4HU1A

Crystal structure of human carbonic anhydrase isozyme xiii with the inhibitor.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
Knots found
sequence length
259
structure length
259
Chain Sequence
LSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Carbonic anhydrase 13
publication title 4-Substituted-2,3,5,6-tetrafluorobenzenesulfonamides as inhibitors of carbonic anhydrases I, II, VII, XII, and XIII.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 259
sequence length 259
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2012-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 4hu1A00
4K0ZA 4E5QA 4QSAA 3P55A 4E49A 1CVFA 3M1JA 4KUVA 3PJJA 3N3JA 5FL6A 4YVYA 1ZNCA 4XFWA 5DSKA 4Z1NA 1LG5A 4Q90A 3S72B 5DSMA 1H9NA 1ZGFA 1CVCA 2HD6A 4PYYA 2POUA 5JEPB 3RZ8A 4LHIA 4QJWA 2CBDA 1HCBA 1Z97A 3D9ZA 5DSLA 5FDCA 5J8ZA 1TEQX 1ZGEA 3W6IA 1CAJA 2EU3A 3M1KA 3N4BA 4Q6EA 4DZ9A 3MNKA 1AVNA 5E2KA 5EHWA 5SZ4A 3B4FA 4Z1JA 1BN4A 1LG6A 3T83A 3M04A 4KUYA 3P3HA 4CNWA 3JXGA 3M2NA 4RFCA 4CQ0A 1RZCA 2WEJA 1CNHA 1BNTA 3MWOA 5G0CA 3RG3A 5A25A 7CA2A 1HVAA 2NWOA 3RGEA 4Q87A 5SZ6A 1OKLA 1URTA 3P3JA 4FVOA 5DSRA 1I8ZA 1I9LA 4K1QA 4YHAA 5DSQA 4FU5A 1MUAA 3M2YA 3MDZA 4ITOA 1FR7A 1CVBA 1BNNA 1CAOA 3DVCA 5L3OA 1JD0A 3HKUA 1KWRA 3M1WA 4RFDA 4K13A 4QIZA 5SZ5A 3MYQA 4Q7PA 4ZWXA 3T5UA 1A42A 3S75B 4WR7A 1V9IC 5JGTB 3NJ9A 3KIGA 3RZ5A 4XZ5A 1XEGA 1TB0X 4FL7A 4WW8A 3KS3A 1RZDA 3KOIA 4KP8A 2NNSA 4QIYA 3U7CA 4QJOA 3S76A 5DSJA 5C8IA 3T5ZA 4N0XB 4YX4A 1CNJA 3IBIA 3KLDB 4ITPA 4BF1A 4K0TA 3T85A 1G46A 1ZSCA 1CAIA 1JCZA 1THKA 3MNUA 5JEGB 1G0FA 1RJ6A 2WEHA 4CNRA 3R17B 4BCWA 2CBAA 1I90A 1I9NA 3PYKA 5CACA 4COQA 1CAYA 1XEVA 3IBUA 4TWLA 4ZWIA 3CAJA 1HEAA 3P4VA 3F7UA 2WEGA 1G52A 2NNOA 1UGFA 3KOKA 5EKJA 2W2JA 3DCCA 4KUWA 3DCSA 1CNIA 2NMXA 3MHMA 2FNMA 1G4OA 4YXUA 3MHOA 1G45A 4ZWYA 1FQLA 1XQ0A 1BV3A 1Z9YA 2QP6A 4JSZA 1Y7WA 2QO8A 1FQRA 4MLTA 5FNIA 3R16A 4ZX1A 2NWZA 4X5SA 1AZMA 4WW6A 3S78B 5AMDA 1FQMA 1ZSAA 2FNNA 2CBBA 2CBCA 4HT0A 2FOYA 3Q31A 5EHEA 1HECA 2FOVA 3JXHC 4M2WA 1TEUX 3RYVB 2IT4A 3QYKA 5L6KA 4QSIA 4RIUA 4MTYA 1ZFQA 1TG3A 1DMYA 3K2FA 3DD0A 2Q1QA 3D93A 3V3JA 1LZVA 2X7UA 4QJ0A 5FLSA 1BNMA 9CA2A 2X7SA 3RZ0B 3MNAA 5FNLA 2FOSA 3B1BA 3CZVA 1Z93A 2NNVA 3SAXA 3ZP9A 5FNHA 2POVA 3HKTA 3ML2A 1F2WA 1CRMA 3UYQA 12CAA 3NI5A 1IF5A 3FE4A 5FLTA 4YWPA 5DSOA 4HBAA 2FMZA 2NXSA 1CA3A 1CANA 1CNGA 4ILXA 4KP5A 5JQTA 3U45X 1CILA 4L5UA 1YO0A 3T82A 4CACA 4Q7WA 1CCTA 4RUXA 2HKKA 5SZ7A 2NXTA 1HEDA 1UGEA 4KV0A 4Q6DA 5FLQA 3F4XA 4LP6A 3GZ0A 4HEWA 5G01A 1LUGA 3OKUA 3OKVA 3P5AA 1G6VA 4Q0LA 2FOUA 2HNCA 3OIMA 2GD8A 1G4JA 4XIXA 1HUGA 1TH9A 3S71B 4YYTA 3S77B 1CNCA 3M98A 5BRUA 3IBLA 1BN3A 4FRCA 2VVBX 4PYXA 1CA2A 3MHCA 3D8WA 2NN1A 1TG9A 3MHLA 2GEHA 3PO6A 4TWMA 5E5RA 4QEFA 4Q9YA 4QSJA 4HEZA 3M2XA 2ZNCA 4FIKA 3MNHA 3BL1A 1RZEA 5EKHA 4E3GA 2HL4A 1BCDA 3M1QA 5FLOA 3RJ7A 1CVAA 4Q83A 4CNXA 5IPZA 1J9WA 3S97A 1T9NA 3M5SA 1TE3X 5JQ0A 1CVHA 3K7KA 4KNJA 4MDMA 4MLXA 3TMJA 3V3HB 4Q08A 4QJPA 3M3XA 2FOQA 3MNJA 1CAKA 5BRWA 3HKNA 3TVOX 4PXXA 4KAPA 4R5AA 3SBIA 3S73B 4IWZA 3UYNA 1HUHA 4UOVA 3V3IB 5FDIA 4Q78A 4WUPA 4WUQA 4E9OX 4GL1X 5BRVA 2Q1BA 5G0BA 1CIMA 4M2RA 3V2JA 3CYUA 5JGSB 5E2RA 3D92A 1RZAA 4HT2A 3HLJA 1OQ5A 5FNMA 3M40A 1TBTX 4YGJA 3DC3A 4Z1KA 1CVDA 1FSNA 5DSIA 1UGCA 3DAZA 4E4AA 3RG4A 4JSWA 1CZMA 3LXEA 4MO8A 1YO1A 3IEOA 5BYIA 1YDBA 5FLRA 3HKQA 1OKNA 4M2VA 4QJMA 3BETA 3KKXA 5E2NA 3ZNCA 3OYSA 3CA2A 4YGLA 3KWAA 3IBNA 1CRAA 3MHIA 3MNIA 4IDRX 1ZFKA 5JEHB 2NN7A 4QK3A 4Q09A 4Q8XA 4E3FA 5DVXA 1CNWA 1MOOA 5E2SA 4ZX0A 5EIJA 4YGKA 3MMFA 1JV0A 4QTLA 1BN1A 4PZHA 4YGFA 4Q8ZA 1CNXA 1IF8A 3DD8A 3OYQA 5FL5A 3C7PA 3L14A 3T84A 1BNWA 1HCAA 2QOAA 3M14A 2CBEA 3MZCA 5FNGA 4QY3A 4Q7VA 1FSQA 3M67A 4CA2A 4XE1A 4N16A 5FNKA 1CALA 1G3ZA 1IF4A 1G48A 3TVNX 4RUYA 1CCUA 4Y0JA 1V9EA 3RLDA 1BICA 1I91A 1H9QA 2CABA 4Q81A 4RIVA 3U3AX 5CLUA 5AMLA 2EZ7A 5SZ1A 3DVDA 5DOGA 1CAZA 1H4NA 1G54A 1ZSBA 3FFPX 1CCSA 2NNGA 1CNKA 4L5VA 1RJ5A 1I9MA 5JG3B 1YDAA 3EFTA 1YDDA 5SZ3A 3RZ1B 4Q99A 5JDVB 1RAYA 4XIWA 3F7BA 4Q49A 1I9QA 2VVAX 3N0NA 3M5EA 5LMDA 1ZH9A 1FSRA 2NXRA 4MDGA 5AMGA 5SZ0A 2HFWA 5BNLA 4Z1EA 4G7AA 4Q06A 6CA2A 4KNNA 1CNYA 4G0CA 3D0NA 3RZ7A 3KONA 1YO2A 4R59A 3OY0A 3FW3A 5DRSA 1KWQA 4HU1A 3S9TA 4L5WA 3V3GB 1G0EA 2WD2A 2NWPA 3EFIA 3IGPA 5EZTX 3BL0A 3V7XA 4LU3A 4RUZA 2OSMA 3M96A 4YGNA 1IF7A 4ZWZA 2OSFA 3V5GA 2X7TA 5JESB 1CNBA 3DC9A 5CA2A 1G53A 3RYJB 3DV7A 3OIKA 3M5TA 1HEBA 4PQ7A 1KOQA 5FLPA 5G03A 4CNVA 3V3FA 3RYYA 3W6HA 2H15A 5E5UA 1FR4A 1G1DA 3K34A 