4ETQC

Vaccinia virus d8l imv envelope protein in complex with fab of murine igg2a la5
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
Knots found
sequence length
233
structure length
225
Chain Sequence
QQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNEYVLSSLHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIFLQVLDHKNVYFQKIVNQLDSIRSANTSAPFDSVFYLDNLLPSKLDYFTYLGTTINHSADAVWIIFPTPINIHSDQLSKFRTLLSLYITENYRNPYKLNDDTEVYYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords anti-vaccinia D8L antigen murine monoclonal IgG2a antibody L
publication title Structural and Biochemical Characterization of the Vaccinia Virus Envelope Protein D8 and Its Recognition by the Antibody LA5.
pubmed doi rcsb
source organism Mus musculus
total genus 59
structure length 225
sequence length 233
chains with identical sequence X
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 4etqC00
4C3TA 4MLTA 1H9NA 1Y7WA 2WD2A 1I9QA 4Z1JA 3M1QA 1CAIA 2NN1A 3RG4A 1G0FA 3CAJA 1ZGEA 4QK1A 4RFDA 4QJWA 4QJOA 4X5SA 5FLPA 1I91A 1FSRA 3LXEA 1CAZA 4N0XB 3B1BA 3M04A 4HT0A 4KNMA 4HEZA 1AZMA 1CRMA 3TVNX 3OIMA 4M2UA 5E2RA 1FQNA 5HPJA 5SZ5A 1V9IC 4YGNA 4LP6A 2FW4A 3U45X 5FLTA 4YX4A 3RJ7A 5FLSA 2EU2A 5DSRA 3M40A 3SAXA 3M96A 1BNMA 2HL4A 3K7KA 5EZTX 1ZSBA 2WEOA 2FOYA 1DMXA 5FNKA 1TEUX 2POUA 5L6KA 3NI5A 3MHLA 3T82A 4RH2A 2OSFA 2VVBX 3JXFA 3OKUA 2EZ7A 5CA2A 4YGKA 3RYJB 5SZ6A 3F4XA 1CVBA 1CVFA 1CAYA 2HFWA 2ZNCA 4MLXA 2NNSA 5L3OA 1YDDA 4KUYA 1ZGFA 1T9NA 4Q87A 3V2MA 2WEGA 4QK2A 3MMFA 2HD6A 1CCUA 1ZSCA 4MDMA 1LG5A 3MWOA 3DCSA 4XIXA 3U3AX 5A25A 1IF9A 3EFIA 3M1WA 5FDIA 4WR7A 3ML2A 2HNCA 1FR7A 4Q8XA 3N0NA 3S72B 4Q81A 4E4AA 2NNVA 5E2SA 1G45A 5E5UA 3ML5A 4KP5A 5SZ4A 3RYXB 1CNYA 3ZP9A 4Y0JA 2FNMA 3HFPA 5FLOA 1UGDA 1FQRA 5EHEA 4Q7SA 2NXTA 1TG3A 1CCTA 1DCBA 1YDCA 4N16A 1ZFQA 1I8ZA 1TBTX 1RZEA 3S73B 1HEDA 1FQLA 3HKTA 2W2JA 5JG5B 2Q38A 3DC9A 3HLJA 3KONA 1CNIA 1FLJA 1CALA 3D9ZA 3V7XA 2FMGA 3P44A 1ZFKA 4Q7PA 4E5QA 3P3JA 2FOQA 1CIMA 2H4NA 4RIUA 5G01A 7CA2A 4HF3A 4CACA 3P5LA 4XZ5A 1OKNA 4E3DA 2GD8A 3BETA 4Q7VA 1UGEA 4Q49A 4XFWA 1CAKA 3MZCA 4JSWA 3C7PA 3RZ1B 4E3GA 1UGBA 4QK3A 3V3HB 4IDRX 5G0CA 1RZAA 5FLQA 3BL1A 2NWYA 1KOQA 4YHAA 4R5AA 1ZNCA 3FW3A 5CJFA 3IGPA 5DOHA 5FNJA 12CAA 3Q31A 3M2YA 5DSPA 4LHIA 3M2XA 3MNIA 4JSSA 3MNKA 4L5UA 1Z9YA 3F7BA 1KOPA 3IEOA 1LGDA 2ABEA 4HEWA 4K0ZA 4YGJA 1CVAA 1HCBA 3CA2A 2CBCA 3U7CA 5EH5A 4R59A 4ITOA 1KWRA 3MNUA 5DRSA 3IBIA 4WW6A 1ZSAA 3TVOX 4PYYA 1I90A 3MHCA 4ZWZA 5EHVA 4YGFA 3DV7A 4PZHA 3MHMA 5SZ1A 4Q9YA 1IF8A 1Z97A 5SZ2A 3S75B 1JCZA 4YGLA 4XIWA 1ZH9A 1CVHA 4G7AA 3EFTA 4QIZA 3V3JA 2X7SA 3PJJA 4RIVA 3S8XA 3M5EA 2Q1BA 3M1KA 1TE3X 1Z93A 4MO8A 5EOIA 2VVAX 4Q8ZA 4QJ0A 2NWPA 4QEFA 1G52A 3DCCA 1HEAA 2GEHA 1XPZA 3RZ5A 3V5GA 4QIYA 3ZNCA 5BYIA 1CNJA 1XQ0A 5FNIA 3F8EA 3RYVB 5FLRA 3S97A 5FNGA 1CANA 3OYQA 4Z1NA 3N3JA 4RUYA 5FNMA 1CINA 4QY3A 3D93A 1CA2A 2OSMA 3V3GB 5DSIA 5SZ0A 5CACA 5FNLA 5SZ3A 3OYSA 5JEGB 5JESB 1G53A 2FNKA 4Q0LA 3R16A 4DZ9A 3OY0A 1CNWA 5BRUA 2X7TA 3KLDB 1JD0A 4KV0A 4Q09A 3M2ZA 4R5BA 5EIJA 2FNNA 4UOVA 3KNEA 4Q6EA 5JQTA 3OKVA 5E5RA 4MTYA 4ZX0A 4K13A 5JEHB 3DD0A 5JGTB 1XEVA 4YXOA 5BNLA 3MHOA 1A42A 3DD8A 3CYUA 4E3FA 3U47A 3PYKA 3RGEA 3RZ0B 4YVYA 1BNNA 1TG9A 4ETQC 3RZ8A 1EOUA 3DBUA 2FOUA 1HCAA 2NN7A 4PQ7A 4QSAA 2CBAA 5JQ0A 5CLUA 5EKHA 4KNNA 4Q08A 4QSBA 1BCDA 3S77B 3T5ZA 1G48A 4K0SA 4KUVA 4BCWA 3K2FA 1CA3A 4K0TA 1YO1A 4Z1KA 3B4FA 1OQ5A 3F7UA 2QP6A 1V9EA 3MNHA 1HUHA 4WUQA 4ZWIA 3UYNA 4CNVA 1RJ5A 3M67A 4ITPA 2WEJA 1IF7A 3M2NA 1G6VA 4BF6A 4E49A 1DCAA 1UGGA 5DSMA 3DA2A 4KUWA 1CNBA 4FPTA 4KAPA 2CBBA 2QO8A 5G03A 3HKQA 1CNKA 1FR4A 1I9LA 1IF5A 3IBUA 3P55A 5EKMA 1I9PA 1BV3A 5DSJA 4HU1A 4HEYA 5FL5A 1OKLA 2CBEA 1J9WA 4L5WA 1AM6A 3S74B 5DSLA 3L14A 1G3ZA 2O4ZA 5SZ7A 1KWQA 4QSJA 4MDLA 4Q90A 4QJXA 4ZX1A 3RLDA 5DSQA 4KNIA 2CA2A 1CNXA 3KWAA 1IF4A 3V3IB 4RFCA 2WD3A 1TB0X 4E3HA 2FOSA 3D92A 4JSZA 4M2VA 3T84A 4FU5A 1BN1A 4YXIA 5DSOA 3JXHC 1CAMA 4QTLA 2Q1QA 4Q07A 5E2KA 4E9OX 1URTA 2EU3A 3DVCA 3PO6A 4Q6DA 4QJMA 3MNJA 2AX2A 1DMYA 3KIGA 4M2WA 5IPZA 1CRAA 4WUPA 2NXSA 1CAOA 3UYQA 2CBDA 4FVNA 4YYTA 4LU3A 4XE1A 1XEGA 4FL7A 3CZVA 1CZMA 3N4BA 4K1QA 4FIKA 1BZMA 1TH9A 2NXRA 4CNRA 1YO0A 1H4NA 3M98A 4QSIA 4Q99A 5E28A 3DVBA 3RYZA 1KEQA 3RYYA 2FOVA 3W6IA 4YXUA 1LZVA 4GL1X 4IWZA 1TTMA 1CAJA 1G54A 4CNWA 3S78B 3T5UA 1BNVA 3SBHA 5BRWA 5G0BA 3DAZA 3FFPX 3V2JA 4Q7WA 1CAHA 5E2NA 3KS3A 1UGAA 4MDGA 5JEPB 4HBAA 1FSNA 4ZWYA 1HECA 3S9TA 5DOGA 3M5TA 1G4JA 4ZAOA 1YO2A 1BICA 8CA2A 3M1JA 3HKNA 3S76A 3IBNA 5DVXA 3KOIA 1BNWA 5EKJA 