4KNMA

Crystal structure of human carbonic anhydrase isozyme xiii with 2-chloro-4-{[(4,6-dimethylpyrimidin-2-yl)sulfanyl]acetyl}benzenesulfonamide
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
Knots found
sequence length
259
structure length
259
Chain Sequence
LSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Carbonic anhydrase 13
publication title Benzenesulfonamides with pyrimidine moiety as inhibitors of human carbonic anhydrases I, II, VI, VII, XII, and XIII
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 259
sequence length 259
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 4knmA00
1BNTA 1FSQA 2FOVA 2IT4A 4QJMA 1FSNA 4CA2A 3C7PA 3KWAA 1CNWA 3PJJA 1TG3A 4FIKA 5JG3B 3S76A 3S74B 4Z0QA 1H9NA 5JESB 1G45A 4Q8YA 3NI5A 1RAZA 2NNSA 1RAYA 4L5VA 4ZAOA 4K0SA 3DCWA 3U45X 3S97A 1CVBA 5AMDA 2HNCA 3M40A 3FFPX 1G0EA 1LGDA 3K7KA 1RZBA 1YO1A 4Z1KA 3QYKA 2CBAA 3T5ZA 3CZVA 1DCAA 3P3JA 1FR4A 5DSKA 1IF7A 3M1QA 2NMXA 1G4OA 4YXIA 1CCTA 1Y7WA 3SBHA 3KLDB 4DZ7A 5C8IA 5E2RA 4Q78A 3S8XA 1CNBA 3CAJA 3ML2A 5EHVA 2POWA 1TEUX 5EKJA 3VBDA 5E5RA 4HF3A 2GD8A 4K13A 1UGFA 2VVAX 1CAMA 1I91A 3MHMA 3CA2A 3S9TA 5BNLA 1CCSA 3OYSA 1BZMA 4Y0JA 3ML5A 4HBAA 4TWLA 3IEOA 1G1DA 3M04A 4QSIA 3M1JA 3RYYA 2OSMA 1OKNA 1JD0A 3MNAA 1URTA 3MNKA 4MLXA 3DVDA 3IBUA 4XE1A 5EHWA 2HKKA 4LU3A 5FNIA 1I9LA 2ILIA 1EOUA 1KOQA 4QK2A 5E2MA 2AW1A 1CVCA 4E3GA 5DSJA 1CAIA 3MHCA 4ETQC 4RN4A 4DZ9A 4HEYA 3M1KA 4YGJA 4WL4A 1HVAA 1YDDA 2FNKA 3IAIA 3OYQA 3RG4A 5FDIA 4QEFA 3ZNCA 2CBBA 3K34A 1AZMA 1RZEA 2FOYA 4Q09A 2FOQA 1AVNA 1BNMA 3JXHC 2AX2A 1H4NA 3M2XA 3RZ5A 3SAPA 1ZH9A 4KAPA 3U7CA 1CVHA 3DD0A 1CAKA 3KNEA 2QOAA 2NXTA 3P5AA 4Q87A 3RZ1B 2NNOA 2ABEA 5EH5A 2F14A 4YGFA 4ITOA 4YGKA 2O4ZA 2CBCA 2NN1A 4QTLA 1CILA 3IBLA 4UOVA 5DSLA 4HEZA 5SZ1A 3KS3A 2EU2A 4YXOA 2FNMA 3M67A 1Z93A 2ZNCA 1BN1A 1CVDA 3P55A 1G53A 3F8EA 3MNHA 5L3OA 4KNNA 9CA2A 1G52A 4RH2A 1RJ6A 5SZ0A 1G54A 5FL4A 1BNUA 1CNKA 3F4XA 1CAYA 4K1QA 3RZ7A 1CRMA 4CQ0A 3OIMA 3V3HB 4KNJA 4E4AA 4PYXA 3CYUA 1FQRA 4HU1A 4YX4A 3UYNA 3BL0A 4X5SA 1YO2A 4Q06A 4RIVA 4XIXA 5DVXA 2OSFA 1G3ZA 4IDRX 5A25A 3HFPA 4TWMA 7CA2A 5DSOA 2Q1QA 5FDCA 1ZNCA 3P5LA 5G0BA 3RG3A 1CNGA 1BV3A 1HECA 3D93A 1YDCA 3N0NA 4QJXA 5AMGA 1BCDA 5FNKA 3SAXA 1XPZA 3P4VA 2NWZA 2FOSA 3P3HA 1G0FA 2VVBX 3KOIA 3RZ8A 1THKA 1Z97A 4G7AA 4KNIA 5E2KA 5FLTA 2NXRA 3U3AX 4Q6DA 1ZGEA 5E5UA 4M2UA 1ZFQA 2X7UA 5JQTA 1BNNA 1LUGA 4YVYA 2POUA 1BN3A 1I9MA 1KWRA 3L14A 4Q81A 5LMDA 3OIKA 4MO8A 1I9OA 3PYKA 4WR7A 3M3XA 5G0CA 5FNLA 4YYTA 2EU3A 3MYQA 1CAOA 5CLUA 4Z1EA 1MUAA 3M14A 5FLRA 2HL4A 3IBIA 5DSNA 3S71B 4E3HA 3HKUA 3U47A 4Q7PA 1G48A 3DC3A 4RUZA 3M98A 1UGDA 1G46A 2GEHA 4RUXA 3DA2A 5EKHA 4PQ7A 5SZ4A 1OKLA 4PXXA 3MNJA 3V2MA 4QJPA 4M2WA 4WW6A 4M2VA 1CNJA 3P58A 5EKMA 3V2JA 1FQLA 1ZSCA 1CNHA 1RZDA 1BNWA 1JV0A 1HUGA 3HKNA 2FOUA 5BYIA 4E9OX 3TVNX 1HCAA 4QY3A 5JEPB 5EHEA 3HKTA 3Q31A 3R16A 2FMGA 3V3JA 12CAA 5FLQA 4MLTA 5DOGA 4FVNA 3MMFA 3R17B 5G01A 2NWPA 4LHIA 3RLDA 4MTYA 4QSBA 1FLJA 1CRAA 4RFCA 1Z9YA 1TEQX 4CNRA 1HEBA 4WUQA 1XEGA 3KOKA 5CJFA 1RZAA 3V3FA 5JGSB 5SZ3A 3FE4A 3KIGA 1CNYA 2FNNA 4G0CA 5CACA 5JG5B 3DBUA 1TB0X 1OKMA 1CCUA 1FQMA 3BL1A 2Q38A 3S75B 1LG5A 4N16A 4PYYA 5DSIA 4IWZA 5FL6A 1J9WA 4QK1A 5FNGA 4HT2A 1XEVA 4CACA 3DCCA 4Q08A 3RYZA 1I9QA 1YDBA 5HPJA 3M2YA 3RJ7A 2FW4A 2NWOA 5FNJA 1I9PA 1TBTX 1TG9A 4QSAA 3HS4A 5DRSA 1DMYA 3S73B 4FPTA 3S77B 1HCBA 3D0NA 1BICA 3K2FA 3MWOA 2WEHA 4Q07A 2HD6A 3RZ0B 3T83A 1TE3X 3B4FA 4BCWA 4Z1NA 3D92A 3V5GA 1I9NA 4R5BA 4Q90A 5FLPA 3DVCA 4L5WA 4WUPA 4Q0LA 2X7TA 5EH7A 2WEJA 1KOPA 2W2JA 1CNIA 4YWPA 3FW3A 2EZ7A 1HUHA 4XFWA 1CVFA 4JS6A 4K0ZA 4QJ0A 1JCZA 3HKQA 3N2PA 3DAZA 4JSWA 4JSZA 3JXFA 5FLSA 4QK3A 4YGLA 2FMZA 3MHOA 4QSJA 3NJ9A 2WD2A 3M5SA 3MNUA 5JEHB 3IGPA 3P44A 4RUYA 5AMLA 3RYJB 1F2WA 1LZVA 4GL1X 5SZ7A 5E28A 4PZHA 4COQA 5JEGB 4MDGA 3N4BA 1CALA 4FVOA 4HEWA 4KUWA 1ZSAA 4E5QA 1RJ5A 4FRCA 2NNGA 4KUVA 4Q7SA 5DSQA 1ZSBA 3HLJA 5L6KA 2WEOA 4YXUA 2NXSA 1CAHA 3M2ZA 4E3FA 2CBDA 5BRUA 1KEQA 3DCSA 5A6HA 5E2NA 3MZCA 4Q49A 1CVAA 4MDLA 5JQ0A 3T85A 4Q7VA 2HOCA 5DSMA 4Q8ZA 1CANA 4XZ5A 4HT0A 5JDVB 4CNXA 2NNVA 1CA2A 5IPZA 4ZX0A 5EH8A 3TVOX 3MNIA 5E2SA 4RIUA 3DC9A 4XIWA 8CA2A 4ZX1A 5SZ6A 2CA2A 4KP8A 4QIYA 3GZ0A 4K0TA 5DOHA 1TH9A 3M1WA 1V9EA 5FNHA 4BF1A 1I8ZA 1I90A 1ZGFA 3OILA 4E49A 4KP5A 5JGTB 4C3TA 4ZWXA 1FQNA 1IF4A 3KONA 4CNWA 1CAJA 5CA2A 3RYXB 4N0XB 3N3JA 5DSRA 5SZ5A 5EOIA 3OY0A 2QO8A 2X7SA 4KNMA 3TMJA 1H9QA 1UGEA 4FL7A 4R5AA 1G6VA 3DVBA 3NB5A 2NN7A 2POVA 3M5EA 1XQ0A 1RZCA 4M2RA 