4QIZA

Crystal structure of human carbonic anhydrase isozyme xiii with inhibitor
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
Knots found
sequence length
258
structure length
258
Chain Sequence
SWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Carbonic anhydrase 13
publication title Functionalization of Fluorinated Benzenesulfonamides and Their Inhibitory Properties toward Carbonic Anhydrases
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 258
sequence length 258
chains with identical sequence B
other databases KnotProt 2.0: S +31
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00194 Carb_anhydrase Eukaryotic-type carbonic anhydrase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.200.10 Alpha Beta Roll Carbonic Anhydrase II Alpha carbonic anhydrase 4qizA00
3CA2A 3IEOA 1BN1A 5FNJA 1CVHA 2Q1BA 4Q6EA 1YO0A 4JSWA 5DSPA 1G52A 3IBLA 3DCCA 4KV0A 4TWMA 4M2RA 4KUYA 4UOVA 5DOHA 3RZ7A 4ETQC 1RZEA 2X7TA 2FOUA 4YGJA 2ZNCA 3EFIA 3JXFA 5A25A 3M2ZA 4YWPA 2AW1A 3DV7A 1UGAA 1FR4A 5SZ1A 2CBDA 3N4BA 3OKVA 3BETA 5AMLA 6CA2A 4M2UA 4Q8YA 3S8XA 2POVA 5FNKA 1LG6A 4L5UA 5E2KA 1Y7WA 3T5ZA 2NNSA 1HECA 5E5RA 1OQ5A 3F4XA 3MNIA 4TWLA 4ZX0A 1Z93A 5FNIA 1ZGEA 4QK1A 4Q7SA 2POUA 5EKMA 2CBEA 5FNGA 3T82A 1THKA 4Z1EA 3HKUA 3RYJB 4E3GA 4QJ0A 1CAZA 4E3FA 2FOSA 1V9IC 1XEGA 3DCWA 3MHIA 1CVAA 1CCTA 5E5UA 1OKMA 3GZ0A 5EKHA 1IF9A 5EIJA 4MLXA 3DA2A 1BNMA 3MNKA 3M98A 1TH9A 3T5UA 4Y0JA 4X5SA 2FNMA 1LZVA 3OY0A 5FLPA 5L3OA 4Z1JA 1CILA 5FLQA 5EHWA 4QY3A 3V7XA 4BCWA 4CNVA 1Z97A 1I9PA 4E4AA 1G54A 1BZMA 1BNTA 1G3ZA 1V9EA 2AX2A 3D93A 5JG3B 1BCDA 3P55A 1H9QA 3ML2A 3U45X 3Q31A 4FPTA 2HD6A 2ABEA 1DCBA 3KWAA 4CA2A 1G4OA 3V3HB 4HEZA 3RG4A 3EFTA 2NN7A 1IF8A 4YGFA 2FW4A 1HVAA 3B1BA 3CYUA 3N0NA 5JGTB 1RJ5A 3HKNA 3DBUA 4Q6DA 1EOUA 2FNKA 1RAZA 3P5LA 1G46A 2EU3A 4RUYA 3RJ7A 4E49A 3LXEA 2NMXA 4ZAOA 3M14A 5JDVB 4R59A 1I9NA 5DOGA 3SBHA 4LHIA 5DSRA 4CACA 3R17B 5FL6A 5JEGB 3JXGA 2O4ZA 2FOYA 1I91A 2NXSA 4WL4A 2HL4A 4RFCA 3PYKA 4PZHA 3P58A 3MWOA 2HKKA 4XZ5A 3KKXA 1YDBA 4QSJA 3V3IB 3DC3A 1YDCA 4JSSA 1CINA 3ML5A 5FLRA 4L5WA 5FLSA 5FNHA 1CANA 3HKTA 1CNJA 1CNHA 2FOQA 1FQRA 5E28A 1ZFKA 1H9NA 1J9WA 2HOCA 5JEPB 2WD2A 1CAIA 1FQNA 1RAYA 3NJ9A 5EHEA 3M1QA 5IPZA 4DZ9A 1HEBA 1TG9A 1FSNA 5L6KA 4ZWYA 3BL0A 1G0EA 3OYSA 1BN4A 4HBAA 1F2WA 5G01A 1UGGA 5JQ0A 4PYYA 3SAPA 3V2MA 4KP8A 1CRAA 1G6VA 1UGFA 1DMYA 3V3FA 1ZSBA 3S71B 1FQLA 1Z9YA 4KNIA 4CNWA 4COQA 4RUZA 4QSBA 5JQTA 4PQ7A 4Z0QA 4HEWA 1RZDA 1LUGA 1FR7A 1BNQA 1CNGA 4CNXA 1YO1A 4WUPA 1H4NA 2WEHA 4YX4A 5BYIA 3KOKA 4KUVA 2QP6A 5DVXA 4YXUA 3OYQA 4MDLA 3HKQA 3T83A 3M2NA 3M96A 5BRVA 3M5EA 3ZNCA 1T9NA 4RH2A 3HS4A 4KAPA 1RZAA 5G0BA 1TEQX 1CAOA 3MMFA 1MOOA 4ZWZA 4QJOA 1I9OA 3U47A 1IF7A 1KWQA 5JG5B 4ITOA 5CLUA 5CACA 2QOAA 4YGLA 3P4VA 3S78B 3JXHC 4QIYA 4E3DA 4E9OX 1XPZA 4XIXA 5FNLA 3W6IA 4Z1NA 4Q7VA 1ZSAA 1FLJA 4FVNA 4YGKA 4Q99A 4YGNA 1I9MA 5HPJA 4KNNA 4QIZA 3M1WA 3MNJA 2WEGA 1CCSA 1UGDA 3D8WA 4Q8ZA 3P3HA 1HUGA 1CVEA 4M2VA 9CA2A 4Q90A 4HT2A 4Q06A 4WUQA 3TVNX 4FU5A 4N0XB 1HCAA 3S9TA 3V5GA 1CVDA 3MZCA 8CA2A 1HEAA 5JGSB 1UGCA 1OKLA 3M5SA 4QSIA 3P5AA 3KS3A 4Q0LA 3MNHA 3S76A 4E3HA 2NNVA 1YDAA 5CJFA 4FRCA 5FL4A 5E2SA 1TG3A 3RYYA 5FNMA 1CAMA 1TBTX 1HCBA 4IDRX 3S74B 5AMGA 3S73B 1XEVA 4Q83A 4K1QA 1JCZA 2W2JA 5FDCA 3FE4A 1YDDA 2WEOA 4M2WA 5EKJA 2VVBX 4Q08A 4Q81A 2GEHA 1CA2A 3HFPA 4Q07A 2WEJA 3MHMA 5LMDA 4QJMA 1FSRA 5DSLA 1CVBA 4BF1A 3DD8A 3SAXA 3F7UA 5EH5A 1AVNA 1CNBA 2NWYA 2FNNA 5SZ0A 4RFDA 5BNLA 5SZ4A 1HEDA 3DC9A 3DVDA 4L5VA 3V3JA 3R16A 4R5BA 1XQ0A 3U7CA 3IBNA 4MDMA 4PYXA 1BNNA 1MUAA 4Q7PA 4RIVA 5J8ZA 3MYQA 2H15A 3MNAA 3IBUA 3DAZA 3SBIA 1DCAA 5DSQA 3M1KA 1I9LA 4Q09A 4Q8XA 2POWA 1URTA 3D9ZA 3ZP9A 4HEYA 4YHAA 4FVOA 4QJPA 3V2JA 4ILXA 3IBIA 5SZ7A 4BF6A 2X7SA 5EH7A 1IF4A 1I9QA 3M2XA 2CABA 1CNKA 4JSAA 4E5QA 3RZ1B 3OIKA 4ITPA 3NI5A 1CAHA 1ZFQA 2WD3A 4QJWA 5CA2A 2NWPA 4YVYA 2EU2A 3VBDA 1CVCA 3RYZA 2Q38A 1A42A 4FIKA 1CNXA 3M1JA 4IWZA 5BRWA 4XIWA 3NB5A 4LU3A 2CBCA 1ZNCA 1JD0A 1LG5A 2ILIA 4MLTA 5EZTX 2F14A 5E2RA 4JS6A 1JV0A 3RZ8A 3DCSA 3KIGA 3M5TA 4QK2A 4Z1KA 1CRMA 3MDZA 5G0CA 1KOPA 5E2MA 4JSZA 5EH8A 3K2FA 4YXIA 1FSQA 3DVBA 7CA2A 2NWZA 1AZMA 3HLJA 5AMDA 3P44A 1CZMA 3B4FA 4HT0A 4WR7A 5SZ6A 3RLDA 4XE1A 1BNVA 1CVFA 1CNWA 4ZX1A 3IGPA 2NN1A 3PO6A 4QTLA 5G03A 1LGDA 3UYQA 3U3AX 1RZCA 3M3XA 2OSMA 3BL1A 1CNYA 1CALA 3P3JA 5DSMA 1RZBA 1CNIA 5EOIA 1KOQA 3UYNA 2HFWA 3S97A 2NNGA 4RN4A 1DMXA 3PJJA 3L14A 3RZ5A 4PXXA 5SZ5A 3F7BA 1CAJA 2FMGA 2VVAX 3RG3A 4QJXA 4WW8A 2Q1QA 5DRSA 1UGBA 4QK3A 4Q49A 