4KNNA

Crystal structure of human carbonic anhydrase isozyme xiii with 2-chloro-4-[(pyrimidin-2-ylsulfanyl)acetyl]benzenesulfonamide
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
Knots found
sequence length
258
structure length
258
Chain Sequence
SWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Carbonic anhydrase 13
publication title Benzenesulfonamides with pyrimidine moiety as inhibitors of human carbonic anhydrases I, II, VI, VII, XII, and XIII
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 258
sequence length 258
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2013-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 4knnA00
2F14A 1YDDA 4M2RA 4RN4A 3KNEA 2OSFA 1BCDA 1IF9A 3DC9A 3DCSA 4KNJA 4XIXA 1CRMA 4N16A 5FL4A 5BRVA 5L3OA 3KWAA 4M2UA 3M2XA 2EU3A 4Q83A 1UGCA 4YGLA 1TEQX 3C7PA 3DV7A 1IF5A 4ETQC 1FR4A 2O4ZA 2FW4A 1AZMA 1CNYA 1TTMA 4Q0LA 1OKLA 4HT0A 1AVNA 5DSIA 2X7SA 5JEGB 3M04A 4HEWA 1ZGEA 4Z0QA 1KOQA 12CAA 2NMXA 1CAJA 2HKKA 3NJ9A 3QYKA 1UGGA 5JGTB 5CLUA 1I8ZA 5G0CA 1CNCA 5A25A 4Q7PA 3IBLA 3M5TA 3BL1A 4Q49A 4TWMA 3UYNA 4C3TA 4K0TA 4Q7SA 3M2YA 4MDMA 3VBDA 4N0XB 5C8IA 1TG9A 4Z1JA 4KAPA 3W6HA 5FNGA 2VVBX 4GL1X 2NN1A 1BNNA 1T9NA 4RUYA 2WD3A 4KUYA 3UYQA 1A42A 1BNQA 1I9LA 1CNJA 3KS3A 1RAZA 3DD8A 3S72B 4Q90A 2VVAX 3P5LA 4IDRX 3OKVA 1LG5A 1ZSAA 2CA2A 2NWZA 4QK2A 1ZNCA 3IEOA 4Q78A 4Q87A 4MLTA 1TEUX 1BNMA 3KONA 3F8EA 4Z1EA 4HBAA 4WL4A 5JG3B 1FQMA 2H15A 4KNNA 4KV0A 5G03A 5EIJA 4M2VA 2NWOA 3HFPA 5FNHA 1CVBA 1I90A 3P5AA 2Q38A 1CVCA 3MHCA 1CA2A 1RZEA 4WW6A 1CVAA 6CA2A 4XFWA 3MMFA 3U7CA 3ML5A 3NB5A 4QJPA 3RLDA 2FOQA 3EFTA 3MZCA 4Q8YA 4BF6A 3M3XA 5DRSA 1G46A 1KWQA 3JXFA 1FR7A 1I9QA 3RZ5A 3OYSA 4LHIA 3M67A 5CJFA 3S74B 3DA2A 3IAIA 3M2NA 1Y7WA 4WUQA 3P4VA 1BNVA 5DVXA 4Q7WA 1XEGA 5E2SA 1CAHA 2FOYA 3HKTA 3ML2A 3OKUA 3PJJA 2AW1A 3T83A 3M40A 5JESB 4WUPA 1BNWA 1G4OA 4E3FA 1OKMA 3S78B 5DSOA 1BNUA 4Q8ZA 5EH5A 1CRAA 1CCTA 2FNNA 3V5GA 5EKJA 4Z1KA 4ZWYA 2W2JA 3NI5A 1G4JA 1RZDA 3V7XA 3HLJA 3KKXA 4Q7VA 1FSNA 3DVBA 1CNXA 3TMJA 5BYIA 2ILIA 4JS6A 2QO8A 5SZ4A 2OSMA 4KUVA 1DMXA 3IBIA 3T82A 2Q1BA 2HD6A 3V3JA 1G0EA 3RYVB 1MUAA 1JCZA 1OKNA 3MNUA 3Q31A 1CZMA 4PQ7A 5E5RA 2HNCA 2FOUA 4CQ0A 2HFWA 2NWPA 2X7UA 2AX2A 1IF8A 2EZ7A 1ZFQA 3EFIA 1ZE8A 3U3AX 3MHLA 3W6IA 2NNGA 2NXRA 1ZGFA 1ZFKA 2FMGA 5FLQA 3CZVA 4KNIA 3U47A 5FDCA 3ZNCA 3S73B 1KOPA 1MOOA 3CYUA 5EZTX 2CABA 2CBEA 4G0CA 5JG5B 1HUGA 5DSQA 5AMGA 1TBTX 4K0SA 3K2FA 4XE1A 5J8ZA 5EHWA 1G0FA 3SBHA 2X7TA 1CNIA 1RJ6A 4QSAA 4QIYA 4BCWA 1HEDA 4QK1A 7CA2A 1FLJA 3M96A 2GEHA 2H4NA 3JXHC 5JGSB 1ZSCA 3R16A 4WW8A 1UGFA 4CNVA 1XQ0A 3DD0A 2POVA 5FLSA 4ITOA 5E2KA 2POWA 4FVNA 5FLRA 4CACA 2CBAA 5DSJA 4HF3A 4Q99A 4R5AA 2FNKA 3KOKA 2QP6A 4Y0JA 3OILA 3M1KA 4QEFA 4E4AA 4X5SA 3DVCA 3PYKA 3M1WA 1F2WA 1KEQA 2EU2A 4M2WA 4QK3A 4ZWZA 1BZMA 4RFCA 5SZ2A 4ZWIA 1H9NA 4Q6EA 2NNSA 1THKA 2FOSA 2WEOA 4DZ9A 5BRUA 1G48A 4K13A 5FNKA 5E2MA 4L5WA 4YGJA 1Z9YA 1I91A 4WR7A 4YXOA 1ZSBA 5FNLA 5EHEA 5FLTA 1ZH9A 3DVDA 4MDLA 1H4NA 4K1QA 3K7KA 3RYJB 4FPTA 1FQNA 1HVAA 1Z93A 5FNJA 4L5VA 5DSMA 1IF4A 1AM6A 1RZAA 3IBNA 3OYQA 3R17B 4COQA 1UGDA 1CIMA 3M1QA 3T84A 5SZ1A 2Q1QA 3M2ZA 1RJ5A 2WEGA 1CCUA 4R59A 5FL5A 3RZ8A 1G3ZA 1JV0A 3V3HB 1TH9A 1BV3A 4FIKA 4QY3A 4ZWXA 3D93A 1FQRA 4LP6A 5FLOA 1Z97A 4YGKA 3S75B 3RG3A 3DC3A 4PYXA 3MNJA 1TE3X 2QOAA 1CNKA 3P44A 3OIMA 5SZ5A 1RZBA 3N0NA 4JSSA 4R5BA 3V3GB 4QJWA 5E2RA 3MNAA 4K0ZA 1CAKA 3MNKA 3DBUA 3T5ZA 1YDCA 4BF1A 4YGNA 3M5SA 4ZX1A 3L14A 4QJXA 1I9MA 1I9NA 1G1DA 3KLDB 3MWOA 4DZ7A 3IGPA 3T85A 4L5UA 3HKUA 1G45A 4XZ5A 4Q6DA 2NXSA 5EH7A 1XPZA 3BL0A 4JSAA 1EOUA 2NXTA 1DCBA 1CAZA 4KUWA 5SZ6A 4Q81A 3RYZA 2NWYA 3V3IB 3B1BA 1RZCA 1CCSA 1CNGA 4FL7A 1G6VA 9CA2A 5EH8A 3PO6A 1BN3A 4CA2A 5SZ7A 4G7AA 5FDIA 4E3GA 4Q09A 3V3FA 4MLXA 4MO8A 1J9WA 2POUA 1G53A 3V2MA 1UGEA 3MHOA 4Q06A 4FU5A 5G0BA 3DCCA 2FNMA 3M5EA 3RYXB 3D8WA 3BETA 4QJ0A 5E2NA 3IBUA 4RUZA 1LZVA 3HS4A 2ABEA 1V9EA 5FL6A 3RG4A 4RIVA 2HOCA 3KIGA 1CALA 1CAOA 1IF7A 4E3DA 1TG3A 4E3HA 4JSWA 1OQ5A 5JQ0A 4LU3A 5L6KA 3M14A 4QJMA 4QTLA 3P55A 5EKHA 1YO0A 3S8XA 2HL4A 1UGAA 1KWRA 2IT4A 1FSRA 3LXEA 1HCAA 5E5UA 4QSIA 4RUXA 4Q08A 3CAJA 3HKNA 1CAMA 3FE4A 1CNWA 1HEAA 5DOHA 1V9IC 1HUHA 1CANA 4Z1NA 2NNOA 4MDGA 5SZ0A 4HEZA 5FNIA 1CVDA 3F7UA 5JDVB 2NNVA 4YWPA 1TB0X 2WEJA 1H9QA 4ILXA 5LMDA 5DSLA 1CVEA 3HKQA 5IPZA 2ZNCA 4PYYA 5E28A 3SAPA 3M1JA 4E9OX 1BICA 4E5QA 3CA2A 3OIKA 5AMDA 4HT2A 3F4XA 8CA2A 3ZP9A 1CAYA 5DOGA 1G54A 4YXIA 1IF6A 3D92A 3M98A 3RZ7A 1BN4A 1DMYA 5FNMA 5CACA 3F7BA 1CNBA 