1HEAA 5J8ZA 1OQ5A 4L5UA 1CNCA 3T5UA 1V9IC 2CBEA 5FNMA 5EIJA 4KV0A 1DCBA 3UYQA 4YHAA 2HFWA 4R59A 1CIMA 4E3DA 4CNVA 3F7UA 1TTMA 3LXEA 1YDAA 1CAZA 3DD8A 5BRWA 4ZWIA 1CINA 3D8WA 1AM6A 1CZMA 1YO0A 4BF6A 4ZWZA 1FR7A 4JSSA 4Q9YA 3W6HA 4ZWYA 3V3IB 4Q8XA 2WD3A 5EZTX 3W6IA 3DV7A 4WW8A 1UGBA 3MHLA 3S72B 2H4NA 3KKXA 1FSRA 5BRVA 3PO6A 3M96A 4LP6A 3S78B 4Q7WA 1IF9A 3MHIA 1BNVA 3F7BA 2CABA 3M2NA 3OKVA 3V3GB 1MOOA 3B1BA 1ZE8A 4FU5A 2WEGA 5FLOA 5SZ2A 1LG6A 1CA3A 4ITPA 1BNQA 1IF8A 3IBNA 4Z1JA 1G4JA 3RGEA 3EFTA 3V7XA 4QJWA 1T9NA 3BETA 4Q6EA 4MDMA 4QIZA 2H15A 4Q83A 4RFDA 1CNXA 3EFIA 1HEDA 3OKUA 3RYVB 1BN4A 1CVEA 1IF5A 4ILXA 5FL5A 1KWQA 3D9ZA 4QJOA 5DSPA 3ZP9A 3SBIA 6CA2A 1DMXA 4JSAA 3MDZA 2NWYA 1IF6A 1UGCA 4KUYA 1A42A 1ZFKA 2QP6A 3T82A 2Q1BA 3T84A 3M5TA 4YGNA 1UGAA 4Q99A 5G03A 1UGGA 3JXGA
chains in the Genus database with same CATH superfamily
1BNTA 1FSQA 2FOVA 2IT4A 4QJMA 1FSNA 4CA2A 3C7PA 3KWAA 1CNWA 3PJJA 1TG3A 4FIKA 5JG3B 3S76A 3S74B 4Z0QA 1H9NA 5JESB 1G45A 4Q8YA 3NI5A 1RAZA 2NNSA 1RAYA 4L5VA 4ZAOA 4K0SA 3DCWA 3U45X 3S97A 1CVBA 5AMDA 2HNCA 3M40A 3FFPX 1G0EA 1LGDA 3K7KA 1RZBA 1YO1A 4Z1KA 3QYKA 2CBAA 3T5ZA 3CZVA 1DCAA 3P3JA 1FR4A 5DSKA 1IF7A 3M1QA 2NMXA 1G4OA 4YXIA 1CCTA 1Y7WA 3SBHA 3KLDB 4DZ7A 5C8IA 5E2RA 4Q78A 3S8XA 1CNBA 3CAJA 3ML2A 5EHVA 2POWA 1TEUX 5EKJA 3VBDA 5E5RA 4HF3A 2GD8A 4K13A 1UGFA 2VVAX 1CAMA 1I91A 3MHMA 3CA2A 3S9TA 5BNLA 1CCSA 3OYSA 1BZMA 4Y0JA 3ML5A 4HBAA 4TWLA 3IEOA 1G1DA 3M04A 4QSIA 3M1JA 3RYYA 2OSMA 1OKNA 1JD0A 3MNAA 1URTA 3MNKA 4MLXA 3DVDA 3IBUA 4XE1A 5EHWA 2HKKA 4LU3A 5FNIA 1I9LA 2ILIA 1EOUA 1KOQA 4QK2A 5E2MA 2AW1A 1CVCA 4E3GA 5DSJA 1CAIA 3MHCA 4ETQC 4RN4A 4DZ9A 4HEYA 3M1KA 4YGJA 4WL4A 1HVAA 1YDDA 2FNKA 3IAIA 3OYQA 3RG4A 5FDIA 4QEFA 3ZNCA 2CBBA 3K34A 1AZMA 1RZEA 2FOYA 4Q09A 2FOQA 1AVNA 1BNMA 3JXHC 2AX2A 1H4NA 3M2XA 3RZ5A 3SAPA 1ZH9A 4KAPA 3U7CA 1CVHA 3DD0A 1CAKA 3KNEA 2QOAA 2NXTA 3P5AA 4Q87A 3RZ1B 2NNOA 2ABEA 5EH5A 2F14A 4YGFA 4ITOA 4YGKA 2O4ZA 2CBCA 2NN1A 4QTLA 1CILA 3IBLA 4UOVA 5DSLA 4HEZA 5SZ1A 3KS3A 2EU2A 4YXOA 2FNMA 3M67A 1Z93A 2ZNCA 1BN1A 1CVDA 3P55A 1G53A 3F8EA 3MNHA 5L3OA 4KNNA 9CA2A 1G52A 4RH2A 1RJ6A 5SZ0A 1G54A 5FL4A 1BNUA 1CNKA 3F4XA 1CAYA 4K1QA 3RZ7A 1CRMA 4CQ0A 3OIMA 3V3HB 4KNJA 4E4AA 4PYXA 3CYUA 1FQRA 4HU1A 4YX4A 3UYNA 3BL0A 4X5SA 1YO2A 4Q06A 4RIVA 4XIXA 5DVXA 2OSFA 1G3ZA 4IDRX 5A25A 3HFPA 4TWMA 7CA2A 5DSOA 2Q1QA 5FDCA 1ZNCA 3P5LA 5G0BA 3RG3A 1CNGA 1BV3A 1HECA 3D93A 1YDCA 3N0NA 4QJXA 5AMGA 1BCDA 5FNKA 3SAXA 1XPZA 3P4VA 2NWZA 2FOSA 3P3HA 1G0FA 2VVBX 3KOIA 3RZ8A 1THKA 1Z97A 4G7AA 4KNIA 5E2KA 5FLTA 2NXRA 3U3AX 4Q6DA 1ZGEA 5E5UA 4M2UA 1ZFQA 2X7UA 5JQTA 1BNNA 1LUGA 4YVYA 2POUA 1BN3A 1I9MA 1KWRA 3L14A 4Q81A 5LMDA 3OIKA 4MO8A 1I9OA 3PYKA 4WR7A 3M3XA 5G0CA 5FNLA 4YYTA 2EU3A 3MYQA 1CAOA 5CLUA 4Z1EA 1MUAA 3M14A 5FLRA 2HL4A 3IBIA 5DSNA 3S71B 4E3HA 3HKUA 3U47A 4Q7PA 1G48A 3DC3A 4RUZA 3M98A 1UGDA 1G46A 2GEHA 4RUXA 3DA2A 5EKHA 4PQ7A 5SZ4A 1OKLA 4PXXA 3MNJA 3V2MA 4QJPA 4M2WA 4WW6A 4M2VA 1CNJA 3P58A 5EKMA 3V2JA 1FQLA 1ZSCA 1CNHA 1RZDA 1BNWA 1JV0A 1HUGA 3HKNA 2FOUA 5BYIA 4E9OX 3TVNX 1HCAA 4QY3A 5JEPB 5EHEA 3HKTA 3Q31A 3R16A 2FMGA 3V3JA 12CAA 5FLQA 4MLTA 5DOGA 4FVNA 3MMFA 3R17B 5G01A 2NWPA 4LHIA 3RLDA 4MTYA 4QSBA 1FLJA 1CRAA 4RFCA 1Z9YA 1TEQX 4CNRA 1HEBA 4WUQA 1XEGA 3KOKA 5CJFA 1RZAA 3V3FA 5JGSB 5SZ3A 3FE4A 3KIGA 1CNYA 2FNNA 4G0CA 5CACA 5JG5B 3DBUA 1TB0X 1OKMA 1CCUA 1FQMA 3BL1A 2Q38A 3S75B 1LG5A 4N16A 4PYYA 5DSIA 4IWZA 5FL6A 1J9WA 4QK1A 5FNGA 4HT2A 1XEVA 4CACA 3DCCA 4Q08A 3RYZA 1I9QA 1YDBA 5HPJA 3M2YA 3RJ7A 2FW4A 2NWOA 5FNJA 1I9PA 1TBTX 1TG9A 4QSAA 3HS4A 5DRSA 1DMYA 3S73B 4FPTA 3S77B 1HCBA 3D0NA 1BICA 3K2FA 3MWOA 2WEHA 4Q07A 2HD6A 3RZ0B 3T83A 1TE3X 3B4FA 4BCWA 4Z1NA 3D92A 3V5GA 1I9NA 4R5BA 4Q90A 5FLPA 3DVCA 4L5WA 4WUPA 4Q0LA 2X7TA 5EH7A 2WEJA 1KOPA 2W2JA 1CNIA 4YWPA 3FW3A 2EZ7A 1HUHA 4XFWA 1CVFA 4JS6A 4K0ZA 4QJ0A 1JCZA 3HKQA 3N2PA 3DAZA 4JSWA 4JSZA 3JXFA 5FLSA 4QK3A 4YGLA 2FMZA 3MHOA 4QSJA 3NJ9A 2WD2A 3M5SA 3MNUA 5JEHB 3IGPA 3P44A 4RUYA 5AMLA 3RYJB 1F2WA 1LZVA 4GL1X 5SZ7A 5E28A 4PZHA 4COQA 5JEGB 4MDGA 3N4BA 1CALA 4FVOA 4HEWA 4KUWA 1ZSAA 4E5QA 1RJ5A 4FRCA 2NNGA 4KUVA 4Q7SA 5DSQA 1ZSBA 3HLJA 5L6KA 2WEOA 4YXUA 2NXSA 1CAHA 3M2ZA 4E3FA 2CBDA 5BRUA 1KEQA 3DCSA 5A6HA 5E2NA 3MZCA 4Q49A 1CVAA 4MDLA 5JQ0A 3T85A 4Q7VA 2HOCA 5DSMA 4Q8ZA 1CANA 4XZ5A 4HT0A 5JDVB 4CNXA 2NNVA 1CA2A 5IPZA 4ZX0A 5EH8A 3TVOX 3MNIA 5E2SA 4RIUA 3DC9A 4XIWA 8CA2A 4ZX1A 5SZ6A 2CA2A 4KP8A 4QIYA 3GZ0A 4K0TA 5DOHA 1TH9A 3M1WA 1V9EA 5FNHA 4BF1A 1I8ZA 1I90A 