4Q7WA 1CAKA 3D92A 1BV3A 2X7UA 3T85A 3OIMA 4WW6A 3N3JA 3M2YA 5FDIA 4Q78A 1UGEA 2CA2A 3K34A 2NXTA 2CBAA 4YXOA 2EZ7A 3KNEA 1IF6A 1BICA 3OKUA 1CNCA 1RJ6A 2GD8A 2CBBA 2FOVA 5A6HA 2NXRA 3IAIA 5E2NA 1ZGFA 1TEUX 1HUHA 1G0FA 4G7AA 4YYTA 3CAJA 4KNMA 1G45A 1BN3A 2IT4A 4MTYA 5BRUA 5DSJA 1OKNA 4QSAA 4DZ7A 3RZ0B 4N16A 4FL7A 4KNJA 3DVCA 3M04A 4ZWXA 4MO8A 4R5AA 4LP6A 2OSFA 3KOIA 4RUXA 4KUWA 1FQMA 3V3GB 1CIMA 5C8IA 4XFWA 1IF5A 5DSNA 2H4NA 1TE3X 1ZH9A 1G53A 5EHVA 3MHLA 4GL1X 5FLOA 3S77B 5JEHB 1BNWA 4K0TA 1I90A 2NWOA 3QYKA 5DSOA 3TMJA 5SZ3A 4Q87A 3D0NA 5FLTA 4QEFA 1TTMA 3M40A 3KLDB 1KEQA 4K13A 3RYVB 5DSIA 1AM6A 1G1DA 1BNUA 1I8ZA 3KONA 4G0CA 4K0ZA 3S72B 1CAYA 3MNUA 4RIUA 3C7PA 2QO8A 4HU1A 4MDGA 1KWRA 3FW3A 3FFPX 4Q9YA 3DD0A 3RGEA 4KP5A 3MHCA 3MHOA 1YO2A 4CNRA 3TVOX 2NNOA 3OILA 3K7KA 3S75B 1ZSCA 5DSKA 1ZE8A 3RYXB 3W6HA 3N2PA 1TB0X 3M67A 4HF3A 1G4JA 5SZ2A 2FMZA 4ZWIA 3CZVA 5FL5A 5JESB 1G48A 3F8EA 4CQ0A 12CAA 1CCUA 3T84A 4K0SA 4C3TA 2HNCA 1CA3A
chains in the Genus database with same CATH superfamily
3CA2A 3IEOA 1BN1A 5FNJA 1CVHA 2Q1BA 4Q6EA 1YO0A 4JSWA 5DSPA 1G52A 3IBLA 3DCCA 4KV0A 4TWMA 4M2RA 4KUYA 4UOVA 5DOHA 3RZ7A 4ETQC 1RZEA 2X7TA 2FOUA 4YGJA 2ZNCA 3EFIA 3JXFA 5A25A 3M2ZA 4YWPA 2AW1A 3DV7A 1UGAA 1FR4A 5SZ1A 2CBDA 3N4BA 3OKVA 3BETA 5AMLA 6CA2A 4M2UA 4Q8YA 3S8XA 2POVA 5FNKA 1LG6A 4L5UA 5E2KA 1Y7WA 3T5ZA 2NNSA 1HECA 5E5RA 1OQ5A 3F4XA 3MNIA 4TWLA 4ZX0A 1Z93A 5FNIA 1ZGEA 4QK1A 4Q7SA 2POUA 5EKMA 2CBEA 5FNGA 3T82A 1THKA 4Z1EA 3HKUA 3RYJB 4E3GA 4QJ0A 1CAZA 4E3FA 2FOSA 1V9IC 1XEGA 3DCWA 3MHIA 1CVAA 1CCTA 5E5UA 1OKMA 3GZ0A 5EKHA 1IF9A 5EIJA 4MLXA 3DA2A 1BNMA 3MNKA 3M98A 1TH9A 3T5UA 4Y0JA 4X5SA 2FNMA 1LZVA 3OY0A 5FLPA 5L3OA 4Z1JA 1CILA 5FLQA 5EHWA 4QY3A 3V7XA 4BCWA 4CNVA 1Z97A 1I9PA 4E4AA 1G54A 1BZMA 1BNTA 1G3ZA 1V9EA 2AX2A 3D93A 5JG3B 1BCDA 3P55A 1H9QA 3ML2A 3U45X 3Q31A 4FPTA 2HD6A 2ABEA 1DCBA 3KWAA 4CA2A 1G4OA 3V3HB 4HEZA 3RG4A 3EFTA 2NN7A 1IF8A 4YGFA 2FW4A 1HVAA 3B1BA 3CYUA 3N0NA 5JGTB 1RJ5A 3HKNA 3DBUA 4Q6DA 1EOUA 2FNKA 1RAZA 3P5LA 1G46A 2EU3A 4RUYA 3RJ7A 4E49A 3LXEA 2NMXA 4ZAOA 3M14A 5JDVB 4R59A 1I9NA 5DOGA 3SBHA 4LHIA 5DSRA 4CACA 3R17B 5FL6A 5JEGB 3JXGA 2O4ZA 2FOYA 1I91A 2NXSA 4WL4A 2HL4A 4RFCA 3PYKA 4PZHA 3P58A 3MWOA 2HKKA 4XZ5A 3KKXA 1YDBA 4QSJA 3V3IB 3DC3A 1YDCA 4JSSA 1CINA 3ML5A 5FLRA 4L5WA 5FLSA 5FNHA 1CANA 3HKTA 1CNJA 1CNHA 2FOQA 1FQRA 5E28A 1ZFKA 1H9NA 1J9WA 2HOCA 5JEPB 2WD2A 1CAIA 1FQNA 1RAYA 3NJ9A 5EHEA 3M1QA 5IPZA 4DZ9A 1HEBA 1TG9A 1FSNA 5L6KA 4ZWYA 3BL0A 1G0EA 3OYSA 1BN4A 4HBAA 1F2WA 5G01A 1UGGA 5JQ0A 4PYYA 3SAPA 3V2MA 4KP8A 1CRAA 1G6VA 1UGFA 1DMYA 3V3FA 1ZSBA 3S71B 1FQLA 1Z9YA 4KNIA 4CNWA 4COQA 4RUZA 4QSBA 5JQTA 4PQ7A 4Z0QA 4HEWA 1RZDA 1LUGA 1FR7A 1BNQA 1CNGA 4CNXA 1YO1A 4WUPA 1H4NA 2WEHA 4YX4A 5BYIA 3KOKA 4KUVA 2QP6A 5DVXA 4YXUA 3OYQA 4MDLA 3HKQA 3T83A 3M2NA 3M96A 5BRVA 3M5EA 3ZNCA 1T9NA 4RH2A 3HS4A 4KAPA 1RZAA 5G0BA 1TEQX 1CAOA 3MMFA 1MOOA 4ZWZA 4QJOA 1I9OA 3U47A 1IF7A 1KWQA 5JG5B 4ITOA 5CLUA 5CACA 2QOAA 4YGLA 3P4VA 3S78B 3JXHC 4QIYA 4E3DA 4E9OX 1XPZA 4XIXA 5FNLA 3W6IA 4Z1NA 4Q7VA 1ZSAA 1FLJA 4FVNA 4YGKA 4Q99A 4YGNA 1I9MA 5HPJA 4KNNA 4QIZA 3M1WA 3MNJA 2WEGA 1CCSA 1UGDA 3D8WA 4Q8ZA 3P3HA 1HUGA 1CVEA 4M2VA 9CA2A 4Q90A 4HT2A 4Q06A 4WUQA 3TVNX 4FU5A 4N0XB 1HCAA 3S9TA 3V5GA 1CVDA 3MZCA 8CA2A 1HEAA 5JGSB 1UGCA 1OKLA 3M5SA 4QSIA 3P5AA 3KS3A 4Q0LA 3MNHA 3S76A 4E3HA 2NNVA 1YDAA 5CJFA 4FRCA 5FL4A 5E2SA 1TG3A 3RYYA 5FNMA 1CAMA 1TBTX 1HCBA 4IDRX 3S74B 5AMGA 3S73B 1XEVA 4Q83A 4K1QA 1JCZA 2W2JA 5FDCA 3FE4A 1YDDA 2WEOA 4M2WA 5EKJA 2VVBX 4Q08A 4Q81A 2GEHA 1CA2A 3HFPA 4Q07A 2WEJA 3MHMA 5LMDA 4QJMA 1FSRA 5DSLA 1CVBA 4BF1A 3DD8A 3SAXA 3F7UA 5EH5A 1AVNA 1CNBA 2NWYA 2FNNA 5SZ0A 4RFDA 5BNLA 5SZ4A 1HEDA 3DC9A 3DVDA 4L5VA 3V3JA 3R16A 4R5BA 1XQ0A 3U7CA 3IBNA 4MDMA 4PYXA 1BNNA 1MUAA 4Q7PA 4RIVA 5J8ZA 3MYQA 2H15A 3MNAA 3IBUA 3DAZA 3SBIA 1DCAA 5DSQA 3M1KA 1I9LA 4Q09A 4Q8XA 2POWA 1URTA 3D9ZA 3ZP9A 4HEYA 4YHAA 4FVOA 4QJPA 3V2JA 4ILXA 3IBIA 5SZ7A 4BF6A 2X7SA 5EH7A 1IF4A 1I9QA 3M2XA 2CABA 1CNKA 4JSAA 4E5QA 3RZ1B 3OIKA 4ITPA 3NI5A 1CAHA 1ZFQA 2WD3A 4QJWA 5CA2A 2NWPA 4YVYA 2EU2A 3VBDA 1CVCA 3RYZA 2Q38A 1A42A 4FIKA 1CNXA 3M1JA 4IWZA 5BRWA 4XIWA 3NB5A 4LU3A 2CBCA 1ZNCA 1JD0A 1LG5A 2ILIA 4MLTA 5EZTX 2F14A 5E2RA 4JS6A 1JV0A 3RZ8A 3DCSA 3KIGA 3M5TA 4QK2A 4Z1KA 1CRMA 3MDZA 5G0CA 1KOPA 5E2MA 4JSZA 5EH8A 3K2FA 4YXIA 1FSQA 3DVBA 7CA2A 2NWZA 1AZMA 3HLJA 5AMDA 3P44A 1CZMA 3B4FA 4HT0A 4WR7A 5SZ6A 3RLDA 4XE1A 1BNVA 1CVFA 1CNWA 4ZX1A 3IGPA 2NN1A 3PO6A 4QTLA 5G03A 1LGDA 3UYQA 3U3AX 1RZCA 3M3XA 