1HCBA 3MHMA 4FVOA 5JEHB 2GD8A 4RFDA 1CINA 4RIUA 3DCWA 5SZ3A 3T5UA 3TVNX 3MHIA 5DSRA 1HEBA 3N3JA 3P3HA 4CNXA 3N2PA 3K34A 3SBIA 4KP8A 3RYYA 3RGEA 3RZ1B 4TWLA 3FFPX 3JXGA 3GZ0A 5AMLA 4YVYA 1DCAA 4RH2A 1LGDA 4XIWA 1YDBA 3U45X 3FW3A 1BNTA 3MYQA 4KP5A 3MDZA 1CILA 2WD2A 4YXUA 5BNLA 3P3JA 1CNHA 5JEPB 1I9OA 5JQTA 5DSKA 1BN1A 3SAXA 3MNIA 5EHVA 4HEYA 5HPJA 1RAYA 3P58A 4HU1A 3N4BA 2CBDA 4E49A 4JSZA 4PXXA 4QSBA 1HECA 5CA2A 3D0NA 4Q07A 5A6HA 2NN7A 2FMZA 1CA3A 1LG6A 4Q8XA 1FQLA 5DSNA 2WEHA 1YO1A 4ZAOA 3DAZA 3S9TA 3RJ7A 1JD0A 4Q9YA 1YDAA 3TVOX 4KNMA 5EKMA 1G52A 3S97A 3MNHA 3KOIA 1CAIA 5BRWA 5EOIA 4UOVA 4MTYA 2FOVA 4QJOA 4YHAA 2CBCA 1CVFA 1YO2A 4ZX0A 4CNRA 1FSQA 4IWZA 4ITPA 3V2JA 4YX4A 4YYTA 3OY0A 2CBBA 1UGBA 3S77B 5DSPA 1URTA 3S71B 4CNWA 4PZHA 3D9ZA 4QIZA 1CVHA 3B4FA 5G01A 4QSJA 1LUGA 3RZ0B 1I9PA 4YGFA 5FLPA 4FRCA 1XEVA 3S76A
chains in the Genus database with same CATH superfamily
2F14A 1YDDA 4M2RA 4RN4A 3KNEA 2OSFA 1BCDA 1IF9A 3DC9A 3DCSA 4KNJA 4XIXA 1CRMA 4N16A 5FL4A 5BRVA 5L3OA 3KWAA 4M2UA 3M2XA 2EU3A 4Q83A 1UGCA 4YGLA 1TEQX 3C7PA 3DV7A 1IF5A 4ETQC 1FR4A 2O4ZA 2FW4A 1AZMA 1CNYA 1TTMA 4Q0LA 1OKLA 4HT0A 1AVNA 5DSIA 2X7SA 5JEGB 3M04A 4HEWA 1ZGEA 4Z0QA 1KOQA 12CAA 2NMXA 1CAJA 2HKKA 3NJ9A 3QYKA 1UGGA 5JGTB 5CLUA 1I8ZA 5G0CA 1CNCA 5A25A 4Q7PA 3IBLA 3M5TA 3BL1A 4Q49A 4TWMA 3UYNA 4C3TA 4K0TA 4Q7SA 3M2YA 4MDMA 3VBDA 4N0XB 5C8IA 1TG9A 4Z1JA 4KAPA 3W6HA 5FNGA 2VVBX 4GL1X 2NN1A 1BNNA 1T9NA 4RUYA 2WD3A 4KUYA 3UYQA 1A42A 1BNQA 1I9LA 1CNJA 3KS3A 1RAZA 3DD8A 3S72B 4Q90A 2VVAX 3P5LA 4IDRX 3OKVA 1LG5A 1ZSAA 2CA2A 2NWZA 4QK2A 1ZNCA 3IEOA 4Q78A 4Q87A 4MLTA 1TEUX 1BNMA 3KONA 3F8EA 4Z1EA 4HBAA 4WL4A 5JG3B 1FQMA 2H15A 4KNNA 4KV0A 5G03A 5EIJA 4M2VA 2NWOA 3HFPA 5FNHA 1CVBA 1I90A 3P5AA 2Q38A 1CVCA 3MHCA 1CA2A 1RZEA 4WW6A 1CVAA 6CA2A 4XFWA 3MMFA 3U7CA 3ML5A 3NB5A 4QJPA 3RLDA 2FOQA 3EFTA 3MZCA 4Q8YA 4BF6A 3M3XA 5DRSA 1G46A 1KWQA 3JXFA 1FR7A 1I9QA 3RZ5A 3OYSA 4LHIA 3M67A 5CJFA 3S74B 3DA2A 3IAIA 3M2NA 1Y7WA 4WUQA 3P4VA 1BNVA 5DVXA 4Q7WA 1XEGA 5E2SA 1CAHA 2FOYA 3HKTA 3ML2A 3OKUA 3PJJA 2AW1A 3T83A 3M40A 5JESB 4WUPA 1BNWA 1G4OA 4E3FA 1OKMA 3S78B 5DSOA 1BNUA 4Q8ZA 5EH5A 1CRAA 1CCTA 2FNNA 3V5GA 5EKJA 4Z1KA 4ZWYA 2W2JA 3NI5A 1G4JA 1RZDA 3V7XA 3HLJA 3KKXA 4Q7VA 1FSNA 3DVBA 1CNXA 3TMJA 5BYIA 2ILIA 4JS6A 2QO8A 5SZ4A 2OSMA 4KUVA 1DMXA 3IBIA 3T82A 2Q1BA 2HD6A 3V3JA 1G0EA 3RYVB 1MUAA 1JCZA 1OKNA 3MNUA 3Q31A 1CZMA 4PQ7A 5E5RA 2HNCA 2FOUA 4CQ0A 2HFWA 2NWPA 2X7UA 2AX2A 1IF8A 2EZ7A 1ZFQA 3EFIA 1ZE8A 3U3AX 3MHLA 3W6IA 2NNGA 2NXRA 1ZGFA 1ZFKA 2FMGA 5FLQA 3CZVA 4KNIA 3U47A 5FDCA 3ZNCA 3S73B 1KOPA 1MOOA 3CYUA 5EZTX 2CABA 2CBEA 4G0CA 5JG5B 1HUGA 5DSQA 5AMGA 1TBTX 4K0SA 3K2FA 4XE1A 5J8ZA 5EHWA 1G0FA 3SBHA 2X7TA 1CNIA 1RJ6A 4QSAA 4QIYA 4BCWA 1HEDA 4QK1A 7CA2A 1FLJA 3M96A 2GEHA 2H4NA 3JXHC 5JGSB 1ZSCA 3R16A 4WW8A 1UGFA 4CNVA 1XQ0A 3DD0A 2POVA 5FLSA 4ITOA 5E2KA 2POWA 4FVNA 5FLRA 4CACA 2CBAA 5DSJA 4HF3A 4Q99A 4R5AA 2FNKA 3KOKA 2QP6A 4Y0JA 3OILA 3M1KA 4QEFA 4E4AA 4X5SA 3DVCA 3PYKA 3M1WA 1F2WA 1KEQA 2EU2A 4M2WA 4QK3A 4ZWZA 1BZMA 4RFCA 5SZ2A 4ZWIA 1H9NA 4Q6EA 2NNSA 1THKA 2FOSA 2WEOA 4DZ9A 5BRUA 1G48A 4K13A 5FNKA 5E2MA 4L5WA 4YGJA 1Z9YA 1I91A 4WR7A 4YXOA 1ZSBA 5FNLA 5EHEA 5FLTA 1ZH9A 3DVDA 4MDLA 1H4NA 4K1QA 3K7KA 3RYJB 4FPTA 1FQNA 1HVAA 1Z93A 5FNJA 4L5VA 5DSMA 1IF4A 1AM6A 1RZAA 3IBNA 3OYQA 3R17B 4COQA 1UGDA 1CIMA 3M1QA 3T84A 5SZ1A 2Q1QA 3M2ZA 1RJ5A 2WEGA 1CCUA 4R59A 5FL5A 3RZ8A 1G3ZA 1JV0A 3V3HB 1TH9A 1BV3A 4FIKA 4QY3A 4ZWXA 3D93A 1FQRA 4LP6A 5FLOA 1Z97A 4YGKA 3S75B 3RG3A 3DC3A 4PYXA 3MNJA 1TE3X 2QOAA 1CNKA 3P44A 3OIMA 5SZ5A 1RZBA 3N0NA 4JSSA 4R5BA 3V3GB 4QJWA 5E2RA 3MNAA 4K0ZA 1CAKA 3MNKA 3DBUA 3T5ZA 1YDCA 4BF1A 4YGNA 3M5SA 4ZX1A 3L14A 4QJXA 1I9MA 1I9NA 1G1DA 3KLDB 3MWOA 4DZ7A 3IGPA 3T85A 4L5UA 3HKUA 1G45A 4XZ5A 4Q6DA 2NXSA 5EH7A 1XPZA 3BL0A 4JSAA 1EOUA 2NXTA 1DCBA 1CAZA 4KUWA 5SZ6A 4Q81A 3RYZA 2NWYA 3V3IB 3B1BA 1RZCA 1CCSA 1CNGA 4FL7A 1G6VA 9CA2A 5EH8A 3PO6A 1BN3A 4CA2A 5SZ7A 4G7AA 5FDIA 4E3GA 4Q09A 3V3FA 4MLXA 4MO8A 1J9WA 2POUA 1G53A 3V2MA 1UGEA 3MHOA 4Q06A 4FU5A 5G0BA 3DCCA 2FNMA 3M5EA 3RYXB 3D8WA 3BETA 4QJ0A 5E2NA 3IBUA 4RUZA 1LZVA 3HS4A 2ABEA 1V9EA 5FL6A 3RG4A 4RIVA 2HOCA 3KIGA 1CALA 1CAOA 1IF7A 4E3DA 1TG3A 4E3HA 4JSWA 1OQ5A 5JQ0A 4LU3A 5L6KA 3M14A 4QJMA 4QTLA 3P55A 5EKHA 1YO0A 3S8XA 2HL4A 1UGAA 1KWRA 2IT4A 1FSRA 3LXEA 1HCAA 5E5UA 4QSIA 4RUXA 4Q08A 3CAJA 3HKNA 1CAMA 3FE4A 1CNWA 1HEAA 5DOHA 1V9IC 1HUHA 1CANA 4Z1NA 2NNOA 4MDGA 5SZ0A 4HEZA 5FNIA 1CVDA 3F7UA 5JDVB 2NNVA 4YWPA 1TB0X 2WEJA 1H9QA 