3MNIA

Human carbonic anhydrase ii mutant k170d
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
Knots found
sequence length
258
structure length
258
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTDGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proton transport
molecule keywords Carbonic anhydrase 2
publication title Structural and kinetic study of the extended active site for proton transfer in human carbonic anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 258
sequence length 258
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 3mniA00
3Q31A 4MDGA 3D9ZA 2FMGA 2FOYA 4R5AA 3RZ7A 3DAZA 1RJ6A 1BN4A 4PZHA 1G4OA 3ML5A 5CA2A 4FL7A 3KKXA 1DCAA 1RAZA 5AMLA 4YXIA 4BF6A 3M04A 1CAMA 5FNKA 4ZWYA 4FVOA 3M1JA 4G7AA 4Q08A 3W6IA 4Q90A 1CNYA 4R59A 2EZ7A 5AMGA 3IBLA 4Q6DA 1IF7A 2FNNA 4M2WA 5BRUA 2NNVA 4LP6A 12CAA 4TWMA 1G48A 5C8IA 1LG6A 3PYKA 3HFPA 1CVBA 3RZ1B 3HKUA 1CCSA 4TWLA 3BETA 2QO8A 1BNTA 4M2UA 3V3JA 5SZ6A 3M40A 4ILXA 4YGKA 4JSZA 2NXRA 3CZVA 2Q38A 3TMJA 4YGJA 4ZWIA 1CNKA 3K2FA 4FRCA 1TH9A 5FNHA 5SZ4A 2CA2A 5EH5A 3HS4A 1IF6A 1F2WA 1YO1A 4UOVA 4CACA 3S8XA 3JXFA 2OSMA 1CALA 3TVOX 1Z9YA 4KP5A 4XZ5A 3MHMA 1RZAA 4CNVA 4X5SA 3MZCA 2WEGA 1CNWA 2VVBX 1BICA 1CAOA 4QSIA 1RZCA 1HEAA 4YX4A 1BN3A 1FLJA 2F14A 1I9MA 1CAIA 3IGPA 3D93A 4DZ9A 4ITPA 2GEHA 4KUWA 4QIZA 3KOIA 3F8EA 3DC3A 4QJOA 5E2KA 4RN4A 1RZBA 4IWZA 1BNNA 1KOQA 5DSJA 5DSQA 5EKMA 3V3GB 1BNWA 3V7XA 4JSAA 3RJ7A 4E3HA 1BNUA 1BCDA 3OY0A 2HD6A 1UGFA 5FLOA 1OQ5A 3P44A 4MLXA 1I90A 5JESB 3P5LA 2CBAA 3HKNA 5JEHB 3DV7A 1AM6A 5E5RA 2NXSA 3SAPA 5EH7A 1HEBA 5G0BA 4K1QA 5DSIA 1TTMA 4HBAA 2NWOA 1CIMA 4JSSA 1AZMA 3IBNA 1CNJA 1XPZA 3U47A 5BRWA 4ETQC 3N3JA 1CVCA 5FLPA 5E2MA 4L5WA 2FNMA 3OKVA 5CLUA 4E3GA 1FSNA 2NNOA 3V3IB 4K0TA 8CA2A 3JXHC 2NNGA 5DSOA 5J8ZA 5L6KA 3MHCA 1KWRA 1CAYA 4ITOA 1THKA 4KNJA 1G1DA 5JG5B 4LU3A 2NMXA 4HEZA 4RFCA 4RFDA 4CA2A 3P3JA 3KIGA 2X7TA 2VVAX 3EFTA 1YDAA 3CA2A 3MHLA 5BYIA 3HKQA 4Q09A 1ZFKA 3M1KA 3RG4A 1I9PA 5EZTX 3U3AX 5DOHA 1TEQX 1HVAA 1BNMA 1DMYA 1ZFQA 5FNJA 3V3HB 3QYKA 1HECA 3MYQA 1LGDA 4RH2A 3CYUA 4JSWA 3DC9A 1FR7A 3B1BA 2EU3A 4N16A 1UGGA 3V5GA 3IBIA 1TE3X 2NWPA 3M1QA 4FU5A 5DSLA 4WR7A 1DCBA 2H4NA 3W6HA 5DSNA 2FOSA 3BL0A 2AX2A 3RZ0B 3M96A 4KNMA 3RG3A 3S77B 2QP6A 4K0SA 2CBBA 4PYXA 3RZ5A 3ZP9A 1BV3A 5L3OA 4Z1NA 1G54A 4QIYA 4WW8A 5FNIA 2POVA 2WD3A 3L14A 1XQ0A 5DSKA 2FNKA 4KAPA 4G0CA 5FLTA 3MNHA 4YWPA 4WUQA 3OKUA 4FIKA 4PQ7A 4IDRX 4COQA 4ZX0A 3IAIA 4Q78A 3KWAA 3OYQA 4YVYA 5HPJA 3DD0A 1TG3A 3OYSA 3DBUA 4Q9YA 2X7UA 2POWA 1CAHA 2HL4A 4Q0LA 5CACA 3S76A 5E2SA 1CNHA 1CVDA 2FOUA 4HU1A 6CA2A 3LXEA 5DSRA 4E3DA 1RZDA 4QJXA 4C3TA 1HEDA 4Q6EA 1CAKA 1CINA 3JXGA 3N4BA 4KNIA 3DCSA 4E5QA 5FL5A 5G01A 3M5TA 5FDCA 4MTYA 1FQRA 1KOPA 5JDVB 3T85A 3DA2A 1BNQA 4WUPA 4Q7WA 1CNBA 1JV0A 4Z1JA 1LUGA 5JEGB 3M3XA 4Q87A 3FE4A 4M2VA 1TBTX 1CCUA 5DVXA 3D92A 4E49A 2CBCA 1T9NA 3S97A 3T82A 1LZVA 3R16A 2WEHA 3M5EA 2WEOA 3P58A 1XEGA 4ZWXA 1MOOA 1YDDA 1V9EA 4HF3A 2O4ZA 4YGFA 3V3FA 1CANA 3BL1A 3DVDA 5DSPA 1IF9A 2HFWA 4Z1KA 5JQ0A 4FVNA 4E9OX 3MNUA 1BN1A 3OIMA 4Z0QA 3RYVB 3DVBA 4Z1EA 1ZGEA 4Q7VA 1FR4A 3T83A 7CA2A 4BCWA 5FLSA 1CVAA 4KV0A 1MUAA 2H15A 3RYXB 1G53A 4Q06A 5BNLA 5EH8A 3NJ9A 5SZ1A 1ZNCA 5A6HA 4QTLA 1CNXA 3IBUA 1HUGA 1CA2A 5JQTA 2FW4A 1TEUX 4LHIA 5E28A 3MNJA 1Z97A 1FSQA 4FPTA 4XFWA 3P5AA 1H4NA 3T5ZA 3EFIA 3S73B 5SZ5A 4MDMA 4RUXA 3V2MA 4QJ0A 3F7UA 4E3FA 1RAYA 3N0NA 1ZGFA 5FL6A 1Y7WA 4CNXA 1FQLA 5BRVA 3KS3A 3M1WA 5EKJA 1CRMA 1RJ5A 4Y0JA 4YXUA 3S78B 5G0CA 4Q8ZA 4KUYA 1TB0X 3M2ZA 2Q1BA 3U45X 4YXOA 4Q99A 4QJWA 1ZSBA 3MNKA 1G0FA 1FSRA 1YDCA 1UGCA 2NN7A 4HT2A 3SAXA 3VBDA 1CVHA 1A42A 4JS6A 4HEYA 3DCWA 5E2NA 3RYZA 3S71B 1CNIA 3RZ8A 5SZ7A 3KLDB 5FL4A 1URTA 5JGSB 3TVNX 2CABA 2HOCA 4QEFA 3S9TA 1IF5A 2ZNCA 5LMDA 1BZMA 2NWZA 1HCAA 5EHWA 3KNEA 3S74B 3IEOA 5DOGA 3S75B 4ZAOA 1IF4A 3SBIA 1JD0A 4KNNA 4L5UA 2WD2A 5DRSA 5FLRA 4CNRA 2NNSA 1CVFA 1G45A 4ZWZA 3NB5A 5EHVA 4CQ0A 3UYQA 3HKTA 3RLDA 4RIVA 3MDZA 1I9OA 2IT4A 4HEWA 1CAZA 3M2NA 5SZ0A 1H9NA 1YO2A 3KOKA 1CRAA 1H9QA 2ILIA 4Q8YA 4MDLA 1ZSAA 3MHIA 3RGEA 1FQMA 3F7BA 1CNGA 4K13A 1TG9A 2AW1A 3N2PA 4QJMA 1Z93A 2QOAA 4R5BA 4WL4A 1HUHA 1V9IC 3M14A 5CJFA 4CNWA 1G52A 5EIJA 3T84A 3DCCA 5JGTB 1XEVA 1ZE8A 1CAJA 1HCBA 3M5SA 3MWOA 3GZ0A 3M98A 3DVCA 1BNVA 4N0XB 2FOVA 4M2RA 3M2YA 4BF1A 1OKLA 1IF8A 1UGDA 3P4VA 4GL1X 4K0ZA 4YGLA 1KWQA 1CA3A 4XIXA 3ZNCA 3MNIA 3PJJA 4XIWA 3D8WA 1CZMA 3K34A 1EOUA 4PXXA 5FNMA 4ZX1A 3S72B 3T5UA 2NN1A 1ZSCA 4MLTA 3UYNA 4DZ7A 1CNCA 