2OSMA 3BL1A 1CNYA 1CALA 3P3JA 5DSMA 1RZBA 1CNIA 5EOIA 1KOQA 3UYNA 2HFWA 3S97A 2NNGA 4RN4A 1DMXA 3PJJA 3L14A 3RZ5A 4PXXA 5SZ5A 3F7BA 1CAJA 2FMGA 2VVAX 3RG3A 4QJXA 4WW8A 2Q1QA 5DRSA 1UGBA 4QK3A 4Q49A 4Q7WA 1CAKA 3D92A 1BV3A 2X7UA 3T85A 3OIMA 4WW6A 3N3JA 3M2YA 5FDIA 4Q78A 1UGEA 2CA2A 3K34A 2NXTA 2CBAA 4YXOA 2EZ7A 3KNEA 1IF6A 1BICA 3OKUA 1CNCA 1RJ6A 2GD8A 2CBBA 2FOVA 5A6HA 2NXRA 3IAIA 5E2NA 1ZGFA 1TEUX 1HUHA 1G0FA 4G7AA 4YYTA 3CAJA 4KNMA 1G45A 1BN3A 2IT4A 4MTYA 5BRUA 5DSJA 1OKNA 4QSAA 4DZ7A 3RZ0B 4N16A 4FL7A 4KNJA 3DVCA 3M04A 4ZWXA 4MO8A 4R5AA 4LP6A 2OSFA 3KOIA 4RUXA 4KUWA 1FQMA 3V3GB 1CIMA 5C8IA 4XFWA 1IF5A 5DSNA 2H4NA 1TE3X 1ZH9A 1G53A 5EHVA 3MHLA 4GL1X 5FLOA 3S77B 5JEHB 1BNWA 4K0TA 1I90A 2NWOA 3QYKA 5DSOA 3TMJA 5SZ3A 4Q87A 3D0NA 5FLTA 4QEFA 1TTMA 3M40A 3KLDB 1KEQA 4K13A 3RYVB 5DSIA 1AM6A 1G1DA 1BNUA 1I8ZA 3KONA 4G0CA 4K0ZA 3S72B 1CAYA 3MNUA 4RIUA 3C7PA 2QO8A 4HU1A 4MDGA 1KWRA 3FW3A 3FFPX 4Q9YA 3DD0A 3RGEA 4KP5A 3MHCA 3MHOA 1YO2A 4CNRA 3TVOX 2NNOA 3OILA 3K7KA 3S75B 1ZSCA 5DSKA 1ZE8A 3RYXB 3W6HA 3N2PA 1TB0X 3M67A 4HF3A 1G4JA 5SZ2A 2FMZA 4ZWIA 3CZVA 5FL5A 5JESB 1G48A 3F8EA 4CQ0A 12CAA 1CCUA 3T84A 4K0SA 4C3TA 2HNCA 1CA3A
chains in the Genus database with same CATH topology
3CA2A 3IEOA 1BN1A 5FNJA 1CVHA 2Q1BA 4Q6EA 1YO0A 4JSWA 5DSPA 1G52A 3IBLA 3DCCA 4KV0A 4TWMA 4M2RA 4KUYA 4UOVA 5DOHA 3RZ7A 4ETQC 1RZEA 2X7TA 2FOUA 4YGJA 2ZNCA 3EFIA 3JXFA 5A25A 3M2ZA 4YWPA 2AW1A 3DV7A 1UGAA 1FR4A 5SZ1A 2CBDA 3N4BA 3OKVA 3BETA 5AMLA 6CA2A 4M2UA 4Q8YA 3S8XA 2POVA 5FNKA 1LG6A 4L5UA 5E2KA 1Y7WA 3T5ZA 2NNSA 1HECA 5E5RA 1OQ5A 3F4XA 3MNIA 4TWLA 4ZX0A 1Z93A 5FNIA 1ZGEA 4QK1A 4Q7SA 2POUA 5EKMA 2CBEA 5FNGA 3T82A 1THKA 4Z1EA 3HKUA 3RYJB 4E3GA 4QJ0A 1CAZA 4E3FA 2FOSA 1V9IC 1XEGA 3DCWA 3MHIA 1CVAA 1CCTA 5E5UA 1OKMA 3GZ0A 5EKHA 1IF9A 5EIJA 4MLXA 3DA2A 1BNMA 3MNKA 3M98A 1TH9A 3T5UA 4Y0JA 4X5SA 2FNMA 1LZVA 3OY0A 5FLPA 5L3OA 4Z1JA 1CILA 5FLQA 5EHWA 4QY3A 3V7XA 4BCWA 4CNVA 1Z97A 1I9PA 4E4AA 1G54A 1BZMA 1BNTA 1G3ZA 1V9EA 2AX2A 3D93A 5JG3B 1BCDA 3P55A 1H9QA 3ML2A 3U45X 3Q31A 4FPTA 2HD6A 2ABEA 1DCBA 3KWAA 4CA2A 1G4OA 3V3HB 4HEZA 3RG4A 3EFTA 2NN7A 1IF8A 4YGFA 2FW4A 1HVAA 3B1BA 3CYUA 3N0NA 5JGTB 1RJ5A 3HKNA 3DBUA 4Q6DA 1EOUA 2FNKA 1RAZA 3P5LA 1G46A 2EU3A 4RUYA 3RJ7A 4E49A 3LXEA 2NMXA 4ZAOA 3M14A 5JDVB 4R59A 1I9NA 5DOGA 3SBHA 4LHIA 5DSRA 4CACA 3R17B 5FL6A 5JEGB 3JXGA 2O4ZA 2FOYA 1I91A 2NXSA 4WL4A 2HL4A 4RFCA 3PYKA 4PZHA 3P58A 3MWOA 2HKKA 4XZ5A 3KKXA 1YDBA 4QSJA 3V3IB 3DC3A 1YDCA 4JSSA 1CINA 3ML5A 5FLRA 4L5WA 5FLSA 5FNHA 1CANA 3HKTA 1CNJA 1CNHA 2FOQA 1FQRA 5E28A 1ZFKA 1H9NA 1J9WA 2HOCA 5JEPB 2WD2A 1CAIA 1FQNA 1RAYA 3NJ9A 5EHEA 3M1QA 5IPZA 4DZ9A 1HEBA 1TG9A 1FSNA 5L6KA 4ZWYA 3BL0A 1G0EA 3OYSA 1BN4A 4HBAA 1F2WA 5G01A 1UGGA 5JQ0A 4PYYA 3SAPA 3V2MA 4KP8A 1CRAA 1G6VA 1UGFA 1DMYA 3V3FA 1ZSBA 3S71B 1FQLA 1Z9YA 4KNIA 4CNWA 4COQA 4RUZA 4QSBA 5JQTA 4PQ7A 4Z0QA 4HEWA 1RZDA 1LUGA 1FR7A 1BNQA 1CNGA 4CNXA 1YO1A 4WUPA 1H4NA 2WEHA 4YX4A 5BYIA 3KOKA 4KUVA 2QP6A 5DVXA 4YXUA 3OYQA 4MDLA 3HKQA 3T83A 3M2NA 3M96A 5BRVA 3M5EA 3ZNCA 1T9NA 4RH2A 3HS4A 4KAPA 1RZAA 5G0BA 1TEQX 1CAOA 3MMFA 1MOOA 4ZWZA 4QJOA 1I9OA 3U47A 1IF7A 1KWQA 5JG5B 4ITOA 5CLUA 5CACA 2QOAA 4YGLA 3P4VA 3S78B 3JXHC 4QIYA 4E3DA 4E9OX 1XPZA 4XIXA 5FNLA 3W6IA 4Z1NA 4Q7VA 1ZSAA 1FLJA 4FVNA 4YGKA 4Q99A 4YGNA 1I9MA 5HPJA 4KNNA 4QIZA 3M1WA 3MNJA 2WEGA 1CCSA 1UGDA 3D8WA 4Q8ZA 3P3HA 1HUGA 1CVEA 4M2VA 9CA2A 4Q90A 4HT2A 4Q06A 4WUQA 3TVNX 4FU5A 4N0XB 1HCAA 3S9TA 3V5GA 1CVDA 3MZCA 8CA2A 1HEAA 5JGSB 1UGCA 1OKLA 3M5SA 4QSIA 3P5AA 3KS3A 4Q0LA 3MNHA 3S76A 4E3HA 2NNVA 1YDAA 5CJFA 4FRCA 5FL4A 5E2SA 1TG3A 3RYYA 5FNMA 1CAMA 1TBTX 1HCBA 4IDRX 3S74B 5AMGA 3S73B 1XEVA 4Q83A 4K1QA 1JCZA 2W2JA 5FDCA 3FE4A 1YDDA 2WEOA 4M2WA 5EKJA 2VVBX 4Q08A 4Q81A 2GEHA 1CA2A 3HFPA 4Q07A 2WEJA 3MHMA 5LMDA 4QJMA 1FSRA 5DSLA 1CVBA 4BF1A 3DD8A 3SAXA 3F7UA 5EH5A 1AVNA 1CNBA 2NWYA 2FNNA 5SZ0A 4RFDA 5BNLA 5SZ4A 1HEDA 3DC9A 3DVDA 4L5VA 3V3JA 3R16A 4R5BA 1XQ0A 3U7CA 3IBNA 4MDMA 4PYXA 1BNNA 1MUAA 4Q7PA 4RIVA 5J8ZA 3MYQA 2H15A 3MNAA 3IBUA 3DAZA 3SBIA 1DCAA 5DSQA 3M1KA 1I9LA 4Q09A 4Q8XA 2POWA 1URTA 3D9ZA 3ZP9A 4HEYA 4YHAA 4FVOA 4QJPA 3V2JA 4ILXA 3IBIA 5SZ7A 4BF6A 2X7SA 5EH7A 1IF4A 1I9QA 3M2XA 2CABA 1CNKA 4JSAA 4E5QA 3RZ1B 3OIKA 4ITPA 3NI5A 1CAHA 1ZFQA 2WD3A 4QJWA 5CA2A 2NWPA 4YVYA 2EU2A 3VBDA 1CVCA 3RYZA 2Q38A 1A42A 4FIKA 1CNXA 3M1JA 4IWZA 5BRWA 4XIWA 3NB5A 4LU3A 2CBCA 1ZNCA 1JD0A 1LG5A 2ILIA 4MLTA 5EZTX 2F14A 5E2RA 4JS6A 1JV0A 3RZ8A 3DCSA 3KIGA 3M5TA 4QK2A 4Z1KA 1CRMA 3MDZA 5G0CA 1KOPA 5E2MA 4JSZA 