA 4Q7PA 4DZ9A 4KUYA 1JCZA 3M04A 1Z93A 3NB5A 1V9IC 1CVHA 3OKUA 1ZGEA 3N4BA 2H4NA 1HUGA 4Q09A 1G52A 2QP6A 1FR7A 1YDAA 3HLJA 5JGTB 1TTMA 1G54A 4ZWIA 3M1KA 1FSQA 3QYKA 1CAMA 7CA2A 4JS6A 3TVOX 3MNHA 3M3XA 3P4VA 4QSBA 3S9TA 1G4JA 1HCBA 5E2RA 4HT0A 1CVAA 5CACA 1CAOA 4QJXA 1KWRA 3M2NA 1BN4A 4HEZA 4E49A 9CA2A 1I9QA 5JG5B 4PQ7A 3EFTA 2NXSA 2ILIA 3OKVA 3P55A 1CNXA 3M5EA 1LZVA 2FW4A 5EH8A 2WEGA 3M2YA 5BRVA 3RYJB 2NNVA 3M2XA 3MNAA 5EHVA 1FSNA 1RZCA 3IGPA 3P3HA 1YDCA 4QK2A 2CBDA 5SZ1A 1G1DA 3BETA 2HKKA 1CRMA 3MNJA 4MDLA 5FNHA 3RYZA 1ZSAA 3S75B 3JXFA 3MDZA 1YO1A 1FSRA 3LXEA 4QJMA 5DSMA 5JG3B 3V3IB 4Z0QA 5L6KA 2Q38A 1CAZA 3ZP9A 3M2ZA 4YX4A 4KP8A 2FMZA 3RYXB 3RYVB 1HUHA 4Q06A 5DSJA 3VBDA 4CACA 4Z1EA 1ZH9A 3S8XA 1CALA 3ML2A 1CNBA 4HF3A 1CA3A 3HKQA 5JGSB 2FMGA 5FNKA 3BL1A 4JSSA 1CCTA 2NWPA 4ITPA 5E28A 1UGCA 5JEGB 3DCWA 1CVBA 5LMDA 3JXHC 1AM6A 3PJJA 4KUVA 2HNCA 5FLSA 4K0TA 1CZMA 1Y7WA 3D92A 3NI5A 5AMLA 4YXUA 3RG3A 1G3ZA 2FOQA 4KNJA 3CA2A 1CVFA 1UGEA 2POVA 2GD8A 5DVXA 1JV0A 3MNIA 4K0ZA 5FNIA 1YO0A 3GZ0A 3SAXA 5SZ5A 4K1QA 4E3DA 3D93A 4ZWZA 2O4ZA 1KWQA 5SZ3A 3DAZA 2EU2A 5DRSA 4Q6DA 5BNLA 3P44A 5G03A 3TMJA 5DSRA 4WUQA 1URTA 4ZAOA 4XIWA 3T82A 4RH2A 1CNCA 4WL4A 4Z1KA 2CBBA 3V2JA 4C3TA 5FNMA 5EH5A 3T84A 3CAJA 4Q87A 1CRAA 4UOVA 1ZE8A 4Y0JA 3RYYA 3DCSA 4FRCA 1J9WA 4RIVA 1UGGA 1V9EA 4Q8YA 5DSKA 3IAIA 3HS4A 5FNLA 1BNNA 4M2RA 1ZSBA 1FQLA 4YHAA 5G0BA 1KOPA 2CBAA 4KV0A 2AX2A 1ZFQA 1XPZA 5SZ7A 3T83A 5HPJA 3R16A 4RFCA 2ABEA 1HEAA 4YGLA 4L5UA 5FNGA 3RGEA 3RG4A 1CAKA 1CIMA 3M1WA 1UGDA 1HEDA 4TWLA 1IF5A 3M1QA 4Q8XA 2NWOA 5EHEA 5DSOA 4Z1NA 4MLXA 4FVOA 3D8WA 2X7SA 5EIJA 3DD8A 3RZ0B 3S74B 1I9OA 2OSMA 1CAIA 3V2MA 1G6VA 4MLTA 1XQ0A 1IF8A 4PZHA 3RZ8A 5E2SA 4RUYA 4WUPA 3OIMA 2VVBX 3DV7A 3HFPA 3M67A 3U47A 4WW6A 3BL0A 1LUGA 1XEVA 1LG6A 3SBIA 5FL4A 2HD6A 4M2VA 4QIYA 1BV3A 5BRUA 1MOOA 2GEHA 1AZMA 1HVAA 3HKUA 5SZ0A 1ZFKA 3IBIA 1G48A 4MO8A 4CQ0A 1BNUA 5JEPB 1G53A 3T85A 1YDDA 5CJFA 5DOGA 4R59A 2IT4A 1FR4A 1CA2A 3IBUA 4TWMA 5BYIA 3EFIA 1I9LA 2NXRA 3KWAA 3D0NA 2W2JA 1IF6A 3M1JA 1CVDA 4HEYA 4Q08A 2CBEA 5EZTX 3U45X 1CANA 3K34A 5EHWA 1FLJA 3L14A 3Q31A 3W6IA 3IEOA 5EH7A 2NWZA 5CA2A 1CNJA 4E3GA 1G45A 5FDIA 3DVCA 3KLDB 2FOSA 1RZEA 3RZ7A 1OKMA 2H15A 1FQRA 4YYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q1Q A;  5BRW A;  4QSI A;  3RJ7 A;  3DCC A;  4KNN A;  1JD0 A;  1IF9 A;  1H9N A;  5FLO A;  2EU3 A;  3N0N A;  5JDV B;  4FPT A;  2FOV A;  3IBN A;  4QK3 A;  3ZNC A;  1HCA A;  1BNV A;  3TVN X;  4E3F A;  5CLU A;  12CA A;  5SZ6 A;  2HFW A;  3CZV A;  1H9Q A;  4ETQ C;  5FL6 A;  3HKT A;  2NNG A;  4MTY A;  2NNO A;  4WW8 A;  3T5Z A;  4RFD A;  3DBU A;  4Q07 A;  4CNX A;  3JXG A;  3M98 A;  4HU1 A;  4Q7V A;  2WEO A;  4E3H A;  5FL5 A;  2WD3 A;  1BNQ A;  4RIU A;  5JQ0 A;  2NMX A;  3MHI A;  3MMF A;  3RZ1 B;  3P3J A;  4WR7 A;  1G46 A;  2NXT A;  5C8I A;  4FL7 A;  4ITO A;  1FQN A;  5A6H A;  3PYK A;  5DSQ A;  2NWY A;  5SZ2 A;  