3MNKA

Human carbonic anhydrase ii mutant k170h
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
Knots found
sequence length
258
structure length
258
Chain Sequence
HHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTHGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and kinetic study of the extended active site for proton transfer in human carbonic anhydrase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Proton transport
molecule keywords Carbonic anhydrase 2
total genus 75
structure length 258
sequence length 258
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2010-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 3mnkA00
2X7TA 4QJMA 3CAJA 4Q7VA 3MHMA 3PYKA 4K0TA 1DMXA 1BV3A 3P3JA 3PO6A 5G0CA 3TMJA 4CACA 1I91A 3SBHA 4Q87A 5FNMA 4Z1EA 8CA2A 1Z9YA 3NB5A 3P58A 1BZMA 2NWPA 5E5UA 3CYUA 4BF1A 2NXRA 1UGCA 2F14A 1RAZA 4Q81A 3F7BA 4PXXA 1ZH9A 3B1BA 3ML5A 4IDRX 5G01A 2WEHA 3K7KA 2WEOA 1YDDA 3M1KA 3ML2A 1JV0A 4CNRA 5EKJA 3DCSA 4PYXA 4XIWA 3VBDA 1XQ0A 3DCCA 3RZ5A 5FNGA 4N16A 2EU2A 1TEQX 2CABA 1BNWA 5DRSA 3M2NA 4KNJA 3D92A 4R5BA 3HKUA 1V9EA 4KUYA 1HUHA 2FOQA 1CAOA 1HCBA 4YGKA 2CBEA 4DZ9A 1BN1A 3L14A 1CNHA 1G54A 3S71B 1I9NA 3N0NA 5JESB 5G0BA 3U47A 1YO0A 1ZSBA 4Q99A 1TG3A 5HPJA 3S72B 2IT4A 4G7AA 3MDZA 3M98A 1DCBA 1G53A 3OKVA 1YDCA 3IBIA 4Q09A 3T5ZA 3F8EA 4QSIA 5JEGB 1UGEA 1I9OA 3IBNA 3JXHC 3HS4A 1RZDA 3SBIA 4QSAA 1FSNA 3CZVA 4R59A 1LUGA 2AX2A 3DVCA 5DSKA 1OKLA 1OKNA 2CA2A 4RIUA 4MLTA 4Q83A 1BNUA 2CBCA 3FE4A 4QTLA 4BCWA 3FW3A 5DSLA 1RJ5A 4KNMA 4MTYA 2OSMA 4MO8A 3MNUA 4ZAOA 5DOGA 5FDIA 1HUGA 1KEQA 5G03A 3V3JA 2FOYA 2NMXA 1IF6A 2X7UA 5AMGA 4FVOA 5BYIA 5LMDA 2NNSA 4CA2A 2QP6A 5E28A 1HCAA 1XEVA 3MHIA 3IBUA 2HNCA 1CILA 1FQRA 1Y7WA 5JEHB 2NWYA 4E3DA 1XEGA 1BNQA 4Q90A 3KIGA 4HEYA 3MNAA 3N4BA 1I8ZA 3S8XA 1ZGEA 4LU3A 4Z1JA 4M2RA 1CAMA 3BETA 3NI5A 1Z97A 3QYKA 4QK3A 2O4ZA 4COQA 1ZFKA 1KWQA 1FSRA 5BRVA 4Q06A 3MHOA 4Q7PA 5EHEA 4ILXA 1CA2A 2ZNCA 4RFCA 1CVFA 3T83A 1BNTA 4BF6A 1J9WA 4Q07A 1HEBA 3S9TA 3KOKA 4HU1A 4FPTA 3S77B 3OYSA 5E2KA 4XZ5A 2GD8A 4FL7A 3LXEA 5C8IA 4YYTA 3D93A 2NNOA 3C7PA 1BN4A 4HBAA 4ZWXA 4Q78A 3IAIA 2POUA 3MZCA 4KP8A 5EH8A 3P55A 4MDLA 5JG3B 2CBBA 4R5AA 5FLPA 4QJ0A 1CAJA 3U45X 3OKUA 5SZ1A 5SZ5A 1IF8A 3KONA 1DMYA 4K1QA 5DSMA 5JQTA 2Q1BA 1CAYA 4CQ0A 4ITOA 4WW6A 3V5GA 4E3GA 4K0SA 4QEFA 3D8WA 5DSIA 4UOVA 1IF5A 1CVHA 1EOUA 4ZX0A 5JGSB 12CAA 2AW1A 5AMLA 1HEAA 1CRMA 5BRWA 1IF9A 1TTMA 5DSOA 2NN1A 5JQ0A 1UGGA 3PJJA 1CRAA 2VVBX 3DAZA 3M04A 2FOSA 1ZSCA 3M5EA 4QJPA 4YGJA 3R16A 5EOIA 4YGNA 4JS6A 4TWMA 1G0FA 5DSRA 1BNNA 1CVEA 2FNMA 3W6IA 1AM6A 1RZCA 3MNHA 3M5SA 1CVCA 2Q1QA 5A6HA 1CCUA 4E3FA 2QOAA 4M2VA 2Q38A 3ZP9A 3GZ0A 2HKKA 4FIKA 1CVDA 3KNEA 1H9NA 4DZ7A 3M5TA 4WUQA 3RYXB 1CNGA 5FNIA 4WUPA 2POVA 3UYNA 1LG6A 3EFTA 4QK2A 4YVYA 1G45A 1CNBA 5FNLA 4RIVA 3S78B 5E5RA 4KNIA 4Q7WA 3RGEA 2FNKA 1DCAA 5FNJA 4RFDA 5DSPA 1G52A 2NXSA 4YXUA 5FLSA 3NJ9A 2H15A 6CA2A 1HEDA 1BNMA 2CBDA 3RZ7A 1G46A 3M2XA 5CACA 1RZBA 4M2WA 1CNKA 4GL1X 1CALA 2HD6A 1BNVA 2POWA 5CLUA 4PQ7A 4HT2A 4Z1KA 4WL4A 4QJOA 4RH2A 5L6KA 5EZTX 3KOIA 3MMFA 4K13A 5E2SA 3M1JA 3P5AA 4Q8YA 4IWZA 3RG4A 3HKNA 4HT0A 1MOOA 4N0XB 1G48A 3KWAA 1ZNCA 3MYQA 4YGFA 4ETQC 1CZMA 3ZNCA 1MUAA 5SZ0A 1TG9A 1G4OA 5DSJA 3HLJA 3DV7A 4ZWIA 2W2JA 2HL4A 4L5VA 5SZ7A 3KS3A 4XFWA 2EU3A 4QSBA 3IEOA 2FW4A 3D9ZA 4L5UA 3M2YA 4KP5A 5A25A 5DSNA 1G0EA 5DVXA 4FU5A 5EIJA 4QIYA 3BL1A 5JEPB 3OIMA 3Q31A 3FFPX 4PZHA 1G3ZA 4ZX1A 1CNJA 1ZGFA 1G1DA 3KKXA 3RYYA 2GEHA 3T85A 2NN7A 3K2FA 4Q8ZA 1I9LA 3V2MA 5BNLA 1BN3A 4QSJA 4YHAA 4YWPA 3MNJA 3RZ0B 1G4JA 2HOCA 1F2WA 3SAPA 2FOVA 3MHCA 1IF7A 3OILA 3RYZA 1TE3X 1CINA 4KNNA 4HEWA 4CNWA 5JDVB 3P44A 3P3HA 3M2ZA 1XPZA 1CCSA 1CAKA 1CNWA 2QO8A 3KLDB 4KV0A 3M96A 1CAHA 3V3HB 4YXOA 3P5LA 4Q7SA 4Z1NA 4RUYA 3W6HA 5SZ6A 3RZ8A 3IGPA 3HFPA 4MDGA 3T84A 4KAPA 4XE1A 3RJ7A 1BICA 3T5UA 3MNIA 3S75B 5SZ2A 3DC9A 3RYVB 5SZ4A 3RYJB 5CA2A 1LGDA 3DVDA 4FRCA 1FSQA 3DA2A 1ZFQA 5CJFA 1I90A 3MNKA 1URTA 1RAYA 3M14A 3BL0A 4FVNA 1KOPA 1HECA 4L5WA 1FR4A 5E2MA 4QY3A 4HF3A 4E4AA 4QK1A 1CVBA 4XIXA 3B4FA 4M2UA 3RG3A 1CNCA 2NWOA 4YX4A 4ZWZA 1HVAA 2WEGA 3V3GB 5FNKA 1I9PA 2OSFA 5EKHA 3R17B 4YGLA 4MLXA 2FMGA 5L3OA 5DSQA 4QJWA 3K34A 5IPZA 1A42A 4LHIA 5SZ3A 2VVAX 1I9MA 4KUVA 1IF4A 3DBUA 1LG5A 3JXGA 3MHLA 1I9QA 2EZ7A 1G6VA 1CANA 5FL6A 3JXFA 2FOUA 3CA2A 1UGBA 4PYYA 2NNGA 3F4XA 5E2NA 4JSWA 1CNYA 1CAZA 1YDBA 3IBLA 1H9QA 5JG5B 4CNXA 1YDAA 3DVBA 5DOHA 3S74B 2H4NA 3M3XA 5EH7A 3S76A 1CA3A 5AMDA 3M1WA 1UGAA 4Q49A 5FLQA 3M40A 4RN4A 