4Z0QA 3MNAA 4PXXA 4M2RA 1TEQX 1CVCA 3OILA 4RUZA 3M5SA 1I9OA 3T83A 1RJ6A 4HT2A 1UGCA 3V3FA 2NMXA 3OIKA 1CCSA 1G46A 4BF1A 1YDAA 4KP8A 3NB5A 4TWLA 3T85A 2POWA 1HUGA 2POVA 3R17B 2AW1A 3RZ7A 3P5AA 2FMZA 2HOCA 1BN4A 5JDVB 5A6HA 1F2WA 5FL4A 3M3XA 5EH8A 2WEHA 3D0NA 2NWOA 4Q8YA 1BNUA 4L5VA 3SAPA 1BNTA 2NWZA 1JV0A 1OKMA 2F14A 4YWPA 1RZCA 3JXGA 1RZBA 1BN3A 1HEBA 5DSNA 1CNCA 6CA2A 4RN4A 2HKKA 5J8ZA 4FRCA 4CQ0A 3BL0A 4WL4A 2IT4A 2CABA 1MOOA 4CNXA 2QOAA 1G1DA 1FSQA 2NNOA 1I9MA 1RAZA 3W6HA 3MDZA 1G0EA 3SBIA 3GZ0A 3HKUA 4Q83A 3M14A 5EH7A 1RAYA 3QYKA 4WW8A 5FNHA 1CILA 4DZ7A 2NNGA 4Z1EA 5FL6A 3RG3A 1CNGA 1BNQA 4FVOA 3MHIA 3IBLA 1IF6A 5DSKA 1LG6A 3P58A 4PYXA 3S71B 1CVEA 1CNHA 4COQA 5EHWA 1UGFA 1HVAA 1FQMA 2H15A 1CVDA 3N2PA 1RZDA 3KKXA 5AMLA 5LMDA 3DCWA 3VBDA 1H9QA 3HS4A 1THKA 3P3HA 4ILXA 2ILIA 3DVDA 4CA2A 4KNJA 5E2MA 4G0CA 3KOKA 9CA2A 1ZE8A 5AMDA 3MYQA 3K34A 4Q78A 3IAIA 5JGSB 2X7UA 1YDBA 4RUXA 4JS6A 5C8IA 5AMGA 3D8WA 5BRVA 3TMJA 1MUAA 5FDCA 4TWMA 1I9NA 1G4OA 3P4VA 4Q06A 4JSAA 4ZWXA 3FE4A 4QJPA 5JG3B 3DC3A 1LUGA 3NJ9A 1AVNA
chains in the Genus database with same CATH superfamily
4C3TA 4MLTA 1H9NA 1Y7WA 2WD2A 1I9QA 4Z1JA 3M1QA 1CAIA 2NN1A 3RG4A 1G0FA 3CAJA 1ZGEA 4QK1A 4RFDA 4QJWA 4QJOA 4X5SA 5FLPA 1I91A 1FSRA 3LXEA 1CAZA 4N0XB 3B1BA 3M04A 4HT0A 4KNMA 4HEZA 1AZMA 1CRMA 3TVNX 3OIMA 4M2UA 5E2RA 1FQNA 5HPJA 5SZ5A 1V9IC 4YGNA 4LP6A 2FW4A 3U45X 5FLTA 4YX4A 3RJ7A 5FLSA 2EU2A 5DSRA 3M40A 3SAXA 3M96A 1BNMA 2HL4A 3K7KA 5EZTX 1ZSBA 2WEOA 2FOYA 1DMXA 5FNKA 1TEUX 2POUA 5L6KA 3NI5A 3MHLA 3T82A 4RH2A 2OSFA 2VVBX 3JXFA 3OKUA 2EZ7A 5CA2A 4YGKA 3RYJB 5SZ6A 3F4XA 1CVBA 1CVFA 1CAYA 2HFWA 2ZNCA 4MLXA 2NNSA 5L3OA 1YDDA 4KUYA 1ZGFA 1T9NA 4Q87A 3V2MA 2WEGA 4QK2A 3MMFA 2HD6A 1CCUA 1ZSCA 4MDMA 1LG5A 3MWOA 3DCSA 4XIXA 3U3AX 5A25A 1IF9A 3EFIA 3M1WA 5FDIA 4WR7A 3ML2A 2HNCA 1FR7A 4Q8XA 3N0NA 3S72B 4Q81A 4E4AA 2NNVA 5E2SA 1G45A 5E5UA 3ML5A 4KP5A 5SZ4A 3RYXB 1CNYA 3ZP9A 4Y0JA 2FNMA 3HFPA 5FLOA 1UGDA 1FQRA 5EHEA 4Q7SA 2NXTA 1TG3A 1CCTA 1DCBA 1YDCA 4N16A 1ZFQA 1I8ZA 1TBTX 1RZEA 3S73B 1HEDA 1FQLA 3HKTA 2W2JA 5JG5B 2Q38A 3DC9A 3HLJA 3KONA 1CNIA 1FLJA 1CALA 3D9ZA 3V7XA 2FMGA 3P44A 1ZFKA 4Q7PA 4E5QA 3P3JA 2FOQA 1CIMA 2H4NA 4RIUA 5G01A 7CA2A 4HF3A 4CACA 3P5LA 4XZ5A 1OKNA 4E3DA 2GD8A 3BETA 4Q7VA 1UGEA 4Q49A 4XFWA 1CAKA 3MZCA 4JSWA 3C7PA 3RZ1B 4E3GA 1UGBA 4QK3A 3V3HB 4IDRX 5G0CA 1RZAA 5FLQA 3BL1A 2NWYA 1KOQA 4YHAA 4R5AA 1ZNCA 3FW3A 5CJFA 3IGPA 5DOHA 5FNJA 12CAA 3Q31A 3M2YA 5DSPA 4LHIA 3M2XA 3MNIA 4JSSA 3MNKA 4L5UA 1Z9YA 3F7BA 1KOPA 3IEOA 1LGDA 2ABEA 4HEWA 4K0ZA 4YGJA 1CVAA 1HCBA 3CA2A 2CBCA 3U7CA 5EH5A 4R59A 4ITOA 1KWRA 3MNUA 5DRSA 3IBIA 4WW6A 1ZSAA 3TVOX 4PYYA 1I90A 3MHCA 4ZWZA 5EHVA 4YGFA 3DV7A 4PZHA 3MHMA 5SZ1A 4Q9YA 1IF8A 1Z97A 5SZ2A 3S75B 1JCZA 4YGLA 4XIWA 1ZH9A 1CVHA 4G7AA 3EFTA 4QIZA 3V3JA 2X7SA 3PJJA 4RIVA 3S8XA 3M5EA 2Q1BA 3M1KA 1TE3X 1Z93A 4MO8A 5EOIA 2VVAX 4Q8ZA 4QJ0A 2NWPA 4QEFA 1G52A 3DCCA 1HEAA 2GEHA 1XPZA 3RZ5A 3V5GA 4QIYA 3ZNCA 5BYIA 1CNJA 1XQ0A 5FNIA 3F8EA 3RYVB 5FLRA 3S97A 5FNGA 1CANA 3OYQA 4Z1NA 3N3JA 4RUYA 5FNMA 1CINA 4QY3A 3D93A 1CA2A 2OSMA 3V3GB 5DSIA 5SZ0A 5CACA 5FNLA 5SZ3A 3OYSA 5JEGB 5JESB 1G53A 2FNKA 4Q0LA 3R16A 4DZ9A 3OY0A 1CNWA 5BRUA 2X7TA 3KLDB 1JD0A 4KV0A 4Q09A 3M2ZA 4R5BA 5EIJA 2FNNA 4UOVA 3KNEA 4Q6EA 5JQTA 3OKVA 5E5RA 4MTYA 4ZX0A 4K13A 5JEHB 3DD0A 5JGTB 1XEVA 4YXOA 5BNLA 3MHOA 1A42A 3DD8A 3CYUA 4E3FA 3U47A 3PYKA 3RGEA 3RZ0B 4YVYA 1BNNA 1TG9A 4ETQC 3RZ8A 1EOUA 3DBUA 2FOUA 1HCAA 2NN7A 4PQ7A 4QSAA 2CBAA 5JQ0A 5CLUA 5EKHA 4KNNA 4Q08A 4QSBA 1BCDA 3S77B 3T5ZA 1G48A 4K0SA 4KUVA 4BCWA 3K2FA 1CA3A 4K0TA 1YO1A 4Z1KA 3B4FA 1OQ5A 3F7UA 2QP6A 1V9EA 3MNHA 1HUHA 4WUQA 4ZWIA 3UYNA 4CNVA 1RJ5A 3M67A 4ITPA 2WEJA 1IF7A 3M2NA 1G6VA 4BF6A 4E49A 1DCAA 1UGGA 5DSMA 3DA2A 4KUWA 1CNBA 4FPTA 4KAPA 2CBBA 2QO8A 5G03A 3HKQA 1CNKA 1FR4A 1I9LA 1IF5A 3IBUA 3P55A 5EKMA 1I9PA 1BV3A 5DSJA 4HU1A 4HEYA 5FL5A 1OKLA 2CBEA 1J9WA 4L5WA 1AM6A 3S74B 5DSLA 3L14A 1G3ZA 2O4ZA 5SZ7A 1KWQA 4QSJA 4MDLA 4Q90A 4QJXA 4ZX1A 3RLDA 5DSQA 4KNIA 2CA2A 1CNXA 3KWAA 1IF4A 3V3IB 4RFCA 2WD3A 1TB0X 4E3HA 2FOSA 3D92A 4JSZA 4M2VA 3T84A 4FU5A 1BN1A 4YXIA 5DSOA 3JXHC 1CAMA 4QTLA 2Q1QA 4Q07A 5E2KA 4E9OX 1URTA 2EU3A 3DVCA 3PO6A 4Q6DA 4QJMA 3MNJA 2AX2A 1DMYA 3KIGA 4M2WA 5IPZA 1CRAA 4WUPA 2NXSA 1CAOA 3UYQA 2CBDA 4FVNA 4YYTA 4LU3A 4XE1A 1XEGA 4FL7A 3CZVA 1CZMA 3N4BA 4K1QA 4FIKA 1BZMA 1TH9A 2NXRA 4CNRA 1YO0A 1H4NA 3M98A 4QSIA 4Q99A 5E28A 3DVBA 3RYZA 1KEQA 3RYYA 2FOVA 3W6IA 4YXUA 1LZVA 4GL1X 4IWZA 1TTMA 1CAJA 1G54A 4CNWA 3S78B 3T5UA 1BNVA 3SBHA 5BRWA 