1ZGFA 3OILA 4E49A 4KP5A 5JGTB 4C3TA 4ZWXA 1FQNA 1IF4A 3KONA 4CNWA 1CAJA 5CA2A 3RYXB 4N0XB 3N3JA 5DSRA 5SZ5A 5EOIA 3OY0A 2QO8A 2X7SA 4KNMA 3TMJA 1H9QA 1UGEA 4FL7A 4R5AA 1G6VA 3DVBA 3NB5A 2NN7A 2POVA 3M5EA 1XQ0A 1RZCA 4M2RA 1HEAA 5J8ZA 1OQ5A 4L5UA 1CNCA 3T5UA 1V9IC 2CBEA 5FNMA 5EIJA 4KV0A 1DCBA 3UYQA 4YHAA 2HFWA 4R59A 1CIMA 4E3DA 4CNVA 3F7UA 1TTMA 3LXEA 1YDAA 1CAZA 3DD8A 5BRWA 4ZWIA 1CINA 3D8WA 1AM6A 1CZMA 1YO0A 4BF6A 4ZWZA 1FR7A 4JSSA 4Q9YA 3W6HA 4ZWYA 3V3IB 4Q8XA 2WD3A 5EZTX 3W6IA 3DV7A 4WW8A 1UGBA 3MHLA 3S72B 2H4NA 3KKXA 1FSRA 5BRVA 3PO6A 3M96A 4LP6A 3S78B 4Q7WA 1IF9A 3MHIA 1BNVA 3F7BA 2CABA 3M2NA 3OKVA 3V3GB 1MOOA 3B1BA 1ZE8A 4FU5A 2WEGA 5FLOA 5SZ2A 1LG6A 1CA3A 4ITPA 1BNQA 1IF8A 3IBNA 4Z1JA 1G4JA 3RGEA 3EFTA 3V7XA 4QJWA 1T9NA 3BETA 4Q6EA 4MDMA 4QIZA 2H15A 4Q83A 4RFDA 1CNXA 3EFIA 1HEDA 3OKUA 3RYVB 1BN4A 1CVEA 1IF5A 4ILXA 5FL5A 1KWQA 3D9ZA 4QJOA 5DSPA 3ZP9A 3SBIA 6CA2A 1DMXA 4JSAA 3MDZA 2NWYA 1IF6A 1UGCA 4KUYA 1A42A 1ZFKA 2QP6A 3T82A 2Q1BA 3T84A 3M5TA 4YGNA 1UGAA 4Q99A 5G03A 1UGGA 3JXGA
chains in the Genus database with same CATH topology
1BNTA 1FSQA 2FOVA 2IT4A 4QJMA 1FSNA 4CA2A 3C7PA 3KWAA 1CNWA 3PJJA 1TG3A 4FIKA 5JG3B 3S76A 3S74B 4Z0QA 1H9NA 5JESB 1G45A 4Q8YA 3NI5A 1RAZA 2NNSA 1RAYA 4L5VA 4ZAOA 4K0SA 3DCWA 3U45X 3S97A 1CVBA 5AMDA 2HNCA 3M40A 3FFPX 1G0EA 1LGDA 3K7KA 1RZBA 1YO1A 4Z1KA 3QYKA 2CBAA 3T5ZA 3CZVA 1DCAA 3P3JA 1FR4A 5DSKA 1IF7A 3M1QA 2NMXA 1G4OA 4YXIA 1CCTA 1Y7WA 3SBHA 3KLDB 4DZ7A 5C8IA 5E2RA 4Q78A 3S8XA 1CNBA 3CAJA 3ML2A 5EHVA 2POWA 1TEUX 5EKJA 3VBDA 5E5RA 4HF3A 2GD8A 4K13A 1UGFA 2VVAX 1CAMA 1I91A 3MHMA 3CA2A 3S9TA 5BNLA 1CCSA 3OYSA 1BZMA 4Y0JA 3ML5A 4HBAA 4TWLA 3IEOA 1G1DA 3M04A 4QSIA 3M1JA 3RYYA 2OSMA 1OKNA 1JD0A 3MNAA 1URTA 3MNKA 4MLXA 3DVDA 3IBUA 4XE1A 5EHWA 2HKKA 4LU3A 5FNIA 1I9LA 2ILIA 1EOUA 1KOQA 4QK2A 5E2MA 2AW1A 1CVCA 4E3GA 5DSJA 1CAIA 3MHCA 4ETQC 4RN4A 4DZ9A 4HEYA 3M1KA 4YGJA 4WL4A 1HVAA 1YDDA 2FNKA 3IAIA 3OYQA 3RG4A 5FDIA 4QEFA 3ZNCA 2CBBA 3K34A 1AZMA 1RZEA 2FOYA 4Q09A 2FOQA 1AVNA 1BNMA 3JXHC 2AX2A 1H4NA 3M2XA 3RZ5A 3SAPA 1ZH9A 4KAPA 3U7CA 1CVHA 3DD0A 1CAKA 3KNEA 2QOAA 2NXTA 3P5AA 4Q87A 3RZ1B 2NNOA 2ABEA 5EH5A 2F14A 4YGFA 4ITOA 4YGKA 2O4ZA 2CBCA 2NN1A 4QTLA 1CILA 3IBLA 4UOVA 5DSLA 4HEZA 5SZ1A 3KS3A 2EU2A 4YXOA 2FNMA 3M67A 1Z93A 2ZNCA 1BN1A 1CVDA 3P55A 1G53A 3F8EA 3MNHA 5L3OA 4KNNA 9CA2A 1G52A 4RH2A 1RJ6A 5SZ0A 1G54A 5FL4A 1BNUA 1CNKA 3F4XA 1CAYA 4K1QA 3RZ7A 1CRMA 4CQ0A 3OIMA 3V3HB 4KNJA 4E4AA 4PYXA 3CYUA 1FQRA 4HU1A 4YX4A 3UYNA 3BL0A 4X5SA 1YO2A 4Q06A 4RIVA 4XIXA 5DVXA 2OSFA 1G3ZA 4IDRX 5A25A 3HFPA 4TWMA 7CA2A 5DSOA 2Q1QA 5FDCA 1ZNCA 3P5LA 5G0BA 3RG3A 1CNGA 1BV3A 1HECA 3D93A 1YDCA 3N0NA 4QJXA 5AMGA 1BCDA 5FNKA 3SAXA 1XPZA 3P4VA 2NWZA 2FOSA 3P3HA 1G0FA 2VVBX 3KOIA 3RZ8A 1THKA 1Z97A 4G7AA 4KNIA 5E2KA 5FLTA 2NXRA 3U3AX 4Q6DA 1ZGEA 5E5UA 4M2UA 1ZFQA 2X7UA 5JQTA 1BNNA 1LUGA 4YVYA 2POUA 1BN3A 1I9MA 1KWRA 3L14A 4Q81A 5LMDA 3OIKA 4MO8A 1I9OA 3PYKA 4WR7A 3M3XA 5G0CA 5FNLA 4YYTA 2EU3A 3MYQA 1CAOA 5CLUA 4Z1EA 1MUAA 3M14A 5FLRA 2HL4A 3IBIA 5DSNA 3S71B 4E3HA 3HKUA 3U47A 4Q7PA 1G48A 3DC3A 4RUZA 3M98A 1UGDA 1G46A 2GEHA 4RUXA 3DA2A 5EKHA 4PQ7A 5SZ4A 1OKLA 4PXXA 3MNJA 3V2MA 4QJPA 4M2WA 4WW6A 4M2VA 1CNJA 3P58A 5EKMA 3V2JA 1FQLA 1ZSCA 1CNHA 1RZDA 1BNWA 1JV0A 1HUGA 3HKNA 2FOUA 5BYIA 4E9OX 3TVNX 1HCAA 4QY3A 5JEPB 5EHEA 3HKTA 3Q31A 3R16A 2FMGA 3V3JA 12CAA 5FLQA 4MLTA 5DOGA 4FVNA 3MMFA 3R17B 5G01A 2NWPA 4LHIA 3RLDA 4MTYA 4QSBA 1FLJA 1CRAA 4RFCA 1Z9YA 1TEQX 4CNRA 1HEBA 4WUQA 1XEGA 3KOKA 5CJFA 1RZAA 3V3FA 5JGSB 5SZ3A 3FE4A 3KIGA 1CNYA 2FNNA 4G0CA 5CACA 5JG5B 3DBUA 1TB0X 1OKMA 1CCUA 1FQMA 3BL1A 2Q38A 3S75B 1LG5A 4N16A 4PYYA 5DSIA 4IWZA 5FL6A 1J9WA 4QK1A 5FNGA 4HT2A 1XEVA 4CACA 3DCCA 4Q08A 3RYZA 1I9QA 1YDBA 5HPJA 3M2YA 3RJ7A 2FW4A 2NWOA 5FNJA 1I9PA 1TBTX 1TG9A 4QSAA 3HS4A 5DRSA 1DMYA 3S73B 4FPTA 3S77B 1HCBA 3D0NA 1BICA 3K2FA 3MWOA 2WEHA 4Q07A 2HD6A 3RZ0B 3T83A 1TE3X 3B4FA 4BCWA 4Z1NA 3D92A 3V5GA 1I9NA 4R5BA 4Q90A 5FLPA 3DVCA 4L5WA 4WUPA 4Q0LA 2X7TA 5EH7A 2WEJA 1KOPA 2W2JA 1CNIA 4YWPA 3FW3A 2EZ7A 1HUHA 4XFWA 1CVFA 4JS6A 4K0ZA 4QJ0A 1JCZA 3HKQA 3N2PA 3DAZA 4JSWA 4JSZA 3JXFA 5FLSA 4QK3A 4YGLA 2FMZA 3MHOA 4QSJA 3NJ9A 2WD2A 3M5SA 3MNUA 5JEHB 3IGPA 3P44A 4RUYA 5AMLA 3RYJB 1F2WA 1LZVA 4GL1X 5SZ7A 5E28A 4PZHA 4COQA 5JEGB 4MDGA 3N4BA 1CALA 4FVOA 4HEWA 4KUWA 1ZSAA 4E5QA 1RJ5A 4FRCA 2NNGA 4KUVA 4Q7SA 5DSQA 1ZSBA 3HLJA 5L6KA 2WEOA 4YXUA 2NXSA 1CAHA 3M2ZA 4E3FA 2CBDA 5BRUA 1KEQA 3DCSA 5A6HA 5E2NA 3MZCA 4Q49A 1CVAA 4MDLA 5JQ0A 3T85A 4Q7VA 