2ABEA 1RAZA 4HF3A 4MDLA 1BZMA 4E3HA 3HS4A 3JXFA 1KOPA 4JSSA 1AM6A 5EH5A 4BF6A 2FNKA 1UGAA 2EU2A 1BNQA 3SAPA 1I9PA 1ZE8A 3M2ZA 5DSPA 1I9OA 3P58A 2F14A 5EHVA 1UGBA 5CJFA 8CA2A 1UGDA 2AW1A 3P44A 4Z0QA 4E3DA 1DCBA 3IAIA 2H4NA 3RYZA 2Q38A 4HEYA 5JG5B 5FNJA 2WD3A 4WL4A 4FPTA 5EH7A 3V2MA 5DOHA 5DSNA 3U47A 1DMXA 4JSAA 3SBHA 4K0SA 3DA2A 4Q07A 1CAMA 3DCWA 4QJXA 5E28A 4KNMA 4FVNA 3P5LA 4YXOA 3OILA 4DZ7A 1RZBA 3S8XA 4RN4A 1FLJA 1LGDA 1BNUA 3F8EA 4JS6A 1UGGA 4C3TA 1OKMA 4M2UA 2O4ZA 1CINA 4Q8YA 4R5BA 1CAHA 4ZAOA 2POWA 3DBUA 2FMGA 4QK2A 5FL4A 1EOUA 3S74B 3N2PA 4QK1A 5EOIA 1KEQA 3NB5A 1XPZA 2ILIA 1IF9A 1YDCA 5HPJA 2AX2A 5E2MA 4KNIA 5SZ2A 5EH8A 4RH2A 2FW4A 1TTMA 3HFPA 3VBDA 4YXIA 2HOCA 3DVBA 1IF6A 1DCAA 5EKMA 4Q7SA 4QSBA 2WEOA 2CA2A 4ETQC 3ML5A 5A6HA 1FQNA 1BNVA 2NWYA 1CVEA 3KNEA 3RYXB
chains in the Genus database with same CATH superfamily
4K0ZA 4E5QA 4QSAA 3P55A 4E49A 1CVFA 3M1JA 4KUVA 3PJJA 3N3JA 5FL6A 4YVYA 1ZNCA 4XFWA 5DSKA 4Z1NA 1LG5A 4Q90A 3S72B 5DSMA 1H9NA 1ZGFA 1CVCA 2HD6A 4PYYA 2POUA 5JEPB 3RZ8A 4LHIA 4QJWA 2CBDA 1HCBA 1Z97A 3D9ZA 5DSLA 5FDCA 5J8ZA 1TEQX 1ZGEA 3W6IA 1CAJA 2EU3A 3M1KA 3N4BA 4Q6EA 4DZ9A 3MNKA 1AVNA 5E2KA 5EHWA 5SZ4A 3B4FA 4Z1JA 1BN4A 1LG6A 3T83A 3M04A 4KUYA 3P3HA 4CNWA 3JXGA 3M2NA 4RFCA 4CQ0A 1RZCA 2WEJA 1CNHA 1BNTA 3MWOA 5G0CA 3RG3A 5A25A 7CA2A 1HVAA 2NWOA 3RGEA 4Q87A 5SZ6A 1OKLA 1URTA 3P3JA 4FVOA 5DSRA 1I8ZA 1I9LA 4K1QA 4YHAA 5DSQA 4FU5A 1MUAA 3M2YA 3MDZA 4ITOA 1FR7A 1CVBA 1BNNA 1CAOA 3DVCA 5L3OA 1JD0A 3HKUA 1KWRA 3M1WA 4RFDA 4K13A 4QIZA 5SZ5A 3MYQA 4Q7PA 4ZWXA 3T5UA 1A42A 3S75B 4WR7A 1V9IC 5JGTB 3NJ9A 3KIGA 3RZ5A 4XZ5A 1XEGA 1TB0X 4FL7A 4WW8A 3KS3A 1RZDA 3KOIA 4KP8A 2NNSA 4QIYA 3U7CA 4QJOA 3S76A 5DSJA 5C8IA 3T5ZA 4N0XB 4YX4A 1CNJA 3IBIA 3KLDB 4ITPA 4BF1A 4K0TA 3T85A 1G46A 1ZSCA 1CAIA 1JCZA 1THKA 3MNUA 5JEGB 1G0FA 1RJ6A 2WEHA 4CNRA 3R17B 4BCWA 2CBAA 1I90A 1I9NA 3PYKA 5CACA 4COQA 1CAYA 1XEVA 3IBUA 4TWLA 4ZWIA 3CAJA 1HEAA 3P4VA 3F7UA 2WEGA 1G52A 2NNOA 1UGFA 3KOKA 5EKJA 2W2JA 3DCCA 4KUWA 3DCSA 1CNIA 2NMXA 3MHMA 2FNMA 1G4OA 4YXUA 3MHOA 1G45A 4ZWYA 1FQLA 1XQ0A 1BV3A 1Z9YA 2QP6A 4JSZA 1Y7WA 2QO8A 1FQRA 4MLTA 5FNIA 3R16A 4ZX1A 2NWZA 4X5SA 1AZMA 4WW6A 3S78B 5AMDA 1FQMA 1ZSAA 2FNNA 2CBBA 2CBCA 4HT0A 2FOYA 3Q31A 5EHEA 1HECA 2FOVA 3JXHC 4M2WA 1TEUX 3RYVB 2IT4A 3QYKA 5L6KA 4QSIA 4RIUA 4MTYA 1ZFQA 1TG3A 1DMYA 3K2FA 3DD0A 2Q1QA 3D93A 3V3JA 1LZVA 2X7UA 4QJ0A 5FLSA 1BNMA 9CA2A 2X7SA 3RZ0B 3MNAA 5FNLA 2FOSA 3B1BA 3CZVA 1Z93A 2NNVA 3SAXA 3ZP9A 5FNHA 2POVA 3HKTA 3ML2A 1F2WA 1CRMA 3UYQA 12CAA 3NI5A 1IF5A 3FE4A 5FLTA 4YWPA 5DSOA 4HBAA 2FMZA 2NXSA 1CA3A 1CANA 1CNGA 4ILXA 4KP5A 5JQTA 3U45X 1CILA 4L5UA 1YO0A 3T82A 4CACA 4Q7WA 1CCTA 4RUXA 2HKKA 5SZ7A 2NXTA 1HEDA 1UGEA 4KV0A 4Q6DA 5FLQA 3F4XA 4LP6A 3GZ0A 4HEWA 5G01A 1LUGA 3OKUA 3OKVA 3P5AA 1G6VA 4Q0LA 2FOUA 2HNCA 3OIMA 2GD8A 1G4JA 4XIXA 1HUGA 1TH9A 3S71B 4YYTA 3S77B 1CNCA 3M98A 5BRUA 3IBLA 1BN3A 4FRCA 2VVBX 4PYXA 1CA2A 3MHCA 3D8WA 2NN1A 1TG9A 3MHLA 2GEHA 3PO6A 4TWMA 5E5RA 4QEFA 4Q9YA 4QSJA 4HEZA 3M2XA 2ZNCA 4FIKA 3MNHA 3BL1A 1RZEA 5EKHA 4E3GA 2HL4A 1BCDA 3M1QA 5FLOA 3RJ7A 1CVAA 4Q83A 4CNXA 5IPZA 1J9WA 3S97A 1T9NA 3M5SA 1TE3X 5JQ0A 1CVHA 3K7KA 4KNJA 4MDMA 4MLXA 3TMJA 3V3HB 4Q08A 4QJPA 3M3XA 2FOQA 3MNJA 1CAKA 5BRWA 3HKNA 3TVOX 4PXXA 4KAPA 4R5AA 3SBIA 3S73B 4IWZA 3UYNA 1HUHA 4UOVA 3V3IB 5FDIA 4Q78A 4WUPA 4WUQA 4E9OX 4GL1X 5BRVA 2Q1BA 5G0BA 1CIMA 4M2RA 3V2JA 3CYUA 5JGSB 5E2RA 3D92A 1RZAA 4HT2A 3HLJA 1OQ5A 5FNMA 3M40A 1TBTX 4YGJA 3DC3A 4Z1KA 1CVDA 1FSNA 5DSIA 1UGCA 3DAZA 4E4AA 3RG4A 4JSWA 1CZMA 3LXEA 4MO8A 1YO1A 3IEOA 5BYIA 1YDBA 5FLRA 3HKQA 1OKNA 4M2VA 4QJMA 3BETA 3KKXA 5E2NA 3ZNCA 3OYSA 3CA2A 4YGLA 3KWAA 3IBNA 1CRAA 3MHIA 3MNIA 4IDRX 1ZFKA 5JEHB 2NN7A 4QK3A 4Q09A 4Q8XA 4E3FA 5DVXA 1CNWA 1MOOA 5E2SA 4ZX0A 5EIJA 4YGKA 3MMFA 1JV0A 4QTLA 1BN1A 4PZHA 4YGFA 4Q8ZA 1CNXA 1IF8A 3DD8A 3OYQA 5FL5A 3C7PA 3L14A 3T84A 1BNWA 1HCAA 2QOAA 3M14A 2CBEA 3MZCA 5FNGA 4QY3A 4Q7VA 1FSQA 3M67A 4CA2A 4XE1A 4N16A 5FNKA 1CALA 1G3ZA 1IF4A 1G48A 3TVNX 4RUYA 1CCUA 4Y0JA 1V9EA 3RLDA 1BICA 1I91A 1H9QA 2CABA 4Q81A 4RIVA 3U3AX 5CLUA 5AMLA 2EZ7A 5SZ1A 3DVDA 5DOGA 1CAZA 1H4NA 1G54A 1ZSBA 3FFPX 1CCSA 2NNGA 1CNKA 4L5VA 1RJ5A 1I9MA 5JG3B 1YDAA 3EFTA 1YDDA 5SZ3A 3RZ1B 4Q99A 5JDVB 1RAYA 4XIWA 3F7BA 4Q49A 1I9QA 2VVAX 3N0NA 3M5EA 5LMDA 1ZH9A 1FSRA 2NXRA 4MDGA 5AMGA 5SZ0A 2HFWA 5BNLA 4Z1EA 4G7AA 4Q06A 6CA2A 4KNNA 1CNYA 4G0CA 3D0NA 3RZ7A 3KONA 1YO2A 4R59A 3OY0A 3FW3A 5DRSA 1KWQA 4HU1A 3S9TA 4L5WA 3V3GB 1G0EA 2WD2A 2NWPA 3EFIA 3IGPA 