5G0BA 3DAZA 3FFPX 3V2JA 4Q7WA 1CAHA 5E2NA 3KS3A 1UGAA 4MDGA 5JEPB 4HBAA 1FSNA 4ZWYA 1HECA 3S9TA 5DOGA 3M5TA 1G4JA 4ZAOA 1YO2A 1BICA 8CA2A 3M1JA 3HKNA 3S76A 3IBNA 5DVXA 3KOIA 1BNWA 5EKJA 4Z0QA 3MNAA 4PXXA 4M2RA 1TEQX 1CVCA 3OILA 4RUZA 3M5SA 1I9OA 3T83A 1RJ6A 4HT2A 1UGCA 3V3FA 2NMXA 3OIKA 1CCSA 1G46A 4BF1A 1YDAA 4KP8A 3NB5A 4TWLA 3T85A 2POWA 1HUGA 2POVA 3R17B 2AW1A 3RZ7A 3P5AA 2FMZA 2HOCA 1BN4A 5JDVB 5A6HA 1F2WA 5FL4A 3M3XA 5EH8A 2WEHA 3D0NA 2NWOA 4Q8YA 1BNUA 4L5VA 3SAPA 1BNTA 2NWZA 1JV0A 1OKMA 2F14A 4YWPA 1RZCA 3JXGA 1RZBA 1BN3A 1HEBA 5DSNA 1CNCA 6CA2A 4RN4A 2HKKA 5J8ZA 4FRCA 4CQ0A 3BL0A 4WL4A 2IT4A 2CABA 1MOOA 4CNXA 2QOAA 1G1DA 1FSQA 2NNOA 1I9MA 1RAZA 3W6HA 3MDZA 1G0EA 3SBIA 3GZ0A 3HKUA 4Q83A 3M14A 5EH7A 1RAYA 3QYKA 4WW8A 5FNHA 1CILA 4DZ7A 2NNGA 4Z1EA 5FL6A 3RG3A 1CNGA 1BNQA 4FVOA 3MHIA 3IBLA 1IF6A 5DSKA 1LG6A 3P58A 4PYXA 3S71B 1CVEA 1CNHA 4COQA 5EHWA 1UGFA 1HVAA 1FQMA 2H15A 1CVDA 3N2PA 1RZDA 3KKXA 5AMLA 5LMDA 3DCWA 3VBDA 1H9QA 3HS4A 1THKA 3P3HA 4ILXA 2ILIA 3DVDA 4CA2A 4KNJA 5E2MA 4G0CA 3KOKA 9CA2A 1ZE8A 5AMDA 3MYQA 3K34A 4Q78A 3IAIA 5JGSB 2X7UA 1YDBA 4RUXA 4JS6A 5C8IA 5AMGA 3D8WA 5BRVA 3TMJA 1MUAA 5FDCA 4TWMA 1I9NA 1G4OA 3P4VA 4Q06A 4JSAA 4ZWXA 3FE4A 4QJPA 5JG3B 3DC3A 1LUGA 3NJ9A 1AVNA
chains in the Genus database with same CATH topology
4C3TA 4MLTA 1H9NA 1Y7WA 2WD2A 1I9QA 4Z1JA 3M1QA 1CAIA 2NN1A 3RG4A 1G0FA 3CAJA 1ZGEA 4QK1A 4RFDA 4QJWA 4QJOA 4X5SA 5FLPA 1I91A 1FSRA 3LXEA 1CAZA 4N0XB 3B1BA 3M04A 4HT0A 4KNMA 4HEZA 1AZMA 1CRMA 3TVNX 3OIMA 4M2UA 5E2RA 1FQNA 5HPJA 5SZ5A 1V9IC 4YGNA 4LP6A 2FW4A 3U45X 5FLTA 4YX4A 3RJ7A 5FLSA 2EU2A 5DSRA 3M40A 3SAXA 3M96A 1BNMA 2HL4A 3K7KA 5EZTX 1ZSBA 2WEOA 2FOYA 1DMXA 5FNKA 1TEUX 2POUA 5L6KA 3NI5A 3MHLA 3T82A 4RH2A 2OSFA 2VVBX 3JXFA 3OKUA 2EZ7A 5CA2A 4YGKA 3RYJB 5SZ6A 3F4XA 1CVBA 1CVFA 1CAYA 2HFWA 2ZNCA 4MLXA 2NNSA 5L3OA 1YDDA 4KUYA 1ZGFA 1T9NA 4Q87A 3V2MA 2WEGA 4QK2A 3MMFA 2HD6A 1CCUA 1ZSCA 4MDMA 1LG5A 3MWOA 3DCSA 4XIXA 3U3AX 5A25A 1IF9A 3EFIA 3M1WA 5FDIA 4WR7A 3ML2A 2HNCA 1FR7A 4Q8XA 3N0NA 3S72B 4Q81A 4E4AA 2NNVA 5E2SA 1G45A 5E5UA 3ML5A 4KP5A 5SZ4A 3RYXB 1CNYA 3ZP9A 4Y0JA 2FNMA 3HFPA 5FLOA 1UGDA 1FQRA 5EHEA 4Q7SA 2NXTA 1TG3A 1CCTA 1DCBA 1YDCA 4N16A 1ZFQA 1I8ZA 1TBTX 1RZEA 3S73B 1HEDA 1FQLA 3HKTA 2W2JA 5JG5B 2Q38A 3DC9A 3HLJA 3KONA 1CNIA 1FLJA 1CALA 3D9ZA 3V7XA 2FMGA 3P44A 1ZFKA 4Q7PA 4E5QA 3P3JA 2FOQA 1CIMA 2H4NA 4RIUA 5G01A 7CA2A 4HF3A 4CACA 3P5LA 4XZ5A 1OKNA 4E3DA 2GD8A 3BETA 4Q7VA 1UGEA 4Q49A 4XFWA 1CAKA 3MZCA 4JSWA 3C7PA 3RZ1B 4E3GA 1UGBA 4QK3A 3V3HB 4IDRX 5G0CA 1RZAA 5FLQA 3BL1A 2NWYA 1KOQA 4YHAA 4R5AA 1ZNCA 3FW3A 5CJFA 3IGPA 5DOHA 5FNJA 12CAA 3Q31A 3M2YA 5DSPA 4LHIA 3M2XA 3MNIA 4JSSA 3MNKA 4L5UA 1Z9YA 3F7BA 1KOPA 3IEOA 1LGDA 2ABEA 4HEWA 4K0ZA 4YGJA 1CVAA 1HCBA 3CA2A 2CBCA 3U7CA 5EH5A 4R59A 4ITOA 1KWRA 3MNUA 5DRSA 3IBIA 4WW6A 1ZSAA 3TVOX 4PYYA 1I90A 3MHCA 4ZWZA 5EHVA 4YGFA 3DV7A 4PZHA 3MHMA 5SZ1A 4Q9YA 1IF8A 1Z97A 5SZ2A 3S75B 1JCZA 4YGLA 4XIWA 1ZH9A 1CVHA 4G7AA 3EFTA 4QIZA 3V3JA 2X7SA 3PJJA 4RIVA 3S8XA 3M5EA 2Q1BA 3M1KA 1TE3X 1Z93A 4MO8A 5EOIA 2VVAX 4Q8ZA 4QJ0A 2NWPA 4QEFA 1G52A 3DCCA 1HEAA 2GEHA 1XPZA 3RZ5A 3V5GA 4QIYA 3ZNCA 5BYIA 1CNJA 1XQ0A 5FNIA 3F8EA 3RYVB 5FLRA 3S97A 5FNGA 1CANA 3OYQA 4Z1NA 3N3JA 4RUYA 5FNMA 1CINA 4QY3A 3D93A 1CA2A 2OSMA 3V3GB 5DSIA 5SZ0A 5CACA 5FNLA 5SZ3A 3OYSA 5JEGB 5JESB 1G53A 2FNKA 4Q0LA 3R16A 4DZ9A 3OY0A 1CNWA 5BRUA 2X7TA 3KLDB 1JD0A 4KV0A 4Q09A 3M2ZA 4R5BA 5EIJA 2FNNA 4UOVA 3KNEA 4Q6EA 5JQTA 3OKVA 5E5RA 4MTYA 4ZX0A 4K13A 5JEHB 3DD0A 5JGTB 1XEVA 4YXOA 5BNLA 3MHOA 1A42A 3DD8A 3CYUA 4E3FA 3U47A 3PYKA 3RGEA 3RZ0B 4YVYA 1BNNA 1TG9A 4ETQC 3RZ8A 1EOUA 3DBUA 2FOUA 1HCAA 2NN7A 4PQ7A 4QSAA 2CBAA 5JQ0A 5CLUA 5EKHA 4KNNA 4Q08A 4QSBA 1BCDA 3S77B 3T5ZA 1G48A 4K0SA 4KUVA 4BCWA 3K2FA 1CA3A 4K0TA 1YO1A 4Z1KA 3B4FA 1OQ5A 3F7UA 2QP6A 1V9EA 3MNHA 1HUHA 4WUQA 4ZWIA 3UYNA 4CNVA 1RJ5A 3M67A 4ITPA 2WEJA 1IF7A 3M2NA 1G6VA 4BF6A 4E49A 1DCAA 1UGGA 5DSMA 3DA2A 4KUWA 1CNBA 4FPTA 4KAPA 2CBBA 2QO8A 5G03A 3HKQA 1CNKA 1FR4A 1I9LA 1IF5A 3IBUA 3P55A 5EKMA 1I9PA 1BV3A 5DSJA 4HU1A 4HEYA 5FL5A 1OKLA 2CBEA 1J9WA 4L5WA 1AM6A 3S74B 5DSLA 3L14A 1G3ZA 2O4ZA 5SZ7A 1KWQA 4QSJA 4MDLA 4Q90A 4QJXA 4ZX1A 3RLDA 5DSQA 4KNIA 2CA2A 1CNXA 3KWAA 1IF4A 3V3IB 4RFCA 2WD3A 1TB0X 4E3HA 2FOSA 3D92A 4JSZA 4M2VA 3T84A 4FU5A 1BN1A 4YXIA 5DSOA 3JXHC 1CAMA 4QTLA 2Q1QA 4Q07A 5E2KA 4E9OX 1URTA 2EU3A 3DVCA 3PO6A 4Q6DA 4QJMA 3MNJA 2AX2A 1DMYA 3KIGA 4M2WA 5IPZA 1CRAA 4WUPA 2NXSA 1CAOA 3UYQA 2CBDA 4FVNA 4YYTA 4LU3A 4XE1A 1XEGA 4FL7A 3CZVA 1CZMA 3N4BA 4K1QA 