3W6HA

Crystal structure of 19f probe-labeled hcai in complex with acetazolamide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
Knots found
sequence length
256
structure length
256
Chain Sequence
WGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Carbonic anhydrase 1
publication title Quantitative Comparison of Protein Dynamics in Live Cells and In Vitro by In-Cell 19F-NMR
rcsb
source organism Homo sapiens
total genus 67
structure length 256
sequence length 256
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2013-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 3w6hA00
4QEFA 1RZCA 3S73B 3RZ0B 5A6HA 4CNRA 1I9PA 4HU1A 2EU2A 2H4NA 3S77B 4YGNA 1IF4A 3RZ5A 5EOIA 3F7UA 4PQ7A 3OYQA 2QOAA 4Q78A 1BNTA 2VVBX 3DD8A 1RAZA 4XIWA 5CA2A 1BN3A 1CA2A 1DMYA 1FQLA 1T9NA 1TE3X 3M14A 2CA2A 4WW6A 5E2KA 4E49A 4TWLA 5A25A 5G01A 5L3OA 5DSNA 4GL1X 3RZ7A 1CNXA 1TEQX 1ZGEA 3V5GA 4M2VA 2FOQA 3PO6A 3P44A 1ZE8A 5EHVA 1G6VA 1CNBA 4Q0LA 4Q9YA 1TEUX 4Z1EA 3M2XA 5EKHA 3V3GB 3RG3A 3MNKA 5JG3B 3JXGA 4Q81A 2O4ZA 4Q7SA 4RUXA 4Q83A 4ZAOA 4YXUA 4E4AA 5DSKA 3L14A 3EFIA 1CNKA 3P5LA 2ABEA 2X7UA 2POWA 4QK3A 5FLPA 3MHMA 4L5UA 3S8XA 1I9LA 4K13A 4Q99A 1CNCA 1RJ5A 3RYVB 3T84A 2VVAX 1ZSAA 2AW1A 4E3FA 5E2NA 5DSQA 2QP6A 1CAOA 3M2ZA 9CA2A 4IDRX 1G3ZA 3D93A 4FPTA 1JV0A 1ZSCA 1I90A 1CAJA 1FR7A 1TBTX 5EHWA 4ZWXA 4ZWZA 3M2YA 3BL0A 4LU3A 3F7BA 4X5SA 3C7PA 2CBBA 1BNVA 4QJPA 3IBLA 1I9QA 5E5RA 1CAKA 7CA2A 4E3HA 1FQNA 3B4FA 4YXOA 3MHIA 3TVNX 5G0BA 4FIKA 4HF3A 5DSRA 3MWOA 4JS6A 1RZBA 5EH7A 3NB5A 5E2SA 1G0EA 1DMXA 2OSFA 4KP5A 1EOUA 3KNEA 3OIMA 3M1QA 1FSQA 5CACA 1CALA 3S9TA 4CNWA 1CNGA 3D9ZA 3FW3A 4YGFA 3TVOX 3SAPA 4BCWA 1KOPA 5FNLA 4PZHA 1KWQA 2AX2A 4MLXA 5LMDA 2WEOA 3M5SA 5JDVB 4KAPA 4QIZA 1TG3A 3MZCA 3M98A 2FNMA 1KWRA 4RUYA 4JSSA 3KONA 5EZTX 5HPJA 3DBUA 3GZ0A 4FRCA 5JEGB 1CVBA 5FNMA 4YXIA 3N0NA 2EU3A 2NWOA 3D8WA 3T5ZA 4PYYA 12CAA 1Z9YA 4Q7VA 4HEZA 1CA3A 5JEHB 1HCBA 3V3HB 2POUA 3MNUA 3ZP9A 1CVCA 4Q90A 3DCSA 4QJWA 5EIJA 2NWPA 5EH8A 4KNMA 4RIVA 4BF1A 2HNCA 3NJ9A 1CNIA 2WD2A 2GEHA 3BETA 4Q09A 3FFPX 5DOHA 3MHOA 1CINA 3PYKA 5JGSB 1CILA 2NNOA 4KV0A 5G0CA 2FNKA 3OILA 5AMLA 4RUZA 1IF8A 3B1BA 1AVNA 4Q49A 3RYJB 2NN7A 4Z0QA 5FL6A 5EKMA 3EFTA 4E9OX 4YGKA 1OKNA 3ML2A 5JQ0A 5E2RA 3IBUA 3RLDA 1XEGA 1I8ZA 3F4XA 4KNIA 4E3DA 2ZNCA 3HKQA 3M1JA 3RYZA 1KEQA 1LG6A 3OKUA 2Q1BA 4JSAA 4WUPA 4CNXA 4N0XB 3R16A 4RFDA 4QSBA 5AMGA 1THKA 4TWMA 5DSOA 4ETQC 2NWZA 4FU5A 2NXTA 2HFWA 1HUHA 1F2WA 1MOOA 4QJXA 4ZX0A 3KS3A 3N2PA 5DSJA 4M2RA 2FW4A 3MHCA 3W6IA 1FSRA 4MDMA 1FSNA 3UYNA 2POVA 3KKXA 1CCUA 1YO1A 5BRVA 5DSLA 4ITOA 5FNHA 1JD0A 5FNJA 4YX4A 3M96A 3SBHA 3KOKA 5BNLA 1CAHA 1HUGA 4FL7A 1Z93A 3HLJA 4RFCA 1XEVA 3P55A 5IPZA 5FNKA 4QY3A 5SZ6A 2WEHA 5BYIA 3HKNA 3JXHC 3S74B 4E5QA 4YWPA 5E5UA 2WEGA 1LUGA 4QK2A 1G53A 3N3JA 4QSJA 4QJOA 4C3TA 3DC9A 3S71B 3MHLA 1CIMA 3OKVA 3R17B 2X7TA 4MDLA 1XPZA 4ITPA 4R5BA 4Y0JA 2FMZA 4Z1JA 1BN4A 1DCAA 3M2NA 2CBEA 1ZNCA 1G52A 4Z1NA 4ZX1A 1YO2A 1G46A 4RN4A 4CA2A 4Q08A 4M2UA 3BL1A 3RYXB 4KUWA 1UGDA 5JEPB 3UYQA 1LZVA 1CNWA 3VBDA 3S78B 5BRWA 3MNAA 5J8ZA 5BRUA 5DOGA 5L6KA 3P5AA 4Q6DA 3Q31A 4QJMA 3DV7A 4FVNA 1I9MA 4RH2A 5FLOA 4E3GA 1RZDA 3M40A 4HEWA 2NWYA 3HKTA 4KP8A 1G4JA 4IWZA 1UGCA 1DCBA 3T5UA 5C8IA 8CA2A 3OIKA 1CNJA 1CANA 4K0ZA 4MLTA 1I9OA 1HEAA 3P3HA 1ZGFA 3T83A 2H15A 4KNNA 5EH5A 3M1KA 3DA2A 4QIYA 5FDIA 3KWAA 4K0TA 4PYXA 2NMXA 3V3IB 3V2JA 1CVHA 1AZMA 2ILIA 4G0CA 1CVEA 5DVXA 3MNJA 1G54A 4YGJA 3RG4A 1CAMA 3DVDA 5JGTB 1UGGA 1UGBA 1UGEA 4LP6A 3CA2A 1BNUA 4CQ0A 1FQRA 1BNNA 3HFPA 2CBDA 3M04A 3D92A 4QK1A 3CAJA 1YDAA 3KIGA 4RIUA 4ZWIA 1H9NA 1CVDA 1ZFQA 2NNVA 3U3AX 3M3XA 1RAYA 3RYYA 4ILXA 5FLRA 5CJFA 1RZAA 1CNYA 1G4OA 2Q1QA 3CYUA 1XQ0A 1YDDA 4XIXA 2FOSA 1IF5A 4XE1A 3MDZA 1OKMA 3U7CA 3U47A 4ZWYA 5DSIA 4QTLA 1BICA 5FLTA 1HVAA 2FNNA 1G48A 1RJ6A 1OKLA 2X7SA 3FE4A 1TG9A 3S72B 4KUYA 1LG5A 1H9QA 1TH9A 2FOUA 1YO0A 1KOQA 4BF6A 3F8EA 3D0NA 3DVBA 5SZ7A 5FNIA 1YDCA 1URTA 1TTMA 1BZMA 4QSAA 3DAZA 1FR4A 5SZ0A 1BN1A 3DCWA 2NN1A 1ZFKA 2HL4A 4M2WA 4HT2A 1CCTA 3KOIA 1BNQA 1I91A 1CAZA 4G7AA 3PJJA 3V3JA 4UOVA 3T82A 1BNWA 3LXEA 2FOVA 5FL4A 3OY0A 4KUVA 2CBCA 4Q8ZA 4MDGA 4FVOA 1ZH9A 1I9NA 2FMGA 2OSMA 1Y7WA 3M5EA 4LHIA 4PXXA 2HD6A 3IGPA 1HEDA 4CACA 1OQ5A 4N16A 1AM6A 2CBAA 3IEOA 1CZMA 4L5VA 1G0FA 4XZ5A 3ZNCA 1BCDA 3IBIA 4Q8YA 3IBNA 4QJ0A 5FLQA 5DSMA 3HS4A 1RZEA 3M1WA 4DZ9A 3P58A 4JSZA 4QSIA 4XFWA 3V7XA 4Z1KA 5G03A 1CNHA 2NNSA 1G1DA 3MMFA 3DVCA 4Q06A 1FQMA 5CLUA 2F14A 2GD8A 1CAIA 5FDCA 4Q07A 4Q7PA 5JQTA 