3MHC A;  4Q90 A;  1T9N A;  4L5V A;  5A25 A;  4XFW A;  5J8Z A;  5DOH A;  4QEF A;  3DC9 A;  4PYY A;  1I9M A;  2AW1 A;  2NNS A;  1UGA A;  1CCS A;  4PYX A;  3K2F A;  4ZX1 A;  1RAZ A;  4IWZ A;  4Q6E A;  1I9P A;  4RUX A;  2FNN A;  4HBA A;  1IF7 A;  3SBH A;  1ZSC A;  1KOQ A;  3D9Z A;  4QSJ A;  5E2N A;  4E9O X;  5SZ4 A;  1KEQ A;  3IBL A;  3R17 B;  4HT2 A;  3MHL A;  4YXI A;  4JSA A;  4COQ A;  1BCD A;  3U7C A;  3S77 B;  4ZX0 A;  2HOC A;  1CCU A;  4YGF A;  4GL1 X;  4LHI A;  4Q99 A;  3P58 A;  3F7B A;  4YGN A;  3OYS A;  1ZNC A;  2QO8 A;  3RZ5 A;  2WD2 A;  4M2W A;  4PXX A;  3F4X A;  4LU3 A;  2Q1B A;  4E4A A;  2POW A;  2VVA X;  5E2K A;  4L5W A;  4CA2 A;  3MHO A;  3S73 B;  3S76 A;  3F8E A;  4ZWX A;  4KNI A;  4K0S A;  2POU A;  5FLP A;  3M96 A;  3DC3 A;  4Q7W A;  1BIC A;  1AVN A;  2FNM A;  3MZC A;  4Q7S A;  4BF6 A;  2X7T A;  3UYN A;  1RJ5 A;  5JQT A;  4YVY A;  1XEG A;  1LG5 A;  5AMD A;  3B1B A;  3FE4 A;  4N16 A;  2WEJ A;  3F7U A;  1RAY A;  1RZD A;  1CAH A;  5IPZ A;  4DZ7 A;  3S72 B;  2OSF A;  3M40 A;  4IDR X;  5DSL A;  1DMX A;  1I91 A;  2QOA A;  5JEH B;  1TBT X;  2NN7 A;  4FIK A;  1H4N A;  4CNR A;  1YDB A;  3ML5 A;  1DCB A;  3P5A A;  4Q83 A;  4R5A A;  5G0C A;  5DSP A;  4QY3 A;  2EZ7 A;  3MHM A;  1I90 A;  5EKJ A;  1EOU A;  2F14 A;  1CAJ A;  1RZA A;  2NN1 A;  4Z1J A;  4QJP A;  1TEU X;  1BZM A;  3V3J A;  5E5R A;  4G0C A;  4QK1 A;  1OKN A;  4N0X B;  8CA2 A;  4QSA A;  4KAP A;  1CIL A;  1OQ5 A;  1F2W A;  1I9N A;  1TEQ X;  4X5S A;  1DMY A;  4BCW A;  3DVD A;  5EOI A;  1DCA A;  3M5S A;  3NJ9 A;  1TG3 A;  1HEC A;  1TH9 A;  4YWP A;  5DSI A;  6CA2 A;  3CYU A;  1BNT A;  4MDG A;  4CNV A;  3P5L A;  1G0F A;  4G7A A;  3S78 B;  1CVC A;  1BN3 A;  3OIK A;  5E2M A;  5FNJ A;  2CBC A;  1TG9 A;  1LGD A;  3DVB A;  4XE1 A;  4M2U A;  1CAY A;  5FDC A;  2ZNC A;  4RN4 A;  4KNM A;  1G0E A;  4QJW A;  3FW3 A;  4QJO A;  3KOK A;  3MYQ A;  3OY0 A;  2FNK A;  1UGF A;  1HEB A;  1G4O A;  3B4F A;  4ZWY A;  1Z97 A;  4Q8Z A;  1CNY A;  1THK A;  4E5Q A;  3C7P A;  5FLR A;  5EKM A;  1CNH A;  4CNW A;  3HKN A;  1MUA A;  5FLQ A;  3MNU A;  3U3A X;  3KNE A;  3V3F A;  4BF1 A;  1CVE A;  3V3G B;  3W6H A;  4Q49 A;  1CNI A;  4QTL A;  4JSW A;  2X7U A;  3PO6 A;  4QIZ A;  2FOU A;  2WEH A;  3KIG A;  3V5G A;  4LP6 A;  5FLT A;  1TE3 X;  3DD0 A;  3V7X A;  5AMG A;  3SAP A;  2FOY A;  4Q78 A;  4QJ0 A;  3FFP X;  3K7K A;  2CA2 A;  1CNG A;  5E5U A;  1BN1 A;  3DA2 A;  5G01 A;  5L3O A;  3M14 A;  3KS3 A;  4FVN A;  1YO2 A;  4XIX A;  3S97 A;  3S71 B;  4K13 A;  4ILX A;  4YGJ A;  1CIN A;  1FQM A;  1RJ6 A;  4XZ5 A;  4Q9Y A;  5DSN A;  3OYQ A;  4FU5 A;  3UYQ A;  1RZB A;  1TB0 X;  3N3J A;  3RLD A;  4KP5 A;  5JES B;  1UGB A;  3KON A;  3T5U A;  4RUZ A;  2HL4 A;  1IF4 A;  3KOI A;  3OIL A;  3MNK A;  1OKL A;  3N2P A;  5EKH A;  1ZGF A;  2CAB A;  3MWO A;  1CNW A;  4HEW A;  4Q0L A;  4R5B A;  3M5T A;  4KUW A;  1Z9Y A;  4YXO A;  4Q81 A;  1BNM A;  3V3H B;  1I8Z