5EH8A 3K2FA 4YXIA 1FSQA 3DVBA 7CA2A 2NWZA 1AZMA 3HLJA 5AMDA 3P44A 1CZMA 3B4FA 4HT0A 4WR7A 5SZ6A 3RLDA 4XE1A 1BNVA 1CVFA 1CNWA 4ZX1A 3IGPA 2NN1A 3PO6A 4QTLA 5G03A 1LGDA 3UYQA 3U3AX 1RZCA 3M3XA 2OSMA 3BL1A 1CNYA 1CALA 3P3JA 5DSMA 1RZBA 1CNIA 5EOIA 1KOQA 3UYNA 2HFWA 3S97A 2NNGA 4RN4A 1DMXA 3PJJA 3L14A 3RZ5A 4PXXA 5SZ5A 3F7BA 1CAJA 2FMGA 2VVAX 3RG3A 4QJXA 4WW8A 2Q1QA 5DRSA 1UGBA 4QK3A 4Q49A 4Q7WA 1CAKA 3D92A 1BV3A 2X7UA 3T85A 3OIMA 4WW6A 3N3JA 3M2YA 5FDIA 4Q78A 1UGEA 2CA2A 3K34A 2NXTA 2CBAA 4YXOA 2EZ7A 3KNEA 1IF6A 1BICA 3OKUA 1CNCA 1RJ6A 2GD8A 2CBBA 2FOVA 5A6HA 2NXRA 3IAIA 5E2NA 1ZGFA 1TEUX 1HUHA 1G0FA 4G7AA 4YYTA 3CAJA 4KNMA 1G45A 1BN3A 2IT4A 4MTYA 5BRUA 5DSJA 1OKNA 4QSAA 4DZ7A 3RZ0B 4N16A 4FL7A 4KNJA 3DVCA 3M04A 4ZWXA 4MO8A 4R5AA 4LP6A 2OSFA 3KOIA 4RUXA 4KUWA 1FQMA 3V3GB 1CIMA 5C8IA 4XFWA 1IF5A 5DSNA 2H4NA 1TE3X 1ZH9A 1G53A 5EHVA 3MHLA 4GL1X 5FLOA 3S77B 5JEHB 1BNWA 4K0TA 1I90A 2NWOA 3QYKA 5DSOA 3TMJA 5SZ3A 4Q87A 3D0NA 5FLTA 4QEFA 1TTMA 3M40A 3KLDB 1KEQA 4K13A 3RYVB 5DSIA 1AM6A 1G1DA 1BNUA 1I8ZA 3KONA 4G0CA 4K0ZA 3S72B 1CAYA 3MNUA 4RIUA 3C7PA 2QO8A 4HU1A 4MDGA 1KWRA 3FW3A 3FFPX 4Q9YA 3DD0A 3RGEA 4KP5A 3MHCA 3MHOA 1YO2A 4CNRA 3TVOX 2NNOA 3OILA 3K7KA 3S75B 1ZSCA 5DSKA 1ZE8A 3RYXB 3W6HA 3N2PA 1TB0X 3M67A 4HF3A 1G4JA 5SZ2A 2FMZA 4ZWIA 3CZVA 5FL5A 5JESB 1G48A 3F8EA 4CQ0A 12CAA 1CCUA 3T84A 4K0SA 4C3TA 2HNCA 1CA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CA2 A;  3IEO A;  1BN1 A;  5FNJ A;  1CVH A;  2Q1B A;  4Q6E A;  1YO0 A;  4JSW A;  5DSP A;  1G52 A;  3IBL A;  3DCC A;  4KV0 A;  4TWM A;  4M2R A;  4KUY A;  4UOV A;  5DOH A;  3RZ7 A;  4ETQ C;  1RZE A;  2X7T A;  2FOU A;  4YGJ A;  2ZNC A;  3EFI A;  3JXF A;  5A25 A;  3M2Z A;  4YWP A;  2AW1 A;  3DV7 A;  1UGA A;  1FR4 A;  5SZ1 A;  2CBD A;  3N4B A;  3OKV A;  3BET A;  5AML A;  6CA2 A;  4M2U A;  4Q8Y A;  3S8X A;  2POV A;  5FNK A;  1LG6 A;  4L5U A;  5E2K A;  1Y7W A;  3T5Z A;  2NNS A;  1HEC A;  5E5R A;  1OQ5 A;  3F4X A;  3MNI A;  4TWL A;  4ZX0 A;  1Z93 A;  5FNI A;  1ZGE A;  4QK1 A;  4Q7S A;  2POU A;  5EKM A;  2CBE A;  5FNG A;  3T82 A;  1THK A;  4Z1E A;  3HKU A;  3RYJ B;  4E3G A;  4QJ0 A;  1CAZ A;  4E3F A;  2FOS A;  1V9I C;  1XEG A;  3DCW A;  3MHI A;  1CVA A;  1CCT A;  5E5U A;  1OKM A;  3GZ0 A;  5EKH A;  1IF9 A;  5EIJ A;  4MLX A;  3DA2 A;  1BNM A;  3MNK A;  3M98 A;  1TH9 A;  3T5U A;  4Y0J A;  4X5S A;  2FNM A;  1LZV A;  3OY0 A;  5FLP A;  5L3O A;  4Z1J A;  1CIL A;  5FLQ A;  5EHW A;  4QY3 A;  3V7X A;  4BCW A;  4CNV A;  1Z97 A;  1I9P A;  4E4A A;  1G54 A;  1BZM A;  1BNT A;  1G3Z A;  1V9E A;  2AX2 A;  3D93 A;  5JG3 B;  1BCD A;  3P55 A;  1H9Q A;  3ML2 A;  3U45 X;  3Q31 A;  4FPT A;  2HD6 A;  2ABE A;  1DCB A;  3KWA A;  4CA2 A;  1G4O A;  3V3H B;  4HEZ A;  3RG4 A;  3EFT A;  2NN7 A;  1IF8 A;  4YGF A;  2FW4 A;  1HVA A;  3B1B A;  3CYU A;  3N0N A;  5JGT B;  1RJ5 A;  3HKN A;  3DBU A;  4Q6D A;  1EOU A;  2FNK A;  1RAZ A;  3P5L A;  1G46 A;  2EU3 A;  4RUY A;  3RJ7 A;  4E49 A;  3LXE A;  2NMX A;  4ZAO A;  3M14 A;  5JDV B;  4R59 A;  1I9N A;  5DOG A;  3SBH A;  4LHI A;  5DSR A;  4CAC A;  3R17 B;  5FL6 A;  5JEG B;  3JXG A;  2O4Z A;  2FOY A;  1I91 A;  2NXS A;  4WL4 A;  2HL4 A;  4RFC A;  3PYK A;  4PZH A;  3P58 A;  3MWO A;  2HKK A;  4XZ5 A;  3KKX A;  1YDB A;  4QSJ A;  3V3I B;  3DC3 A;  1YDC A;  4JSS A;  1CIN A;  3ML5 A;  5FLR A;  4L5W A;  5FLS A;  5FNH A;  1CAN A;  3HKT A;  1CNJ A;  1CNH A;  2FOQ A;  1FQR A;  5E28 A;  1ZFK A;  1H9N A;  1J9W A;  2HOC A;  5JEP B;  2WD2 A;  1CAI A;  1FQN A;  1RAY A;  3NJ9 A;  5EHE A;  3M1Q A;  5IPZ A;  4DZ9 A;  1HEB A;  1TG9 A;  1FSN A;  5L6K A;  4ZWY A;  3BL0 A;  1G0E A;  3OYS A;  1BN4 A;  4HBA A;  1F2W A;  5G01 A;  1UGG A;  5JQ0 A;  4PYY A;  3SAP A;  3V2M A;  4KP8 A;  1CRA A;  1G6V A;  1UGF A;  1DMY A;  3V3F A;  1ZSB A;  3S71 B;  1FQL A;  1Z9Y A;  4KNI A;  4CNW A;  4COQ A;  4RUZ A;  4QSB A;  5JQT A;  4PQ7 A;  4Z0Q A;  4HEW A;  1RZD A;  1LUG A;  1FR7 A;  1BNQ A;  1CNG A;  4CNX A;  1YO1 A;  4WUP A;  1H4N A;  2WEH A;  4YX4 A;  5BYI A;  3KOK A;  4KUV A;  2QP6 A;  5DVX A;  4YXU A;  3OYQ A;  4MDL A;  3HKQ A;  3T83 A;  3M2N A;  3M96 A;  5BRV A;  3M5E A;  3ZNC A;  1T9N A;  4RH2 A;  3HS4 A;  4KAP A;  1RZA A;  5G0B A;  1TEQ X;  1CAO A;  3MMF A;  1MOO A;  4ZWZ A;  4QJO A;  1I9O A;  3U47 A;  1IF7 A;  1KWQ A;  5JG5 B;  4ITO A;  5CLU A;  5CAC A;  2QOA A;  4YGL A;  3P4V A;  3S78 B;  3JXH C;  4QIY A;  4E3D A;  4E9O X;  1XPZ A;  4XIX A;  5FNL A;  3W6I A;  4Z1N A;  4Q7V A;  1ZSA A;  1FLJ A;  4FVN A;  4YGK A;  4Q99 A;  4YGN