4FIKA 1BZMA 1TH9A 2NXRA 4CNRA 1YO0A 1H4NA 3M98A 4QSIA 4Q99A 5E28A 3DVBA 3RYZA 1KEQA 3RYYA 2FOVA 3W6IA 4YXUA 1LZVA 4GL1X 4IWZA 1TTMA 1CAJA 1G54A 4CNWA 3S78B 3T5UA 1BNVA 3SBHA 5BRWA 5G0BA 3DAZA 3FFPX 3V2JA 4Q7WA 1CAHA 5E2NA 3KS3A 1UGAA 4MDGA 5JEPB 4HBAA 1FSNA 4ZWYA 1HECA 3S9TA 5DOGA 3M5TA 1G4JA 4ZAOA 1YO2A 1BICA 8CA2A 3M1JA 3HKNA 3S76A 3IBNA 5DVXA 3KOIA 1BNWA 5EKJA 4Z0QA 3MNAA 4PXXA 4M2RA 1TEQX 1CVCA 3OILA 4RUZA 3M5SA 1I9OA 3T83A 1RJ6A 4HT2A 1UGCA 3V3FA 2NMXA 3OIKA 1CCSA 1G46A 4BF1A 1YDAA 4KP8A 3NB5A 4TWLA 3T85A 2POWA 1HUGA 2POVA 3R17B 2AW1A 3RZ7A 3P5AA 2FMZA 2HOCA 1BN4A 5JDVB 5A6HA 1F2WA 5FL4A 3M3XA 5EH8A 2WEHA 3D0NA 2NWOA 4Q8YA 1BNUA 4L5VA 3SAPA 1BNTA 2NWZA 1JV0A 1OKMA 2F14A 4YWPA 1RZCA 3JXGA 1RZBA 1BN3A 1HEBA 5DSNA 1CNCA 6CA2A 4RN4A 2HKKA 5J8ZA 4FRCA 4CQ0A 3BL0A 4WL4A 2IT4A 2CABA 1MOOA 4CNXA 2QOAA 1G1DA 1FSQA 2NNOA 1I9MA 1RAZA 3W6HA 3MDZA 1G0EA 3SBIA 3GZ0A 3HKUA 4Q83A 3M14A 5EH7A 1RAYA 3QYKA 4WW8A 5FNHA 1CILA 4DZ7A 2NNGA 4Z1EA 5FL6A 3RG3A 1CNGA 1BNQA 4FVOA 3MHIA 3IBLA 1IF6A 5DSKA 1LG6A 3P58A 4PYXA 3S71B 1CVEA 1CNHA 4COQA 5EHWA 1UGFA 1HVAA 1FQMA 2H15A 1CVDA 3N2PA 1RZDA 3KKXA 5AMLA 5LMDA 3DCWA 3VBDA 1H9QA 3HS4A 1THKA 3P3HA 4ILXA 2ILIA 3DVDA 4CA2A 4KNJA 5E2MA 4G0CA 3KOKA 9CA2A 1ZE8A 5AMDA 3MYQA 3K34A 4Q78A 3IAIA 5JGSB 2X7UA 1YDBA 4RUXA 4JS6A 5C8IA 5AMGA 3D8WA 5BRVA 3TMJA 1MUAA 5FDCA 4TWMA 1I9NA 1G4OA 3P4VA 4Q06A 4JSAA 4ZWXA 3FE4A 4QJPA 5JG3B 3DC3A 1LUGA 3NJ9A 1AVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3T A;  4MLT A;  1H9N A;  1Y7W A;  2WD2 A;  1I9Q A;  4Z1J A;  3M1Q A;  1CAI A;  2NN1 A;  3RG4 A;  1G0F A;  3CAJ A;  1ZGE A;  4QK1 A;  4RFD A;  4QJW A;  4QJO A;  4X5S A;  5FLP A;  1I91 A;  1FSR A;  3LXE A;  1CAZ A;  4N0X B;  3B1B A;  3M04 A;  4HT0 A;  4KNM A;  4HEZ A;  1AZM A;  1CRM A;  3TVN X;  3OIM A;  4M2U A;  5E2R A;  1FQN A;  5HPJ A;  5SZ5 A;  1V9I C;  4YGN A;  4LP6 A;  2FW4 A;  3U45 X;  5FLT A;  4YX4 A;  3RJ7 A;  5FLS A;  2EU2 A;  5DSR A;  3M40 A;  3SAX A;  3M96 A;  1BNM A;  2HL4 A;  3K7K A;  5EZT X;  1ZSB A;  2WEO A;  2FOY A;  1DMX A;  5FNK A;  1TEU X;  2POU A;  5L6K A;  3NI5 A;  3MHL A;  3T82 A;  4RH2 A;  2OSF A;  2VVB X;  3JXF A;  3OKU A;  2EZ7 A;  5CA2 A;  4YGK A;  3RYJ B;  5SZ6 A;  3F4X A;  1CVB A;  1CVF A;  1CAY A;  2HFW A;  2ZNC A;  4MLX A;  2NNS A;  5L3O A;  1YDD A;  4KUY A;  1ZGF A;  1T9N A;  4Q87 A;  3V2M A;  2WEG A;  4QK2 A;  3MMF A;  2HD6 A;  1CCU A;  1ZSC A;  4MDM A;  1LG5 A;  3MWO A;  3DCS A;  4XIX A;  3U3A X;  5A25 A;  1IF9 A;  3EFI A;  3M1W A;  5FDI A;  4WR7 A;  3ML2 A;  2HNC A;  1FR7 A;  4Q8X A;  3N0N A;  3S72 B;  4Q81 A;  4E4A A;  2NNV A;  5E2S A;  1G45 A;  5E5U A;  3ML5 A;  4KP5 A;  5SZ4 A;  3RYX B;  1CNY A;  3ZP9 A;  4Y0J A;  2FNM A;  3HFP A;  5FLO A;  1UGD A;  1FQR A;  5EHE A;  4Q7S A;  2NXT A;  1TG3 A;  1CCT A;  1DCB A;  1YDC A;  4N16 A;  1ZFQ A;  1I8Z A;  1TBT X;  1RZE A;  3S73 B;  1HED A;  1FQL A;  3HKT A;  2W2J A;  5JG5 B;  2Q38 A;  3DC9 A;  3HLJ A;  3KON A;  1CNI A;  1FLJ A;  1CAL A;  3D9Z A;  3V7X A;  2FMG A;  3P44 A;  1ZFK A;  4Q7P A;  4E5Q A;  3P3J A;  2FOQ A;  1CIM A;  2H4N A;  4RIU A;  5G01 A;  7CA2 A;  4HF3 A;  4CAC A;  3P5L A;  4XZ5 A;  1OKN A;  4E3D A;  2GD8 A;  3BET A;  4Q7V A;  1UGE A;  4Q49 A;  4XFW A;  1CAK A;  3MZC A;  4JSW A;  3C7P A;  3RZ1 B;  4E3G A;  1UGB A;  4QK3 A;  3V3H B;  4IDR X;  5G0C A;  1RZA A;  5FLQ A;  3BL1 A;  2NWY A;  1KOQ A;  4YHA A;  4R5A A;  1ZNC A;  3FW3 A;  5CJF A;  3IGP A;  5DOH A;  5FNJ A;  12CA A;  3Q31 A;  3M2Y A;  5DSP A;  4LHI A;  3M2X A;  3MNI A;  4JSS A;  3MNK A;  4L5U A;  1Z9Y A;  3F7B A;  1KOP A;  3IEO A;  1LGD A;  2ABE A;  4HEW A;  4K0Z A;  4YGJ A;  1CVA A;  1HCB A;  3CA2 A;  2CBC A;  3U7C A;  5EH5 A;  4R59 A;  4ITO A;  1KWR A;  3MNU A;  5DRS A;  3IBI A;  4WW6 A;  1ZSA A;  3TVO X;  4PYY A;  1I90 A;  3MHC A;  4ZWZ A;  5EHV A;  4YGF A;  3DV7 A;  4PZH A;  3MHM A;  5SZ1 A;  4Q9Y A;  1IF8 A;  1Z97 A;  5SZ2 A;  3S75 B;  1JCZ A;  4YGL A;  4XIW A;  1ZH9 A;  1CVH A;  4G7A A;  3EFT A;  4QIZ A;  3V3J A;  2X7S A;  3PJJ A;  4RIV A;  3S8X A;  3M5E A;  2Q1B A;  3M1K A;  1TE3 X;  1Z93 A;  4MO8 A;  5EOI A;  2VVA X;  4Q8Z A;  4QJ0 A;  2NWP A;  4QEF A;  1G52 A;  3DCC A;  1HEA A;  2GEH A;  1XPZ A;  3RZ5 A;  3V5G A;  4QIY A;  3ZNC A;  5BYI A;  1CNJ A;  1XQ0 A;  5FNI A;  3F8E A;  3RYV B;  5FLR A;  3S97 A;  5FNG A;  1CAN A;  3OYQ A;  4Z1N A;  3N3J A;  4RUY A;  5FNM A;  1CIN A;  4QY3 A;  3D93 A;  1CA2 A;  2OSM A;  3V3G B;  5DSI A;  5SZ0 A;  5CAC A;  5FNL A;  5SZ3 A;  3OYS A;  5JEG B;  5JES B;  