1TH9A 1T9NA 3V7XA 4WW8A 1KWRA 5FL5A 2HFWA 4JSZA 4TWLA 3U7CA 2CBAA 2WD2A 3D0NA 2WEJA 5FLOA 1CNXA 1CNIA 2ILIA 7CA2A 3M67A 2WD3A 1OKMA 4HEZA 3OIKA 3OY0A 3F7UA 1OQ5A 9CA2A 3TVNX 3S97A 3SAXA 4C3TA 4ITPA 1YO1A 1YO2A 5FDCA 3RZ1B 3P4VA 3DD0A 1FLJA 5EHVA 3DC3A 4E49A 1TEUX 4LP6A 1FQNA 4Q08A 1AZMA 4G0CA 4QIZA 1ZSAA 4Q6EA 1LZVA 4Q9YA 5FLRA 5FNHA 4JSSA 1THKA 2NNVA 4JSAA 2NXTA 3V3IB 4KUWA 1RZEA 4RUXA 4E3HA 1FQMA 5JGTB 5BRUA 4E9OX 1CIMA 2FNNA 2X7SA 3EFIA 1TBTX 4X5SA 1CVAA 4Q0LA 3HKTA 4Q8XA 5E2RA 1ZE8A 5FLTA 3DCWA 3M1QA 1JD0A 4K0ZA 1UGDA 3RLDA 1CCTA 3HKQA 4RUZA 4ZWYA 3DD8A 1KOQA 4E5QA 3N2PA 4Q6DA 3TVOX 5EKMA 1CAIA 4WR7A 1BCDA 4Z0QA 1RJ6A 4Y0JA 4CNVA 3UYQA 1V9IC 3V2JA 1RZAA 4MDMA 3MWOA 3U3AX 2FMZA 1UGFA 1AVNA 3OYQA 1H4NA 2ABEA 5FL4A 4YXIA 3T82A 5EH5A 4QJXA 1FR7A 1Z93A 1FQLA 1JCZA 5EHWA 2NWZA 1TB0X 3S73B 5J8ZA 3N3JA 3V3FA
chains in the Genus database with same CATH superfamily
2X7TA 4QJMA 3CAJA 4Q7VA 3MHMA 3PYKA 4K0TA 1DMXA 1BV3A 3P3JA 3PO6A 5G0CA 3TMJA 4CACA 1I91A 3SBHA 4Q87A 5FNMA 4Z1EA 8CA2A 1Z9YA 3NB5A 3P58A 1BZMA 2NWPA 5E5UA 3CYUA 4BF1A 2NXRA 1UGCA 2F14A 1RAZA 4Q81A 3F7BA 4PXXA 1ZH9A 3B1BA 3ML5A 4IDRX 5G01A 2WEHA 3K7KA 2WEOA 1YDDA 3M1KA 3ML2A 1JV0A 4CNRA 5EKJA 3DCSA 4PYXA 4XIWA 3VBDA 1XQ0A 3DCCA 3RZ5A 5FNGA 4N16A 2EU2A 1TEQX 2CABA 1BNWA 5DRSA 3M2NA 4KNJA 3D92A 4R5BA 3HKUA 1V9EA 4KUYA 1HUHA 2FOQA 1CAOA 1HCBA 4YGKA 2CBEA 4DZ9A 1BN1A 3L14A 1CNHA 1G54A 3S71B 1I9NA 3N0NA 5JESB 5G0BA 3U47A 1YO0A 1ZSBA 4Q99A 1TG3A 5HPJA 3S72B 2IT4A 4G7AA 3MDZA 3M98A 1DCBA 1G53A 3OKVA 1YDCA 3IBIA 4Q09A 3T5ZA 3F8EA 4QSIA 5JEGB 1UGEA 1I9OA 3IBNA 3JXHC 3HS4A 1RZDA 3SBIA 4QSAA 1FSNA 3CZVA 4R59A 1LUGA 2AX2A 3DVCA 5DSKA 1OKLA 1OKNA 2CA2A 4RIUA 4MLTA 4Q83A 1BNUA 2CBCA 3FE4A 4QTLA 4BCWA 3FW3A 5DSLA 1RJ5A 4KNMA 4MTYA 2OSMA 4MO8A 3MNUA 4ZAOA 5DOGA 5FDIA 1HUGA 1KEQA 5G03A 3V3JA 2FOYA 2NMXA 1IF6A 2X7UA 5AMGA 4FVOA 5BYIA 5LMDA 2NNSA 4CA2A 2QP6A 5E28A 1HCAA 1XEVA 3MHIA 3IBUA 2HNCA 1CILA 1FQRA 1Y7WA 5JEHB 2NWYA 4E3DA 1XEGA 1BNQA 4Q90A 3KIGA 4HEYA 3MNAA 3N4BA 1I8ZA 3S8XA 1ZGEA 4LU3A 4Z1JA 4M2RA 1CAMA 3BETA 3NI5A 1Z97A 3QYKA 4QK3A 2O4ZA 4COQA 1ZFKA 1KWQA 1FSRA 5BRVA 4Q06A 3MHOA 4Q7PA 5EHEA 4ILXA 1CA2A 2ZNCA 4RFCA 1CVFA 3T83A 1BNTA 4BF6A 1J9WA 4Q07A 1HEBA 3S9TA 3KOKA 4HU1A 4FPTA 3S77B 3OYSA 5E2KA 4XZ5A 2GD8A 4FL7A 3LXEA 5C8IA 4YYTA 3D93A 2NNOA 3C7PA 1BN4A 4HBAA 4ZWXA 4Q78A 3IAIA 2POUA 3MZCA 4KP8A 5EH8A 3P55A 4MDLA 5JG3B 2CBBA 4R5AA 5FLPA 4QJ0A 1CAJA 3U45X 3OKUA 5SZ1A 5SZ5A 1IF8A 3KONA 1DMYA 4K1QA 5DSMA 5JQTA 2Q1BA 1CAYA 4CQ0A 4ITOA 4WW6A 3V5GA 4E3GA 4K0SA 4QEFA 3D8WA 5DSIA 4UOVA 1IF5A 1CVHA 1EOUA 4ZX0A 5JGSB 12CAA 2AW1A 5AMLA 1HEAA 1CRMA 5BRWA 1IF9A 1TTMA 5DSOA 2NN1A 5JQ0A 1UGGA 3PJJA 1CRAA 2VVBX 3DAZA 3M04A 2FOSA 1ZSCA 3M5EA 4QJPA 4YGJA 3R16A 5EOIA 4YGNA 4JS6A 4TWMA 1G0FA 5DSRA 1BNNA 1CVEA 2FNMA 3W6IA 1AM6A 1RZCA 3MNHA 3M5SA 1CVCA 2Q1QA 5A6HA 1CCUA 4E3FA 2QOAA 4M2VA 2Q38A 3ZP9A 3GZ0A 2HKKA 4FIKA 1CVDA 3KNEA 1H9NA 4DZ7A 3M5TA 4WUQA 3RYXB 1CNGA 5FNIA 4WUPA 2POVA 3UYNA 1LG6A 3EFTA 4QK2A 4YVYA 1G45A 1CNBA 5FNLA 4RIVA 3S78B 5E5RA 4KNIA 4Q7WA 3RGEA 2FNKA 1DCAA 5FNJA 4RFDA 5DSPA 1G52A 2NXSA 4YXUA 5FLSA 3NJ9A 2H15A 6CA2A 1HEDA 1BNMA 2CBDA 3RZ7A 1G46A 3M2XA 5CACA 1RZBA 4M2WA 1CNKA 4GL1X 1CALA 2HD6A 1BNVA 2POWA 5CLUA 4PQ7A 4HT2A 4Z1KA 4WL4A 4QJOA 4RH2A 5L6KA 5EZTX 3KOIA 3MMFA 4K13A 5E2SA 3M1JA 3P5AA 4Q8YA 4IWZA 3RG4A 3HKNA 4HT0A 1MOOA 4N0XB 1G48A 3KWAA 1ZNCA 3MYQA 4YGFA 4ETQC 1CZMA 3ZNCA 1MUAA 5SZ0A 1TG9A 1G4OA 5DSJA 3HLJA 3DV7A 4ZWIA 2W2JA 2HL4A 4L5VA 5SZ7A 3KS3A 4XFWA 2EU3A 4QSBA 3IEOA 2FW4A 3D9ZA 4L5UA 3M2YA 4KP5A 5A25A 5DSNA 1G0EA 5DVXA 4FU5A 5EIJA 4QIYA 3BL1A 5JEPB 3OIMA 3Q31A 3FFPX 4PZHA 1G3ZA 4ZX1A 1CNJA 1ZGFA 1G1DA 3KKXA 3RYYA 2GEHA 3T85A 2NN7A 3K2FA 4Q8ZA 1I9LA 3V2MA 5BNLA 1BN3A 4QSJA 4YHAA 4YWPA 3MNJA 3RZ0B 1G4JA 2HOCA 1F2WA 3SAPA 2FOVA 3MHCA 1IF7A 3OILA 3RYZA 1TE3X 1CINA 4KNNA 4HEWA 4CNWA 5JDVB 3P44A 3P3HA 3M2ZA 1XPZA 1CCSA 1CAKA 1CNWA 2QO8A 3KLDB 4KV0A 3M96A 1CAHA 3V3HB 4YXOA 3P5LA 4Q7SA 4Z1NA 4RUYA 3W6HA 5SZ6A 3RZ8A 3IGPA 3HFPA 4MDGA 3T84A 4KAPA 4XE1A 3RJ7A 1BICA 3T5UA 3MNIA 3S75B 5SZ2A 3DC9A 3RYVB 5SZ4A 3RYJB 5CA2A 1LGDA 3DVDA 4FRCA 1FSQA 3DA2A 1ZFQA 5CJFA 1I90A 3MNKA 1URTA 1RAYA 3M14A 3BL0A 4FVNA 1KOPA 1HECA 4L5WA 1FR4A 5E2MA 4QY3A 4HF3A 4E4AA 4QK1A 1CVBA 4XIXA 3B4FA 4M2UA 3RG3A 1CNCA 2NWOA 4YX4A 4ZWZA 1HVAA 2WEGA 3V3GB 5FNKA 1I9PA 2OSFA 5EKHA 3R17B 4YGLA 4MLXA 2FMGA 5L3OA 5DSQA 4QJWA 3K34A 5IPZA 1A42A 4LHIA 5SZ3A 2VVAX 1I9MA 4KUVA 1IF4A 3DBUA 1LG5A 3JXGA 3MHLA 1I9QA 2EZ7A 