A;  4JSZ A;  4YGK A;  1CNK A;  1A42 A;  1BNW A;  4MDM A;  3KKX A;  4Q7P A;  4DZ9 A;  4KUY A;  1JCZ A;  3M04 A;  1Z93 A;  3NB5 A;  1V9I C;  1CVH A;  3OKU A;  1ZGE A;  3N4B A;  2H4N A;  1HUG A;  4Q09 A;  1G52 A;  2QP6 A;  1FR7 A;  1YDA A;  3HLJ A;  5JGT B;  1TTM A;  1G54 A;  4ZWI A;  3M1K A;  1FSQ A;  3QYK A;  1CAM A;  7CA2 A;  4JS6 A;  3TVO X;  3MNH A;  3M3X A;  3P4V A;  4QSB A;  3S9T A;  1G4J A;  1HCB A;  5E2R A;  4HT0 A;  1CVA A;  5CAC A;  1CAO A;  4QJX A;  1KWR A;  3M2N A;  1BN4 A;  4HEZ A;  4E49 A;  9CA2 A;  1I9Q A;  5JG5 B;  4PQ7 A;  3EFT A;  2NXS A;  2ILI A;  3OKV A;  3P55 A;  1CNX A;  3M5E A;  1LZV A;  2FW4 A;  5EH8 A;  2WEG A;  3M2Y A;  5BRV A;  3RYJ B;  2NNV A;  3M2X A;  3MNA A;  5EHV A;  1FSN A;  1RZC A;  3IGP A;  3P3H A;  1YDC A;  4QK2 A;  2CBD A;  5SZ1 A;  1G1D A;  3BET A;  2HKK A;  1CRM A;  3MNJ A;  4MDL A;  5FNH A;  3RYZ A;  1ZSA A;  3S75 B;  3JXF A;  3MDZ A;  1YO1 A;  1FSR A;  3LXE A;  4QJM A;  5DSM A;  5JG3 B;  3V3I B;  4Z0Q A;  5L6K A;  2Q38 A;  1CAZ A;  3ZP9 A;  3M2Z A;  4YX4 A;  4KP8 A;  2FMZ A;  3RYX B;  3RYV B;  1HUH A;  4Q06 A;  5DSJ A;  3VBD A;  4CAC A;  4Z1E A;  1ZH9 A;  3S8X A;  1CAL A;  3ML2 A;  1CNB A;  4HF3 A;  1CA3 A;  3HKQ A;  5JGS B;  2FMG A;  5FNK A;  3BL1 A;  4JSS A;  1CCT A;  2NWP A;  4ITP A;  5E28 A;  1UGC A;  5JEG B;  3DCW A;  1CVB A;  5LMD A;  3JXH C;  1AM6 A;  3PJJ A;  4KUV A;  2HNC A;  5FLS A;  4K0T A;  1CZM A;  1Y7W A;  3D92 A;  3NI5 A;  5AML A;  4YXU A;  3RG3 A;  1G3Z A;  2FOQ A;  4KNJ A;  3CA2 A;  1CVF A;  1UGE A;  2POV A;  2GD8 A;  5DVX A;  1JV0 A;  3MNI A;  4K0Z A;  5FNI A;  1YO0 A;  3GZ0 A;  3SAX A;  5SZ5 A;  4K1Q A;  4E3D A;  3D93 A;  4ZWZ A;  2O4Z A;  1KWQ A;  5SZ3 A;  3DAZ A;  2EU2 A;  5DRS A;  4Q6D A;  5BNL A;  3P44 A;  5G03 A;  3TMJ A;  5DSR A;  4WUQ A;  1URT A;  4ZAO A;  4XIW A;  3T82 A;  4RH2 A;  1CNC A;  4WL4 A;  4Z1K A;  2CBB A;  3V2J A;  4C3T A;  5FNM A;  5EH5 A;  3T84 A;  3CAJ A;  4Q87 A;  1CRA A;  4UOV A;  1ZE8 A;  4Y0J A;  3RYY A;  3DCS A;  4FRC A;  1J9W A;  4RIV A;  1UGG A;  1V9E A;  4Q8Y A;  5DSK A;  3IAI A;  3HS4 A;  5FNL A;  1BNN A;  4M2R A;  1ZSB A;  1FQL A;  4YHA A;  5G0B A;  1KOP A;  2CBA A;  4KV0 A;  2AX2 A;  1ZFQ A;  1XPZ A;  5SZ7 A;  3T83 A;  5HPJ A;  3R16 A;  4RFC A;  2ABE A;  1HEA A;  4YGL A;  4L5U A;  5FNG A;  3RGE A;  3RG4 A;  1CAK A;  1CIM A;  3M1W A;  1UGD A;  1HED A;  4TWL A;  1IF5 A;  3M1Q A;  4Q8X A;  2NWO A;  5EHE A;  5DSO A;  4Z1N A;  4MLX A;  4FVO A;  3D8W A;  2X7S A;  5EIJ A;  3DD8 A;  3RZ0 B;  3S74 B;  1I9O A;  2OSM A;  1CAI A;  3V2M A;  1G6V A;  4MLT A;  1XQ0 A;  1IF8 A;  4PZH A;  3RZ8 A;  5E2S A;  4RUY A;  4WUP A;  3OIM A;  2VVB X;  3DV7 A;  3HFP A;  3M67 A;  3U47 A;  4WW6 A;  3BL0 A;  1LUG A;  1XEV A;  1LG6 A;  3SBI A;  5FL4 A;  2HD6 A;  4M2V A;  4QIY A;  1BV3 A;  5BRU A;  1MOO A;  2GEH A;  1AZM A;  1HVA A;  3HKU A;  5SZ0 A;  1ZFK A;  3IBI A;  1G48 A;  4MO8 A;  4CQ0 