5EZTX 3BL0A 3V7XA 4LU3A 4RUZA 2OSMA 3M96A 4YGNA 1IF7A 4ZWZA 2OSFA 3V5GA 2X7TA 5JESB 1CNBA 3DC9A 5CA2A 1G53A 3RYJB 3DV7A 3OIKA 3M5TA 1HEBA 4PQ7A 1KOQA 5FLPA 5G03A 4CNVA 3V3FA 3RYYA 3W6HA 2H15A 5E5UA 1FR4A 1G1DA 3K34A 2ABEA 1RAZA 4HF3A 4MDLA 1BZMA 4E3HA 3HS4A 3JXFA 1KOPA 4JSSA 1AM6A 5EH5A 4BF6A 2FNKA 1UGAA 2EU2A 1BNQA 3SAPA 1I9PA 1ZE8A 3M2ZA 5DSPA 1I9OA 3P58A 2F14A 5EHVA 1UGBA 5CJFA 8CA2A 1UGDA 2AW1A 3P44A 4Z0QA 4E3DA 1DCBA 3IAIA 2H4NA 3RYZA 2Q38A 4HEYA 5JG5B 5FNJA 2WD3A 4WL4A 4FPTA 5EH7A 3V2MA 5DOHA 5DSNA 3U47A 1DMXA 4JSAA 3SBHA 4K0SA 3DA2A 4Q07A 1CAMA 3DCWA 4QJXA 5E28A 4KNMA 4FVNA 3P5LA 4YXOA 3OILA 4DZ7A 1RZBA 3S8XA 4RN4A 1FLJA 1LGDA 1BNUA 3F8EA 4JS6A 1UGGA 4C3TA 1OKMA 4M2UA 2O4ZA 1CINA 4Q8YA 4R5BA 1CAHA 4ZAOA 2POWA 3DBUA 2FMGA 4QK2A 5FL4A 1EOUA 3S74B 3N2PA 4QK1A 5EOIA 1KEQA 3NB5A 1XPZA 2ILIA 1IF9A 1YDCA 5HPJA 2AX2A 5E2MA 4KNIA 5SZ2A 5EH8A 4RH2A 2FW4A 1TTMA 3HFPA 3VBDA 4YXIA 2HOCA 3DVBA 1IF6A 1DCAA 5EKMA 4Q7SA 4QSBA 2WEOA 2CA2A 4ETQC 3ML5A 5A6HA 1FQNA 1BNVA 2NWYA 1CVEA 3KNEA 3RYXB
chains in the Genus database with same CATH topology
4K0ZA 4E5QA 4QSAA 3P55A 4E49A 1CVFA 3M1JA 4KUVA 3PJJA 3N3JA 5FL6A 4YVYA 1ZNCA 4XFWA 5DSKA 4Z1NA 1LG5A 4Q90A 3S72B 5DSMA 1H9NA 1ZGFA 1CVCA 2HD6A 4PYYA 2POUA 5JEPB 3RZ8A 4LHIA 4QJWA 2CBDA 1HCBA 1Z97A 3D9ZA 5DSLA 5FDCA 5J8ZA 1TEQX 1ZGEA 3W6IA 1CAJA 2EU3A 3M1KA 3N4BA 4Q6EA 4DZ9A 3MNKA 1AVNA 5E2KA 5EHWA 5SZ4A 3B4FA 4Z1JA 1BN4A 1LG6A 3T83A 3M04A 4KUYA 3P3HA 4CNWA 3JXGA 3M2NA 4RFCA 4CQ0A 1RZCA 2WEJA 1CNHA 1BNTA 3MWOA 5G0CA 3RG3A 5A25A 7CA2A 1HVAA 2NWOA 3RGEA 4Q87A 5SZ6A 1OKLA 1URTA 3P3JA 4FVOA 5DSRA 1I8ZA 1I9LA 4K1QA 4YHAA 5DSQA 4FU5A 1MUAA 3M2YA 3MDZA 4ITOA 1FR7A 1CVBA 1BNNA 1CAOA 3DVCA 5L3OA 1JD0A 3HKUA 1KWRA 3M1WA 4RFDA 4K13A 4QIZA 5SZ5A 3MYQA 4Q7PA 4ZWXA 3T5UA 1A42A 3S75B 4WR7A 1V9IC 5JGTB 3NJ9A 3KIGA 3RZ5A 4XZ5A 1XEGA 1TB0X 4FL7A 4WW8A 3KS3A 1RZDA 3KOIA 4KP8A 2NNSA 4QIYA 3U7CA 4QJOA 3S76A 5DSJA 5C8IA 3T5ZA 4N0XB 4YX4A 1CNJA 3IBIA 3KLDB 4ITPA 4BF1A 4K0TA 3T85A 1G46A 1ZSCA 1CAIA 1JCZA 1THKA 3MNUA 5JEGB 1G0FA 1RJ6A 2WEHA 4CNRA 3R17B 4BCWA 2CBAA 1I90A 1I9NA 3PYKA 5CACA 4COQA 1CAYA 1XEVA 3IBUA 4TWLA 4ZWIA 3CAJA 1HEAA 3P4VA 3F7UA 2WEGA 1G52A 2NNOA 1UGFA 3KOKA 5EKJA 2W2JA 3DCCA 4KUWA 3DCSA 1CNIA 2NMXA 3MHMA 2FNMA 1G4OA 4YXUA 3MHOA 1G45A 4ZWYA 1FQLA 1XQ0A 1BV3A 1Z9YA 2QP6A 4JSZA 1Y7WA 2QO8A 1FQRA 4MLTA 5FNIA 3R16A 4ZX1A 2NWZA 4X5SA 1AZMA 4WW6A 3S78B 5AMDA 1FQMA 1ZSAA 2FNNA 2CBBA 2CBCA 4HT0A 2FOYA 3Q31A 5EHEA 1HECA 2FOVA 3JXHC 4M2WA 1TEUX 3RYVB 2IT4A 3QYKA 5L6KA 4QSIA 4RIUA 4MTYA 1ZFQA 1TG3A 1DMYA 3K2FA 3DD0A 2Q1QA 3D93A 3V3JA 1LZVA 2X7UA 4QJ0A 5FLSA 1BNMA 9CA2A 2X7SA 3RZ0B 3MNAA 5FNLA 2FOSA 3B1BA 3CZVA 1Z93A 2NNVA 3SAXA 3ZP9A 5FNHA 2POVA 3HKTA 3ML2A 1F2WA 1CRMA 3UYQA 12CAA 3NI5A 1IF5A 3FE4A 5FLTA 4YWPA 5DSOA 4HBAA 2FMZA 2NXSA 1CA3A 1CANA 1CNGA 4ILXA 4KP5A 5JQTA 3U45X 1CILA 4L5UA 1YO0A 3T82A 4CACA 4Q7WA 1CCTA 4RUXA 2HKKA 5SZ7A 2NXTA 1HEDA 1UGEA 4KV0A 4Q6DA 5FLQA 3F4XA 4LP6A 3GZ0A 4HEWA 5G01A 1LUGA 3OKUA 3OKVA 3P5AA 1G6VA 4Q0LA 2FOUA 2HNCA 3OIMA 2GD8A 1G4JA 4XIXA 1HUGA 1TH9A 3S71B 4YYTA 3S77B 1CNCA 3M98A 5BRUA 3IBLA 1BN3A 4FRCA 2VVBX 4PYXA 1CA2A 3MHCA 3D8WA 2NN1A 1TG9A 3MHLA 2GEHA 3PO6A 4TWMA 5E5RA 4QEFA 4Q9YA 4QSJA 4HEZA 3M2XA 2ZNCA 4FIKA 3MNHA 3BL1A 1RZEA 5EKHA 4E3GA 2HL4A 1BCDA 3M1QA 5FLOA 3RJ7A 1CVAA 4Q83A 4CNXA 5IPZA 1J9WA 3S97A 1T9NA 3M5SA 1TE3X 5JQ0A 1CVHA 3K7KA 4KNJA 4MDMA 4MLXA 3TMJA 3V3HB 4Q08A 4QJPA 3M3XA 2FOQA 3MNJA 1CAKA 5BRWA 3HKNA 3TVOX 4PXXA 4KAPA 4R5AA 3SBIA 3S73B 4IWZA 3UYNA 1HUHA 4UOVA 3V3IB 5FDIA 4Q78A 4WUPA 4WUQA 4E9OX 4GL1X 5BRVA 2Q1BA 5G0BA 1CIMA 4M2RA 3V2JA 3CYUA 5JGSB 5E2RA 3D92A 1RZAA 4HT2A 3HLJA 1OQ5A 5FNMA 3M40A 1TBTX 4YGJA 3DC3A 4Z1KA 1CVDA 1FSNA 5DSIA 1UGCA 3DAZA 4E4AA 3RG4A 4JSWA 1CZMA 3LXEA 4MO8A 1YO1A 3IEOA 5BYIA 1YDBA 5FLRA 3HKQA 1OKNA 4M2VA 4QJMA 3BETA 3KKXA 5E2NA 3ZNCA 3OYSA 3CA2A 4YGLA 3KWAA 3IBNA 1CRAA 3MHIA 3MNIA 4IDRX 1ZFKA 5JEHB 2NN7A 4QK3A 4Q09A 4Q8XA 4E3FA 5DVXA 1CNWA 1MOOA 5E2SA 4ZX0A 5EIJA 4YGKA 3MMFA 1JV0A 4QTLA 1BN1A 4PZHA 4YGFA 4Q8ZA 1CNXA 1IF8A 3DD8A 3OYQA 5FL5A 3C7PA 3L14A 3T84A 1BNWA 1HCAA 2QOAA 3M14A 2CBEA 3MZCA 5FNGA 4QY3A 4Q7VA 1FSQA 3M67A 4CA2A 4XE1A 4N16A 5FNKA 1CALA 1G3ZA 1IF4A 1G48A 3TVNX 4RUYA 1CCUA 4Y0JA 1V9EA 3RLDA 1BICA 1I91A 1H9QA 2CABA 4Q81A 4RIVA 3U3AX 5CLUA 5AMLA 2EZ7A 5SZ1A 3DVDA 5DOGA 1CAZA 1H4NA 1G54A 1ZSBA 3FFPX 1CCSA 2NNGA 1CNKA 4L5VA 1RJ5A 1I9MA 5JG3B 1YDAA 3EFTA 1YDDA 5SZ3A 3RZ1B 4Q99A 5JDVB 1RAYA 4XIWA 3F7BA 4Q49A 1I9QA 2VVAX 