1G6VA 1CANA 5FL6A 3JXFA 2FOUA 3CA2A 1UGBA 4PYYA 2NNGA 3F4XA 5E2NA 4JSWA 1CNYA 1CAZA 1YDBA 3IBLA 1H9QA 5JG5B 4CNXA 1YDAA 3DVBA 5DOHA 3S74B 2H4NA 3M3XA 5EH7A 3S76A 1CA3A 5AMDA 3M1WA 1UGAA 4Q49A 5FLQA 3M40A 4RN4A 1TH9A 1T9NA 3V7XA 4WW8A 1KWRA 5FL5A 2HFWA 4JSZA 4TWLA 3U7CA 2CBAA 2WD2A 3D0NA 2WEJA 5FLOA 1CNXA 1CNIA 2ILIA 7CA2A 3M67A 2WD3A 1OKMA 4HEZA 3OIKA 3OY0A 3F7UA 1OQ5A 9CA2A 3TVNX 3S97A 3SAXA 4C3TA 4ITPA 1YO1A 1YO2A 5FDCA 3RZ1B 3P4VA 3DD0A 1FLJA 5EHVA 3DC3A 4E49A 1TEUX 4LP6A 1FQNA 4Q08A 1AZMA 4G0CA 4QIZA 1ZSAA 4Q6EA 1LZVA 4Q9YA 5FLRA 5FNHA 4JSSA 1THKA 2NNVA 4JSAA 2NXTA 3V3IB 4KUWA 1RZEA 4RUXA 4E3HA 1FQMA 5JGTB 5BRUA 4E9OX 1CIMA 2FNNA 2X7SA 3EFIA 1TBTX 4X5SA 1CVAA 4Q0LA 3HKTA 4Q8XA 5E2RA 1ZE8A 5FLTA 3DCWA 3M1QA 1JD0A 4K0ZA 1UGDA 3RLDA 1CCTA 3HKQA 4RUZA 4ZWYA 3DD8A 1KOQA 4E5QA 3N2PA 4Q6DA 3TVOX 5EKMA 1CAIA 4WR7A 1BCDA 4Z0QA 1RJ6A 4Y0JA 4CNVA 3UYQA 1V9IC 3V2JA 1RZAA 4MDMA 3MWOA 3U3AX 2FMZA 1UGFA 1AVNA 3OYQA 1H4NA 2ABEA 5FL4A 4YXIA 3T82A 5EH5A 4QJXA 1FR7A 1Z93A 1FQLA 1JCZA 5EHWA 2NWZA 1TB0X 3S73B 5J8ZA 3N3JA 3V3FA
chains in the Genus database with same CATH topology
2X7TA 4QJMA 3CAJA 4Q7VA 3MHMA 3PYKA 4K0TA 1DMXA 1BV3A 3P3JA 3PO6A 5G0CA 3TMJA 4CACA 1I91A 3SBHA 4Q87A 5FNMA 4Z1EA 8CA2A 1Z9YA 3NB5A 3P58A 1BZMA 2NWPA 5E5UA 3CYUA 4BF1A 2NXRA 1UGCA 2F14A 1RAZA 4Q81A 3F7BA 4PXXA 1ZH9A 3B1BA 3ML5A 4IDRX 5G01A 2WEHA 3K7KA 2WEOA 1YDDA 3M1KA 3ML2A 1JV0A 4CNRA 5EKJA 3DCSA 4PYXA 4XIWA 3VBDA 1XQ0A 3DCCA 3RZ5A 5FNGA 4N16A 2EU2A 1TEQX 2CABA 1BNWA 5DRSA 3M2NA 4KNJA 3D92A 4R5BA 3HKUA 1V9EA 4KUYA 1HUHA 2FOQA 1CAOA 1HCBA 4YGKA 2CBEA 4DZ9A 1BN1A 3L14A 1CNHA 1G54A 3S71B 1I9NA 3N0NA 5JESB 5G0BA 3U47A 1YO0A 1ZSBA 4Q99A 1TG3A 5HPJA 3S72B 2IT4A 4G7AA 3MDZA 3M98A 1DCBA 1G53A 3OKVA 1YDCA 3IBIA 4Q09A 3T5ZA 3F8EA 4QSIA 5JEGB 1UGEA 1I9OA 3IBNA 3JXHC 3HS4A 1RZDA 3SBIA 4QSAA 1FSNA 3CZVA 4R59A 1LUGA 2AX2A 3DVCA 5DSKA 1OKLA 1OKNA 2CA2A 4RIUA 4MLTA 4Q83A 1BNUA 2CBCA 3FE4A 4QTLA 4BCWA 3FW3A 5DSLA 1RJ5A 4KNMA 4MTYA 2OSMA 4MO8A 3MNUA 4ZAOA 5DOGA 5FDIA 1HUGA 1KEQA 5G03A 3V3JA 2FOYA 2NMXA 1IF6A 2X7UA 5AMGA 4FVOA 5BYIA 5LMDA 2NNSA 4CA2A 2QP6A 5E28A 1HCAA 1XEVA 3MHIA 3IBUA 2HNCA 1CILA 1FQRA 1Y7WA 5JEHB 2NWYA 4E3DA 1XEGA 1BNQA 4Q90A 3KIGA 4HEYA 3MNAA 3N4BA 1I8ZA 3S8XA 1ZGEA 4LU3A 4Z1JA 4M2RA 1CAMA 3BETA 3NI5A 1Z97A 3QYKA 4QK3A 2O4ZA 4COQA 1ZFKA 1KWQA 1FSRA 5BRVA 4Q06A 3MHOA 4Q7PA 5EHEA 4ILXA 1CA2A 2ZNCA 4RFCA 1CVFA 3T83A 1BNTA 4BF6A 1J9WA 4Q07A 1HEBA 3S9TA 3KOKA 4HU1A 4FPTA 3S77B 3OYSA 5E2KA 4XZ5A 2GD8A 4FL7A 3LXEA 5C8IA 4YYTA 3D93A 2NNOA 3C7PA 1BN4A 4HBAA 4ZWXA 4Q78A 3IAIA 2POUA 3MZCA 4KP8A 5EH8A 3P55A 4MDLA 5JG3B 2CBBA 4R5AA 5FLPA 4QJ0A 1CAJA 3U45X 3OKUA 5SZ1A 5SZ5A 1IF8A 3KONA 1DMYA 4K1QA 5DSMA 5JQTA 2Q1BA 1CAYA 4CQ0A 4ITOA 4WW6A 3V5GA 4E3GA 4K0SA 4QEFA 3D8WA 5DSIA 4UOVA 1IF5A 1CVHA 1EOUA 4ZX0A 5JGSB 12CAA 2AW1A 5AMLA 1HEAA 1CRMA 5BRWA 1IF9A 1TTMA 5DSOA 2NN1A 5JQ0A 1UGGA 3PJJA 1CRAA 2VVBX 3DAZA 3M04A 2FOSA 1ZSCA 3M5EA 4QJPA 4YGJA 3R16A 5EOIA 4YGNA 4JS6A 4TWMA 1G0FA 5DSRA 1BNNA 1CVEA 2FNMA 3W6IA 1AM6A 1RZCA 3MNHA 3M5SA 1CVCA 2Q1QA 5A6HA 1CCUA 4E3FA 2QOAA 4M2VA 2Q38A 3ZP9A 3GZ0A 2HKKA 4FIKA 1CVDA 3KNEA 1H9NA 4DZ7A 3M5TA 4WUQA 3RYXB 1CNGA 5FNIA 4WUPA 2POVA 3UYNA 1LG6A 3EFTA 4QK2A 4YVYA 1G45A 1CNBA 5FNLA 4RIVA 3S78B 5E5RA 4KNIA 4Q7WA 3RGEA 2FNKA 1DCAA 5FNJA 4RFDA 5DSPA 1G52A 2NXSA 4YXUA 5FLSA 3NJ9A 2H15A 6CA2A 1HEDA 1BNMA 2CBDA 3RZ7A 1G46A 3M2XA 5CACA 1RZBA 4M2WA 1CNKA 4GL1X 1CALA 2HD6A 1BNVA 2POWA 5CLUA 4PQ7A 4HT2A 4Z1KA 4WL4A 4QJOA 4RH2A 5L6KA 5EZTX 3KOIA 3MMFA 4K13A 5E2SA 3M1JA 3P5AA 4Q8YA 4IWZA 3RG4A 3HKNA 4HT0A 1MOOA 4N0XB 1G48A 3KWAA 1ZNCA 3MYQA 4YGFA 4ETQC 1CZMA 3ZNCA 1MUAA 5SZ0A 1TG9A 1G4OA 5DSJA 3HLJA 3DV7A 4ZWIA 2W2JA 2HL4A 4L5VA 5SZ7A 3KS3A 4XFWA 2EU3A 4QSBA 3IEOA 2FW4A 3D9ZA 4L5UA 3M2YA 4KP5A 5A25A 5DSNA 1G0EA 5DVXA 4FU5A 5EIJA 4QIYA 3BL1A 5JEPB 3OIMA 3Q31A 3FFPX 4PZHA 1G3ZA 4ZX1A 1CNJA 1ZGFA 1G1DA 3KKXA 3RYYA 2GEHA 3T85A 2NN7A 3K2FA 4Q8ZA 1I9LA 3V2MA 5BNLA 1BN3A 4QSJA 4YHAA 4YWPA 3MNJA 3RZ0B 1G4JA 2HOCA 1F2WA 3SAPA 2FOVA 3MHCA 1IF7A 3OILA 3RYZA 1TE3X 1CINA 4KNNA 4HEWA 4CNWA 5JDVB 3P44A 3P3HA 3M2ZA 1XPZA 1CCSA 1CAKA 1CNWA 2QO8A 3KLDB 4KV0A 3M96A 1CAHA 3V3HB 4YXOA 3P5LA 4Q7SA 4Z1NA 4RUYA 3W6HA 5SZ6A 3RZ8A 3IGPA 3HFPA 4MDGA 3T84A 4KAPA 4XE1A 3RJ7A 1BICA 3T5UA 3MNIA 3S75B 5SZ2A 3DC9A 3RYVB 5SZ4A 3RYJB 5CA2A 1LGDA 3DVDA 4FRCA 1FSQA 3DA2A 1ZFQA 5CJFA 1I90A 3MNKA 1URTA 1RAYA 3M14A 3BL0A 4FVNA 1KOPA 1HECA 4L5WA 1FR4A 5E2MA 4QY3A 4HF3A 4E4AA 4QK1A 1CVBA 4XIXA 3B4FA 