A;  1I9M A;  5HPJ A;  4KNN A;  4QIZ A;  3M1W A;  3MNJ A;  2WEG A;  1CCS A;  1UGD A;  3D8W A;  4Q8Z A;  3P3H A;  1HUG A;  1CVE A;  4M2V A;  9CA2 A;  4Q90 A;  4HT2 A;  4Q06 A;  4WUQ A;  3TVN X;  4FU5 A;  4N0X B;  1HCA A;  3S9T A;  3V5G A;  1CVD A;  3MZC A;  8CA2 A;  1HEA A;  5JGS B;  1UGC A;  1OKL A;  3M5S A;  4QSI A;  3P5A A;  3KS3 A;  4Q0L A;  3MNH A;  3S76 A;  4E3H A;  2NNV A;  1YDA A;  5CJF A;  4FRC A;  5FL4 A;  5E2S A;  1TG3 A;  3RYY A;  5FNM A;  1CAM A;  1TBT X;  1HCB A;  4IDR X;  3S74 B;  5AMG A;  3S73 B;  1XEV A;  4Q83 A;  4K1Q A;  1JCZ A;  2W2J A;  5FDC A;  3FE4 A;  1YDD A;  2WEO A;  4M2W A;  5EKJ A;  2VVB X;  4Q08 A;  4Q81 A;  2GEH A;  1CA2 A;  3HFP A;  4Q07 A;  2WEJ A;  3MHM A;  5LMD A;  4QJM A;  1FSR A;  5DSL A;  1CVB A;  4BF1 A;  3DD8 A;  3SAX A;  3F7U A;  5EH5 A;  1AVN A;  1CNB A;  2NWY A;  2FNN A;  5SZ0 A;  4RFD A;  5BNL A;  5SZ4 A;  1HED A;  3DC9 A;  3DVD A;  4L5V A;  3V3J A;  3R16 A;  4R5B A;  1XQ0 A;  3U7C A;  3IBN A;  4MDM A;  4PYX A;  1BNN A;  1MUA A;  4Q7P A;  4RIV A;  5J8Z A;  3MYQ A;  2H15 A;  3MNA A;  3IBU A;  3DAZ A;  3SBI A;  1DCA A;  5DSQ A;  3M1K A;  1I9L A;  4Q09 A;  4Q8X A;  2POW A;  1URT A;  3D9Z A;  3ZP9 A;  4HEY A;  4YHA A;  4FVO A;  4QJP A;  3V2J A;  4ILX A;  3IBI A;  5SZ7 A;  4BF6 A;  2X7S A;  5EH7 A;  1IF4 A;  1I9Q A;  3M2X A;  2CAB A;  1CNK A;  4JSA A;  4E5Q A;  3RZ1 B;  3OIK A;  4ITP A;  3NI5 A;  1CAH A;  1ZFQ A;  2WD3 A;  4QJW A;  5CA2 A;  2NWP A;  4YVY A;  2EU2 A;  3VBD A;  1CVC A;  3RYZ A;  2Q38 A;  1A42 A;  4FIK A;  1CNX A;  3M1J A;  4IWZ A;  5BRW A;  4XIW A;  3NB5 A;  4LU3 A;  2CBC A;  1ZNC A;  1JD0 A;  1LG5 A;  2ILI A;  4MLT A;  5EZT X;  2F14 A;  5E2R A;  4JS6 A;  1JV0 A;  3RZ8 A;  3DCS A;  3KIG A;  3M5T A;  4QK2 A;  4Z1K A;  1CRM A;  3MDZ A;  5G0C A;  1KOP A;  5E2M A;  4JSZ A;  5EH8 A;  3K2F A;  4YXI A;  1FSQ A;  3DVB A;  7CA2 A;  2NWZ A;  1AZM A;  3HLJ A;  5AMD A;  3P44 A;  1CZM A;  3B4F A;  4HT0 A;  4WR7 A;  5SZ6 A;  3RLD A;  4XE1 A;  1BNV A;  1CVF A;  1CNW A;  4ZX1 A;  3IGP A;  2NN1 A;  3PO6 A;  4QTL A;  5G03 A;  1LGD A;  3UYQ A;  3U3A X;  1RZC A;  3M3X A;  2OSM A;  3BL1 A;  1CNY A;  1CAL A;  3P3J A;  5DSM A;  1RZB A;  1CNI A;  5EOI A;  1KOQ A;  3UYN A;  2HFW A;  3S97 A;  2NNG A;  4RN4 A;  1DMX A;  3PJJ A;  3L14 A;  3RZ5 A;  4PXX A;  5SZ5 A;  3F7B A;  1CAJ A;  2FMG A;  2VVA X;  3RG3 A;  4QJX A;  4WW8 A;  2Q1Q A;  5DRS A;  1UGB A;  4QK3 A;  4Q49 A;  4Q7W A;  1CAK A;  3D92 A;  1BV3 A;  2X7U A;  3T85 A;  3OIM A;  4WW6 A;  3N3J A;  3M2Y A;  5FDI A;  4Q78 A;  1UGE A;  2CA2 A;  3K34 A;  2NXT A;  2CBA A;  4YXO A;  2EZ7 A;  3KNE A;  1IF6 A;  1BIC A;  3OKU A;  1CNC A;  1RJ6 A;  2GD8 A;  2CBB A;  2FOV A;  5A6H A;  2NXR A;  3IAI A;  5E2N A;  1ZGF A;  1TEU X;  1HUH A;  1G0F A;  4G7A A;  4YYT A;  3CAJ A;  4KNM A;  1G45 A;  1BN3 A;  2IT4 A;  4MTY A;  5BRU A;  5DSJ A;  1OKN A;  4QSA A;  4DZ7 A;  3RZ0 B;  4N16 A;  4FL7 A;  4KNJ A;  3DVC A;  3M04 A;  4ZWX A;  4MO8 A;  4R5A A;  4LP6 A;  2OSF A;  3KOI A;  4RUX A;  4KUW A;  1FQM A;  3V3G B;  1CIM A;  5C8I A;  4XFW A;  1IF5 A;  5DSN A;  2H4N A;  1TE3 X;  1ZH9 A;  1G53 A;  5EHV A;  3MHL A;  4GL1 X;  5FLO A;  3S77 B;  5JEH B;  1BNW A;  4K0T A;  1I90 A;  2NWO A;  3QYK A;  5DSO A;  3TMJ A;  5SZ3 A;  4Q87 A;  3D0N A;  5FLT A;  4QEF A;  1TTM A;  3M40 A;  3KLD B;  1KEQ A;  4K13 A;  3RYV B;  5DSI A;  1AM6 A;  1G1D A;  1BNU A;  1I8Z A;  3KON A;  4G0C A;  4K0Z A;  3S72 B;  1CAY A;  3MNU A;  4RIU A;  3C7P A;  2QO8 A;  4HU1 A;  4MDG A;  1KWR A;  3FW3 A;  3FFP X;  4Q9Y A;  3DD0 A;  3RGE A;  4KP5 A;  3MHC A;  3MHO A;  1YO2 A;  4CNR A;  3TVO X;  2NNO A;  3OIL A;  3K7K A;  3S75 B;  1ZSC A;  5DSK A;  1ZE8 A;  3RYX B;  3W6H A;  3N2P A;  1TB0 X;  3M67 A;  4HF3 A;  1G4J A;  5SZ2 A;  2FMZ A;  4ZWI A;  3CZV A;  5FL5 A;  5JES B;  1G48 A;  3F8E A;  4CQ0 A;  12CA A;  1CCU A;  3T84 A;  4K0S A;  4C3T A;  2HNC A;  1CA3 A; 
#chains in the Genus database with same CATH topology