3N0NA 3M5EA 5LMDA 1ZH9A 1FSRA 2NXRA 4MDGA 5AMGA 5SZ0A 2HFWA 5BNLA 4Z1EA 4G7AA 4Q06A 6CA2A 4KNNA 1CNYA 4G0CA 3D0NA 3RZ7A 3KONA 1YO2A 4R59A 3OY0A 3FW3A 5DRSA 1KWQA 4HU1A 3S9TA 4L5WA 3V3GB 1G0EA 2WD2A 2NWPA 3EFIA 3IGPA 5EZTX 3BL0A 3V7XA 4LU3A 4RUZA 2OSMA 3M96A 4YGNA 1IF7A 4ZWZA 2OSFA 3V5GA 2X7TA 5JESB 1CNBA 3DC9A 5CA2A 1G53A 3RYJB 3DV7A 3OIKA 3M5TA 1HEBA 4PQ7A 1KOQA 5FLPA 5G03A 4CNVA 3V3FA 3RYYA 3W6HA 2H15A 5E5UA 1FR4A 1G1DA 3K34A 2ABEA 1RAZA 4HF3A 4MDLA 1BZMA 4E3HA 3HS4A 3JXFA 1KOPA 4JSSA 1AM6A 5EH5A 4BF6A 2FNKA 1UGAA 2EU2A 1BNQA 3SAPA 1I9PA 1ZE8A 3M2ZA 5DSPA 1I9OA 3P58A 2F14A 5EHVA 1UGBA 5CJFA 8CA2A 1UGDA 2AW1A 3P44A 4Z0QA 4E3DA 1DCBA 3IAIA 2H4NA 3RYZA 2Q38A 4HEYA 5JG5B 5FNJA 2WD3A 4WL4A 4FPTA 5EH7A 3V2MA 5DOHA 5DSNA 3U47A 1DMXA 4JSAA 3SBHA 4K0SA 3DA2A 4Q07A 1CAMA 3DCWA 4QJXA 5E28A 4KNMA 4FVNA 3P5LA 4YXOA 3OILA 4DZ7A 1RZBA 3S8XA 4RN4A 1FLJA 1LGDA 1BNUA 3F8EA 4JS6A 1UGGA 4C3TA 1OKMA 4M2UA 2O4ZA 1CINA 4Q8YA 4R5BA 1CAHA 4ZAOA 2POWA 3DBUA 2FMGA 4QK2A 5FL4A 1EOUA 3S74B 3N2PA 4QK1A 5EOIA 1KEQA 3NB5A 1XPZA 2ILIA 1IF9A 1YDCA 5HPJA 2AX2A 5E2MA 4KNIA 5SZ2A 5EH8A 4RH2A 2FW4A 1TTMA 3HFPA 3VBDA 4YXIA 2HOCA 3DVBA 1IF6A 1DCAA 5EKMA 4Q7SA 4QSBA 2WEOA 2CA2A 4ETQC 3ML5A 5A6HA 1FQNA 1BNVA 2NWYA 1CVEA 3KNEA 3RYXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0Z A;  4E5Q A;  4QSA A;  3P55 A;  4E49 A;  1CVF A;  3M1J A;  4KUV A;  3PJJ A;  3N3J A;  5FL6 A;  4YVY A;  1ZNC A;  4XFW A;  5DSK A;  4Z1N A;  1LG5 A;  4Q90 A;  3S72 B;  5DSM A;  1H9N A;  1ZGF A;  1CVC A;  2HD6 A;  4PYY A;  2POU A;  5JEP B;  3RZ8 A;  4LHI A;  4QJW A;  2CBD A;  1HCB A;  1Z97 A;  3D9Z A;  5DSL A;  5FDC A;  5J8Z A;  1TEQ X;  1ZGE A;  3W6I A;  1CAJ A;  2EU3 A;  3M1K A;  3N4B A;  4Q6E A;  4DZ9 A;  3MNK A;  1AVN A;  5E2K A;  5EHW A;  5SZ4 A;  3B4F A;  4Z1J A;  1BN4 A;  1LG6 A;  3T83 A;  3M04 A;  4KUY A;  3P3H A;  4CNW A;  3JXG A;  3M2N A;  4RFC A;  4CQ0 A;  1RZC A;  2WEJ A;  1CNH A;  1BNT A;  3MWO A;  5G0C A;  3RG3 A;  5A25 A;  7CA2 A;  1HVA A;  2NWO A;  3RGE A;  4Q87 A;  5SZ6 A;  1OKL A;  1URT A;  3P3J A;  4FVO A;  5DSR A;  1I8Z A;  1I9L A;  4K1Q A;  4YHA A;  5DSQ A;  4FU5 A;  1MUA A;  3M2Y A;  3MDZ A;  4ITO A;  1FR7 A;  1CVB A;  1BNN A;  1CAO A;  3DVC A;  5L3O A;  1JD0 A;  3HKU A;  1KWR A;  3M1W A;  4RFD A;  4K13 A;  4QIZ A;  5SZ5 A;  3MYQ A;  4Q7P A;  4ZWX A;  3T5U A;  1A42 A;  3S75 B;  4WR7 A;  1V9I C;  5JGT B;  3NJ9 A;  3KIG A;  3RZ5 A;  4XZ5 A;  1XEG A;  1TB0 X;  4FL7 A;  4WW8 A;  3KS3 A;  1RZD A;  3KOI A;  4KP8 A;  2NNS A;  4QIY A;  3U7C A;  4QJO A;  3S76 A;  5DSJ A;  5C8I A;  3T5Z A;  4N0X B;  4YX4 A;  1CNJ A;  3IBI A;  3KLD B;  4ITP A;  4BF1 A;  4K0T A;  3T85 A;  1G46 A;  1ZSC A;  1CAI A;  1JCZ A;  1THK A;  3MNU A;  5JEG B;  1G0F A;  1RJ6 A;  2WEH A;  4CNR A;  3R17 B;  4BCW A;  2CBA A;  1I90 A;  1I9N A;  3PYK A;  5CAC A;  4COQ A;  1CAY A;  1XEV A;  3IBU A;  4TWL A;  4ZWI A;  3CAJ A;  1HEA A;  3P4V A;  3F7U A;  2WEG A;  1G52 A;  2NNO A;  1UGF A;  3KOK A;  5EKJ A;  2W2J A;  3DCC A;  4KUW A;  3DCS A;  1CNI A;  2NMX A;  3MHM A;  2FNM A;  1G4O A;  4YXU A;  3MHO A;  1G45 A;  4ZWY A;  1FQL A;  1XQ0 A;  1BV3 A;  1Z9Y A;  2QP6 A;  4JSZ A;  1Y7W A;  2QO8 A;  1FQR A;  4MLT A;  5FNI A;  3R16 A;  4ZX1 A;  2NWZ A;  4X5S A;  1AZM A;  4WW6 A;  3S78 B;  5AMD A;  1FQM A;  1ZSA A;  2FNN A;  2CBB A;  2CBC A;  4HT0 A;  2FOY A;  3Q31 A;  5EHE A;  1HEC A;  2FOV A;  3JXH C;  4M2W A;  1TEU X;  3RYV B;  2IT4 A;  3QYK A;  5L6K A;  4QSI A;  4RIU A;  4MTY A;  1ZFQ A;  1TG3 A;  1DMY A;  3K2F A;  3DD0 A;  2Q1Q A;  3D93 A;  3V3J A;  1LZV A;  2X7U A;  4QJ0 A;  5FLS A;  1BNM A;  9CA2 A;  2X7S A;  3RZ0 B;  3MNA A;  5FNL A;  2FOS A;  3B1B A;  3CZV A;  1Z93 A;  2NNV A;  3SAX A;  3ZP9 A;  5FNH A;  2POV A;  3HKT A;  3ML2 A;  1F2W A;  1CRM A;  3UYQ A;  12CA A;  3NI5 A;  1IF5 A;  3FE4 A;  5FLT A;  4YWP A;  5DSO A;  4HBA A;  2FMZ A;  2NXS A;  1CA3 A;  1CAN A;  1CNG A;  4ILX A;  4KP5 A;  5JQT A;  3U45 X;  1CIL A;  4L5U A;  1YO0 A;  3T82 A;  4CAC A;  4Q7W A;  1CCT A;  4RUX A;  2HKK A;  5SZ7 A;  2NXT A;  1HED A;  1UGE A;  4KV0 A;  4Q6D A;  5FLQ A;  3F4X A;  4LP6 A;  3GZ0 A;  4HEW A;  5G01 A;  1LUG A;  3OKU A;  3OKV A;  3P5A A;  1G6V A;  4Q0L A;  2FOU A;  2HNC A;  3OIM A;  2GD8 A;  1G4J A;  4XIX A;  1HUG A;  1TH9 A;  3S71 B;  4YYT A;  3S77 B;  1CNC A;  3M98 A;  5BRU A;  3IBL A;  1BN3 A;  4FRC A;  2VVB X;  4PYX A;  1CA2 A;  3MHC A;  3D8W A;  2NN1 A;  1TG9 A;  3MHL A;  2GEH A;  3PO6 A;  4TWM A;  5E5R A;  4QEF