A;  1BNU A;  5JEP B;  1G53 A;  3T85 A;  1YDD A;  5CJF A;  5DOG A;  4R59 A;  2IT4 A;  1FR4 A;  1CA2 A;  3IBU A;  4TWM A;  5BYI A;  3EFI A;  1I9L A;  2NXR A;  3KWA A;  3D0N A;  2W2J A;  1IF6 A;  3M1J A;  1CVD A;  4HEY A;  4Q08 A;  2CBE A;  5EZT X;  3U45 X;  1CAN A;  3K34 A;  5EHW A;  1FLJ A;  3L14 A;  3Q31 A;  3W6I A;  3IEO A;  5EH7 A;  2NWZ A;  5CA2 A;  1CNJ A;  4E3G A;  1G45 A;  5FDI A;  3DVC A;  3KLD B;  2FOS A;  1RZE A;  3RZ7 A;  1OKM A;  2H15 A;  1FQR A;  4YYT A; 
#chains in the Genus database with same CATH topology
 2Q1Q A;  5BRW A;  4QSI A;  3RJ7 A;  3DCC A;  4KNN A;  1JD0 A;  1IF9 A;  1H9N A;  5FLO A;  2EU3 A;  3N0N A;  5JDV B;  4FPT A;  2FOV A;  3IBN A;  4QK3 A;  3ZNC A;  1HCA A;  1BNV A;  3TVN X;  4E3F A;  5CLU A;  12CA A;  5SZ6 A;  2HFW A;  3CZV A;  1H9Q A;  4ETQ C;  5FL6 A;  3HKT A;  2NNG A;  4MTY A;  2NNO A;  4WW8 A;  3T5Z A;  4RFD A;  3DBU A;  4Q07 A;  4CNX A;  3JXG A;  3M98 A;  4HU1 A;  4Q7V A;  2WEO A;  4E3H A;  5FL5 A;  2WD3 A;  1BNQ A;  4RIU A;  5JQ0 A;  2NMX A;  3MHI A;  3MMF A;  3RZ1 B;  3P3J A;  4WR7 A;  1G46 A;  2NXT A;  5C8I A;  4FL7 A;  4ITO A;  1FQN A;  5A6H A;  3PYK A;  5DSQ A;  2NWY A;  5SZ2 A;  3MHC A;  4Q90 A;  1T9N A;  4L5V A;  5A25 A;  4XFW A;  5J8Z A;  5DOH A;  4QEF A;  3DC9 A;  4PYY A;  1I9M A;  2AW1 A;  2NNS A;  1UGA A;  1CCS A;  4PYX A;  3K2F A;  4ZX1 A;  1RAZ A;  4IWZ A;  4Q6E A;  1I9P A;  4RUX A;  2FNN A;  4HBA A;  1IF7 A;  3SBH A;  1ZSC A;  1KOQ A;  3D9Z A;  4QSJ A;  5E2N A;  4E9O X;  5SZ4 A;  1KEQ A;  3IBL A;  3R17 B;  4HT2 A;  3MHL A;  4YXI A;  4JSA A;  4COQ A;  1BCD A;  3U7C A;  3S77 B;  4ZX0 A;  2HOC A;  1CCU A;  4YGF A;  4GL1 X;  4LHI A;  4Q99 A;  3P58 A;  3F7B A;  4YGN A;  3OYS A;  1ZNC A;  2QO8 A;  3RZ5 A;  2WD2 A;  4M2W A;  4PXX A;  3F4X A;  4LU3 A;  2Q1B A;  4E4A A;  2POW A;  2VVA X;  5E2K A;  4L5W A;  4CA2 A;  3MHO A;  3S73 B;  3S76 A;  3F8E A;  4ZWX A;  4KNI A;  4K0S A;  2POU A;  5FLP A;  3M96 A;  3DC3 A;  4Q7W A;  1BIC A;  1AVN A;  2FNM A;  3MZC A;  4Q7S A;  4BF6 A;  2X7T A;  3UYN A;  1RJ5 A;  5JQT A;  4YVY A;  1XEG A;  1LG5 A;  5AMD A;  3B1B A;  3FE4 A;  4N16 A;  2WEJ A;  3F7U A;  1RAY A;  1RZD A;  1CAH A;  5IPZ A;  4DZ7 A;  3S72 B;  2OSF A;  3M40 A;  4IDR X;  5DSL A;  1DMX A;  1I91 A;  2QOA A;  5JEH B;  1TBT X;  2NN7 A;  4FIK A;  1H4N A;  4CNR A;  1YDB A;  3ML5 A;  1DCB A;  3P5A A;  4Q83 A;  4R5A A;  5G0C A;  5DSP A;  4QY3 A;  2EZ7 A;  3MHM A;  1I90 A;  5EKJ A;  1EOU A;  2F14 A;  1CAJ A;  1RZA A;  2NN1 A;  4Z1J A;  4QJP A;  1TEU X;  1BZM A;  3V3J A;  5E5R A;  4G0C A;  4QK1 A;  1OKN A;  4N0X B;  8CA2 A;  4QSA A;  4KAP A;  1CIL A;  1OQ5 A;  1F2W A;  1I9N A;  1TEQ X;  4X5S A;  1DMY A;  4BCW A;  3DVD A;  5EOI A;  1DCA A;  3M5S A;  3NJ9 A;  1TG3 A;  1HEC A;  1TH9 A;  4YWP A;  5DSI A;  6CA2 A;  3CYU A;  1BNT A;  4MDG A;  4CNV A;  3P5L A;  1G0F A;  4G7A A;  3S78 B;  1CVC A;  1BN3 A;  3OIK A;  5E2M A;  5FNJ A;  2CBC A;  1TG9 A;  1LGD A;  3DVB A;  4XE1 A;  4M2U A;  1CAY A;  5FDC A;  2ZNC A;  4RN4 A;  4KNM A;  1G0E A;  4QJW A;  3FW3 A;  4QJO A;  3KOK A;  3MYQ A;  3OY0 A;  2FNK A;  1UGF A;  1HEB A;  1G4O A;  3B4F A;  4ZWY A;  1Z97 A;  4Q8Z A;  1CNY A;  1THK A;  4E5Q A;  3C7P A;  5FLR A;  5EKM A;  1CNH A;  4CNW A;  3HKN A;  1MUA A;  5FLQ A;  3MNU A;  3U3A X;  3KNE A;  3V3F A;  4BF1 A;  1CVE A;  3V3G B;  3W6H A;  4Q49 A;  1CNI A;  4QTL A;  4JSW A;  2X7U A;  3PO6 A;  4QIZ A;  2FOU A;  2WEH A;  3KIG A;  3V5G A;  4LP6 A;  5FLT A;  1TE3 X;  3DD0 A;  3V7X A;  5AMG A;  3SAP A;  2FOY A;  4Q78 A;  4QJ0 A;  3FFP X;  3K7K A;  2CA2 A;  1CNG A;  5E5U A;  1BN1 A;  3DA2 A;  5G01 A;  5L3O A;  3M14 A;  3KS3 A;  4FVN A;  1YO2 A;  4XIX A;  3S97 A;  3S71 B;  4K13 A;  4ILX A;  4YGJ A;  1CIN A;  1FQM A;  1RJ6 A;  4XZ5 A;  4Q9Y A;  5DSN A;  3OYQ A;  4FU5 A;  3UYQ A;  1RZB A;  1TB0 X;  3N3J A;  3RLD A;  4KP5 A;  5JES B;  1UGB A;  3KON A;  3T5U A;  4RUZ A;  2HL4 A;  1IF4 A;  3KOI A;  3OIL A;  3MNK A;  1OKL A;  3N2P A;  5EKH A;  1ZGF A;  2CAB A;  3MWO A;  1CNW A;  4HEW A;  4Q0L A;  4R5B A;  3M5T A;  4KUW A;  1Z9Y A;  4YXO A;  4Q81 A;  1BNM A;  3V3H B;  1I8Z A;  4JSZ A;  4YGK A;  1CNK A;  1A42 A;  1BNW A;  4MDM A;  3KKX A;  4Q7P A;  4DZ9 A;  4KUY A;  1JCZ A;  3M04 A;  1Z93 A;  3NB5 A;  1V9I C;  1CVH A;  3OKU A;  1ZGE A;  3N4B A;  2H4N A;  1HUG A;  4Q09 A;  1G52 A;  2QP6 A;  1FR7 A;  1YDA A;  3HLJ A;  5JGT B;  1TTM A;  1G54 A;  4ZWI A;  3M1K A;  1FSQ A;  3QYK A;  1CAM A;  7CA2 A;  4JS6 A;  3TVO X;  3MNH A;  3M3X A;  3P4V A;  4QSB A;  3S9T A;  1G4J A;  1HCB A;  5E2R A;  4HT0 A;  1CVA A;  5CAC A;  1CAO A;  4QJX A;  1KWR A;  3M2N A;  1BN4 A;  4HEZ A;  4E49 A;  9CA2 A;  1I9Q A;  5JG5 B;  4PQ7 A;  3EFT A;  2NXS A;  2ILI A;  3OKV A;  3P55 A;  1CNX A;  3M5E A;  1LZV A;  2FW4 A;  5EH8 A;  2WEG A;  3M2Y A;  5BRV A;  3RYJ B;  2NNV A;  3M2X A;  3MNA A;  5EHV A;  1FSN A;  1RZC A;  3IGP A;  3P3H A;  1YDC A;  4QK2 A;  2CBD A;  5SZ1 A;  1G1D A;  3BET A;  2HKK A;  1CRM A;  3MNJ A;  4MDL A;  5FNH A;  3RYZ A;  1ZSA A;  3S75 B;  3JXF A;  3MDZ A;  1YO1 A;  1FSR A;  3LXE A;  4QJM A;  5DSM A;  5JG3 B;  3V3I B;  4Z0Q A;  5L6K A;  2Q38 A;  1CAZ A;  3ZP9 A;  3M2Z A;  4YX4 A;  4KP8 A;  2FMZ A;  3RYX B;  3RYV B;  1HUH A;  4Q06 A;  5DSJ A;  3VBD A;  4CAC A;  4Z1E A;  1ZH9 A;  3S8X A;  1CAL A;  3ML2 A;  1CNB A;  4HF3 A;  1CA3 A;  3HKQ A;  5JGS B;  2FMG A;  5FNK A;  3BL1 A;  4JSS A;  1CCT A;  2NWP A;  4ITP A;  5E28 A;  1UGC A;  5JEG B;  3DCW A;  1CVB A;  5LMD A;  3JXH C;  1AM6 A;  3PJJ A;  4KUV A;  2HNC A;  5FLS A;  4K0T A;  1CZM A;  1Y7W A;  3D92 A;  3NI5 A;  5AML A;  4YXU A;  3RG3 A;  1G3Z A;  2FOQ A;  4KNJ A;  3CA2 A;  1CVF A;  1UGE A;  2POV A;  2GD8 A;  5DVX A;  1JV0 A;  3MNI A;  4K0Z A;  5FNI A;  1YO0 A;  3GZ0 A;  3SAX A;  5SZ5 A;  4K1Q A;  4E3D A;  3D93 A;  4ZWZ A;  2O4Z A;  1KWQ A;  5SZ3 A;  3DAZ A;  2EU2 A;  