3DC3A 5EHEA 1CAYA 4HBAA 5JESB 4JSWA 1TB0X 1UGAA 4WL4A 3S97A 1IF9A 1IF7A 3QYKA 1H4NA 3S76A 4Q87A 3KLDB 1G45A 4K0SA 1CVFA 1YDBA 3TMJA 2FOYA 4YVYA 3M67A 2NNGA 3K2FA 2HOCA 3M5TA 1BV3A 3N4BA 5EKJA 1BNMA 1Z97A 4HT0A 1FLJA 4HEYA 1CRAA 1V9IC 4Q7WA 4R59A 5SZ1A 1UGFA 1IF6A 2EZ7A 3DD0A 2WD3A 3P4VA 1ZSBA 5SZ4A 3HKUA 2NXSA 4CNVA 3ML5A 4YGLA 4YHAA 2Q38A 1J9WA 4Q6EA 4R5AA 5FLSA 5SZ2A 2WEJA 4MTYA 2QO8A 1CVAA 1HEBA 2HKKA 4Q8XA 4WUQA 3OYSA 1A42A 5DRSA 1HCAA 3DCCA 3MYQA 3SAXA 3P3JA 1HECA 3RZ8A 3MNIA 1CRMA 3MNHA 2W2JA 5FL5A 3NI5A 3CZVA 3IAIA 5SZ5A 2NXRA 3V3FA 6CA2A 3JXFA 3K34A 3RJ7A 4WR7A 5DSPA 5SZ3A 1MUAA 2IT4A 3K7KA 3S75B 4L5WA 5FNGA 1LGDA 5E28A 2CABA 1CCSA 1JCZA 4KNJA 3T85A 5E2MA 5AMDA 3RZ1B 3U45X 4WW8A 3W6HA 4COQA 4DZ7A 4YYTA 1V9EA 4MO8A 3V2MA 5JG5B 3RGEA 4K1QA 3SBIA
chains in the Genus database with same CATH superfamily
4QEFA 1RZCA 3S73B 3RZ0B 5A6HA 4CNRA 1I9PA 4HU1A 2EU2A 2H4NA 3S77B 4YGNA 1IF4A 3RZ5A 5EOIA 3F7UA 4PQ7A 3OYQA 2QOAA 4Q78A 1BNTA 2VVBX 3DD8A 1RAZA 4XIWA 5CA2A 1BN3A 1CA2A 1DMYA 1FQLA 1T9NA 1TE3X 3M14A 2CA2A 4WW6A 5E2KA 4E49A 4TWLA 5A25A 5G01A 5L3OA 5DSNA 4GL1X 3RZ7A 1CNXA 1TEQX 1ZGEA 3V5GA 4M2VA 2FOQA 3PO6A 3P44A 1ZE8A 5EHVA 1G6VA 1CNBA 4Q0LA 4Q9YA 1TEUX 4Z1EA 3M2XA 5EKHA 3V3GB 3RG3A 3MNKA 5JG3B 3JXGA 4Q81A 2O4ZA 4Q7SA 4RUXA 4Q83A 4ZAOA 4YXUA 4E4AA 5DSKA 3L14A 3EFIA 1CNKA 3P5LA 2ABEA 2X7UA 2POWA 4QK3A 5FLPA 3MHMA 4L5UA 3S8XA 1I9LA 4K13A 4Q99A 1CNCA 1RJ5A 3RYVB 3T84A 2VVAX 1ZSAA 2AW1A 4E3FA 5E2NA 5DSQA 2QP6A 1CAOA 3M2ZA 9CA2A 4IDRX 1G3ZA 3D93A 4FPTA 1JV0A 1ZSCA 1I90A 1CAJA 1FR7A 1TBTX 5EHWA 4ZWXA 4ZWZA 3M2YA 3BL0A 4LU3A 3F7BA 4X5SA 3C7PA 2CBBA 1BNVA 4QJPA 3IBLA 1I9QA 5E5RA 1CAKA 7CA2A 4E3HA 1FQNA 3B4FA 4YXOA 3MHIA 3TVNX 5G0BA 4FIKA 4HF3A 5DSRA 3MWOA 4JS6A 1RZBA 5EH7A 3NB5A 5E2SA 1G0EA 1DMXA 2OSFA 4KP5A 1EOUA 3KNEA 3OIMA 3M1QA 1FSQA 5CACA 1CALA 3S9TA 4CNWA 1CNGA 3D9ZA 3FW3A 4YGFA 3TVOX 3SAPA 4BCWA 1KOPA 5FNLA 4PZHA 1KWQA 2AX2A 4MLXA 5LMDA 2WEOA 3M5SA 5JDVB 4KAPA 4QIZA 1TG3A 3MZCA 3M98A 2FNMA 1KWRA 4RUYA 4JSSA 3KONA 5EZTX 5HPJA 3DBUA 3GZ0A 4FRCA 5JEGB 1CVBA 5FNMA 4YXIA 3N0NA 2EU3A 2NWOA 3D8WA 3T5ZA 4PYYA 12CAA 1Z9YA 4Q7VA 4HEZA 1CA3A 5JEHB 1HCBA 3V3HB 2POUA 3MNUA 3ZP9A 1CVCA 4Q90A 3DCSA 4QJWA 5EIJA 2NWPA 5EH8A 4KNMA 4RIVA 4BF1A 2HNCA 3NJ9A 1CNIA 2WD2A 2GEHA 3BETA 4Q09A 3FFPX 5DOHA 3MHOA 1CINA 3PYKA 5JGSB 1CILA 2NNOA 4KV0A 5G0CA 2FNKA 3OILA 5AMLA 4RUZA 1IF8A 3B1BA 1AVNA 4Q49A 3RYJB 2NN7A 4Z0QA 5FL6A 5EKMA 3EFTA 4E9OX 4YGKA 1OKNA 3ML2A 5JQ0A 5E2RA 3IBUA 3RLDA 1XEGA 1I8ZA 3F4XA 4KNIA 4E3DA 2ZNCA 3HKQA 3M1JA 3RYZA 1KEQA 1LG6A 3OKUA 2Q1BA 4JSAA 4WUPA 4CNXA 4N0XB 3R16A 4RFDA 4QSBA 5AMGA 1THKA 4TWMA 5DSOA 4ETQC 2NWZA 4FU5A 2NXTA 2HFWA 1HUHA 1F2WA 1MOOA 4QJXA 4ZX0A 3KS3A 3N2PA 5DSJA 4M2RA 2FW4A 3MHCA 3W6IA 1FSRA 4MDMA 1FSNA 3UYNA 2POVA 3KKXA 1CCUA 1YO1A 5BRVA 5DSLA 4ITOA 5FNHA 1JD0A 5FNJA 4YX4A 3M96A 3SBHA 3KOKA 5BNLA 1CAHA 1HUGA 4FL7A 1Z93A 3HLJA 4RFCA 1XEVA 3P55A 5IPZA 5FNKA 4QY3A 5SZ6A 2WEHA 5BYIA 3HKNA 3JXHC 3S74B 4E5QA 4YWPA 5E5UA 2WEGA 1LUGA 4QK2A 1G53A 3N3JA 4QSJA 4QJOA 4C3TA 3DC9A 3S71B 3MHLA 1CIMA 3OKVA 3R17B 2X7TA 4MDLA 1XPZA 4ITPA 4R5BA 4Y0JA 2FMZA 4Z1JA 1BN4A 1DCAA 3M2NA 2CBEA 1ZNCA 1G52A 4Z1NA 4ZX1A 1YO2A 1G46A 4RN4A 4CA2A 4Q08A 4M2UA 3BL1A 3RYXB 4KUWA 1UGDA 5JEPB 3UYQA 1LZVA 1CNWA 3VBDA 3S78B 5BRWA 3MNAA 5J8ZA 5BRUA 5DOGA 5L6KA 3P5AA 4Q6DA 3Q31A 4QJMA 3DV7A 4FVNA 1I9MA 4RH2A 5FLOA 4E3GA 1RZDA 3M40A 4HEWA 2NWYA 3HKTA 4KP8A 1G4JA 4IWZA 1UGCA 1DCBA 3T5UA 5C8IA 8CA2A 3OIKA 1CNJA 1CANA 4K0ZA 4MLTA 1I9OA 1HEAA 3P3HA 1ZGFA 3T83A 2H15A 4KNNA 5EH5A 3M1KA 3DA2A 4QIYA 5FDIA 3KWAA 4K0TA 4PYXA 2NMXA 3V3IB 3V2JA 1CVHA 1AZMA 2ILIA 4G0CA 1CVEA 5DVXA 3MNJA 1G54A 4YGJA 3RG4A 1CAMA 3DVDA 5JGTB 1UGGA 1UGBA 1UGEA 4LP6A 3CA2A 1BNUA 4CQ0A 1FQRA 1BNNA 3HFPA 2CBDA 3M04A 3D92A 4QK1A 3CAJA 1YDAA 3KIGA 4RIUA 4ZWIA 1H9NA 1CVDA 1ZFQA 2NNVA 3U3AX 3M3XA 1RAYA 3RYYA 4ILXA 5FLRA 5CJFA 1RZAA 1CNYA 1G4OA 2Q1QA 3CYUA 1XQ0A 1YDDA 4XIXA 2FOSA 1IF5A 4XE1A 3MDZA 1OKMA 3U7CA 3U47A 4ZWYA 5DSIA 4QTLA 1BICA 5FLTA 1HVAA 2FNNA 1G48A 1RJ6A 1OKLA 2X7SA 3FE4A 1TG9A 3S72B 4KUYA 1LG5A 1H9QA 1TH9A 2FOUA 1YO0A 1KOQA 4BF6A 3F8EA 3D0NA 3DVBA 5SZ7A 5FNIA 1YDCA 1URTA 1TTMA 1BZMA 4QSAA 3DAZA 1FR4A 5SZ0A 1BN1A 3DCWA 2NN1A 1ZFKA 2HL4A 4M2WA 4HT2A 1CCTA 3KOIA 1BNQA 1I91A 1CAZA 4G7AA 3PJJA 3V3JA 4UOVA 3T82A 1BNWA 3LXEA 2FOVA 5FL4A 3OY0A 4KUVA 2CBCA 4Q8ZA 4MDGA 4FVOA 1ZH9A 1I9NA 2FMGA 2OSMA 1Y7WA 3M5EA 4LHIA 4PXXA 2HD6A 3IGPA 1HEDA 4CACA 1OQ5A 4N16A 1AM6A 2CBAA 3IEOA 1CZMA 4L5VA 