4M2UA 3RG3A 1CNCA 2NWOA 4YX4A 4ZWZA 1HVAA 2WEGA 3V3GB 5FNKA 1I9PA 2OSFA 5EKHA 3R17B 4YGLA 4MLXA 2FMGA 5L3OA 5DSQA 4QJWA 3K34A 5IPZA 1A42A 4LHIA 5SZ3A 2VVAX 1I9MA 4KUVA 1IF4A 3DBUA 1LG5A 3JXGA 3MHLA 1I9QA 2EZ7A 1G6VA 1CANA 5FL6A 3JXFA 2FOUA 3CA2A 1UGBA 4PYYA 2NNGA 3F4XA 5E2NA 4JSWA 1CNYA 1CAZA 1YDBA 3IBLA 1H9QA 5JG5B 4CNXA 1YDAA 3DVBA 5DOHA 3S74B 2H4NA 3M3XA 5EH7A 3S76A 1CA3A 5AMDA 3M1WA 1UGAA 4Q49A 5FLQA 3M40A 4RN4A 1TH9A 1T9NA 3V7XA 4WW8A 1KWRA 5FL5A 2HFWA 4JSZA 4TWLA 3U7CA 2CBAA 2WD2A 3D0NA 2WEJA 5FLOA 1CNXA 1CNIA 2ILIA 7CA2A 3M67A 2WD3A 1OKMA 4HEZA 3OIKA 3OY0A 3F7UA 1OQ5A 9CA2A 3TVNX 3S97A 3SAXA 4C3TA 4ITPA 1YO1A 1YO2A 5FDCA 3RZ1B 3P4VA 3DD0A 1FLJA 5EHVA 3DC3A 4E49A 1TEUX 4LP6A 1FQNA 4Q08A 1AZMA 4G0CA 4QIZA 1ZSAA 4Q6EA 1LZVA 4Q9YA 5FLRA 5FNHA 4JSSA 1THKA 2NNVA 4JSAA 2NXTA 3V3IB 4KUWA 1RZEA 4RUXA 4E3HA 1FQMA 5JGTB 5BRUA 4E9OX 1CIMA 2FNNA 2X7SA 3EFIA 1TBTX 4X5SA 1CVAA 4Q0LA 3HKTA 4Q8XA 5E2RA 1ZE8A 5FLTA 3DCWA 3M1QA 1JD0A 4K0ZA 1UGDA 3RLDA 1CCTA 3HKQA 4RUZA 4ZWYA 3DD8A 1KOQA 4E5QA 3N2PA 4Q6DA 3TVOX 5EKMA 1CAIA 4WR7A 1BCDA 4Z0QA 1RJ6A 4Y0JA 4CNVA 3UYQA 1V9IC 3V2JA 1RZAA 4MDMA 3MWOA 3U3AX 2FMZA 1UGFA 1AVNA 3OYQA 1H4NA 2ABEA 5FL4A 4YXIA 3T82A 5EH5A 4QJXA 1FR7A 1Z93A 1FQLA 1JCZA 5EHWA 2NWZA 1TB0X 3S73B 5J8ZA 3N3JA 3V3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X7T A;  4QJM A;  3CAJ A;  4Q7V A;  3MHM A;  3PYK A;  4K0T A;  1DMX A;  1BV3 A;  3P3J A;  3PO6 A;  5G0C A;  3TMJ A;  4CAC A;  1I91 A;  3SBH A;  4Q87 A;  5FNM A;  4Z1E A;  8CA2 A;  1Z9Y A;  3NB5 A;  3P58 A;  1BZM A;  2NWP A;  5E5U A;  3CYU A;  4BF1 A;  2NXR A;  1UGC A;  2F14 A;  1RAZ A;  4Q81 A;  3F7B A;  4PXX A;  1ZH9 A;  3B1B A;  3ML5 A;  4IDR X;  5G01 A;  2WEH A;  3K7K A;  2WEO A;  1YDD A;  3M1K A;  3ML2 A;  1JV0 A;  4CNR A;  5EKJ A;  3DCS A;  4PYX A;  4XIW A;  3VBD A;  1XQ0 A;  3DCC A;  3RZ5 A;  5FNG A;  4N16 A;  2EU2 A;  1TEQ X;  2CAB A;  1BNW A;  5DRS A;  3M2N A;  4KNJ A;  3D92 A;  4R5B A;  3HKU A;  1V9E A;  4KUY A;  1HUH A;  2FOQ A;  1CAO A;  1HCB A;  4YGK A;  2CBE A;  4DZ9 A;  1BN1 A;  3L14 A;  1CNH A;  1G54 A;  3S71 B;  1I9N A;  3N0N A;  5JES B;  5G0B A;  3U47 A;  1YO0 A;  1ZSB A;  4Q99 A;  1TG3 A;  5HPJ A;  3S72 B;  2IT4 A;  4G7A A;  3MDZ A;  3M98 A;  1DCB A;  1G53 A;  3OKV A;  1YDC A;  3IBI A;  4Q09 A;  3T5Z A;  3F8E A;  4QSI A;  5JEG B;  1UGE A;  1I9O A;  3IBN A;  3JXH C;  3HS4 A;  1RZD A;  3SBI A;  4QSA A;  1FSN A;  3CZV A;  4R59 A;  1LUG A;  2AX2 A;  3DVC A;  5DSK A;  1OKL A;  1OKN A;  2CA2 A;  4RIU A;  4MLT A;  4Q83 A;  1BNU A;  2CBC A;  3FE4 A;  4QTL A;  4BCW A;  3FW3 A;  5DSL A;  1RJ5 A;  4KNM A;  4MTY A;  2OSM A;  4MO8 A;  3MNU A;  4ZAO A;  5DOG A;  5FDI A;  1HUG A;  1KEQ A;  5G03 A;  3V3J A;  2FOY A;  2NMX A;  1IF6 A;  2X7U A;  5AMG A;  4FVO A;  5BYI A;  5LMD A;  2NNS A;  4CA2 A;  2QP6 A;  5E28 A;  1HCA A;  1XEV A;  3MHI A;  3IBU A;  2HNC A;  1CIL A;  1FQR A;  1Y7W A;  5JEH B;  2NWY A;  4E3D A;  1XEG A;  1BNQ A;  4Q90 A;  3KIG A;  4HEY A;  3MNA A;  3N4B A;  1I8Z A;  3S8X A;  1ZGE A;  4LU3 A;  4Z1J A;  4M2R A;  1CAM A;  3BET A;  3NI5 A;  1Z97 A;  3QYK A;  4QK3 A;  2O4Z A;  4COQ A;  1ZFK A;  1KWQ A;  1FSR A;  5BRV A;  4Q06 A;  3MHO A;  4Q7P A;  5EHE A;  4ILX A;  1CA2 A;  2ZNC A;  4RFC A;  1CVF A;  3T83 A;  1BNT A;  4BF6 A;  1J9W A;  4Q07 A;  1HEB A;  3S9T A;  3KOK A;  4HU1 A;  4FPT A;  3S77 B;  3OYS A;  5E2K A;  4XZ5 A;  2GD8 A;  4FL7 A;  3LXE A;  5C8I A;  4YYT A;  3D93 A;  2NNO A;  3C7P A;  1BN4 A;  4HBA A;  4ZWX A;  4Q78 A;  3IAI A;  2POU A;  3MZC A;  4KP8 A;  5EH8 A;  3P55 A;  4MDL A;  5JG3 B;  2CBB A;  4R5A A;  5FLP A;  4QJ0 A;  1CAJ A;  3U45 X;  3OKU A;  5SZ1 A;  5SZ5 A;  1IF8 A;  3KON A;  1DMY A;  4K1Q A;  5DSM A;  5JQT A;  2Q1B A;  1CAY A;  4CQ0 A;  4ITO A;  4WW6 A;  3V5G A;  4E3G A;  4K0S A;  4QEF A;  3D8W A;  5DSI A;  4UOV A;  1IF5 A;  1CVH A;  1EOU A;  4ZX0 A;  5JGS B;  12CA A;  2AW1 A;  5AML A;  1HEA A;  1CRM A;  5BRW A;  1IF9 A;  1TTM A;  5DSO A;  2NN1 A;  5JQ0 A;  1UGG A;  3PJJ A;  1CRA A;  2VVB X;  3DAZ A;  3M04 A;  2FOS A;  1ZSC A;  3M5E A;  4QJP A;  4YGJ A;  3R16 A;  5EOI A;  4YGN A;  4JS6 A;  4TWM A;  1G0F A;  5DSR A;  1BNN A;  1CVE A;  2FNM A;  3W6I A;  1AM6 A;  1RZC A;  3MNH A;  3M5S A;  1CVC A;  2Q1Q A;  5A6H A;  1CCU A;  4E3F A;  2QOA A;  4M2V A;  2Q38 A;  3ZP9 A;  3GZ0 A;  2HKK A;  4FIK A;  1CVD A;  3KNE A;  1H9N A;  4DZ7 A;  3M5T A;  4WUQ A;  3RYX B;  1CNG A;  5FNI A;  4WUP A;  2POV A;  3UYN A;  1LG6 A;  3EFT A;  4QK2 A;  