5DRS A;  4Q6D A;  5BNL A;  3P44 A;  5G03 A;  3TMJ A;  5DSR A;  4WUQ A;  1URT A;  4ZAO A;  4XIW A;  3T82 A;  4RH2 A;  1CNC A;  4WL4 A;  4Z1K A;  2CBB A;  3V2J A;  4C3T A;  5FNM A;  5EH5 A;  3T84 A;  3CAJ A;  4Q87 A;  1CRA A;  4UOV A;  1ZE8 A;  4Y0J A;  3RYY A;  3DCS A;  4FRC A;  1J9W A;  4RIV A;  1UGG A;  1V9E A;  4Q8Y A;  5DSK A;  3IAI A;  3HS4 A;  5FNL A;  1BNN A;  4M2R A;  1ZSB A;  1FQL A;  4YHA A;  5G0B A;  1KOP A;  2CBA A;  4KV0 A;  2AX2 A;  1ZFQ A;  1XPZ A;  5SZ7 A;  3T83 A;  5HPJ A;  3R16 A;  4RFC A;  2ABE A;  1HEA A;  4YGL A;  4L5U A;  5FNG A;  3RGE A;  3RG4 A;  1CAK A;  1CIM A;  3M1W A;  1UGD A;  1HED A;  4TWL A;  1IF5 A;  3M1Q A;  4Q8X A;  2NWO A;  5EHE A;  5DSO A;  4Z1N A;  4MLX A;  4FVO A;  3D8W A;  2X7S A;  5EIJ A;  3DD8 A;  3RZ0 B;  3S74 B;  1I9O A;  2OSM A;  1CAI A;  3V2M A;  1G6V A;  4MLT A;  1XQ0 A;  1IF8 A;  4PZH A;  3RZ8 A;  5E2S A;  4RUY A;  4WUP A;  3OIM A;  2VVB X;  3DV7 A;  3HFP A;  3M67 A;  3U47 A;  4WW6 A;  3BL0 A;  1LUG A;  1XEV A;  1LG6 A;  3SBI A;  5FL4 A;  2HD6 A;  4M2V A;  4QIY A;  1BV3 A;  5BRU A;  1MOO A;  2GEH A;  1AZM A;  1HVA A;  3HKU A;  5SZ0 A;  1ZFK A;  3IBI A;  1G48 A;  4MO8 A;  4CQ0 A;  1BNU A;  5JEP B;  1G53 A;  3T85 A;  1YDD A;  5CJF A;  5DOG A;  4R59 A;  2IT4 A;  1FR4 A;  1CA2 A;  3IBU A;  4TWM A;  5BYI A;  3EFI A;  1I9L A;  2NXR A;  3KWA A;  3D0N A;  2W2J A;  1IF6 A;  3M1J A;  1CVD A;  4HEY A;  4Q08 A;  2CBE A;  5EZT X;  3U45 X;  1CAN A;  3K34 A;  5EHW A;  1FLJ A;  3L14 A;  3Q31 A;  3W6I A;  3IEO A;  5EH7 A;  2NWZ A;  5CA2 A;  1CNJ A;  4E3G A;  1G45 A;  5FDI A;  3DVC A;  3KLD B;  2FOS A;  1RZE A;  3RZ7 A;  1OKM A;  2H15 A;  1FQR A;  4YYT A; 
#chains in the Genus database with same CATH homology
 2Q1Q A;  5BRW A;  4QSI A;  3RJ7 A;  3DCC A;  4KNN A;  1JD0 A;  1IF9 A;  1H9N A;  5FLO A;  2EU3 A;  3N0N A;  5JDV B;  4FPT A;  2FOV A;  3IBN A;  4QK3 A;  3ZNC A;  1HCA A;  1BNV A;  3TVN X;  4E3F A;  5CLU A;  12CA A;  5SZ6 A;  2HFW A;  3CZV A;  1H9Q A;  4ETQ C;  5FL6 A;  3HKT A;  2NNG A;  4MTY A;  2NNO A;  4WW8 A;  3T5Z A;  4RFD A;  3DBU A;  4Q07 A;  4CNX A;  3JXG A;  3M98 A;  4HU1 A;  4Q7V A;  2WEO A;  4E3H A;  5FL5 A;  2WD3 A;  1BNQ A;  4RIU A;  5JQ0 A;  2NMX A;  3MHI A;  3MMF A;  3RZ1 B;  3P3J A;  4WR7 A;  1G46 A;  2NXT A;  5C8I A;  4FL7 A;  4ITO A;  1FQN A;  5A6H A;  3PYK A;  5DSQ A;  2NWY A;  5SZ2 A;  3MHC A;  4Q90 A;  1T9N A;  4L5V A;  5A25 A;  4XFW A;  5J8Z A;  5DOH A;  4QEF A;  3DC9 A;  4PYY A;  1I9M A;  2AW1 A;  2NNS A;  1UGA A;  1CCS A;  4PYX A;  3K2F A;  4ZX1 A;  1RAZ A;  4IWZ A;  4Q6E A;  1I9P A;  4RUX A;  2FNN A;  4HBA A;  1IF7 A;  3SBH A;  1ZSC A;  1KOQ A;  3D9Z A;  4QSJ A;  5E2N A;  4E9O X;  5SZ4 A;  1KEQ A;  3IBL A;  3R17 B;  4HT2 A;  3MHL A;  4YXI A;  4JSA A;  4COQ A;  1BCD A;  3U7C A;  3S77 B;  4ZX0 A;  2HOC A;  1CCU A;  4YGF A;  4GL1 X;  4LHI A;  4Q99 A;  3P58 A;  3F7B A;  4YGN A;  3OYS A;  1ZNC A;  