1G53 A;  2FNK A;  4Q0L A;  3R16 A;  4DZ9 A;  3OY0 A;  1CNW A;  5BRU A;  2X7T A;  3KLD B;  1JD0 A;  4KV0 A;  4Q09 A;  3M2Z A;  4R5B A;  5EIJ A;  2FNN A;  4UOV A;  3KNE A;  4Q6E A;  5JQT A;  3OKV A;  5E5R A;  4MTY A;  4ZX0 A;  4K13 A;  5JEH B;  3DD0 A;  5JGT B;  1XEV A;  4YXO A;  5BNL A;  3MHO A;  1A42 A;  3DD8 A;  3CYU A;  4E3F A;  3U47 A;  3PYK A;  3RGE A;  3RZ0 B;  4YVY A;  1BNN A;  1TG9 A;  4ETQ C;  3RZ8 A;  1EOU A;  3DBU A;  2FOU A;  1HCA A;  2NN7 A;  4PQ7 A;  4QSA A;  2CBA A;  5JQ0 A;  5CLU A;  5EKH A;  4KNN A;  4Q08 A;  4QSB A;  1BCD A;  3S77 B;  3T5Z A;  1G48 A;  4K0S A;  4KUV A;  4BCW A;  3K2F A;  1CA3 A;  4K0T A;  1YO1 A;  4Z1K A;  3B4F A;  1OQ5 A;  3F7U A;  2QP6 A;  1V9E A;  3MNH A;  1HUH A;  4WUQ A;  4ZWI A;  3UYN A;  4CNV A;  1RJ5 A;  3M67 A;  4ITP A;  2WEJ A;  1IF7 A;  3M2N A;  1G6V A;  4BF6 A;  4E49 A;  1DCA A;  1UGG A;  5DSM A;  3DA2 A;  4KUW A;  1CNB A;  4FPT A;  4KAP A;  2CBB A;  2QO8 A;  5G03 A;  3HKQ A;  1CNK A;  1FR4 A;  1I9L A;  1IF5 A;  3IBU A;  3P55 A;  5EKM A;  1I9P A;  1BV3 A;  5DSJ A;  4HU1 A;  4HEY A;  5FL5 A;  1OKL A;  2CBE A;  1J9W A;  4L5W A;  1AM6 A;  3S74 B;  5DSL A;  3L14 A;  1G3Z A;  2O4Z A;  5SZ7 A;  1KWQ A;  4QSJ A;  4MDL A;  4Q90 A;  4QJX A;  4ZX1 A;  3RLD A;  5DSQ A;  4KNI A;  2CA2 A;  1CNX A;  3KWA A;  1IF4 A;  3V3I B;  4RFC A;  2WD3 A;  1TB0 X;  4E3H A;  2FOS A;  3D92 A;  4JSZ A;  4M2V A;  3T84 A;  4FU5 A;  1BN1 A;  4YXI A;  5DSO A;  3JXH C;  1CAM A;  4QTL A;  2Q1Q A;  4Q07 A;  5E2K A;  4E9O X;  1URT A;  2EU3 A;  3DVC A;  3PO6 A;  4Q6D A;  4QJM A;  3MNJ A;  2AX2 A;  1DMY A;  3KIG A;  4M2W A;  5IPZ A;  1CRA A;  4WUP A;  2NXS A;  1CAO A;  3UYQ A;  2CBD A;  4FVN A;  4YYT A;  4LU3 A;  4XE1 A;  1XEG A;  4FL7 A;  3CZV A;  1CZM A;  3N4B A;  4K1Q A;  4FIK A;  1BZM A;  1TH9 A;  2NXR A;  4CNR A;  1YO0 A;  1H4N A;  3M98 A;  4QSI A;  4Q99 A;  5E28 A;  3DVB A;  3RYZ A;  1KEQ A;  3RYY A;  2FOV A;  3W6I A;  4YXU A;  1LZV A;  4GL1 X;  4IWZ A;  1TTM A;  1CAJ A;  1G54 A;  4CNW A;  3S78 B;  3T5U A;  1BNV A;  3SBH A;  5BRW A;  5G0B A;  3DAZ A;  3FFP X;  3V2J A;  4Q7W A;  1CAH A;  5E2N A;  3KS3 A;  1UGA A;  4MDG A;  5JEP B;  4HBA A;  1FSN A;  4ZWY A;  1HEC A;  3S9T A;  5DOG A;  3M5T A;  1G4J A;  4ZAO A;  1YO2 A;  1BIC A;  8CA2 A;  3M1J A;  3HKN A;  3S76 A;  3IBN A;  5DVX A;  3KOI A;  1BNW A;  5EKJ A;  4Z0Q A;  3MNA A;  4PXX A;  4M2R A;  1TEQ X;  1CVC A;  3OIL A;  4RUZ A;  3M5S A;  1I9O A;  3T83 A;  1RJ6 A;  4HT2 A;  1UGC A;  3V3F A;  2NMX A;  3OIK A;  1CCS A;  1G46 A;  4BF1 A;  1YDA A;  4KP8 A;  3NB5 A;  4TWL A;  3T85 A;  2POW A;  1HUG A;  2POV A;  3R17 B;  2AW1 A;  3RZ7 A;  3P5A A;  2FMZ A;  2HOC A;  1BN4 A;  5JDV B;  5A6H A;  1F2W A;  5FL4 A;  3M3X A;  5EH8 A;  2WEH A;  3D0N A;  2NWO A;  4Q8Y A;  1BNU A;  4L5V A;  3SAP A;  1BNT A;  2NWZ A;  1JV0 A;  1OKM A;  2F14 A;  4YWP A;  1RZC A;  3JXG A;  1RZB A;  1BN3 A;  1HEB A;  5DSN A;  1CNC A;  6CA2 A;  4RN4 A;  2HKK A;  5J8Z A;  4FRC A;  4CQ0 A;  3BL0 A;  4WL4 A;  2IT4 A;  2CAB A;  1MOO A;  4CNX A;  2QOA A;  1G1D A;  1FSQ A;  2NNO A;  1I9M A;  1RAZ A;  3W6H A;  3MDZ A;  1G0E A;  3SBI A;  3GZ0 A;  3HKU A;  4Q83 A;  3M14 A;  5EH7 A;  1RAY A;  3QYK A;  4WW8 A;  5FNH A;  1CIL A;  4DZ7 A;  2NNG A;  4Z1E A;  5FL6 A;  3RG3 A;  1CNG A;  1BNQ A;  4FVO A;  3MHI A;  3IBL A;  1IF6 A;  5DSK A;  1LG6 A;  3P58 A;  4PYX A;  3S71 B;  1CVE A;  1CNH A;  4COQ A;  5EHW A;  1UGF A;  1HVA A;  1FQM A;  2H15 A;  1CVD A;  3N2P A;  1RZD A;  3KKX A;  5AML A;  5LMD A;  3DCW A;  3VBD A;  1H9Q A;  3HS4 A;  1THK A;  3P3H A;  4ILX A;  2ILI A;  3DVD A;  4CA2 A;  4KNJ A;  5E2M A;  4G0C A;  3KOK A;  9CA2 A;  1ZE8 A;  5AMD A;  3MYQ A;  3K34 A;  4Q78 A;  3IAI A;  5JGS B;  2X7U A;  1YDB A;  4RUX A;  4JS6 A;  5C8I A;  5AMG A;  3D8W A;  5BRV A;  3TMJ A;  1MUA A;  5FDC A;  4TWM A;  1I9N A;  1G4O A;  3P4V A;  4Q06 A;  4JSA A;  4ZWX A;  3FE4 A;  4QJP A;  5JG3 B;  3DC3 A;  1LUG A;  3NJ9 A;  1AVN A; 
#chains in the Genus database with same CATH topology