4ILXA 5LMDA 5DSLA 1CVEA 3HKQA 5IPZA 2ZNCA 4PYYA 5E28A 3SAPA 3M1JA 4E9OX 1BICA 4E5QA 3CA2A 3OIKA 5AMDA 4HT2A 3F4XA 8CA2A 3ZP9A 1CAYA 5DOGA 1G54A 4YXIA 1IF6A 3D92A 3M98A 3RZ7A 1BN4A 1DMYA 5FNMA 5CACA 3F7BA 1CNBA 1HCBA 3MHMA 4FVOA 5JEHB 2GD8A 4RFDA 1CINA 4RIUA 3DCWA 5SZ3A 3T5UA 3TVNX 3MHIA 5DSRA 1HEBA 3N3JA 3P3HA 4CNXA 3N2PA 3K34A 3SBIA 4KP8A 3RYYA 3RGEA 3RZ1B 4TWLA 3FFPX 3JXGA 3GZ0A 5AMLA 4YVYA 1DCAA 4RH2A 1LGDA 4XIWA 1YDBA 3U45X 3FW3A 1BNTA 3MYQA 4KP5A 3MDZA 1CILA 2WD2A 4YXUA 5BNLA 3P3JA 1CNHA 5JEPB 1I9OA 5JQTA 5DSKA 1BN1A 3SAXA 3MNIA 5EHVA 4HEYA 5HPJA 1RAYA 3P58A 4HU1A 3N4BA 2CBDA 4E49A 4JSZA 4PXXA 4QSBA 1HECA 5CA2A 3D0NA 4Q07A 5A6HA 2NN7A 2FMZA 1CA3A 1LG6A 4Q8XA 1FQLA 5DSNA 2WEHA 1YO1A 4ZAOA 3DAZA 3S9TA 3RJ7A 1JD0A 4Q9YA 1YDAA 3TVOX 4KNMA 5EKMA 1G52A 3S97A 3MNHA 3KOIA 1CAIA 5BRWA 5EOIA 4UOVA 4MTYA 2FOVA 4QJOA 4YHAA 2CBCA 1CVFA 1YO2A 4ZX0A 4CNRA 1FSQA 4IWZA 4ITPA 3V2JA 4YX4A 4YYTA 3OY0A 2CBBA 1UGBA 3S77B 5DSPA 1URTA 3S71B 4CNWA 4PZHA 3D9ZA 4QIZA 1CVHA 3B4FA 5G01A 4QSJA 1LUGA 3RZ0B 1I9PA 4YGFA 5FLPA 4FRCA 1XEVA 3S76A
chains in the Genus database with same CATH topology
2F14A 1YDDA 4M2RA 4RN4A 3KNEA 2OSFA 1BCDA 1IF9A 3DC9A 3DCSA 4KNJA 4XIXA 1CRMA 4N16A 5FL4A 5BRVA 5L3OA 3KWAA 4M2UA 3M2XA 2EU3A 4Q83A 1UGCA 4YGLA 1TEQX 3C7PA 3DV7A 1IF5A 4ETQC 1FR4A 2O4ZA 2FW4A 1AZMA 1CNYA 1TTMA 4Q0LA 1OKLA 4HT0A 1AVNA 5DSIA 2X7SA 5JEGB 3M04A 4HEWA 1ZGEA 4Z0QA 1KOQA 12CAA 2NMXA 1CAJA 2HKKA 3NJ9A 3QYKA 1UGGA 5JGTB 5CLUA 1I8ZA 5G0CA 1CNCA 5A25A 4Q7PA 3IBLA 3M5TA 3BL1A 4Q49A 4TWMA 3UYNA 4C3TA 4K0TA 4Q7SA 3M2YA 4MDMA 3VBDA 4N0XB 5C8IA 1TG9A 4Z1JA 4KAPA 3W6HA 5FNGA 2VVBX 4GL1X 2NN1A 1BNNA 1T9NA 4RUYA 2WD3A 4KUYA 3UYQA 1A42A 1BNQA 1I9LA 1CNJA 3KS3A 1RAZA 3DD8A 3S72B 4Q90A 2VVAX 3P5LA 4IDRX 3OKVA 1LG5A 1ZSAA 2CA2A 2NWZA 4QK2A 1ZNCA 3IEOA 4Q78A 4Q87A 4MLTA 1TEUX 1BNMA 3KONA 3F8EA 4Z1EA 4HBAA 4WL4A 5JG3B 1FQMA 2H15A 4KNNA 4KV0A 5G03A 5EIJA 4M2VA 2NWOA 3HFPA 5FNHA 1CVBA 1I90A 3P5AA 2Q38A 1CVCA 3MHCA 1CA2A 1RZEA 4WW6A 1CVAA 6CA2A 4XFWA 3MMFA 3U7CA 3ML5A 3NB5A 4QJPA 3RLDA 2FOQA 3EFTA 3MZCA 4Q8YA 4BF6A 3M3XA 5DRSA 1G46A 1KWQA 3JXFA 1FR7A 1I9QA 3RZ5A 3OYSA 4LHIA 3M67A 5CJFA 3S74B 3DA2A 3IAIA 3M2NA 1Y7WA 4WUQA 3P4VA 1BNVA 5DVXA 4Q7WA 1XEGA 5E2SA 1CAHA 2FOYA 3HKTA 3ML2A 3OKUA 3PJJA 2AW1A 3T83A 3M40A 5JESB 4WUPA 1BNWA 1G4OA 4E3FA 1OKMA 3S78B 5DSOA 1BNUA 4Q8ZA 5EH5A 1CRAA 1CCTA 2FNNA 3V5GA 5EKJA 4Z1KA 4ZWYA 2W2JA 3NI5A 1G4JA 1RZDA 3V7XA 3HLJA 3KKXA 4Q7VA 1FSNA 3DVBA 1CNXA 3TMJA 5BYIA 2ILIA 4JS6A 2QO8A 5SZ4A 2OSMA 4KUVA 1DMXA 3IBIA 3T82A 2Q1BA 2HD6A 3V3JA 1G0EA 3RYVB 1MUAA 1JCZA 1OKNA 3MNUA 3Q31A 1CZMA 4PQ7A 5E5RA 2HNCA 2FOUA 4CQ0A 2HFWA 2NWPA 2X7UA 2AX2A 1IF8A 2EZ7A 1ZFQA 3EFIA 1ZE8A 3U3AX 3MHLA 3W6IA 2NNGA 2NXRA 1ZGFA 1ZFKA 2FMGA 5FLQA 3CZVA 4KNIA 3U47A 5FDCA 3ZNCA 3S73B 1KOPA 1MOOA 3CYUA 5EZTX 2CABA 2CBEA 4G0CA 5JG5B 1HUGA 5DSQA 5AMGA 1TBTX 4K0SA 3K2FA 4XE1A 5J8ZA 5EHWA 1G0FA 3SBHA 2X7TA 1CNIA 1RJ6A 4QSAA 4QIYA 4BCWA 1HEDA 4QK1A 7CA2A 1FLJA 3M96A 2GEHA 2H4NA 3JXHC 5JGSB 1ZSCA 3R16A 4WW8A 1UGFA 4CNVA 1XQ0A 3DD0A 2POVA 5FLSA 4ITOA 5E2KA 2POWA 4FVNA 5FLRA 4CACA 2CBAA 5DSJA 4HF3A 4Q99A 4R5AA 2FNKA 3KOKA 2QP6A 4Y0JA 3OILA 3M1KA 4QEFA 4E4AA 4X5SA 3DVCA 3PYKA 3M1WA 1F2WA 1KEQA 2EU2A 4M2WA 4QK3A 4ZWZA 1BZMA 4RFCA 5SZ2A 4ZWIA 1H9NA 4Q6EA 2NNSA 1THKA 2FOSA 2WEOA 4DZ9A 5BRUA 1G48A 4K13A 5FNKA 5E2MA 4L5WA 4YGJA 1Z9YA 1I91A 4WR7A 4YXOA 1ZSBA 5FNLA 5EHEA 5FLTA 1ZH9A 3DVDA 4MDLA 1H4NA 4K1QA 3K7KA 3RYJB 4FPTA 1FQNA 1HVAA 1Z93A 5FNJA 4L5VA 5DSMA 1IF4A 1AM6A 1RZAA 3IBNA 3OYQA 3R17B 4COQA 1UGDA 1CIMA 3M1QA 3T84A 5SZ1A 2Q1QA 3M2ZA 1RJ5A 2WEGA 1CCUA 4R59A 5FL5A 3RZ8A 1G3ZA 1JV0A 3V3HB 1TH9A 1BV3A 4FIKA 4QY3A 4ZWXA 3D93A 1FQRA 4LP6A 5FLOA 1Z97A 4YGKA 3S75B 3RG3A 3DC3A 4PYXA 3MNJA 1TE3X 2QOAA 1CNKA 3P44A 3OIMA 5SZ5A 1RZBA 3N0NA 4JSSA 4R5BA 3V3GB 4QJWA 5E2RA 3MNAA 4K0ZA 1CAKA 3MNKA 3DBUA 3T5ZA 1YDCA 4BF1A 4YGNA 3M5SA 4ZX1A 3L14A 4QJXA 1I9MA 1I9NA 1G1DA 3KLDB 3MWOA 4DZ7A 3IGPA 3T85A 4L5UA 3HKUA 1G45A 4XZ5A 4Q6DA 2NXSA 5EH7A 1XPZA 3BL0A 4JSAA 1EOUA 2NXTA 1DCBA 1CAZA 4KUWA 5SZ6A 4Q81A 3RYZA 2NWYA 3V3IB 3B1BA 1RZCA 1CCSA 1CNGA 4FL7A 1G6VA 9CA2A 5EH8A 3PO6A 1BN3A 4CA2A 5SZ7A 4G7AA 5FDIA 4E3GA 4Q09A 3V3FA 4MLXA 4MO8A 1J9WA 2POUA 1G53A 3V2MA 1UGEA 3MHOA 4Q06A 4FU5A 5G0BA 3DCCA 2FNMA 3M5EA 3RYXB 3D8WA 3BETA 4QJ0A 5E2NA 3IBUA 4RUZA 1LZVA 3HS4A 2ABEA 1V9EA 5FL6A 3RG4A 4RIVA 2HOCA 3KIGA 1CALA 1CAOA 1IF7A 4E3DA 1TG3A 4E3HA 4JSWA 1OQ5A 5JQ0A 4LU3A 5L6KA 3M14A 4QJMA 4QTLA 3P55A 5EKHA 1YO0A 3S8XA 