2HOCA 5DSMA 4Q8ZA 1CANA 4XZ5A 4HT0A 5JDVB 4CNXA 2NNVA 1CA2A 5IPZA 4ZX0A 5EH8A 3TVOX 3MNIA 5E2SA 4RIUA 3DC9A 4XIWA 8CA2A 4ZX1A 5SZ6A 2CA2A 4KP8A 4QIYA 3GZ0A 4K0TA 5DOHA 1TH9A 3M1WA 1V9EA 5FNHA 4BF1A 1I8ZA 1I90A 1ZGFA 3OILA 4E49A 4KP5A 5JGTB 4C3TA 4ZWXA 1FQNA 1IF4A 3KONA 4CNWA 1CAJA 5CA2A 3RYXB 4N0XB 3N3JA 5DSRA 5SZ5A 5EOIA 3OY0A 2QO8A 2X7SA 4KNMA 3TMJA 1H9QA 1UGEA 4FL7A 4R5AA 1G6VA 3DVBA 3NB5A 2NN7A 2POVA 3M5EA 1XQ0A 1RZCA 4M2RA 1HEAA 5J8ZA 1OQ5A 4L5UA 1CNCA 3T5UA 1V9IC 2CBEA 5FNMA 5EIJA 4KV0A 1DCBA 3UYQA 4YHAA 2HFWA 4R59A 1CIMA 4E3DA 4CNVA 3F7UA 1TTMA 3LXEA 1YDAA 1CAZA 3DD8A 5BRWA 4ZWIA 1CINA 3D8WA 1AM6A 1CZMA 1YO0A 4BF6A 4ZWZA 1FR7A 4JSSA 4Q9YA 3W6HA 4ZWYA 3V3IB 4Q8XA 2WD3A 5EZTX 3W6IA 3DV7A 4WW8A 1UGBA 3MHLA 3S72B 2H4NA 3KKXA 1FSRA 5BRVA 3PO6A 3M96A 4LP6A 3S78B 4Q7WA 1IF9A 3MHIA 1BNVA 3F7BA 2CABA 3M2NA 3OKVA 3V3GB 1MOOA 3B1BA 1ZE8A 4FU5A 2WEGA 5FLOA 5SZ2A 1LG6A 1CA3A 4ITPA 1BNQA 1IF8A 3IBNA 4Z1JA 1G4JA 3RGEA 3EFTA 3V7XA 4QJWA 1T9NA 3BETA 4Q6EA 4MDMA 4QIZA 2H15A 4Q83A 4RFDA 1CNXA 3EFIA 1HEDA 3OKUA 3RYVB 1BN4A 1CVEA 1IF5A 4ILXA 5FL5A 1KWQA 3D9ZA 4QJOA 5DSPA 3ZP9A 3SBIA 6CA2A 1DMXA 4JSAA 3MDZA 2NWYA 1IF6A 1UGCA 4KUYA 1A42A 1ZFKA 2QP6A 3T82A 2Q1BA 3T84A 3M5TA 4YGNA 1UGAA 4Q99A 5G03A 1UGGA 3JXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNT A;  1FSQ A;  2FOV A;  2IT4 A;  4QJM A;  1FSN A;  4CA2 A;  3C7P A;  3KWA A;  1CNW A;  3PJJ A;  1TG3 A;  4FIK A;  5JG3 B;  3S76 A;  3S74 B;  4Z0Q A;  1H9N A;  5JES B;  1G45 A;  4Q8Y A;  3NI5 A;  1RAZ A;  2NNS A;  1RAY A;  4L5V A;  4ZAO A;  4K0S A;  3DCW A;  3U45 X;  3S97 A;  1CVB A;  5AMD A;  2HNC A;  3M40 A;  3FFP X;  1G0E A;  1LGD A;  3K7K A;  1RZB A;  1YO1 A;  4Z1K A;  3QYK A;  2CBA A;  3T5Z A;  3CZV A;  1DCA A;  3P3J A;  1FR4 A;  5DSK A;  1IF7 A;  3M1Q A;  2NMX A;  1G4O A;  4YXI A;  1CCT A;  1Y7W A;  3SBH A;  3KLD B;  4DZ7 A;  5C8I A;  5E2R A;  4Q78 A;  3S8X A;  1CNB A;  3CAJ A;  3ML2 A;  5EHV A;  2POW A;  1TEU X;  5EKJ A;  3VBD A;  5E5R A;  4HF3 A;  2GD8 A;  4K13 A;  1UGF A;  2VVA X;  1CAM A;  1I91 A;  3MHM A;  3CA2 A;  3S9T A;  5BNL A;  1CCS A;  3OYS A;  1BZM A;  4Y0J A;  3ML5 A;  4HBA A;  4TWL A;  3IEO A;  1G1D A;  3M04 A;  4QSI A;  3M1J A;  3RYY A;  2OSM A;  1OKN A;  1JD0 A;  3MNA A;  1URT A;  3MNK A;  4MLX A;  3DVD A;  3IBU A;  4XE1 A;  5EHW A;  2HKK A;  4LU3 A;  5FNI A;  1I9L A;  2ILI A;  1EOU A;  1KOQ A;  4QK2 A;  5E2M A;  2AW1 A;  1CVC A;  4E3G A;  5DSJ A;  1CAI A;  3MHC A;  4ETQ C;  4RN4 A;  4DZ9 A;  4HEY A;  3M1K A;  4YGJ A;  4WL4 A;  1HVA A;  1YDD A;  2FNK A;  3IAI A;  3OYQ A;  3RG4 A;  5FDI A;  4QEF A;  3ZNC A;  2CBB A;  3K34 A;  1AZM A;  1RZE A;  2FOY A;  4Q09 A;  2FOQ A;  1AVN A;  1BNM A;  3JXH C;  2AX2 A;  1H4N A;  3M2X A;  3RZ5 A;  3SAP A;  1ZH9 A;  4KAP A;  3U7C A;  1CVH A;  3DD0 A;  1CAK A;  3KNE A;  2QOA A;  2NXT A;  3P5A A;  4Q87 A;  3RZ1 B;  2NNO A;  2ABE A;  5EH5 A;  2F14 A;  4YGF A;  4ITO A;  4YGK A;  2O4Z A;  2CBC A;  2NN1 A;  4QTL A;  1CIL A;  3IBL A;  4UOV A;  5DSL A;  4HEZ A;  5SZ1 A;  3KS3 A;  2EU2 A;  4YXO A;  2FNM A;  3M67 A;  1Z93 A;  2ZNC A;  1BN1 A;  1CVD A;  3P55 A;  1G53 A;  3F8E A;  3MNH A;  5L3O A;  4KNN A;  9CA2 A;  1G52 A;  4RH2 A;  1RJ6 A;  5SZ0 A;  1G54 A;  5FL4 A;  1BNU A;  1CNK A;  3F4X A;  1CAY A;  4K1Q A;  3RZ7 A;  1CRM A;  4CQ0 A;  3OIM A;  3V3H B;  4KNJ A;  4E4A A;  4PYX A;  3CYU A;  1FQR A;  4HU1 A;  4YX4 A;  3UYN A;  3BL0 A;  4X5S A;  1YO2 A;  4Q06 A;  4RIV A;  4XIX A;  5DVX A;  2OSF A;  1G3Z A;  4IDR X;  5A25 A;  3HFP A;  4TWM A;  7CA2 A;  5DSO A;  2Q1Q A;  5FDC A;  1ZNC A;  3P5L A;  5G0B A;  3RG3 A;  1CNG A;  1BV3 A;  1HEC A;  3D93 A;  1YDC A;  3N0N A;  4QJX A;  5AMG A;  1BCD A;  5FNK A;  3SAX A;  1XPZ A;  3P4V A;  2NWZ A;  2FOS A;  3P3H A;  1G0F A;  2VVB X;  3KOI A;  3RZ8 A;  1THK A;  1Z97 A;  4G7A A;  4KNI A;  5E2K A;  5FLT A;  2NXR A;  3U3A X;  4Q6D A;  1ZGE A;  5E5U A;  4M2U A;  1ZFQ A;  2X7U A;  5JQT A;  1BNN A;  1LUG A;  4YVY A;  2POU A;  1BN3 A;  1I9M A;  1KWR A;  3L14 A;  4Q81 A;  5LMD A;  3OIK A;  4MO8 A;  1I9O A;  3PYK A;  4WR7 A;  3M3X A;  5G0C A;  5FNL A;  4YYT A;  2EU3 A;  3MYQ A;  1CAO A;  5CLU A;  4Z1E A;  1MUA A;  3M14 A;  5FLR A;  2HL4 A;  3IBI A;  5DSN A;  3S71 B;  4E3H A;  3HKU A;  3U47 A;  4Q7P A;  1G48 A;  3DC3 A;  4RUZ A;  3M98 A;  1UGD A;  1G46 A;  2GEH A;  4RUX A;  3DA2 A;  5EKH A;  4PQ7 A;  5SZ4 A;  1OKL A;  4PXX A;  3MNJ A;  3V2M A;  4QJP A;  4M2W A;  4WW6 A;  4M2V A;  1CNJ A;  3P58 A;  5EKM A;  