A;  4Q9Y A;  4QSJ A;  4HEZ A;  3M2X A;  2ZNC A;  4FIK A;  3MNH A;  3BL1 A;  1RZE A;  5EKH A;  4E3G A;  2HL4 A;  1BCD A;  3M1Q A;  5FLO A;  3RJ7 A;  1CVA A;  4Q83 A;  4CNX A;  5IPZ A;  1J9W A;  3S97 A;  1T9N A;  3M5S A;  1TE3 X;  5JQ0 A;  1CVH A;  3K7K A;  4KNJ A;  4MDM A;  4MLX A;  3TMJ A;  3V3H B;  4Q08 A;  4QJP A;  3M3X A;  2FOQ A;  3MNJ A;  1CAK A;  5BRW A;  3HKN A;  3TVO X;  4PXX A;  4KAP A;  4R5A A;  3SBI A;  3S73 B;  4IWZ A;  3UYN A;  1HUH A;  4UOV A;  3V3I B;  5FDI A;  4Q78 A;  4WUP A;  4WUQ A;  4E9O X;  4GL1 X;  5BRV A;  2Q1B A;  5G0B A;  1CIM A;  4M2R A;  3V2J A;  3CYU A;  5JGS B;  5E2R A;  3D92 A;  1RZA A;  4HT2 A;  3HLJ A;  1OQ5 A;  5FNM A;  3M40 A;  1TBT X;  4YGJ A;  3DC3 A;  4Z1K A;  1CVD A;  1FSN A;  5DSI A;  1UGC A;  3DAZ A;  4E4A A;  3RG4 A;  4JSW A;  1CZM A;  3LXE A;  4MO8 A;  1YO1 A;  3IEO A;  5BYI A;  1YDB A;  5FLR A;  3HKQ A;  1OKN A;  4M2V A;  4QJM A;  3BET A;  3KKX A;  5E2N A;  3ZNC A;  3OYS A;  3CA2 A;  4YGL A;  3KWA A;  3IBN A;  1CRA A;  3MHI A;  3MNI A;  4IDR X;  1ZFK A;  5JEH B;  2NN7 A;  4QK3 A;  4Q09 A;  4Q8X A;  4E3F A;  5DVX A;  1CNW A;  1MOO A;  5E2S A;  4ZX0 A;  5EIJ A;  4YGK A;  3MMF A;  1JV0 A;  4QTL A;  1BN1 A;  4PZH A;  4YGF A;  4Q8Z A;  1CNX A;  1IF8 A;  3DD8 A;  3OYQ A;  5FL5 A;  3C7P A;  3L14 A;  3T84 A;  1BNW A;  1HCA A;  2QOA A;  3M14 A;  2CBE A;  3MZC A;  5FNG A;  4QY3 A;  4Q7V A;  1FSQ A;  3M67 A;  4CA2 A;  4XE1 A;  4N16 A;  5FNK A;  1CAL A;  1G3Z A;  1IF4 A;  1G48 A;  3TVN X;  4RUY A;  1CCU A;  4Y0J A;  1V9E A;  3RLD A;  1BIC A;  1I91 A;  1H9Q A;  2CAB A;  4Q81 A;  4RIV A;  3U3A X;  5CLU A;  5AML A;  2EZ7 A;  5SZ1 A;  3DVD A;  5DOG A;  1CAZ A;  1H4N A;  1G54 A;  1ZSB A;  3FFP X;  1CCS A;  2NNG A;  1CNK A;  4L5V A;  1RJ5 A;  1I9M A;  5JG3 B;  1YDA A;  3EFT A;  1YDD A;  5SZ3 A;  3RZ1 B;  4Q99 A;  5JDV B;  1RAY A;  4XIW A;  3F7B A;  4Q49 A;  1I9Q A;  2VVA X;  3N0N A;  3M5E A;  5LMD A;  1ZH9 A;  1FSR A;  2NXR A;  4MDG A;  5AMG A;  5SZ0 A;  2HFW A;  5BNL A;  4Z1E A;  4G7A A;  4Q06 A;  6CA2 A;  4KNN A;  1CNY A;  4G0C A;  3D0N A;  3RZ7 A;  3KON A;  1YO2 A;  4R59 A;  3OY0 A;  3FW3 A;  5DRS A;  1KWQ A;  4HU1 A;  3S9T A;  4L5W A;  3V3G B;  1G0E A;  2WD2 A;  2NWP A;  3EFI A;  3IGP A;  5EZT X;  3BL0 A;  3V7X A;  4LU3 A;  4RUZ A;  2OSM A;  3M96 A;  4YGN A;  1IF7 A;  4ZWZ A;  2OSF A;  3V5G A;  2X7T A;  5JES B;  1CNB A;  3DC9 A;  5CA2 A;  1G53 A;  3RYJ B;  3DV7 A;  3OIK A;  3M5T A;  1HEB A;  4PQ7 A;  1KOQ A;  5FLP A;  5G03 A;  4CNV A;  3V3F A;  3RYY A;  3W6H A;  2H15 A;  5E5U A;  1FR4 A;  1G1D A;  3K34 A;  2ABE A;  1RAZ A;  4HF3 A;  4MDL A;  1BZM A;  4E3H A;  3HS4 A;  3JXF A;  1KOP A;  4JSS A;  1AM6 A;  5EH5 A;  4BF6 A;  2FNK A;  1UGA A;  2EU2 A;  1BNQ A;  3SAP A;  1I9P A;  1ZE8 A;  3M2Z A;  5DSP A;  1I9O A;  3P58 A;  2F14 A;  5EHV A;  1UGB A;  5CJF A;  8CA2 A;  1UGD A;  2AW1 A;  3P44 A;  4Z0Q A;  4E3D A;  1DCB A;  3IAI A;  2H4N A;  3RYZ A;  2Q38 A;  4HEY A;  5JG5 B;  5FNJ A;  2WD3 A;  4WL4 A;  4FPT A;  5EH7 A;  3V2M A;  5DOH A;  5DSN A;  3U47 A;  1DMX A;  4JSA A;  3SBH A;  4K0S A;  3DA2 A;  4Q07 A;  1CAM A;  3DCW A;  4QJX A;  5E28 A;  4KNM A;  4FVN A;  3P5L A;  4YXO A;  3OIL A;  4DZ7 A;  1RZB A;  3S8X A;  4RN4 A;  1FLJ A;  1LGD A;  1BNU A;  3F8E A;  4JS6 A;  1UGG A;  4C3T A;  1OKM A;  4M2U A;  2O4Z A;  1CIN A;  4Q8Y A;  4R5B A;  1CAH A;  4ZAO A;  2POW A;  3DBU A;  2FMG A;  4QK2 A;  5FL4 A;  1EOU A;  3S74 B;  3N2P A;  4QK1 A;  5EOI A;  1KEQ A;  3NB5 A;  1XPZ A;  2ILI A;  1IF9 A;  1YDC A;  5HPJ A;  2AX2 A;  5E2M A;  4KNI A;  5SZ2 A;  5EH8 A;  4RH2 A;  2FW4 A;  1TTM A;  3HFP A;  3VBD A;  4YXI A;  2HOC A;  3DVB A;  1IF6 A;  1DCA A;  5EKM A;  4Q7S A;  4QSB A;  2WEO A;  2CA2 A;  4ETQ C;  3ML5 A;  5A6H A;  1FQN A;  1BNV A;  2NWY A;  1CVE A;  3KNE A;  3RYX B; 
#chains in the Genus database with same CATH topology