4YVY A;  1G45 A;  1CNB A;  5FNL A;  4RIV A;  3S78 B;  5E5R A;  4KNI A;  4Q7W A;  3RGE A;  2FNK A;  1DCA A;  5FNJ A;  4RFD A;  5DSP A;  1G52 A;  2NXS A;  4YXU A;  5FLS A;  3NJ9 A;  2H15 A;  6CA2 A;  1HED A;  1BNM A;  2CBD A;  3RZ7 A;  1G46 A;  3M2X A;  5CAC A;  1RZB A;  4M2W A;  1CNK A;  4GL1 X;  1CAL A;  2HD6 A;  1BNV A;  2POW A;  5CLU A;  4PQ7 A;  4HT2 A;  4Z1K A;  4WL4 A;  4QJO A;  4RH2 A;  5L6K A;  5EZT X;  3KOI A;  3MMF A;  4K13 A;  5E2S A;  3M1J A;  3P5A A;  4Q8Y A;  4IWZ A;  3RG4 A;  3HKN A;  4HT0 A;  1MOO A;  4N0X B;  1G48 A;  3KWA A;  1ZNC A;  3MYQ A;  4YGF A;  4ETQ C;  1CZM A;  3ZNC A;  1MUA A;  5SZ0 A;  1TG9 A;  1G4O A;  5DSJ A;  3HLJ A;  3DV7 A;  4ZWI A;  2W2J A;  2HL4 A;  4L5V A;  5SZ7 A;  3KS3 A;  4XFW A;  2EU3 A;  4QSB A;  3IEO A;  2FW4 A;  3D9Z A;  4L5U A;  3M2Y A;  4KP5 A;  5A25 A;  5DSN A;  1G0E A;  5DVX A;  4FU5 A;  5EIJ A;  4QIY A;  3BL1 A;  5JEP B;  3OIM A;  3Q31 A;  3FFP X;  4PZH A;  1G3Z A;  4ZX1 A;  1CNJ A;  1ZGF A;  1G1D A;  3KKX A;  3RYY A;  2GEH A;  3T85 A;  2NN7 A;  3K2F A;  4Q8Z A;  1I9L A;  3V2M A;  5BNL A;  1BN3 A;  4QSJ A;  4YHA A;  4YWP A;  3MNJ A;  3RZ0 B;  1G4J A;  2HOC A;  1F2W A;  3SAP A;  2FOV A;  3MHC A;  1IF7 A;  3OIL A;  3RYZ A;  1TE3 X;  1CIN A;  4KNN A;  4HEW A;  4CNW A;  5JDV B;  3P44 A;  3P3H A;  3M2Z A;  1XPZ A;  1CCS A;  1CAK A;  1CNW A;  2QO8 A;  3KLD B;  4KV0 A;  3M96 A;  1CAH A;  3V3H B;  4YXO A;  3P5L A;  4Q7S A;  4Z1N A;  4RUY A;  3W6H A;  5SZ6 A;  3RZ8 A;  3IGP A;  3HFP A;  4MDG A;  3T84 A;  4KAP A;  4XE1 A;  3RJ7 A;  1BIC A;  3T5U A;  3MNI A;  3S75 B;  5SZ2 A;  3DC9 A;  3RYV B;  5SZ4 A;  3RYJ B;  5CA2 A;  1LGD A;  3DVD A;  4FRC A;  1FSQ A;  3DA2 A;  1ZFQ A;  5CJF A;  1I90 A;  3MNK A;  1URT A;  1RAY A;  3M14 A;  3BL0 A;  4FVN A;  1KOP A;  1HEC A;  4L5W A;  1FR4 A;  5E2M A;  4QY3 A;  4HF3 A;  4E4A A;  4QK1 A;  1CVB A;  4XIX A;  3B4F A;  4M2U A;  3RG3 A;  1CNC A;  2NWO A;  4YX4 A;  4ZWZ A;  1HVA A;  2WEG A;  3V3G B;  5FNK A;  1I9P A;  2OSF A;  5EKH A;  3R17 B;  4YGL A;  4MLX A;  2FMG A;  5L3O A;  5DSQ A;  4QJW A;  3K34 A;  5IPZ A;  1A42 A;  4LHI A;  5SZ3 A;  2VVA X;  1I9M A;  4KUV A;  1IF4 A;  3DBU A;  1LG5 A;  3JXG A;  3MHL A;  1I9Q A;  2EZ7 A;  1G6V A;  1CAN A;  5FL6 A;  3JXF A;  2FOU A;  3CA2 A;  1UGB A;  4PYY A;  2NNG A;  3F4X A;  5E2N A;  4JSW A;  1CNY A;  1CAZ A;  1YDB A;  3IBL A;  1H9Q A;  5JG5 B;  4CNX A;  1YDA A;  3DVB A;  5DOH A;  3S74 B;  2H4N A;  3M3X A;  5EH7 A;  3S76 A;  1CA3 A;  5AMD A;  3M1W A;  1UGA A;  4Q49 A;  5FLQ A;  3M40 A;  4RN4 A;  1TH9 A;  1T9N A;  3V7X A;  4WW8 A;  1KWR A;  5FL5 A;  2HFW A;  4JSZ A;  4TWL A;  3U7C A;  2CBA A;  2WD2 A;  3D0N A;  2WEJ A;  5FLO A;  1CNX A;  1CNI A;  2ILI A;  7CA2 A;  3M67 A;  2WD3 A;  1OKM A;  4HEZ A;  3OIK A;  3OY0 A;  3F7U A;  1OQ5 A;  9CA2 A;  3TVN X;  3S97 A;  3SAX A;  4C3T A;  4ITP A;  1YO1 A;  1YO2 A;  5FDC A;  3RZ1 B;  3P4V A;  3DD0 A;  1FLJ A;  5EHV A;  3DC3 A;  4E49 A;  1TEU X;  4LP6 A;  1FQN A;  4Q08 A;  1AZM A;  4G0C A;  4QIZ A;  1ZSA A;  4Q6E A;  1LZV A;  4Q9Y A;  5FLR A;  5FNH A;  4JSS A;  1THK A;  2NNV A;  4JSA A;  2NXT A;  3V3I B;  4KUW A;  1RZE A;  4RUX A;  4E3H A;  1FQM A;  5JGT B;  5BRU A;  4E9O X;  1CIM A;  2FNN A;  2X7S A;  3EFI A;  1TBT X;  4X5S A;  1CVA A;  4Q0L A;  3HKT A;  4Q8X A;  5E2R A;  1ZE8 A;  5FLT A;  3DCW A;  3M1Q A;  1JD0 A;  4K0Z A;  1UGD A;  3RLD A;  1CCT A;  3HKQ A;  4RUZ A;  4ZWY A;  3DD8 A;  1KOQ A;  4E5Q A;  3N2P A;  4Q6D A;  3TVO X;  5EKM A;  1CAI A;  4WR7 A;  1BCD A;  4Z0Q A;  1RJ6 A;  4Y0J A;  4CNV A;  3UYQ A;  1V9I C;  3V2J A;  1RZA A;  4MDM A;  3MWO A;  3U3A X;  2FMZ A;  1UGF A;  1AVN A;  3OYQ A;  1H4N A;  2ABE A;  5FL4 A;  4YXI A;  3T82 A;  5EH5 A;  4QJX A;  1FR7 A;  1Z93 A;  1FQL A;  1JCZ A;  5EHW A;  2NWZ A;  1TB0 X;  3S73 B;  5J8Z A;  3N3J A;  3V3F A; 
#chains in the Genus database with same CATH topology