1OKMA 3D0NA 3R17B 9CA2A 3OILA 4QSJA 3MHOA 4RIUA 4QK2A 1G4JA 1AVNA 4E4AA 4KUVA 4PYYA 3V2JA 3DD8A 1DMXA 5FLQA 2HNCA 2X7SA 4MO8A 4QY3A 3SBHA 1G46A 2FOQA 2NXTA 2CBEA 5AMDA 1G0EA 4KP8A 4YHAA 1I9QA 4WW6A 2Q1QA 1J9WA 3C7PA 3B4FA 1JCZA 2WEJA 4XE1A 2NWYA 3CAJA 3M2XA 1I91A 5DSMA 1UGEA 2FMZA 5JG3B 5EHEA 4Q8XA 1CCTA 3MNAA 3MMFA 4Q7SA 3PO6A 5A25A 4QSBA 1ZH9A 5FNGA 1I8ZA 1RZEA 4L5VA 1OKNA 4Q07A 4QK3A 4YGNA 4Q49A 4HT0A 1YO0A 5JEPB 1I9LA 1YDBA 1G3ZA 3RYYA 1CILA 3ML2A 3NI5A 1FQNA 3P55A 5E2RA 4QJPA 3OIKA 1I9NA 4QSAA 5E5UA 1UGBA 5G03A 1UGAA 2W2JA 5EOIA 1LG5A 2EU2A 2ABEA 3FFPX 3K7KA 4Q83A 5SZ2A 5IPZA 1CVEA 3KONA 4YYTA 3FW3A 2POUA 2HKKA 5FDIA 1G6VA 4RUYA 4QK1A 4RUZA 3U7CA 3HLJA 5EKHA 1KEQA 3M67A 4Q7PA 4Q81A 2OSFA 3F4XA 5SZ3A 2CBDA 5FNLA 3RYJB 3P3HA 2GD8A
chains in the Genus database with same CATH superfamily
3Q31A 4MDGA 3D9ZA 2FMGA 2FOYA 4R5AA 3RZ7A 3DAZA 1RJ6A 1BN4A 4PZHA 1G4OA 3ML5A 5CA2A 4FL7A 3KKXA 1DCAA 1RAZA 5AMLA 4YXIA 4BF6A 3M04A 1CAMA 5FNKA 4ZWYA 4FVOA 3M1JA 4G7AA 4Q08A 3W6IA 4Q90A 1CNYA 4R59A 2EZ7A 5AMGA 3IBLA 4Q6DA 1IF7A 2FNNA 4M2WA 5BRUA 2NNVA 4LP6A 12CAA 4TWMA 1G48A 5C8IA 1LG6A 3PYKA 3HFPA 1CVBA 3RZ1B 3HKUA 1CCSA 4TWLA 3BETA 2QO8A 1BNTA 4M2UA 3V3JA 5SZ6A 3M40A 4ILXA 4YGKA 4JSZA 2NXRA 3CZVA 2Q38A 3TMJA 4YGJA 4ZWIA 1CNKA 3K2FA 4FRCA 1TH9A 5FNHA 5SZ4A 2CA2A 5EH5A 3HS4A 1IF6A 1F2WA 1YO1A 4UOVA 4CACA 3S8XA 3JXFA 2OSMA 1CALA 3TVOX 1Z9YA 4KP5A 4XZ5A 3MHMA 1RZAA 4CNVA 4X5SA 3MZCA 2WEGA 1CNWA 2VVBX 1BICA 1CAOA 4QSIA 1RZCA 1HEAA 4YX4A 1BN3A 1FLJA 2F14A 1I9MA 1CAIA 3IGPA 3D93A 4DZ9A 4ITPA 2GEHA 4KUWA 4QIZA 3KOIA 3F8EA 3DC3A 4QJOA 5E2KA 4RN4A 1RZBA 4IWZA 1BNNA 1KOQA 5DSJA 5DSQA 5EKMA 3V3GB 1BNWA 3V7XA 4JSAA 3RJ7A 4E3HA 1BNUA 1BCDA 3OY0A 2HD6A 1UGFA 5FLOA 1OQ5A 3P44A 4MLXA 1I90A 5JESB 3P5LA 2CBAA 3HKNA 5JEHB 3DV7A 1AM6A 5E5RA 2NXSA 3SAPA 5EH7A 1HEBA 5G0BA 4K1QA 5DSIA 1TTMA 4HBAA 2NWOA 1CIMA 4JSSA 1AZMA 3IBNA 1CNJA 1XPZA 3U47A 5BRWA 4ETQC 3N3JA 1CVCA 5FLPA 5E2MA 4L5WA 2FNMA 3OKVA 5CLUA 4E3GA 1FSNA 2NNOA 3V3IB 4K0TA 8CA2A 3JXHC 2NNGA 5DSOA 5J8ZA 5L6KA 3MHCA 1KWRA 1CAYA 4ITOA 1THKA 4KNJA 1G1DA 5JG5B 4LU3A 2NMXA 4HEZA 4RFCA 4RFDA 4CA2A 3P3JA 3KIGA 2X7TA 2VVAX 3EFTA 1YDAA 3CA2A 3MHLA 5BYIA 3HKQA 4Q09A 1ZFKA 3M1KA 3RG4A 1I9PA 5EZTX 3U3AX 5DOHA 1TEQX 1HVAA 1BNMA 1DMYA 1ZFQA 5FNJA 3V3HB 3QYKA 1HECA 3MYQA 1LGDA 4RH2A 3CYUA 4JSWA 3DC9A 1FR7A 3B1BA 2EU3A 4N16A 1UGGA 3V5GA 3IBIA 1TE3X 2NWPA 3M1QA 4FU5A 5DSLA 4WR7A 1DCBA 2H4NA 3W6HA 5DSNA 2FOSA 3BL0A 2AX2A 3RZ0B 3M96A 4KNMA 3RG3A 3S77B 2QP6A 4K0SA 2CBBA 4PYXA 3RZ5A 3ZP9A 1BV3A 5L3OA 4Z1NA 1G54A 4QIYA 4WW8A 5FNIA 2POVA 2WD3A 3L14A 1XQ0A 5DSKA 2FNKA 4KAPA 4G0CA 5FLTA 3MNHA 4YWPA 4WUQA 3OKUA 4FIKA 4PQ7A 4IDRX 4COQA 4ZX0A 3IAIA 4Q78A 3KWAA 3OYQA 4YVYA 5HPJA 3DD0A 1TG3A 3OYSA 3DBUA 4Q9YA 2X7UA 2POWA 1CAHA 2HL4A 4Q0LA 5CACA 3S76A 5E2SA 1CNHA 1CVDA 2FOUA 4HU1A 6CA2A 3LXEA 5DSRA 4E3DA 1RZDA 4QJXA 4C3TA 1HEDA 4Q6EA 1CAKA 1CINA 3JXGA 3N4BA 4KNIA 3DCSA 4E5QA 5FL5A 5G01A 3M5TA 5FDCA 4MTYA 1FQRA 1KOPA 5JDVB 3T85A 3DA2A 1BNQA 4WUPA 4Q7WA 1CNBA 1JV0A 4Z1JA 1LUGA 5JEGB 3M3XA 4Q87A 3FE4A 4M2VA 1TBTX 1CCUA 5DVXA 3D92A 4E49A 2CBCA 1T9NA 3S97A 3T82A 1LZVA 3R16A 2WEHA 3M5EA 2WEOA 3P58A 1XEGA 4ZWXA 1MOOA 1YDDA 1V9EA 4HF3A 2O4ZA 4YGFA 3V3FA 1CANA 3BL1A 3DVDA 5DSPA 1IF9A 2HFWA 4Z1KA 5JQ0A 4FVNA 4E9OX 3MNUA 1BN1A 3OIMA 4Z0QA 3RYVB 3DVBA 4Z1EA 1ZGEA 4Q7VA 1FR4A 3T83A 7CA2A 4BCWA 5FLSA 1CVAA 4KV0A 1MUAA 2H15A 3RYXB 1G53A 4Q06A 5BNLA 5EH8A 3NJ9A 5SZ1A 1ZNCA 5A6HA 4QTLA 1CNXA 3IBUA 1HUGA 1CA2A 5JQTA 2FW4A 1TEUX 4LHIA 5E28A 3MNJA 1Z97A 1FSQA 4FPTA 4XFWA 3P5AA 1H4NA 3T5ZA 3EFIA 3S73B 5SZ5A 4MDMA 4RUXA 3V2MA 4QJ0A 3F7UA 4E3FA 1RAYA 3N0NA 1ZGFA 5FL6A 1Y7WA 4CNXA 1FQLA 5BRVA 3KS3A 3M1WA 5EKJA 1CRMA 1RJ5A 4Y0JA 4YXUA 3S78B 5G0CA 4Q8ZA 4KUYA 1TB0X 3M2ZA 2Q1BA 3U45X 4YXOA 4Q99A 4QJWA 1ZSBA 3MNKA 1G0FA 1FSRA 1YDCA 1UGCA 2NN7A 4HT2A 3SAXA 3VBDA 1CVHA 1A42A 4JS6A 4HEYA 3DCWA 5E2NA 3RYZA 3S71B 1CNIA 3RZ8A 5SZ7A 3KLDB 5FL4A 1URTA 5JGSB 3TVNX 2CABA 2HOCA 4QEFA 3S9TA 1IF5A 2ZNCA 5LMDA 1BZMA 2NWZA 1HCAA 5EHWA 3KNEA 3S74B 3IEOA 5DOGA 3S75B 4ZAOA 1IF4A 3SBIA 1JD0A 4KNNA 4L5UA 2WD2A 5DRSA 5FLRA 4CNRA 2NNSA 1CVFA 1G45A 4ZWZA 3NB5A 5EHVA 4CQ0A 3UYQA 3HKTA 3RLDA 4RIVA 3MDZA 1I9OA 2IT4A 4HEWA 1CAZA 3M2NA 5SZ0A 1H9NA 1YO2A 3KOKA 1CRAA 1H9QA 2ILIA 4Q8YA 4MDLA 1ZSAA 3MHIA 3RGEA 1FQMA 3F7BA 1CNGA 4K13A 1TG9A 2AW1A 3N2PA 4QJMA 1Z93A 2QOAA 4R5BA 4WL4A 1HUHA 1V9IC 3M14A 5CJFA 4CNWA 1G52A 5EIJA 3T84A 3DCCA 5JGTB 1XEVA 1ZE8A 1CAJA 1HCBA 3M5SA 3MWOA 3GZ0A 