1G0FA 4XZ5A 3ZNCA 1BCDA 3IBIA 4Q8YA 3IBNA 4QJ0A 5FLQA 5DSMA 3HS4A 1RZEA 3M1WA 4DZ9A 3P58A 4JSZA 4QSIA 4XFWA 3V7XA 4Z1KA 5G03A 1CNHA 2NNSA 1G1DA 3MMFA 3DVCA 4Q06A 1FQMA 5CLUA 2F14A 2GD8A 1CAIA 5FDCA 4Q07A 4Q7PA 5JQTA 3DC3A 5EHEA 1CAYA 4HBAA 5JESB 4JSWA 1TB0X 1UGAA 4WL4A 3S97A 1IF9A 1IF7A 3QYKA 1H4NA 3S76A 4Q87A 3KLDB 1G45A 4K0SA 1CVFA 1YDBA 3TMJA 2FOYA 4YVYA 3M67A 2NNGA 3K2FA 2HOCA 3M5TA 1BV3A 3N4BA 5EKJA 1BNMA 1Z97A 4HT0A 1FLJA 4HEYA 1CRAA 1V9IC 4Q7WA 4R59A 5SZ1A 1UGFA 1IF6A 2EZ7A 3DD0A 2WD3A 3P4VA 1ZSBA 5SZ4A 3HKUA 2NXSA 4CNVA 3ML5A 4YGLA 4YHAA 2Q38A 1J9WA 4Q6EA 4R5AA 5FLSA 5SZ2A 2WEJA 4MTYA 2QO8A 1CVAA 1HEBA 2HKKA 4Q8XA 4WUQA 3OYSA 1A42A 5DRSA 1HCAA 3DCCA 3MYQA 3SAXA 3P3JA 1HECA 3RZ8A 3MNIA 1CRMA 3MNHA 2W2JA 5FL5A 3NI5A 3CZVA 3IAIA 5SZ5A 2NXRA 3V3FA 6CA2A 3JXFA 3K34A 3RJ7A 4WR7A 5DSPA 5SZ3A 1MUAA 2IT4A 3K7KA 3S75B 4L5WA 5FNGA 1LGDA 5E28A 2CABA 1CCSA 1JCZA 4KNJA 3T85A 5E2MA 5AMDA 3RZ1B 3U45X 4WW8A 3W6HA 4COQA 4DZ7A 4YYTA 1V9EA 4MO8A 3V2MA 5JG5B 3RGEA 4K1QA 3SBIA
chains in the Genus database with same CATH topology
4QEFA 1RZCA 3S73B 3RZ0B 5A6HA 4CNRA 1I9PA 4HU1A 2EU2A 2H4NA 3S77B 4YGNA 1IF4A 3RZ5A 5EOIA 3F7UA 4PQ7A 3OYQA 2QOAA 4Q78A 1BNTA 2VVBX 3DD8A 1RAZA 4XIWA 5CA2A 1BN3A 1CA2A 1DMYA 1FQLA 1T9NA 1TE3X 3M14A 2CA2A 4WW6A 5E2KA 4E49A 4TWLA 5A25A 5G01A 5L3OA 5DSNA 4GL1X 3RZ7A 1CNXA 1TEQX 1ZGEA 3V5GA 4M2VA 2FOQA 3PO6A 3P44A 1ZE8A 5EHVA 1G6VA 1CNBA 4Q0LA 4Q9YA 1TEUX 4Z1EA 3M2XA 5EKHA 3V3GB 3RG3A 3MNKA 5JG3B 3JXGA 4Q81A 2O4ZA 4Q7SA 4RUXA 4Q83A 4ZAOA 4YXUA 4E4AA 5DSKA 3L14A 3EFIA 1CNKA 3P5LA 2ABEA 2X7UA 2POWA 4QK3A 5FLPA 3MHMA 4L5UA 3S8XA 1I9LA 4K13A 4Q99A 1CNCA 1RJ5A 3RYVB 3T84A 2VVAX 1ZSAA 2AW1A 4E3FA 5E2NA 5DSQA 2QP6A 1CAOA 3M2ZA 9CA2A 4IDRX 1G3ZA 3D93A 4FPTA 1JV0A 1ZSCA 1I90A 1CAJA 1FR7A 1TBTX 5EHWA 4ZWXA 4ZWZA 3M2YA 3BL0A 4LU3A 3F7BA 4X5SA 3C7PA 2CBBA 1BNVA 4QJPA 3IBLA 1I9QA 5E5RA 1CAKA 7CA2A 4E3HA 1FQNA 3B4FA 4YXOA 3MHIA 3TVNX 5G0BA 4FIKA 4HF3A 5DSRA 3MWOA 4JS6A 1RZBA 5EH7A 3NB5A 5E2SA 1G0EA 1DMXA 2OSFA 4KP5A 1EOUA 3KNEA 3OIMA 3M1QA 1FSQA 5CACA 1CALA 3S9TA 4CNWA 1CNGA 3D9ZA 3FW3A 4YGFA 3TVOX 3SAPA 4BCWA 1KOPA 5FNLA 4PZHA 1KWQA 2AX2A 4MLXA 5LMDA 2WEOA 3M5SA 5JDVB 4KAPA 4QIZA 1TG3A 3MZCA 3M98A 2FNMA 1KWRA 4RUYA 4JSSA 3KONA 5EZTX 5HPJA 3DBUA 3GZ0A 4FRCA 5JEGB 1CVBA 5FNMA 4YXIA 3N0NA 2EU3A 2NWOA 3D8WA 3T5ZA 4PYYA 12CAA 1Z9YA 4Q7VA 4HEZA 1CA3A 5JEHB 1HCBA 3V3HB 2POUA 3MNUA 3ZP9A 1CVCA 4Q90A 3DCSA 4QJWA 5EIJA 2NWPA 5EH8A 4KNMA 4RIVA 4BF1A 2HNCA 3NJ9A 1CNIA 2WD2A 2GEHA 3BETA 4Q09A 3FFPX 5DOHA 3MHOA 1CINA 3PYKA 5JGSB 1CILA 2NNOA 4KV0A 5G0CA 2FNKA 3OILA 5AMLA 4RUZA 1IF8A 3B1BA 1AVNA 4Q49A 3RYJB 2NN7A 4Z0QA 5FL6A 5EKMA 3EFTA 4E9OX 4YGKA 1OKNA 3ML2A 5JQ0A 5E2RA 3IBUA 3RLDA 1XEGA 1I8ZA 3F4XA 4KNIA 4E3DA 2ZNCA 3HKQA 3M1JA 3RYZA 1KEQA 1LG6A 3OKUA 2Q1BA 4JSAA 4WUPA 4CNXA 4N0XB 3R16A 4RFDA 4QSBA 5AMGA 1THKA 4TWMA 5DSOA 4ETQC 2NWZA 4FU5A 2NXTA 2HFWA 1HUHA 1F2WA 1MOOA 4QJXA 4ZX0A 3KS3A 3N2PA 5DSJA 4M2RA 2FW4A 3MHCA 3W6IA 1FSRA 4MDMA 1FSNA 3UYNA 2POVA 3KKXA 1CCUA 1YO1A 5BRVA 5DSLA 4ITOA 5FNHA 1JD0A 5FNJA 4YX4A 3M96A 3SBHA 3KOKA 5BNLA 1CAHA 1HUGA 4FL7A 1Z93A 3HLJA 4RFCA 1XEVA 3P55A 5IPZA 5FNKA 4QY3A 5SZ6A 2WEHA 5BYIA 3HKNA 3JXHC 3S74B 4E5QA 4YWPA 5E5UA 2WEGA 1LUGA 4QK2A 1G53A 3N3JA 4QSJA 4QJOA 4C3TA 3DC9A 3S71B 3MHLA 1CIMA 3OKVA 3R17B 2X7TA 4MDLA 1XPZA 4ITPA 4R5BA 4Y0JA 2FMZA 4Z1JA 1BN4A 1DCAA 3M2NA 2CBEA 1ZNCA 1G52A 4Z1NA 4ZX1A 1YO2A 1G46A 4RN4A 4CA2A 4Q08A 4M2UA 3BL1A 3RYXB 4KUWA 1UGDA 5JEPB 3UYQA 1LZVA 1CNWA 3VBDA 3S78B 5BRWA 3MNAA 5J8ZA 5BRUA 5DOGA 5L6KA 3P5AA 4Q6DA 3Q31A 4QJMA 3DV7A 4FVNA 1I9MA 4RH2A 5FLOA 4E3GA 1RZDA 3M40A 4HEWA 2NWYA 3HKTA 4KP8A 1G4JA 4IWZA 1UGCA 1DCBA 3T5UA 5C8IA 8CA2A 3OIKA 1CNJA 1CANA 4K0ZA 4MLTA 1I9OA 1HEAA 3P3HA 1ZGFA 3T83A 2H15A 4KNNA 5EH5A 3M1KA 3DA2A 4QIYA 5FDIA 3KWAA 4K0TA 4PYXA 2NMXA 3V3IB 3V2JA 1CVHA 1AZMA 2ILIA 4G0CA 1CVEA 5DVXA 3MNJA 1G54A 4YGJA 3RG4A 1CAMA 3DVDA 5JGTB 1UGGA 1UGBA 1UGEA 4LP6A 3CA2A 1BNUA 4CQ0A 1FQRA 1BNNA 3HFPA 2CBDA 3M04A 3D92A 4QK1A 3CAJA 1YDAA 3KIGA 4RIUA 4ZWIA 1H9NA 1CVDA 1ZFQA 2NNVA 3U3AX 3M3XA 1RAYA 3RYYA 4ILXA 5FLRA 5CJFA 1RZAA 1CNYA 1G4OA 2Q1QA 3CYUA 1XQ0A 1YDDA 4XIXA 2FOSA 1IF5A 4XE1A 3MDZA 1OKMA 3U7CA 3U47A 4ZWYA 5DSIA 4QTLA 1BICA 5FLTA 1HVAA 2FNNA 1G48A 1RJ6A 1OKLA 2X7SA 3FE4A 1TG9A 3S72B 4KUYA 1LG5A 1H9QA 1TH9A 2FOUA 1YO0A 1KOQA 4BF6A 3F8EA 3D0NA 3DVBA 5SZ7A 5FNIA 1YDCA 1URTA 1TTMA 1BZMA 4QSAA 3DAZA 1FR4A 5SZ0A 1BN1A 3DCWA 2NN1A 1ZFKA 2HL4A 4M2WA 4HT2A 1CCTA 3KOIA 1BNQA 1I91A 1CAZA 4G7AA 3PJJA 3V3JA 4UOVA 3T82A 1BNWA 3LXEA 2FOVA 5FL4A 3OY0A 4KUVA 2CBCA 4Q8ZA 4MDGA 4FVOA 1ZH9A 1I9NA 2FMGA 2OSMA 1Y7WA 3M5EA 4LHIA 4PXXA 2HD6A 3IGPA 1HEDA 4CACA 1OQ5A 4N16A 1AM6A 2CBAA 3IEOA 1CZMA 4L5VA 1G0FA 4XZ5A 3ZNCA 1BCDA 3IBIA 4Q8YA 3IBNA 4QJ0A 5FLQA 5DSMA 3HS4A 1RZEA 3M1WA 4DZ9A 3P58A 4JSZA 4QSIA 4XFWA 3V7XA 4Z1KA 5G03A 1CNHA 2NNSA 1G1DA 3MMFA 3DVCA 4Q06A 1FQMA 5CLUA 2F14A 2GD8A 1CAIA 5FDCA 4Q07A 4Q7PA 5JQTA 3DC3A 5EHEA 1CAYA 4HBAA 5JESB 4JSWA 1TB0X 1UGAA 4WL4A 3S97A 1IF9A 1IF7A 3QYKA 1H4NA 3S76A 4Q87A 3KLDB 1G45A 4K0SA 1CVFA 1YDBA 3TMJA 2FOYA 4YVYA 3M67A 2NNGA 3K2FA 2HOCA 3M5TA 1BV3A 3N4BA 5EKJA 1BNMA 1Z97A 4HT0A 1FLJA 4HEYA 1CRAA 1V9IC 4Q7WA 4R59A 5SZ1A 1UGFA 1IF6A 2EZ7A 3DD0A 2WD3A 3P4VA 1ZSBA 5SZ4A 3HKUA 2NXSA 4CNVA 3ML5A 4YGLA 4YHAA 2Q38A 1J9WA 4Q6EA 4R5AA 5FLSA 5SZ2A 2WEJA 4MTYA 2QO8A 1CVAA 1HEBA 2HKKA 4Q8XA 4WUQA 3OYSA 1A42A 5DRSA 1HCAA 3DCCA 3MYQA 3SAXA 3P3JA 1HECA 3RZ8A 3MNIA 1CRMA 3MNHA 2W2JA 5FL5A 3NI5A 3CZVA 3IAIA 5SZ5A 2NXRA 3V3FA 6CA2A 3JXFA 3K34A 3RJ7A 4WR7A 5DSPA 5SZ3A 1MUAA 2IT4A 3K7KA 3S75B 4L5WA 5FNGA 1LGDA 5E28A 2CABA 1CCSA 1JCZA 4KNJA 3T85A 5E2MA 5AMDA 3RZ1B 3U45X 4WW8A 3W6HA 4COQA 4DZ7A 4YYTA 1V9EA 4MO8A 3V2MA 5JG5B 3RGEA 4K1QA 3SBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QEF A;  1RZC A;  3S73 B;  3RZ0 B;  5A6H A;  4CNR A;  1I9P A;  4HU1 A;  2EU2 A;  2H4N A;  3S77 B;  4YGN A;  1IF4 A;  3RZ5 A;  5EOI A;  3F7U A;  4PQ7 A;  3OYQ A;  2QOA A;  4Q78 A;  1BNT A;  2VVB X;  3DD8 A;  1RAZ A;  4XIW A;  5CA2 A;  1BN3 A;  1CA2 A;  1DMY A;  1FQL A;  1T9N A;  1TE3 X;  3M14 A;  2CA2 A;  4WW6 A;  5E2K A;  4E49 A;  4TWL A;  5A25 A;  5G01 A;  5L3O A;  5DSN A;  4GL1 X;  3RZ7 A;  1CNX A;  1TEQ X;  1ZGE A;  3V5G A;  4M2V A;  2FOQ A;  3PO6 A;  3P44 A;  1ZE8 A;  5EHV A;  1G6V A;  1CNB A;  4Q0L A;  4Q9Y A;  1TEU X;  4Z1E A;  3M2X A;  5EKH A;  3V3G B;  3RG3 A;  3MNK A;  5JG3 B;  3JXG A;  4Q81 A;  2O4Z A;  4Q7S A;  4RUX A;  4Q83 A;  4ZAO A;  4YXU A;  4E4A A;  5DSK A;  3L14 A;  3EFI A;  1CNK A;  3P5L A;  2ABE A;  2X7U A;  2POW A;  4QK3 A;  5FLP A;  3MHM A;  4L5U A;  3S8X A;  1I9L A;  4K13 A;  4Q99 A;  1CNC A;  1RJ5 A;  3RYV B;  3T84 A;  2VVA X;  1ZSA A;  2AW1 A;  4E3F A;  5E2N A;  5DSQ A;  2QP6 A;  1CAO A;  3M2Z A;  9CA2 A;  4IDR X;  1G3Z A;  3D93 A;  4FPT A;  1JV0 A;  1ZSC A;  1I90 A;  1CAJ A;  1FR7 A;  1TBT X;  5EHW A;  4ZWX A;  4ZWZ A;  3M2Y A;  3BL0 A;  4LU3 A;  3F7B A;  4X5S A;  3C7P A;  2CBB A;  1BNV A;  4QJP A;  3IBL A;  1I9Q A;  5E5R A;  1CAK A;  7CA2 A;  4E3H A;  1FQN A;  3B4F A;  4YXO A;  3MHI A;  3TVN X;  5G0B A;  4FIK A;  4HF3 A;  5DSR A;  3MWO A;  4JS6 A;  1RZB A;  5EH7 A;  3NB5 A;  5E2S A;  1G0E A;  1DMX A;  2OSF A;  4KP5 A;  1EOU A;  3KNE A;  3OIM A;  3M1Q A;  1FSQ A;  5CAC A;  1CAL A;  3S9T A;  4CNW A;  1CNG A;  3D9Z A;  3FW3 A;  4YGF A;  3TVO X;  3SAP A;  4BCW A;  1KOP A;  5FNL A;  4PZH A;  1KWQ A;  2AX2 A;  4MLX A;  5LMD A;  2WEO A;  3M5S A;  5JDV B;  4KAP A;  4QIZ A;  1TG3 A;  3MZC A;  3M98 A;  2FNM A;  1KWR A;  4RUY A;  4JSS A;  3KON A;  5EZT X;  5HPJ A;  3DBU A;  3GZ0 A;  4FRC A;  5JEG B;  1CVB A;  5FNM A;  4YXI A;  3N0N A;  2EU3 A;  2NWO A;  3D8W A;  3T5Z A;  4PYY A;  12CA A;  1Z9Y A;  4Q7V A;  4HEZ A;  1CA3 A;  5JEH B;  1HCB A;  3V3H B;  2POU A;  3MNU A;  3ZP9 A;  1CVC A;  4Q90 A;  3DCS A;  4QJW A;  5EIJ A;  2NWP A;  5EH8 A;  4KNM A;  4RIV A;  4BF1 A;  2HNC A;  3NJ9 A;  1CNI A;  2WD2 A;  2GEH A;  3BET A;  4Q09 A;  3FFP X;  5DOH A;  3MHO A;  1CIN A;  3PYK A;  5JGS B;  1CIL A;  2NNO A;  4KV0 A;  5G0C A;  2FNK A;  3OIL A;  5AML A;  4RUZ A;  1IF8 A;  3B1B A;  1AVN A;  4Q49 A;  3RYJ B;  2NN7 A;  4Z0Q A;  5FL6 A;  5EKM A;  3EFT A;  4E9O X;  4YGK A;  1OKN A;  3ML2 A;  5JQ0 A;  5E2R A;  3IBU A;  3RLD A;  1XEG A;  1I8Z A;  3F4X A;  4KNI A;  4E3D A;  2ZNC A;  3HKQ A;  3M1J A;  3RYZ A;  1KEQ A;  1LG6 A;  3OKU A;  2Q1B A;  4JSA A;  4WUP A;  4CNX A;  4N0X B;  3R16 A;  4RFD A;  4QSB A;  5AMG A;  1THK A;  4TWM A;  5DSO A;  4ETQ C;  2NWZ A;  4FU5 A;  2NXT A;  2HFW A;  1HUH A;  1F2W A;  1MOO A;  4QJX A;  4ZX0 A;  3KS3 A;  3N2P A;  5DSJ A;  4M2R A;  2FW4 A;  3MHC A;  3W6I A;  1FSR A;  4MDM A;  1FSN A;  3UYN A;  2POV A;  3KKX A;  1CCU A;  1YO1 A;  5BRV A;  5DSL A;  4ITO A;  5FNH A;  1JD0 A;  5FNJ A;  4YX4 A;  3M96 A;  3SBH A;  3KOK A;  5BNL A;  1CAH A;  1HUG A;  4FL7 A;  1Z93 A;  3HLJ A;  4RFC A;  1XEV A;  3P55 A;  5IPZ A;  5FNK A;  4QY3 A;  5SZ6 A;  2WEH A;  5BYI A;  3HKN A;  3JXH