3V2J A;  1FQL A;  1ZSC A;  1CNH A;  1RZD A;  1BNW A;  1JV0 A;  1HUG A;  3HKN A;  2FOU A;  5BYI A;  4E9O X;  3TVN X;  1HCA A;  4QY3 A;  5JEP B;  5EHE A;  3HKT A;  3Q31 A;  3R16 A;  2FMG A;  3V3J A;  12CA A;  5FLQ A;  4MLT A;  5DOG A;  4FVN A;  3MMF A;  3R17 B;  5G01 A;  2NWP A;  4LHI A;  3RLD A;  4MTY A;  4QSB A;  1FLJ A;  1CRA A;  4RFC A;  1Z9Y A;  1TEQ X;  4CNR A;  1HEB A;  4WUQ A;  1XEG A;  3KOK A;  5CJF A;  1RZA A;  3V3F A;  5JGS B;  5SZ3 A;  3FE4 A;  3KIG A;  1CNY A;  2FNN A;  4G0C A;  5CAC A;  5JG5 B;  3DBU A;  1TB0 X;  1OKM A;  1CCU A;  1FQM A;  3BL1 A;  2Q38 A;  3S75 B;  1LG5 A;  4N16 A;  4PYY A;  5DSI A;  4IWZ A;  5FL6 A;  1J9W A;  4QK1 A;  5FNG A;  4HT2 A;  1XEV A;  4CAC A;  3DCC A;  4Q08 A;  3RYZ A;  1I9Q A;  1YDB A;  5HPJ A;  3M2Y A;  3RJ7 A;  2FW4 A;  2NWO A;  5FNJ A;  1I9P A;  1TBT X;  1TG9 A;  4QSA A;  3HS4 A;  5DRS A;  1DMY A;  3S73 B;  4FPT A;  3S77 B;  1HCB A;  3D0N A;  1BIC A;  3K2F A;  3MWO A;  2WEH A;  4Q07 A;  2HD6 A;  3RZ0 B;  3T83 A;  1TE3 X;  3B4F A;  4BCW A;  4Z1N A;  3D92 A;  3V5G A;  1I9N A;  4R5B A;  4Q90 A;  5FLP A;  3DVC A;  4L5W A;  4WUP A;  4Q0L A;  2X7T A;  5EH7 A;  2WEJ A;  1KOP A;  2W2J A;  1CNI A;  4YWP A;  3FW3 A;  2EZ7 A;  1HUH A;  4XFW A;  1CVF A;  4JS6 A;  4K0Z A;  4QJ0 A;  1JCZ A;  3HKQ A;  3N2P A;  3DAZ A;  4JSW A;  4JSZ A;  3JXF A;  5FLS A;  4QK3 A;  4YGL A;  2FMZ A;  3MHO A;  4QSJ A;  3NJ9 A;  2WD2 A;  3M5S A;  3MNU A;  5JEH B;  3IGP A;  3P44 A;  4RUY A;  5AML A;  3RYJ B;  1F2W A;  1LZV A;  4GL1 X;  5SZ7 A;  5E28 A;  4PZH A;  4COQ A;  5JEG B;  4MDG A;  3N4B A;  1CAL A;  4FVO A;  4HEW A;  4KUW A;  1ZSA A;  4E5Q A;  1RJ5 A;  4FRC A;  2NNG A;  4KUV A;  4Q7S A;  5DSQ A;  1ZSB A;  3HLJ A;  5L6K A;  2WEO A;  4YXU A;  2NXS A;  1CAH A;  3M2Z A;  4E3F A;  2CBD A;  5BRU A;  1KEQ A;  3DCS A;  5A6H A;  5E2N A;  3MZC A;  4Q49 A;  1CVA A;  4MDL A;  5JQ0 A;  3T85 A;  4Q7V A;  2HOC A;  5DSM A;  4Q8Z A;  1CAN A;  4XZ5 A;  4HT0 A;  5JDV B;  4CNX A;  2NNV A;  1CA2 A;  5IPZ A;  4ZX0 A;  5EH8 A;  3TVO X;  3MNI A;  5E2S A;  4RIU A;  3DC9 A;  4XIW A;  8CA2 A;  4ZX1 A;  5SZ6 A;  2CA2 A;  4KP8 A;  4QIY A;  3GZ0 A;  4K0T A;  5DOH A;  1TH9 A;  3M1W A;  1V9E A;  5FNH A;  4BF1 A;  1I8Z A;  1I90 A;  1ZGF A;  3OIL A;  4E49 A;  4KP5 A;  5JGT B;  4C3T A;  4ZWX A;  1FQN A;  1IF4 A;  3KON A;  4CNW A;  1CAJ A;  5CA2 A;  3RYX B;  4N0X B;  3N3J A;  5DSR A;  5SZ5 A;  5EOI A;  3OY0 A;  2QO8 A;  2X7S A;  4KNM A;  3TMJ A;  1H9Q A;  1UGE A;  4FL7 A;  4R5A A;  1G6V A;  3DVB A;  3NB5 A;  2NN7 A;  2POV A;  3M5E A;  1XQ0 A;  1RZC A;  4M2R A;  1HEA A;  5J8Z A;  1OQ5 A;  4L5U A;  1CNC A;  3T5U A;  1V9I C;  2CBE A;  5FNM A;  5EIJ A;  4KV0 A;  1DCB A;  3UYQ A;  4YHA A;  2HFW A;  4R59 A;  1CIM A;  4E3D A;  4CNV A;  3F7U A;  1TTM A;  3LXE A;  1YDA A;  1CAZ A;  3DD8 A;  5BRW A;  4ZWI A;  1CIN A;  3D8W A;  1AM6 A;  1CZM A;  1YO0 A;  4BF6 A;  4ZWZ A;  1FR7 A;  4JSS A;  4Q9Y A;  3W6H A;  4ZWY A;  3V3I B;  4Q8X A;  2WD3 A;  5EZT X;  3W6I A;  3DV7 A;  4WW8 A;  1UGB A;  3MHL A;  3S72 B;  2H4N A;  3KKX A;  1FSR A;  5BRV A;  3PO6 A;  3M96 A;  4LP6 A;  3S78 B;  4Q7W A;  1IF9 A;  3MHI A;  1BNV A;  3F7B A;  2CAB A;  3M2N A;  3OKV A;  3V3G B;  1MOO A;  3B1B A;  1ZE8 A;  4FU5 A;  2WEG A;  5FLO A;  5SZ2 A;  1LG6 A;  1CA3 A;  4ITP A;  1BNQ A;  1IF8 A;  3IBN A;  4Z1J A;  1G4J A;  3RGE A;  3EFT A;  3V7X A;  4QJW A;  1T9N A;  3BET A;  4Q6E A;  4MDM A;  4QIZ A;  2H15 A;  4Q83 A;  4RFD A;  1CNX A;  3EFI A;  1HED A;  3OKU A;  3RYV B;  1BN4 A;  1CVE A;  1IF5 A;  4ILX A;  5FL5 A;  1KWQ A;  3D9Z A;  4QJO A;  5DSP A;  3ZP9 A;  3SBI A;  6CA2 A;  1DMX A;  4JSA A;  3MDZ A;  2NWY A;  1IF6 A;  1UGC A;  4KUY A;  1A42 A;  1ZFK A;  2QP6 A;  3T82 A;  2Q1B A;  3T84 A;  3M5T A;  4YGN A;  1UGA A;  4Q99 A;  5G03 A;  1UGG A;  3JXG A; 
#chains in the Genus database with same CATH topology