2HL4A 1UGAA 1KWRA 2IT4A 1FSRA 3LXEA 1HCAA 5E5UA 4QSIA 4RUXA 4Q08A 3CAJA 3HKNA 1CAMA 3FE4A 1CNWA 1HEAA 5DOHA 1V9IC 1HUHA 1CANA 4Z1NA 2NNOA 4MDGA 5SZ0A 4HEZA 5FNIA 1CVDA 3F7UA 5JDVB 2NNVA 4YWPA 1TB0X 2WEJA 1H9QA 4ILXA 5LMDA 5DSLA 1CVEA 3HKQA 5IPZA 2ZNCA 4PYYA 5E28A 3SAPA 3M1JA 4E9OX 1BICA 4E5QA 3CA2A 3OIKA 5AMDA 4HT2A 3F4XA 8CA2A 3ZP9A 1CAYA 5DOGA 1G54A 4YXIA 1IF6A 3D92A 3M98A 3RZ7A 1BN4A 1DMYA 5FNMA 5CACA 3F7BA 1CNBA 1HCBA 3MHMA 4FVOA 5JEHB 2GD8A 4RFDA 1CINA 4RIUA 3DCWA 5SZ3A 3T5UA 3TVNX 3MHIA 5DSRA 1HEBA 3N3JA 3P3HA 4CNXA 3N2PA 3K34A 3SBIA 4KP8A 3RYYA 3RGEA 3RZ1B 4TWLA 3FFPX 3JXGA 3GZ0A 5AMLA 4YVYA 1DCAA 4RH2A 1LGDA 4XIWA 1YDBA 3U45X 3FW3A 1BNTA 3MYQA 4KP5A 3MDZA 1CILA 2WD2A 4YXUA 5BNLA 3P3JA 1CNHA 5JEPB 1I9OA 5JQTA 5DSKA 1BN1A 3SAXA 3MNIA 5EHVA 4HEYA 5HPJA 1RAYA 3P58A 4HU1A 3N4BA 2CBDA 4E49A 4JSZA 4PXXA 4QSBA 1HECA 5CA2A 3D0NA 4Q07A 5A6HA 2NN7A 2FMZA 1CA3A 1LG6A 4Q8XA 1FQLA 5DSNA 2WEHA 1YO1A 4ZAOA 3DAZA 3S9TA 3RJ7A 1JD0A 4Q9YA 1YDAA 3TVOX 4KNMA 5EKMA 1G52A 3S97A 3MNHA 3KOIA 1CAIA 5BRWA 5EOIA 4UOVA 4MTYA 2FOVA 4QJOA 4YHAA 2CBCA 1CVFA 1YO2A 4ZX0A 4CNRA 1FSQA 4IWZA 4ITPA 3V2JA 4YX4A 4YYTA 3OY0A 2CBBA 1UGBA 3S77B 5DSPA 1URTA 3S71B 4CNWA 4PZHA 3D9ZA 4QIZA 1CVHA 3B4FA 5G01A 4QSJA 1LUGA 3RZ0B 1I9PA 4YGFA 5FLPA 4FRCA 1XEVA 3S76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F14 A;  1YDD A;  4M2R A;  4RN4 A;  3KNE A;  2OSF A;  1BCD A;  1IF9 A;  3DC9 A;  3DCS A;  4KNJ A;  4XIX A;  1CRM A;  4N16 A;  5FL4 A;  5BRV A;  5L3O A;  3KWA A;  4M2U A;  3M2X A;  2EU3 A;  4Q83 A;  1UGC A;  4YGL A;  1TEQ X;  3C7P A;  3DV7 A;  1IF5 A;  4ETQ C;  1FR4 A;  2O4Z A;  2FW4 A;  1AZM A;  1CNY A;  1TTM A;  4Q0L A;  1OKL A;  4HT0 A;  1AVN A;  5DSI A;  2X7S A;  5JEG B;  3M04 A;  4HEW A;  1ZGE A;  4Z0Q A;  1KOQ A;  12CA A;  2NMX A;  1CAJ A;  2HKK A;  3NJ9 A;  3QYK A;  1UGG A;  5JGT B;  5CLU A;  1I8Z A;  5G0C A;  1CNC A;  5A25 A;  4Q7P A;  3IBL A;  3M5T A;  3BL1 A;  4Q49 A;  4TWM A;  3UYN A;  4C3T A;  4K0T A;  4Q7S A;  3M2Y A;  4MDM A;  3VBD A;  4N0X B;  5C8I A;  1TG9 A;  4Z1J A;  4KAP A;  3W6H A;  5FNG A;  2VVB X;  4GL1 X;  2NN1 A;  1BNN A;  1T9N A;  4RUY A;  2WD3 A;  4KUY A;  3UYQ A;  1A42 A;  1BNQ A;  1I9L A;  1CNJ A;  3KS3 A;  1RAZ A;  3DD8 A;  3S72 B;  4Q90 A;  2VVA X;  3P5L A;  4IDR X;  3OKV A;  1LG5 A;  1ZSA A;  2CA2 A;  2NWZ A;  4QK2 A;  1ZNC A;  3IEO A;  4Q78 A;  4Q87 A;  4MLT A;  1TEU X;  1BNM A;  3KON A;  3F8E A;  4Z1E A;  4HBA A;  4WL4 A;  5JG3 B;  1FQM A;  2H15 A;  4KNN A;  4KV0 A;  5G03 A;  5EIJ A;  4M2V A;  2NWO A;  3HFP A;  5FNH A;  1CVB A;  1I90 A;  3P5A A;  2Q38 A;  1CVC A;  3MHC A;  1CA2 A;  1RZE A;  4WW6 A;  1CVA A;  6CA2 A;  4XFW A;  3MMF A;  3U7C A;  3ML5 A;  3NB5 A;  4QJP A;  3RLD A;  2FOQ A;  3EFT A;  3MZC A;  4Q8Y A;  4BF6 A;  3M3X A;  5DRS A;  1G46 A;  1KWQ A;  3JXF A;  1FR7 A;  1I9Q A;  3RZ5 A;  3OYS A;  4LHI A;  3M67 A;  5CJF A;  3S74 B;  3DA2 A;  3IAI A;  3M2N A;  1Y7W A;  4WUQ A;  3P4V A;  1BNV A;  5DVX A;  4Q7W A;  1XEG A;  5E2S A;  1CAH A;  2FOY A;  3HKT A;  3ML2 A;  3OKU A;  3PJJ A;  2AW1 A;  3T83 A;  3M40 A;  5JES B;  4WUP A;  1BNW A;  1G4O A;  4E3F A;  1OKM A;  3S78 B;  5DSO A;  1BNU A;  4Q8Z A;  5EH5 A;  1CRA A;  1CCT A;  2FNN A;  3V5G A;  5EKJ A;  4Z1K A;  4ZWY A;  2W2J A;  3NI5 A;  1G4J A;  1RZD A;  3V7X A;  3HLJ A;  3KKX A;  4Q7V A;  1FSN A;  3DVB A;  1CNX A;  3TMJ A;  5BYI A;  2ILI A;  4JS6 A;  2QO8 A;  5SZ4 A;  2OSM A;  4KUV A;  1DMX A;  3IBI A;  3T82 A;  2Q1B A;  2HD6 A;  3V3J A;  1G0E A;  3RYV B;  1MUA A;  1JCZ A;  1OKN A;  3MNU A;  3Q31 A;  1CZM A;  4PQ7 A;  5E5R A;  2HNC A;  2FOU A;  4CQ0 A;  2HFW A;  2NWP A;  2X7U A;  2AX2 A;  1IF8 A;  2EZ7 A;  1ZFQ A;  3EFI A;  1ZE8 A;  3U3A X;  3MHL A;  3W6I A;  2NNG A;  2NXR A;  1ZGF A;  1ZFK A;  2FMG A;  5FLQ A;  3CZV A;  4KNI A;  3U47 A;  5FDC A;  3ZNC A;  3S73 B;  1KOP A;  1MOO A;  3CYU A;  5EZT X;  2CAB A;  2CBE A;  4G0C A;  5JG5 B;  1HUG A;  5DSQ A;  5AMG A;  1TBT X;  4K0S A;  3K2F A;  4XE1 A;  5J8Z A;  5EHW A;  1G0F A;  3SBH A;  2X7T A;  1CNI A;  1RJ6 A;  4QSA A;  4QIY A;  4BCW A;  1HED A;  4QK1 A;  7CA2 A;  1FLJ A;  3M96 A;  2GEH A;  2H4N A;  3JXH C;  5JGS B;  1ZSC A;  3R16 A;  4WW8 A;  1UGF A;  4CNV A;  1XQ0 A;  3DD0 A;  2POV A;  5FLS A;  4ITO A;  5E2K A;  2POW A;  4FVN A;  5FLR A;  4CAC A;  2CBA A;  5DSJ A;  4HF3 A;  4Q99 A;  4R5A A;  2FNK A;  3KOK A;  2QP6 A;  4Y0J A;  3OIL A;  3M1K A;  4QEF A;  4E4A A;  4X5S A;  3DVC A;  3PYK A;  3M1W A;  1F2W A;  1KEQ A;  2EU2 A;  4M2W A;  4QK3 A;  4ZWZ A;  1BZM A;  4RFC A;  5SZ2 A;  4ZWI A;  1H9N A;  4Q6E A;  2NNS A;  1THK A;  2FOS A;  2WEO A;  4DZ9 A;  5BRU A;  1G48 A;  4K13 A;  5FNK A;  5E2M A;  4L5W A;  4YGJ A;  1Z9Y A;  1I91 A;  4WR7 A;  4YXO A;  1ZSB A;  5FNL A;  5EHE A;  5FLT A;  1ZH9 A;  3DVD A;  4MDL A;  1H4N A;  4K1Q A;  3K7K A;  3RYJ B;  4FPT A;  1FQN A;  1HVA A;  1Z93 A;  5FNJ A;  4L5V A;  5DSM A;  1IF4 A;  1AM6 A;  1RZA A;  3IBN A;  3OYQ A;  3R17 B;  4COQ A;  1UGD A;  1CIM A;  3M1Q A;  3T84 A;  5SZ1 A;  2Q1Q A;  3M2Z A;  1RJ5 A;  2WEG A;  1CCU A;  4R59 A;  5FL5 A;  3RZ8 A;  1G3Z A;  1JV0 A;  3V3H B;  1TH9 A;  1BV3 A;  4FIK A;  4QY3 A;  4ZWX A;  3D93 A;  1FQR A;  4LP6 A;  5FLO A;  1Z97 A;  4YGK A;  3S75 B;  3RG3 A;  3DC3 A;  4PYX A;  3MNJ A;  1TE3 X;  2QOA A;  1CNK A;  3P44 A;  3OIM A;  5SZ5 A;  1RZB A;  3N0N A;  4JSS A;  4R5B A;  3V3G B;  4QJW A;  5E2R A;  3MNA A;  4K0Z A;  1CAK A;  3MNK A;  3DBU A;  3T5Z A;  1YDC A;  4BF1 A;  4YGN A;  3M5S A;  4ZX1 A;  3L14 A;  4QJX A;  1I9M A;  1I9N A;  1G1D A;  3KLD B;  3MWO A;  4DZ7 A;  3IGP A;  3T85 A;  4L5U A;  3HKU A;  1G45 A;  4XZ5 A;  4Q6D A;  2NXS A;  5EH7 A;  1XPZ A;  3BL0 A;  4JSA A;  1EOU A;  2NXT A;  1DCB A;  1CAZ A;  4KUW A;  5SZ6 A;  4Q81 A;  3RYZ A;  2NWY A;  3V3I B;  3B1B A;  1RZC A;  1CCS A;  1CNG A;  4FL7 A;  1G6V A;  9CA2 A;  5EH8 A;  3PO6 A;  1BN3 A;  4CA2 A;  5SZ7 A;  4G7A A;  5FDI A;  4E3G A;  4Q09 A;  3V3F A;  4MLX A;  4MO8 A;  1J9W A;  2POU A;  1G53 A;  3V2M A;  1UGE A;  3MHO A;  4Q06 A;  4FU5 A;  5G0B A;  3DCC A;  2FNM A;  3M5E A;  3RYX B;  3D8W A;  3BET A;  4QJ0 A;  5E2N A;  3IBU A;  4RUZ A;  1LZV A;  3HS4 A;  2ABE A;  1V9E A;  5FL6 A;  3RG4 A;  4RIV A;  2HOC A;  3KIG A;  1CAL A;  1CAO A;  1IF7 A;  4E3D A;  1TG3 A;  4E3H A;  4JSW A;  1OQ5 A;  5JQ0 A;  4LU3 A;  5L6K A;  3M14 A;  4QJM A;  4QTL A;  3P55 A;  5EKH A;  1YO0 A;  3S8X A;  2HL4 A;  1UGA A;  1KWR A;  2IT4 A;  1FSR A;  3LXE A;  1HCA A;  5E5U A;  4QSI A;  4RUX A;  4Q08 A;  3CAJ A;  3HKN A;  1CAM A;  3FE4 A;  1CNW A;  1HEA A;  5DOH A;  1V9I C;  1HUH A;  1CAN A;  4Z1N A;  2NNO A;  4MDG A;  5SZ0 A;  4HEZ A;  5FNI A;  1CVD A;  3F7U A;  5JDV B;  2NNV A;  4YWP A;  1TB0 X;  2WEJ A;  1H9Q A;  4ILX A;  5LMD A;  5DSL A;  1CVE A;  3HKQ A;  5IPZ A;  2ZNC A;  4PYY A;  5E28 A;  3SAP A;  3M1J A;  4E9O X;  1BIC A;  4E5Q A;  3CA2 A;  3OIK A;  5AMD A;  4HT2 A;  3F4X A;  8CA2 A;  3ZP9 A;  1CAY A;  5DOG A;  1G54 A;  4YXI A;  1IF6 A;  3D92 A;  3M98 A;  3RZ7 A;  1BN4 A;  1DMY A;  5FNM A;  5CAC A;  3F7B A;  1CNB A;  1HCB A;  3MHM A;  4FVO A;  5JEH B;  2GD8 A;  4RFD A;  1CIN A;  4RIU A;  3DCW A;  5SZ3 A;  3T5U A;  3TVN X;  3MHI A;  5DSR A;  1HEB A;  3N3J A;  3P3H A;  4CNX A;  3N2P A;  3K34 A;  3SBI A;  4KP8 A;  3RYY A;  3RGE A;  3RZ1 B;  4TWL A;  3FFP X;  3JXG A;  3GZ0 A;  5AML A;  4YVY A;  1DCA A;  4RH2 A;  1LGD A;  4XIW A;  1YDB A;  3U45 X;  3FW3 A;  1BNT A;  3MYQ A;  4KP5 A;  3MDZ A;  1CIL A;  2WD2 A;  4YXU A;  5BNL A;  3P3J A;  1CNH A;  5JEP B;  1I9O A;  5JQT A;  5DSK A;  1BN1 A;  3SAX A;  3MNI A;  5EHV A;  4HEY A;  5HPJ A;  1RAY A;  3P58 A;  4HU1 A;  3N4B A;  2CBD A;  4E49 A;  4JSZ A;  4PXX A;  4QSB A;  1HEC A;  5CA2 A;  3D0N A;  4Q07 A;  5A6H A;  2NN7 A;  2FMZ A;  1CA3 A;  1LG6 A;  4Q8X A;  1FQL A;  5DSN A;  2WEH A;  1YO1 A;  4ZAO A;  3DAZ A;  3S9T A;  3RJ7 A;  1JD0 A;  4Q9Y A;  1YDA A;  3TVO X;  4KNM A;  5EKM A;  1G52 A;  3S97 A;  3MNH A;  3KOI A;  1CAI A;  5BRW A;  5EOI A;  4UOV A;  4MTY A;  2FOV A;  4QJO A;  4YHA A;  2CBC A;  1CVF A;  1YO2 A;  4ZX0 A;  4CNR A;  1FSQ A;  4IWZ A;  4ITP A;  3V2J A;  4YX4 A;  4YYT A;  3OY0 A;  2CBB A;  1UGB A;  3S77 B;  5DSP A;  1URT A;  3S71 B;  4CNW A;  4PZH A;  3D9Z A;  4QIZ A;  1CVH A;  3B4F A;  5G01 A;  4QSJ A;  1LUG A;  3RZ0 B;  1I9P A;  4YGF A;  5FLP A;  4FRC A;  1XEV A;  3S76 A; 
#chains in the Genus database with same CATH topology
 2F14 A;  1YDD A;  4M2R A;  4RN4 A;  3KNE A;  2OSF A;  1BCD A;  1IF9 A;  3DC9 A;  3DCS A;  4KNJ A;  4XIX A;  1CRM A;  4N16 A;  5FL4 A;  5BRV A;  5L3O A;  3KWA A;  4M2U A;  3M2X A;  2EU3 A;  4Q83 A;  1UGC A;  4YGL A;  1TEQ X;  3C7P A;  3DV7 A;  1IF5 A;  4ETQ C;  1FR4 A;  2O4Z A;  2FW4 A;  1AZM A;  1CNY A;  1TTM A;  4Q0L A;  1OKL A;  4HT0 A;  1AVN A;  5DSI A;  2X7S A;  5JEG B;  3M04 A;  4HEW A;  1ZGE A;  4Z0Q A;  1KOQ A;  12CA A;  2NMX A;  1CAJ A;  2HKK A;  3NJ9 A;  3QYK A;  1UGG A;  5JGT B;  5CLU A;  1I8Z A;  5G0C A;  1CNC A;  5A25 A;  4Q7P A;  3IBL A;  3M5T A;  3BL1 A;  4Q49 A;  4TWM A;  3UYN A;  4C3T A;  4K0T A;  4Q7S A;  3M2Y A;  4MDM A;  3VBD A;  4N0X B;  5C8I A;  1TG9 A;  4Z1J A;  4KAP A;  3W6H A;  5FNG A;  2VVB X;  4GL1 X;  2NN1 A;  1BNN A;  1T9N A;  4RUY A;  2WD3 A;  4KUY A;  3UYQ A;  1A42 A;  1BNQ A;  1I9L A;  1CNJ A;  3KS3 A;  1RAZ A;  3DD8 A;  3S72 B;  4Q90 A;  2VVA X;  3P5L A;  4IDR X;  3OKV A;  1LG5 A;  1ZSA A;  2CA2 A;  2NWZ A;  4QK2 A;  1ZNC A;  3IEO A;  4Q78 A;  4Q87 A;  4MLT A;  1TEU X;  1BNM A;  3KON A;  3F8E A;  4Z1E A;  4HBA A;  4WL4 A;  5JG3 B;  1FQM A;  2H15 A;  4KNN A;  4KV0 A;  5G03 A;  5EIJ A;  4M2V A;  2NWO A;  3HFP A;  5FNH A;  1CVB A;  1I90 A;  3P5A A;  2Q38 A;  1CVC A;  3MHC A;  1CA2 A;  1RZE A;  4WW6 A;  1CVA A;  6CA2 A;  4XFW A;  3MMF A;  3U7C A;  3ML5 A;  3NB5 A;  4QJP A;  3RLD A;  2FOQ A;  3EFT A;  3MZC A;  4Q8Y A;  4BF6 A;  3M3X A;  5DRS A;  1G46 A;  1KWQ A;  3JXF A;  1FR7 A;  1I9Q A;  3RZ5 A;  3OYS A;  4LHI A;  3M67 A;  5CJF A;  3S74 B;  3DA2 A;  3IAI A;  3M2N A;  1Y7W A;  4WUQ A;  3P4V A;  1BNV A;  5DVX A;  4Q7W A;  1XEG A;  5E2S A;  1CAH A;  2FOY A;  3HKT A;  3ML2 A;  3OKU A;  3PJJ A;  2AW1 A;  3T83 A;  3M40 A;  5JES B;  4WUP A;  1BNW A;  1G4O A;  4E3F A;  1OKM A;  3S78 B;  5DSO A;  1BNU A;  4Q8Z A;  5EH5 A;  1CRA A;  1CCT A;  2FNN A;  3V5G A;  5EKJ A;  4Z1K A;  4ZWY A;  2W2J A;  3NI5 A;  1G4J A;  1RZD A;  3V7X A;  3HLJ A;  3KKX A;  4Q7V A;  1FSN A;  3DVB A;  1CNX A;  3TMJ A;  5BYI A;  2ILI A;  4JS6 A;  2QO8 A;  5SZ4 A;  2OSM A;  4KUV A;  1DMX A;  3IBI A;  3T82 A;  2Q1B A;  2HD6 A;  3V3J A;  1G0E A;  3RYV B;  1MUA A;  1JCZ A;  1OKN A;  3MNU A;  3Q31 A;  1CZM A;  4PQ7 A;  5E5R A;  2HNC A;  2FOU A;  4CQ0 A;  2HFW A;  2NWP A;  2X7U A;  2AX2 A;  1IF8 A;  2EZ7 A;  1ZFQ A;  3EFI A;  1ZE8 A;  3U3A X;  3MHL A;  3W6I A;  2NNG A;  2NXR A;  1ZGF A;  1ZFK A;  2FMG A;  5FLQ A;  3CZV A;  4KNI A;  3U47 A;  5FDC A;  3ZNC A;  3S73 B;  1KOP A;  1MOO A;  3CYU A;  5EZT X;  2CAB A;  2CBE A;  4G0C A;  5JG5 B;  1HUG A;  5DSQ A;  5AMG A;  1TBT X;  4K0S A;  3K2F A;  4XE1 A;  5J8Z A;  5EHW A;  1G0F A;  3SBH A;  2X7T A;  1CNI A;  1RJ6 A;  4QSA A;  4QIY A;  4BCW A;  1HED A;  4QK1 A;  7CA2 A;  1FLJ A;  3M96 A;  2GEH A;  2H4N A;  3JXH C;  5JGS B;  1ZSC A;  3R16 A;  4WW8 A;  1UGF A;  4CNV A;  1XQ0 A;  3DD0 A;  2POV A;  5FLS A;  4ITO A;  5E2K A;  2POW A;  4FVN A;  5FLR A;  4CAC A;  2CBA A;  5DSJ A;  4HF3 A;  4Q99 A;  4R5A A;  2FNK A;  3KOK A;  2QP6 A;  4Y0J A;  3OIL A;  3M1K A;  4QEF A;  4E4A A;  4X5S A;  3DVC A;  3PYK A;  3M1W A;  1F2W A;  1KEQ A;  2EU2 A;  4M2W A;  4QK3 A;  4ZWZ A;  1BZM A;  4RFC A;  5SZ2 A;  4ZWI A;  1H9N A;  4Q6E A;  2NNS A;  1THK A;  2FOS A;  2WEO A;  4DZ9 A;  5BRU A;  1G48 A;  4K13 A;  5FNK A;  5E2M A;  4L5W A;  4YGJ A;  1Z9Y A;  1I91 A;  4WR7 A;  4YXO A;  1ZSB A;  5FNL A;  5EHE A;  5FLT A;  1ZH9 A;  3DVD A;  4MDL A;  1H4N A;  4K1Q A;  3K7K A;  3RYJ B;  4FPT A;  1FQN A;  1HVA A;  1Z93 A;  5FNJ A;  4L5V A;  5DSM A;  1IF4 A;  1AM6 A;  1RZA A;  3IBN A;  3OYQ A;  3R17 B;  4COQ A;  1UGD A;  1CIM A;  3M1Q A;  3T84 A;  5SZ1 A;  2Q1Q A;  3M2Z A;  1RJ5 A;  2WEG A;  1CCU A;  4R59 A;  5FL5 A;  3RZ8 A;  1G3Z A;  1JV0 A;  3V3H B;  1TH9 A;  1BV3 A;  4FIK A;  4QY3 A;  4ZWX A;  3D93 A;  1FQR A;  4LP6 A;  5FLO A;  1Z97 A;  4YGK A;  3S75 B;  3RG3 A;  3DC3 A;  4PYX A;  3MNJ A;  1TE3 X;  2QOA A;  1CNK A;  3P44 A;  3OIM A;  5SZ5 A;  1RZB A;  3N0N A;  4JSS A;  4R5B A;  3V3G B;  4QJW A;  5E2R A;  3MNA A;  4K0Z A;  1CAK A;  3MNK A;  3DBU A;  3T5Z A;  1YDC A;  4BF1 A;  4YGN A;  3M5S A;  4ZX1 A;  3L14 A;  4QJX A;  1I9M A;  1I9N A;  1G1D A;  3KLD B;  3MWO A;  4DZ7 A;  3IGP A;  3T85 A;  4L5U A;  3HKU A;  1G45 A;  4XZ5 A;  4Q6D A;  2NXS A;  5EH7 A;  1XPZ A;  3BL0 A;  4JSA A;  1EOU A;  2NXT A;  1DCB A;  1CAZ A;  4KUW A;  5SZ6 A;  4Q81 A;  3RYZ A;  2NWY A;  3V3I B;  3B1B A;  1RZC A;  1CCS A;  1CNG A;  4FL7 A;  1G6V A;  9CA2 A;  5EH8 A;  3PO6 A;  1BN3 A;  4CA2 A;  5SZ7 A;  4G7A A;  5FDI A;  4E3G A;  4Q09 A;  3V3F A;  4MLX A;  4MO8 A;  1J9W A;  2POU A;  1G53 A;  3V2M A;  1UGE A;  3MHO A;  4Q06 A;  4FU5 A;  5G0B A;  3DCC A;  2FNM A;  3M5E A;  3RYX B;  3D8W A;  3BET A;  4QJ0 A;  5E2N A;  3IBU A;  4RUZ A;  1LZV A;  3HS4 A;  2ABE A;  1V9E A;  5FL6 A;  3RG4 A;  4RIV A;  2HOC A;  3KIG A;  1CAL A;  1CAO A;  1IF7 A;  4E3D A;  1TG3 A;  4E3H A;  4JSW A;  1OQ5 A;  5JQ0 A;  4LU3 A;  5L6K A;  3M14 A;  4QJM A;  4QTL A;  3P55 A;  5EKH A;  1YO0 A;  3S8X A;  2HL4 A;  1UGA A;  1KWR A;  2IT4 A;  1FSR A;  3LXE