3M98A 3DVCA 1BNVA 4N0XB 2FOVA 4M2RA 3M2YA 4BF1A 1OKLA 1IF8A 1UGDA 3P4VA 4GL1X 4K0ZA 4YGLA 1KWQA 1CA3A 4XIXA 3ZNCA 3MNIA 3PJJA 4XIWA 3D8WA 1CZMA 3K34A 1EOUA 4PXXA 5FNMA 4ZX1A 3S72B 3T5UA 2NN1A 1ZSCA 4MLTA 3UYNA 4DZ7A 1CNCA 1OKMA 3D0NA 3R17B 9CA2A 3OILA 4QSJA 3MHOA 4RIUA 4QK2A 1G4JA 1AVNA 4E4AA 4KUVA 4PYYA 3V2JA 3DD8A 1DMXA 5FLQA 2HNCA 2X7SA 4MO8A 4QY3A 3SBHA 1G46A 2FOQA 2NXTA 2CBEA 5AMDA 1G0EA 4KP8A 4YHAA 1I9QA 4WW6A 2Q1QA 1J9WA 3C7PA 3B4FA 1JCZA 2WEJA 4XE1A 2NWYA 3CAJA 3M2XA 1I91A 5DSMA 1UGEA 2FMZA 5JG3B 5EHEA 4Q8XA 1CCTA 3MNAA 3MMFA 4Q7SA 3PO6A 5A25A 4QSBA 1ZH9A 5FNGA 1I8ZA 1RZEA 4L5VA 1OKNA 4Q07A 4QK3A 4YGNA 4Q49A 4HT0A 1YO0A 5JEPB 1I9LA 1YDBA 1G3ZA 3RYYA 1CILA 3ML2A 3NI5A 1FQNA 3P55A 5E2RA 4QJPA 3OIKA 1I9NA 4QSAA 5E5UA 1UGBA 5G03A 1UGAA 2W2JA 5EOIA 1LG5A 2EU2A 2ABEA 3FFPX 3K7KA 4Q83A 5SZ2A 5IPZA 1CVEA 3KONA 4YYTA 3FW3A 2POUA 2HKKA 5FDIA 1G6VA 4RUYA 4QK1A 4RUZA 3U7CA 3HLJA 5EKHA 1KEQA 3M67A 4Q7PA 4Q81A 2OSFA 3F4XA 5SZ3A 2CBDA 5FNLA 3RYJB 3P3HA 2GD8A
chains in the Genus database with same CATH topology
3Q31A 4MDGA 3D9ZA 2FMGA 2FOYA 4R5AA 3RZ7A 3DAZA 1RJ6A 1BN4A 4PZHA 1G4OA 3ML5A 5CA2A 4FL7A 3KKXA 1DCAA 1RAZA 5AMLA 4YXIA 4BF6A 3M04A 1CAMA 5FNKA 4ZWYA 4FVOA 3M1JA 4G7AA 4Q08A 3W6IA 4Q90A 1CNYA 4R59A 2EZ7A 5AMGA 3IBLA 4Q6DA 1IF7A 2FNNA 4M2WA 5BRUA 2NNVA 4LP6A 12CAA 4TWMA 1G48A 5C8IA 1LG6A 3PYKA 3HFPA 1CVBA 3RZ1B 3HKUA 1CCSA 4TWLA 3BETA 2QO8A 1BNTA 4M2UA 3V3JA 5SZ6A 3M40A 4ILXA 4YGKA 4JSZA 2NXRA 3CZVA 2Q38A 3TMJA 4YGJA 4ZWIA 1CNKA 3K2FA 4FRCA 1TH9A 5FNHA 5SZ4A 2CA2A 5EH5A 3HS4A 1IF6A 1F2WA 1YO1A 4UOVA 4CACA 3S8XA 3JXFA 2OSMA 1CALA 3TVOX 1Z9YA 4KP5A 4XZ5A 3MHMA 1RZAA 4CNVA 4X5SA 3MZCA 2WEGA 1CNWA 2VVBX 1BICA 1CAOA 4QSIA 1RZCA 1HEAA 4YX4A 1BN3A 1FLJA 2F14A 1I9MA 1CAIA 3IGPA 3D93A 4DZ9A 4ITPA 2GEHA 4KUWA 4QIZA 3KOIA 3F8EA 3DC3A 4QJOA 5E2KA 4RN4A 1RZBA 4IWZA 1BNNA 1KOQA 5DSJA 5DSQA 5EKMA 3V3GB 1BNWA 3V7XA 4JSAA 3RJ7A 4E3HA 1BNUA 1BCDA 3OY0A 2HD6A 1UGFA 5FLOA 1OQ5A 3P44A 4MLXA 1I90A 5JESB 3P5LA 2CBAA 3HKNA 5JEHB 3DV7A 1AM6A 5E5RA 2NXSA 3SAPA 5EH7A 1HEBA 5G0BA 4K1QA 5DSIA 1TTMA 4HBAA 2NWOA 1CIMA 4JSSA 1AZMA 3IBNA 1CNJA 1XPZA 3U47A 5BRWA 4ETQC 3N3JA 1CVCA 5FLPA 5E2MA 4L5WA 2FNMA 3OKVA 5CLUA 4E3GA 1FSNA 2NNOA 3V3IB 4K0TA 8CA2A 3JXHC 2NNGA 5DSOA 5J8ZA 5L6KA 3MHCA 1KWRA 1CAYA 4ITOA 1THKA 4KNJA 1G1DA 5JG5B 4LU3A 2NMXA 4HEZA 4RFCA 4RFDA 4CA2A 3P3JA 3KIGA 2X7TA 2VVAX 3EFTA 1YDAA 3CA2A 3MHLA 5BYIA 3HKQA 4Q09A 1ZFKA 3M1KA 3RG4A 1I9PA 5EZTX 3U3AX 5DOHA 1TEQX 1HVAA 1BNMA 1DMYA 1ZFQA 5FNJA 3V3HB 3QYKA 1HECA 3MYQA 1LGDA 4RH2A 3CYUA 4JSWA 3DC9A 1FR7A 3B1BA 2EU3A 4N16A 1UGGA 3V5GA 3IBIA 1TE3X 2NWPA 3M1QA 4FU5A 5DSLA 4WR7A 1DCBA 2H4NA 3W6HA 5DSNA 2FOSA 3BL0A 2AX2A 3RZ0B 3M96A 4KNMA 3RG3A 3S77B 2QP6A 4K0SA 2CBBA 4PYXA 3RZ5A 3ZP9A 1BV3A 5L3OA 4Z1NA 1G54A 4QIYA 4WW8A 5FNIA 2POVA 2WD3A 3L14A 1XQ0A 5DSKA 2FNKA 4KAPA 4G0CA 5FLTA 3MNHA 4YWPA 4WUQA 3OKUA 4FIKA 4PQ7A 4IDRX 4COQA 4ZX0A 3IAIA 4Q78A 3KWAA 3OYQA 4YVYA 5HPJA 3DD0A 1TG3A 3OYSA 3DBUA 4Q9YA 2X7UA 2POWA 1CAHA 2HL4A 4Q0LA 5CACA 3S76A 5E2SA 1CNHA 1CVDA 2FOUA 4HU1A 6CA2A 3LXEA 5DSRA 4E3DA 1RZDA 4QJXA 4C3TA 1HEDA 4Q6EA 1CAKA 1CINA 3JXGA 3N4BA 4KNIA 3DCSA 4E5QA 5FL5A 5G01A 3M5TA 5FDCA 4MTYA 1FQRA 1KOPA 5JDVB 3T85A 3DA2A 1BNQA 4WUPA 4Q7WA 1CNBA 1JV0A 4Z1JA 1LUGA 5JEGB 3M3XA 4Q87A 3FE4A 4M2VA 1TBTX 1CCUA 5DVXA 3D92A 4E49A 2CBCA 1T9NA 3S97A 3T82A 1LZVA 3R16A 2WEHA 3M5EA 2WEOA 3P58A 1XEGA 4ZWXA 1MOOA 1YDDA 1V9EA 4HF3A 2O4ZA 4YGFA 3V3FA 1CANA 3BL1A 3DVDA 5DSPA 1IF9A 2HFWA 4Z1KA 5JQ0A 4FVNA 4E9OX 3MNUA 1BN1A 3OIMA 4Z0QA 3RYVB 3DVBA 4Z1EA 1ZGEA 4Q7VA 1FR4A 3T83A 7CA2A 4BCWA 5FLSA 1CVAA 4KV0A 1MUAA 2H15A 3RYXB 1G53A 4Q06A 5BNLA 5EH8A 3NJ9A 5SZ1A 1ZNCA 5A6HA 4QTLA 1CNXA 3IBUA 1HUGA 1CA2A 5JQTA 2FW4A 1TEUX 4LHIA 5E28A 3MNJA 1Z97A 1FSQA 4FPTA 4XFWA 3P5AA 1H4NA 3T5ZA 3EFIA 3S73B 5SZ5A 4MDMA 4RUXA 3V2MA 4QJ0A 3F7UA 4E3FA 1RAYA 3N0NA 1ZGFA 5FL6A 1Y7WA 4CNXA 1FQLA 5BRVA 3KS3A 3M1WA 5EKJA 1CRMA 1RJ5A 4Y0JA 4YXUA 3S78B 5G0CA 4Q8ZA 4KUYA 1TB0X 3M2ZA 2Q1BA 3U45X 4YXOA 4Q99A 4QJWA 1ZSBA 3MNKA 1G0FA 1FSRA 1YDCA 1UGCA 2NN7A 4HT2A 3SAXA 3VBDA 1CVHA 1A42A 4JS6A 4HEYA 3DCWA 5E2NA 3RYZA 3S71B 1CNIA 3RZ8A 5SZ7A 3KLDB 5FL4A 1URTA 5JGSB 3TVNX 2CABA 2HOCA 4QEFA 3S9TA 1IF5A 2ZNCA 5LMDA 1BZMA 2NWZA 1HCAA 5EHWA 3KNEA 3S74B 3IEOA 5DOGA 3S75B 4ZAOA 1IF4A 3SBIA 1JD0A 4KNNA 4L5UA 2WD2A 5DRSA 5FLRA 4CNRA 2NNSA 1CVFA 1G45A 4ZWZA 3NB5A 5EHVA 4CQ0A 3UYQA 3HKTA 3RLDA 4RIVA 3MDZA 1I9OA 2IT4A 4HEWA 1CAZA 3M2NA 5SZ0A 1H9NA 1YO2A 3KOKA 