 1BNT A;  1FSQ A;  2FOV A;  2IT4 A;  4QJM A;  1FSN A;  4CA2 A;  3C7P A;  3KWA A;  1CNW A;  3PJJ A;  1TG3 A;  4FIK A;  5JG3 B;  3S76 A;  3S74 B;  4Z0Q A;  1H9N A;  5JES B;  1G45 A;  4Q8Y A;  3NI5 A;  1RAZ A;  2NNS A;  1RAY A;  4L5V A;  4ZAO A;  4K0S A;  3DCW A;  3U45 X;  3S97 A;  1CVB A;  5AMD A;  2HNC A;  3M40 A;  3FFP X;  1G0E A;  1LGD A;  3K7K A;  1RZB A;  1YO1 A;  4Z1K A;  3QYK A;  2CBA A;  3T5Z A;  3CZV A;  1DCA A;  3P3J A;  1FR4 A;  5DSK A;  1IF7 A;  3M1Q A;  2NMX A;  1G4O A;  4YXI A;  1CCT A;  1Y7W A;  3SBH A;  3KLD B;  4DZ7 A;  5C8I A;  5E2R A;  4Q78 A;  3S8X A;  1CNB A;  3CAJ A;  3ML2 A;  5EHV A;  2POW A;  1TEU X;  5EKJ A;  3VBD A;  5E5R A;  4HF3 A;  2GD8 A;  4K13 A;  1UGF A;  2VVA X;  1CAM A;  1I91 A;  3MHM A;  3CA2 A;  3S9T A;  5BNL A;  1CCS A;  3OYS A;  1BZM A;  4Y0J A;  3ML5 A;  4HBA A;  4TWL A;  3IEO A;  1G1D A;  3M04 A;  4QSI A;  3M1J A;  3RYY A;  2OSM A;  1OKN A;  1JD0 A;  3MNA A;  1URT A;  3MNK A;  4MLX A;  3DVD A;  3IBU A;  4XE1 A;  5EHW A;  2HKK A;  4LU3 A;  5FNI A;  1I9L A;  2ILI A;  1EOU A;  1KOQ A;  4QK2 A;  5E2M A;  2AW1 A;  1CVC A;  4E3G A;  5DSJ A;  1CAI A;  3MHC A;  4ETQ C;  4RN4 A;  4DZ9 A;  4HEY A;  3M1K A;  4YGJ A;  4WL4 A;  1HVA A;  1YDD A;  2FNK A;  3IAI A;  3OYQ A;  3RG4 A;  5FDI A;  4QEF A;  3ZNC A;  2CBB A;  3K34 A;  1AZM A;  1RZE A;  2FOY A;  4Q09 A;  2FOQ A;  1AVN A;  1BNM A;  3JXH C;  2AX2 A;  1H4N A;  3M2X A;  3RZ5 A;  3SAP A;  1ZH9 A;  4KAP A;  3U7C A;  1CVH A;  3DD0 A;  1CAK A;  3KNE A;  2QOA A;  2NXT A;  3P5A A;  4Q87 A;  3RZ1 B;  2NNO A;  2ABE A;  5EH5 A;  2F14 A;  4YGF A;  4ITO A;  4YGK A;  2O4Z A;  2CBC A;  2NN1 A;  4QTL A;  1CIL A;  3IBL A;  4UOV A;  5DSL A;  4HEZ A;  5SZ1 A;  3KS3 A;  2EU2 A;  4YXO A;  2FNM A;  3M67 A;  1Z93 A;  2ZNC A;  1BN1 A;  1CVD A;  3P55 A;  1G53 A;  3F8E A;  3MNH A;  5L3O A;  4KNN A;  9CA2 A;  1G52 A;  4RH2 A;  1RJ6 A;  5SZ0 A;  1G54 A;  5FL4 A;  1BNU A;  1CNK A;  3F4X A;  1CAY A;  4K1Q A;  3RZ7 A;  1CRM A;  4CQ0 A;  3OIM A;  3V3H B;  4KNJ A;  4E4A A;  4PYX A;  3CYU A;  1FQR A;  4HU1 A;  4YX4 A;  3UYN A;  3BL0 A;  4X5S A;  1YO2 A;  4Q06 A;  4RIV A;  4XIX A;  5DVX A;  2OSF A;  1G3Z A;  4IDR X;  5A25 A;  3HFP A;  4TWM A;  7CA2 A;  5DSO A;  2Q1Q A;  5FDC A;  1ZNC A;  3P5L A;  5G0B A;  3RG3 A;  1CNG A;  1BV3 A;  1HEC A;  3D93 A;  1YDC A;  3N0N A;  4QJX A;  5AMG A;  1BCD A;  5FNK A;  3SAX A;  1XPZ A;  3P4V A;  2NWZ A;  2FOS A;  3P3H A;  1G0F A;  2VVB X;  3KOI A;  3RZ8 A;  1THK A;  1Z97 A;  4G7A A;  4KNI A;  5E2K A;  5FLT A;  2NXR A;  3U3A X;  4Q6D A;  1ZGE A;  5E5U A;  4M2U A;  1ZFQ A;  2X7U A;  5JQT A;  1BNN A;  1LUG A;  4YVY A;  2POU A;  1BN3 A;  1I9M A;  1KWR A;  3L14 A;  4Q81 A;  5LMD A;  3OIK A;  4MO8 A;  1I9O A;  3PYK A;  4WR7 A;  3M3X A;  5G0C A;  5FNL A;  4YYT A;  2EU3 A;  3MYQ A;  1CAO A;  5CLU A;  4Z1E A;  1MUA A;  3M14 A;  5FLR A;  2HL4 A;  3IBI A;  5DSN A;  3S71 B;  4E3H A;  3HKU A;  3U47 A;  4Q7P A;  1G48 A;  3DC3 A;  4RUZ A;  3M98 A;  1UGD A;  1G46 A;  2GEH A;  4RUX A;  3DA2 A;  5EKH A;  4PQ7 A;  5SZ4 A;  1OKL A;  4PXX A;  3MNJ A;  3V2M A;  4QJP A;  4M2W A;  4WW6 A;  4M2V A;  1CNJ A;  3P58 A;  5EKM A;  3V2J A;  1FQL A;  1ZSC A;  1CNH A;  1RZD A;  1BNW A;  1JV0 A;  1HUG A;  3HKN A;  2FOU A;  5BYI A;  4E9O X;  3TVN X;  1HCA A;  4QY3 A;  5JEP B;  5EHE A;  3HKT A;  3Q31 A;  3R16 A;  2FMG A;  3V3J A;  12CA A;  5FLQ A;  4MLT A;  5DOG A;  4FVN A;  3MMF A;  3R17 B;  5G01 A;  2NWP A;  4LHI A;  3RLD A;  4MTY A;  4QSB A;  1FLJ A;  1CRA A;  4RFC A;  1Z9Y A;  1TEQ X;  4CNR A;  1HEB A;  4WUQ A;  1XEG A;  3KOK A;  5CJF A;  1RZA A;  3V3F A;  5JGS B;  5SZ3 A;  3FE4 A;  3KIG A;  1CNY A;  2FNN A;  4G0C A;  5CAC A;  5JG5 B;  3DBU A;  1TB0 X;  1OKM A;  1CCU A;  1FQM A;  3BL1 A;  2Q38 A;  3S75 B;  1LG5 A;  4N16 A;  4PYY A;  5DSI A;  4IWZ A;  5FL6 A;  1J9W A;  4QK1 A;  5FNG A;  4HT2 A;  1XEV A;  4CAC A;  3DCC A;  4Q08 A;  3RYZ A;  1I9Q A;  1YDB A;  5HPJ A;  3M2Y A;  3RJ7 A;  2FW4 A;  2NWO A;  5FNJ A;  1I9P A;  1TBT X;  1TG9 A;  4QSA A;  3HS4 A;  5DRS A;  1DMY A;  3S73 B;  4FPT A;  3S77 B;  1HCB A;  3D0N A;  1BIC A;  3K2F A;  3MWO A;  2WEH A;  4Q07 A;  2HD6 A;  3RZ0 B;  3T83 A;  1TE3 X;  3B4F A;  4BCW A;  4Z1N A;  3D92 A;  3V5G A;  1I9N A;  4R5B A;  4Q90 A;  5FLP A;  3DVC A;  4L5W A;  4WUP A;  4Q0L A;  2X7T A;  5EH7 A;  2WEJ A;  1KOP A;  2W2J A;  1CNI A;  4YWP A;  3FW3 A;  2EZ7 A;  1HUH A;  4XFW A;  1CVF A;  4JS6 A;  4K0Z A;  4QJ0 A;  1JCZ A;  3HKQ A;  3N2P A;  3DAZ A;  4JSW A;  4JSZ A;  3JXF A;  5FLS A;  4QK3 A;  4YGL A;  2FMZ A;  3MHO A;  4QSJ A;  3NJ9 A;  2WD2 A;  3M5S A;  3MNU A;  5JEH B;  3IGP A;  3P44 A;  4RUY A;  5AML A;  3RYJ B;  1F2W A;  1LZV A;  4GL1 X;  5SZ7 A;  5E28 A;  4PZH A;  4COQ A;  5JEG B;  4MDG A;  3N4B A;  1CAL A;  4FVO A;  4HEW A;  4KUW A;  1ZSA A;  4E5Q A;  1RJ5 A;  4FRC A;  2NNG A;  4KUV A;  4Q7S A;  5DSQ A;  1ZSB A;  3HLJ A;  5L6K A;  2WEO A;  4YXU A;  2NXS A;  1CAH A;  3M2Z A;  4E3F A;  2CBD A;  5BRU A;  1KEQ A;  3DCS A;  5A6H A;  5E2N A;  3MZC A;  4Q49 A;  1CVA A;  4MDL A;  5JQ0 A;  3T85 A;  4Q7V A;  2HOC A;  5DSM A;  