 2X7T A;  4QJM A;  3CAJ A;  4Q7V A;  3MHM A;  3PYK A;  4K0T A;  1DMX A;  1BV3 A;  3P3J A;  3PO6 A;  5G0C A;  3TMJ A;  4CAC A;  1I91 A;  3SBH A;  4Q87 A;  5FNM A;  4Z1E A;  8CA2 A;  1Z9Y A;  3NB5 A;  3P58 A;  1BZM A;  2NWP A;  5E5U A;  3CYU A;  4BF1 A;  2NXR A;  1UGC A;  2F14 A;  1RAZ A;  4Q81 A;  3F7B A;  4PXX A;  1ZH9 A;  3B1B A;  3ML5 A;  4IDR X;  5G01 A;  2WEH A;  3K7K A;  2WEO A;  1YDD A;  3M1K A;  3ML2 A;  1JV0 A;  4CNR A;  5EKJ A;  3DCS A;  4PYX A;  4XIW A;  3VBD A;  1XQ0 A;  3DCC A;  3RZ5 A;  5FNG A;  4N16 A;  2EU2 A;  1TEQ X;  2CAB A;  1BNW A;  5DRS A;  3M2N A;  4KNJ A;  3D92 A;  4R5B A;  3HKU A;  1V9E A;  4KUY A;  1HUH A;  2FOQ A;  1CAO A;  1HCB A;  4YGK A;  2CBE A;  4DZ9 A;  1BN1 A;  3L14 A;  1CNH A;  1G54 A;  3S71 B;  1I9N A;  3N0N A;  5JES B;  5G0B A;  3U47 A;  1YO0 A;  1ZSB A;  4Q99 A;  1TG3 A;  5HPJ A;  3S72 B;  2IT4 A;  4G7A A;  3MDZ A;  3M98 A;  1DCB A;  1G53 A;  3OKV A;  1YDC A;  3IBI A;  4Q09 A;  3T5Z A;  3F8E A;  4QSI A;  5JEG B;  1UGE A;  1I9O A;  3IBN A;  3JXH C;  3HS4 A;  1RZD A;  3SBI A;  4QSA A;  1FSN A;  3CZV A;  4R59 A;  1LUG A;  2AX2 A;  3DVC A;  5DSK A;  1OKL A;  1OKN A;  2CA2 A;  4RIU A;  4MLT A;  4Q83 A;  1BNU A;  2CBC A;  3FE4 A;  4QTL A;  4BCW A;  3FW3 A;  5DSL A;  1RJ5 A;  4KNM A;  4MTY A;  2OSM A;  4MO8 A;  3MNU A;  4ZAO A;  5DOG A;  5FDI A;  1HUG A;  1KEQ A;  5G03 A;  3V3J A;  2FOY A;  2NMX A;  1IF6 A;  2X7U A;  5AMG A;  4FVO A;  5BYI A;  5LMD A;  2NNS A;  4CA2 A;  2QP6 A;  5E28 A;  1HCA A;  1XEV A;  3MHI A;  3IBU A;  2HNC A;  1CIL A;  1FQR A;  1Y7W A;  5JEH B;  2NWY A;  4E3D A;  1XEG A;  1BNQ A;  4Q90 A;  3KIG A;  4HEY A;  3MNA A;  3N4B A;  1I8Z A;  3S8X A;  1ZGE A;  4LU3 A;  4Z1J A;  4M2R A;  1CAM A;  3BET A;  3NI5 A;  1Z97 A;  3QYK A;  4QK3 A;  2O4Z A;  4COQ A;  1ZFK A;  1KWQ A;  1FSR A;  5BRV A;  4Q06 A;  3MHO A;  4Q7P A;  5EHE A;  4ILX A;  1CA2 A;  2ZNC A;  4RFC A;  1CVF A;  3T83 A;  1BNT A;  4BF6 A;  1J9W A;  4Q07 A;  1HEB A;  3S9T A;  3KOK A;  4HU1 A;  4FPT A;  3S77 B;  3OYS A;  5E2K A;  4XZ5 A;  2GD8 A;  4FL7 A;  3LXE A;  5C8I A;  4YYT A;  3D93 A;  2NNO A;  3C7P A;  1BN4 A;  4HBA A;  4ZWX A;  4Q78 A;  3IAI A;  2POU A;  3MZC A;  4KP8 A;  5EH8 A;  3P55 A;  4MDL A;  5JG3 B;  2CBB A;  4R5A A;  5FLP A;  4QJ0 A;  1CAJ A;  3U45 X;  3OKU A;  5SZ1 A;  5SZ5 A;  1IF8 A;  3KON A;  1DMY A;  4K1Q A;  5DSM A;  5JQT A;  2Q1B A;  1CAY A;  4CQ0 A;  4ITO A;  4WW6 A;  3V5G A;  4E3G A;  4K0S A;  4QEF A;  3D8W A;  5DSI A;  4UOV A;  1IF5 A;  1CVH A;  1EOU A;  4ZX0 A;  5JGS B;  12CA A;  2AW1 A;  5AML A;  1HEA A;  1CRM A;  5BRW A;  1IF9 A;  1TTM A;  5DSO A;  2NN1 A;  5JQ0 A;  1UGG A;  3PJJ A;  1CRA A;  2VVB X;  3DAZ A;  3M04 A;  2FOS A;  1ZSC A;  3M5E A;  4QJP A;  4YGJ A;  3R16 A;  5EOI A;  4YGN A;  4JS6 A;  4TWM A;  1G0F A;  5DSR A;  1BNN A;  1CVE A;  2FNM A;  3W6I A;  1AM6 A;  1RZC A;  3MNH A;  3M5S A;  1CVC A;  2Q1Q A;  5A6H A;  1CCU A;  4E3F A;  2QOA A;  4M2V A;  2Q38 A;  3ZP9 A;  3GZ0 A;  2HKK A;  4FIK A;  1CVD A;  3KNE A;  1H9N A;  4DZ7 A;  3M5T A;  4WUQ A;  3RYX B;  1CNG A;  5FNI A;  4WUP A;  2POV A;  3UYN A;  1LG6 A;  3EFT A;  4QK2 A;  4YVY A;  1G45 A;  1CNB A;  5FNL A;  4RIV A;  3S78 B;  5E5R A;  4KNI A;  4Q7W A;  3RGE A;  2FNK A;  1DCA A;  5FNJ A;  4RFD A;  5DSP A;  1G52 A;  2NXS A;  4YXU A;  5FLS A;  3NJ9 A;  2H15 A;  6CA2 A;  1HED A;  1BNM A;  2CBD A;  3RZ7 A;  1G46 A;  3M2X A;  5CAC A;  1RZB A;  4M2W A;  1CNK A;  4GL1 X;  1CAL A;  2HD6 A;  1BNV A;  2POW A;  5CLU A;  4PQ7 A;  4HT2 A;  4Z1K A;  4WL4 A;  4QJO A;  4RH2 A;  5L6K A;  5EZT X;  3KOI A;  3MMF A;  4K13 A;  5E2S A;  3M1J A;  3P5A A;  4Q8Y A;  4IWZ A;  3RG4 A;  3HKN A;  4HT0 A;  1MOO A;  4N0X B;  1G48 A;  3KWA A;  1ZNC A;  3MYQ A;  4YGF A;  4ETQ C;  1CZM A;  3ZNC A;  1MUA A;  5SZ0 A;  1TG9 A;  1G4O A;  5DSJ A;  3HLJ A;  3DV7 A;  4ZWI A;  2W2J A;  2HL4 A;  4L5V A;  5SZ7 A;  3KS3 A;  4XFW A;  2EU3 A;  4QSB A;  3IEO A;  2FW4 A;  3D9Z A;  4L5U A;  3M2Y A;  4KP5 A;  5A25 A;  5DSN A;  1G0E A;  5DVX A;  4FU5 A;  5EIJ A;  4QIY A;  3BL1 A;  5JEP B;  3OIM A;  3Q31 A;  3FFP X;  4PZH A;  1G3Z A;  4ZX1 A;  1CNJ A;  1ZGF A;  1G1D A;  3KKX A;  3RYY A;  2GEH A;  3T85 A;  2NN7 A;  3K2F A;  4Q8Z A;  1I9L A;  3V2M A;  5BNL A;  1BN3 A;  4QSJ A;  4YHA A;  4YWP A;  3MNJ A;  3RZ0 B;  1G4J A;  2HOC A;  1F2W A;  3SAP A;  2FOV A;  3MHC A;  1IF7 A;  3OIL A;  3RYZ A;  1TE3 X;  1CIN A;  4KNN A;  4HEW A;  4CNW A;  5JDV B;  3P44 A;  3P3H A;  3M2Z A;  1XPZ A;  1CCS A;  1CAK A;  1CNW A;  2QO8 A;  3KLD B;  4KV0 A;  3M96 A;  1CAH A;  3V3H B;  4YXO A;  3P5L A;  4Q7S A;  4Z1N A;  4RUY A;  3W6H A;  5SZ6 A;  3RZ8 A;  3IGP A;  3HFP A;  4MDG A;  3T84 A;  4KAP A;  4XE1 A;  3RJ7 A;  1BIC A;  3T5U A;  3MNI A;  3S75 B;  5SZ2 A;  3DC9 A;  3RYV B;  5SZ4 A;  3RYJ B;  5CA2 A;  1LGD A;  3DVD A;  4FRC A;  1FSQ A;  3DA2 A;  1ZFQ A;  5CJF A;  1I90 A;  3MNK A;  1URT A;  1RAY A;  3M14 A;  3BL0 A;  4FVN A;  1KOP A;  1HEC A;  4L5W A;  1FR4 A;  5E2M A;  4QY3 A;  4HF3 A;  4E4A A;  4QK1 A;  1CVB A;  4XIX A;  3B4F A;  4M2U A;  3RG3 A;  1CNC A;  2NWO A;  4YX4 