2QO8 A;  3RZ5 A;  2WD2 A;  4M2W A;  4PXX A;  3F4X A;  4LU3 A;  2Q1B A;  4E4A A;  2POW A;  2VVA X;  5E2K A;  4L5W A;  4CA2 A;  3MHO A;  3S73 B;  3S76 A;  3F8E A;  4ZWX A;  4KNI A;  4K0S A;  2POU A;  5FLP A;  3M96 A;  3DC3 A;  4Q7W A;  1BIC A;  1AVN A;  2FNM A;  3MZC A;  4Q7S A;  4BF6 A;  2X7T A;  3UYN A;  1RJ5 A;  5JQT A;  4YVY A;  1XEG A;  1LG5 A;  5AMD A;  3B1B A;  3FE4 A;  4N16 A;  2WEJ A;  3F7U A;  1RAY A;  1RZD A;  1CAH A;  5IPZ A;  4DZ7 A;  3S72 B;  2OSF A;  3M40 A;  4IDR X;  5DSL A;  1DMX A;  1I91 A;  2QOA A;  5JEH B;  1TBT X;  2NN7 A;  4FIK A;  1H4N A;  4CNR A;  1YDB A;  3ML5 A;  1DCB A;  3P5A A;  4Q83 A;  4R5A A;  5G0C A;  5DSP A;  4QY3 A;  2EZ7 A;  3MHM A;  1I90 A;  5EKJ A;  1EOU A;  2F14 A;  1CAJ A;  1RZA A;  2NN1 A;  4Z1J A;  4QJP A;  1TEU X;  1BZM A;  3V3J A;  5E5R A;  4G0C A;  4QK1 A;  1OKN A;  4N0X B;  8CA2 A;  4QSA A;  4KAP A;  1CIL A;  1OQ5 A;  1F2W A;  1I9N A;  1TEQ X;  4X5S A;  1DMY A;  4BCW A;  3DVD A;  5EOI A;  1DCA A;  3M5S A;  3NJ9 A;  1TG3 A;  1HEC A;  1TH9 A;  4YWP A;  5DSI A;  6CA2 A;  3CYU A;  1BNT A;  4MDG A;  4CNV A;  3P5L A;  1G0F A;  4G7A A;  3S78 B;  1CVC A;  1BN3 A;  3OIK A;  5E2M A;  5FNJ A;  2CBC A;  1TG9 A;  1LGD A;  3DVB A;  4XE1 A;  4M2U A;  1CAY A;  5FDC A;  2ZNC A;  4RN4 A;  4KNM A;  1G0E A;  4QJW A;  3FW3 A;  4QJO A;  3KOK A;  3MYQ A;  3OY0 A;  2FNK A;  1UGF A;  1HEB A;  1G4O A;  3B4F A;  4ZWY A;  1Z97 A;  4Q8Z A;  1CNY A;  1THK A;  4E5Q A;  3C7P A;  5FLR A;  5EKM A;  1CNH A;  4CNW A;  3HKN A;  1MUA A;  5FLQ A;  3MNU A;  3U3A X;  3KNE A;  3V3F A;  4BF1 A;  1CVE A;  3V3G B;  3W6H A;  4Q49 A;  1CNI A;  4QTL A;  4JSW A;  2X7U A;  3PO6 A;  4QIZ A;  2FOU A;  2WEH A;  3KIG A;  3V5G A;  4LP6 A;  5FLT A;  1TE3 X;  3DD0 A;  3V7X A;  5AMG A;  3SAP A;  2FOY A;  4Q78 A;  4QJ0 A;  3FFP X;  3K7K A;  2CA2 A;  1CNG A;  5E5U A;  1BN1 A;  3DA2 A;  5G01 A;  5L3O A;  3M14 A;  3KS3 A;  4FVN A;  1YO2 A;  4XIX A;  3S97 A;  3S71 B;  4K13 A;  4ILX A;  4YGJ A;  1CIN A;  1FQM A;  1RJ6 A;  4XZ5 A;  4Q9Y A;  5DSN A;  3OYQ A;  4FU5 A;  3UYQ A;  1RZB A;  1TB0 X;  3N3J A;  3RLD A;  4KP5 A;  5JES B;  1UGB A;  3KON A;  3T5U A;  4RUZ A;  2HL4 A;  1IF4 A;  3KOI A;  3OIL A;  3MNK A;  1OKL A;  3N2P A;  5EKH A;  1ZGF A;  2CAB A;  3MWO A;  1CNW A;  4HEW A;  4Q0L A;  4R5B A;  3M5T A;  4KUW A;  1Z9Y A;  4YXO A;  4Q81 A;  1BNM A;  3V3H B;  1I8Z A;  4JSZ A;  4YGK A;  1CNK A;  1A42 A;  1BNW A;  4MDM A;  3KKX A;  4Q7P A;  4DZ9 A;  4KUY A;  1JCZ A;  3M04 A;  1Z93 A;  3NB5 A;  1V9I C;  1CVH A;  3OKU A;  1ZGE A;  3N4B A;  2H4N A;  1HUG A;  4Q09 A;  1G52 A;  2QP6 A;  1FR7 A;  1YDA A;  3HLJ A;  5JGT B;  1TTM A;  1G54 A;  4ZWI A;  3M1K A;  1FSQ A;  3QYK A;  1CAM A;  7CA2 A;  4JS6 A;  3TVO X;  3MNH A;  3M3X A;  3P4V A;  4QSB A;  3S9T A;  1G4J A;  1HCB A;  5E2R A;  4HT0 A;  1CVA A;  5CAC A;  1CAO A;  4QJX A;  1KWR A;  3M2N A;  1BN4 A;  4HEZ A;  4E49 A;  9CA2 A;  1I9Q