 4C3T A;  4MLT A;  1H9N A;  1Y7W A;  2WD2 A;  1I9Q A;  4Z1J A;  3M1Q A;  1CAI A;  2NN1 A;  3RG4 A;  1G0F A;  3CAJ A;  1ZGE A;  4QK1 A;  4RFD A;  4QJW A;  4QJO A;  4X5S A;  5FLP A;  1I91 A;  1FSR A;  3LXE A;  1CAZ A;  4N0X B;  3B1B A;  3M04 A;  4HT0 A;  4KNM A;  4HEZ A;  1AZM A;  1CRM A;  3TVN X;  3OIM A;  4M2U A;  5E2R A;  1FQN A;  5HPJ A;  5SZ5 A;  1V9I C;  4YGN A;  4LP6 A;  2FW4 A;  3U45 X;  5FLT A;  4YX4 A;  3RJ7 A;  5FLS A;  2EU2 A;  5DSR A;  3M40 A;  3SAX A;  3M96 A;  1BNM A;  2HL4 A;  3K7K A;  5EZT X;  1ZSB A;  2WEO A;  2FOY A;  1DMX A;  5FNK A;  1TEU X;  2POU A;  5L6K A;  3NI5 A;  3MHL A;  3T82 A;  4RH2 A;  2OSF A;  2VVB X;  3JXF A;  3OKU A;  2EZ7 A;  5CA2 A;  4YGK A;  3RYJ B;  5SZ6 A;  3F4X A;  1CVB A;  1CVF A;  1CAY A;  2HFW A;  2ZNC A;  4MLX A;  2NNS A;  5L3O A;  1YDD A;  4KUY A;  1ZGF A;  1T9N A;  4Q87 A;  3V2M A;  2WEG A;  4QK2 A;  3MMF A;  2HD6 A;  1CCU A;  1ZSC A;  4MDM A;  1LG5 A;  3MWO A;  3DCS A;  4XIX A;  3U3A X;  5A25 A;  1IF9 A;  3EFI A;  3M1W A;  5FDI A;  4WR7 A;  3ML2 A;  2HNC A;  1FR7 A;  4Q8X A;  3N0N A;  3S72 B;  4Q81 A;  4E4A A;  2NNV A;  5E2S A;  1G45 A;  5E5U A;  3ML5 A;  4KP5 A;  5SZ4 A;  3RYX B;  1CNY A;  3ZP9 A;  4Y0J A;  2FNM A;  3HFP A;  5FLO A;  1UGD A;  1FQR A;  5EHE A;  4Q7S A;  2NXT A;  1TG3 A;  1CCT A;  1DCB A;  1YDC A;  4N16 A;  1ZFQ A;  1I8Z A;  1TBT X;  1RZE A;  3S73 B;  1HED A;  1FQL A;  3HKT A;  2W2J A;  5JG5 B;  2Q38 A;  3DC9 A;  3HLJ A;  3KON A;  1CNI A;  1FLJ A;  1CAL A;  3D9Z A;  3V7X A;  2FMG A;  3P44 A;  1ZFK A;  4Q7P A;  4E5Q A;  3P3J A;  2FOQ A;  1CIM A;  2H4N A;  4RIU A;  5G01 A;  7CA2 A;  4HF3 A;  4CAC A;  3P5L A;  4XZ5 A;  1OKN A;  4E3D A;  2GD8 A;  3BET A;  4Q7V A;  1UGE A;  4Q49 A;  4XFW A;  1CAK A;  3MZC A;  4JSW A;  3C7P A;  3RZ1 B;  4E3G A;  1UGB A;  4QK3 A;  3V3H B;  4IDR X;  5G0C A;  1RZA A;  5FLQ A;  3BL1 A;  2NWY A;  1KOQ A;  4YHA A;  4R5A A;  1ZNC A;  3FW3 A;  5CJF A;  3IGP A;  5DOH A;  5FNJ A;  12CA A;  3Q31 A;  3M2Y A;  5DSP A;  4LHI A;  3M2X A;  3MNI A;  4JSS A;  3MNK A;  4L5U A;  1Z9Y A;  3F7B A;  1KOP A;  3IEO A;  1LGD A;  2ABE A;  4HEW A;  4K0Z A;  4YGJ A;  1CVA A;  1HCB A;  3CA2 A;  2CBC A;  3U7C A;  5EH5 A;  4R59 A;  4ITO A;  1KWR A;  3MNU A;  5DRS A;  3IBI A;  4WW6 A;  1ZSA A;  3TVO X;  4PYY A;  1I90 A;  3MHC A;  4ZWZ A;  5EHV A;  4YGF A;  3DV7 A;  4PZH A;  3MHM A;  5SZ1 A;  4Q9Y A;  1IF8 A;  1Z97 A;  5SZ2 A;  3S75 B;  1JCZ A;  4YGL A;  4XIW A;  1ZH9 A;  1CVH A;  4G7A A;  3EFT A;  4QIZ A;  3V3J A;  2X7S A;  3PJJ A;  4RIV A;  3S8X A;  3M5E A;  2Q1B A;  3M1K A;  1TE3 X;  1Z93 A;  4MO8 A;  5EOI A;  2VVA X;  4Q8Z A;  4QJ0 A;  2NWP A;  4QEF A;  1G52 A;  3DCC A;  1HEA A;  2GEH A;  1XPZ A;  3RZ5 A;  3V5G A;  4QIY A;  3ZNC A;  5BYI A;  1CNJ A;  1XQ0 A;  5FNI A;  3F8E A;  3RYV B;  5FLR A;  3S97 A;  5FNG A;  1CAN A;  3OYQ A;  4Z1N A;  3N3J A;  4RUY A;  5FNM A;  1CIN A;  4QY3 A;  3D93 A;  1CA2 A;  2OSM A;  3V3G B;  5DSI A;  5SZ0 A;  5CAC A;  5FNL A;  5SZ3 A;  3OYS A;  5JEG B;  5JES B;  1G53 A;  2FNK A;  4Q0L A;  3R16 A;  4DZ9 A;  3OY0 A;  1CNW A;  5BRU A;  2X7T A;  3KLD B;  1JD0 A;  4KV0 A;  4Q09 A;  3M2Z A;  4R5B A;  5EIJ A;  2FNN A;  4UOV A;  3KNE A;  4Q6E A;  5JQT A;  3OKV A;  5E5R A;  4MTY A;  4ZX0 A;  4K13 A;  5JEH B;  3DD0 A;  5JGT B;  1XEV A;  4YXO A;  5BNL A;  3MHO A;  1A42 A;  3DD8 A;  3CYU A;  4E3F A;  3U47 A;  3PYK A;  3RGE A;  3RZ0 B;  4YVY A;  1BNN A;  1TG9 A;  4ETQ C;  3RZ8 A;  1EOU A;  3DBU A;  2FOU A;  1HCA A;  2NN7 A;  4PQ7 A;  4QSA A;  2CBA A;  5JQ0 A;  5CLU A;  5EKH A;  4KNN A;  4Q08 A;  4QSB A;  1BCD A;  3S77 B;  3T5Z A;  1G48 A;  4K0S A;  4KUV A;  4BCW A;  3K2F A;  1CA3 A;  4K0T A;  1YO1 A;  4Z1K A;  3B4F A;  1OQ5 A;  3F7U A;  2QP6 A;  1V9E A;  3MNH A;  1HUH A;  4WUQ A;  4ZWI A;  3UYN A;  4CNV A;  1RJ5 A;  3M67 A;  4ITP A;  2WEJ A;  1IF7 A;  3M2N A;  1G6V A;  4BF6 A;  4E49 A;  1DCA A;  1UGG A;  5DSM A;  3DA2 A;  4KUW A;  1CNB A;  4FPT A;  4KAP A;  2CBB A;  2QO8 A;  5G03 A;  3HKQ A;  1CNK A;  1FR4 A;  1I9L A;  1IF5 A;  3IBU A;  3P55 A;  5EKM A;  1I9P A;  1BV3 A;  5DSJ A;  4HU1 A;  4HEY A;  5FL5 A;  1OKL A;  2CBE A;  1J9W A;  4L5W A;  1AM6 A;  3S74 B;  5DSL A;  3L14 A;  1G3Z A;  2O4Z A;  5SZ7 A;  1KWQ A;  4QSJ A;  4MDL A;  4Q90 A;  4QJX A;  4ZX1 A;  3RLD A;  5DSQ A;  4KNI A;  2CA2 A;  1CNX A;  3KWA A;  1IF4 A;  3V3I B;  4RFC A;  2WD3 A;  1TB0 X;  4E3H A;  2FOS A;  3D92 A;  4JSZ A;  4M2V A;  3T84 A;  4FU5 A;  1BN1 A;  4YXI A;  5DSO A;  3JXH C;  1CAM A;  4QTL A;  2Q1Q A;  4Q07 A;  5E2K A;  4E9O X;  1URT A;  2EU3 A;  3DVC A;  3PO6 A;  4Q6D A;  4QJM A;  3MNJ A;  2AX2 A;  1DMY A;  3KIG A;  4M2W A;  5IPZ A;  1CRA A;  4WUP A;  2NXS A;  1CAO A;  3UYQ A;  2CBD A;  4FVN A;  4YYT A;  4LU3 A;  4XE1 A;  1XEG A;  4FL7 A;  3CZV A;  1CZM A;  3N4B A;  4K1Q A;  4FIK A;  1BZM A;  1TH9 A;  2NXR A;  4CNR A;  1YO0 A;  1H4N A;  3M98 A;  4QSI A;  4Q99 A;  5E28 A;  3DVB A;  3RYZ A;  1KEQ A;  3RYY A;  2FOV A;  3W6I A;  4YXU A;  1LZV A;  4GL1 X;  4IWZ A;  1TTM A;  1CAJ A;  1G54 