A;  1HCA A;  5E5U A;  4QSI A;  4RUX A;  4Q08 A;  3CAJ A;  3HKN A;  1CAM A;  3FE4 A;  1CNW A;  1HEA A;  5DOH A;  1V9I C;  1HUH A;  1CAN A;  4Z1N A;  2NNO A;  4MDG A;  5SZ0 A;  4HEZ A;  5FNI A;  1CVD A;  3F7U A;  5JDV B;  2NNV A;  4YWP A;  1TB0 X;  2WEJ A;  1H9Q A;  4ILX A;  5LMD A;  5DSL A;  1CVE A;  3HKQ A;  5IPZ A;  2ZNC A;  4PYY A;  5E28 A;  3SAP A;  3M1J A;  4E9O X;  1BIC A;  4E5Q A;  3CA2 A;  3OIK A;  5AMD A;  4HT2 A;  3F4X A;  8CA2 A;  3ZP9 A;  1CAY A;  5DOG A;  1G54 A;  4YXI A;  1IF6 A;  3D92 A;  3M98 A;  3RZ7 A;  1BN4 A;  1DMY A;  5FNM A;  5CAC A;  3F7B A;  1CNB A;  1HCB A;  3MHM A;  4FVO A;  5JEH B;  2GD8 A;  4RFD A;  1CIN A;  4RIU A;  3DCW A;  5SZ3 A;  3T5U A;  3TVN X;  3MHI A;  5DSR A;  1HEB A;  3N3J A;  3P3H A;  4CNX A;  3N2P A;  3K34 A;  3SBI A;  4KP8 A;  3RYY A;  3RGE A;  3RZ1 B;  4TWL A;  3FFP X;  3JXG A;  3GZ0 A;  5AML A;  4YVY A;  1DCA A;  4RH2 A;  1LGD A;  4XIW A;  1YDB A;  3U45 X;  3FW3 A;  1BNT A;  3MYQ A;  4KP5 A;  3MDZ A;  1CIL A;  2WD2 A;  4YXU A;  5BNL A;  3P3J A;  1CNH A;  5JEP B;  1I9O A;  5JQT A;  5DSK A;  1BN1 A;  3SAX A;  3MNI A;  5EHV A;  4HEY A;  5HPJ A;  1RAY A;  3P58 A;  4HU1 A;  3N4B A;  2CBD A;  4E49 A;  4JSZ A;  4PXX A;  4QSB A;  1HEC A;  5CA2 A;  3D0N A;  4Q07 A;  5A6H A;  2NN7 A;  2FMZ A;  1CA3 A;  1LG6 A;  4Q8X A;  1FQL A;  5DSN A;  2WEH A;  1YO1 A;  4ZAO A;  3DAZ A;  3S9T A;  3RJ7 A;  1JD0 A;  4Q9Y A;  1YDA A;  3TVO X;  4KNM A;  5EKM A;  1G52 A;  3S97 A;  3MNH A;  3KOI A;  1CAI A;  5BRW A;  5EOI A;  4UOV A;  4MTY A;  2FOV A;  4QJO A;  4YHA A;  2CBC A;  1CVF A;  1YO2 A;  4ZX0 A;  4CNR A;  1FSQ A;  4IWZ A;  4ITP A;  3V2J A;  4YX4 A;  4YYT A;  3OY0 A;  2CBB A;  1UGB A;  3S77 B;  5DSP A;  1URT A;  3S71 B;  4CNW A;  4PZH A;  3D9Z A;  4QIZ A;  1CVH A;  3B4F A;  5G01 A;  4QSJ A;  1LUG A;  3RZ0 B;  1I9P A;  4YGF A;  5FLP A;  4FRC A;  1XEV A;  3S76 A; 
#chains in the Genus database with same CATH homology
 2F14 A;  1YDD A;  4M2R A;  4RN4 A;  3KNE A;  2OSF A;  1BCD A;  1IF9 A;  3DC9 A;  3DCS A;  4KNJ A;  4XIX A;  1CRM A;  4N16 A;  5FL4 A;  5BRV A;  5L3O A;  3KWA A;  4M2U A;  3M2X A;  2EU3 A;  4Q83 A;  1UGC A;  4YGL A;  1TEQ X;  3C7P A;  3DV7 A;  1IF5 A;  4ETQ C;  1FR4 A;  2O4Z A;  2FW4 A;  1AZM A;  1CNY A;  1TTM A;  4Q0L A;  1OKL A;  4HT0 A;  1AVN A;  5DSI A;  2X7S A;  5JEG B;  3M04 A;  4HEW A;  1ZGE A;  4Z0Q A;  1KOQ A;  12CA A;  2NMX A;  1CAJ A;  2HKK A;  3NJ9 A;  3QYK A;  1UGG A;  5JGT B;  5CLU A;  1I8Z A;  5G0C A;  1CNC A;  5A25 A;  4Q7P A;  3IBL A;  3M5T A;  3BL1 A;  4Q49 A;  4TWM A;  3UYN A;  4C3T A;  4K0T A;  4Q7S A;  3M2Y A;  4MDM A;  3VBD A;  4N0X B;  5C8I A;  1TG9 A;  4Z1J A;  4KAP A;  3W6H A;  5FNG A;  2VVB X;  4GL1 X;  2NN1 A;  1BNN A;  1T9N A;  4RUY A;  2WD3 A;  4KUY A;  3UYQ A;  1A42 A;  1BNQ A;  1I9L A;  1CNJ A;  3KS3 A;  1RAZ A;  3DD8 A;  3S72 B;  4Q90 A;  2VVA X;  3P5L A;  4IDR X;  3OKV A;  1LG5 A;  1ZSA A;  2CA2 A;  2NWZ A;  4QK2 A;  1ZNC A;  3IEO A;  4Q78 A;  4Q87 A;  4MLT A;  1TEU X;  1BNM A;  3KON A;  3F8E A;  4Z1E A;  4HBA A;  4WL4 A;  5JG3 B;  1FQM A;  2H15 A;  4KNN A;  4KV0 A;  5G03 A;  5EIJ A;  4M2V A;  2NWO A;  3HFP A;  5FNH A;  1CVB A;  1I90 A;  3P5A A;  2Q38 A;  1CVC A;  3MHC A;  1CA2 A;  1RZE A;  4WW6 A;  1CVA A;  6CA2 A;  4XFW A;  3MMF A;  3U7C A;  3ML5 A;  3NB5 A;  4QJP A;  3RLD A;  2FOQ A;  3EFT A;  3MZC A;  4Q8Y A;  4BF6 A;  3M3X A;  5DRS A;  1G46 A;  1KWQ A;  3JXF A;  1FR7 A;  1I9Q A;  3RZ5 A;  3OYS A;  4LHI A;  3M67 A;  5CJF A;  3S74 B;  3DA2 A;  3IAI A;  3M2N A;  1Y7W A;  4WUQ A;  3P4V A;  1BNV A;  5DVX A;  4Q7W A;  1XEG A;  5E2S A;  1CAH A;  2FOY A;  3HKT A;  3ML2 A;  3OKU A;  3PJJ A;  2AW1 A;  3T83 A;  3M40 A;  5JES B;  4WUP A;  1BNW A;  1G4O A;  4E3F A;  1OKM A;  3S78 B;  5DSO A;  1BNU A;  4Q8Z A;  5EH5 A;  1CRA A;  1CCT A;  2FNN A;  3V5G A;  5EKJ A;  4Z1K A;  4ZWY A;  2W2J A;  3NI5 A;  1G4J A;  1RZD A;  3V7X A;  3HLJ A;  3KKX A;  4Q7V A;  1FSN A;  3DVB A;  1CNX A;  3TMJ A;  5BYI A;  2ILI A;  4JS6 A;  2QO8 A;  5SZ4 A;  2OSM A;  4KUV A;  1DMX A;  3IBI A;  3T82 A;  2Q1B A;  2HD6 A;  3V3J A;  1G0E A;  3RYV B;  1MUA A;  1JCZ A;  1OKN A;  3MNU A;  3Q31 A;  1CZM A;  4PQ7 A;  5E5R A;  2HNC A;  2FOU A;  4CQ0 A;  2HFW A;  2NWP A;  2X7U A;  2AX2 A;  1IF8 A;  2EZ7 A;  1ZFQ A;  3EFI A;  1ZE8 A;  3U3A X;  3MHL A;  3W6I A;  2NNG A;  2NXR A;  1ZGF A;  1ZFK A;  2FMG A;  5FLQ A;  3CZV A;  4KNI A;  3U47 A;  5FDC A;  3ZNC A;  3S73 B;  1KOP A;  1MOO A;  3CYU A;  5EZT X;  2CAB