1CRAA 1H9QA 2ILIA 4Q8YA 4MDLA 1ZSAA 3MHIA 3RGEA 1FQMA 3F7BA 1CNGA 4K13A 1TG9A 2AW1A 3N2PA 4QJMA 1Z93A 2QOAA 4R5BA 4WL4A 1HUHA 1V9IC 3M14A 5CJFA 4CNWA 1G52A 5EIJA 3T84A 3DCCA 5JGTB 1XEVA 1ZE8A 1CAJA 1HCBA 3M5SA 3MWOA 3GZ0A 3M98A 3DVCA 1BNVA 4N0XB 2FOVA 4M2RA 3M2YA 4BF1A 1OKLA 1IF8A 1UGDA 3P4VA 4GL1X 4K0ZA 4YGLA 1KWQA 1CA3A 4XIXA 3ZNCA 3MNIA 3PJJA 4XIWA 3D8WA 1CZMA 3K34A 1EOUA 4PXXA 5FNMA 4ZX1A 3S72B 3T5UA 2NN1A 1ZSCA 4MLTA 3UYNA 4DZ7A 1CNCA 1OKMA 3D0NA 3R17B 9CA2A 3OILA 4QSJA 3MHOA 4RIUA 4QK2A 1G4JA 1AVNA 4E4AA 4KUVA 4PYYA 3V2JA 3DD8A 1DMXA 5FLQA 2HNCA 2X7SA 4MO8A 4QY3A 3SBHA 1G46A 2FOQA 2NXTA 2CBEA 5AMDA 1G0EA 4KP8A 4YHAA 1I9QA 4WW6A 2Q1QA 1J9WA 3C7PA 3B4FA 1JCZA 2WEJA 4XE1A 2NWYA 3CAJA 3M2XA 1I91A 5DSMA 1UGEA 2FMZA 5JG3B 5EHEA 4Q8XA 1CCTA 3MNAA 3MMFA 4Q7SA 3PO6A 5A25A 4QSBA 1ZH9A 5FNGA 1I8ZA 1RZEA 4L5VA 1OKNA 4Q07A 4QK3A 4YGNA 4Q49A 4HT0A 1YO0A 5JEPB 1I9LA 1YDBA 1G3ZA 3RYYA 1CILA 3ML2A 3NI5A 1FQNA 3P55A 5E2RA 4QJPA 3OIKA 1I9NA 4QSAA 5E5UA 1UGBA 5G03A 1UGAA 2W2JA 5EOIA 1LG5A 2EU2A 2ABEA 3FFPX 3K7KA 4Q83A 5SZ2A 5IPZA 1CVEA 3KONA 4YYTA 3FW3A 2POUA 2HKKA 5FDIA 1G6VA 4RUYA 4QK1A 4RUZA 3U7CA 3HLJA 5EKHA 1KEQA 3M67A 4Q7PA 4Q81A 2OSFA 3F4XA 5SZ3A 2CBDA 5FNLA 3RYJB 3P3HA 2GD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q31 A;  4MDG A;  3D9Z A;  2FMG A;  2FOY A;  4R5A A;  3RZ7 A;  3DAZ A;  1RJ6 A;  1BN4 A;  4PZH A;  1G4O A;  3ML5 A;  5CA2 A;  4FL7 A;  3KKX A;  1DCA A;  1RAZ A;  5AML A;  4YXI A;  4BF6 A;  3M04 A;  1CAM A;  5FNK A;  4ZWY A;  4FVO A;  3M1J A;  4G7A A;  4Q08 A;  3W6I A;  4Q90 A;  1CNY A;  4R59 A;  2EZ7 A;  5AMG A;  3IBL A;  4Q6D A;  1IF7 A;  2FNN A;  4M2W A;  5BRU A;  2NNV A;  4LP6 A;  12CA A;  4TWM A;  1G48 A;  5C8I A;  1LG6 A;  3PYK A;  3HFP A;  1CVB A;  3RZ1 B;  3HKU A;  1CCS A;  4TWL A;  3BET A;  2QO8 A;  1BNT A;  4M2U A;  3V3J A;  5SZ6 A;  3M40 A;  4ILX A;  4YGK A;  4JSZ A;  2NXR A;  3CZV A;  2Q38 A;  3TMJ A;  4YGJ A;  4ZWI A;  1CNK A;  3K2F A;  4FRC A;  1TH9 A;  5FNH A;  5SZ4 A;  2CA2 A;  5EH5 A;  3HS4 A;  1IF6 A;  1F2W A;  1YO1 A;  4UOV A;  4CAC A;  3S8X A;  3JXF A;  2OSM A;  1CAL A;  3TVO X;  1Z9Y A;  4KP5 A;  4XZ5 A;  3MHM A;  1RZA A;  4CNV A;  4X5S A;  3MZC A;  2WEG A;  1CNW A;  2VVB X;  1BIC A;  1CAO A;  4QSI A;  1RZC A;  1HEA A;  4YX4 A;  1BN3 A;  1FLJ A;  2F14 A;  1I9M A;  1CAI A;  3IGP A;  3D93 A;  4DZ9 A;  4ITP A;  2GEH A;  4KUW A;  4QIZ A;  3KOI A;  3F8E A;  3DC3 A;  4QJO A;  5E2K A;  4RN4 A;  1RZB A;  4IWZ A;  1BNN A;  1KOQ A;  5DSJ A;  5DSQ A;  5EKM A;  3V3G B;  1BNW A;  3V7X A;  4JSA A;  3RJ7 A;  4E3H A;  1BNU A;  1BCD A;  3OY0 A;  2HD6 A;  1UGF A;  5FLO A;  1OQ5 A;  3P44 A;  4MLX A;  1I90 A;  5JES B;  3P5L A;  2CBA A;  3HKN A;  5JEH B;  3DV7 A;  1AM6 A;  5E5R A;  2NXS A;  3SAP A;  5EH7 A;  1HEB A;  5G0B A;  4K1Q A;  5DSI A;  1TTM A;  4HBA A;  2NWO A;  1CIM A;  4JSS A;  1AZM A;  3IBN A;  1CNJ A;  1XPZ A;  3U47 A;  5BRW A;  4ETQ C;  3N3J A;  1CVC A;  5FLP A;  5E2M A;  4L5W A;  2FNM A;  3OKV A;  5CLU A;  4E3G A;  1FSN A;  2NNO A;  3V3I B;  4K0T A;  8CA2 A;  3JXH C;  2NNG A;  5DSO A;  5J8Z A;  5L6K A;  3MHC A;  1KWR A;  1CAY A;  4ITO A;  1THK A;  4KNJ A;  1G1D A;  5JG5 B;  4LU3 A;  2NMX A;  4HEZ A;  4RFC A;  4RFD A;  4CA2 A;  3P3J A;  3KIG A;  2X7T A;  2VVA X;  3EFT A;  1YDA A;  3CA2 A;  3MHL A;  5BYI A;  3HKQ A;  4Q09 A;  1ZFK A;  3M1K A;  3RG4 A;  1I9P A;  5EZT X;  3U3A X;  5DOH A;  1TEQ X;  1HVA A;  1BNM A;  1DMY A;  1ZFQ A;  5FNJ A;  3V3H B;  3QYK A;  1HEC A;  3MYQ A;  1LGD A;  4RH2 A;  3CYU A;  4JSW A;  3DC9 A;  1FR7 A;  3B1B A;  2EU3 A;  4N16 A;  1UGG A;  3V5G A;  3IBI A;  1TE3 X;  2NWP A;  3M1Q A;  4FU5 A;  5DSL A;  4WR7 A;  1DCB A;  2H4N A;  3W6H A;  5DSN A;  2FOS A;  3BL0 A;  2AX2 A;  3RZ0 B;  3M96 A;  4KNM A;  3RG3 A;  3S77 B;  2QP6 A;  4K0S A;  2CBB A;  4PYX A;  3RZ5 A;  3ZP9 A;  1BV3 A;  5L3O A;  4Z1N A;  1G54 A;  4QIY A;  4WW8 A;  5FNI A;  2POV A;  2WD3 A;  3L14 A;  1XQ0 A;  5DSK A;  2FNK A;  4KAP A;  4G0C A;  5FLT A;  3MNH A;  4YWP A;  4WUQ A;  3OKU A;  4FIK A;  4PQ7 A;  4IDR X;  4COQ A;  4ZX0 A;  3IAI A;  4Q78 A;  3KWA A;  3OYQ A;  4YVY A;  5HPJ A;  3DD0 A;  1TG3 A;  3OYS A;  3DBU A;  4Q9Y A;  2X7U A;  2POW A;  1CAH A;  2HL4 A;  4Q0L A;  5CAC A;  3S76 A;  5E2S A;  1CNH A;  1CVD A;  2FOU A;  4HU1 A;  6CA2 A;  3LXE A;  5DSR A;  4E3D A;  1RZD A;  4QJX A;  4C3T A;  1HED A;  4Q6E A;  1CAK A;  1CIN A;  3JXG A;  3N4B A;  4KNI A;  3DCS A;  4E5Q A;  5FL5 A;  5G01 A;  3M5T A;  5FDC