 3CA2 A;  3IEO A;  1BN1 A;  5FNJ A;  1CVH A;  2Q1B A;  4Q6E A;  1YO0 A;  4JSW A;  5DSP A;  1G52 A;  3IBL A;  3DCC A;  4KV0 A;  4TWM A;  4M2R A;  4KUY A;  4UOV A;  5DOH A;  3RZ7 A;  4ETQ C;  1RZE A;  2X7T A;  2FOU A;  4YGJ A;  2ZNC A;  3EFI A;  3JXF A;  5A25 A;  3M2Z A;  4YWP A;  2AW1 A;  3DV7 A;  1UGA A;  1FR4 A;  5SZ1 A;  2CBD A;  3N4B A;  3OKV A;  3BET A;  5AML A;  6CA2 A;  4M2U A;  4Q8Y A;  3S8X A;  2POV A;  5FNK A;  1LG6 A;  4L5U A;  5E2K A;  1Y7W A;  3T5Z A;  2NNS A;  1HEC A;  5E5R A;  1OQ5 A;  3F4X A;  3MNI A;  4TWL A;  4ZX0 A;  1Z93 A;  5FNI A;  1ZGE A;  4QK1 A;  4Q7S A;  2POU A;  5EKM A;  2CBE A;  5FNG A;  3T82 A;  1THK A;  4Z1E A;  3HKU A;  3RYJ B;  4E3G A;  4QJ0 A;  1CAZ A;  4E3F A;  2FOS A;  1V9I C;  1XEG A;  3DCW A;  3MHI A;  1CVA A;  1CCT A;  5E5U A;  1OKM A;  3GZ0 A;  5EKH A;  1IF9 A;  5EIJ A;  4MLX A;  3DA2 A;  1BNM A;  3MNK A;  3M98 A;  1TH9 A;  3T5U A;  4Y0J A;  4X5S A;  2FNM A;  1LZV A;  3OY0 A;  5FLP A;  5L3O A;  4Z1J A;  1CIL A;  5FLQ A;  5EHW A;  4QY3 A;  3V7X A;  4BCW A;  4CNV A;  1Z97 A;  1I9P A;  4E4A A;  1G54 A;  1BZM A;  1BNT A;  1G3Z A;  1V9E A;  2AX2 A;  3D93 A;  5JG3 B;  1BCD A;  3P55 A;  1H9Q A;  3ML2 A;  3U45 X;  3Q31 A;  4FPT A;  2HD6 A;  2ABE A;  1DCB A;  3KWA A;  4CA2 A;  1G4O A;  3V3H B;  4HEZ A;  3RG4 A;  3EFT A;  2NN7 A;  1IF8 A;  4YGF A;  2FW4 A;  1HVA A;  3B1B A;  3CYU A;  3N0N A;  5JGT B;  1RJ5 A;  3HKN A;  3DBU A;  4Q6D A;  1EOU A;  2FNK A;  1RAZ A;  3P5L A;  1G46 A;  2EU3 A;  4RUY A;  3RJ7 A;  4E49 A;  3LXE A;  2NMX A;  4ZAO A;  3M14 A;  5JDV B;  4R59 A;  1I9N A;  5DOG A;  3SBH A;  4LHI A;  5DSR A;  4CAC A;  3R17 B;  5FL6 A;  5JEG B;  3JXG A;  2O4Z A;  2FOY A;  1I91 A;  2NXS A;  4WL4 A;  2HL4 A;  4RFC A;  3PYK A;  4PZH A;  3P58 A;  3MWO A;  2HKK A;  4XZ5 A;  3KKX A;  1YDB A;  4QSJ A;  3V3I B;  3DC3 A;  1YDC A;  4JSS A;  1CIN A;  3ML5 A;  5FLR A;  4L5W A;  5FLS A;  5FNH A;  1CAN A;  3HKT A;  1CNJ A;  1CNH A;  2FOQ A;  1FQR A;  5E28 A;  1ZFK A;  1H9N A;  1J9W A;  2HOC A;  5JEP B;  2WD2 A;  1CAI A;  1FQN A;  1RAY A;  3NJ9 A;  5EHE A;  3M1Q A;  5IPZ A;  4DZ9 A;  1HEB A;  1TG9 A;  1FSN A;  5L6K A;  4ZWY A;  3BL0 A;  1G0E A;  3OYS A;  1BN4 A;  4HBA A;  1F2W A;  5G01 A;  1UGG A;  5JQ0 A;  4PYY A;  3SAP A;  3V2M A;  4KP8 A;  1CRA A;  1G6V A;  1UGF A;  1DMY A;  3V3F A;  1ZSB A;  3S71 B;  1FQL A;  1Z9Y A;  4KNI A;  4CNW A;  4COQ A;  4RUZ A;  4QSB A;  5JQT A;  4PQ7 A;  4Z0Q A;  4HEW A;  1RZD A;  1LUG A;  1FR7 A;  1BNQ A;  1CNG A;  4CNX A;  1YO1 A;  4WUP A;  1H4N A;  2WEH A;  4YX4 A;  5BYI A;  3KOK A;  4KUV A;  2QP6 A;  5DVX A;  4YXU A;  3OYQ A;  4MDL A;  3HKQ A;  3T83 A;  3M2N A;  3M96 A;  5BRV A;  3M5E A;  3ZNC A;  1T9N A;  4RH2 A;  3HS4 A;  4KAP A;  1RZA A;  5G0B A;  1TEQ X;  1CAO A;  3MMF A;  1MOO A;  4ZWZ A;  4QJO A;  1I9O A;  3U47 A;  1IF7 A;  1KWQ A;  5JG5 B;  4ITO A;  5CLU A;  5CAC A;  2QOA A;  4YGL A;  3P4V A;  3S78 B;  3JXH C;  4QIY A;  4E3D A;  4E9O X;  1XPZ A;  4XIX A;  5FNL A;  3W6I A;  4Z1N A;  4Q7V A;  1ZSA A;  1FLJ A;  4FVN A;  4YGK A;  4Q99 A;  4YGN A;  1I9M A;  5HPJ A;  4KNN A;  4QIZ A;  3M1W A;  3MNJ A;  2WEG A;  1CCS A;  1UGD A;  3D8W A;  4Q8Z A;  3P3H A;  1HUG A;  1CVE A;  4M2V A;  9CA2 A;  4Q90 A;  4HT2 A;  4Q06 A;  4WUQ A;  3TVN X;  4FU5 A;  4N0X B;  1HCA A;  3S9T A;  3V5G A;  1CVD A;  3MZC A;  8CA2 A;  1HEA A;  5JGS B;  1UGC A;  1OKL A;  3M5S A;  4QSI A;  3P5A A;  3KS3 A;  4Q0L A;  3MNH A;  3S76 A;  4E3H A;  2NNV A;  1YDA A;  5CJF A;  4FRC A;  5FL4 A;  5E2S A;  1TG3 A;  3RYY A;  5FNM A;  1CAM A;  1TBT X;  1HCB A;  4IDR X;  3S74 B;  5AMG A;  3S73 B;  1XEV A;  4Q83 A;  4K1Q A;  1JCZ A;  2W2J A;  5FDC A;  3FE4 A;  1YDD A;  2WEO A;  4M2W A;  5EKJ A;  2VVB X;  4Q08 A;  4Q81 A;  2GEH A;  1CA2 A;  3HFP A;  4Q07 A;  2WEJ A;  3MHM A;  5LMD A;  4QJM A;  1FSR A;  5DSL A;  1CVB A;  4BF1 A;  3DD8 A;  3SAX A;  3F7U A;  5EH5 A;  1AVN A;  1CNB A;  2NWY A;  2FNN A;  5SZ0 A;  4RFD A;  5BNL A;  5SZ4 A;  1HED A;  3DC9 A;  3DVD A;  4L5V A;  3V3J A;  3R16 A;  4R5B A;  1XQ0 A;  3U7C A;  3IBN A;  4MDM A;  4PYX A;  1BNN A;  1MUA A;  4Q7P A;  4RIV A;  5J8Z A;  3MYQ A;  2H15 A;  3MNA A;  3IBU A;  3DAZ A;  3SBI A;  1DCA A;  5DSQ A;  3M1K A;  1I9L A;  4Q09 A;  4Q8X A;  2POW A;  1URT A;  3D9Z A;  3ZP9 A;  4HEY A;  4YHA A;  4FVO A;  4QJP A;  3V2J A;  4ILX A;  3IBI A;  5SZ7 A;  4BF6 A;  2X7S A;  5EH7 A;  1IF4 A;  1I9Q A;  3M2X A;  2CAB A;  1CNK A;  4JSA A;  4E5Q A;  3RZ1 B;  3OIK A;  4ITP A;  3NI5 A;  1CAH A;  1ZFQ A;  2WD3 A;  4QJW A;  5CA2 A;  2NWP A;  4YVY A;  2EU2 A;  3VBD A;  1CVC A;  3RYZ A;  2Q38 A;  1A42 A;  4FIK A;  1CNX A;  3M1J A;  4IWZ A;  5BRW A;  4XIW A;  3NB5 A;  4LU3 A;  2CBC A;  1ZNC A;  1JD0 A;  1LG5 A;  2ILI A;  4MLT A;  5EZT X;  2F14 A;  5E2R A;  4JS6 A;  1JV0 A;  3RZ8 A;  3DCS A;  3KIG A;  3M5T A;  4QK2 A;  4Z1K A;  1CRM A;  3MDZ A;  5G0C A;  1KOP A;  5E2M A;  4JSZ A;  5EH8 A;  3K2F A;  4YXI A;  1FSQ A;  3DVB A;  7CA2 A;  2NWZ A;  1AZM A;  3HLJ A;  5AMD A;  3P44 A;  1CZM A;  3B4F A;  4HT0 A;  4WR7 A;  5SZ6 A;  