A;  4ZWZ A;  1HVA A;  2WEG A;  3V3G B;  5FNK A;  1I9P A;  2OSF A;  5EKH A;  3R17 B;  4YGL A;  4MLX A;  2FMG A;  5L3O A;  5DSQ A;  4QJW A;  3K34 A;  5IPZ A;  1A42 A;  4LHI A;  5SZ3 A;  2VVA X;  1I9M A;  4KUV A;  1IF4 A;  3DBU A;  1LG5 A;  3JXG A;  3MHL A;  1I9Q A;  2EZ7 A;  1G6V A;  1CAN A;  5FL6 A;  3JXF A;  2FOU A;  3CA2 A;  1UGB A;  4PYY A;  2NNG A;  3F4X A;  5E2N A;  4JSW A;  1CNY A;  1CAZ A;  1YDB A;  3IBL A;  1H9Q A;  5JG5 B;  4CNX A;  1YDA A;  3DVB A;  5DOH A;  3S74 B;  2H4N A;  3M3X A;  5EH7 A;  3S76 A;  1CA3 A;  5AMD A;  3M1W A;  1UGA A;  4Q49 A;  5FLQ A;  3M40 A;  4RN4 A;  1TH9 A;  1T9N A;  3V7X A;  4WW8 A;  1KWR A;  5FL5 A;  2HFW A;  4JSZ A;  4TWL A;  3U7C A;  2CBA A;  2WD2 A;  3D0N A;  2WEJ A;  5FLO A;  1CNX A;  1CNI A;  2ILI A;  7CA2 A;  3M67 A;  2WD3 A;  1OKM A;  4HEZ A;  3OIK A;  3OY0 A;  3F7U A;  1OQ5 A;  9CA2 A;  3TVN X;  3S97 A;  3SAX A;  4C3T A;  4ITP A;  1YO1 A;  1YO2 A;  5FDC A;  3RZ1 B;  3P4V A;  3DD0 A;  1FLJ A;  5EHV A;  3DC3 A;  4E49 A;  1TEU X;  4LP6 A;  1FQN A;  4Q08 A;  1AZM A;  4G0C A;  4QIZ A;  1ZSA A;  4Q6E A;  1LZV A;  4Q9Y A;  5FLR A;  5FNH A;  4JSS A;  1THK A;  2NNV A;  4JSA A;  2NXT A;  3V3I B;  4KUW A;  1RZE A;  4RUX A;  4E3H A;  1FQM A;  5JGT B;  5BRU A;  4E9O X;  1CIM A;  2FNN A;  2X7S A;  3EFI A;  1TBT X;  4X5S A;  1CVA A;  4Q0L A;  3HKT A;  4Q8X A;  5E2R A;  1ZE8 A;  5FLT A;  3DCW A;  3M1Q A;  1JD0 A;  4K0Z A;  1UGD A;  3RLD A;  1CCT A;  3HKQ A;  4RUZ A;  4ZWY A;  3DD8 A;  1KOQ A;  4E5Q A;  3N2P A;  4Q6D A;  3TVO X;  5EKM A;  1CAI A;  4WR7 A;  1BCD A;  4Z0Q A;  1RJ6 A;  4Y0J A;  4CNV A;  3UYQ A;  1V9I C;  3V2J A;  1RZA A;  4MDM A;  3MWO A;  3U3A X;  2FMZ A;  1UGF A;  1AVN A;  3OYQ A;  1H4N A;  2ABE A;  5FL4 A;  4YXI A;  3T82 A;  5EH5 A;  4QJX A;  1FR7 A;  1Z93 A;  1FQL A;  1JCZ A;  5EHW A;  2NWZ A;  1TB0 X;  3S73 B;  5J8Z A;  3N3J A;  3V3F A; 
#chains in the Genus database with same CATH homology
 2X7T A;  4QJM A;  3CAJ A;  4Q7V A;  3MHM A;  3PYK A;  4K0T A;  1DMX A;  1BV3 A;  3P3J A;  3PO6 A;  5G0C A;  3TMJ A;  4CAC A;  1I91 A;  3SBH A;  4Q87 A;  5FNM A;  4Z1E A;  8CA2 A;  1Z9Y A;  3NB5 A;  3P58 A;  1BZM A;  2NWP A;  5E5U A;  3CYU A;  4BF1 A;  2NXR A;  1UGC A;  2F14 A;  1RAZ A;  4Q81 A;  3F7B A;  4PXX A;  1ZH9 A;  3B1B A;  3ML5 A;  4IDR X;  5G01 A;  2WEH A;  3K7K A;  2WEO A;  1YDD A;  3M1K A;  3ML2 A;  1JV0 A;  4CNR A;  5EKJ A;  3DCS A;  4PYX A;  4XIW A;  3VBD A;  1XQ0 A;  3DCC A;  3RZ5 A;  5FNG A;  4N16 A;  2EU2 A;  1TEQ X;  2CAB A;  1BNW A;  5DRS A;  3M2N A;  4KNJ A;  3D92 A;  4R5B A;  3HKU A;  1V9E A;  4KUY A;  1HUH A;  2FOQ A;  1CAO A;  1HCB A;  4YGK A;  2CBE A;  4DZ9 A;  1BN1 A;  3L14 A;  1CNH A;  1G54 A;  3S71 B;  1I9N A;  3N0N A;  5JES B;  5G0B A;  3U47 A;  1YO0 A;  1ZSB A;  4Q99 A;  1TG3 A;  5HPJ A;  3S72 B;  2IT4 A;  4G7A A;  3MDZ A;  3M98 A;  1DCB A;  1G53 A;  3OKV A;  1YDC A;  3IBI A;  4Q09 A;  3T5Z A;  3F8E A;  4QSI A;  5JEG B;  1UGE A;  1I9O A;  3IBN A;  3JXH C;  3HS4 A;  1RZD A;  3SBI A;  4QSA A;  1FSN A;  3CZV A;  4R59 A;  1LUG A;  2AX2 A;  3DVC A;  5DSK A;  1OKL A;  1OKN A;  2CA2 A;  4RIU A;  4MLT A;  4Q83 A;  1BNU A;  2CBC A;  3FE4 A;  4QTL A;  4BCW A;  3FW3 A;  5DSL A;  1RJ5 A;  4KNM A;  4MTY A;  2OSM A;  4MO8 A;  3MNU A;  4ZAO A;  5DOG A;  5FDI A;  1HUG A;  1KEQ A;  5G03 A;  3V3J A;  2FOY A;  2NMX A;  1IF6 A;  2X7U A;  5AMG A;  4FVO A;  5BYI A;  5LMD A;  2NNS A;  4CA2 A;  2QP6 A;  5E28 A;  1HCA A;  1XEV A;  3MHI A;  3IBU A;  2HNC A;  1CIL A;  1FQR A;  1Y7W A;  5JEH B;  2NWY A;  4E3D A;  1XEG A;  1BNQ A;  4Q90 A;  3KIG A;  4HEY A;  3MNA A;  3N4B A;  1I8Z A;  3S8X A;  1ZGE A;  4LU3 A;  4Z1J A;  4M2R A;  1CAM A;  3BET A;  3NI5 A;  1Z97 A;  3QYK A;  4QK3 A;  2O4Z A;  4COQ A;  1ZFK A;  1KWQ A;  1FSR A;  5BRV A;  4Q06 A;  3MHO A;  4Q7P A;  5EHE A;  4ILX A;  1CA2 A;  2ZNC A;  4RFC A;  1CVF A;  3T83 A;  1BNT A;  4BF6 A;  1J9W A;  4Q07 A;  1HEB A;  3S9T A;  3KOK A;  4HU1 A;  4FPT A;  3S77 B;  3OYS A;  5E2K A;  4XZ5 A;  2GD8 A;  4FL7 A;  3LXE A;  5C8I A;  4YYT A;  3D93 A;  2NNO A;  3C7P A;  1BN4 A;  4HBA A;  4ZWX A;  4Q78 A;  3IAI A;  2POU A;  3MZC A;  4KP8 A;  5EH8 A;  3P55 A;  4MDL A;  5JG3 B;  2CBB A;  4R5A A;  5FLP A;  4QJ0 A;  1CAJ A;  3U45 X;  3OKU A;  5SZ1 A;  5SZ5 A;  1IF8 A;  3KON A;  1DMY A;  4K1Q A;  5DSM A;  5JQT A;  2Q1B A;  1CAY A;  4CQ0 A;  4ITO A;  4WW6 A;  3V5G A;  4E3G A;  4K0S A;  4QEF A;  3D8W A;  5DSI A;  4UOV A;  1IF5 A;  1CVH A;  1EOU A;  4ZX0 A;  5JGS