A;  4MTY A;  1FQR A;  1KOP A;  5JDV B;  3T85 A;  3DA2 A;  1BNQ A;  4WUP A;  4Q7W A;  1CNB A;  1JV0 A;  4Z1J A;  1LUG A;  5JEG B;  3M3X A;  4Q87 A;  3FE4 A;  4M2V A;  1TBT X;  1CCU A;  5DVX A;  3D92 A;  4E49 A;  2CBC A;  1T9N A;  3S97 A;  3T82 A;  1LZV A;  3R16 A;  2WEH A;  3M5E A;  2WEO A;  3P58 A;  1XEG A;  4ZWX A;  1MOO A;  1YDD A;  1V9E A;  4HF3 A;  2O4Z A;  4YGF A;  3V3F A;  1CAN A;  3BL1 A;  3DVD A;  5DSP A;  1IF9 A;  2HFW A;  4Z1K A;  5JQ0 A;  4FVN A;  4E9O X;  3MNU A;  1BN1 A;  3OIM A;  4Z0Q A;  3RYV B;  3DVB A;  4Z1E A;  1ZGE A;  4Q7V A;  1FR4 A;  3T83 A;  7CA2 A;  4BCW A;  5FLS A;  1CVA A;  4KV0 A;  1MUA A;  2H15 A;  3RYX B;  1G53 A;  4Q06 A;  5BNL A;  5EH8 A;  3NJ9 A;  5SZ1 A;  1ZNC A;  5A6H A;  4QTL A;  1CNX A;  3IBU A;  1HUG A;  1CA2 A;  5JQT A;  2FW4 A;  1TEU X;  4LHI A;  5E28 A;  3MNJ A;  1Z97 A;  1FSQ A;  4FPT A;  4XFW A;  3P5A A;  1H4N A;  3T5Z A;  3EFI A;  3S73 B;  5SZ5 A;  4MDM A;  4RUX A;  3V2M A;  4QJ0 A;  3F7U A;  4E3F A;  1RAY A;  3N0N A;  1ZGF A;  5FL6 A;  1Y7W A;  4CNX A;  1FQL A;  5BRV A;  3KS3 A;  3M1W A;  5EKJ A;  1CRM A;  1RJ5 A;  4Y0J A;  4YXU A;  3S78 B;  5G0C A;  4Q8Z A;  4KUY A;  1TB0 X;  3M2Z A;  2Q1B A;  3U45 X;  4YXO A;  4Q99 A;  4QJW A;  1ZSB A;  3MNK A;  1G0F A;  1FSR A;  1YDC A;  1UGC A;  2NN7 A;  4HT2 A;  3SAX A;  3VBD A;  1CVH A;  1A42 A;  4JS6 A;  4HEY A;  3DCW A;  5E2N A;  3RYZ A;  3S71 B;  1CNI A;  3RZ8 A;  5SZ7 A;  3KLD B;  5FL4 A;  1URT A;  5JGS B;  3TVN X;  2CAB A;  2HOC A;  4QEF A;  3S9T A;  1IF5 A;  2ZNC A;  5LMD A;  1BZM A;  2NWZ A;  1HCA A;  5EHW A;  3KNE A;  3S74 B;  3IEO A;  5DOG A;  3S75 B;  4ZAO A;  1IF4 A;  3SBI A;  1JD0 A;  4KNN A;  4L5U A;  2WD2 A;  5DRS A;  5FLR A;  4CNR A;  2NNS A;  1CVF A;  1G45 A;  4ZWZ A;  3NB5 A;  5EHV A;  4CQ0 A;  3UYQ A;  3HKT A;  3RLD A;  4RIV A;  3MDZ A;  1I9O A;  2IT4 A;  4HEW A;  1CAZ A;  3M2N A;  5SZ0 A;  1H9N A;  1YO2 A;  3KOK A;  1CRA A;  1H9Q A;  2ILI A;  4Q8Y A;  4MDL A;  1ZSA A;  3MHI A;  3RGE A;  1FQM A;  3F7B A;  1CNG A;  4K13 A;  1TG9 A;  2AW1 A;  3N2P A;  4QJM A;  1Z93 A;  2QOA A;  4R5B A;  4WL4 A;  1HUH A;  1V9I C;  3M14 A;  5CJF A;  4CNW A;  1G52 A;  5EIJ A;  3T84 A;  3DCC A;  5JGT B;  1XEV A;  1ZE8 A;  1CAJ A;  1HCB A;  3M5S A;  3MWO A;  3GZ0 A;  3M98 A;  3DVC A;  1BNV A;  4N0X B;  2FOV A;  4M2R A;  3M2Y A;  4BF1 A;  1OKL A;  1IF8 A;  1UGD A;  3P4V A;  4GL1 X;  4K0Z A;  4YGL A;  1KWQ A;  1CA3 A;  4XIX A;  3ZNC A;  3MNI A;  3PJJ A;  4XIW A;  3D8W A;  1CZM A;  3K34 A;  1EOU A;  4PXX A;  5FNM A;  4ZX1 A;  3S72 B;  3T5U A;  2NN1 A;  1ZSC A;  4MLT A;  3UYN A;  4DZ7 A;  1CNC A;  1OKM A;  3D0N A;  3R17 B;  9CA2 A;  3OIL A;  4QSJ A;  3MHO A;  4RIU A;  4QK2 A;  1G4J A;  1AVN A;  4E4A A;  4KUV A;  4PYY A;  3V2J A;  3DD8 A;  1DMX A;  5FLQ A;  2HNC A;  2X7S A;  4MO8 A;  4QY3 A;  3SBH A;  1G46 A;  2FOQ A;  2NXT A;  2CBE A;  5AMD A;  1G0E A;  4KP8 A;  4YHA A;  1I9Q A;  4WW6 A;  2Q1Q A;  1J9W A;  3C7P A;  3B4F A;  1JCZ A;  2WEJ A;  4XE1 A;  2NWY A;  3CAJ A;  3M2X A;  1I91 A;  5DSM A;  1UGE A;  2FMZ A;  5JG3 B;  5EHE A;  4Q8X A;  1CCT A;  3MNA A;  3MMF A;  4Q7S A;  3PO6 A;  5A25 A;  4QSB A;  1ZH9 A;  5FNG A;  1I8Z A;  1RZE A;  4L5V A;  1OKN A;  4Q07 A;  4QK3 A;  4YGN A;  4Q49 A;  4HT0 A;  1YO0 A;  5JEP B;  1I9L A;  1YDB A;  1G3Z A;  3RYY A;  1CIL A;  3ML2 A;  3NI5 A;  1FQN A;  3P55 A;  5E2R A;  4QJP A;  3OIK A;  1I9N A;  4QSA A;  5E5U A;  1UGB A;  5G03 A;  1UGA A;  2W2J A;  5EOI A;  1LG5 A;  2EU2 A;  2ABE A;  3FFP X;  3K7K A;  4Q83 A;  5SZ2 A;  5IPZ A;  1CVE A;  3KON A;  4YYT A;  3FW3 A;  2POU A;  2HKK A;  5FDI A;  1G6V A;  4RUY A;  4QK1 A;  4RUZ A;  3U7C A;  3HLJ A;  5EKH A;  1KEQ A;  3M67 A;  4Q7P A;  4Q81 A;  2OSF A;  3F4X A;  5SZ3 A;  2CBD A;  5FNL A;  3RYJ B;  3P3H A;  2GD8 A; 
#chains in the Genus database with same CATH topology