3RLD A;  4XE1 A;  1BNV A;  1CVF A;  1CNW A;  4ZX1 A;  3IGP A;  2NN1 A;  3PO6 A;  4QTL A;  5G03 A;  1LGD A;  3UYQ A;  3U3A X;  1RZC A;  3M3X A;  2OSM A;  3BL1 A;  1CNY A;  1CAL A;  3P3J A;  5DSM A;  1RZB A;  1CNI A;  5EOI A;  1KOQ A;  3UYN A;  2HFW A;  3S97 A;  2NNG A;  4RN4 A;  1DMX A;  3PJJ A;  3L14 A;  3RZ5 A;  4PXX A;  5SZ5 A;  3F7B A;  1CAJ A;  2FMG A;  2VVA X;  3RG3 A;  4QJX A;  4WW8 A;  2Q1Q A;  5DRS A;  1UGB A;  4QK3 A;  4Q49 A;  4Q7W A;  1CAK A;  3D92 A;  1BV3 A;  2X7U A;  3T85 A;  3OIM A;  4WW6 A;  3N3J A;  3M2Y A;  5FDI A;  4Q78 A;  1UGE A;  2CA2 A;  3K34 A;  2NXT A;  2CBA A;  4YXO A;  2EZ7 A;  3KNE A;  1IF6 A;  1BIC A;  3OKU A;  1CNC A;  1RJ6 A;  2GD8 A;  2CBB A;  2FOV A;  5A6H A;  2NXR A;  3IAI A;  5E2N A;  1ZGF A;  1TEU X;  1HUH A;  1G0F A;  4G7A A;  4YYT A;  3CAJ A;  4KNM A;  1G45 A;  1BN3 A;  2IT4 A;  4MTY A;  5BRU A;  5DSJ A;  1OKN A;  4QSA A;  4DZ7 A;  3RZ0 B;  4N16 A;  4FL7 A;  4KNJ A;  3DVC A;  3M04 A;  4ZWX A;  4MO8 A;  4R5A A;  4LP6 A;  2OSF A;  3KOI A;  4RUX A;  4KUW A;  1FQM A;  3V3G B;  1CIM A;  5C8I A;  4XFW A;  1IF5 A;  5DSN A;  2H4N A;  1TE3 X;  1ZH9 A;  1G53 A;  5EHV A;  3MHL A;  4GL1 X;  5FLO A;  3S77 B;  5JEH B;  1BNW A;  4K0T A;  1I90 A;  2NWO A;  3QYK A;  5DSO A;  3TMJ A;  5SZ3 A;  4Q87 A;  3D0N A;  5FLT A;  4QEF A;  1TTM A;  3M40 A;  3KLD B;  1KEQ A;  4K13 A;  3RYV B;  5DSI A;  1AM6 A;  1G1D A;  1BNU A;  1I8Z A;  3KON A;  4G0C A;  4K0Z A;  3S72 B;  1CAY A;  3MNU A;  4RIU A;  3C7P A;  2QO8 A;  4HU1 A;  4MDG A;  1KWR A;  3FW3 A;  3FFP X;  4Q9Y A;  3DD0 A;  3RGE A;  4KP5 A;  3MHC A;  3MHO A;  1YO2 A;  4CNR A;  3TVO X;  2NNO A;  3OIL A;  3K7K A;  3S75 B;  1ZSC A;  5DSK A;  1ZE8 A;  3RYX B;  3W6H A;  3N2P A;  1TB0 X;  3M67 A;  4HF3 A;  1G4J A;  5SZ2 A;  2FMZ A;  4ZWI A;  3CZV A;  5FL5 A;  5JES B;  1G48 A;  3F8E A;  4CQ0 A;  12CA A;  1CCU A;  3T84 A;  4K0S A;  4C3T A;  2HNC A;  1CA3 A; 
#chains in the Genus database with same CATH homology
 3CA2 A;  3IEO A;  1BN1 A;  5FNJ A;  1CVH A;  2Q1B A;  4Q6E A;  1YO0 A;  4JSW A;  5DSP A;  1G52 A;  3IBL A;  3DCC A;  4KV0 A;  4TWM A;  4M2R A;  4KUY A;  4UOV A;  5DOH A;  3RZ7 A;  4ETQ C;  1RZE A;  2X7T A;  2FOU A;  4YGJ A;  2ZNC A;  3EFI A;  3JXF A;  5A25 A;  3M2Z A;  4YWP A;  2AW1 A;  3DV7 A;  1UGA A;  1FR4 A;  5SZ1 A;  2CBD A;  3N4B A;  3OKV A;  3BET A;  5AML A;  6CA2 A;  4M2U A;  4Q8Y A;  3S8X A;  2POV A;  5FNK A;  1LG6 A;  4L5U A;  5E2K A;  1Y7W A;  3T5Z A;  2NNS A;  1HEC A;  5E5R A;  1OQ5 A;  3F4X A;  3MNI A;  4TWL A;  4ZX0 A;  1Z93 A;  5FNI A;  1ZGE A;  4QK1 A;  4Q7S A;  2POU A;  5EKM A;  2CBE A;  5FNG A;  3T82 A;  1THK A;  4Z1E A;  3HKU A;  3RYJ B;  4E3G A;  4QJ0 A;  1CAZ A;  4E3F A;  2FOS A;  1V9I C;  1XEG A;  3DCW A;  3MHI A;  1CVA A;  1CCT A;  5E5U A;  1OKM A;  3GZ0 A;  5EKH A;  1IF9 A;  5EIJ A;  4MLX A;  3DA2 A;  1BNM A;  3MNK A;  3M98 A;  1TH9 A;  3T5U A;  4Y0J A;  4X5S A;  2FNM A;  1LZV A;  3OY0 A;  5FLP A;  5L3O A;  4Z1J A;  1CIL A;  5FLQ A;  5EHW A;  4QY3 A;  3V7X A;  4BCW A;  4CNV A;  1Z97 A;  1I9P A;  4E4A A;  1G54 A;  1BZM A;  1BNT A;  1G3Z A;  1V9E A;  2AX2 A;  3D93 A;  5JG3 B;  1BCD A;  3P55 A;  1H9Q A;  3ML2 A;  3U45 X;  3Q31 A;  4FPT A;  2HD6 A;  2ABE A;  1DCB A;  3KWA A;  4CA2 A;  1G4O A;  3V3H B;  4HEZ A;  3RG4 A;  3EFT A;  2NN7 A;  1IF8 A;  4YGF A;  2FW4 A;  1HVA A;  3B1B A;  3CYU A;  3N0N A;  5JGT B;  1RJ5 A;  3HKN A;  3DBU A;  4Q6D A;  1EOU A;  2FNK A;  1RAZ A;  3P5L A;  1G46 A;  2EU3 A;  4RUY A;  3RJ7 A;  4E49 A;  3LXE A;  2NMX A;  4ZAO A;  3M14 A;  5JDV B;  4R59 A;  1I9N A;  5DOG A;  3SBH A;  4LHI A;  5DSR A;  4CAC A;  3R17 B;  5FL6 A;  5JEG B;  3JXG A;  2O4Z A;  2FOY A;  1I91 A;  2NXS A;  4WL4 A;  2HL4 A;  4RFC A;  3PYK A;  4PZH A;  3P58 A;  3MWO A;  2HKK A;  4XZ5 A;  3KKX A;  1YDB A;  4QSJ A;  3V3I B;  3DC3 A;  1YDC A;  4JSS A;  1CIN A;  3ML5 A;  5FLR A;  4L5W A;  5FLS A;  5FNH A;  1CAN A;  3HKT A;  1CNJ A;  1CNH A;  2FOQ A;  1FQR A;  5E28 A;  1ZFK A;  1H9N A;  1J9W A;  2HOC A;  5JEP B;  2WD2 A;  1CAI A;  1FQN A;  1RAY A;  3NJ9 A;  5EHE A;  3M1Q A;  5IPZ A;  4DZ9 A;  1HEB A;  1TG9 A;  1FSN A;  5L6K A;  4ZWY A;  3BL0 A;  1G0E A;  3OYS A;  1BN4 A;  4HBA A;  1F2W A;  5G01 A;  1UGG A;  5JQ0 A;  4PYY A;  3SAP A;  3V2M A;  4KP8 A;  1CRA A;  1G6V A;  1UGF A;  1DMY A;  3V3F A;  1ZSB A;  3S71 B;  1FQL A;  1Z9Y A;  4KNI A;  4CNW A;  4COQ A;  4RUZ A;  4QSB A;  5JQT A;  4PQ7 A;  4Z0Q A;  4HEW A;  1RZD A;  1LUG A;  1FR7 A;  1BNQ A;  1CNG A;  4CNX A;  1YO1 