A;  4CNW A;  3S78 B;  3T5U A;  1BNV A;  3SBH A;  5BRW A;  5G0B A;  3DAZ A;  3FFP X;  3V2J A;  4Q7W A;  1CAH A;  5E2N A;  3KS3 A;  1UGA A;  4MDG A;  5JEP B;  4HBA A;  1FSN A;  4ZWY A;  1HEC A;  3S9T A;  5DOG A;  3M5T A;  1G4J A;  4ZAO A;  1YO2 A;  1BIC A;  8CA2 A;  3M1J A;  3HKN A;  3S76 A;  3IBN A;  5DVX A;  3KOI A;  1BNW A;  5EKJ A;  4Z0Q A;  3MNA A;  4PXX A;  4M2R A;  1TEQ X;  1CVC A;  3OIL A;  4RUZ A;  3M5S A;  1I9O A;  3T83 A;  1RJ6 A;  4HT2 A;  1UGC A;  3V3F A;  2NMX A;  3OIK A;  1CCS A;  1G46 A;  4BF1 A;  1YDA A;  4KP8 A;  3NB5 A;  4TWL A;  3T85 A;  2POW A;  1HUG A;  2POV A;  3R17 B;  2AW1 A;  3RZ7 A;  3P5A A;  2FMZ A;  2HOC A;  1BN4 A;  5JDV B;  5A6H A;  1F2W A;  5FL4 A;  3M3X A;  5EH8 A;  2WEH A;  3D0N A;  2NWO A;  4Q8Y A;  1BNU A;  4L5V A;  3SAP A;  1BNT A;  2NWZ A;  1JV0 A;  1OKM A;  2F14 A;  4YWP A;  1RZC A;  3JXG A;  1RZB A;  1BN3 A;  1HEB A;  5DSN A;  1CNC A;  6CA2 A;  4RN4 A;  2HKK A;  5J8Z A;  4FRC A;  4CQ0 A;  3BL0 A;  4WL4 A;  2IT4 A;  2CAB A;  1MOO A;  4CNX A;  2QOA A;  1G1D A;  1FSQ A;  2NNO A;  1I9M A;  1RAZ A;  3W6H A;  3MDZ A;  1G0E A;  3SBI A;  3GZ0 A;  3HKU A;  4Q83 A;  3M14 A;  5EH7 A;  1RAY A;  3QYK A;  4WW8 A;  5FNH A;  1CIL A;  4DZ7 A;  2NNG A;  4Z1E A;  5FL6 A;  3RG3 A;  1CNG A;  1BNQ A;  4FVO A;  3MHI A;  3IBL A;  1IF6 A;  5DSK A;  1LG6 A;  3P58 A;  4PYX A;  3S71 B;  1CVE A;  1CNH A;  4COQ A;  5EHW A;  1UGF A;  1HVA A;  1FQM A;  2H15 A;  1CVD A;  3N2P A;  1RZD A;  3KKX A;  5AML A;  5LMD A;  3DCW A;  3VBD A;  1H9Q A;  3HS4 A;  1THK A;  3P3H A;  4ILX A;  2ILI A;  3DVD A;  4CA2 A;  4KNJ A;  5E2M A;  4G0C A;  3KOK A;  9CA2 A;  1ZE8 A;  5AMD A;  3MYQ A;  3K34 A;  4Q78 A;  3IAI A;  5JGS B;  2X7U A;  1YDB A;  4RUX A;  4JS6 A;  5C8I A;  5AMG A;  3D8W A;  5BRV A;  3TMJ A;  1MUA A;  5FDC A;  4TWM A;  1I9N A;  1G4O A;  3P4V A;  4Q06 A;  4JSA A;  4ZWX A;  3FE4 A;  4QJP A;  5JG3 B;  3DC3 A;  1LUG A;  3NJ9 A;  1AVN A; 
#chains in the Genus database with same CATH homology
 4C3T A;  4MLT A;  1H9N A;  1Y7W A;  2WD2 A;  1I9Q A;  4Z1J A;  3M1Q A;  1CAI A;  2NN1 A;  3RG4 A;  1G0F A;  3CAJ A;  1ZGE A;  4QK1 A;  4RFD A;  4QJW A;  4QJO A;  4X5S A;  5FLP A;  1I91 A;  1FSR A;  3LXE A;  1CAZ A;  4N0X B;  3B1B A;  3M04 A;  4HT0 A;  4KNM A;  4HEZ A;  1AZM A;  1CRM A;  3TVN X;  3OIM A;  4M2U A;  5E2R A;  1FQN A;  5HPJ A;  5SZ5 A;  1V9I C;  4YGN A;  4LP6 A;  2FW4 A;  3U45 X;  5FLT A;  4YX4 A;  3RJ7 A;  5FLS A;  2EU2 A;  5DSR A;  3M40 A;  3SAX A;  3M96 A;  1BNM A;  2HL4 A;  3K7K A;  5EZT X;  1ZSB A;  2WEO A;  2FOY A;  1DMX A;  5FNK A;  1TEU X;  2POU A;  5L6K A;  3NI5 A;  3MHL A;  3T82 A;  4RH2 A;  2OSF A;  2VVB X;  3JXF A;  3OKU A;  2EZ7 A;  5CA2 A;  4YGK A;  3RYJ B;  5SZ6 A;  3F4X A;  1CVB A;  1CVF A;  1CAY A;  2HFW A;  2ZNC A;  4MLX A;  2NNS A;  5L3O A;  1YDD A;  4KUY A;  1ZGF A;  1T9N A;  4Q87 A;  3V2M A;  2WEG A;  4QK2 A;  3MMF A;  2HD6 A;  1CCU A;  1ZSC A;  4MDM A;  1LG5 A;  3MWO A;  3DCS A;  4XIX A;  3U3A X;  5A25 A;  1IF9 A;  3EFI A;  3M1W A;  5FDI A;  4WR7 A;  3ML2 A;  2HNC A;  1FR7 A;  4Q8X A;  3N0N A;  3S72 B;  4Q81 A;  4E4A A;  2NNV A;  5E2S A;  1G45 A;  5E5U A;  3ML5 A;  4KP5 A;  5SZ4 A;  3RYX B;  1CNY A;  3ZP9 A;  4Y0J A;  2FNM A;  3HFP A;  5FLO A;  1UGD A;  1FQR A;  5EHE A;  4Q7S A;  2NXT A;  1TG3 A;  1CCT A;  1DCB A;  1YDC A;  4N16 A;  1ZFQ A;  1I8Z A;  1TBT X;  1RZE A;  3S73 B;  1HED A;  1FQL A;  3HKT A;  2W2J A;  5JG5 B;  2Q38 A;  3DC9 A;  3HLJ A;  3KON A;  1CNI A;  1FLJ A;  1CAL A;  3D9Z A;  3V7X A;  2FMG A;  3P44 A;  1ZFK A;  4Q7P A;  4E5Q A;  3P3J A;  2FOQ A;  1CIM A;  2H4N A;  4RIU A;  5G01 A;  7CA2 A;  4HF3 A;  4CAC A;  3P5L A;  4XZ5 A;  1OKN A;  4E3D A;  2GD8 A;  3BET A;  4Q7V A;  1UGE A;  4Q49 A;  4XFW A;  1CAK A;  3MZC A;  4JSW A;  3C7P A;  3RZ1 B;  4E3G A;  1UGB A;  4QK3 A;  3V3H B;  4IDR X;  5G0C A;  1RZA A;  5FLQ A;  3BL1 A;  2NWY A;  1KOQ A;  4YHA A;  4R5A A;  1ZNC A;  3FW3 A;  5CJF A;  3IGP A;  5DOH A;  5FNJ A;  12CA A;  3Q31 A;  3M2Y A;  5DSP A;  4LHI A;  3M2X A;  3MNI A;  4JSS A;  3MNK A;  4L5U A;  1Z9Y A;  3F7B A;  1KOP A;  3IEO A;  1LGD A;  2ABE A;  4HEW A;  4K0Z A;  4YGJ A;  1CVA A;  1HCB A;  3CA2 A;  2CBC A;  3U7C A;  5EH5 A;  4R59 A;  4ITO A;  1KWR A;  3MNU A;  5DRS A;  3IBI A;  4WW6 A;  1ZSA A;  3TVO X;  4PYY A;  1I90 A;  3MHC A;  4ZWZ A;  5EHV A;  4YGF A;  3DV7 A;  4PZH A;  3MHM A;  5SZ1 A;  4Q9Y A;  1IF8 A;  1Z97 A;  5SZ2 A;  3S75 B;  1JCZ A;  4YGL A;  4XIW A;  1ZH9 A;  1CVH A;  4G7A A;  3EFT A;  4QIZ A;  3V3J