 3Q31 A;  4MDG A;  3D9Z A;  2FMG A;  2FOY A;  4R5A A;  3RZ7 A;  3DAZ A;  1RJ6 A;  1BN4 A;  4PZH A;  1G4O A;  3ML5 A;  5CA2 A;  4FL7 A;  3KKX A;  1DCA A;  1RAZ A;  5AML A;  4YXI A;  4BF6 A;  3M04 A;  1CAM A;  5FNK A;  4ZWY A;  4FVO A;  3M1J A;  4G7A A;  4Q08 A;  3W6I A;  4Q90 A;  1CNY A;  4R59 A;  2EZ7 A;  5AMG A;  3IBL A;  4Q6D A;  1IF7 A;  2FNN A;  4M2W A;  5BRU A;  2NNV A;  4LP6 A;  12CA A;  4TWM A;  1G48 A;  5C8I A;  1LG6 A;  3PYK A;  3HFP A;  1CVB A;  3RZ1 B;  3HKU A;  1CCS A;  4TWL A;  3BET A;  2QO8 A;  1BNT A;  4M2U A;  3V3J A;  5SZ6 A;  3M40 A;  4ILX A;  4YGK A;  4JSZ A;  2NXR A;  3CZV A;  2Q38 A;  3TMJ A;  4YGJ A;  4ZWI A;  1CNK A;  3K2F A;  4FRC A;  1TH9 A;  5FNH A;  5SZ4 A;  2CA2 A;  5EH5 A;  3HS4 A;  1IF6 A;  1F2W A;  1YO1 A;  4UOV A;  4CAC A;  3S8X A;  3JXF A;  2OSM A;  1CAL A;  3TVO X;  1Z9Y A;  4KP5 A;  4XZ5 A;  3MHM A;  1RZA A;  4CNV A;  4X5S A;  3MZC A;  2WEG A;  1CNW A;  2VVB X;  1BIC A;  1CAO A;  4QSI A;  1RZC A;  1HEA A;  4YX4 A;  1BN3 A;  1FLJ A;  2F14 A;  1I9M A;  1CAI A;  3IGP A;  3D93 A;  4DZ9 A;  4ITP A;  2GEH A;  4KUW A;  4QIZ A;  3KOI A;  3F8E A;  3DC3 A;  4QJO A;  5E2K A;  4RN4 A;  1RZB A;  4IWZ A;  1BNN A;  1KOQ A;  5DSJ A;  5DSQ A;  5EKM A;  3V3G B;  1BNW A;  3V7X A;  4JSA A;  3RJ7 A;  4E3H A;  1BNU A;  1BCD A;  3OY0 A;  2HD6 A;  1UGF A;  5FLO A;  1OQ5 A;  3P44 A;  4MLX A;  1I90 A;  5JES B;  3P5L A;  2CBA A;  3HKN A;  5JEH B;  3DV7 A;  1AM6 A;  5E5R A;  2NXS A;  3SAP A;  5EH7 A;  1HEB A;  5G0B A;  4K1Q A;  5DSI A;  1TTM A;  4HBA A;  2NWO A;  1CIM A;  4JSS A;  1AZM A;  3IBN A;  1CNJ A;  1XPZ A;  3U47 A;  5BRW A;  4ETQ C;  3N3J A;  1CVC A;  5FLP A;  5E2M A;  4L5W A;  2FNM A;  3OKV A;  5CLU A;  4E3G A;  1FSN A;  2NNO A;  3V3I B;  4K0T A;  8CA2 A;  3JXH C;  2NNG A;  5DSO A;  5J8Z A;  5L6K A;  3MHC A;  1KWR A;  1CAY A;  4ITO A;  1THK A;  4KNJ A;  1G1D A;  5JG5 B;  4LU3 A;  2NMX A;  4HEZ A;  4RFC A;  4RFD A;  4CA2 A;  3P3J A;  3KIG A;  2X7T A;  2VVA X;  3EFT A;  1YDA A;  3CA2 A;  3MHL A;  5BYI A;  3HKQ A;  4Q09 A;  1ZFK A;  3M1K A;  3RG4 A;  1I9P A;  5EZT X;  3U3A X;  5DOH A;  1TEQ X;  1HVA A;  1BNM A;  1DMY A;  1ZFQ A;  5FNJ A;  3V3H B;  3QYK A;  1HEC A;  3MYQ A;  1LGD A;  4RH2 A;  3CYU A;  4JSW A;  3DC9 A;  1FR7 A;  3B1B A;  2EU3 A;  4N16 A;  1UGG A;  3V5G A;  3IBI A;  1TE3 X;  2NWP A;  3M1Q A;  4FU5 A;  5DSL A;  4WR7 A;  1DCB A;  2H4N A;  3W6H A;  5DSN A;  2FOS A;  3BL0 A;  2AX2 A;  3RZ0 B;  3M96 A;  4KNM A;  3RG3 A;  3S77 B;  2QP6 A;  4K0S A;  2CBB A;  4PYX A;  3RZ5 A;  3ZP9 A;  1BV3 A;  5L3O A;  4Z1N A;  1G54 A;  4QIY A;  4WW8 A;  5FNI A;  2POV A;  2WD3 A;  3L14 A;  1XQ0 A;  5DSK A;  2FNK A;  4KAP A;  4G0C A;  5FLT A;  3MNH A;  4YWP A;  4WUQ A;  3OKU A;  4FIK A;  4PQ7 A;  4IDR X;  4COQ A;  4ZX0 A;  3IAI A;  4Q78 A;  3KWA A;  3OYQ A;  4YVY A;  5HPJ A;  3DD0 A;  1TG3 A;  3OYS A;  3DBU A;  4Q9Y A;  2X7U A;  2POW A;  1CAH A;  2HL4 A;  4Q0L A;  5CAC A;  3S76 A;  5E2S A;  1CNH A;  1CVD A;  2FOU A;  4HU1 A;  6CA2 A;  3LXE A;  5DSR A;  4E3D A;  1RZD A;  4QJX A;  4C3T A;  1HED A;  4Q6E A;  1CAK A;  1CIN A;  3JXG A;  3N4B A;  4KNI A;  3DCS A;  4E5Q A;  5FL5 A;  5G01 A;  3M5T A;  5FDC A;  4MTY A;  1FQR A;  1KOP A;  5JDV B;  3T85 A;  3DA2 A;  1BNQ A;  4WUP A;  4Q7W A;  1CNB A;  1JV0 A;  4Z1J A;  1LUG A;  5JEG B;  3M3X A;  4Q87 A;  3FE4 A;  4M2V A;  1TBT X;  1CCU A;  5DVX A;  3D92 A;  4E49 A;  2CBC A;  1T9N A;  3S97 A;  3T82 A;  1LZV A;  3R16 A;  2WEH A;  3M5E A;  2WEO A;  3P58 A;  1XEG A;  4ZWX A;  1MOO A;  1YDD A;  1V9E A;  4HF3 A;  2O4Z A;  4YGF A;  3V3F A;  1CAN A;  3BL1 A;  3DVD A;  5DSP A;  1IF9 A;  2HFW A;  4Z1K A;  5JQ0 A;  4FVN A;  4E9O X;  3MNU A;  1BN1 A;  3OIM A;  4Z0Q A;  3RYV B;  3DVB A;  4Z1E A;  1ZGE A;  4Q7V A;  1FR4 A;  3T83 A;  7CA2 A;  4BCW A;  5FLS A;  1CVA A;  4KV0 A;  1MUA A;  2H15 A;  3RYX B;  1G53 A;  4Q06 A;  5BNL A;  5EH8 A;  3NJ9 A;  5SZ1 A;  1ZNC A;  5A6H A;  4QTL A;  1CNX A;  3IBU A;  1HUG A;  1CA2 A;  5JQT A;  2FW4 A;  1TEU X;  4LHI A;  5E28 A;  3MNJ A;  1Z97 A;  1FSQ A;  4FPT A;  4XFW A;  3P5A A;  1H4N A;  3T5Z A;  3EFI A;  3S73 B;  5SZ5 A;  4MDM A;  4RUX A;  3V2M A;  4QJ0 A;  3F7U A;  4E3F A;  1RAY A;  3N0N A;  1ZGF A;  5FL6 A;  1Y7W A;  4CNX A;  1FQL A;  5BRV A;  3KS3 A;  3M1W A;  5EKJ A;  1CRM A;  1RJ5 A;  4Y0J A;  4YXU A;  3S78 B;  5G0C A;  4Q8Z A;  4KUY A;  1TB0 X;  3M2Z A;  2Q1B A;  3U45 X;  4YXO A;  4Q99 A;  4QJW A;  1ZSB A;  3MNK A;  1G0F A;  1FSR A;  1YDC A;  1UGC A;  2NN7 A;  4HT2 A;  3SAX A;  3VBD A;  1CVH A;  1A42 A;  4JS6 A;  4HEY A;  3DCW A;  5E2N A;  3RYZ A;  3S71 B;  1CNI A;  3RZ8 A;  5SZ7 A;  3KLD B;  5FL4 A;  1URT A;  5JGS B;  3TVN X;  2CAB A;  2HOC A;  4QEF A;  3S9T A;  1IF5 A;  2ZNC A;  5LMD A;  1BZM A;  2NWZ A;  1HCA A;  5EHW A;  3KNE A;  3S74 B;  3IEO A;  5DOG A;  3S75 B;  4ZAO A;  1IF4 A;  3SBI A;  1JD0 A;  4KNN A;  4L5U A;  2WD2 A;  5DRS A;  5FLR A;  4CNR A;  2NNS A;  1CVF A;  1G45 A;  4ZWZ A;  3NB5 A;  5EHV A;  4CQ0 A;  3UYQ A;  3HKT A;  3RLD A;  4RIV A;  3MDZ A;  1I9O A;  2IT4 A;  4HEW A;  1CAZ A;  3M2N A;  5SZ0 A;  1H9N A;  1YO2 A;  