A;  2CBE A;  4G0C A;  5JG5 B;  1HUG A;  5DSQ A;  5AMG A;  1TBT X;  4K0S A;  3K2F A;  4XE1 A;  5J8Z A;  5EHW A;  1G0F A;  3SBH A;  2X7T A;  1CNI A;  1RJ6 A;  4QSA A;  4QIY A;  4BCW A;  1HED A;  4QK1 A;  7CA2 A;  1FLJ A;  3M96 A;  2GEH A;  2H4N A;  3JXH C;  5JGS B;  1ZSC A;  3R16 A;  4WW8 A;  1UGF A;  4CNV A;  1XQ0 A;  3DD0 A;  2POV A;  5FLS A;  4ITO A;  5E2K A;  2POW A;  4FVN A;  5FLR A;  4CAC A;  2CBA A;  5DSJ A;  4HF3 A;  4Q99 A;  4R5A A;  2FNK A;  3KOK A;  2QP6 A;  4Y0J A;  3OIL A;  3M1K A;  4QEF A;  4E4A A;  4X5S A;  3DVC A;  3PYK A;  3M1W A;  1F2W A;  1KEQ A;  2EU2 A;  4M2W A;  4QK3 A;  4ZWZ A;  1BZM A;  4RFC A;  5SZ2 A;  4ZWI A;  1H9N A;  4Q6E A;  2NNS A;  1THK A;  2FOS A;  2WEO A;  4DZ9 A;  5BRU A;  1G48 A;  4K13 A;  5FNK A;  5E2M A;  4L5W A;  4YGJ A;  1Z9Y A;  1I91 A;  4WR7 A;  4YXO A;  1ZSB A;  5FNL A;  5EHE A;  5FLT A;  1ZH9 A;  3DVD A;  4MDL A;  1H4N A;  4K1Q A;  3K7K A;  3RYJ B;  4FPT A;  1FQN A;  1HVA A;  1Z93 A;  5FNJ A;  4L5V A;  5DSM A;  1IF4 A;  1AM6 A;  1RZA A;  3IBN A;  3OYQ A;  3R17 B;  4COQ A;  1UGD A;  1CIM A;  3M1Q A;  3T84 A;  5SZ1 A;  2Q1Q A;  3M2Z A;  1RJ5 A;  2WEG A;  1CCU A;  4R59 A;  5FL5 A;  3RZ8 A;  1G3Z A;  1JV0 A;  3V3H B;  1TH9 A;  1BV3 A;  4FIK A;  4QY3 A;  4ZWX A;  3D93 A;  1FQR A;  4LP6 A;  5FLO A;  1Z97 A;  4YGK A;  3S75 B;  3RG3 A;  3DC3 A;  4PYX A;  3MNJ A;  1TE3 X;  2QOA A;  1CNK A;  3P44 A;  3OIM A;  5SZ5 A;  1RZB A;  3N0N A;  4JSS A;  4R5B A;  3V3G B;  4QJW A;  5E2R A;  3MNA A;  4K0Z A;  1CAK A;  3MNK A;  3DBU A;  3T5Z A;  1YDC A;  4BF1 A;  4YGN A;  3M5S A;  4ZX1 A;  3L14 A;  4QJX A;  1I9M A;  1I9N A;  1G1D A;  3KLD B;  3MWO A;  4DZ7 A;  3IGP A;  3T85 A;  4L5U A;  3HKU A;  1G45 A;  4XZ5 A;  4Q6D A;  2NXS A;  5EH7 A;  1XPZ A;  3BL0 A;  4JSA A;  1EOU A;  2NXT A;  1DCB A;  1CAZ A;  4KUW A;  5SZ6 A;  4Q81 A;  3RYZ A;  2NWY A;  3V3I B;  3B1B A;  1RZC A;  1CCS A;  1CNG A;  4FL7 A;  1G6V A;  9CA2 A;  5EH8 A;  3PO6 A;  1BN3 A;  4CA2 A;  5SZ7 A;  4G7A A;  5FDI A;  4E3G A;  4Q09 A;  3V3F A;  4MLX A;  4MO8 A;  1J9W A;  2POU A;  1G53 A;  3V2M A;  1UGE A;  3MHO A;  4Q06 A;  4FU5 A;  5G0B A;  3DCC A;  2FNM A;  3M5E A;  3RYX B;  3D8W A;  3BET A;  4QJ0 A;  5E2N A;  3IBU A;  4RUZ A;  1LZV A;  3HS4 A;  2ABE A;  1V9E A;  5FL6 A;  3RG4 A;  4RIV A;  2HOC A;  3KIG A;  1CAL A;  1CAO A;  1IF7 A;  4E3D A;  1TG3 A;  4E3H A;  4JSW A;  1OQ5 A;  5JQ0 A;  4LU3 A;  5L6K A;  3M14 A;  4QJM A;  4QTL A;  3P55 A;  5EKH A;  1YO0 A;  3S8X A;  2HL4 A;  1UGA A;  1KWR A;  2IT4 A;  1FSR A;  3LXE A;  1HCA A;  5E5U A;  4QSI A;  4RUX A;  4Q08 A;  3CAJ A;  3HKN A;  1CAM A;  3FE4 A;  1CNW A;  1HEA A;  5DOH A;  1V9I C;  1HUH A;  1CAN A;  4Z1N A;  2NNO A;  4MDG A;  5SZ0 A;  4HEZ A;  5FNI A;  1CVD A;  3F7U A;  5JDV B;  2NNV A;  4YWP A;  1TB0 X;  2WEJ A;  1H9Q A;  4ILX A;  5LMD A;  5DSL A;  1CVE A;  3HKQ A;  5IPZ A;  2ZNC A;  4PYY A;  5E28 A;  3SAP A;  3M1J A;  4E9O X;  1BIC A;  4E5Q A;  3CA2 A;  3OIK A;  5AMD A;  4HT2 A;  3F4X A;  8CA2 A;  3ZP9 A;  1CAY A;  5DOG A;  1G54 A;  4YXI A;  1IF6 A;  3D92 A;  3M98 A;  3RZ7 A;  1BN4 A;  1DMY A;  5FNM A;  5CAC A;  3F7B A;  1CNB A;  1HCB A;  3MHM A;  4FVO A;  5JEH B;  2GD8 A;  4RFD A;  1CIN A;  4RIU A;  3DCW A;  5SZ3 A;  3T5U A;  3TVN X;  3MHI A;  5DSR A;  1HEB A;  3N3J A;  3P3H A;  4CNX A;  3N2P A;  3K34 A;  3SBI A;  4KP8 A;  3RYY A;  3RGE A;  3RZ1 B;  4TWL A;  3FFP X;  3JXG A;  3GZ0 A;  5AML A;  4YVY A;  1DCA A;  4RH2 A;  1LGD A;  4XIW A;  1YDB A;  3U45 X;  3FW3 A;  1BNT A;  3MYQ A;  4KP5 A;  3MDZ A;  1CIL A;  2WD2 A;  4YXU A;  5BNL A;  3P3J A;  1CNH A;  5JEP B;  1I9O A;  5JQT A;  5DSK A;  1BN1 A;  3SAX A;  3MNI A;  5EHV A;  4HEY A;  5HPJ A;  1RAY A;  3P58 A;  4HU1 A;  3N4B A;  2CBD A;  4E49 A;  4JSZ A;  4PXX A;  4QSB A;  1HEC A;  5CA2 A;  3D0N A;  4Q07 A;  5A6H A;  2NN7 A;  2FMZ A;  1CA3 A;  1LG6 A;  4Q8X A;  1FQL A;  5DSN A;  2WEH A;  1YO1 A;  4ZAO A;  3DAZ A;  3S9T A;  3RJ7 A;  1JD0 A;  4Q9Y A;  1YDA A;  3TVO X;  4KNM A;  5EKM A;  1G52 A;  3S97 A;  3MNH A;  3KOI A;  1CAI A;  5BRW A;  5EOI A;  4UOV A;  4MTY A;  2FOV A;  4QJO A;  4YHA A;  2CBC A;  1CVF A;  1YO2 A;  4ZX0 A;  4CNR A;  1FSQ A;  4IWZ A;  4ITP A;  3V2J A;  4YX4 A;  4YYT A;  3OY0 A;  2CBB A;  1UGB A;  3S77 B;  5DSP A;  1URT A;  3S71 B;  4CNW A;  4PZH A;  3D9Z A;  4QIZ A;  1CVH A;  3B4F A;  5G01 A;  4QSJ A;  1LUG A;  3RZ0 B;  1I9P A;  4YGF A;  5FLP A;  4FRC A;  1XEV A;  3S76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...