A;  4WUP A;  1H4N A;  2WEH A;  4YX4 A;  5BYI A;  3KOK A;  4KUV A;  2QP6 A;  5DVX A;  4YXU A;  3OYQ A;  4MDL A;  3HKQ A;  3T83 A;  3M2N A;  3M96 A;  5BRV A;  3M5E A;  3ZNC A;  1T9N A;  4RH2 A;  3HS4 A;  4KAP A;  1RZA A;  5G0B A;  1TEQ X;  1CAO A;  3MMF A;  1MOO A;  4ZWZ A;  4QJO A;  1I9O A;  3U47 A;  1IF7 A;  1KWQ A;  5JG5 B;  4ITO A;  5CLU A;  5CAC A;  2QOA A;  4YGL A;  3P4V A;  3S78 B;  3JXH C;  4QIY A;  4E3D A;  4E9O X;  1XPZ A;  4XIX A;  5FNL A;  3W6I A;  4Z1N A;  4Q7V A;  1ZSA A;  1FLJ A;  4FVN A;  4YGK A;  4Q99 A;  4YGN A;  1I9M A;  5HPJ A;  4KNN A;  4QIZ A;  3M1W A;  3MNJ A;  2WEG A;  1CCS A;  1UGD A;  3D8W A;  4Q8Z A;  3P3H A;  1HUG A;  1CVE A;  4M2V A;  9CA2 A;  4Q90 A;  4HT2 A;  4Q06 A;  4WUQ A;  3TVN X;  4FU5 A;  4N0X B;  1HCA A;  3S9T A;  3V5G A;  1CVD A;  3MZC A;  8CA2 A;  1HEA A;  5JGS B;  1UGC A;  1OKL A;  3M5S A;  4QSI A;  3P5A A;  3KS3 A;  4Q0L A;  3MNH A;  3S76 A;  4E3H A;  2NNV A;  1YDA A;  5CJF A;  4FRC A;  5FL4 A;  5E2S A;  1TG3 A;  3RYY A;  5FNM A;  1CAM A;  1TBT X;  1HCB A;  4IDR X;  3S74 B;  5AMG A;  3S73 B;  1XEV A;  4Q83 A;  4K1Q A;  1JCZ A;  2W2J A;  5FDC A;  3FE4 A;  1YDD A;  2WEO A;  4M2W A;  5EKJ A;  2VVB X;  4Q08 A;  4Q81 A;  2GEH A;  1CA2 A;  3HFP A;  4Q07 A;  2WEJ A;  3MHM A;  5LMD A;  4QJM A;  1FSR A;  5DSL A;  1CVB A;  4BF1 A;  3DD8 A;  3SAX A;  3F7U A;  5EH5 A;  1AVN A;  1CNB A;  2NWY A;  2FNN A;  5SZ0 A;  4RFD A;  5BNL A;  5SZ4 A;  1HED A;  3DC9 A;  3DVD A;  4L5V A;  3V3J A;  3R16 A;  4R5B A;  1XQ0 A;  3U7C A;  3IBN A;  4MDM A;  4PYX A;  1BNN A;  1MUA A;  4Q7P A;  4RIV A;  5J8Z A;  3MYQ A;  2H15 A;  3MNA A;  3IBU A;  3DAZ A;  3SBI A;  1DCA A;  5DSQ A;  3M1K A;  1I9L A;  4Q09 A;  4Q8X A;  2POW A;  1URT A;  3D9Z A;  3ZP9 A;  4HEY A;  4YHA A;  4FVO A;  4QJP A;  3V2J A;  4ILX A;  3IBI A;  5SZ7 A;  4BF6 A;  2X7S A;  5EH7 A;  1IF4 A;  1I9Q A;  3M2X A;  2CAB A;  1CNK A;  4JSA A;  4E5Q A;  3RZ1 B;  3OIK A;  4ITP A;  3NI5 A;  1CAH A;  1ZFQ A;  2WD3 A;  4QJW A;  5CA2 A;  2NWP A;  4YVY A;  2EU2 A;  3VBD A;  1CVC A;  3RYZ A;  2Q38 A;  1A42 A;  4FIK A;  1CNX A;  3M1J A;  4IWZ A;  5BRW A;  4XIW A;  3NB5 A;  4LU3 A;  2CBC A;  1ZNC A;  1JD0 A;  1LG5 A;  2ILI A;  4MLT A;  5EZT X;  2F14 A;  5E2R A;  4JS6 A;  1JV0 A;  3RZ8 A;  3DCS A;  3KIG A;  3M5T A;  4QK2 A;  4Z1K A;  1CRM A;  3MDZ A;  5G0C A;  1KOP A;  5E2M A;  4JSZ A;  5EH8 A;  3K2F A;  4YXI A;  1FSQ A;  3DVB A;  7CA2 A;  2NWZ A;  1AZM A;  3HLJ A;  5AMD A;  3P44 A;  1CZM A;  3B4F A;  4HT0 A;  4WR7 A;  5SZ6 A;  3RLD A;  4XE1 A;  1BNV A;  1CVF A;  1CNW A;  4ZX1 A;  3IGP A;  2NN1 A;  3PO6 A;  4QTL A;  5G03 A;  1LGD A;  3UYQ A;  3U3A X;  1RZC A;  3M3X A;  2OSM A;  3BL1 A;  1CNY A;  1CAL A;  3P3J A;  5DSM A;  1RZB A;  1CNI A;  5EOI A;  1KOQ A;  3UYN A;  2HFW A;  3S97 A;  2NNG A;  4RN4 A;  1DMX A;  3PJJ A;  3L14 A;  3RZ5 A;  4PXX A;  5SZ5 A;  3F7B A;  1CAJ A;  2FMG A;  2VVA X;  3RG3 A;  4QJX A;  4WW8 A;  2Q1Q A;  5DRS A;  1UGB A;  4QK3 A;  4Q49 A;  4Q7W A;  1CAK A;  3D92 A;  1BV3 A;  2X7U A;  3T85 A;  3OIM A;  4WW6 A;  3N3J A;  3M2Y A;  5FDI A;  4Q78 A;  1UGE A;  2CA2 A;  3K34 A;  2NXT A;  2CBA A;  4YXO A;  2EZ7 A;  3KNE A;  1IF6 A;  1BIC A;  3OKU A;  1CNC A;  1RJ6 A;  2GD8 A;  2CBB A;  2FOV A;  5A6H A;  2NXR A;  3IAI A;  5E2N A;  1ZGF A;  1TEU X;  1HUH A;  1G0F A;  4G7A A;  4YYT A;  3CAJ A;  4KNM A;  1G45 A;  1BN3 A;  2IT4 A;  4MTY A;  5BRU A;  5DSJ A;  1OKN A;  4QSA A;  4DZ7 A;  3RZ0 B;  4N16 A;  4FL7 A;  4KNJ A;  3DVC A;  3M04 A;  4ZWX A;  4MO8 A;  4R5A A;  4LP6 A;  2OSF A;  3KOI A;  4RUX A;  4KUW A;  1FQM A;  3V3G B;  1CIM A;  5C8I A;  4XFW A;  1IF5 A;  5DSN A;  2H4N A;  1TE3 X;  1ZH9 A;  1G53 A;  5EHV A;  3MHL A;  4GL1 X;  5FLO A;  3S77 B;  5JEH B;  1BNW A;  4K0T A;  1I90 A;  2NWO A;  3QYK A;  5DSO A;  3TMJ A;  5SZ3 A;  4Q87 A;  3D0N A;  5FLT A;  4QEF A;  1TTM A;  3M40 A;  3KLD B;  1KEQ A;  4K13 A;  3RYV B;  5DSI A;  1AM6 A;  1G1D A;  1BNU A;  1I8Z A;  3KON A;  4G0C A;  4K0Z A;  3S72 B;  1CAY A;  3MNU A;  4RIU A;  3C7P A;  2QO8 A;  4HU1 A;  4MDG A;  1KWR A;  3FW3 A;  3FFP X;  4Q9Y A;  3DD0 A;  3RGE A;  4KP5 A;  3MHC A;  3MHO A;  1YO2 A;  4CNR A;  3TVO X;  2NNO A;  3OIL A;  3K7K A;  3S75 B;  1ZSC A;  5DSK A;  1ZE8 A;  3RYX B;  3W6H A;  3N2P A;  1TB0 X;  3M67 A;  4HF3 A;  1G4J A;  5SZ2 A;  2FMZ A;  4ZWI A;  3CZV A;  5FL5 A;  5JES B;  1G48 A;  3F8E A;  4CQ0 A;  12CA A;  1CCU A;  3T84 A;  4K0S A;  4C3T A;  2HNC A;  1CA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...