3KOK A;  1CRA A;  1H9Q A;  2ILI A;  4Q8Y A;  4MDL A;  1ZSA A;  3MHI A;  3RGE A;  1FQM A;  3F7B A;  1CNG A;  4K13 A;  1TG9 A;  2AW1 A;  3N2P A;  4QJM A;  1Z93 A;  2QOA A;  4R5B A;  4WL4 A;  1HUH A;  1V9I C;  3M14 A;  5CJF A;  4CNW A;  1G52 A;  5EIJ A;  3T84 A;  3DCC A;  5JGT B;  1XEV A;  1ZE8 A;  1CAJ A;  1HCB A;  3M5S A;  3MWO A;  3GZ0 A;  3M98 A;  3DVC A;  1BNV A;  4N0X B;  2FOV A;  4M2R A;  3M2Y A;  4BF1 A;  1OKL A;  1IF8 A;  1UGD A;  3P4V A;  4GL1 X;  4K0Z A;  4YGL A;  1KWQ A;  1CA3 A;  4XIX A;  3ZNC A;  3MNI A;  3PJJ A;  4XIW A;  3D8W A;  1CZM A;  3K34 A;  1EOU A;  4PXX A;  5FNM A;  4ZX1 A;  3S72 B;  3T5U A;  2NN1 A;  1ZSC A;  4MLT A;  3UYN A;  4DZ7 A;  1CNC A;  1OKM A;  3D0N A;  3R17 B;  9CA2 A;  3OIL A;  4QSJ A;  3MHO A;  4RIU A;  4QK2 A;  1G4J A;  1AVN A;  4E4A A;  4KUV A;  4PYY A;  3V2J A;  3DD8 A;  1DMX A;  5FLQ A;  2HNC A;  2X7S A;  4MO8 A;  4QY3 A;  3SBH A;  1G46 A;  2FOQ A;  2NXT A;  2CBE A;  5AMD A;  1G0E A;  4KP8 A;  4YHA A;  1I9Q A;  4WW6 A;  2Q1Q A;  1J9W A;  3C7P A;  3B4F A;  1JCZ A;  2WEJ A;  4XE1 A;  2NWY A;  3CAJ A;  3M2X A;  1I91 A;  5DSM A;  1UGE A;  2FMZ A;  5JG3 B;  5EHE A;  4Q8X A;  1CCT A;  3MNA A;  3MMF A;  4Q7S A;  3PO6 A;  5A25 A;  4QSB A;  1ZH9 A;  5FNG A;  1I8Z A;  1RZE A;  4L5V A;  1OKN A;  4Q07 A;  4QK3 A;  4YGN A;  4Q49 A;  4HT0 A;  1YO0 A;  5JEP B;  1I9L A;  1YDB A;  1G3Z A;  3RYY A;  1CIL A;  3ML2 A;  3NI5 A;  1FQN A;  3P55 A;  5E2R A;  4QJP A;  3OIK A;  1I9N A;  4QSA A;  5E5U A;  1UGB A;  5G03 A;  1UGA A;  2W2J A;  5EOI A;  1LG5 A;  2EU2 A;  2ABE A;  3FFP X;  3K7K A;  4Q83 A;  5SZ2 A;  5IPZ A;  1CVE A;  3KON A;  4YYT A;  3FW3 A;  2POU A;  2HKK A;  5FDI A;  1G6V A;  4RUY A;  4QK1 A;  4RUZ A;  3U7C A;  3HLJ A;  5EKH A;  1KEQ A;  3M67 A;  4Q7P A;  4Q81 A;  2OSF A;  3F4X A;  5SZ3 A;  2CBD A;  5FNL A;  3RYJ B;  3P3H A;  2GD8 A; 
#chains in the Genus database with same CATH homology
 3Q31 A;  4MDG A;  3D9Z A;  2FMG A;  2FOY A;  4R5A A;  3RZ7 A;  3DAZ A;  1RJ6 A;  1BN4 A;  4PZH A;  1G4O A;  3ML5 A;  5CA2 A;  4FL7 A;  3KKX A;  1DCA A;  1RAZ A;  5AML A;  4YXI A;  4BF6 A;  3M04 A;  1CAM A;  5FNK A;  4ZWY A;  4FVO A;  3M1J A;  4G7A A;  4Q08 A;  3W6I A;  4Q90 A;  1CNY A;  4R59 A;  2EZ7 A;  5AMG A;  3IBL A;  4Q6D A;  1IF7 A;  2FNN A;  4M2W A;  5BRU A;  2NNV A;  4LP6 A;  12CA A;  4TWM A;  1G48 A;  5C8I A;  1LG6 A;  3PYK A;  3HFP A;  1CVB A;  3RZ1 B;  3HKU A;  1CCS A;  4TWL A;  3BET A;  2QO8 A;  1BNT A;  4M2U A;  3V3J A;  5SZ6 A;  3M40 A;  4ILX A;  4YGK A;  4JSZ A;  2NXR A;  3CZV A;  2Q38 A;  3TMJ A;  4YGJ A;  4ZWI A;  1CNK A;  3K2F A;  4FRC A;  1TH9 A;  5FNH A;  5SZ4 A;  2CA2 A;  5EH5 A;  3HS4 A;  1IF6 A;  1F2W A;  1YO1 A;  4UOV A;  4CAC A;  3S8X A;  3JXF A;  2OSM A;  1CAL A;  3TVO X;  1Z9Y A;  4KP5 A;  4XZ5 A;  3MHM A;  1RZA A;  4CNV A;  4X5S A;  3MZC A;  2WEG A;  1CNW A;  2VVB X;  1BIC A;  1CAO A;  4QSI A;  1RZC A;  1HEA A;  4YX4 A;  1BN3 A;  1FLJ A;  2F14 A;  1I9M A;  1CAI A;  3IGP A;  3D93 A;  4DZ9 A;  4ITP A;  2GEH A;  4KUW A;  4QIZ A;  3KOI A;  3F8E A;  3DC3 A;  4QJO A;  5E2K A;  4RN4 A;  1RZB A;  4IWZ A;  1BNN A;  1KOQ A;  5DSJ A;  5DSQ A;  5EKM A;  3V3G B;  1BNW A;  3V7X A;  4JSA A;  3RJ7 A;  4E3H A;  1BNU A;  1BCD A;  3OY0 A;  2HD6 A;  1UGF A;  5FLO A;  1OQ5 A;  3P44 A;  4MLX A;  1I90 A;  5JES B;  3P5L A;  2CBA A;  3HKN A;  5JEH B;  3DV7 A;  1AM6 A;  5E5R A;  2NXS A;  3SAP A;  5EH7 A;  1HEB A;  5G0B A;  4K1Q A;  5DSI A;  1TTM A;  4HBA A;  2NWO A;  1CIM A;  4JSS A;  1AZM A;  3IBN A;  1CNJ A;  1XPZ A;  3U47 A;  5BRW A;  4ETQ C;  3N3J A;  1CVC A;  5FLP A;  5E2M A;  4L5W A;  2FNM A;  3OKV A;  5CLU A;  4E3G A;  1FSN A;  2NNO A;  3V3I B;  4K0T A;  8CA2 A;  3JXH C;  2NNG A;  5DSO A;  5J8Z A;  5L6K A;  3MHC A;  1KWR A;  1CAY A;  4ITO A;  1THK A;  4KNJ A;  1G1D A;  5JG5 B;  4LU3 A;  2NMX A;  4HEZ A;  4RFC A;  4RFD A;  4CA2 A;  3P3J A;  3KIG A;  2X7T A;  2VVA X;  3EFT A;  1YDA A;  3CA2 A;  3MHL A;  5BYI A;  3HKQ A;  4Q09 A;  1ZFK A;  3M1K A;  3RG4 A;  1I9P A;  5EZT X;  3U3A X;  5DOH A;  1TEQ X;  1HVA A;  1BNM A;  1DMY A;  1ZFQ A;  5FNJ A;  3V3H B;  3QYK A;  1HEC A;  3MYQ A;  1LGD A;  4RH2 A;  3CYU A;  4JSW A;  3DC9 A;  1FR7 A;  3B1B A;  2EU3 A;  4N16 A;  1UGG A;  3V5G A;  3IBI A;  1TE3 X;  2NWP A;  3M1Q A;  4FU5 A;  5DSL A;  4WR7 A;  1DCB A;  2H4N A;  3W6H A;  5DSN A;  2FOS A;  3BL0 A;  2AX2 A;  3RZ0 B;  3M96 A;  4KNM A;  3RG3 A;  3S77 B;  2QP6 A;  4K0S A;  2CBB A;  4PYX A;  3RZ5 A;  3ZP9 