C;  3S74 B;  4E5Q A;  4YWP A;  5E5U A;  2WEG A;  1LUG A;  4QK2 A;  1G53 A;  3N3J A;  4QSJ A;  4QJO A;  4C3T A;  3DC9 A;  3S71 B;  3MHL A;  1CIM A;  3OKV A;  3R17 B;  2X7T A;  4MDL A;  1XPZ A;  4ITP A;  4R5B A;  4Y0J A;  2FMZ A;  4Z1J A;  1BN4 A;  1DCA A;  3M2N A;  2CBE A;  1ZNC A;  1G52 A;  4Z1N A;  4ZX1 A;  1YO2 A;  1G46 A;  4RN4 A;  4CA2 A;  4Q08 A;  4M2U A;  3BL1 A;  3RYX B;  4KUW A;  1UGD A;  5JEP B;  3UYQ A;  1LZV A;  1CNW A;  3VBD A;  3S78 B;  5BRW A;  3MNA A;  5J8Z A;  5BRU A;  5DOG A;  5L6K A;  3P5A A;  4Q6D A;  3Q31 A;  4QJM A;  3DV7 A;  4FVN A;  1I9M A;  4RH2 A;  5FLO A;  4E3G A;  1RZD A;  3M40 A;  4HEW A;  2NWY A;  3HKT A;  4KP8 A;  1G4J A;  4IWZ A;  1UGC A;  1DCB A;  3T5U A;  5C8I A;  8CA2 A;  3OIK A;  1CNJ A;  1CAN A;  4K0Z A;  4MLT A;  1I9O A;  1HEA A;  3P3H A;  1ZGF A;  3T83 A;  2H15 A;  4KNN A;  5EH5 A;  3M1K A;  3DA2 A;  4QIY A;  5FDI A;  3KWA A;  4K0T A;  4PYX A;  2NMX A;  3V3I B;  3V2J A;  1CVH A;  1AZM A;  2ILI A;  4G0C A;  1CVE A;  5DVX A;  3MNJ A;  1G54 A;  4YGJ A;  3RG4 A;  1CAM A;  3DVD A;  5JGT B;  1UGG A;  1UGB A;  1UGE A;  4LP6 A;  3CA2 A;  1BNU A;  4CQ0 A;  1FQR A;  1BNN A;  3HFP A;  2CBD A;  3M04 A;  3D92 A;  4QK1 A;  3CAJ A;  1YDA A;  3KIG A;  4RIU A;  4ZWI A;  1H9N A;  1CVD A;  1ZFQ A;  2NNV A;  3U3A X;  3M3X A;  1RAY A;  3RYY A;  4ILX A;  5FLR A;  5CJF A;  1RZA A;  1CNY A;  1G4O A;  2Q1Q A;  3CYU A;  1XQ0 A;  1YDD A;  4XIX A;  2FOS A;  1IF5 A;  4XE1 A;  3MDZ A;  1OKM A;  3U7C A;  3U47 A;  4ZWY A;  5DSI A;  4QTL A;  1BIC A;  5FLT A;  1HVA A;  2FNN A;  1G48 A;  1RJ6 A;  1OKL A;  2X7S A;  3FE4 A;  1TG9 A;  3S72 B;  4KUY A;  1LG5 A;  1H9Q A;  1TH9 A;  2FOU A;  1YO0 A;  1KOQ A;  4BF6 A;  3F8E A;  3D0N A;  3DVB A;  5SZ7 A;  5FNI A;  1YDC A;  1URT A;  1TTM A;  1BZM A;  4QSA A;  3DAZ A;  1FR4 A;  5SZ0 A;  1BN1 A;  3DCW A;  2NN1 A;  1ZFK A;  2HL4 A;  4M2W A;  4HT2 A;  1CCT A;  3KOI A;  1BNQ A;  1I91 A;  1CAZ A;  4G7A A;  3PJJ A;  3V3J A;  4UOV A;  3T82 A;  1BNW A;  3LXE A;  2FOV A;  5FL4 A;  3OY0 A;  4KUV A;  2CBC A;  4Q8Z A;  4MDG A;  4FVO A;  1ZH9 A;  1I9N A;  2FMG A;  2OSM A;  1Y7W A;  3M5E A;  4LHI A;  4PXX A;  2HD6 A;  3IGP A;  1HED A;  4CAC A;  1OQ5 A;  4N16 A;  1AM6 A;  2CBA A;  3IEO A;  1CZM A;  4L5V A;  1G0F A;  4XZ5 A;  3ZNC A;  1BCD A;  3IBI A;  4Q8Y A;  3IBN A;  4QJ0 A;  5FLQ A;  5DSM A;  3HS4 A;  1RZE A;  3M1W A;  4DZ9 A;  3P58 A;  4JSZ A;  4QSI A;  4XFW A;  3V7X A;  4Z1K A;  5G03 A;  1CNH A;  2NNS A;  1G1D A;  3MMF A;  3DVC A;  4Q06 A;  1FQM A;  5CLU A;  2F14 A;  2GD8 A;  1CAI A;  5FDC A;  4Q07 A;  4Q7P A;  5JQT A;  3DC3 A;  5EHE A;  1CAY A;  4HBA A;  5JES B;  4JSW A;  1TB0 X;  1UGA A;  4WL4 A;  3S97 A;  1IF9 A;  1IF7 A;  3QYK A;  1H4N A;  3S76 A;  4Q87 A;  3KLD B;  1G45 A;  4K0S A;  1CVF A;  1YDB A;  3TMJ A;  2FOY A;  4YVY A;  3M67 A;  2NNG A;  3K2F A;  2HOC A;  3M5T A;  1BV3 A;  3N4B A;  5EKJ A;  1BNM A;  1Z97 A;  4HT0 A;  1FLJ A;  4HEY A;  1CRA A;  1V9I C;  4Q7W A;  4R59 A;  5SZ1 A;  1UGF A;  1IF6 A;  2EZ7 A;  3DD0 A;  2WD3 A;  3P4V A;  1ZSB A;  5SZ4 A;  3HKU A;  2NXS A;  4CNV A;  3ML5 A;  4YGL A;  4YHA A;  2Q38 A;  1J9W A;  4Q6E A;  4R5A A;  5FLS A;  5SZ2 A;  2WEJ A;  4MTY A;  2QO8 A;  1CVA A;  1HEB A;  2HKK A;  4Q8X A;  4WUQ A;  3OYS A;  1A42 A;  5DRS A;  1HCA A;  3DCC A;  3MYQ A;  3SAX A;  3P3J A;  1HEC A;  3RZ8 A;  3MNI A;  1CRM A;  3MNH A;  2W2J A;  5FL5 A;  3NI5 A;  3CZV A;  3IAI A;  5SZ5 A;  2NXR A;  3V3F A;  6CA2 A;  3JXF A;  3K34 A;  3RJ7 A;  4WR7 A;  5DSP A;  5SZ3 A;  1MUA A;  2IT4 A;  3K7K A;  3S75 B;  4L5W A;  5FNG A;  1LGD A;  5E28 A;  2CAB A;  1CCS A;  1JCZ A;  4KNJ A;  3T85 A;  5E2M A;  5AMD A;  3RZ1 B;  3U45 X;  4WW8 A;  3W6H A;  4COQ A;  4DZ7 A;  4YYT A;  1V9E A;  4MO8 A;  3V2M A;  5JG5 B;  3RGE A;  4K1Q A;  3SBI A; 
#chains in the Genus database with same CATH topology