A;  2X7S A;  3PJJ A;  4RIV A;  3S8X A;  3M5E A;  2Q1B A;  3M1K A;  1TE3 X;  1Z93 A;  4MO8 A;  5EOI A;  2VVA X;  4Q8Z A;  4QJ0 A;  2NWP A;  4QEF A;  1G52 A;  3DCC A;  1HEA A;  2GEH A;  1XPZ A;  3RZ5 A;  3V5G A;  4QIY A;  3ZNC A;  5BYI A;  1CNJ A;  1XQ0 A;  5FNI A;  3F8E A;  3RYV B;  5FLR A;  3S97 A;  5FNG A;  1CAN A;  3OYQ A;  4Z1N A;  3N3J A;  4RUY A;  5FNM A;  1CIN A;  4QY3 A;  3D93 A;  1CA2 A;  2OSM A;  3V3G B;  5DSI A;  5SZ0 A;  5CAC A;  5FNL A;  5SZ3 A;  3OYS A;  5JEG B;  5JES B;  1G53 A;  2FNK A;  4Q0L A;  3R16 A;  4DZ9 A;  3OY0 A;  1CNW A;  5BRU A;  2X7T A;  3KLD B;  1JD0 A;  4KV0 A;  4Q09 A;  3M2Z A;  4R5B A;  5EIJ A;  2FNN A;  4UOV A;  3KNE A;  4Q6E A;  5JQT A;  3OKV A;  5E5R A;  4MTY A;  4ZX0 A;  4K13 A;  5JEH B;  3DD0 A;  5JGT B;  1XEV A;  4YXO A;  5BNL A;  3MHO A;  1A42 A;  3DD8 A;  3CYU A;  4E3F A;  3U47 A;  3PYK A;  3RGE A;  3RZ0 B;  4YVY A;  1BNN A;  1TG9 A;  4ETQ C;  3RZ8 A;  1EOU A;  3DBU A;  2FOU A;  1HCA A;  2NN7 A;  4PQ7 A;  4QSA A;  2CBA A;  5JQ0 A;  5CLU A;  5EKH A;  4KNN A;  4Q08 A;  4QSB A;  1BCD A;  3S77 B;  3T5Z A;  1G48 A;  4K0S A;  4KUV A;  4BCW A;  3K2F A;  1CA3 A;  4K0T A;  1YO1 A;  4Z1K A;  3B4F A;  1OQ5 A;  3F7U A;  2QP6 A;  1V9E A;  3MNH A;  1HUH A;  4WUQ A;  4ZWI A;  3UYN A;  4CNV A;  1RJ5 A;  3M67 A;  4ITP A;  2WEJ A;  1IF7 A;  3M2N A;  1G6V A;  4BF6 A;  4E49 A;  1DCA A;  1UGG A;  5DSM A;  3DA2 A;  4KUW A;  1CNB A;  4FPT A;  4KAP A;  2CBB A;  2QO8 A;  5G03 A;  3HKQ A;  1CNK A;  1FR4 A;  1I9L A;  1IF5 A;  3IBU A;  3P55 A;  5EKM A;  1I9P A;  1BV3 A;  5DSJ A;  4HU1 A;  4HEY A;  5FL5 A;  1OKL A;  2CBE A;  1J9W A;  4L5W A;  1AM6 A;  3S74 B;  5DSL A;  3L14 A;  1G3Z A;  2O4Z A;  5SZ7 A;  1KWQ A;  4QSJ A;  4MDL A;  4Q90 A;  4QJX A;  4ZX1 A;  3RLD A;  5DSQ A;  4KNI A;  2CA2 A;  1CNX A;  3KWA A;  1IF4 A;  3V3I B;  4RFC A;  2WD3 A;  1TB0 X;  4E3H A;  2FOS A;  3D92 A;  4JSZ A;  4M2V A;  3T84 A;  4FU5 A;  1BN1 A;  4YXI A;  5DSO A;  3JXH C;  1CAM A;  4QTL A;  2Q1Q A;  4Q07 A;  5E2K A;  4E9O X;  1URT A;  2EU3 A;  3DVC A;  3PO6 A;  4Q6D A;  4QJM A;  3MNJ A;  2AX2 A;  1DMY A;  3KIG A;  4M2W A;  5IPZ A;  1CRA A;  4WUP A;  2NXS A;  1CAO A;  3UYQ A;  2CBD A;  4FVN A;  4YYT A;  4LU3 A;  4XE1 A;  1XEG A;  4FL7 A;  3CZV A;  1CZM A;  3N4B A;  4K1Q A;  4FIK A;  1BZM A;  1TH9 A;  2NXR A;  4CNR A;  1YO0 A;  1H4N A;  3M98 A;  4QSI A;  4Q99 A;  5E28 A;  3DVB A;  3RYZ A;  1KEQ A;  3RYY A;  2FOV A;  3W6I A;  4YXU A;  1LZV A;  4GL1 X;  4IWZ A;  1TTM A;  1CAJ A;  1G54 A;  4CNW A;  3S78 B;  3T5U A;  1BNV A;  3SBH A;  5BRW A;  5G0B A;  3DAZ A;  3FFP X;  3V2J A;  4Q7W A;  1CAH A;  5E2N A;  3KS3 A;  1UGA A;  4MDG A;  5JEP B;  4HBA A;  1FSN A;  4ZWY A;  1HEC A;  3S9T A;  5DOG A;  3M5T A;  1G4J A;  4ZAO A;  1YO2 A;  1BIC A;  8CA2 A;  3M1J A;  3HKN A;  3S76 A;  3IBN A;  5DVX A;  3KOI A;  1BNW A;  5EKJ A;  4Z0Q A;  3MNA A;  4PXX A;  4M2R A;  1TEQ X;  1CVC A;  3OIL A;  4RUZ A;  3M5S A;  1I9O A;  3T83 A;  1RJ6 A;  4HT2 A;  1UGC A;  3V3F A;  2NMX A;  3OIK A;  1CCS A;  1G46 A;  4BF1 A;  1YDA A;  4KP8 A;  3NB5 A;  4TWL A;  3T85 A;  2POW A;  1HUG A;  2POV A;  3R17 B;  2AW1 A;  3RZ7 A;  3P5A A;  2FMZ A;  2HOC A;  1BN4 A;  5JDV B;  5A6H A;  1F2W A;  5FL4 A;  3M3X A;  5EH8 A;  2WEH A;  3D0N A;  2NWO A;  4Q8Y A;  1BNU A;  4L5V A;  3SAP A;  1BNT A;  2NWZ A;  1JV0 A;  1OKM A;  2F14 A;  4YWP A;  1RZC A;  3JXG A;  1RZB A;  1BN3 A;  1HEB A;  5DSN A;  1CNC A;  6CA2 A;  4RN4 A;  2HKK A;  5J8Z A;  4FRC A;  4CQ0 A;  3BL0 A;  4WL4 A;  2IT4 A;  2CAB A;  1MOO A;  4CNX A;  2QOA A;  1G1D A;  1FSQ A;  2NNO A;  1I9M A;  1RAZ A;  3W6H A;  3MDZ A;  1G0E A;  3SBI A;  3GZ0 A;  3HKU A;  4Q83 A;  3M14 A;  5EH7 A;  1RAY A;  3QYK A;  4WW8 A;  5FNH A;  1CIL A;  4DZ7 A;  2NNG A;  4Z1E A;  5FL6 A;  3RG3 A;  1CNG A;  1BNQ A;  4FVO A;  3MHI A;  3IBL A;  1IF6 A;  5DSK A;  1LG6 A;  3P58 A;  4PYX A;  3S71 B;  1CVE A;  1CNH A;  4COQ A;  5EHW A;  1UGF A;  1HVA A;  1FQM A;  2H15 A;  1CVD A;  3N2P A;  1RZD A;  3KKX A;  5AML A;  5LMD A;  3DCW A;  3VBD A;  1H9Q A;  3HS4 A;  1THK A;  3P3H A;  4ILX A;  2ILI A;  3DVD A;  4CA2 A;  4KNJ A;  5E2M A;  4G0C A;  3KOK A;  9CA2 A;  1ZE8 A;  5AMD A;  3MYQ A;  3K34 A;  4Q78 A;  3IAI A;  5JGS B;  2X7U A;  1YDB A;  4RUX A;  4JS6 A;  5C8I A;  5AMG A;  3D8W A;  5BRV A;  3TMJ A;  1MUA A;  5FDC A;  4TWM A;  1I9N A;  1G4O A;  3P4V A;  4Q06 A;  4JSA A;  4ZWX A;  3FE4 A;  4QJP A;  5JG3 B;  3DC3 A;  1LUG A;  3NJ9 A;  1AVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...