 4K0Z A;  4E5Q A;  4QSA A;  3P55 A;  4E49 A;  1CVF A;  3M1J A;  4KUV A;  3PJJ A;  3N3J A;  5FL6 A;  4YVY A;  1ZNC A;  4XFW A;  5DSK A;  4Z1N A;  1LG5 A;  4Q90 A;  3S72 B;  5DSM A;  1H9N A;  1ZGF A;  1CVC A;  2HD6 A;  4PYY A;  2POU A;  5JEP B;  3RZ8 A;  4LHI A;  4QJW A;  2CBD A;  1HCB A;  1Z97 A;  3D9Z A;  5DSL A;  5FDC A;  5J8Z A;  1TEQ X;  1ZGE A;  3W6I A;  1CAJ A;  2EU3 A;  3M1K A;  3N4B A;  4Q6E A;  4DZ9 A;  3MNK A;  1AVN A;  5E2K A;  5EHW A;  5SZ4 A;  3B4F A;  4Z1J A;  1BN4 A;  1LG6 A;  3T83 A;  3M04 A;  4KUY A;  3P3H A;  4CNW A;  3JXG A;  3M2N A;  4RFC A;  4CQ0 A;  1RZC A;  2WEJ A;  1CNH A;  1BNT A;  3MWO A;  5G0C A;  3RG3 A;  5A25 A;  7CA2 A;  1HVA A;  2NWO A;  3RGE A;  4Q87 A;  5SZ6 A;  1OKL A;  1URT A;  3P3J A;  4FVO A;  5DSR A;  1I8Z A;  1I9L A;  4K1Q A;  4YHA A;  5DSQ A;  4FU5 A;  1MUA A;  3M2Y A;  3MDZ A;  4ITO A;  1FR7 A;  1CVB A;  1BNN A;  1CAO A;  3DVC A;  5L3O A;  1JD0 A;  3HKU A;  1KWR A;  3M1W A;  4RFD A;  4K13 A;  4QIZ A;  5SZ5 A;  3MYQ A;  4Q7P A;  4ZWX A;  3T5U A;  1A42 A;  3S75 B;  4WR7 A;  1V9I C;  5JGT B;  3NJ9 A;  3KIG A;  3RZ5 A;  4XZ5 A;  1XEG A;  1TB0 X;  4FL7 A;  4WW8 A;  3KS3 A;  1RZD A;  3KOI A;  4KP8 A;  2NNS A;  4QIY A;  3U7C A;  4QJO A;  3S76 A;  5DSJ A;  5C8I A;  3T5Z A;  4N0X B;  4YX4 A;  1CNJ A;  3IBI A;  3KLD B;  4ITP A;  4BF1 A;  4K0T A;  3T85 A;  1G46 A;  1ZSC A;  1CAI A;  1JCZ A;  1THK A;  3MNU A;  5JEG B;  1G0F A;  1RJ6 A;  2WEH A;  4CNR A;  3R17 B;  4BCW A;  2CBA A;  1I90 A;  1I9N A;  3PYK A;  5CAC A;  4COQ A;  1CAY A;  1XEV A;  3IBU A;  4TWL A;  4ZWI A;  3CAJ A;  1HEA A;  3P4V A;  3F7U A;  2WEG A;  1G52 A;  2NNO A;  1UGF A;  3KOK A;  5EKJ A;  2W2J A;  3DCC A;  4KUW A;  3DCS A;  1CNI A;  2NMX A;  3MHM A;  2FNM A;  1G4O A;  4YXU A;  3MHO A;  1G45 A;  4ZWY A;  1FQL A;  1XQ0 A;  1BV3 A;  1Z9Y A;  2QP6 A;  4JSZ A;  1Y7W A;  2QO8 A;  1FQR A;  4MLT A;  5FNI A;  3R16 A;  4ZX1 A;  2NWZ A;  4X5S A;  1AZM A;  4WW6 A;  3S78 B;  5AMD A;  1FQM A;  1ZSA A;  2FNN A;  2CBB A;  2CBC A;  4HT0 A;  2FOY A;  3Q31 A;  5EHE A;  1HEC A;  2FOV A;  3JXH C;  4M2W A;  1TEU X;  3RYV B;  2IT4 A;  3QYK A;  5L6K A;  4QSI A;  4RIU A;  4MTY A;  1ZFQ A;  1TG3 A;  1DMY A;  3K2F A;  3DD0 A;  2Q1Q A;  3D93 A;  3V3J A;  1LZV A;  2X7U A;  4QJ0 A;  5FLS A;  1BNM A;  9CA2 A;  2X7S A;  3RZ0 B;  3MNA A;  5FNL A;  2FOS A;  3B1B A;  3CZV A;  1Z93 A;  2NNV A;  3SAX A;  3ZP9 A;  5FNH A;  2POV A;  3HKT A;  3ML2 A;  1F2W A;  1CRM A;  3UYQ A;  12CA A;  3NI5 A;  1IF5 A;  3FE4 A;  5FLT A;  4YWP A;  5DSO A;  4HBA A;  2FMZ A;  2NXS A;  1CA3 A;  1CAN A;  1CNG A;  4ILX A;  4KP5 A;  5JQT A;  3U45 X;  1CIL A;  4L5U A;  1YO0 A;  3T82 A;  4CAC A;  4Q7W A;  1CCT A;  4RUX A;  2HKK A;  5SZ7 A;  2NXT A;  1HED A;  1UGE A;  4KV0 A;  4Q6D A;  5FLQ A;  3F4X A;  4LP6 A;  3GZ0 A;  4HEW A;  5G01 A;  1LUG A;  3OKU A;  3OKV A;  3P5A A;  1G6V A;  4Q0L A;  2FOU A;  2HNC A;  3OIM A;  2GD8 A;  1G4J A;  4XIX A;  1HUG A;  1TH9 A;  3S71 B;  4YYT A;  3S77 B;  1CNC A;  3M98 A;  5BRU A;  3IBL A;  1BN3 A;  4FRC A;  2VVB X;  4PYX A;  1CA2 A;  3MHC A;  3D8W A;  2NN1 A;  1TG9 A;  3MHL A;  2GEH A;  3PO6 A;  4TWM A;  5E5R A;  4QEF A;  4Q9Y A;  4QSJ A;  4HEZ A;  3M2X A;  2ZNC A;  4FIK A;  3MNH A;  3BL1 A;  1RZE A;  5EKH A;  4E3G A;  2HL4 A;  1BCD A;  3M1Q A;  5FLO A;  3RJ7 A;  1CVA A;  4Q83 A;  4CNX A;  5IPZ A;  1J9W A;  3S97 A;  1T9N A;  3M5S A;  1TE3 X;  5JQ0 A;  1CVH A;  3K7K A;  4KNJ A;  4MDM A;  4MLX A;  3TMJ A;  3V3H B;  4Q08 A;  4QJP A;  3M3X A;  2FOQ A;  3MNJ A;  1CAK A;  5BRW A;  3HKN A;  3TVO X;  4PXX A;  4KAP A;  4R5A A;  3SBI A;  3S73 B;  4IWZ A;  3UYN A;  1HUH A;  4UOV A;  3V3I B;  5FDI A;  4Q78 A;  4WUP A;  4WUQ A;  4E9O X;  4GL1 X;  5BRV A;  2Q1B A;  5G0B A;  1CIM A;  4M2R A;  3V2J A;  3CYU A;  5JGS B;  5E2R A;  3D92 A;  1RZA A;  4HT2 A;  3HLJ A;  1OQ5 A;  5FNM A;  3M40 A;  1TBT X;  4YGJ A;  3DC3 A;  4Z1K A;  1CVD A;  1FSN A;  5DSI A;  1UGC A;  3DAZ A;  4E4A A;  3RG4 A;  4JSW A;  1CZM A;  3LXE A;  4MO8 A;  1YO1 A;  3IEO A;  5BYI A;  1YDB A;  5FLR A;  3HKQ A;  1OKN A;  4M2V A;  4QJM A;  3BET A;  3KKX A;  5E2N A;  3ZNC A;  3OYS A;  3CA2 A;  4YGL A;  3KWA A;  3IBN A;  1CRA A;  3MHI A;  3MNI A;  4IDR X;  1ZFK A;  5JEH B;  2NN7 A;  4QK3 A;  4Q09 A;  4Q8X A;  4E3F A;  5DVX A;  1CNW A;  1MOO A;  5E2S A;  4ZX0 A;  5EIJ A;  4YGK A;  3MMF A;  1JV0 A;  4QTL A;  1BN1 A;  4PZH A;  4YGF A;  4Q8Z A;  1CNX A;  1IF8 A;  3DD8 A;  3OYQ A;  5FL5 A;  3C7P A;  3L14 A;  3T84 A;  1BNW A;  1HCA A;  2QOA A;  3M14 A;  2CBE A;  3MZC A;  5FNG A;  4QY3 A;  4Q7V A;  1FSQ A;  3M67 A;  4CA2 A;  4XE1 A;  4N16 A;  5FNK A;  1CAL A;  1G3Z A;  1IF4 A;  1G48 A;  3TVN X;  4RUY A;  1CCU A;  4Y0J A;  1V9E A;  3RLD A;  1BIC A;  1I91 A;  1H9Q A;  2CAB A;  4Q81 A;  4RIV A;  3U3A X;  5CLU A;  5AML A;  2EZ7 A;  5SZ1 A;  3DVD A;  5DOG A;  1CAZ A;  1H4N A;  1G54 A;  1ZSB A;  3FFP X;  1CCS A;  2NNG A;  1CNK A;  4L5V A;  1RJ5 A;  1I9M A;  5JG3 B;  1YDA A;  3EFT A;  1YDD A;  5SZ3 A;  3RZ1 B;  4Q99 A;  5JDV B;  1RAY A;  4XIW A;  3F7B A;  4Q49 A;  1I9Q A;  2VVA X;  3N0N A;  3M5E A;  