 4QEF A;  1RZC A;  3S73 B;  3RZ0 B;  5A6H A;  4CNR A;  1I9P A;  4HU1 A;  2EU2 A;  2H4N A;  3S77 B;  4YGN A;  1IF4 A;  3RZ5 A;  5EOI A;  3F7U A;  4PQ7 A;  3OYQ A;  2QOA A;  4Q78 A;  1BNT A;  2VVB X;  3DD8 A;  1RAZ A;  4XIW A;  5CA2 A;  1BN3 A;  1CA2 A;  1DMY A;  1FQL A;  1T9N A;  1TE3 X;  3M14 A;  2CA2 A;  4WW6 A;  5E2K A;  4E49 A;  4TWL A;  5A25 A;  5G01 A;  5L3O A;  5DSN A;  4GL1 X;  3RZ7 A;  1CNX A;  1TEQ X;  1ZGE A;  3V5G A;  4M2V A;  2FOQ A;  3PO6 A;  3P44 A;  1ZE8 A;  5EHV A;  1G6V A;  1CNB A;  4Q0L A;  4Q9Y A;  1TEU X;  4Z1E A;  3M2X A;  5EKH A;  3V3G B;  3RG3 A;  3MNK A;  5JG3 B;  3JXG A;  4Q81 A;  2O4Z A;  4Q7S A;  4RUX A;  4Q83 A;  4ZAO A;  4YXU A;  4E4A A;  5DSK A;  3L14 A;  3EFI A;  1CNK A;  3P5L A;  2ABE A;  2X7U A;  2POW A;  4QK3 A;  5FLP A;  3MHM A;  4L5U A;  3S8X A;  1I9L A;  4K13 A;  4Q99 A;  1CNC A;  1RJ5 A;  3RYV B;  3T84 A;  2VVA X;  1ZSA A;  2AW1 A;  4E3F A;  5E2N A;  5DSQ A;  2QP6 A;  1CAO A;  3M2Z A;  9CA2 A;  4IDR X;  1G3Z A;  3D93 A;  4FPT A;  1JV0 A;  1ZSC A;  1I90 A;  1CAJ A;  1FR7 A;  1TBT X;  5EHW A;  4ZWX A;  4ZWZ A;  3M2Y A;  3BL0 A;  4LU3 A;  3F7B A;  4X5S A;  3C7P A;  2CBB A;  1BNV A;  4QJP A;  3IBL A;  1I9Q A;  5E5R A;  1CAK A;  7CA2 A;  4E3H A;  1FQN A;  3B4F A;  4YXO A;  3MHI A;  3TVN X;  5G0B A;  4FIK A;  4HF3 A;  5DSR A;  3MWO A;  4JS6 A;  1RZB A;  5EH7 A;  3NB5 A;  5E2S A;  1G0E A;  1DMX A;  2OSF A;  4KP5 A;  1EOU A;  3KNE A;  3OIM A;  3M1Q A;  1FSQ A;  5CAC A;  1CAL A;  3S9T A;  4CNW A;  1CNG A;  3D9Z A;  3FW3 A;  4YGF A;  3TVO X;  3SAP A;  4BCW A;  1KOP A;  5FNL A;  4PZH A;  1KWQ A;  2AX2 A;  4MLX A;  5LMD A;  2WEO A;  3M5S A;  5JDV B;  4KAP A;  4QIZ A;  1TG3 A;  3MZC A;  3M98 A;  2FNM A;  1KWR A;  4RUY A;  4JSS A;  3KON A;  5EZT X;  5HPJ A;  3DBU A;  3GZ0 A;  4FRC A;  5JEG B;  1CVB A;  5FNM A;  4YXI A;  3N0N A;  2EU3 A;  2NWO A;  3D8W A;  3T5Z A;  4PYY A;  12CA A;  1Z9Y A;  4Q7V A;  4HEZ A;  1CA3 A;  5JEH B;  1HCB A;  3V3H B;  2POU A;  3MNU A;  3ZP9 A;  1CVC A;  4Q90 A;  3DCS A;  4QJW A;  5EIJ A;  2NWP A;  5EH8 A;  4KNM A;  4RIV A;  4BF1 A;  2HNC A;  3NJ9 A;  1CNI A;  2WD2 A;  2GEH A;  3BET A;  4Q09 A;  3FFP X;  5DOH A;  3MHO A;  1CIN A;  3PYK A;  5JGS B;  1CIL A;  2NNO A;  4KV0 A;  5G0C A;  2FNK A;  3OIL A;  5AML A;  4RUZ A;  1IF8 A;  3B1B A;  1AVN A;  4Q49 A;  3RYJ B;  2NN7 A;  4Z0Q A;  5FL6 A;  5EKM A;  3EFT A;  4E9O X;  4YGK A;  1OKN A;  3ML2 A;  5JQ0 A;  5E2R A;  3IBU A;  3RLD A;  1XEG A;  1I8Z A;  3F4X A;  4KNI A;  4E3D A;  2ZNC A;  3HKQ A;  3M1J A;  3RYZ A;  1KEQ A;  1LG6 A;  3OKU A;  2Q1B A;  4JSA A;  4WUP A;  4CNX A;  4N0X B;  3R16 A;  4RFD A;  4QSB A;  5AMG A;  1THK A;  4TWM A;  5DSO A;  4ETQ C;  2NWZ A;  4FU5 A;  2NXT A;  2HFW A;  1HUH A;  1F2W A;  1MOO A;  4QJX A;  4ZX0 A;  3KS3 A;  3N2P A;  5DSJ A;  4M2R A;  2FW4 A;  3MHC A;  3W6I A;  1FSR A;  4MDM A;  1FSN A;  3UYN A;  2POV A;  3KKX A;  1CCU A;  1YO1 A;  5BRV A;  5DSL A;  4ITO A;  5FNH A;  1JD0 A;  5FNJ A;  4YX4 A;  3M96 A;  3SBH A;  3KOK A;  5BNL A;  1CAH A;  1HUG A;  4FL7 A;  1Z93 A;  3HLJ A;  4RFC A;  1XEV A;  3P55 A;  5IPZ A;  5FNK A;  4QY3 A;  5SZ6 A;  2WEH A;  5BYI A;  3HKN A;  3JXH C;  3S74 B;  4E5Q A;  4YWP A;  5E5U A;  2WEG A;  1LUG A;  4QK2 A;  1G53 A;  3N3J A;  4QSJ A;  4QJO A;  4C3T A;  3DC9 A;  3S71 B;  3MHL A;  1CIM A;  3OKV A;  3R17 B;  2X7T A;  4MDL A;  1XPZ A;  4ITP A;  4R5B A;  4Y0J A;  2FMZ A;  4Z1J A;  1BN4 A;  1DCA A;  3M2N A;  2CBE A;  1ZNC A;  1G52 A;  4Z1N A;  4ZX1 A;  1YO2 A;  1G46 A;  4RN4 A;  4CA2 A;  4Q08 A;  4M2U A;  3BL1 A;  3RYX B;  4KUW A;  1UGD A;  5JEP B;  3UYQ A;  1LZV A;  1CNW A;  3VBD A;  3S78 B;  5BRW A;  3MNA A;  5J8Z A;  5BRU A;  5DOG A;  5L6K A;  3P5A A;  4Q6D A;  3Q31 A;  4QJM A;  3DV7 A;  4FVN A;  1I9M A;  4RH2 A;  5FLO A;  4E3G A;  1RZD A;  3M40 A;  4HEW A;  2NWY A;  3HKT A;  4KP8 A;  1G4J A;  4IWZ A;  1UGC A;  1DCB A;  3T5U A;  5C8I A;  8CA2 A;  3OIK A;  1CNJ A;  1CAN A;  4K0Z A;  4MLT A;  1I9O A;  1HEA A;  3P3H A;  1ZGF A;  3T83 A;  2H15 A;  4KNN A;  5EH5 A;  3M1K A;  3DA2 A;  4QIY A;  5FDI A;  3KWA A;  4K0T A;  4PYX A;  2NMX A;  3V3I B;  3V2J A;  1CVH A;  1AZM A;  2ILI A;  4G0C A;  1CVE A;  5DVX A;  3MNJ A;  1G54 A;  4YGJ A;  3RG4 A;  1CAM A;  3DVD A;  5JGT B;  1UGG A;  1UGB A;  1UGE A;  4LP6 A;  3CA2 A;  1BNU A;  4CQ0 A;  1FQR A;  1BNN A;  3HFP A;  2CBD A;  3M04 A;  3D92 A;  4QK1 A;  3CAJ A;  1YDA A;  3KIG A;  4RIU A;  4ZWI A;  1H9N A;  1CVD A;  1ZFQ A;  2NNV A;  3U3A X;  3M3X A;  1RAY A;  3RYY A;  4ILX A;  5FLR A;  5CJF A;  1RZA A;  1CNY A;  1G4O A;  2Q1Q A;  3CYU A;  1XQ0 A;  1YDD A;  4XIX A;  2FOS A;  1IF5 A;  4XE1 A;  3MDZ A;  1OKM A;  3U7C A;  3U47 A;  4ZWY A;  5DSI A;  4QTL A;  1BIC A;  5FLT A;  1HVA A;  2FNN A;  1G48 A;  1RJ6 A;  1OKL A;  2X7S A;  3FE4 A;  1TG9 A;  3S72 B;  4KUY A;  1LG5 A;  1H9Q A;  1TH9 A;  2FOU A;  1YO0 A;  1KOQ A;  4BF6 A;  3F8E A;  3D0N A;  3DVB A;  5SZ7 A;  5FNI A;  1YDC A;  1URT A;  1TTM A;  1BZM A;  4QSA A;  3DAZ A;  1FR4 A;  5SZ0 A;  1BN1 A;  3DCW A;  2NN1 A;  1ZFK A;  2HL4 A;  4M2W A;  4HT2 A;  1CCT A;  3KOI A;  1BNQ A;  1I91 A;  1CAZ A;  4G7A A;  3PJJ A;  3V3J A;  4UOV A;  3T82 A;  1BNW A;  3LXE A;  2FOV A;  5FL4 A;  3OY0 A;  4KUV A;  2CBC A;  4Q8Z A;  4MDG A;  4FVO A;  1ZH9 A;  1I9N A;  2FMG A;  2OSM A;  1Y7W A;  3M5E A;  4LHI A;  4PXX A;  2HD6 A;  3IGP A;  1HED A;  4CAC A;  1OQ5 A;  4N16 A;  1AM6 A;  2CBA A;  3IEO A;  1CZM A;  4L5V A;  1G0F A;  4XZ5 A;  3ZNC A;  1BCD A;  3IBI A;  4Q8Y A;  3IBN A;  4QJ0 A;  5FLQ A;  5DSM A;  3HS4 A;  1RZE A;  3M1W A;  4DZ9 A;  3P58 A;  4JSZ A;  4QSI A;  4XFW A;  3V7X A;  4Z1K A;  5G03 A;  1CNH A;  2NNS A;  1G1D A;  3MMF A;  3DVC A;  4Q06 A;  1FQM A;  5CLU A;  2F14 A;  2GD8 A;  1CAI A;  5FDC A;  4Q07 A;  4Q7P A;  5JQT A;  3DC3 A;  5EHE A;  1CAY A;  4HBA A;  5JES B;  4JSW A;  1TB0 X;  1UGA A;  4WL4 A;  3S97 A;  1IF9 A;  1IF7 A;  3QYK A;  1H4N A;  3S76 A;  4Q87 A;  3KLD B;  1G45 A;  4K0S A;  1CVF A;  1YDB A;  3TMJ A;  2FOY A;  4YVY A;  3M67 A;  2NNG A;  3K2F A;  2HOC A;  3M5T A;  1BV3 A;  3N4B A;  5EKJ A;  1BNM A;  1Z97 A;  4HT0 A;  1FLJ A;  4HEY A;  1CRA A;  1V9I C;  4Q7W A;  4R59 A;  5SZ1 A;  1UGF A;  1IF6 A;  2EZ7 A;  3DD0 A;  2WD3 A;  3P4V A;  1ZSB A;  5SZ4 A;  3HKU A;  2NXS A;  4CNV A;  3ML5 A;  4YGL A;  4YHA A;  2Q38 A;  1J9W A;  4Q6E A;  4R5A A;  5FLS A;  5SZ2 A;  2WEJ A;  4MTY A;  2QO8 A;  1CVA A;  1HEB A;  2HKK A;  4Q8X A;  4WUQ A;  3OYS A;  1A42 A;  5DRS A;  1HCA A;  3DCC A;  3MYQ A;  3SAX A;  3P3J A;  1HEC A;  3RZ8 A;  3MNI A;  1CRM A;  3MNH A;  2W2J A;  5FL5 A;  3NI5 A;  3CZV A;  3IAI A;  5SZ5 A;  2NXR A;  3V3F A;  6CA2 A;  3JXF A;  3K34 A;  3RJ7 A;  4WR7 A;  5DSP A;  5SZ3 A;  1MUA A;  2IT4 A;  3K7K A;  3S75 B;  4L5W A;  5FNG A;  1LGD A;  5E28 A;  2CAB A;  1CCS A;  1JCZ A;  4KNJ A;  3T85 A;  5E2M A;  5AMD A;  3RZ1 B;  3U45 X;  4WW8 A;  3W6H A;  4COQ A;  4DZ7 A;  4YYT A;  1V9E A;  4MO8 A;  3V2M A;  5JG5 B;  3RGE A;  4K1Q A;  3SBI A; 
#chains in the Genus database with same CATH homology
 4QEF A;  1RZC A;  3S73 B;  3RZ0 B;  5A6H A;  4CNR A;  1I9P A;  4HU1 A;  2EU2 A;  2H4N A;  3S77 B;  4YGN A;  1IF4 A;  3RZ5 A;  5EOI A;  3F7U A;  4PQ7 A;  3OYQ A;  2QOA A;  4Q78 A;  1BNT A;  2VVB X;  3DD8 A;  1RAZ A;  4XIW A;  5CA2 A;  1BN3 A;  1CA2 A;  1DMY A;  1FQL A;  1T9N A;  1TE3 X;  3M14 A;  2CA2 A;  4WW6 A;  5E2K A;  4E49 A;  4TWL A;  5A25 A;  5G01 A;  5L3O A;  5DSN A;  4GL1 X;  3RZ7 A;  1CNX A;  1TEQ X;  1ZGE A;  3V5G A;  4M2V A;  2FOQ A;  3PO6 A;  3P44 A;  1ZE8 A;  5EHV A;  1G6V A;  1CNB A;  4Q0L A;  4Q9Y A;  1TEU X;  4Z1E A;  3M2X A;  5EKH A;  3V3G B;  3RG3 A;  3MNK A;  5JG3 B;  3JXG A;  4Q81 A;  2O4Z A;  4Q7S A;  4RUX A;  4Q83 A;  4ZAO A;  4YXU A;  4E4A A;  5DSK A;  3L14 A;  3EFI A;  1CNK A;  3P5L A;  2ABE A;  2X7U A;  2POW A;  4QK3 A;  5FLP A;  3MHM A;  4L5U A;  3S8X A;  1I9L A;  4K13 A;  4Q99 A;  1CNC A;  1RJ5 A;  3RYV B;  3T84 A;  2VVA X;  1ZSA A;  2AW1 A;  4E3F A;  5E2N A;  5DSQ A;  2QP6 A;  1CAO A;  3M2Z A;  9CA2 A;  4IDR X;  1G3Z A;  3D93 A;  4FPT A;  1JV0 A;  1ZSC A;  1I90 A;  1CAJ A;  1FR7 A;  1TBT X;  5EHW A;  4ZWX A;  4ZWZ A;  3M2Y A;  3BL0 A;  4LU3 A;  3F7B A;  4X5S A;  3C7P A;  2CBB A;  1BNV A;  4QJP A;  3IBL A;  1I9Q A;  5E5R A;  1CAK A;  7CA2 A;  4E3H A;  1FQN A;  3B4F A;  4YXO A;  3MHI A;  3TVN X;  5G0B A;  4FIK A;  4HF3 A;  5DSR A;  3MWO A;  4JS6 A;  1RZB A;  5EH7 A;  3NB5 A;  5E2S A;  1G0E A;  1DMX A;  2OSF A;  4KP5 A;  1EOU A;  3KNE A;  3OIM A;  3M1Q A;  1FSQ A;  5CAC A;  1CAL A;  3S9T A;  4CNW A;  1CNG A;  3D9Z A;  3FW3 A;  4YGF A;  3TVO X;  3SAP A;  4BCW A;  1KOP A;  5FNL A;  4PZH A;  1KWQ A;  2AX2 A;  4MLX A;  5LMD A;  2WEO A;  3M5S A;  5JDV B;  4KAP A;  4QIZ A;  1TG3 A;  3MZC A;  3M98 A;  2FNM A;  1KWR A;  4RUY A;  4JSS A;  3KON A;  5EZT X;  5HPJ A;  3DBU A;  3GZ0 A;  4FRC A;  5JEG B;  1CVB A;  5FNM A;  4YXI A;  3N0N A;  2EU3 A;  2NWO A;  3D8W A;  3T5Z A;  4PYY A;  12CA A;  1Z9Y A;  4Q7V A;  4HEZ A;  1CA3 A;  5JEH B;  1HCB A;  3V3H B;  2POU A;  3MNU A;  3ZP9 A;  1CVC A;  4Q90 A;  3DCS A;  4QJW A;  5EIJ A;  2NWP A;  5EH8 A;  4KNM A;  4RIV A;  4BF1 A;  2HNC A;  3NJ9 A;  1CNI A;  2WD2 A;  2GEH A;  3BET A;  4Q09 A;  3FFP X;  5DOH A;  3MHO A;  1CIN A;  3PYK A;  5JGS B;  1CIL A;  2NNO A;  4KV0 A;  5G0C A;  2FNK A;  3OIL A;  5AML A;  4RUZ A;  1IF8 A;  3B1B A;  1AVN A;  4Q49 A;  3RYJ B;  2NN7 A;  4Z0Q A;  5FL6 A;  5EKM A;  3EFT A;  4E9O X;  4YGK A;  1OKN A;  3ML2 A;  5JQ0 A;  5E2R A;  3IBU A;  3RLD A;  1XEG A;  1I8Z A;  3F4X A;  4KNI A;  4E3D A;  2ZNC A;  3HKQ A;  3M1J A;  3RYZ A;  1KEQ A;  1LG6 A;  3OKU A;  2Q1B A;  4JSA A;  4WUP A;  4CNX A;  4N0X B;  3R16 A;  4RFD A;  4QSB A;  5AMG A;  1THK A;  4TWM A;  5DSO A;  4ETQ C;  2NWZ A;  4FU5 A;  2NXT A;  2HFW A;  1HUH A;  1F2W A;  1MOO A;  4QJX A;  4ZX0 A;  3KS3 A;  3N2P A;  5DSJ A;  4M2R A;  2FW4 A;  3MHC A;  3W6I A;  1FSR A;  4MDM A;  1FSN A;  3UYN A;  2POV A;  3KKX A;  1CCU A;  1YO1 A;  5BRV A;  5DSL A;  4ITO A;  5FNH A;  1JD0 A;  5FNJ A;  4YX4 A;  3M96 A;  3SBH A;  3KOK A;  5BNL A;  1CAH A;  1HUG A;  4FL7 A;  1Z93 A;  3HLJ A;  4RFC A;  1XEV A;  3P55 A;  5IPZ A;  5FNK A;  4QY3 A;  5SZ6 A;  2WEH A;  5BYI A;  3HKN A;  3JXH C;  3S74 B;  4E5Q A;  4YWP A;  5E5U A;  2WEG A;  1LUG A;  4QK2 A;  1G53 A;  3N3J A;  4QSJ A;  4QJO A;  4C3T A;  3DC9 A;  3S71 B;  3MHL A;  1CIM A;  3OKV A;  3R17 B;  2X7T A;  4MDL A;  1XPZ A;  4ITP A;  4R5B A;  4Y0J A;  2FMZ A;  4Z1J A;  1BN4 A;  1DCA A;  3M2N A;  2CBE A;  1ZNC A;  1G52 A;  4Z1N A;  4ZX1 A;  1YO2 A;  1G46 A;  4RN4 A;  4CA2 A;  4Q08 A;  4M2U A;  3BL1 A;  3RYX B;  4KUW A;  1UGD A;  5JEP B;  3UYQ A;  1LZV A;  1CNW A;  3VBD A;  3S78 B;  5BRW A;  3MNA A;  5J8Z A;  5BRU A;  5DOG A;  5L6K A;  3P5A A;  4Q6D A;  3Q31 A;  4QJM A;  3DV7 A;  4FVN A;  1I9M A;  4RH2 A;  5FLO A;  4E3G A;  1RZD A;  3M40 A;  4HEW A;  2NWY A;  3HKT A;  4KP8 A;  1G4J A;  4IWZ A;  1UGC A;  1DCB A;  3T5U A;  5C8I A;  8CA2 A;  3OIK A;  1CNJ A;  1CAN A;  4K0Z A;  4MLT A;  1I9O A;  1HEA A;  3P3H A;  1ZGF A;  3T83 A;  2H15 A;  4KNN A;  5EH5 A;  3M1K A;  3DA2 A;  4QIY A;  5FDI A;  3KWA A;  4K0T A;  4PYX A;  2NMX A;  3V3I B;  3V2J A;  1CVH A;  1AZM A;  2ILI A;  4G0C A;  1CVE A;  5DVX A;  3MNJ A;  1G54 A;  4YGJ A;  3RG4 A;  1CAM A;  3DVD A;  5JGT B;  1UGG A;  1UGB A;  1UGE A;  4LP6 A;  3CA2 A;  1BNU A;  4CQ0 A;  1FQR A;  1BNN A;  3HFP A;  2CBD A;  3M04 A;  3D92 A;  4QK1 A;  3CAJ A;  1YDA A;  3KIG A;  4RIU A;  4ZWI A;  1H9N A;  1CVD A;  1ZFQ A;  2NNV A;  3U3A X;  3M3X A;  1RAY A;  3RYY A;  4ILX A;  5FLR A;  5CJF A;  1RZA A;  1CNY A;  1G4O A;  2Q1Q A;  3CYU A;  1XQ0 A;  1YDD A;  4XIX A;  2FOS A;  1IF5 A;  4XE1 A;  3MDZ A;  1OKM A;  3U7C A;  3U47 A;  4ZWY A;  5DSI A;  4QTL A;  1BIC A;  5FLT A;  1HVA A;  2FNN A;  1G48 A;  1RJ6 A;  1OKL A;  2X7S A;  3FE4 A;  1TG9 A;  3S72 B;  4KUY A;  1LG5 A;  1H9Q A;  1TH9 A;  2FOU A;  1YO0 A;  1KOQ A;  4BF6 A;  3F8E A;  3D0N A;  3DVB A;  5SZ7 A;  5FNI A;  1YDC A;  1URT A;  1TTM A;  1BZM A;  4QSA A;  3DAZ A;  1FR4 A;  5SZ0 A;  1BN1 A;  3DCW A;  2NN1 A;  1ZFK A;  2HL4 A;  4M2W A;  4HT2 A;  1CCT A;  3KOI A;  1BNQ A;  1I91 A;  1CAZ A;  4G7A A;  3PJJ A;  3V3J A;  4UOV A;  3T82 A;  1BNW A;  3LXE A;  2FOV A;  5FL4 A;  3OY0 A;  4KUV A;  2CBC A;  4Q8Z A;  4MDG A;  4FVO A;  1ZH9 A;  1I9N A;  2FMG A;  2OSM A;  1Y7W A;  3M5E A;  4LHI A;  4PXX A;  2HD6 A;  3IGP A;  1HED A;  4CAC A;  1OQ5 A;  4N16 A;  1AM6 A;  2CBA A;  3IEO A;  1CZM A;  4L5V A;  1G0F A;  4XZ5 A;  3ZNC A;  1BCD A;  3IBI A;  4Q8Y A;  3IBN A;  4QJ0 A;  5FLQ A;  5DSM A;  3HS4 A;  1RZE A;  3M1W A;  4DZ9 A;  3P58 A;  4JSZ A;  4QSI A;  4XFW A;  3V7X A;  4Z1K A;  5G03 A;  1CNH A;  2NNS A;  1G1D A;  3MMF A;  3DVC A;  4Q06 A;  1FQM A;  5CLU A;  2F14 A;  2GD8 A;  1CAI A;  5FDC A;  4Q07 A;  4Q7P A;  5JQT A;  3DC3 A;  5EHE A;  1CAY A;  4HBA A;  5JES B;  4JSW A;  1TB0 X;  1UGA A;  4WL4 A;  3S97 A;  1IF9 A;  1IF7 A;  3QYK A;  1H4N A;  3S76 A;  4Q87 A;  3KLD B;  1G45 A;  4K0S A;  1CVF A;  1YDB A;  3TMJ A;  2FOY A;  4YVY A;  3M67 A;  2NNG A;  3K2F A;  2HOC A;  3M5T A;  1BV3 A;  3N4B A;  5EKJ A;  1BNM A;  1Z97 A;  4HT0 A;  1FLJ A;  4HEY A;  1CRA A;  1V9I C;  4Q7W A;  4R59 A;  5SZ1 A;  1UGF A;  1IF6 A;  2EZ7 A;  3DD0 A;  2WD3 A;  3P4V A;  1ZSB A;  5SZ4 A;  3HKU A;  2NXS A;  4CNV A;  3ML5 A;  4YGL A;  4YHA A;  2Q38 A;  1J9W A;  4Q6E A;  4R5A A;  5FLS A;  5SZ2 A;  2WEJ A;  4MTY A;  2QO8 A;  1CVA A;  1HEB A;  2HKK A;  4Q8X A;  4WUQ A;  3OYS A;  1A42 A;  5DRS A;  1HCA A;  3DCC A;  3MYQ A;  3SAX A;  3P3J A;  1HEC A;  3RZ8 A;  3MNI A;  1CRM A;  3MNH A;  2W2J A;  5FL5 A;  3NI5 A;  3CZV A;  3IAI A;  5SZ5 A;  2NXR A;  3V3F A;  6CA2 A;  3JXF A;  3K34 A;  3RJ7 A;  4WR7 A;  5DSP A;  5SZ3 A;  1MUA A;  2IT4 A;  3K7K A;  3S75 B;  4L5W A;  5FNG A;  1LGD A;  5E28 A;  2CAB A;  1CCS A;  1JCZ A;  4KNJ A;  3T85 A;  5E2M A;  5AMD A;  3RZ1 B;  3U45 X;  4WW8 A;  3W6H A;  4COQ A;  4DZ7 A;  4YYT A;  1V9E A;  4MO8 A;  3V2M A;  5JG5 B;  3RGE A;  4K1Q A;  3SBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...