4Q8Z A;  1CAN A;  4XZ5 A;  4HT0 A;  5JDV B;  4CNX A;  2NNV A;  1CA2 A;  5IPZ A;  4ZX0 A;  5EH8 A;  3TVO X;  3MNI A;  5E2S A;  4RIU A;  3DC9 A;  4XIW A;  8CA2 A;  4ZX1 A;  5SZ6 A;  2CA2 A;  4KP8 A;  4QIY A;  3GZ0 A;  4K0T A;  5DOH A;  1TH9 A;  3M1W A;  1V9E A;  5FNH A;  4BF1 A;  1I8Z A;  1I90 A;  1ZGF A;  3OIL A;  4E49 A;  4KP5 A;  5JGT B;  4C3T A;  4ZWX A;  1FQN A;  1IF4 A;  3KON A;  4CNW A;  1CAJ A;  5CA2 A;  3RYX B;  4N0X B;  3N3J A;  5DSR A;  5SZ5 A;  5EOI A;  3OY0 A;  2QO8 A;  2X7S A;  4KNM A;  3TMJ A;  1H9Q A;  1UGE A;  4FL7 A;  4R5A A;  1G6V A;  3DVB A;  3NB5 A;  2NN7 A;  2POV A;  3M5E A;  1XQ0 A;  1RZC A;  4M2R A;  1HEA A;  5J8Z A;  1OQ5 A;  4L5U A;  1CNC A;  3T5U A;  1V9I C;  2CBE A;  5FNM A;  5EIJ A;  4KV0 A;  1DCB A;  3UYQ A;  4YHA A;  2HFW A;  4R59 A;  1CIM A;  4E3D A;  4CNV A;  3F7U A;  1TTM A;  3LXE A;  1YDA A;  1CAZ A;  3DD8 A;  5BRW A;  4ZWI A;  1CIN A;  3D8W A;  1AM6 A;  1CZM A;  1YO0 A;  4BF6 A;  4ZWZ A;  1FR7 A;  4JSS A;  4Q9Y A;  3W6H A;  4ZWY A;  3V3I B;  4Q8X A;  2WD3 A;  5EZT X;  3W6I A;  3DV7 A;  4WW8 A;  1UGB A;  3MHL A;  3S72 B;  2H4N A;  3KKX A;  1FSR A;  5BRV A;  3PO6 A;  3M96 A;  4LP6 A;  3S78 B;  4Q7W A;  1IF9 A;  3MHI A;  1BNV A;  3F7B A;  2CAB A;  3M2N A;  3OKV A;  3V3G B;  1MOO A;  3B1B A;  1ZE8 A;  4FU5 A;  2WEG A;  5FLO A;  5SZ2 A;  1LG6 A;  1CA3 A;  4ITP A;  1BNQ A;  1IF8 A;  3IBN A;  4Z1J A;  1G4J A;  3RGE A;  3EFT A;  3V7X A;  4QJW A;  1T9N A;  3BET A;  4Q6E A;  4MDM A;  4QIZ A;  2H15 A;  4Q83 A;  4RFD A;  1CNX A;  3EFI A;  1HED A;  3OKU A;  3RYV B;  1BN4 A;  1CVE A;  1IF5 A;  4ILX A;  5FL5 A;  1KWQ A;  3D9Z A;  4QJO A;  5DSP A;  3ZP9 A;  3SBI A;  6CA2 A;  1DMX A;  4JSA A;  3MDZ A;  2NWY A;  1IF6 A;  1UGC A;  4KUY A;  1A42 A;  1ZFK A;  2QP6 A;  3T82 A;  2Q1B A;  3T84 A;  3M5T A;  4YGN A;  1UGA A;  4Q99 A;  5G03 A;  1UGG A;  3JXG A; 
#chains in the Genus database with same CATH homology
 1BNT A;  1FSQ A;  2FOV A;  2IT4 A;  4QJM A;  1FSN A;  4CA2 A;  3C7P A;  3KWA A;  1CNW A;  3PJJ A;  1TG3 A;  4FIK A;  5JG3 B;  3S76 A;  3S74 B;  4Z0Q A;  1H9N A;  5JES B;  1G45 A;  4Q8Y A;  3NI5 A;  1RAZ A;  2NNS A;  1RAY A;  4L5V A;  4ZAO A;  4K0S A;  3DCW A;  3U45 X;  3S97 A;  1CVB A;  5AMD A;  2HNC A;  3M40 A;  3FFP X;  1G0E A;  1LGD A;  3K7K A;  1RZB A;  1YO1 A;  4Z1K A;  3QYK A;  2CBA A;  3T5Z A;  3CZV A;  1DCA A;  3P3J A;  1FR4 A;  5DSK A;  1IF7 A;  3M1Q A;  2NMX A;  1G4O A;  4YXI A;  1CCT A;  1Y7W A;  3SBH A;  3KLD B;  4DZ7 A;  5C8I A;  5E2R A;  4Q78 A;  3S8X A;  1CNB A;  3CAJ A;  3ML2 A;  5EHV A;  2POW A;  1TEU X;  5EKJ A;  3VBD A;  5E5R A;  4HF3 A;  2GD8 A;  4K13 A;  1UGF A;  2VVA X;  1CAM A;  1I91 A;  3MHM A;  3CA2 A;  3S9T A;  5BNL A;  1CCS A;  3OYS A;  1BZM A;  4Y0J A;  3ML5 A;  4HBA A;  4TWL A;  3IEO A;  1G1D A;  3M04 A;  4QSI A;  3M1J A;  3RYY A;  2OSM A;  1OKN A;  1JD0 A;  3MNA A;  1URT A;  3MNK A;  4MLX A;  3DVD A;  3IBU A;  4XE1 A;  5EHW A;  2HKK A;  4LU3 A;  5FNI A;  1I9L A;  2ILI A;  1EOU A;  1KOQ A;  4QK2 A;  5E2M A;  2AW1 A;  1CVC A;  4E3G A;  5DSJ A;  1CAI A;  3MHC A;  4ETQ C;  4RN4 A;  4DZ9 A;  4HEY A;  3M1K A;  4YGJ A;  4WL4 A;  1HVA A;  1YDD A;  2FNK A;  3IAI A;  3OYQ A;  3RG4 A;  5FDI A;  4QEF A;  3ZNC A;  2CBB A;  3K34 A;  1AZM A;  1RZE A;  2FOY A;  4Q09 A;  2FOQ A;  1AVN A;  1BNM A;  3JXH C;  2AX2 A;  1H4N A;  3M2X A;  3RZ5 A;  3SAP A;  1ZH9 A;  4KAP A;  3U7C A;  1CVH A;  3DD0 A;  1CAK A;  3KNE A;  2QOA A;  2NXT A;  3P5A A;  4Q87 A;  3RZ1 B;  2NNO A;  2ABE A;  5EH5 A;  2F14 A;  4YGF A;  4ITO A;  4YGK A;  2O4Z A;  2CBC A;  2NN1 A;  4QTL A;  1CIL A;  3IBL A;  4UOV A;  5DSL A;  4HEZ A;  5SZ1 A;  3KS3 A;  2EU2 A;  4YXO A;  2FNM A;  3M67 A;  1Z93 A;  2ZNC A;  1BN1 A;  1CVD A;  3P55 A;  1G53 A;  3F8E A;  3MNH A;  5L3O A;  4KNN A;  9CA2 A;  1G52 A;  4RH2 A;  1RJ6 A;  5SZ0 A;  1G54 A;  5FL4 A;  1BNU A;  1CNK A;  3F4X A;  1CAY A;  4K1Q A;  3RZ7 A;  1CRM A;  4CQ0 A;  3OIM A;  3V3H B;  4KNJ A;  4E4A A;  4PYX A;  3CYU A;  1FQR A;  4HU1 A;  4YX4 A;  3UYN A;  3BL0 A;  4X5S A;  1YO2 A;  4Q06 A;  4RIV A;  4XIX A;  5DVX A;  2OSF A;  1G3Z A;  4IDR X;  5A25 A;  3HFP A;  4TWM A;  7CA2 A;  5DSO A;  2Q1Q A;  5FDC A;  1ZNC A;  3P5L A;  5G0B A;  3RG3 A;  1CNG A;  1BV3 A;  1HEC A;  3D93 A;  1YDC A;  3N0N A;  4QJX A;  5AMG A;  1BCD A;  5FNK A;  3SAX A;  1XPZ A;  3P4V A;  2NWZ A;  2FOS A;  3P3H A;  1G0F A;  2VVB X;  3KOI A;  3RZ8 A;  1THK A;  1Z97 A;  4G7A A;  4KNI A;  5E2K A;  5FLT A;  2NXR A;  