5LMD A;  1ZH9 A;  1FSR A;  2NXR A;  4MDG A;  5AMG A;  5SZ0 A;  2HFW A;  5BNL A;  4Z1E A;  4G7A A;  4Q06 A;  6CA2 A;  4KNN A;  1CNY A;  4G0C A;  3D0N A;  3RZ7 A;  3KON A;  1YO2 A;  4R59 A;  3OY0 A;  3FW3 A;  5DRS A;  1KWQ A;  4HU1 A;  3S9T A;  4L5W A;  3V3G B;  1G0E A;  2WD2 A;  2NWP A;  3EFI A;  3IGP A;  5EZT X;  3BL0 A;  3V7X A;  4LU3 A;  4RUZ A;  2OSM A;  3M96 A;  4YGN A;  1IF7 A;  4ZWZ A;  2OSF A;  3V5G A;  2X7T A;  5JES B;  1CNB A;  3DC9 A;  5CA2 A;  1G53 A;  3RYJ B;  3DV7 A;  3OIK A;  3M5T A;  1HEB A;  4PQ7 A;  1KOQ A;  5FLP A;  5G03 A;  4CNV A;  3V3F A;  3RYY A;  3W6H A;  2H15 A;  5E5U A;  1FR4 A;  1G1D A;  3K34 A;  2ABE A;  1RAZ A;  4HF3 A;  4MDL A;  1BZM A;  4E3H A;  3HS4 A;  3JXF A;  1KOP A;  4JSS A;  1AM6 A;  5EH5 A;  4BF6 A;  2FNK A;  1UGA A;  2EU2 A;  1BNQ A;  3SAP A;  1I9P A;  1ZE8 A;  3M2Z A;  5DSP A;  1I9O A;  3P58 A;  2F14 A;  5EHV A;  1UGB A;  5CJF A;  8CA2 A;  1UGD A;  2AW1 A;  3P44 A;  4Z0Q A;  4E3D A;  1DCB A;  3IAI A;  2H4N A;  3RYZ A;  2Q38 A;  4HEY A;  5JG5 B;  5FNJ A;  2WD3 A;  4WL4 A;  4FPT A;  5EH7 A;  3V2M A;  5DOH A;  5DSN A;  3U47 A;  1DMX A;  4JSA A;  3SBH A;  4K0S A;  3DA2 A;  4Q07 A;  1CAM A;  3DCW A;  4QJX A;  5E28 A;  4KNM A;  4FVN A;  3P5L A;  4YXO A;  3OIL A;  4DZ7 A;  1RZB A;  3S8X A;  4RN4 A;  1FLJ A;  1LGD A;  1BNU A;  3F8E A;  4JS6 A;  1UGG A;  4C3T A;  1OKM A;  4M2U A;  2O4Z A;  1CIN A;  4Q8Y A;  4R5B A;  1CAH A;  4ZAO A;  2POW A;  3DBU A;  2FMG A;  4QK2 A;  5FL4 A;  1EOU A;  3S74 B;  3N2P A;  4QK1 A;  5EOI A;  1KEQ A;  3NB5 A;  1XPZ A;  2ILI A;  1IF9 A;  1YDC A;  5HPJ A;  2AX2 A;  5E2M A;  4KNI A;  5SZ2 A;  5EH8 A;  4RH2 A;  2FW4 A;  1TTM A;  3HFP A;  3VBD A;  4YXI A;  2HOC A;  3DVB A;  1IF6 A;  1DCA A;  5EKM A;  4Q7S A;  4QSB A;  2WEO A;  2CA2 A;  4ETQ C;  3ML5 A;  5A6H A;  1FQN A;  1BNV A;  2NWY A;  1CVE A;  3KNE A;  3RYX B; 
#chains in the Genus database with same CATH homology
 4K0Z A;  4E5Q A;  4QSA A;  3P55 A;  4E49 A;  1CVF A;  3M1J A;  4KUV A;  3PJJ A;  3N3J A;  5FL6 A;  4YVY A;  1ZNC A;  4XFW A;  5DSK A;  4Z1N A;  1LG5 A;  4Q90 A;  3S72 B;  5DSM A;  1H9N A;  1ZGF A;  1CVC A;  2HD6 A;  4PYY A;  2POU A;  5JEP B;  3RZ8 A;  4LHI A;  4QJW A;  2CBD A;  1HCB A;  1Z97 A;  3D9Z A;  5DSL A;  5FDC A;  5J8Z A;  1TEQ X;  1ZGE A;  3W6I A;  1CAJ A;  2EU3 A;  3M1K A;  3N4B A;  4Q6E A;  4DZ9 A;  3MNK A;  1AVN A;  5E2K A;  5EHW A;  5SZ4 A;  3B4F A;  4Z1J A;  1BN4 A;  1LG6 A;  3T83 A;  3M04 A;  4KUY A;  3P3H A;  4CNW A;  3JXG A;  3M2N A;  4RFC A;  4CQ0 A;  1RZC A;  2WEJ A;  1CNH A;  1BNT A;  3MWO A;  5G0C A;  3RG3 A;  5A25 A;  7CA2 A;  1HVA A;  2NWO A;  3RGE A;  4Q87 A;  5SZ6 A;  1OKL A;  1URT A;  3P3J A;  4FVO A;  5DSR A;  1I8Z A;  1I9L A;  4K1Q A;  4YHA A;  5DSQ A;  4FU5 A;  1MUA A;  3M2Y A;  3MDZ A;  4ITO A;  1FR7 A;  1CVB A;  1BNN A;  1CAO A;  3DVC A;  5L3O A;  1JD0 A;  3HKU A;  1KWR A;  3M1W A;  4RFD A;  4K13 A;  4QIZ A;  5SZ5 A;  3MYQ A;  4Q7P A;  4ZWX A;  3T5U A;  1A42 A;  3S75 B;  4WR7 A;  1V9I C;  5JGT B;  3NJ9 A;  3KIG A;  3RZ5 A;  4XZ5 A;  1XEG A;  1TB0 X;  4FL7 A;  4WW8 A;  3KS3 A;  1RZD A;  3KOI A;  4KP8 A;  2NNS A;  4QIY A;  3U7C A;  4QJO A;  3S76 A;  5DSJ A;  5C8I A;  3T5Z A;  4N0X B;  4YX4 A;  1CNJ A;  3IBI A;  3KLD B;  4ITP A;  4BF1 A;  4K0T A;  3T85 A;  1G46 A;  1ZSC A;  1CAI A;  1JCZ A;  1THK A;  3MNU A;  5JEG B;  1G0F A;  1RJ6 A;  2WEH A;  4CNR A;  3R17 B;  4BCW A;  2CBA A;  1I90 A;  1I9N A;  3PYK A;  5CAC A;  4COQ A;  1CAY A;  1XEV A;  3IBU A;  4TWL A;  4ZWI A;  3CAJ A;  1HEA A;  3P4V A;  3F7U A;  2WEG A;  1G52 A;  2NNO A;  1UGF A;  3KOK A;  5EKJ A;  2W2J A;  3DCC A;  4KUW A;  3DCS A;  1CNI A;  2NMX A;  3MHM A;  2FNM A;  1G4O A;  4YXU A;  3MHO A;  1G45 A;  4ZWY A;  1FQL A;  1XQ0 A;  1BV3 A;  1Z9Y A;  2QP6 A;  4JSZ A;  1Y7W A;  2QO8 A;  1FQR A;  4MLT A;  5FNI A;  3R16 A;  4ZX1 A;  2NWZ A;  4X5S A;  1AZM A;  4WW6 A;  3S78 B;  5AMD A;  1FQM A;  1ZSA A;  2FNN A;  2CBB A;  2CBC A;  4HT0 A;  2FOY A;  3Q31 A;  5EHE A;  1HEC A;  2FOV A;  3JXH C;  4M2W A;  1TEU X;  3RYV B;  2IT4 A;  3QYK A;  5L6K A;  4QSI A;  4RIU A;  4MTY A;  1ZFQ A;  1TG3 A;  1DMY A;  3K2F A;  3DD0 A;  2Q1Q A;  3D93 A;  3V3J A;  1LZV A;  2X7U A;  4QJ0 A;  5FLS A;  1BNM A;  9CA2 A;  2X7S A;  3RZ0 B;  3MNA A;  5FNL A;  2FOS A;  3B1B A;  3CZV A;  1Z93 A;  2NNV A;  3SAX A;  3ZP9 A;  5FNH A;  2POV A;  3HKT A;  3ML2 A;  1F2W A;  1CRM A;  3UYQ A;  12CA A;  3NI5 A;  1IF5 A;  3FE4 A;  5FLT A;  4YWP A;  5DSO A;  4HBA