A;  5JG5 B;  4PQ7 A;  3EFT A;  2NXS A;  2ILI A;  3OKV A;  3P55 A;  1CNX A;  3M5E A;  1LZV A;  2FW4 A;  5EH8 A;  2WEG A;  3M2Y A;  5BRV A;  3RYJ B;  2NNV A;  3M2X A;  3MNA A;  5EHV A;  1FSN A;  1RZC A;  3IGP A;  3P3H A;  1YDC A;  4QK2 A;  2CBD A;  5SZ1 A;  1G1D A;  3BET A;  2HKK A;  1CRM A;  3MNJ A;  4MDL A;  5FNH A;  3RYZ A;  1ZSA A;  3S75 B;  3JXF A;  3MDZ A;  1YO1 A;  1FSR A;  3LXE A;  4QJM A;  5DSM A;  5JG3 B;  3V3I B;  4Z0Q A;  5L6K A;  2Q38 A;  1CAZ A;  3ZP9 A;  3M2Z A;  4YX4 A;  4KP8 A;  2FMZ A;  3RYX B;  3RYV B;  1HUH A;  4Q06 A;  5DSJ A;  3VBD A;  4CAC A;  4Z1E A;  1ZH9 A;  3S8X A;  1CAL A;  3ML2 A;  1CNB A;  4HF3 A;  1CA3 A;  3HKQ A;  5JGS B;  2FMG A;  5FNK A;  3BL1 A;  4JSS A;  1CCT A;  2NWP A;  4ITP A;  5E28 A;  1UGC A;  5JEG B;  3DCW A;  1CVB A;  5LMD A;  3JXH C;  1AM6 A;  3PJJ A;  4KUV A;  2HNC A;  5FLS A;  4K0T A;  1CZM A;  1Y7W A;  3D92 A;  3NI5 A;  5AML A;  4YXU A;  3RG3 A;  1G3Z A;  2FOQ A;  4KNJ A;  3CA2 A;  1CVF A;  1UGE A;  2POV A;  2GD8 A;  5DVX A;  1JV0 A;  3MNI A;  4K0Z A;  5FNI A;  1YO0 A;  3GZ0 A;  3SAX A;  5SZ5 A;  4K1Q A;  4E3D A;  3D93 A;  4ZWZ A;  2O4Z A;  1KWQ A;  5SZ3 A;  3DAZ A;  2EU2 A;  5DRS A;  4Q6D A;  5BNL A;  3P44 A;  5G03 A;  3TMJ A;  5DSR A;  4WUQ A;  1URT A;  4ZAO A;  4XIW A;  3T82 A;  4RH2 A;  1CNC A;  4WL4 A;  4Z1K A;  2CBB A;  3V2J A;  4C3T A;  5FNM A;  5EH5 A;  3T84 A;  3CAJ A;  4Q87 A;  1CRA A;  4UOV A;  1ZE8 A;  4Y0J A;  3RYY A;  3DCS A;  4FRC A;  1J9W A;  4RIV A;  1UGG A;  1V9E A;  4Q8Y A;  5DSK A;  3IAI A;  3HS4 A;  5FNL A;  1BNN A;  4M2R A;  1ZSB A;  1FQL A;  4YHA A;  5G0B A;  1KOP A;  2CBA A;  4KV0 A;  2AX2 A;  1ZFQ A;  1XPZ A;  5SZ7 A;  3T83 A;  5HPJ A;  3R16 A;  4RFC A;  2ABE A;  1HEA A;  4YGL A;  4L5U A;  5FNG A;  3RGE A;  3RG4 A;  1CAK A;  1CIM A;  3M1W A;  1UGD A;  1HED A;  4TWL A;  1IF5 A;  3M1Q A;  4Q8X A;  2NWO A;  5EHE A;  5DSO A;  4Z1N A;  4MLX A;  4FVO A;  3D8W A;  2X7S A;  5EIJ A;  3DD8 A;  3RZ0 B;  3S74 B;  1I9O A;  2OSM A;  1CAI A;  3V2M A;  1G6V A;  4MLT A;  1XQ0 A;  1IF8 A;  4PZH A;  3RZ8 A;  5E2S A;  4RUY A;  4WUP A;  3OIM A;  2VVB X;  3DV7 A;  3HFP A;  3M67 A;  3U47 A;  4WW6 A;  3BL0 A;  1LUG A;  1XEV A;  1LG6 A;  3SBI A;  5FL4 A;  2HD6 A;  4M2V A;  4QIY A;  1BV3 A;  5BRU A;  1MOO A;  2GEH A;  1AZM A;  1HVA A;  3HKU A;  5SZ0 A;  1ZFK A;  3IBI A;  1G48 A;  4MO8 A;  4CQ0 A;  1BNU A;  5JEP B;  1G53 A;  3T85 A;  1YDD A;  5CJF A;  5DOG A;  4R59 A;  2IT4 A;  1FR4 A;  1CA2 A;  3IBU A;  4TWM A;  5BYI A;  3EFI A;  1I9L A;  2NXR A;  3KWA A;  3D0N A;  2W2J A;  1IF6 A;  3M1J A;  1CVD A;  4HEY A;  4Q08 A;  2CBE A;  5EZT X;  3U45 X;  1CAN A;  3K34 A;  5EHW A;  1FLJ A;  3L14 A;  3Q31 A;  3W6I A;  3IEO A;  5EH7 A;  2NWZ A;  5CA2 A;  1CNJ A;  4E3G A;  1G45 A;  5FDI A;  3DVC A;  3KLD B;  2FOS A;  1RZE A;  3RZ7 A;  1OKM A;  2H15 A;  1FQR A;  4YYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...