B;  12CA A;  2AW1 A;  5AML A;  1HEA A;  1CRM A;  5BRW A;  1IF9 A;  1TTM A;  5DSO A;  2NN1 A;  5JQ0 A;  1UGG A;  3PJJ A;  1CRA A;  2VVB X;  3DAZ A;  3M04 A;  2FOS A;  1ZSC A;  3M5E A;  4QJP A;  4YGJ A;  3R16 A;  5EOI A;  4YGN A;  4JS6 A;  4TWM A;  1G0F A;  5DSR A;  1BNN A;  1CVE A;  2FNM A;  3W6I A;  1AM6 A;  1RZC A;  3MNH A;  3M5S A;  1CVC A;  2Q1Q A;  5A6H A;  1CCU A;  4E3F A;  2QOA A;  4M2V A;  2Q38 A;  3ZP9 A;  3GZ0 A;  2HKK A;  4FIK A;  1CVD A;  3KNE A;  1H9N A;  4DZ7 A;  3M5T A;  4WUQ A;  3RYX B;  1CNG A;  5FNI A;  4WUP A;  2POV A;  3UYN A;  1LG6 A;  3EFT A;  4QK2 A;  4YVY A;  1G45 A;  1CNB A;  5FNL A;  4RIV A;  3S78 B;  5E5R A;  4KNI A;  4Q7W A;  3RGE A;  2FNK A;  1DCA A;  5FNJ A;  4RFD A;  5DSP A;  1G52 A;  2NXS A;  4YXU A;  5FLS A;  3NJ9 A;  2H15 A;  6CA2 A;  1HED A;  1BNM A;  2CBD A;  3RZ7 A;  1G46 A;  3M2X A;  5CAC A;  1RZB A;  4M2W A;  1CNK A;  4GL1 X;  1CAL A;  2HD6 A;  1BNV A;  2POW A;  5CLU A;  4PQ7 A;  4HT2 A;  4Z1K A;  4WL4 A;  4QJO A;  4RH2 A;  5L6K A;  5EZT X;  3KOI A;  3MMF A;  4K13 A;  5E2S A;  3M1J A;  3P5A A;  4Q8Y A;  4IWZ A;  3RG4 A;  3HKN A;  4HT0 A;  1MOO A;  4N0X B;  1G48 A;  3KWA A;  1ZNC A;  3MYQ A;  4YGF A;  4ETQ C;  1CZM A;  3ZNC A;  1MUA A;  5SZ0 A;  1TG9 A;  1G4O A;  5DSJ A;  3HLJ A;  3DV7 A;  4ZWI A;  2W2J A;  2HL4 A;  4L5V A;  5SZ7 A;  3KS3 A;  4XFW A;  2EU3 A;  4QSB A;  3IEO A;  2FW4 A;  3D9Z A;  4L5U A;  3M2Y A;  4KP5 A;  5A25 A;  5DSN A;  1G0E A;  5DVX A;  4FU5 A;  5EIJ A;  4QIY A;  3BL1 A;  5JEP B;  3OIM A;  3Q31 A;  3FFP X;  4PZH A;  1G3Z A;  4ZX1 A;  1CNJ A;  1ZGF A;  1G1D A;  3KKX A;  3RYY A;  2GEH A;  3T85 A;  2NN7 A;  3K2F A;  4Q8Z A;  1I9L A;  3V2M A;  5BNL A;  1BN3 A;  4QSJ A;  4YHA A;  4YWP A;  3MNJ A;  3RZ0 B;  1G4J A;  2HOC A;  1F2W A;  3SAP A;  2FOV A;  3MHC A;  1IF7 A;  3OIL A;  3RYZ A;  1TE3 X;  1CIN A;  4KNN A;  4HEW A;  4CNW A;  5JDV B;  3P44 A;  3P3H A;  3M2Z A;  1XPZ A;  1CCS A;  1CAK A;  1CNW A;  2QO8 A;  3KLD B;  4KV0 A;  3M96 A;  1CAH A;  3V3H B;  4YXO A;  3P5L A;  4Q7S A;  4Z1N A;  4RUY A;  3W6H A;  5SZ6 A;  3RZ8 A;  3IGP A;  3HFP A;  4MDG A;  3T84 A;  4KAP A;  4XE1 A;  3RJ7 A;  1BIC A;  3T5U A;  3MNI A;  3S75 B;  5SZ2 A;  3DC9 A;  3RYV B;  5SZ4 A;  3RYJ B;  5CA2 A;  1LGD A;  3DVD A;  4FRC A;  1FSQ A;  3DA2 A;  1ZFQ A;  5CJF A;  1I90 A;  3MNK A;  1URT A;  1RAY A;  3M14 A;  3BL0 A;  4FVN A;  1KOP A;  1HEC A;  4L5W A;  1FR4 A;  5E2M A;  4QY3 A;  4HF3 A;  4E4A A;  4QK1 A;  1CVB A;  4XIX A;  3B4F A;  4M2U A;  3RG3 A;  1CNC A;  2NWO A;  4YX4 A;  4ZWZ A;  1HVA A;  2WEG A;  3V3G B;  5FNK A;  1I9P A;  2OSF A;  5EKH A;  3R17 B;  4YGL A;  4MLX A;  2FMG A;  5L3O A;  5DSQ A;  4QJW A;  3K34 A;  5IPZ A;  1A42 A;  4LHI A;  5SZ3 A;  2VVA X;  1I9M A;  4KUV A;  1IF4 A;  3DBU A;  1LG5 A;  3JXG A;  3MHL A;  1I9Q A;  2EZ7 A;  1G6V A;  1CAN A;  5FL6 A;  3JXF A;  2FOU A;  3CA2 A;  1UGB A;  4PYY A;  2NNG A;  3F4X A;  5E2N A;  4JSW A;  1CNY A;  1CAZ A;  1YDB A;  3IBL A;  1H9Q A;  5JG5 B;  4CNX A;  1YDA A;  3DVB A;  5DOH A;  3S74 B;  2H4N A;  3M3X A;  5EH7 A;  3S76 A;  1CA3 A;  5AMD A;  3M1W A;  1UGA A;  4Q49 A;  5FLQ A;  3M40 A;  4RN4 A;  1TH9 A;  1T9N A;  3V7X A;  4WW8 A;  1KWR A;  5FL5 A;  2HFW A;  4JSZ A;  4TWL A;  3U7C A;  2CBA A;  2WD2 A;  3D0N A;  2WEJ A;  5FLO A;  1CNX A;  1CNI A;  2ILI A;  7CA2 A;  3M67 A;  2WD3 A;  1OKM A;  4HEZ A;  3OIK A;  3OY0 A;  3F7U A;  1OQ5 A;  9CA2 A;  3TVN X;  3S97 A;  3SAX A;  4C3T A;  4ITP A;  1YO1 A;  1YO2 A;  5FDC A;  3RZ1 B;  3P4V A;  3DD0 A;  1FLJ A;  5EHV A;  3DC3 A;  4E49 A;  1TEU X;  4LP6 A;  1FQN A;  4Q08 A;  1AZM A;  4G0C A;  4QIZ A;  1ZSA A;  4Q6E A;  1LZV A;  4Q9Y A;  5FLR A;  5FNH A;  4JSS A;  1THK A;  2NNV A;  4JSA A;  2NXT A;  3V3I B;  4KUW A;  1RZE A;  4RUX A;  4E3H A;  1FQM A;  5JGT B;  5BRU A;  4E9O X;  1CIM A;  2FNN A;  2X7S A;  3EFI A;  1TBT X;  4X5S A;  1CVA A;  4Q0L A;  3HKT A;  4Q8X A;  5E2R A;  1ZE8 A;  5FLT A;  3DCW A;  3M1Q A;  1JD0 A;  4K0Z A;  1UGD A;  3RLD A;  1CCT A;  3HKQ A;  4RUZ A;  4ZWY A;  3DD8 A;  1KOQ A;  4E5Q A;  3N2P A;  4Q6D A;  3TVO X;  5EKM A;  1CAI A;  4WR7 A;  1BCD A;  4Z0Q A;  1RJ6 A;  4Y0J A;  4CNV A;  3UYQ A;  1V9I C;  3V2J A;  1RZA A;  4MDM A;  3MWO A;  3U3A X;  2FMZ A;  1UGF A;  1AVN A;  3OYQ A;  1H4N A;  2ABE A;  5FL4 A;  4YXI A;  3T82 A;  5EH5 A;  4QJX A;  1FR7 A;  1Z93 A;  1FQL A;  1JCZ A;  5EHW A;  2NWZ A;  1TB0 X;  3S73 B;  5J8Z A;  3N3J A;  3V3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...