A;  2FMZ A;  2NXS A;  1CA3 A;  1CAN A;  1CNG A;  4ILX A;  4KP5 A;  5JQT A;  3U45 X;  1CIL A;  4L5U A;  1YO0 A;  3T82 A;  4CAC A;  4Q7W A;  1CCT A;  4RUX A;  2HKK A;  5SZ7 A;  2NXT A;  1HED A;  1UGE A;  4KV0 A;  4Q6D A;  5FLQ A;  3F4X A;  4LP6 A;  3GZ0 A;  4HEW A;  5G01 A;  1LUG A;  3OKU A;  3OKV A;  3P5A A;  1G6V A;  4Q0L A;  2FOU A;  2HNC A;  3OIM A;  2GD8 A;  1G4J A;  4XIX A;  1HUG A;  1TH9 A;  3S71 B;  4YYT A;  3S77 B;  1CNC A;  3M98 A;  5BRU A;  3IBL A;  1BN3 A;  4FRC A;  2VVB X;  4PYX A;  1CA2 A;  3MHC A;  3D8W A;  2NN1 A;  1TG9 A;  3MHL A;  2GEH A;  3PO6 A;  4TWM A;  5E5R A;  4QEF A;  4Q9Y A;  4QSJ A;  4HEZ A;  3M2X A;  2ZNC A;  4FIK A;  3MNH A;  3BL1 A;  1RZE A;  5EKH A;  4E3G A;  2HL4 A;  1BCD A;  3M1Q A;  5FLO A;  3RJ7 A;  1CVA A;  4Q83 A;  4CNX A;  5IPZ A;  1J9W A;  3S97 A;  1T9N A;  3M5S A;  1TE3 X;  5JQ0 A;  1CVH A;  3K7K A;  4KNJ A;  4MDM A;  4MLX A;  3TMJ A;  3V3H B;  4Q08 A;  4QJP A;  3M3X A;  2FOQ A;  3MNJ A;  1CAK A;  5BRW A;  3HKN A;  3TVO X;  4PXX A;  4KAP A;  4R5A A;  3SBI A;  3S73 B;  4IWZ A;  3UYN A;  1HUH A;  4UOV A;  3V3I B;  5FDI A;  4Q78 A;  4WUP A;  4WUQ A;  4E9O X;  4GL1 X;  5BRV A;  2Q1B A;  5G0B A;  1CIM A;  4M2R A;  3V2J A;  3CYU A;  5JGS B;  5E2R A;  3D92 A;  1RZA A;  4HT2 A;  3HLJ A;  1OQ5 A;  5FNM A;  3M40 A;  1TBT X;  4YGJ A;  3DC3 A;  4Z1K A;  1CVD A;  1FSN A;  5DSI A;  1UGC A;  3DAZ A;  4E4A A;  3RG4 A;  4JSW A;  1CZM A;  3LXE A;  4MO8 A;  1YO1 A;  3IEO A;  5BYI A;  1YDB A;  5FLR A;  3HKQ A;  1OKN A;  4M2V A;  4QJM A;  3BET A;  3KKX A;  5E2N A;  3ZNC A;  3OYS A;  3CA2 A;  4YGL A;  3KWA A;  3IBN A;  1CRA A;  3MHI A;  3MNI A;  4IDR X;  1ZFK A;  5JEH B;  2NN7 A;  4QK3 A;  4Q09 A;  4Q8X A;  4E3F A;  5DVX A;  1CNW A;  1MOO A;  5E2S A;  4ZX0 A;  5EIJ A;  4YGK A;  3MMF A;  1JV0 A;  4QTL A;  1BN1 A;  4PZH A;  4YGF A;  4Q8Z A;  1CNX A;  1IF8 A;  3DD8 A;  3OYQ A;  5FL5 A;  3C7P A;  3L14 A;  3T84 A;  1BNW A;  1HCA A;  2QOA A;  3M14 A;  2CBE A;  3MZC A;  5FNG A;  4QY3 A;  4Q7V A;  1FSQ A;  3M67 A;  4CA2 A;  4XE1 A;  4N16 A;  5FNK A;  1CAL A;  1G3Z A;  1IF4 A;  1G48 A;  3TVN X;  4RUY A;  1CCU A;  4Y0J A;  1V9E A;  3RLD A;  1BIC A;  1I91 A;  1H9Q A;  2CAB A;  4Q81 A;  4RIV A;  3U3A X;  5CLU A;  5AML A;  2EZ7 A;  5SZ1 A;  3DVD A;  5DOG A;  1CAZ A;  1H4N A;  1G54 A;  1ZSB A;  3FFP X;  1CCS A;  2NNG A;  1CNK A;  4L5V A;  1RJ5 A;  1I9M A;  5JG3 B;  1YDA A;  3EFT A;  1YDD A;  5SZ3 A;  3RZ1 B;  4Q99 A;  5JDV B;  1RAY A;  4XIW A;  3F7B A;  4Q49 A;  1I9Q A;  2VVA X;  3N0N A;  3M5E A;  5LMD A;  1ZH9 A;  1FSR A;  2NXR A;  4MDG A;  5AMG A;  5SZ0 A;  2HFW A;  5BNL A;  4Z1E A;  4G7A A;  4Q06 A;  6CA2 A;  4KNN A;  1CNY A;  4G0C A;  3D0N A;  3RZ7 A;  3KON A;  1YO2 A;  4R59 A;  3OY0 A;  3FW3 A;  5DRS A;  1KWQ A;  4HU1 A;  3S9T A;  4L5W A;  3V3G B;  1G0E A;  2WD2 A;  2NWP A;  3EFI A;  3IGP A;  5EZT X;  3BL0 A;  3V7X A;  4LU3 A;  4RUZ A;  2OSM A;  3M96 A;  4YGN A;  1IF7 A;  4ZWZ A;  2OSF A;  3V5G A;  2X7T A;  5JES B;  1CNB A;  3DC9 A;  5CA2 A;  1G53 A;  3RYJ B;  3DV7 A;  3OIK A;  3M5T A;  1HEB A;  4PQ7 A;  1KOQ A;  5FLP A;  5G03 A;  4CNV A;  3V3F A;  3RYY A;  3W6H A;  2H15 A;  5E5U A;  1FR4 A;  1G1D A;  3K34 A;  2ABE A;  1RAZ A;  4HF3 A;  4MDL A;  1BZM A;  4E3H A;  3HS4 A;  3JXF A;  1KOP A;  4JSS A;  1AM6 A;  5EH5 A;  4BF6 A;  2FNK A;  1UGA A;  2EU2 A;  1BNQ A;  3SAP A;  1I9P A;  1ZE8 A;  3M2Z A;  5DSP A;  1I9O A;  3P58 A;  2F14 A;  5EHV A;  1UGB A;  5CJF A;  8CA2 A;  1UGD A;  2AW1 A;  3P44 A;  4Z0Q A;  4E3D A;  1DCB A;  3IAI A;  2H4N A;  3RYZ A;  2Q38 A;  4HEY A;  5JG5 B;  5FNJ A;  2WD3 A;  4WL4 A;  4FPT A;  5EH7 A;  3V2M A;  5DOH A;  5DSN A;  3U47 A;  1DMX A;  4JSA A;  3SBH A;  4K0S A;  3DA2 A;  4Q07 A;  1CAM A;  3DCW A;  4QJX A;  5E28 A;  4KNM A;  4FVN A;  3P5L A;  4YXO A;  3OIL A;  4DZ7 A;  1RZB A;  3S8X A;  4RN4 A;  1FLJ A;  1LGD A;  1BNU A;  3F8E A;  4JS6 A;  1UGG A;  4C3T A;  1OKM A;  4M2U A;  2O4Z A;  1CIN A;  4Q8Y A;  4R5B A;  1CAH A;  4ZAO A;  2POW A;  3DBU A;  2FMG A;  4QK2 A;  5FL4 A;  1EOU A;  3S74 B;  3N2P A;  4QK1 A;  5EOI A;  1KEQ A;  3NB5 A;  1XPZ A;  2ILI A;  1IF9 A;  1YDC A;  5HPJ A;  2AX2 A;  5E2M A;  4KNI A;  5SZ2 A;  5EH8 A;  4RH2 A;  2FW4 A;  1TTM A;  3HFP A;  3VBD A;  4YXI A;  2HOC A;  3DVB A;  1IF6 A;  1DCA A;  5EKM A;  4Q7S A;  4QSB A;  2WEO A;  2CA2 A;  4ETQ C;  3ML5 A;  5A6H A;  1FQN A;  1BNV A;  2NWY A;  1CVE A;  3KNE A;  3RYX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...