3U3A X;  4Q6D A;  1ZGE A;  5E5U A;  4M2U A;  1ZFQ A;  2X7U A;  5JQT A;  1BNN A;  1LUG A;  4YVY A;  2POU A;  1BN3 A;  1I9M A;  1KWR A;  3L14 A;  4Q81 A;  5LMD A;  3OIK A;  4MO8 A;  1I9O A;  3PYK A;  4WR7 A;  3M3X A;  5G0C A;  5FNL A;  4YYT A;  2EU3 A;  3MYQ A;  1CAO A;  5CLU A;  4Z1E A;  1MUA A;  3M14 A;  5FLR A;  2HL4 A;  3IBI A;  5DSN A;  3S71 B;  4E3H A;  3HKU A;  3U47 A;  4Q7P A;  1G48 A;  3DC3 A;  4RUZ A;  3M98 A;  1UGD A;  1G46 A;  2GEH A;  4RUX A;  3DA2 A;  5EKH A;  4PQ7 A;  5SZ4 A;  1OKL A;  4PXX A;  3MNJ A;  3V2M A;  4QJP A;  4M2W A;  4WW6 A;  4M2V A;  1CNJ A;  3P58 A;  5EKM A;  3V2J A;  1FQL A;  1ZSC A;  1CNH A;  1RZD A;  1BNW A;  1JV0 A;  1HUG A;  3HKN A;  2FOU A;  5BYI A;  4E9O X;  3TVN X;  1HCA A;  4QY3 A;  5JEP B;  5EHE A;  3HKT A;  3Q31 A;  3R16 A;  2FMG A;  3V3J A;  12CA A;  5FLQ A;  4MLT A;  5DOG A;  4FVN A;  3MMF A;  3R17 B;  5G01 A;  2NWP A;  4LHI A;  3RLD A;  4MTY A;  4QSB A;  1FLJ A;  1CRA A;  4RFC A;  1Z9Y A;  1TEQ X;  4CNR A;  1HEB A;  4WUQ A;  1XEG A;  3KOK A;  5CJF A;  1RZA A;  3V3F A;  5JGS B;  5SZ3 A;  3FE4 A;  3KIG A;  1CNY A;  2FNN A;  4G0C A;  5CAC A;  5JG5 B;  3DBU A;  1TB0 X;  1OKM A;  1CCU A;  1FQM A;  3BL1 A;  2Q38 A;  3S75 B;  1LG5 A;  4N16 A;  4PYY A;  5DSI A;  4IWZ A;  5FL6 A;  1J9W A;  4QK1 A;  5FNG A;  4HT2 A;  1XEV A;  4CAC A;  3DCC A;  4Q08 A;  3RYZ A;  1I9Q A;  1YDB A;  5HPJ A;  3M2Y A;  3RJ7 A;  2FW4 A;  2NWO A;  5FNJ A;  1I9P A;  1TBT X;  1TG9 A;  4QSA A;  3HS4 A;  5DRS A;  1DMY A;  3S73 B;  4FPT A;  3S77 B;  1HCB A;  3D0N A;  1BIC A;  3K2F A;  3MWO A;  2WEH A;  4Q07 A;  2HD6 A;  3RZ0 B;  3T83 A;  1TE3 X;  3B4F A;  4BCW A;  4Z1N A;  3D92 A;  3V5G A;  1I9N A;  4R5B A;  4Q90 A;  5FLP A;  3DVC A;  4L5W A;  4WUP A;  4Q0L A;  2X7T A;  5EH7 A;  2WEJ A;  1KOP A;  2W2J A;  1CNI A;  4YWP A;  3FW3 A;  2EZ7 A;  1HUH A;  4XFW A;  1CVF A;  4JS6 A;  4K0Z A;  4QJ0 A;  1JCZ A;  3HKQ A;  3N2P A;  3DAZ A;  4JSW A;  4JSZ A;  3JXF A;  5FLS A;  4QK3 A;  4YGL A;  2FMZ A;  3MHO A;  4QSJ A;  3NJ9 A;  2WD2 A;  3M5S A;  3MNU A;  5JEH B;  3IGP A;  3P44 A;  4RUY A;  5AML A;  3RYJ B;  1F2W A;  1LZV A;  4GL1 X;  5SZ7 A;  5E28 A;  4PZH A;  4COQ A;  5JEG B;  4MDG A;  3N4B A;  1CAL A;  4FVO A;  4HEW A;  4KUW A;  1ZSA A;  4E5Q A;  1RJ5 A;  4FRC A;  2NNG A;  4KUV A;  4Q7S A;  5DSQ A;  1ZSB A;  3HLJ A;  5L6K A;  2WEO A;  4YXU A;  2NXS A;  1CAH A;  3M2Z A;  4E3F A;  2CBD A;  5BRU A;  1KEQ A;  3DCS A;  5A6H A;  5E2N A;  3MZC A;  4Q49 A;  1CVA A;  4MDL A;  5JQ0 A;  3T85 A;  4Q7V A;  2HOC A;  5DSM A;  4Q8Z A;  1CAN A;  4XZ5 A;  4HT0 A;  5JDV B;  4CNX A;  2NNV A;  1CA2 A;  5IPZ A;  4ZX0 A;  5EH8 A;  3TVO X;  3MNI A;  5E2S A;  4RIU A;  3DC9 A;  4XIW A;  8CA2 A;  4ZX1 A;  5SZ6 A;  2CA2 A;  4KP8 A;  4QIY A;  3GZ0 A;  4K0T A;  5DOH A;  1TH9 A;  3M1W A;  1V9E A;  5FNH A;  4BF1 A;  1I8Z A;  1I90 A;  1ZGF A;  3OIL A;  4E49 A;  4KP5 A;  5JGT B;  4C3T A;  4ZWX A;  1FQN A;  1IF4 A;  3KON A;  4CNW A;  1CAJ A;  5CA2 A;  3RYX B;  4N0X B;  3N3J A;  5DSR A;  5SZ5 A;  5EOI A;  3OY0 A;  2QO8 A;  2X7S A;  4KNM A;  3TMJ A;  1H9Q A;  1UGE A;  4FL7 A;  4R5A A;  1G6V A;  3DVB A;  3NB5 A;  2NN7 A;  2POV A;  3M5E A;  1XQ0 A;  1RZC A;  4M2R A;  1HEA A;  5J8Z A;  1OQ5 A;  4L5U A;  1CNC A;  3T5U A;  1V9I C;  2CBE A;  5FNM A;  5EIJ A;  4KV0 A;  1DCB A;  3UYQ A;  4YHA A;  2HFW A;  4R59 A;  1CIM A;  4E3D A;  4CNV A;  3F7U A;  1TTM A;  3LXE A;  1YDA A;  1CAZ A;  3DD8 A;  5BRW A;  4ZWI A;  1CIN A;  3D8W A;  1AM6 A;  1CZM A;  1YO0 A;  4BF6 A;  4ZWZ A;  1FR7 A;  4JSS A;  4Q9Y A;  3W6H A;  4ZWY A;  3V3I B;  4Q8X A;  2WD3 A;  5EZT X;  3W6I A;  3DV7 A;  4WW8 A;  1UGB A;  3MHL A;  3S72 B;  2H4N A;  3KKX A;  1FSR A;  5BRV A;  3PO6 A;  3M96 A;  4LP6 A;  3S78 B;  4Q7W A;  1IF9 A;  3MHI A;  1BNV A;  3F7B A;  2CAB A;  3M2N A;  3OKV A;  3V3G B;  1MOO A;  3B1B A;  1ZE8 A;  4FU5 A;  2WEG A;  5FLO A;  5SZ2 A;  1LG6 A;  1CA3 A;  4ITP A;  1BNQ A;  1IF8 A;  3IBN A;  4Z1J A;  1G4J A;  3RGE A;  3EFT A;  3V7X A;  4QJW A;  1T9N A;  3BET A;  4Q6E A;  4MDM A;  4QIZ A;  2H15 A;  4Q83 A;  4RFD A;  1CNX A;  3EFI A;  1HED A;  3OKU A;  3RYV B;  1BN4 A;  1CVE A;  1IF5 A;  4ILX A;  5FL5 A;  1KWQ A;  3D9Z A;  4QJO A;  5DSP A;  3ZP9 A;  3SBI A;  6CA2 A;  1DMX A;  4JSA A;  3MDZ A;  2NWY A;  1IF6 A;  1UGC A;  4KUY A;  1A42 A;  1ZFK A;  2QP6 A;  3T82 A;  2Q1B A;  3T84 A;  3M5T A;  4YGN A;  1UGA A;  4Q99 A;  5G03 A;  1UGG A;  3JXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...