A;  1BV3 A;  5L3O A;  4Z1N A;  1G54 A;  4QIY A;  4WW8 A;  5FNI A;  2POV A;  2WD3 A;  3L14 A;  1XQ0 A;  5DSK A;  2FNK A;  4KAP A;  4G0C A;  5FLT A;  3MNH A;  4YWP A;  4WUQ A;  3OKU A;  4FIK A;  4PQ7 A;  4IDR X;  4COQ A;  4ZX0 A;  3IAI A;  4Q78 A;  3KWA A;  3OYQ A;  4YVY A;  5HPJ A;  3DD0 A;  1TG3 A;  3OYS A;  3DBU A;  4Q9Y A;  2X7U A;  2POW A;  1CAH A;  2HL4 A;  4Q0L A;  5CAC A;  3S76 A;  5E2S A;  1CNH A;  1CVD A;  2FOU A;  4HU1 A;  6CA2 A;  3LXE A;  5DSR A;  4E3D A;  1RZD A;  4QJX A;  4C3T A;  1HED A;  4Q6E A;  1CAK A;  1CIN A;  3JXG A;  3N4B A;  4KNI A;  3DCS A;  4E5Q A;  5FL5 A;  5G01 A;  3M5T A;  5FDC A;  4MTY A;  1FQR A;  1KOP A;  5JDV B;  3T85 A;  3DA2 A;  1BNQ A;  4WUP A;  4Q7W A;  1CNB A;  1JV0 A;  4Z1J A;  1LUG A;  5JEG B;  3M3X A;  4Q87 A;  3FE4 A;  4M2V A;  1TBT X;  1CCU A;  5DVX A;  3D92 A;  4E49 A;  2CBC A;  1T9N A;  3S97 A;  3T82 A;  1LZV A;  3R16 A;  2WEH A;  3M5E A;  2WEO A;  3P58 A;  1XEG A;  4ZWX A;  1MOO A;  1YDD A;  1V9E A;  4HF3 A;  2O4Z A;  4YGF A;  3V3F A;  1CAN A;  3BL1 A;  3DVD A;  5DSP A;  1IF9 A;  2HFW A;  4Z1K A;  5JQ0 A;  4FVN A;  4E9O X;  3MNU A;  1BN1 A;  3OIM A;  4Z0Q A;  3RYV B;  3DVB A;  4Z1E A;  1ZGE A;  4Q7V A;  1FR4 A;  3T83 A;  7CA2 A;  4BCW A;  5FLS A;  1CVA A;  4KV0 A;  1MUA A;  2H15 A;  3RYX B;  1G53 A;  4Q06 A;  5BNL A;  5EH8 A;  3NJ9 A;  5SZ1 A;  1ZNC A;  5A6H A;  4QTL A;  1CNX A;  3IBU A;  1HUG A;  1CA2 A;  5JQT A;  2FW4 A;  1TEU X;  4LHI A;  5E28 A;  3MNJ A;  1Z97 A;  1FSQ A;  4FPT A;  4XFW A;  3P5A A;  1H4N A;  3T5Z A;  3EFI A;  3S73 B;  5SZ5 A;  4MDM A;  4RUX A;  3V2M A;  4QJ0 A;  3F7U A;  4E3F A;  1RAY A;  3N0N A;  1ZGF A;  5FL6 A;  1Y7W A;  4CNX A;  1FQL A;  5BRV A;  3KS3 A;  3M1W A;  5EKJ A;  1CRM A;  1RJ5 A;  4Y0J A;  4YXU A;  3S78 B;  5G0C A;  4Q8Z A;  4KUY A;  1TB0 X;  3M2Z A;  2Q1B A;  3U45 X;  4YXO A;  4Q99 A;  4QJW A;  1ZSB A;  3MNK A;  1G0F A;  1FSR A;  1YDC A;  1UGC A;  2NN7 A;  4HT2 A;  3SAX A;  3VBD A;  1CVH A;  1A42 A;  4JS6 A;  4HEY A;  3DCW A;  5E2N A;  3RYZ A;  3S71 B;  1CNI A;  3RZ8 A;  5SZ7 A;  3KLD B;  5FL4 A;  1URT A;  5JGS B;  3TVN X;  2CAB A;  2HOC A;  4QEF A;  3S9T A;  1IF5 A;  2ZNC A;  5LMD A;  1BZM A;  2NWZ A;  1HCA A;  5EHW A;  3KNE A;  3S74 B;  3IEO A;  5DOG A;  3S75 B;  4ZAO A;  1IF4 A;  3SBI A;  1JD0 A;  4KNN A;  4L5U A;  2WD2 A;  5DRS A;  5FLR A;  4CNR A;  2NNS A;  1CVF A;  1G45 A;  4ZWZ A;  3NB5 A;  5EHV A;  4CQ0 A;  3UYQ A;  3HKT A;  3RLD A;  4RIV A;  3MDZ A;  1I9O A;  2IT4 A;  4HEW A;  1CAZ A;  3M2N A;  5SZ0 A;  1H9N A;  1YO2 A;  3KOK A;  1CRA A;  1H9Q A;  2ILI A;  4Q8Y A;  4MDL A;  1ZSA A;  3MHI A;  3RGE A;  1FQM A;  3F7B A;  1CNG A;  4K13 A;  1TG9 A;  2AW1 A;  3N2P A;  4QJM A;  1Z93 A;  2QOA A;  4R5B A;  4WL4 A;  1HUH A;  1V9I C;  3M14 A;  5CJF A;  4CNW A;  1G52 A;  5EIJ A;  3T84 A;  3DCC A;  5JGT B;  1XEV A;  1ZE8 A;  1CAJ A;  1HCB A;  3M5S A;  3MWO A;  3GZ0 A;  3M98 A;  3DVC A;  1BNV A;  4N0X B;  2FOV A;  4M2R A;  3M2Y A;  4BF1 A;  1OKL A;  1IF8 A;  1UGD A;  3P4V A;  4GL1 X;  4K0Z A;  4YGL A;  1KWQ A;  1CA3 A;  4XIX A;  3ZNC A;  3MNI A;  3PJJ A;  4XIW A;  3D8W A;  1CZM A;  3K34 A;  1EOU A;  4PXX A;  5FNM A;  4ZX1 A;  3S72 B;  3T5U A;  2NN1 A;  1ZSC A;  4MLT A;  3UYN A;  4DZ7 A;  1CNC A;  1OKM A;  3D0N A;  3R17 B;  9CA2 A;  3OIL A;  4QSJ A;  3MHO A;  4RIU A;  4QK2 A;  1G4J A;  1AVN A;  4E4A A;  4KUV A;  4PYY A;  3V2J A;  3DD8 A;  1DMX A;  5FLQ A;  2HNC A;  2X7S A;  4MO8 A;  4QY3 A;  3SBH A;  1G46 A;  2FOQ A;  2NXT A;  2CBE A;  5AMD A;  1G0E A;  4KP8 A;  4YHA A;  1I9Q A;  4WW6 A;  2Q1Q A;  1J9W A;  3C7P A;  3B4F A;  1JCZ A;  2WEJ A;  4XE1 A;  2NWY A;  3CAJ A;  3M2X A;  1I91 A;  5DSM A;  1UGE A;  2FMZ A;  5JG3 B;  5EHE A;  4Q8X A;  1CCT A;  3MNA A;  3MMF A;  4Q7S A;  3PO6 A;  5A25 A;  4QSB A;  1ZH9 A;  5FNG A;  1I8Z A;  1RZE A;  4L5V A;  1OKN A;  4Q07 A;  4QK3 A;  4YGN A;  4Q49 A;  4HT0 A;  1YO0 A;  5JEP B;  1I9L A;  1YDB A;  1G3Z A;  3RYY A;  1CIL A;  3ML2 A;  3NI5 A;  1FQN A;  3P55 A;  5E2R A;  4QJP A;  3OIK A;  1I9N A;  4QSA A;  5E5U A;  1UGB A;  5G03 A;  1UGA A;  2W2J A;  5EOI A;  1LG5 A;  2EU2 A;  2ABE A;  3FFP X;  3K7K A;  4Q83 A;  5SZ2 A;  5IPZ A;  1CVE A;  3KON A;  4YYT A;  3FW3 A;  2POU A;  2HKK A;  5FDI A;  1G6V A;  4RUY A;  4QK1 A;  4RUZ A;  3U7C A;  3HLJ A;  5EKH A;  1KEQ A;  3M67 A;  4Q7P A;  4Q81 A;  2OSF A;  3F4X A;  5SZ3 A;  2CBD A;  5FNL A;  3RYJ B;  3P3H A;  2GD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...